data_4YZC
# 
_entry.id   4YZC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YZC         
WWPDB D_1000208346 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          4YZD 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YZC 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Concha, N.O.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Mol.Pharmacol. 
_citation.journal_id_ASTM           MOPMA3 
_citation.journal_id_CSD            0197 
_citation.journal_id_ISSN           1521-0111 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            88 
_citation.language                  ? 
_citation.page_first                1011 
_citation.page_last                 1023 
_citation.title                     
'Long-Range Inhibitor-Induced Conformational Regulation of Human IRE1 alpha Endoribonuclease Activity.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1124/mol.115.100917 
_citation.pdbx_database_id_PubMed   26438213 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Concha, N.O.'   1  
primary 'Smallwood, A.'  2  
primary 'Bonnette, W.'   3  
primary 'Totoritis, R.'  4  
primary 'Zhang, G.'      5  
primary 'Federowicz, K.' 6  
primary 'Yang, J.'       7  
primary 'Qi, H.'         8  
primary 'Chen, S.'       9  
primary 'Campobasso, N.' 10 
primary 'Choudhry, A.E.' 11 
primary 'Shuster, L.E.'  12 
primary 'Evans, K.A.'    13 
primary 'Ralph, J.'      14 
primary 'Sweitzer, S.'   15 
primary 'Heerding, D.A.' 16 
primary 'Buser, C.A.'    17 
primary 'Su, D.S.'       18 
primary 'DeYoung, M.P.'  19 
# 
_cell.entry_id           4YZC 
_cell.length_a           49.337 
_cell.length_b           155.260 
_cell.length_c           155.643 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4YZC 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein kinase/endoribonuclease IRE1' 46850.504 2  2.7.11.1,3.1.26.- ? 'UNP residues 562-963' 
? 
2 non-polymer nat STAUROSPORINE                                           466.531   2  ?                 ? ?                      
? 
3 water       nat water                                                   18.015    58 ?                 ? ?                      
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Endoplasmic reticulum-to-nucleus signaling 1,Inositol-requiring protein 1,hIRE1p,Ire1-alpha,IRE1a' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;SVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIA
IELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAVG
RH(SEP)F(SEP)RR(SEP)GVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQRQANILLGA
CSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKESLDGPIVKQLERGGRAV
VKMDWRENITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAME
LCSHERLFQPYYFHEPP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIA
IELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAVG
RHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQRQANILLGACSLDCLHPEKHE
DVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVP
LQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPYY
FHEPP
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   VAL n 
1 3   VAL n 
1 4   ILE n 
1 5   VAL n 
1 6   GLY n 
1 7   LYS n 
1 8   ILE n 
1 9   SER n 
1 10  PHE n 
1 11  CYS n 
1 12  PRO n 
1 13  LYS n 
1 14  ASP n 
1 15  VAL n 
1 16  LEU n 
1 17  GLY n 
1 18  HIS n 
1 19  GLY n 
1 20  ALA n 
1 21  GLU n 
1 22  GLY n 
1 23  THR n 
1 24  ILE n 
1 25  VAL n 
1 26  TYR n 
1 27  ARG n 
1 28  GLY n 
1 29  MET n 
1 30  PHE n 
1 31  ASP n 
1 32  ASN n 
1 33  ARG n 
1 34  ASP n 
1 35  VAL n 
1 36  ALA n 
1 37  VAL n 
1 38  LYS n 
1 39  ARG n 
1 40  ILE n 
1 41  LEU n 
1 42  PRO n 
1 43  GLU n 
1 44  CYS n 
1 45  PHE n 
1 46  SER n 
1 47  PHE n 
1 48  ALA n 
1 49  ASP n 
1 50  ARG n 
1 51  GLU n 
1 52  VAL n 
1 53  GLN n 
1 54  LEU n 
1 55  LEU n 
1 56  ARG n 
1 57  GLU n 
1 58  SER n 
1 59  ASP n 
1 60  GLU n 
1 61  HIS n 
1 62  PRO n 
1 63  ASN n 
1 64  VAL n 
1 65  ILE n 
1 66  ARG n 
1 67  TYR n 
1 68  PHE n 
1 69  CYS n 
1 70  THR n 
1 71  GLU n 
1 72  LYS n 
1 73  ASP n 
1 74  ARG n 
1 75  GLN n 
1 76  PHE n 
1 77  GLN n 
1 78  TYR n 
1 79  ILE n 
1 80  ALA n 
1 81  ILE n 
1 82  GLU n 
1 83  LEU n 
1 84  CYS n 
1 85  ALA n 
1 86  ALA n 
1 87  THR n 
1 88  LEU n 
1 89  GLN n 
1 90  GLU n 
1 91  TYR n 
1 92  VAL n 
1 93  GLU n 
1 94  GLN n 
1 95  LYS n 
1 96  ASP n 
1 97  PHE n 
1 98  ALA n 
1 99  HIS n 
1 100 LEU n 
1 101 GLY n 
1 102 LEU n 
1 103 GLU n 
1 104 PRO n 
1 105 ILE n 
1 106 THR n 
1 107 LEU n 
1 108 LEU n 
1 109 GLN n 
1 110 GLN n 
1 111 THR n 
1 112 THR n 
1 113 SER n 
1 114 GLY n 
1 115 LEU n 
1 116 ALA n 
1 117 HIS n 
1 118 LEU n 
1 119 HIS n 
1 120 SER n 
1 121 LEU n 
1 122 ASN n 
1 123 ILE n 
1 124 VAL n 
1 125 HIS n 
1 126 ARG n 
1 127 ASP n 
1 128 LEU n 
1 129 LYS n 
1 130 PRO n 
1 131 HIS n 
1 132 ASN n 
1 133 ILE n 
1 134 LEU n 
1 135 ILE n 
1 136 SER n 
1 137 MET n 
1 138 PRO n 
1 139 ASN n 
1 140 ALA n 
1 141 HIS n 
1 142 GLY n 
1 143 LYS n 
1 144 ILE n 
1 145 LYS n 
1 146 ALA n 
1 147 MET n 
1 148 ILE n 
1 149 SER n 
1 150 ASP n 
1 151 PHE n 
1 152 GLY n 
1 153 LEU n 
1 154 CYS n 
1 155 LYS n 
1 156 LYS n 
1 157 LEU n 
1 158 ALA n 
1 159 VAL n 
1 160 GLY n 
1 161 ARG n 
1 162 HIS n 
1 163 SEP n 
1 164 PHE n 
1 165 SEP n 
1 166 ARG n 
1 167 ARG n 
1 168 SEP n 
1 169 GLY n 
1 170 VAL n 
1 171 PRO n 
1 172 GLY n 
1 173 THR n 
1 174 GLU n 
1 175 GLY n 
1 176 TRP n 
1 177 ILE n 
1 178 ALA n 
1 179 PRO n 
1 180 GLU n 
1 181 MET n 
1 182 LEU n 
1 183 SER n 
1 184 GLU n 
1 185 ASP n 
1 186 CYS n 
1 187 LYS n 
1 188 GLU n 
1 189 ASN n 
1 190 PRO n 
1 191 THR n 
1 192 TYR n 
1 193 THR n 
1 194 VAL n 
1 195 ASP n 
1 196 ILE n 
1 197 PHE n 
1 198 SER n 
1 199 ALA n 
1 200 GLY n 
1 201 CYS n 
1 202 VAL n 
1 203 PHE n 
1 204 TYR n 
1 205 TYR n 
1 206 VAL n 
1 207 ILE n 
1 208 SER n 
1 209 GLU n 
1 210 GLY n 
1 211 SER n 
1 212 HIS n 
1 213 PRO n 
1 214 PHE n 
1 215 GLY n 
1 216 LYS n 
1 217 SER n 
1 218 LEU n 
1 219 GLN n 
1 220 ARG n 
1 221 GLN n 
1 222 ALA n 
1 223 ASN n 
1 224 ILE n 
1 225 LEU n 
1 226 LEU n 
1 227 GLY n 
1 228 ALA n 
1 229 CYS n 
1 230 SER n 
1 231 LEU n 
1 232 ASP n 
1 233 CYS n 
1 234 LEU n 
1 235 HIS n 
1 236 PRO n 
1 237 GLU n 
1 238 LYS n 
1 239 HIS n 
1 240 GLU n 
1 241 ASP n 
1 242 VAL n 
1 243 ILE n 
1 244 ALA n 
1 245 ARG n 
1 246 GLU n 
1 247 LEU n 
1 248 ILE n 
1 249 GLU n 
1 250 LYS n 
1 251 MET n 
1 252 ILE n 
1 253 ALA n 
1 254 MET n 
1 255 ASP n 
1 256 PRO n 
1 257 GLN n 
1 258 LYS n 
1 259 ARG n 
1 260 PRO n 
1 261 SER n 
1 262 ALA n 
1 263 LYS n 
1 264 HIS n 
1 265 VAL n 
1 266 LEU n 
1 267 LYS n 
1 268 HIS n 
1 269 PRO n 
1 270 PHE n 
1 271 PHE n 
1 272 TRP n 
1 273 SER n 
1 274 LEU n 
1 275 GLU n 
1 276 LYS n 
1 277 GLN n 
1 278 LEU n 
1 279 GLN n 
1 280 PHE n 
1 281 PHE n 
1 282 GLN n 
1 283 ASP n 
1 284 VAL n 
1 285 SER n 
1 286 ASP n 
1 287 ARG n 
1 288 ILE n 
1 289 GLU n 
1 290 LYS n 
1 291 GLU n 
1 292 SER n 
1 293 LEU n 
1 294 ASP n 
1 295 GLY n 
1 296 PRO n 
1 297 ILE n 
1 298 VAL n 
1 299 LYS n 
1 300 GLN n 
1 301 LEU n 
1 302 GLU n 
1 303 ARG n 
1 304 GLY n 
1 305 GLY n 
1 306 ARG n 
1 307 ALA n 
1 308 VAL n 
1 309 VAL n 
1 310 LYS n 
1 311 MET n 
1 312 ASP n 
1 313 TRP n 
1 314 ARG n 
1 315 GLU n 
1 316 ASN n 
1 317 ILE n 
1 318 THR n 
1 319 VAL n 
1 320 PRO n 
1 321 LEU n 
1 322 GLN n 
1 323 THR n 
1 324 ASP n 
1 325 LEU n 
1 326 ARG n 
1 327 LYS n 
1 328 PHE n 
1 329 ARG n 
1 330 THR n 
1 331 TYR n 
1 332 LYS n 
1 333 GLY n 
1 334 GLY n 
1 335 SER n 
1 336 VAL n 
1 337 ARG n 
1 338 ASP n 
1 339 LEU n 
1 340 LEU n 
1 341 ARG n 
1 342 ALA n 
1 343 MET n 
1 344 ARG n 
1 345 ASN n 
1 346 LYS n 
1 347 LYS n 
1 348 HIS n 
1 349 HIS n 
1 350 TYR n 
1 351 ARG n 
1 352 GLU n 
1 353 LEU n 
1 354 PRO n 
1 355 ALA n 
1 356 GLU n 
1 357 VAL n 
1 358 ARG n 
1 359 GLU n 
1 360 THR n 
1 361 LEU n 
1 362 GLY n 
1 363 SER n 
1 364 LEU n 
1 365 PRO n 
1 366 ASP n 
1 367 ASP n 
1 368 PHE n 
1 369 VAL n 
1 370 CYS n 
1 371 TYR n 
1 372 PHE n 
1 373 THR n 
1 374 SER n 
1 375 ARG n 
1 376 PHE n 
1 377 PRO n 
1 378 HIS n 
1 379 LEU n 
1 380 LEU n 
1 381 ALA n 
1 382 HIS n 
1 383 THR n 
1 384 TYR n 
1 385 ARG n 
1 386 ALA n 
1 387 MET n 
1 388 GLU n 
1 389 LEU n 
1 390 CYS n 
1 391 SER n 
1 392 HIS n 
1 393 GLU n 
1 394 ARG n 
1 395 LEU n 
1 396 PHE n 
1 397 GLN n 
1 398 PRO n 
1 399 TYR n 
1 400 TYR n 
1 401 PHE n 
1 402 HIS n 
1 403 GLU n 
1 404 PRO n 
1 405 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   405 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ERN1, IRE1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Fall Armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            Sf9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ERN1_HUMAN 
_struct_ref.pdbx_db_accession          O75460 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIA
IELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAVG
RHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQRQANILLGACSLDCLHPEKHE
DVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVP
LQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPYY
FHEPP
;
_struct_ref.pdbx_align_begin           562 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4YZC A 1 ? 405 ? O75460 562 ? 966 ? 562 966 
2 1 4YZC B 1 ? 405 ? O75460 562 ? 966 ? 562 966 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?               'C5 H9 N O2'     115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE   PHOSPHONOSERINE 'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE          ?               'C3 H7 N O3'     105.093 
STU non-polymer         . STAUROSPORINE   ?               'C28 H26 N4 O3'  466.531 
THR 'L-peptide linking' y THREONINE       ?               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YZC 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.20 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.60 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;The complex of pIRE1a (547-977) with staurosporine was prepared by mixing the protein with 0.5 mM staurosporine and incubated overnight on ice.  The crystals were grown at 20C by vapor diffusion in sitting drop containing 2 ul of protein (13 mg/ml in 50 mM Hepes, pH 7.5, 200 mM NaCl, 5 mM DTT, 1 mM EDTA) and 2ul reservoir solution containing PEG 300 (30%-40%), 100 mM Hepes pH 7.5, 200 mM KCl. Small hexagonal plates appeared over 5-10 days and reached full size (0.05 X 0.75 X 0.15 mm) in ~20 days. The crystals were flash-frozen in liquid N2 directly from the crystallization drop. All diffraction data was collected at the Advanced Photon Source, Argonne National Laboratories, Life Sciences CAT, Sector 21
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   'single crystal' 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-02-17 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-D' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-D 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            34.120 
_reflns.entry_id                         4YZC 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.4939 
_reflns.d_resolution_low                 40.23 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       41927 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.23 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.5 
_reflns.pdbx_Rmerge_I_obs                0.09722 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         22.713 
_reflns.pdbx_netI_over_sigmaI            13.36 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.070 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         226940 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.4939 
_reflns_shell.d_res_low                   2.583 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           4710 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        88.06 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.1343 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            1.089 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                0 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4YZC 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     41901 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.225 
_refine.ls_d_res_high                            2.494 
_refine.ls_percent_reflns_obs                    98.17 
_refine.ls_R_factor_obs                          0.2489 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2468 
_refine.ls_R_factor_R_free                       0.2892 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.05 
_refine.ls_number_reflns_R_free                  2116 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3P23 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.35 
_refine.pdbx_overall_phase_error                 33.16 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6036 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         70 
_refine_hist.number_atoms_solvent             58 
_refine_hist.number_atoms_total               6164 
_refine_hist.d_res_high                       2.494 
_refine_hist.d_res_low                        40.225 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 6270 'X-RAY DIFFRACTION' ? 
f_angle_d          0.648  ? ? 8519 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 12.676 ? ? 2274 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.036  ? ? 926  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 1086 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.4939 2.5519  2269 0.3310 86.00  0.3652 . . 132 . . . . 
'X-RAY DIFFRACTION' . 2.5519 2.6157  2478 0.3200 94.00  0.3892 . . 154 . . . . 
'X-RAY DIFFRACTION' . 2.6157 2.6864  2548 0.3096 97.00  0.3636 . . 148 . . . . 
'X-RAY DIFFRACTION' . 2.6864 2.7654  2594 0.3130 97.00  0.3469 . . 153 . . . . 
'X-RAY DIFFRACTION' . 2.7654 2.8547  2636 0.3034 99.00  0.3427 . . 129 . . . . 
'X-RAY DIFFRACTION' . 2.8547 2.9567  2653 0.2799 100.00 0.3224 . . 139 . . . . 
'X-RAY DIFFRACTION' . 2.9567 3.0750  2695 0.2881 100.00 0.3478 . . 156 . . . . 
'X-RAY DIFFRACTION' . 3.0750 3.2149  2646 0.2634 100.00 0.2958 . . 124 . . . . 
'X-RAY DIFFRACTION' . 3.2149 3.3843  2691 0.2738 100.00 0.3269 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.3843 3.5962  2707 0.2557 100.00 0.3206 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.5962 3.8737  2697 0.2405 100.00 0.3229 . . 139 . . . . 
'X-RAY DIFFRACTION' . 3.8737 4.2631  2711 0.2214 100.00 0.2402 . . 140 . . . . 
'X-RAY DIFFRACTION' . 4.2631 4.8791  2759 0.1904 100.00 0.2361 . . 140 . . . . 
'X-RAY DIFFRACTION' . 4.8791 6.1436  2783 0.2193 100.00 0.2575 . . 138 . . . . 
'X-RAY DIFFRACTION' . 6.1436 40.2298 2918 0.2080 100.00 0.2089 . . 136 . . . . 
# 
_struct.entry_id                     4YZC 
_struct.title                        'Crystal structure of pIRE1alpha in complex with staurosporine' 
_struct.pdbx_descriptor              'Serine/threonine-protein kinase/endoribonuclease IRE1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YZC 
_struct_keywords.text            'IRE1, inhibitor, staurosporine, complex, Transferase-transferase inhibitor complex' 
_struct_keywords.pdbx_keywords   'Transferase/transferase inhibitor' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG A 50  ? ASP A 59  ? ARG A 611 ASP A 620 1 ? 10 
HELX_P HELX_P2  AA2 LEU A 88  ? VAL A 92  ? LEU A 649 VAL A 653 1 ? 5  
HELX_P HELX_P3  AA3 PRO A 104 ? LEU A 121 ? PRO A 665 LEU A 682 1 ? 18 
HELX_P HELX_P4  AA4 ASP A 150 ? CYS A 154 ? ASP A 711 CYS A 715 5 ? 5  
HELX_P HELX_P5  AA5 ALA A 178 ? SER A 183 ? ALA A 739 SER A 744 1 ? 6  
HELX_P HELX_P6  AA6 TYR A 192 ? SER A 208 ? TYR A 753 SER A 769 1 ? 17 
HELX_P HELX_P7  AA7 LYS A 216 ? GLY A 227 ? LYS A 777 GLY A 788 1 ? 12 
HELX_P HELX_P8  AA8 LYS A 238 ? LYS A 250 ? LYS A 799 LYS A 811 1 ? 13 
HELX_P HELX_P9  AA9 ASP A 255 ? ARG A 259 ? ASP A 816 ARG A 820 5 ? 5  
HELX_P HELX_P10 AB1 SER A 261 ? HIS A 268 ? SER A 822 HIS A 829 1 ? 8  
HELX_P HELX_P11 AB2 PRO A 269 ? TRP A 272 ? PRO A 830 TRP A 833 5 ? 4  
HELX_P HELX_P12 AB3 SER A 273 ? GLU A 289 ? SER A 834 GLU A 850 1 ? 17 
HELX_P HELX_P13 AB4 GLY A 295 ? GLY A 304 ? GLY A 856 GLY A 865 1 ? 10 
HELX_P HELX_P14 AB5 THR A 318 ? THR A 323 ? THR A 879 THR A 884 1 ? 6  
HELX_P HELX_P15 AB6 SER A 335 ? HIS A 349 ? SER A 896 HIS A 910 1 ? 15 
HELX_P HELX_P16 AB7 TYR A 350 ? LEU A 353 ? TYR A 911 LEU A 914 5 ? 4  
HELX_P HELX_P17 AB8 PRO A 354 ? GLY A 362 ? PRO A 915 GLY A 923 1 ? 9  
HELX_P HELX_P18 AB9 PRO A 365 ? PHE A 376 ? PRO A 926 PHE A 937 1 ? 12 
HELX_P HELX_P19 AC1 HIS A 378 ? MET A 387 ? HIS A 939 MET A 948 1 ? 10 
HELX_P HELX_P20 AC2 GLU A 388 ? SER A 391 ? GLU A 949 SER A 952 5 ? 4  
HELX_P HELX_P21 AC3 ARG B 50  ? ASP B 59  ? ARG B 611 ASP B 620 1 ? 10 
HELX_P HELX_P22 AC4 LEU B 88  ? VAL B 92  ? LEU B 649 VAL B 653 1 ? 5  
HELX_P HELX_P23 AC5 PRO B 104 ? LEU B 121 ? PRO B 665 LEU B 682 1 ? 18 
HELX_P HELX_P24 AC6 ALA B 178 ? SER B 183 ? ALA B 739 SER B 744 1 ? 6  
HELX_P HELX_P25 AC7 TYR B 192 ? SER B 208 ? TYR B 753 SER B 769 1 ? 17 
HELX_P HELX_P26 AC8 LYS B 216 ? GLY B 227 ? LYS B 777 GLY B 788 1 ? 12 
HELX_P HELX_P27 AC9 LYS B 238 ? ILE B 252 ? LYS B 799 ILE B 813 1 ? 15 
HELX_P HELX_P28 AD1 ASP B 255 ? ARG B 259 ? ASP B 816 ARG B 820 5 ? 5  
HELX_P HELX_P29 AD2 SER B 261 ? HIS B 268 ? SER B 822 HIS B 829 1 ? 8  
HELX_P HELX_P30 AD3 PRO B 269 ? TRP B 272 ? PRO B 830 TRP B 833 5 ? 4  
HELX_P HELX_P31 AD4 SER B 273 ? GLU B 289 ? SER B 834 GLU B 850 1 ? 17 
HELX_P HELX_P32 AD5 GLY B 295 ? ARG B 303 ? GLY B 856 ARG B 864 1 ? 9  
HELX_P HELX_P33 AD6 GLY B 304 ? LYS B 310 ? GLY B 865 LYS B 871 1 ? 7  
HELX_P HELX_P34 AD7 THR B 318 ? ARG B 326 ? THR B 879 ARG B 887 1 ? 9  
HELX_P HELX_P35 AD8 SER B 335 ? HIS B 349 ? SER B 896 HIS B 910 1 ? 15 
HELX_P HELX_P36 AD9 PRO B 354 ? GLY B 362 ? PRO B 915 GLY B 923 1 ? 9  
HELX_P HELX_P37 AE1 PRO B 365 ? PHE B 376 ? PRO B 926 PHE B 937 1 ? 12 
HELX_P HELX_P38 AE2 HIS B 378 ? MET B 387 ? HIS B 939 MET B 948 1 ? 10 
HELX_P HELX_P39 AE3 GLU B 388 ? SER B 391 ? GLU B 949 SER B 952 5 ? 4  
HELX_P HELX_P40 AE4 GLU B 393 ? GLN B 397 ? GLU B 954 GLN B 958 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? A HIS 162 C ? ? ? 1_555 A SEP 163 N ? ? A HIS 723 A SEP 724 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale2  covale both ? A SEP 163 C ? ? ? 1_555 A PHE 164 N ? ? A SEP 724 A PHE 725 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale3  covale both ? A PHE 164 C ? ? ? 1_555 A SEP 165 N ? ? A PHE 725 A SEP 726 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale4  covale both ? A SEP 165 C ? ? ? 1_555 A ARG 166 N ? ? A SEP 726 A ARG 727 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale5  covale both ? A ARG 167 C ? ? ? 1_555 A SEP 168 N ? ? A ARG 728 A SEP 729 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale6  covale both ? A SEP 168 C ? ? ? 1_555 A GLY 169 N ? ? A SEP 729 A GLY 730 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale7  covale both ? B HIS 162 C ? ? ? 1_555 B SEP 163 N ? ? B HIS 723 B SEP 724 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale8  covale both ? B SEP 163 C ? ? ? 1_555 B PHE 164 N ? ? B SEP 724 B PHE 725 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale9  covale both ? B PHE 164 C ? ? ? 1_555 B SEP 165 N ? ? B PHE 725 B SEP 726 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale10 covale both ? B SEP 165 C ? ? ? 1_555 B ARG 166 N ? ? B SEP 726 B ARG 727 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale11 covale both ? B ARG 167 C ? ? ? 1_555 B SEP 168 N ? ? B ARG 728 B SEP 729 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale12 covale both ? B SEP 168 C ? ? ? 1_555 B GLY 169 N ? ? B SEP 729 B GLY 730 1_555 ? ? ? ? ? ? ? 1.328 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 289 A . ? GLU 850 A LYS 290 A ? LYS 851 A 1 -2.44  
2 GLY 362 A . ? GLY 923 A SER 363 A ? SER 924 A 1 8.30   
3 LEU 364 A . ? LEU 925 A PRO 365 A ? PRO 926 A 1 -23.71 
4 GLU 289 B . ? GLU 850 B LYS 290 B ? LYS 851 B 1 -4.17  
5 GLY 362 B . ? GLY 923 B SER 363 B ? SER 924 B 1 7.12   
6 LEU 364 B . ? LEU 925 B PRO 365 B ? PRO 926 B 1 -24.14 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 6 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 3   ? VAL A 5   ? VAL A 564 VAL A 566 
AA1 2 ILE A 8   ? HIS A 18  ? ILE A 569 HIS A 579 
AA1 3 ILE A 24  ? PHE A 30  ? ILE A 585 PHE A 591 
AA1 4 ARG A 33  ? ILE A 40  ? ARG A 594 ILE A 601 
AA1 5 GLN A 77  ? GLU A 82  ? GLN A 638 GLU A 643 
AA1 6 TYR A 67  ? LYS A 72  ? TYR A 628 LYS A 633 
AA2 1 CYS A 84  ? THR A 87  ? CYS A 645 THR A 648 
AA2 2 LEU A 134 ? SER A 136 ? LEU A 695 SER A 697 
AA2 3 ALA A 146 ? MET A 147 ? ALA A 707 MET A 708 
AA3 1 ILE A 123 ? VAL A 124 ? ILE A 684 VAL A 685 
AA3 2 LYS A 155 ? LYS A 156 ? LYS A 716 LYS A 717 
AA4 1 VAL B 3   ? VAL B 5   ? VAL B 564 VAL B 566 
AA4 2 ILE B 8   ? HIS B 18  ? ILE B 569 HIS B 579 
AA4 3 ILE B 24  ? PHE B 30  ? ILE B 585 PHE B 591 
AA4 4 ASP B 34  ? ILE B 40  ? ASP B 595 ILE B 601 
AA4 5 GLN B 77  ? GLU B 82  ? GLN B 638 GLU B 643 
AA4 6 TYR B 67  ? LYS B 72  ? TYR B 628 LYS B 633 
AA5 1 CYS B 84  ? THR B 87  ? CYS B 645 THR B 648 
AA5 2 ILE B 133 ? SER B 136 ? ILE B 694 SER B 697 
AA5 3 ALA B 146 ? ILE B 148 ? ALA B 707 ILE B 709 
AA6 1 ILE B 123 ? VAL B 124 ? ILE B 684 VAL B 685 
AA6 2 LYS B 155 ? LYS B 156 ? LYS B 716 LYS B 717 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 3   ? N VAL A 564 O PHE A 10  ? O PHE A 571 
AA1 2 3 N SER A 9   ? N SER A 570 O MET A 29  ? O MET A 590 
AA1 3 4 N TYR A 26  ? N TYR A 587 O VAL A 37  ? O VAL A 598 
AA1 4 5 N ALA A 36  ? N ALA A 597 O ILE A 81  ? O ILE A 642 
AA1 5 6 O TYR A 78  ? O TYR A 639 N GLU A 71  ? N GLU A 632 
AA2 1 2 N ALA A 86  ? N ALA A 647 O ILE A 135 ? O ILE A 696 
AA2 2 3 N LEU A 134 ? N LEU A 695 O MET A 147 ? O MET A 708 
AA3 1 2 N VAL A 124 ? N VAL A 685 O LYS A 155 ? O LYS A 716 
AA4 1 2 N VAL B 5   ? N VAL B 566 O ILE B 8   ? O ILE B 569 
AA4 2 3 N SER B 9   ? N SER B 570 O MET B 29  ? O MET B 590 
AA4 3 4 N GLY B 28  ? N GLY B 589 O VAL B 35  ? O VAL B 596 
AA4 4 5 N ALA B 36  ? N ALA B 597 O ILE B 81  ? O ILE B 642 
AA4 5 6 O TYR B 78  ? O TYR B 639 N GLU B 71  ? N GLU B 632 
AA5 1 2 N ALA B 86  ? N ALA B 647 O ILE B 135 ? O ILE B 696 
AA5 2 3 N LEU B 134 ? N LEU B 695 O MET B 147 ? O MET B 708 
AA6 1 2 N VAL B 124 ? N VAL B 685 O LYS B 155 ? O LYS B 716 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A STU 1001 ? 14 'binding site for residue STU A 1001' 
AC2 Software B STU 1001 ? 14 'binding site for residue STU B 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 LEU A 16  ? LEU A 577  . ? 1_555 ? 
2  AC1 14 GLY A 17  ? GLY A 578  . ? 1_555 ? 
3  AC1 14 VAL A 25  ? VAL A 586  . ? 1_555 ? 
4  AC1 14 ALA A 36  ? ALA A 597  . ? 1_555 ? 
5  AC1 14 LYS A 38  ? LYS A 599  . ? 1_555 ? 
6  AC1 14 ILE A 81  ? ILE A 642  . ? 1_555 ? 
7  AC1 14 GLU A 82  ? GLU A 643  . ? 1_555 ? 
8  AC1 14 LEU A 83  ? LEU A 644  . ? 1_555 ? 
9  AC1 14 CYS A 84  ? CYS A 645  . ? 1_555 ? 
10 AC1 14 ALA A 85  ? ALA A 646  . ? 1_555 ? 
11 AC1 14 HIS A 131 ? HIS A 692  . ? 1_555 ? 
12 AC1 14 LEU A 134 ? LEU A 695  . ? 1_555 ? 
13 AC1 14 SER A 149 ? SER A 710  . ? 1_555 ? 
14 AC1 14 HOH E .   ? HOH A 1111 . ? 1_555 ? 
15 AC2 14 LEU B 16  ? LEU B 577  . ? 1_555 ? 
16 AC2 14 GLY B 17  ? GLY B 578  . ? 1_555 ? 
17 AC2 14 VAL B 25  ? VAL B 586  . ? 1_555 ? 
18 AC2 14 ALA B 36  ? ALA B 597  . ? 1_555 ? 
19 AC2 14 LYS B 38  ? LYS B 599  . ? 1_555 ? 
20 AC2 14 ILE B 65  ? ILE B 626  . ? 1_555 ? 
21 AC2 14 ILE B 81  ? ILE B 642  . ? 1_555 ? 
22 AC2 14 GLU B 82  ? GLU B 643  . ? 1_555 ? 
23 AC2 14 LEU B 83  ? LEU B 644  . ? 1_555 ? 
24 AC2 14 CYS B 84  ? CYS B 645  . ? 1_555 ? 
25 AC2 14 ALA B 85  ? ALA B 646  . ? 1_555 ? 
26 AC2 14 HIS B 131 ? HIS B 692  . ? 1_555 ? 
27 AC2 14 LEU B 134 ? LEU B 695  . ? 1_555 ? 
28 AC2 14 SER B 149 ? SER B 710  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4YZC 
_atom_sites.fract_transf_matrix[1][1]   0.020269 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006441 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006425 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . SER A 1 1   ? -26.571 41.671  -72.272 1.00 41.30  ? 562  SER A N    1 
ATOM   2     C CA   . SER A 1 1   ? -25.255 42.285  -72.404 1.00 44.39  ? 562  SER A CA   1 
ATOM   3     C C    . SER A 1 1   ? -24.159 41.249  -72.181 1.00 47.86  ? 562  SER A C    1 
ATOM   4     O O    . SER A 1 1   ? -24.363 40.269  -71.469 1.00 47.71  ? 562  SER A O    1 
ATOM   5     C CB   . SER A 1 1   ? -25.103 43.442  -71.414 1.00 46.42  ? 562  SER A CB   1 
ATOM   6     O OG   . SER A 1 1   ? -23.809 44.015  -71.492 1.00 49.69  ? 562  SER A OG   1 
ATOM   7     H HA   . SER A 1 1   ? -25.158 42.641  -73.301 1.00 53.27  ? 562  SER A HA   1 
ATOM   8     H HB2  . SER A 1 1   ? -25.762 44.123  -71.621 1.00 55.71  ? 562  SER A HB2  1 
ATOM   9     H HB3  . SER A 1 1   ? -25.246 43.107  -70.514 1.00 55.71  ? 562  SER A HB3  1 
ATOM   10    H HG   . SER A 1 1   ? -23.741 44.647  -70.943 1.00 59.62  ? 562  SER A HG   1 
ATOM   11    N N    . VAL A 1 2   ? -23.000 41.461  -72.802 1.00 45.51  ? 563  VAL A N    1 
ATOM   12    C CA   . VAL A 1 2   ? -21.859 40.564  -72.658 1.00 44.79  ? 563  VAL A CA   1 
ATOM   13    C C    . VAL A 1 2   ? -20.586 41.397  -72.624 1.00 40.11  ? 563  VAL A C    1 
ATOM   14    O O    . VAL A 1 2   ? -20.416 42.330  -73.416 1.00 41.75  ? 563  VAL A O    1 
ATOM   15    C CB   . VAL A 1 2   ? -21.801 39.525  -73.799 1.00 40.79  ? 563  VAL A CB   1 
ATOM   16    C CG1  . VAL A 1 2   ? -20.512 38.705  -73.728 1.00 40.60  ? 563  VAL A CG1  1 
ATOM   17    C CG2  . VAL A 1 2   ? -23.013 38.609  -73.747 1.00 41.53  ? 563  VAL A CG2  1 
ATOM   18    H H    . VAL A 1 2   ? -22.850 42.129  -73.322 1.00 54.61  ? 563  VAL A H    1 
ATOM   19    H HA   . VAL A 1 2   ? -21.932 40.087  -71.817 1.00 53.74  ? 563  VAL A HA   1 
ATOM   20    H HB   . VAL A 1 2   ? -21.813 39.990  -74.650 1.00 48.95  ? 563  VAL A HB   1 
ATOM   21    H HG11 . VAL A 1 2   ? -20.505 38.064  -74.455 1.00 48.72  ? 563  VAL A HG11 1 
ATOM   22    H HG12 . VAL A 1 2   ? -19.753 39.304  -73.808 1.00 48.72  ? 563  VAL A HG12 1 
ATOM   23    H HG13 . VAL A 1 2   ? -20.479 38.242  -72.877 1.00 48.72  ? 563  VAL A HG13 1 
ATOM   24    H HG21 . VAL A 1 2   ? -22.954 37.966  -74.471 1.00 49.84  ? 563  VAL A HG21 1 
ATOM   25    H HG22 . VAL A 1 2   ? -23.023 38.147  -72.894 1.00 49.84  ? 563  VAL A HG22 1 
ATOM   26    H HG23 . VAL A 1 2   ? -23.816 39.144  -73.843 1.00 49.84  ? 563  VAL A HG23 1 
ATOM   27    N N    . VAL A 1 3   ? -19.693 41.053  -71.701 1.00 38.60  ? 564  VAL A N    1 
ATOM   28    C CA   . VAL A 1 3   ? -18.367 41.649  -71.599 1.00 38.35  ? 564  VAL A CA   1 
ATOM   29    C C    . VAL A 1 3   ? -17.349 40.557  -71.894 1.00 37.49  ? 564  VAL A C    1 
ATOM   30    O O    . VAL A 1 3   ? -17.432 39.456  -71.336 1.00 42.42  ? 564  VAL A O    1 
ATOM   31    C CB   . VAL A 1 3   ? -18.126 42.262  -70.208 1.00 36.80  ? 564  VAL A CB   1 
ATOM   32    C CG1  . VAL A 1 3   ? -16.703 42.807  -70.091 1.00 35.65  ? 564  VAL A CG1  1 
ATOM   33    C CG2  . VAL A 1 3   ? -19.141 43.357  -69.929 1.00 37.73  ? 564  VAL A CG2  1 
ATOM   34    H H    . VAL A 1 3   ? -19.840 40.454  -71.102 1.00 46.32  ? 564  VAL A H    1 
ATOM   35    H HA   . VAL A 1 3   ? -18.272 42.348  -72.265 1.00 46.02  ? 564  VAL A HA   1 
ATOM   36    H HB   . VAL A 1 3   ? -18.238 41.572  -69.536 1.00 44.15  ? 564  VAL A HB   1 
ATOM   37    H HG11 . VAL A 1 3   ? -16.582 43.185  -69.206 1.00 42.78  ? 564  VAL A HG11 1 
ATOM   38    H HG12 . VAL A 1 3   ? -16.076 42.080  -70.229 1.00 42.78  ? 564  VAL A HG12 1 
ATOM   39    H HG13 . VAL A 1 3   ? -16.571 43.492  -70.765 1.00 42.78  ? 564  VAL A HG13 1 
ATOM   40    H HG21 . VAL A 1 3   ? -18.970 43.727  -69.049 1.00 45.28  ? 564  VAL A HG21 1 
ATOM   41    H HG22 . VAL A 1 3   ? -19.052 44.048  -70.603 1.00 45.28  ? 564  VAL A HG22 1 
ATOM   42    H HG23 . VAL A 1 3   ? -20.032 42.976  -69.961 1.00 45.28  ? 564  VAL A HG23 1 
ATOM   43    N N    . ILE A 1 4   ? -16.399 40.858  -72.772 1.00 37.79  ? 565  ILE A N    1 
ATOM   44    C CA   . ILE A 1 4   ? -15.329 39.936  -73.132 1.00 38.82  ? 565  ILE A CA   1 
ATOM   45    C C    . ILE A 1 4   ? -14.015 40.646  -72.850 1.00 38.49  ? 565  ILE A C    1 
ATOM   46    O O    . ILE A 1 4   ? -13.700 41.658  -73.489 1.00 44.51  ? 565  ILE A O    1 
ATOM   47    C CB   . ILE A 1 4   ? -15.412 39.497  -74.602 1.00 33.35  ? 565  ILE A CB   1 
ATOM   48    C CG1  . ILE A 1 4   ? -16.763 38.835  -74.885 1.00 34.08  ? 565  ILE A CG1  1 
ATOM   49    C CG2  . ILE A 1 4   ? -14.262 38.551  -74.945 1.00 36.29  ? 565  ILE A CG2  1 
ATOM   50    C CD1  . ILE A 1 4   ? -17.005 38.512  -76.353 1.00 35.25  ? 565  ILE A CD1  1 
ATOM   51    H H    . ILE A 1 4   ? -16.352 41.612  -73.184 1.00 45.34  ? 565  ILE A H    1 
ATOM   52    H HA   . ILE A 1 4   ? -15.379 39.146  -72.572 1.00 46.58  ? 565  ILE A HA   1 
ATOM   53    H HB   . ILE A 1 4   ? -15.336 40.286  -75.161 1.00 40.02  ? 565  ILE A HB   1 
ATOM   54    H HG12 . ILE A 1 4   ? -16.812 38.003  -74.388 1.00 40.90  ? 565  ILE A HG12 1 
ATOM   55    H HG13 . ILE A 1 4   ? -17.470 39.432  -74.594 1.00 40.90  ? 565  ILE A HG13 1 
ATOM   56    H HG21 . ILE A 1 4   ? -14.336 38.289  -75.876 1.00 43.55  ? 565  ILE A HG21 1 
ATOM   57    H HG22 . ILE A 1 4   ? -13.420 39.010  -74.796 1.00 43.55  ? 565  ILE A HG22 1 
ATOM   58    H HG23 . ILE A 1 4   ? -14.317 37.768  -74.375 1.00 43.55  ? 565  ILE A HG23 1 
ATOM   59    H HD11 . ILE A 1 4   ? -17.877 38.097  -76.445 1.00 42.30  ? 565  ILE A HD11 1 
ATOM   60    H HD12 . ILE A 1 4   ? -16.974 39.334  -76.866 1.00 42.30  ? 565  ILE A HD12 1 
ATOM   61    H HD13 . ILE A 1 4   ? -16.315 37.903  -76.660 1.00 42.30  ? 565  ILE A HD13 1 
ATOM   62    N N    . VAL A 1 5   ? -13.252 40.124  -71.895 1.00 40.71  ? 566  VAL A N    1 
ATOM   63    C CA   . VAL A 1 5   ? -11.901 40.591  -71.609 1.00 43.21  ? 566  VAL A CA   1 
ATOM   64    C C    . VAL A 1 5   ? -10.981 39.404  -71.852 1.00 41.79  ? 566  VAL A C    1 
ATOM   65    O O    . VAL A 1 5   ? -11.006 38.427  -71.092 1.00 40.95  ? 566  VAL A O    1 
ATOM   66    C CB   . VAL A 1 5   ? -11.759 41.117  -70.173 1.00 47.16  ? 566  VAL A CB   1 
ATOM   67    C CG1  . VAL A 1 5   ? -10.540 42.019  -70.061 1.00 44.93  ? 566  VAL A CG1  1 
ATOM   68    C CG2  . VAL A 1 5   ? -13.012 41.869  -69.743 1.00 45.92  ? 566  VAL A CG2  1 
ATOM   69    H H    . VAL A 1 5   ? -13.503 39.479  -71.385 1.00 48.85  ? 566  VAL A H    1 
ATOM   70    H HA   . VAL A 1 5   ? -11.663 41.301  -72.226 1.00 51.85  ? 566  VAL A HA   1 
ATOM   71    H HB   . VAL A 1 5   ? -11.635 40.366  -69.571 1.00 56.59  ? 566  VAL A HB   1 
ATOM   72    H HG11 . VAL A 1 5   ? -10.468 42.340  -69.149 1.00 53.92  ? 566  VAL A HG11 1 
ATOM   73    H HG12 . VAL A 1 5   ? -9.749  41.511  -70.297 1.00 53.92  ? 566  VAL A HG12 1 
ATOM   74    H HG13 . VAL A 1 5   ? -10.646 42.768  -70.668 1.00 53.92  ? 566  VAL A HG13 1 
ATOM   75    H HG21 . VAL A 1 5   ? -12.892 42.187  -68.834 1.00 55.11  ? 566  VAL A HG21 1 
ATOM   76    H HG22 . VAL A 1 5   ? -13.151 42.619  -70.341 1.00 55.11  ? 566  VAL A HG22 1 
ATOM   77    H HG23 . VAL A 1 5   ? -13.771 41.266  -69.785 1.00 55.11  ? 566  VAL A HG23 1 
ATOM   78    N N    . GLY A 1 6   ? -10.166 39.490  -72.899 1.00 40.91  ? 567  GLY A N    1 
ATOM   79    C CA   . GLY A 1 6   ? -9.285  38.385  -73.243 1.00 40.47  ? 567  GLY A CA   1 
ATOM   80    C C    . GLY A 1 6   ? -10.063 37.096  -73.428 1.00 40.97  ? 567  GLY A C    1 
ATOM   81    O O    . GLY A 1 6   ? -11.026 37.029  -74.200 1.00 33.98  ? 567  GLY A O    1 
ATOM   82    H H    . GLY A 1 6   ? -10.105 40.171  -73.420 1.00 49.09  ? 567  GLY A H    1 
ATOM   83    H HA2  . GLY A 1 6   ? -8.816  38.586  -74.068 1.00 48.56  ? 567  GLY A HA2  1 
ATOM   84    H HA3  . GLY A 1 6   ? -8.632  38.255  -72.538 1.00 48.56  ? 567  GLY A HA3  1 
ATOM   85    N N    . LYS A 1 7   ? -9.644  36.055  -72.705 1.00 42.78  ? 568  LYS A N    1 
ATOM   86    C CA   . LYS A 1 7   ? -10.301 34.755  -72.768 1.00 41.72  ? 568  LYS A CA   1 
ATOM   87    C C    . LYS A 1 7   ? -11.526 34.663  -71.871 1.00 38.56  ? 568  LYS A C    1 
ATOM   88    O O    . LYS A 1 7   ? -12.242 33.658  -71.932 1.00 36.30  ? 568  LYS A O    1 
ATOM   89    C CB   . LYS A 1 7   ? -9.321  33.650  -72.374 1.00 42.77  ? 568  LYS A CB   1 
ATOM   90    C CG   . LYS A 1 7   ? -7.939  33.795  -72.976 1.00 44.90  ? 568  LYS A CG   1 
ATOM   91    C CD   . LYS A 1 7   ? -7.410  32.461  -73.465 1.00 55.28  ? 568  LYS A CD   1 
ATOM   92    C CE   . LYS A 1 7   ? -8.132  32.003  -74.722 1.00 64.64  ? 568  LYS A CE   1 
ATOM   93    N NZ   . LYS A 1 7   ? -7.907  32.942  -75.858 1.00 70.27  ? 568  LYS A NZ   1 
ATOM   94    H H    . LYS A 1 7   ? -8.974  36.080  -72.167 1.00 51.33  ? 568  LYS A H    1 
ATOM   95    H HA   . LYS A 1 7   ? -10.586 34.591  -73.681 1.00 50.06  ? 568  LYS A HA   1 
ATOM   96    H HB2  . LYS A 1 7   ? -9.223  33.652  -71.409 1.00 51.32  ? 568  LYS A HB2  1 
ATOM   97    H HB3  . LYS A 1 7   ? -9.681  32.798  -72.665 1.00 51.32  ? 568  LYS A HB3  1 
ATOM   98    H HG2  . LYS A 1 7   ? -7.980  34.402  -73.731 1.00 53.88  ? 568  LYS A HG2  1 
ATOM   99    H HG3  . LYS A 1 7   ? -7.330  34.136  -72.302 1.00 53.88  ? 568  LYS A HG3  1 
ATOM   100   H HD2  . LYS A 1 7   ? -6.466  32.546  -73.670 1.00 66.34  ? 568  LYS A HD2  1 
ATOM   101   H HD3  . LYS A 1 7   ? -7.545  31.791  -72.776 1.00 66.34  ? 568  LYS A HD3  1 
ATOM   102   H HE2  . LYS A 1 7   ? -7.801  31.129  -74.980 1.00 77.56  ? 568  LYS A HE2  1 
ATOM   103   H HE3  . LYS A 1 7   ? -9.085  31.963  -74.546 1.00 77.56  ? 568  LYS A HE3  1 
ATOM   104   H HZ1  . LYS A 1 7   ? -8.207  33.753  -75.646 1.00 84.32  ? 568  LYS A HZ1  1 
ATOM   105   H HZ2  . LYS A 1 7   ? -7.038  32.994  -76.042 1.00 84.32  ? 568  LYS A HZ2  1 
ATOM   106   H HZ3  . LYS A 1 7   ? -8.339  32.654  -76.581 1.00 84.32  ? 568  LYS A HZ3  1 
ATOM   107   N N    . ILE A 1 8   ? -11.779 35.672  -71.045 1.00 39.72  ? 569  ILE A N    1 
ATOM   108   C CA   . ILE A 1 8   ? -12.847 35.623  -70.055 1.00 38.29  ? 569  ILE A CA   1 
ATOM   109   C C    . ILE A 1 8   ? -14.099 36.260  -70.640 1.00 38.06  ? 569  ILE A C    1 
ATOM   110   O O    . ILE A 1 8   ? -14.072 37.405  -71.108 1.00 38.44  ? 569  ILE A O    1 
ATOM   111   C CB   . ILE A 1 8   ? -12.415 36.321  -68.754 1.00 36.87  ? 569  ILE A CB   1 
ATOM   112   C CG1  . ILE A 1 8   ? -11.386 35.449  -68.032 1.00 32.02  ? 569  ILE A CG1  1 
ATOM   113   C CG2  . ILE A 1 8   ? -13.616 36.581  -67.839 1.00 31.65  ? 569  ILE A CG2  1 
ATOM   114   C CD1  . ILE A 1 8   ? -10.721 36.107  -66.842 1.00 37.00  ? 569  ILE A CD1  1 
ATOM   115   H H    . ILE A 1 8   ? -11.337 36.410  -71.040 1.00 47.66  ? 569  ILE A H    1 
ATOM   116   H HA   . ILE A 1 8   ? -13.048 34.697  -69.848 1.00 45.94  ? 569  ILE A HA   1 
ATOM   117   H HB   . ILE A 1 8   ? -12.003 37.171  -68.978 1.00 44.24  ? 569  ILE A HB   1 
ATOM   118   H HG12 . ILE A 1 8   ? -11.829 34.646  -67.715 1.00 38.42  ? 569  ILE A HG12 1 
ATOM   119   H HG13 . ILE A 1 8   ? -10.688 35.208  -68.662 1.00 38.42  ? 569  ILE A HG13 1 
ATOM   120   H HG21 . ILE A 1 8   ? -13.307 37.021  -67.032 1.00 37.98  ? 569  ILE A HG21 1 
ATOM   121   H HG22 . ILE A 1 8   ? -14.249 37.150  -68.304 1.00 37.98  ? 569  ILE A HG22 1 
ATOM   122   H HG23 . ILE A 1 8   ? -14.032 35.734  -67.616 1.00 37.98  ? 569  ILE A HG23 1 
ATOM   123   H HD11 . ILE A 1 8   ? -10.089 35.484  -66.450 1.00 44.40  ? 569  ILE A HD11 1 
ATOM   124   H HD12 . ILE A 1 8   ? -10.258 36.905  -67.141 1.00 44.40  ? 569  ILE A HD12 1 
ATOM   125   H HD13 . ILE A 1 8   ? -11.401 36.342  -66.192 1.00 44.40  ? 569  ILE A HD13 1 
ATOM   126   N N    . SER A 1 9   ? -15.195 35.510  -70.614 1.00 42.46  ? 570  SER A N    1 
ATOM   127   C CA   . SER A 1 9   ? -16.495 35.955  -71.093 1.00 40.06  ? 570  SER A CA   1 
ATOM   128   C C    . SER A 1 9   ? -17.482 35.880  -69.941 1.00 38.81  ? 570  SER A C    1 
ATOM   129   O O    . SER A 1 9   ? -17.592 34.841  -69.284 1.00 39.56  ? 570  SER A O    1 
ATOM   130   C CB   . SER A 1 9   ? -16.978 35.083  -72.256 1.00 33.65  ? 570  SER A CB   1 
ATOM   131   O OG   . SER A 1 9   ? -18.393 35.022  -72.296 1.00 39.80  ? 570  SER A OG   1 
ATOM   132   H H    . SER A 1 9   ? -15.207 34.705  -70.310 1.00 50.95  ? 570  SER A H    1 
ATOM   133   H HA   . SER A 1 9   ? -16.436 36.874  -71.395 1.00 48.08  ? 570  SER A HA   1 
ATOM   134   H HB2  . SER A 1 9   ? -16.656 35.462  -73.089 1.00 40.37  ? 570  SER A HB2  1 
ATOM   135   H HB3  . SER A 1 9   ? -16.628 34.186  -72.144 1.00 40.37  ? 570  SER A HB3  1 
ATOM   136   H HG   . SER A 1 9   ? -18.641 34.541  -72.939 1.00 47.76  ? 570  SER A HG   1 
ATOM   137   N N    . PHE A 1 10  ? -18.183 36.979  -69.682 1.00 39.59  ? 571  PHE A N    1 
ATOM   138   C CA   . PHE A 1 10  ? -19.220 36.963  -68.665 1.00 41.24  ? 571  PHE A CA   1 
ATOM   139   C C    . PHE A 1 10  ? -20.293 37.978  -69.017 1.00 41.17  ? 571  PHE A C    1 
ATOM   140   O O    . PHE A 1 10  ? -20.014 39.027  -69.605 1.00 34.37  ? 571  PHE A O    1 
ATOM   141   C CB   . PHE A 1 10  ? -18.652 37.252  -67.267 1.00 40.93  ? 571  PHE A CB   1 
ATOM   142   C CG   . PHE A 1 10  ? -18.353 38.704  -67.012 1.00 33.47  ? 571  PHE A CG   1 
ATOM   143   C CD1  . PHE A 1 10  ? -19.332 39.550  -66.515 1.00 37.70  ? 571  PHE A CD1  1 
ATOM   144   C CD2  . PHE A 1 10  ? -17.090 39.219  -67.252 1.00 34.81  ? 571  PHE A CD2  1 
ATOM   145   C CE1  . PHE A 1 10  ? -19.060 40.883  -66.277 1.00 36.22  ? 571  PHE A CE1  1 
ATOM   146   C CE2  . PHE A 1 10  ? -16.813 40.552  -67.012 1.00 36.12  ? 571  PHE A CE2  1 
ATOM   147   C CZ   . PHE A 1 10  ? -17.800 41.384  -66.524 1.00 37.70  ? 571  PHE A CZ   1 
ATOM   148   H H    . PHE A 1 10  ? -18.078 37.736  -70.077 1.00 47.51  ? 571  PHE A H    1 
ATOM   149   H HA   . PHE A 1 10  ? -19.631 36.084  -68.646 1.00 49.48  ? 571  PHE A HA   1 
ATOM   150   H HB2  . PHE A 1 10  ? -19.297 36.962  -66.603 1.00 49.12  ? 571  PHE A HB2  1 
ATOM   151   H HB3  . PHE A 1 10  ? -17.825 36.757  -67.159 1.00 49.12  ? 571  PHE A HB3  1 
ATOM   152   H HD1  . PHE A 1 10  ? -20.184 39.218  -66.348 1.00 45.24  ? 571  PHE A HD1  1 
ATOM   153   H HD2  . PHE A 1 10  ? -16.422 38.662  -67.582 1.00 41.78  ? 571  PHE A HD2  1 
ATOM   154   H HE1  . PHE A 1 10  ? -19.727 41.441  -65.946 1.00 43.46  ? 571  PHE A HE1  1 
ATOM   155   H HE2  . PHE A 1 10  ? -15.962 40.889  -67.180 1.00 43.34  ? 571  PHE A HE2  1 
ATOM   156   H HZ   . PHE A 1 10  ? -17.615 42.281  -66.362 1.00 45.24  ? 571  PHE A HZ   1 
ATOM   157   N N    . CYS A 1 11  ? -21.525 37.643  -68.645 1.00 42.55  ? 572  CYS A N    1 
ATOM   158   C CA   A CYS A 1 11  ? -22.652 38.548  -68.801 0.51 48.41  ? 572  CYS A CA   1 
ATOM   159   C CA   B CYS A 1 11  ? -22.651 38.551  -68.802 0.49 43.28  ? 572  CYS A CA   1 
ATOM   160   C C    . CYS A 1 11  ? -22.838 39.337  -67.510 1.00 50.05  ? 572  CYS A C    1 
ATOM   161   O O    . CYS A 1 11  ? -23.058 38.724  -66.457 1.00 49.71  ? 572  CYS A O    1 
ATOM   162   C CB   A CYS A 1 11  ? -23.912 37.766  -69.129 0.51 52.95  ? 572  CYS A CB   1 
ATOM   163   C CB   B CYS A 1 11  ? -23.919 37.783  -69.133 0.49 52.11  ? 572  CYS A CB   1 
ATOM   164   S SG   A CYS A 1 11  ? -25.464 38.638  -68.818 0.51 55.29  ? 572  CYS A SG   1 
ATOM   165   S SG   B CYS A 1 11  ? -23.780 36.700  -70.571 0.49 44.32  ? 572  CYS A SG   1 
ATOM   166   H H    A CYS A 1 11  ? -21.733 36.886  -68.294 0.51 51.06  ? 572  CYS A H    1 
ATOM   167   H H    B CYS A 1 11  ? -21.734 36.886  -68.294 0.49 51.06  ? 572  CYS A H    1 
ATOM   168   H HA   A CYS A 1 11  ? -22.475 39.170  -69.523 0.51 58.09  ? 572  CYS A HA   1 
ATOM   169   H HA   B CYS A 1 11  ? -22.469 39.175  -69.522 0.49 51.94  ? 572  CYS A HA   1 
ATOM   170   H HB2  A CYS A 1 11  ? -23.892 37.533  -70.071 0.51 63.53  ? 572  CYS A HB2  1 
ATOM   171   H HB2  B CYS A 1 11  ? -24.157 37.232  -68.371 0.49 62.53  ? 572  CYS A HB2  1 
ATOM   172   H HB3  A CYS A 1 11  ? -23.920 36.957  -68.595 0.51 63.53  ? 572  CYS A HB3  1 
ATOM   173   H HB3  B CYS A 1 11  ? -24.629 38.419  -69.311 0.49 62.53  ? 572  CYS A HB3  1 
ATOM   174   H HG   A CYS A 1 11  ? -25.491 39.636  -69.484 0.51 66.34  ? 572  CYS A HG   1 
ATOM   175   H HG   B CYS A 1 11  ? -24.829 36.145  -70.745 0.49 53.18  ? 572  CYS A HG   1 
ATOM   176   N N    . PRO A 1 12  ? -22.756 40.671  -67.532 1.00 49.08  ? 573  PRO A N    1 
ATOM   177   C CA   . PRO A 1 12  ? -22.827 41.423  -66.265 1.00 49.29  ? 573  PRO A CA   1 
ATOM   178   C C    . PRO A 1 12  ? -24.122 41.220  -65.497 1.00 58.18  ? 573  PRO A C    1 
ATOM   179   O O    . PRO A 1 12  ? -24.168 41.529  -64.300 1.00 54.70  ? 573  PRO A O    1 
ATOM   180   C CB   . PRO A 1 12  ? -22.661 42.884  -66.709 1.00 50.22  ? 573  PRO A CB   1 
ATOM   181   C CG   . PRO A 1 12  ? -23.052 42.899  -68.142 1.00 54.54  ? 573  PRO A CG   1 
ATOM   182   C CD   . PRO A 1 12  ? -22.638 41.572  -68.693 1.00 50.94  ? 573  PRO A CD   1 
ATOM   183   H HA   . PRO A 1 12  ? -22.082 41.181  -65.694 1.00 59.15  ? 573  PRO A HA   1 
ATOM   184   H HB2  . PRO A 1 12  ? -23.248 43.454  -66.188 1.00 60.26  ? 573  PRO A HB2  1 
ATOM   185   H HB3  . PRO A 1 12  ? -21.736 43.155  -66.603 1.00 60.26  ? 573  PRO A HB3  1 
ATOM   186   H HG2  . PRO A 1 12  ? -24.012 43.015  -68.216 1.00 65.45  ? 573  PRO A HG2  1 
ATOM   187   H HG3  . PRO A 1 12  ? -22.586 43.617  -68.599 1.00 65.45  ? 573  PRO A HG3  1 
ATOM   188   H HD2  . PRO A 1 12  ? -23.243 41.295  -69.399 1.00 61.12  ? 573  PRO A HD2  1 
ATOM   189   H HD3  . PRO A 1 12  ? -21.720 41.605  -69.003 1.00 61.12  ? 573  PRO A HD3  1 
ATOM   190   N N    . LYS A 1 13  ? -25.173 40.711  -66.141 1.00 60.76  ? 574  LYS A N    1 
ATOM   191   C CA   . LYS A 1 13  ? -26.427 40.457  -65.443 1.00 60.06  ? 574  LYS A CA   1 
ATOM   192   C C    . LYS A 1 13  ? -26.317 39.290  -64.470 1.00 63.63  ? 574  LYS A C    1 
ATOM   193   O O    . LYS A 1 13  ? -27.093 39.227  -63.510 1.00 64.50  ? 574  LYS A O    1 
ATOM   194   C CB   . LYS A 1 13  ? -27.545 40.212  -66.468 1.00 62.58  ? 574  LYS A CB   1 
ATOM   195   C CG   . LYS A 1 13  ? -28.531 39.082  -66.146 1.00 64.80  ? 574  LYS A CG   1 
ATOM   196   C CD   . LYS A 1 13  ? -29.258 38.609  -67.393 1.00 66.05  ? 574  LYS A CD   1 
ATOM   197   C CE   . LYS A 1 13  ? -29.417 37.097  -67.372 1.00 72.29  ? 574  LYS A CE   1 
ATOM   198   N NZ   . LYS A 1 13  ? -29.949 36.548  -68.648 1.00 79.11  ? 574  LYS A NZ   1 
ATOM   199   H H    . LYS A 1 13  ? -25.183 40.507  -66.977 1.00 72.91  ? 574  LYS A H    1 
ATOM   200   H HA   . LYS A 1 13  ? -26.663 41.246  -64.931 1.00 72.07  ? 574  LYS A HA   1 
ATOM   201   H HB2  . LYS A 1 13  ? -28.061 41.029  -66.554 1.00 75.10  ? 574  LYS A HB2  1 
ATOM   202   H HB3  . LYS A 1 13  ? -27.134 40.001  -67.320 1.00 75.10  ? 574  LYS A HB3  1 
ATOM   203   H HG2  . LYS A 1 13  ? -28.046 38.330  -65.772 1.00 77.76  ? 574  LYS A HG2  1 
ATOM   204   H HG3  . LYS A 1 13  ? -29.191 39.404  -65.512 1.00 77.76  ? 574  LYS A HG3  1 
ATOM   205   H HD2  . LYS A 1 13  ? -30.141 39.010  -67.424 1.00 79.26  ? 574  LYS A HD2  1 
ATOM   206   H HD3  . LYS A 1 13  ? -28.746 38.854  -68.179 1.00 79.26  ? 574  LYS A HD3  1 
ATOM   207   H HE2  . LYS A 1 13  ? -28.550 36.692  -67.211 1.00 86.75  ? 574  LYS A HE2  1 
ATOM   208   H HE3  . LYS A 1 13  ? -30.032 36.855  -66.663 1.00 86.75  ? 574  LYS A HE3  1 
ATOM   209   H HZ1  . LYS A 1 13  ? -30.024 35.663  -68.589 1.00 94.93  ? 574  LYS A HZ1  1 
ATOM   210   H HZ2  . LYS A 1 13  ? -30.750 36.896  -68.818 1.00 94.93  ? 574  LYS A HZ2  1 
ATOM   211   H HZ3  . LYS A 1 13  ? -29.398 36.747  -69.318 1.00 94.93  ? 574  LYS A HZ3  1 
ATOM   212   N N    . ASP A 1 14  ? -25.372 38.376  -64.684 1.00 66.25  ? 575  ASP A N    1 
ATOM   213   C CA   . ASP A 1 14  ? -25.213 37.211  -63.820 1.00 57.67  ? 575  ASP A CA   1 
ATOM   214   C C    . ASP A 1 14  ? -24.209 37.569  -62.732 1.00 51.98  ? 575  ASP A C    1 
ATOM   215   O O    . ASP A 1 14  ? -23.014 37.718  -63.004 1.00 59.12  ? 575  ASP A O    1 
ATOM   216   C CB   . ASP A 1 14  ? -24.742 35.999  -64.621 1.00 52.26  ? 575  ASP A CB   1 
ATOM   217   C CG   . ASP A 1 14  ? -25.625 35.710  -65.818 1.00 54.80  ? 575  ASP A CG   1 
ATOM   218   O OD1  . ASP A 1 14  ? -26.861 35.811  -65.683 1.00 68.80  ? 575  ASP A OD1  1 
ATOM   219   O OD2  . ASP A 1 14  ? -25.082 35.381  -66.895 1.00 51.83  ? 575  ASP A OD2  1 
ATOM   220   H H    . ASP A 1 14  ? -24.806 38.410  -65.330 1.00 79.50  ? 575  ASP A H    1 
ATOM   221   H HA   . ASP A 1 14  ? -26.061 36.997  -63.402 1.00 69.21  ? 575  ASP A HA   1 
ATOM   222   H HB2  . ASP A 1 14  ? -23.842 36.163  -64.944 1.00 62.71  ? 575  ASP A HB2  1 
ATOM   223   H HB3  . ASP A 1 14  ? -24.751 35.218  -64.046 1.00 62.71  ? 575  ASP A HB3  1 
ATOM   224   N N    . VAL A 1 15  ? -24.693 37.681  -61.500 1.00 49.91  ? 576  VAL A N    1 
ATOM   225   C CA   . VAL A 1 15  ? -23.878 38.055  -60.351 1.00 45.76  ? 576  VAL A CA   1 
ATOM   226   C C    . VAL A 1 15  ? -24.049 36.973  -59.299 1.00 39.41  ? 576  VAL A C    1 
ATOM   227   O O    . VAL A 1 15  ? -25.169 36.720  -58.836 1.00 35.23  ? 576  VAL A O    1 
ATOM   228   C CB   . VAL A 1 15  ? -24.278 39.429  -59.788 1.00 46.93  ? 576  VAL A CB   1 
ATOM   229   C CG1  . VAL A 1 15  ? -23.498 39.738  -58.514 1.00 40.13  ? 576  VAL A CG1  1 
ATOM   230   C CG2  . VAL A 1 15  ? -24.054 40.516  -60.827 1.00 50.59  ? 576  VAL A CG2  1 
ATOM   231   H H    . VAL A 1 15  ? -25.518 37.541  -61.299 1.00 59.89  ? 576  VAL A H    1 
ATOM   232   H HA   . VAL A 1 15  ? -22.944 38.088  -60.612 1.00 54.91  ? 576  VAL A HA   1 
ATOM   233   H HB   . VAL A 1 15  ? -25.222 39.416  -59.565 1.00 56.31  ? 576  VAL A HB   1 
ATOM   234   H HG11 . VAL A 1 15  ? -23.769 40.608  -58.182 1.00 48.16  ? 576  VAL A HG11 1 
ATOM   235   H HG12 . VAL A 1 15  ? -23.691 39.055  -57.853 1.00 48.16  ? 576  VAL A HG12 1 
ATOM   236   H HG13 . VAL A 1 15  ? -22.549 39.742  -58.718 1.00 48.16  ? 576  VAL A HG13 1 
ATOM   237   H HG21 . VAL A 1 15  ? -24.313 41.371  -60.449 1.00 60.71  ? 576  VAL A HG21 1 
ATOM   238   H HG22 . VAL A 1 15  ? -23.115 40.532  -61.070 1.00 60.71  ? 576  VAL A HG22 1 
ATOM   239   H HG23 . VAL A 1 15  ? -24.596 40.322  -61.608 1.00 60.71  ? 576  VAL A HG23 1 
ATOM   240   N N    . LEU A 1 16  ? -22.941 36.337  -58.923 1.00 39.39  ? 577  LEU A N    1 
ATOM   241   C CA   . LEU A 1 16  ? -22.979 35.378  -57.829 1.00 43.20  ? 577  LEU A CA   1 
ATOM   242   C C    . LEU A 1 16  ? -23.018 36.081  -56.479 1.00 43.03  ? 577  LEU A C    1 
ATOM   243   O O    . LEU A 1 16  ? -23.648 35.578  -55.542 1.00 45.81  ? 577  LEU A O    1 
ATOM   244   C CB   . LEU A 1 16  ? -21.775 34.437  -57.924 1.00 39.85  ? 577  LEU A CB   1 
ATOM   245   C CG   . LEU A 1 16  ? -21.650 33.701  -59.260 1.00 37.39  ? 577  LEU A CG   1 
ATOM   246   C CD1  . LEU A 1 16  ? -20.381 32.860  -59.307 1.00 34.84  ? 577  LEU A CD1  1 
ATOM   247   C CD2  . LEU A 1 16  ? -22.872 32.830  -59.521 1.00 35.52  ? 577  LEU A CD2  1 
ATOM   248   H H    . LEU A 1 16  ? -22.167 36.442  -59.281 1.00 47.26  ? 577  LEU A H    1 
ATOM   249   H HA   . LEU A 1 16  ? -23.783 34.841  -57.909 1.00 51.84  ? 577  LEU A HA   1 
ATOM   250   H HB2  . LEU A 1 16  ? -20.965 34.956  -57.796 1.00 47.82  ? 577  LEU A HB2  1 
ATOM   251   H HB3  . LEU A 1 16  ? -21.848 33.769  -57.225 1.00 47.82  ? 577  LEU A HB3  1 
ATOM   252   H HG   . LEU A 1 16  ? -21.597 34.356  -59.973 1.00 44.87  ? 577  LEU A HG   1 
ATOM   253   H HD11 . LEU A 1 16  ? -20.334 32.408  -60.165 1.00 41.81  ? 577  LEU A HD11 1 
ATOM   254   H HD12 . LEU A 1 16  ? -19.613 33.441  -59.197 1.00 41.81  ? 577  LEU A HD12 1 
ATOM   255   H HD13 . LEU A 1 16  ? -20.409 32.207  -58.590 1.00 41.81  ? 577  LEU A HD13 1 
ATOM   256   H HD21 . LEU A 1 16  ? -22.761 32.378  -60.372 1.00 42.62  ? 577  LEU A HD21 1 
ATOM   257   H HD22 . LEU A 1 16  ? -22.952 32.177  -58.807 1.00 42.62  ? 577  LEU A HD22 1 
ATOM   258   H HD23 . LEU A 1 16  ? -23.661 33.393  -59.544 1.00 42.62  ? 577  LEU A HD23 1 
ATOM   259   N N    . GLY A 1 17  ? -22.387 37.243  -56.371 1.00 38.94  ? 578  GLY A N    1 
ATOM   260   C CA   . GLY A 1 17  ? -22.412 38.003  -55.137 1.00 40.83  ? 578  GLY A CA   1 
ATOM   261   C C    . GLY A 1 17  ? -21.510 39.209  -55.239 1.00 43.75  ? 578  GLY A C    1 
ATOM   262   O O    . GLY A 1 17  ? -20.775 39.393  -56.215 1.00 43.37  ? 578  GLY A O    1 
ATOM   263   H H    . GLY A 1 17  ? -21.936 37.613  -57.003 1.00 46.72  ? 578  GLY A H    1 
ATOM   264   H HA2  . GLY A 1 17  ? -23.316 38.302  -54.953 1.00 49.00  ? 578  GLY A HA2  1 
ATOM   265   H HA3  . GLY A 1 17  ? -22.110 37.447  -54.402 1.00 49.00  ? 578  GLY A HA3  1 
ATOM   266   N N    . HIS A 1 18  ? -21.586 40.044  -54.206 1.00 49.64  ? 579  HIS A N    1 
ATOM   267   C CA   . HIS A 1 18  ? -20.763 41.241  -54.089 1.00 50.62  ? 579  HIS A CA   1 
ATOM   268   C C    . HIS A 1 18  ? -19.767 41.067  -52.952 1.00 47.51  ? 579  HIS A C    1 
ATOM   269   O O    . HIS A 1 18  ? -20.136 40.629  -51.858 1.00 45.88  ? 579  HIS A O    1 
ATOM   270   C CB   . HIS A 1 18  ? -21.622 42.482  -53.838 1.00 52.34  ? 579  HIS A CB   1 
ATOM   271   C CG   . HIS A 1 18  ? -22.555 42.810  -54.960 1.00 52.25  ? 579  HIS A CG   1 
ATOM   272   N ND1  . HIS A 1 18  ? -22.267 43.765  -55.911 1.00 51.58  ? 579  HIS A ND1  1 
ATOM   273   C CD2  . HIS A 1 18  ? -23.773 42.314  -55.282 1.00 51.39  ? 579  HIS A CD2  1 
ATOM   274   C CE1  . HIS A 1 18  ? -23.267 43.842  -56.771 1.00 53.67  ? 579  HIS A CE1  1 
ATOM   275   N NE2  . HIS A 1 18  ? -24.193 42.972  -56.412 1.00 54.60  ? 579  HIS A NE2  1 
ATOM   276   H H    . HIS A 1 18  ? -22.122 39.933  -53.542 1.00 59.57  ? 579  HIS A H    1 
ATOM   277   H HA   . HIS A 1 18  ? -20.268 41.373  -54.912 1.00 60.75  ? 579  HIS A HA   1 
ATOM   278   H HB2  . HIS A 1 18  ? -22.156 42.337  -53.041 1.00 62.81  ? 579  HIS A HB2  1 
ATOM   279   H HB3  . HIS A 1 18  ? -21.037 43.245  -53.706 1.00 62.81  ? 579  HIS A HB3  1 
ATOM   280   H HD2  . HIS A 1 18  ? -24.238 41.651  -54.824 1.00 61.67  ? 579  HIS A HD2  1 
ATOM   281   H HE1  . HIS A 1 18  ? -23.310 44.412  -57.505 1.00 64.40  ? 579  HIS A HE1  1 
ATOM   282   H HE2  . HIS A 1 18  ? -24.939 42.839  -56.820 1.00 65.51  ? 579  HIS A HE2  1 
ATOM   283   N N    . GLY A 1 19  ? -18.514 41.410  -53.217 1.00 51.48  ? 580  GLY A N    1 
ATOM   284   C CA   . GLY A 1 19  ? -17.471 41.424  -52.212 1.00 51.38  ? 580  GLY A CA   1 
ATOM   285   C C    . GLY A 1 19  ? -17.360 42.772  -51.537 1.00 56.47  ? 580  GLY A C    1 
ATOM   286   O O    . GLY A 1 19  ? -18.341 43.511  -51.401 1.00 62.52  ? 580  GLY A O    1 
ATOM   287   H H    . GLY A 1 19  ? -18.240 41.645  -53.997 1.00 61.78  ? 580  GLY A H    1 
ATOM   288   H HA2  . GLY A 1 19  ? -17.660 40.754  -51.537 1.00 61.66  ? 580  GLY A HA2  1 
ATOM   289   H HA3  . GLY A 1 19  ? -16.619 41.214  -52.626 1.00 61.66  ? 580  GLY A HA3  1 
ATOM   290   N N    . ALA A 1 20  ? -16.146 43.095  -51.104 1.00 56.55  ? 581  ALA A N    1 
ATOM   291   C CA   . ALA A 1 20  ? -15.838 44.367  -50.472 1.00 61.61  ? 581  ALA A CA   1 
ATOM   292   C C    . ALA A 1 20  ? -14.940 45.191  -51.386 1.00 62.77  ? 581  ALA A C    1 
ATOM   293   O O    . ALA A 1 20  ? -14.190 44.646  -52.201 1.00 60.52  ? 581  ALA A O    1 
ATOM   294   C CB   . ALA A 1 20  ? -15.153 44.162  -49.118 1.00 64.81  ? 581  ALA A CB   1 
ATOM   295   H H    . ALA A 1 20  ? -15.465 42.574  -51.169 1.00 67.85  ? 581  ALA A H    1 
ATOM   296   H HA   . ALA A 1 20  ? -16.660 44.861  -50.327 1.00 73.93  ? 581  ALA A HA   1 
ATOM   297   H HB1  . ALA A 1 20  ? -14.962 45.028  -48.727 1.00 77.78  ? 581  ALA A HB1  1 
ATOM   298   H HB2  . ALA A 1 20  ? -15.746 43.659  -48.538 1.00 77.78  ? 581  ALA A HB2  1 
ATOM   299   H HB3  . ALA A 1 20  ? -14.327 43.671  -49.254 1.00 77.78  ? 581  ALA A HB3  1 
ATOM   300   N N    . GLU A 1 21  ? -15.044 46.514  -51.253 1.00 65.65  ? 582  GLU A N    1 
ATOM   301   C CA   . GLU A 1 21  ? -14.219 47.451  -52.016 1.00 69.84  ? 582  GLU A CA   1 
ATOM   302   C C    . GLU A 1 21  ? -14.532 47.377  -53.510 1.00 69.50  ? 582  GLU A C    1 
ATOM   303   O O    . GLU A 1 21  ? -13.636 47.473  -54.350 1.00 67.86  ? 582  GLU A O    1 
ATOM   304   C CB   . GLU A 1 21  ? -12.728 47.206  -51.767 1.00 69.23  ? 582  GLU A CB   1 
ATOM   305   C CG   . GLU A 1 21  ? -12.324 47.187  -50.295 1.00 78.72  ? 582  GLU A CG   1 
ATOM   306   C CD   . GLU A 1 21  ? -11.766 48.511  -49.803 1.00 88.35  ? 582  GLU A CD   1 
ATOM   307   O OE1  . GLU A 1 21  ? -11.941 49.538  -50.491 1.00 99.43  ? 582  GLU A OE1  1 
ATOM   308   O OE2  . GLU A 1 21  ? -11.147 48.522  -48.719 1.00 87.10  ? 582  GLU A OE2  1 
ATOM   309   H H    . GLU A 1 21  ? -15.596 46.900  -50.718 1.00 78.78  ? 582  GLU A H    1 
ATOM   310   H HA   . GLU A 1 21  ? -14.421 48.353  -51.719 1.00 83.81  ? 582  GLU A HA   1 
ATOM   311   H HB2  . GLU A 1 21  ? -12.487 46.347  -52.149 1.00 83.08  ? 582  GLU A HB2  1 
ATOM   312   H HB3  . GLU A 1 21  ? -12.221 47.910  -52.202 1.00 83.08  ? 582  GLU A HB3  1 
ATOM   313   H HG2  . GLU A 1 21  ? -13.104 46.975  -49.759 1.00 94.47  ? 582  GLU A HG2  1 
ATOM   314   H HG3  . GLU A 1 21  ? -11.641 46.510  -50.166 1.00 94.47  ? 582  GLU A HG3  1 
ATOM   315   N N    . GLY A 1 22  ? -15.808 47.205  -53.843 1.00 65.08  ? 583  GLY A N    1 
ATOM   316   C CA   . GLY A 1 22  ? -16.227 47.141  -55.228 1.00 66.34  ? 583  GLY A CA   1 
ATOM   317   C C    . GLY A 1 22  ? -16.003 45.809  -55.902 1.00 58.47  ? 583  GLY A C    1 
ATOM   318   O O    . GLY A 1 22  ? -16.211 45.706  -57.117 1.00 62.92  ? 583  GLY A O    1 
ATOM   319   H H    . GLY A 1 22  ? -16.451 47.123  -53.278 1.00 78.09  ? 583  GLY A H    1 
ATOM   320   H HA2  . GLY A 1 22  ? -17.174 47.346  -55.279 1.00 79.61  ? 583  GLY A HA2  1 
ATOM   321   H HA3  . GLY A 1 22  ? -15.746 47.816  -55.733 1.00 79.61  ? 583  GLY A HA3  1 
ATOM   322   N N    . THR A 1 23  ? -15.587 44.786  -55.161 1.00 58.07  ? 584  THR A N    1 
ATOM   323   C CA   . THR A 1 23  ? -15.400 43.466  -55.745 1.00 53.19  ? 584  THR A CA   1 
ATOM   324   C C    . THR A 1 23  ? -16.752 42.854  -56.089 1.00 48.11  ? 584  THR A C    1 
ATOM   325   O O    . THR A 1 23  ? -17.655 42.803  -55.248 1.00 52.86  ? 584  THR A O    1 
ATOM   326   C CB   . THR A 1 23  ? -14.642 42.556  -54.777 1.00 53.32  ? 584  THR A CB   1 
ATOM   327   O OG1  . THR A 1 23  ? -13.351 43.114  -54.499 1.00 56.65  ? 584  THR A OG1  1 
ATOM   328   C CG2  . THR A 1 23  ? -14.469 41.154  -55.367 1.00 52.86  ? 584  THR A CG2  1 
ATOM   329   H H    . THR A 1 23  ? -15.407 44.831  -54.321 1.00 69.68  ? 584  THR A H    1 
ATOM   330   H HA   . THR A 1 23  ? -14.883 43.545  -56.561 1.00 63.83  ? 584  THR A HA   1 
ATOM   331   H HB   . THR A 1 23  ? -15.143 42.479  -53.950 1.00 63.99  ? 584  THR A HB   1 
ATOM   332   H HG1  . THR A 1 23  ? -13.436 43.875  -54.152 1.00 67.98  ? 584  THR A HG1  1 
ATOM   333   H HG21 . THR A 1 23  ? -13.987 40.590  -54.743 1.00 63.43  ? 584  THR A HG21 1 
ATOM   334   H HG22 . THR A 1 23  ? -15.338 40.760  -55.543 1.00 63.43  ? 584  THR A HG22 1 
ATOM   335   H HG23 . THR A 1 23  ? -13.971 41.203  -56.197 1.00 63.43  ? 584  THR A HG23 1 
ATOM   336   N N    . ILE A 1 24  ? -16.891 42.399  -57.333 1.00 44.72  ? 585  ILE A N    1 
ATOM   337   C CA   . ILE A 1 24  ? -18.063 41.656  -57.781 1.00 44.82  ? 585  ILE A CA   1 
ATOM   338   C C    . ILE A 1 24  ? -17.581 40.362  -58.419 1.00 40.25  ? 585  ILE A C    1 
ATOM   339   O O    . ILE A 1 24  ? -16.535 40.336  -59.076 1.00 39.94  ? 585  ILE A O    1 
ATOM   340   C CB   . ILE A 1 24  ? -18.920 42.454  -58.788 1.00 44.51  ? 585  ILE A CB   1 
ATOM   341   C CG1  . ILE A 1 24  ? -18.943 43.942  -58.422 1.00 51.02  ? 585  ILE A CG1  1 
ATOM   342   C CG2  . ILE A 1 24  ? -20.327 41.866  -58.844 1.00 45.35  ? 585  ILE A CG2  1 
ATOM   343   C CD1  . ILE A 1 24  ? -19.786 44.800  -59.352 1.00 49.60  ? 585  ILE A CD1  1 
ATOM   344   H H    . ILE A 1 24  ? -16.303 42.512  -57.950 1.00 53.67  ? 585  ILE A H    1 
ATOM   345   H HA   . ILE A 1 24  ? -18.616 41.433  -57.016 1.00 53.78  ? 585  ILE A HA   1 
ATOM   346   H HB   . ILE A 1 24  ? -18.519 42.365  -59.666 1.00 53.41  ? 585  ILE A HB   1 
ATOM   347   H HG12 . ILE A 1 24  ? -19.304 44.037  -57.527 1.00 61.22  ? 585  ILE A HG12 1 
ATOM   348   H HG13 . ILE A 1 24  ? -18.036 44.283  -58.448 1.00 61.22  ? 585  ILE A HG13 1 
ATOM   349   H HG21 . ILE A 1 24  ? -20.856 42.375  -59.478 1.00 54.42  ? 585  ILE A HG21 1 
ATOM   350   H HG22 . ILE A 1 24  ? -20.270 40.940  -59.127 1.00 54.42  ? 585  ILE A HG22 1 
ATOM   351   H HG23 . ILE A 1 24  ? -20.726 41.919  -57.962 1.00 54.42  ? 585  ILE A HG23 1 
ATOM   352   H HD11 . ILE A 1 24  ? -19.746 45.722  -59.052 1.00 59.52  ? 585  ILE A HD11 1 
ATOM   353   H HD12 . ILE A 1 24  ? -19.432 44.730  -60.253 1.00 59.52  ? 585  ILE A HD12 1 
ATOM   354   H HD13 . ILE A 1 24  ? -20.702 44.484  -59.330 1.00 59.52  ? 585  ILE A HD13 1 
ATOM   355   N N    . VAL A 1 25  ? -18.342 39.290  -58.217 1.00 34.08  ? 586  VAL A N    1 
ATOM   356   C CA   . VAL A 1 25  ? -18.068 37.998  -58.831 1.00 35.25  ? 586  VAL A CA   1 
ATOM   357   C C    . VAL A 1 25  ? -19.245 37.651  -59.734 1.00 32.42  ? 586  VAL A C    1 
ATOM   358   O O    . VAL A 1 25  ? -20.405 37.801  -59.336 1.00 29.80  ? 586  VAL A O    1 
ATOM   359   C CB   . VAL A 1 25  ? -17.827 36.901  -57.774 1.00 34.66  ? 586  VAL A CB   1 
ATOM   360   C CG1  . VAL A 1 25  ? -18.960 36.855  -56.758 1.00 47.68  ? 586  VAL A CG1  1 
ATOM   361   C CG2  . VAL A 1 25  ? -17.623 35.543  -58.438 1.00 30.80  ? 586  VAL A CG2  1 
ATOM   362   H H    . VAL A 1 25  ? -19.040 39.288  -57.716 1.00 40.90  ? 586  VAL A H    1 
ATOM   363   H HA   . VAL A 1 25  ? -17.273 38.068  -59.382 1.00 42.31  ? 586  VAL A HA   1 
ATOM   364   H HB   . VAL A 1 25  ? -17.013 37.114  -57.292 1.00 41.59  ? 586  VAL A HB   1 
ATOM   365   H HG11 . VAL A 1 25  ? -18.775 36.157  -56.111 1.00 57.22  ? 586  VAL A HG11 1 
ATOM   366   H HG12 . VAL A 1 25  ? -19.018 37.714  -56.311 1.00 57.22  ? 586  VAL A HG12 1 
ATOM   367   H HG13 . VAL A 1 25  ? -19.791 36.666  -57.221 1.00 57.22  ? 586  VAL A HG13 1 
ATOM   368   H HG21 . VAL A 1 25  ? -17.474 34.875  -57.751 1.00 36.96  ? 586  VAL A HG21 1 
ATOM   369   H HG22 . VAL A 1 25  ? -18.416 35.320  -58.950 1.00 36.96  ? 586  VAL A HG22 1 
ATOM   370   H HG23 . VAL A 1 25  ? -16.852 35.592  -59.026 1.00 36.96  ? 586  VAL A HG23 1 
ATOM   371   N N    . TYR A 1 26  ? -18.941 37.204  -60.950 1.00 31.68  ? 587  TYR A N    1 
ATOM   372   C CA   . TYR A 1 26  ? -19.943 36.859  -61.945 1.00 33.57  ? 587  TYR A CA   1 
ATOM   373   C C    . TYR A 1 26  ? -19.810 35.392  -62.323 1.00 31.17  ? 587  TYR A C    1 
ATOM   374   O O    . TYR A 1 26  ? -18.761 34.772  -62.133 1.00 29.14  ? 587  TYR A O    1 
ATOM   375   C CB   . TYR A 1 26  ? -19.797 37.698  -63.223 1.00 36.97  ? 587  TYR A CB   1 
ATOM   376   C CG   . TYR A 1 26  ? -19.736 39.196  -63.029 1.00 32.33  ? 587  TYR A CG   1 
ATOM   377   C CD1  . TYR A 1 26  ? -18.526 39.838  -62.811 1.00 33.61  ? 587  TYR A CD1  1 
ATOM   378   C CD2  . TYR A 1 26  ? -20.885 39.971  -63.098 1.00 38.46  ? 587  TYR A CD2  1 
ATOM   379   C CE1  . TYR A 1 26  ? -18.464 41.209  -62.649 1.00 41.51  ? 587  TYR A CE1  1 
ATOM   380   C CE2  . TYR A 1 26  ? -20.835 41.340  -62.937 1.00 39.61  ? 587  TYR A CE2  1 
ATOM   381   C CZ   . TYR A 1 26  ? -19.623 41.956  -62.714 1.00 41.88  ? 587  TYR A CZ   1 
ATOM   382   O OH   . TYR A 1 26  ? -19.569 43.321  -62.553 1.00 51.62  ? 587  TYR A OH   1 
ATOM   383   H H    . TYR A 1 26  ? -18.135 37.089  -61.226 1.00 38.01  ? 587  TYR A H    1 
ATOM   384   H HA   . TYR A 1 26  ? -20.829 37.005  -61.579 1.00 40.29  ? 587  TYR A HA   1 
ATOM   385   H HB2  . TYR A 1 26  ? -18.979 37.431  -63.671 1.00 44.36  ? 587  TYR A HB2  1 
ATOM   386   H HB3  . TYR A 1 26  ? -20.555 37.512  -63.799 1.00 44.36  ? 587  TYR A HB3  1 
ATOM   387   H HD1  . TYR A 1 26  ? -17.744 39.337  -62.767 1.00 40.33  ? 587  TYR A HD1  1 
ATOM   388   H HD2  . TYR A 1 26  ? -21.705 39.559  -63.249 1.00 46.15  ? 587  TYR A HD2  1 
ATOM   389   H HE1  . TYR A 1 26  ? -17.647 41.626  -62.497 1.00 49.82  ? 587  TYR A HE1  1 
ATOM   390   H HE2  . TYR A 1 26  ? -21.615 41.845  -62.981 1.00 47.54  ? 587  TYR A HE2  1 
ATOM   391   H HH   . TYR A 1 26  ? -20.340 43.648  -62.615 1.00 61.94  ? 587  TYR A HH   1 
ATOM   392   N N    . ARG A 1 27  ? -20.893 34.842  -62.864 1.00 31.06  ? 588  ARG A N    1 
ATOM   393   C CA   . ARG A 1 27  ? -20.817 33.585  -63.592 1.00 30.26  ? 588  ARG A CA   1 
ATOM   394   C C    . ARG A 1 27  ? -20.409 33.883  -65.029 1.00 36.85  ? 588  ARG A C    1 
ATOM   395   O O    . ARG A 1 27  ? -20.958 34.792  -65.661 1.00 38.29  ? 588  ARG A O    1 
ATOM   396   C CB   . ARG A 1 27  ? -22.158 32.854  -63.553 1.00 41.03  ? 588  ARG A CB   1 
ATOM   397   C CG   . ARG A 1 27  ? -22.137 31.487  -64.217 1.00 36.09  ? 588  ARG A CG   1 
ATOM   398   C CD   . ARG A 1 27  ? -23.427 30.724  -63.958 1.00 41.67  ? 588  ARG A CD   1 
ATOM   399   N NE   . ARG A 1 27  ? -23.433 29.420  -64.614 1.00 60.36  ? 588  ARG A NE   1 
ATOM   400   C CZ   . ARG A 1 27  ? -24.381 28.502  -64.451 1.00 69.90  ? 588  ARG A CZ   1 
ATOM   401   N NH1  . ARG A 1 27  ? -25.410 28.735  -63.647 1.00 75.12  ? 588  ARG A NH1  1 
ATOM   402   N NH2  . ARG A 1 27  ? -24.299 27.344  -65.092 1.00 66.01  ? 588  ARG A NH2  1 
ATOM   403   H H    . ARG A 1 27  ? -21.683 35.178  -62.823 1.00 37.27  ? 588  ARG A H    1 
ATOM   404   H HA   . ARG A 1 27  ? -20.142 33.015  -63.191 1.00 36.31  ? 588  ARG A HA   1 
ATOM   405   H HB2  . ARG A 1 27  ? -22.418 32.730  -62.627 1.00 49.23  ? 588  ARG A HB2  1 
ATOM   406   H HB3  . ARG A 1 27  ? -22.821 33.395  -64.010 1.00 49.23  ? 588  ARG A HB3  1 
ATOM   407   H HG2  . ARG A 1 27  ? -22.036 31.597  -65.175 1.00 43.31  ? 588  ARG A HG2  1 
ATOM   408   H HG3  . ARG A 1 27  ? -21.400 30.968  -63.859 1.00 43.31  ? 588  ARG A HG3  1 
ATOM   409   H HD2  . ARG A 1 27  ? -23.527 30.583  -63.003 1.00 50.01  ? 588  ARG A HD2  1 
ATOM   410   H HD3  . ARG A 1 27  ? -24.175 31.238  -64.300 1.00 50.01  ? 588  ARG A HD3  1 
ATOM   411   H HE   . ARG A 1 27  ? -22.779 29.233  -65.141 1.00 72.43  ? 588  ARG A HE   1 
ATOM   412   H HH11 . ARG A 1 27  ? -25.468 29.485  -63.229 1.00 90.15  ? 588  ARG A HH11 1 
ATOM   413   H HH12 . ARG A 1 27  ? -26.020 28.138  -63.545 1.00 90.15  ? 588  ARG A HH12 1 
ATOM   414   H HH21 . ARG A 1 27  ? -23.634 27.187  -65.614 1.00 79.21  ? 588  ARG A HH21 1 
ATOM   415   H HH22 . ARG A 1 27  ? -24.912 26.750  -64.987 1.00 79.21  ? 588  ARG A HH22 1 
ATOM   416   N N    . GLY A 1 28  ? -19.444 33.130  -65.540 1.00 35.11  ? 589  GLY A N    1 
ATOM   417   C CA   . GLY A 1 28  ? -18.875 33.444  -66.828 1.00 32.89  ? 589  GLY A CA   1 
ATOM   418   C C    . GLY A 1 28  ? -18.223 32.238  -67.465 1.00 31.02  ? 589  GLY A C    1 
ATOM   419   O O    . GLY A 1 28  ? -18.334 31.112  -66.975 1.00 31.43  ? 589  GLY A O    1 
ATOM   420   H H    . GLY A 1 28  ? -19.106 32.438  -65.159 1.00 42.14  ? 589  GLY A H    1 
ATOM   421   H HA2  . GLY A 1 28  ? -19.571 33.768  -67.421 1.00 39.47  ? 589  GLY A HA2  1 
ATOM   422   H HA3  . GLY A 1 28  ? -18.206 34.139  -66.728 1.00 39.47  ? 589  GLY A HA3  1 
ATOM   423   N N    . MET A 1 29  ? -17.550 32.496  -68.580 1.00 30.99  ? 590  MET A N    1 
ATOM   424   C CA   . MET A 1 29  ? -16.892 31.475  -69.377 1.00 31.89  ? 590  MET A CA   1 
ATOM   425   C C    . MET A 1 29  ? -15.404 31.769  -69.473 1.00 28.44  ? 590  MET A C    1 
ATOM   426   O O    . MET A 1 29  ? -14.999 32.922  -69.651 1.00 33.75  ? 590  MET A O    1 
ATOM   427   C CB   . MET A 1 29  ? -17.481 31.421  -70.785 1.00 36.13  ? 590  MET A CB   1 
ATOM   428   C CG   . MET A 1 29  ? -18.951 31.060  -70.835 1.00 36.54  ? 590  MET A CG   1 
ATOM   429   S SD   . MET A 1 29  ? -19.247 29.334  -70.423 1.00 60.08  ? 590  MET A SD   1 
ATOM   430   C CE   . MET A 1 29  ? -18.505 28.515  -71.834 1.00 57.52  ? 590  MET A CE   1 
ATOM   431   H H    . MET A 1 29  ? -17.458 33.288  -68.904 1.00 37.18  ? 590  MET A H    1 
ATOM   432   H HA   . MET A 1 29  ? -17.022 30.609  -68.960 1.00 38.26  ? 590  MET A HA   1 
ATOM   433   H HB2  . MET A 1 29  ? -17.378 32.293  -71.199 1.00 43.36  ? 590  MET A HB2  1 
ATOM   434   H HB3  . MET A 1 29  ? -16.997 30.756  -71.299 1.00 43.36  ? 590  MET A HB3  1 
ATOM   435   H HG2  . MET A 1 29  ? -19.434 31.609  -70.198 1.00 43.85  ? 590  MET A HG2  1 
ATOM   436   H HG3  . MET A 1 29  ? -19.286 31.217  -71.732 1.00 43.85  ? 590  MET A HG3  1 
ATOM   437   H HE1  . MET A 1 29  ? -18.601 27.556  -71.729 1.00 69.02  ? 590  MET A HE1  1 
ATOM   438   H HE2  . MET A 1 29  ? -18.956 28.807  -72.641 1.00 69.02  ? 590  MET A HE2  1 
ATOM   439   H HE3  . MET A 1 29  ? -17.565 28.751  -71.876 1.00 69.02  ? 590  MET A HE3  1 
ATOM   440   N N    . PHE A 1 30  ? -14.594 30.725  -69.332 1.00 28.00  ? 591  PHE A N    1 
ATOM   441   C CA   . PHE A 1 30  ? -13.185 30.787  -69.691 1.00 31.55  ? 591  PHE A CA   1 
ATOM   442   C C    . PHE A 1 30  ? -12.804 29.483  -70.371 1.00 32.28  ? 591  PHE A C    1 
ATOM   443   O O    . PHE A 1 30  ? -13.005 28.406  -69.802 1.00 33.31  ? 591  PHE A O    1 
ATOM   444   C CB   . PHE A 1 30  ? -12.299 31.024  -68.464 1.00 35.80  ? 591  PHE A CB   1 
ATOM   445   C CG   . PHE A 1 30  ? -10.856 30.685  -68.691 1.00 35.31  ? 591  PHE A CG   1 
ATOM   446   C CD1  . PHE A 1 30  ? -10.046 31.516  -69.448 1.00 35.26  ? 591  PHE A CD1  1 
ATOM   447   C CD2  . PHE A 1 30  ? -10.309 29.533  -68.152 1.00 35.19  ? 591  PHE A CD2  1 
ATOM   448   C CE1  . PHE A 1 30  ? -8.717  31.203  -69.660 1.00 38.01  ? 591  PHE A CE1  1 
ATOM   449   C CE2  . PHE A 1 30  ? -8.982  29.216  -68.361 1.00 35.62  ? 591  PHE A CE2  1 
ATOM   450   C CZ   . PHE A 1 30  ? -8.185  30.051  -69.116 1.00 35.97  ? 591  PHE A CZ   1 
ATOM   451   H H    . PHE A 1 30  ? -14.841 29.961  -69.026 1.00 33.60  ? 591  PHE A H    1 
ATOM   452   H HA   . PHE A 1 30  ? -13.042 31.513  -70.318 1.00 37.85  ? 591  PHE A HA   1 
ATOM   453   H HB2  . PHE A 1 30  ? -12.349 31.961  -68.219 1.00 42.96  ? 591  PHE A HB2  1 
ATOM   454   H HB3  . PHE A 1 30  ? -12.622 30.475  -67.733 1.00 42.96  ? 591  PHE A HB3  1 
ATOM   455   H HD1  . PHE A 1 30  ? -10.401 32.292  -69.817 1.00 42.31  ? 591  PHE A HD1  1 
ATOM   456   H HD2  . PHE A 1 30  ? -10.843 28.966  -67.642 1.00 42.22  ? 591  PHE A HD2  1 
ATOM   457   H HE1  . PHE A 1 30  ? -8.182  31.768  -70.170 1.00 45.61  ? 591  PHE A HE1  1 
ATOM   458   H HE2  . PHE A 1 30  ? -8.625  28.440  -67.993 1.00 42.74  ? 591  PHE A HE2  1 
ATOM   459   H HZ   . PHE A 1 30  ? -7.290  29.839  -69.258 1.00 43.16  ? 591  PHE A HZ   1 
ATOM   460   N N    . ASP A 1 31  ? -12.237 29.589  -71.573 1.00 32.72  ? 592  ASP A N    1 
ATOM   461   C CA   . ASP A 1 31  ? -11.799 28.431  -72.350 1.00 35.46  ? 592  ASP A CA   1 
ATOM   462   C C    . ASP A 1 31  ? -12.916 27.393  -72.461 1.00 33.79  ? 592  ASP A C    1 
ATOM   463   O O    . ASP A 1 31  ? -12.721 26.200  -72.223 1.00 33.86  ? 592  ASP A O    1 
ATOM   464   C CB   . ASP A 1 31  ? -10.533 27.823  -71.740 1.00 37.11  ? 592  ASP A CB   1 
ATOM   465   C CG   . ASP A 1 31  ? -9.878  26.794  -72.644 1.00 35.56  ? 592  ASP A CG   1 
ATOM   466   O OD1  . ASP A 1 31  ? -10.143 26.807  -73.865 1.00 52.38  ? 592  ASP A OD1  1 
ATOM   467   O OD2  . ASP A 1 31  ? -9.092  25.973  -72.130 1.00 37.58  ? 592  ASP A OD2  1 
ATOM   468   H H    . ASP A 1 31  ? -12.093 30.339  -71.968 1.00 39.27  ? 592  ASP A H    1 
ATOM   469   H HA   . ASP A 1 31  ? -11.581 28.725  -73.248 1.00 42.55  ? 592  ASP A HA   1 
ATOM   470   H HB2  . ASP A 1 31  ? -9.891  28.530  -71.577 1.00 44.53  ? 592  ASP A HB2  1 
ATOM   471   H HB3  . ASP A 1 31  ? -10.764 27.385  -70.906 1.00 44.53  ? 592  ASP A HB3  1 
ATOM   472   N N    . ASN A 1 32  ? -14.110 27.871  -72.816 1.00 34.92  ? 593  ASN A N    1 
ATOM   473   C CA   . ASN A 1 32  ? -15.274 27.011  -73.046 1.00 40.45  ? 593  ASN A CA   1 
ATOM   474   C C    . ASN A 1 32  ? -15.630 26.189  -71.809 1.00 37.55  ? 593  ASN A C    1 
ATOM   475   O O    . ASN A 1 32  ? -16.105 25.056  -71.923 1.00 38.28  ? 593  ASN A O    1 
ATOM   476   C CB   . ASN A 1 32  ? -15.055 26.085  -74.249 1.00 41.99  ? 593  ASN A CB   1 
ATOM   477   C CG   . ASN A 1 32  ? -14.853 26.846  -75.545 1.00 49.09  ? 593  ASN A CG   1 
ATOM   478   O OD1  . ASN A 1 32  ? -15.804 27.376  -76.120 1.00 55.25  ? 593  ASN A OD1  1 
ATOM   479   N ND2  . ASN A 1 32  ? -13.611 26.893  -76.018 1.00 51.47  ? 593  ASN A ND2  1 
ATOM   480   H H    . ASN A 1 32  ? -14.275 28.707  -72.933 1.00 41.90  ? 593  ASN A H    1 
ATOM   481   H HA   . ASN A 1 32  ? -16.036 27.576  -73.248 1.00 48.55  ? 593  ASN A HA   1 
ATOM   482   H HB2  . ASN A 1 32  ? -14.266 25.544  -74.092 1.00 50.39  ? 593  ASN A HB2  1 
ATOM   483   H HB3  . ASN A 1 32  ? -15.833 25.515  -74.354 1.00 50.39  ? 593  ASN A HB3  1 
ATOM   484   H HD21 . ASN A 1 32  ? -13.446 27.313  -76.750 1.00 61.77  ? 593  ASN A HD21 1 
ATOM   485   H HD22 . ASN A 1 32  ? -12.973 26.504  -75.592 1.00 61.77  ? 593  ASN A HD22 1 
ATOM   486   N N    . ARG A 1 33  ? -15.407 26.751  -70.622 1.00 37.94  ? 594  ARG A N    1 
ATOM   487   C CA   . ARG A 1 33  ? -15.784 26.117  -69.366 1.00 36.72  ? 594  ARG A CA   1 
ATOM   488   C C    . ARG A 1 33  ? -16.547 27.111  -68.508 1.00 31.02  ? 594  ARG A C    1 
ATOM   489   O O    . ARG A 1 33  ? -16.209 28.297  -68.470 1.00 30.81  ? 594  ARG A O    1 
ATOM   490   C CB   . ARG A 1 33  ? -14.554 25.612  -68.600 1.00 33.41  ? 594  ARG A CB   1 
ATOM   491   H H    . ARG A 1 33  ? -15.029 27.516  -70.519 1.00 45.53  ? 594  ARG A H    1 
ATOM   492   H HA   . ARG A 1 33  ? -16.363 25.361  -69.548 1.00 44.07  ? 594  ARG A HA   1 
ATOM   493   N N    . ASP A 1 34  ? -17.585 26.626  -67.829 1.00 36.40  ? 595  ASP A N    1 
ATOM   494   C CA   . ASP A 1 34  ? -18.270 27.444  -66.840 1.00 36.74  ? 595  ASP A CA   1 
ATOM   495   C C    . ASP A 1 34  ? -17.310 27.784  -65.711 1.00 29.80  ? 595  ASP A C    1 
ATOM   496   O O    . ASP A 1 34  ? -16.635 26.904  -65.170 1.00 37.06  ? 595  ASP A O    1 
ATOM   497   C CB   . ASP A 1 34  ? -19.493 26.710  -66.292 1.00 40.92  ? 595  ASP A CB   1 
ATOM   498   C CG   . ASP A 1 34  ? -20.595 26.571  -67.319 1.00 48.75  ? 595  ASP A CG   1 
ATOM   499   O OD1  . ASP A 1 34  ? -20.575 25.581  -68.080 1.00 63.69  ? 595  ASP A OD1  1 
ATOM   500   O OD2  . ASP A 1 34  ? -21.479 27.451  -67.367 1.00 57.53  ? 595  ASP A OD2  1 
ATOM   501   H H    . ASP A 1 34  ? -17.906 25.834  -67.922 1.00 43.68  ? 595  ASP A H    1 
ATOM   502   H HA   . ASP A 1 34  ? -18.567 28.271  -67.253 1.00 44.09  ? 595  ASP A HA   1 
ATOM   503   H HB2  . ASP A 1 34  ? -19.228 25.820  -66.013 1.00 49.10  ? 595  ASP A HB2  1 
ATOM   504   H HB3  . ASP A 1 34  ? -19.847 27.204  -65.537 1.00 49.10  ? 595  ASP A HB3  1 
ATOM   505   N N    . VAL A 1 35  ? -17.231 29.071  -65.372 1.00 22.08  ? 596  VAL A N    1 
ATOM   506   C CA   . VAL A 1 35  ? -16.328 29.544  -64.330 1.00 26.17  ? 596  VAL A CA   1 
ATOM   507   C C    . VAL A 1 35  ? -16.984 30.703  -63.592 1.00 29.63  ? 596  VAL A C    1 
ATOM   508   O O    . VAL A 1 35  ? -17.965 31.292  -64.054 1.00 31.03  ? 596  VAL A O    1 
ATOM   509   C CB   . VAL A 1 35  ? -14.959 29.992  -64.901 1.00 28.69  ? 596  VAL A CB   1 
ATOM   510   C CG1  . VAL A 1 35  ? -14.231 28.820  -65.543 1.00 27.92  ? 596  VAL A CG1  1 
ATOM   511   C CG2  . VAL A 1 35  ? -15.138 31.127  -65.898 1.00 29.95  ? 596  VAL A CG2  1 
ATOM   512   H H    . VAL A 1 35  ? -17.697 29.694  -65.736 1.00 26.49  ? 596  VAL A H    1 
ATOM   513   H HA   . VAL A 1 35  ? -16.172 28.829  -63.694 1.00 31.40  ? 596  VAL A HA   1 
ATOM   514   H HB   . VAL A 1 35  ? -14.409 30.321  -64.173 1.00 34.43  ? 596  VAL A HB   1 
ATOM   515   H HG11 . VAL A 1 35  ? -13.380 29.129  -65.891 1.00 33.50  ? 596  VAL A HG11 1 
ATOM   516   H HG12 . VAL A 1 35  ? -14.085 28.134  -64.873 1.00 33.50  ? 596  VAL A HG12 1 
ATOM   517   H HG13 . VAL A 1 35  ? -14.775 28.468  -66.265 1.00 33.50  ? 596  VAL A HG13 1 
ATOM   518   H HG21 . VAL A 1 35  ? -14.268 31.387  -66.239 1.00 35.94  ? 596  VAL A HG21 1 
ATOM   519   H HG22 . VAL A 1 35  ? -15.701 30.821  -66.626 1.00 35.94  ? 596  VAL A HG22 1 
ATOM   520   H HG23 . VAL A 1 35  ? -15.556 31.878  -65.449 1.00 35.94  ? 596  VAL A HG23 1 
ATOM   521   N N    . ALA A 1 36  ? -16.434 31.014  -62.423 1.00 26.88  ? 597  ALA A N    1 
ATOM   522   C CA   . ALA A 1 36  ? -16.724 32.259  -61.731 1.00 27.23  ? 597  ALA A CA   1 
ATOM   523   C C    . ALA A 1 36  ? -15.657 33.280  -62.096 1.00 26.68  ? 597  ALA A C    1 
ATOM   524   O O    . ALA A 1 36  ? -14.481 32.937  -62.248 1.00 28.29  ? 597  ALA A O    1 
ATOM   525   C CB   . ALA A 1 36  ? -16.759 32.054  -60.217 1.00 27.91  ? 597  ALA A CB   1 
ATOM   526   H H    . ALA A 1 36  ? -15.879 30.509  -62.005 1.00 32.26  ? 597  ALA A H    1 
ATOM   527   H HA   . ALA A 1 36  ? -17.587 32.597  -62.018 1.00 32.67  ? 597  ALA A HA   1 
ATOM   528   H HB1  . ALA A 1 36  ? -16.954 32.902  -59.789 1.00 33.49  ? 597  ALA A HB1  1 
ATOM   529   H HB2  . ALA A 1 36  ? -17.450 31.408  -60.002 1.00 33.49  ? 597  ALA A HB2  1 
ATOM   530   H HB3  . ALA A 1 36  ? -15.895 31.726  -59.923 1.00 33.49  ? 597  ALA A HB3  1 
ATOM   531   N N    . VAL A 1 37  ? -16.075 34.533  -62.248 1.00 29.03  ? 598  VAL A N    1 
ATOM   532   C CA   . VAL A 1 37  ? -15.197 35.619  -62.673 1.00 31.37  ? 598  VAL A CA   1 
ATOM   533   C C    . VAL A 1 37  ? -15.207 36.663  -61.567 1.00 30.75  ? 598  VAL A C    1 
ATOM   534   O O    . VAL A 1 37  ? -16.242 37.289  -61.306 1.00 28.07  ? 598  VAL A O    1 
ATOM   535   C CB   . VAL A 1 37  ? -15.642 36.230  -64.009 1.00 26.53  ? 598  VAL A CB   1 
ATOM   536   C CG1  . VAL A 1 37  ? -14.650 37.290  -64.463 1.00 29.38  ? 598  VAL A CG1  1 
ATOM   537   C CG2  . VAL A 1 37  ? -15.790 35.148  -65.065 1.00 25.70  ? 598  VAL A CG2  1 
ATOM   538   H H    . VAL A 1 37  ? -16.885 34.785  -62.108 1.00 34.83  ? 598  VAL A H    1 
ATOM   539   H HA   . VAL A 1 37  ? -14.292 35.284  -62.773 1.00 37.64  ? 598  VAL A HA   1 
ATOM   540   H HB   . VAL A 1 37  ? -16.506 36.656  -63.891 1.00 31.84  ? 598  VAL A HB   1 
ATOM   541   H HG11 . VAL A 1 37  ? -14.951 37.662  -65.308 1.00 35.25  ? 598  VAL A HG11 1 
ATOM   542   H HG12 . VAL A 1 37  ? -14.605 37.989  -63.792 1.00 35.25  ? 598  VAL A HG12 1 
ATOM   543   H HG13 . VAL A 1 37  ? -13.778 36.880  -64.574 1.00 35.25  ? 598  VAL A HG13 1 
ATOM   544   H HG21 . VAL A 1 37  ? -16.071 35.557  -65.898 1.00 30.85  ? 598  VAL A HG21 1 
ATOM   545   H HG22 . VAL A 1 37  ? -14.935 34.706  -65.185 1.00 30.85  ? 598  VAL A HG22 1 
ATOM   546   H HG23 . VAL A 1 37  ? -16.456 34.507  -64.770 1.00 30.85  ? 598  VAL A HG23 1 
ATOM   547   N N    . LYS A 1 38  ? -14.055 36.867  -60.931 1.00 33.16  ? 599  LYS A N    1 
ATOM   548   C CA   . LYS A 1 38  ? -13.913 37.812  -59.828 1.00 37.21  ? 599  LYS A CA   1 
ATOM   549   C C    . LYS A 1 38  ? -13.274 39.085  -60.370 1.00 35.55  ? 599  LYS A C    1 
ATOM   550   O O    . LYS A 1 38  ? -12.100 39.084  -60.752 1.00 39.64  ? 599  LYS A O    1 
ATOM   551   C CB   . LYS A 1 38  ? -13.068 37.216  -58.705 1.00 38.49  ? 599  LYS A CB   1 
ATOM   552   C CG   . LYS A 1 38  ? -12.961 38.105  -57.474 1.00 41.94  ? 599  LYS A CG   1 
ATOM   553   C CD   . LYS A 1 38  ? -11.940 37.574  -56.482 1.00 38.78  ? 599  LYS A CD   1 
ATOM   554   C CE   . LYS A 1 38  ? -11.967 38.369  -55.184 1.00 40.91  ? 599  LYS A CE   1 
ATOM   555   N NZ   . LYS A 1 38  ? -11.018 37.835  -54.167 1.00 43.14  ? 599  LYS A NZ   1 
ATOM   556   H H    . LYS A 1 38  ? -13.323 36.459  -61.127 1.00 39.80  ? 599  LYS A H    1 
ATOM   557   H HA   . LYS A 1 38  ? -14.789 38.032  -59.474 1.00 44.66  ? 599  LYS A HA   1 
ATOM   558   H HB2  . LYS A 1 38  ? -13.465 36.375  -58.429 1.00 46.19  ? 599  LYS A HB2  1 
ATOM   559   H HB3  . LYS A 1 38  ? -12.170 37.061  -59.037 1.00 46.19  ? 599  LYS A HB3  1 
ATOM   560   H HG2  . LYS A 1 38  ? -12.685 38.994  -57.746 1.00 50.33  ? 599  LYS A HG2  1 
ATOM   561   H HG3  . LYS A 1 38  ? -13.823 38.142  -57.031 1.00 50.33  ? 599  LYS A HG3  1 
ATOM   562   H HD2  . LYS A 1 38  ? -12.143 36.648  -56.277 1.00 46.54  ? 599  LYS A HD2  1 
ATOM   563   H HD3  . LYS A 1 38  ? -11.052 37.647  -56.866 1.00 46.54  ? 599  LYS A HD3  1 
ATOM   564   H HE2  . LYS A 1 38  ? -11.721 39.289  -55.371 1.00 49.09  ? 599  LYS A HE2  1 
ATOM   565   H HE3  . LYS A 1 38  ? -12.861 38.334  -54.810 1.00 49.09  ? 599  LYS A HE3  1 
ATOM   566   H HZ1  . LYS A 1 38  ? -11.061 38.323  -53.425 1.00 51.77  ? 599  LYS A HZ1  1 
ATOM   567   H HZ2  . LYS A 1 38  ? -11.225 36.992  -53.971 1.00 51.77  ? 599  LYS A HZ2  1 
ATOM   568   H HZ3  . LYS A 1 38  ? -10.186 37.862  -54.483 1.00 51.77  ? 599  LYS A HZ3  1 
ATOM   569   N N    . ARG A 1 39  ? -14.049 40.167  -60.401 1.00 41.24  ? 600  ARG A N    1 
ATOM   570   C CA   . ARG A 1 39  ? -13.568 41.471  -60.843 1.00 44.17  ? 600  ARG A CA   1 
ATOM   571   C C    . ARG A 1 39  ? -13.153 42.266  -59.611 1.00 46.04  ? 600  ARG A C    1 
ATOM   572   O O    . ARG A 1 39  ? -13.998 42.624  -58.784 1.00 44.13  ? 600  ARG A O    1 
ATOM   573   C CB   . ARG A 1 39  ? -14.644 42.211  -61.633 1.00 47.54  ? 600  ARG A CB   1 
ATOM   574   C CG   . ARG A 1 39  ? -14.143 43.481  -62.302 1.00 52.80  ? 600  ARG A CG   1 
ATOM   575   C CD   . ARG A 1 39  ? -15.253 44.201  -63.043 1.00 52.80  ? 600  ARG A CD   1 
ATOM   576   N NE   . ARG A 1 39  ? -16.192 44.848  -62.131 1.00 57.56  ? 600  ARG A NE   1 
ATOM   577   C CZ   . ARG A 1 39  ? -17.132 45.708  -62.511 1.00 64.65  ? 600  ARG A CZ   1 
ATOM   578   N NH1  . ARG A 1 39  ? -17.265 46.034  -63.791 1.00 72.96  ? 600  ARG A NH1  1 
ATOM   579   N NH2  . ARG A 1 39  ? -17.939 46.247  -61.609 1.00 59.69  ? 600  ARG A NH2  1 
ATOM   580   H H    . ARG A 1 39  ? -14.876 40.170  -60.165 1.00 49.48  ? 600  ARG A H    1 
ATOM   581   H HA   . ARG A 1 39  ? -12.791 41.355  -61.413 1.00 53.01  ? 600  ARG A HA   1 
ATOM   582   H HB2  . ARG A 1 39  ? -14.983 41.624  -62.327 1.00 57.05  ? 600  ARG A HB2  1 
ATOM   583   H HB3  . ARG A 1 39  ? -15.363 42.456  -61.030 1.00 57.05  ? 600  ARG A HB3  1 
ATOM   584   H HG2  . ARG A 1 39  ? -13.792 44.080  -61.625 1.00 63.36  ? 600  ARG A HG2  1 
ATOM   585   H HG3  . ARG A 1 39  ? -13.450 43.253  -62.941 1.00 63.36  ? 600  ARG A HG3  1 
ATOM   586   H HD2  . ARG A 1 39  ? -14.865 44.885  -63.612 1.00 63.37  ? 600  ARG A HD2  1 
ATOM   587   H HD3  . ARG A 1 39  ? -15.746 43.561  -63.579 1.00 63.37  ? 600  ARG A HD3  1 
ATOM   588   H HE   . ARG A 1 39  ? -16.132 44.662  -61.294 1.00 69.07  ? 600  ARG A HE   1 
ATOM   589   H HH11 . ARG A 1 39  ? -16.743 45.687  -64.380 1.00 87.55  ? 600  ARG A HH11 1 
ATOM   590   H HH12 . ARG A 1 39  ? -17.875 46.591  -64.032 1.00 87.55  ? 600  ARG A HH12 1 
ATOM   591   H HH21 . ARG A 1 39  ? -17.856 46.039  -60.779 1.00 71.63  ? 600  ARG A HH21 1 
ATOM   592   H HH22 . ARG A 1 39  ? -18.547 46.804  -61.855 1.00 71.63  ? 600  ARG A HH22 1 
ATOM   593   N N    . ILE A 1 40  ? -11.854 42.539  -59.488 1.00 46.23  ? 601  ILE A N    1 
ATOM   594   C CA   . ILE A 1 40  ? -11.332 43.285  -58.348 1.00 56.03  ? 601  ILE A CA   1 
ATOM   595   C C    . ILE A 1 40  ? -10.756 44.610  -58.829 1.00 60.82  ? 601  ILE A C    1 
ATOM   596   O O    . ILE A 1 40  ? -10.733 44.893  -60.032 1.00 55.57  ? 601  ILE A O    1 
ATOM   597   C CB   . ILE A 1 40  ? -10.266 42.471  -57.588 1.00 53.03  ? 601  ILE A CB   1 
ATOM   598   C CG1  . ILE A 1 40  ? -9.060  42.178  -58.490 1.00 57.41  ? 601  ILE A CG1  1 
ATOM   599   C CG2  . ILE A 1 40  ? -10.871 41.180  -57.070 1.00 46.91  ? 601  ILE A CG2  1 
ATOM   600   C CD1  . ILE A 1 40  ? -7.889  41.542  -57.770 1.00 50.64  ? 601  ILE A CD1  1 
ATOM   601   H H    . ILE A 1 40  ? -11.254 42.302  -60.056 1.00 55.48  ? 601  ILE A H    1 
ATOM   602   H HA   . ILE A 1 40  ? -12.058 43.477  -57.734 1.00 67.24  ? 601  ILE A HA   1 
ATOM   603   H HB   . ILE A 1 40  ? -9.962  42.994  -56.829 1.00 63.63  ? 601  ILE A HB   1 
ATOM   604   H HG12 . ILE A 1 40  ? -9.338  41.572  -59.195 1.00 68.89  ? 601  ILE A HG12 1 
ATOM   605   H HG13 . ILE A 1 40  ? -8.751  43.012  -58.878 1.00 68.89  ? 601  ILE A HG13 1 
ATOM   606   H HG21 . ILE A 1 40  ? -10.189 40.680  -56.595 1.00 56.29  ? 601  ILE A HG21 1 
ATOM   607   H HG22 . ILE A 1 40  ? -11.603 41.393  -56.470 1.00 56.29  ? 601  ILE A HG22 1 
ATOM   608   H HG23 . ILE A 1 40  ? -11.199 40.661  -57.822 1.00 56.29  ? 601  ILE A HG23 1 
ATOM   609   H HD11 . ILE A 1 40  ? -7.173  41.390  -58.406 1.00 60.76  ? 601  ILE A HD11 1 
ATOM   610   H HD12 . ILE A 1 40  ? -7.588  42.140  -57.069 1.00 60.76  ? 601  ILE A HD12 1 
ATOM   611   H HD13 . ILE A 1 40  ? -8.175  40.699  -57.386 1.00 60.76  ? 601  ILE A HD13 1 
ATOM   612   N N    . LEU A 1 41  ? -10.286 45.422  -57.887 1.00 61.14  ? 602  LEU A N    1 
ATOM   613   C CA   . LEU A 1 41  ? -9.566  46.653  -58.186 1.00 63.18  ? 602  LEU A CA   1 
ATOM   614   C C    . LEU A 1 41  ? -8.141  46.505  -57.674 1.00 64.91  ? 602  LEU A C    1 
ATOM   615   O O    . LEU A 1 41  ? -7.935  46.475  -56.450 1.00 64.40  ? 602  LEU A O    1 
ATOM   616   C CB   . LEU A 1 41  ? -10.249 47.858  -57.537 1.00 69.15  ? 602  LEU A CB   1 
ATOM   617   C CG   . LEU A 1 41  ? -11.606 48.268  -58.120 1.00 68.72  ? 602  LEU A CG   1 
ATOM   618   C CD1  . LEU A 1 41  ? -12.727 47.357  -57.635 1.00 66.59  ? 602  LEU A CD1  1 
ATOM   619   C CD2  . LEU A 1 41  ? -11.916 49.718  -57.780 1.00 72.19  ? 602  LEU A CD2  1 
ATOM   620   H H    . LEU A 1 41  ? -10.376 45.276  -57.044 1.00 73.36  ? 602  LEU A H    1 
ATOM   621   H HA   . LEU A 1 41  ? -9.539  46.791  -59.146 1.00 75.81  ? 602  LEU A HA   1 
ATOM   622   H HB2  . LEU A 1 41  ? -10.387 47.659  -56.598 1.00 82.98  ? 602  LEU A HB2  1 
ATOM   623   H HB3  . LEU A 1 41  ? -9.657  48.623  -57.619 1.00 82.98  ? 602  LEU A HB3  1 
ATOM   624   H HG   . LEU A 1 41  ? -11.564 48.194  -59.086 1.00 82.46  ? 602  LEU A HG   1 
ATOM   625   H HD11 . LEU A 1 41  ? -13.564 47.651  -58.027 1.00 79.90  ? 602  LEU A HD11 1 
ATOM   626   H HD12 . LEU A 1 41  ? -12.534 46.447  -57.910 1.00 79.90  ? 602  LEU A HD12 1 
ATOM   627   H HD13 . LEU A 1 41  ? -12.778 47.407  -56.668 1.00 79.90  ? 602  LEU A HD13 1 
ATOM   628   H HD21 . LEU A 1 41  ? -12.778 49.954  -58.159 1.00 86.63  ? 602  LEU A HD21 1 
ATOM   629   H HD22 . LEU A 1 41  ? -11.940 49.818  -56.816 1.00 86.63  ? 602  LEU A HD22 1 
ATOM   630   H HD23 . LEU A 1 41  ? -11.224 50.285  -58.155 1.00 86.63  ? 602  LEU A HD23 1 
ATOM   631   N N    . PRO A 1 42  ? -7.125  46.406  -58.547 1.00 69.33  ? 603  PRO A N    1 
ATOM   632   C CA   . PRO A 1 42  ? -5.763  46.121  -58.077 1.00 71.68  ? 603  PRO A CA   1 
ATOM   633   C C    . PRO A 1 42  ? -5.193  47.216  -57.179 1.00 73.24  ? 603  PRO A C    1 
ATOM   634   O O    . PRO A 1 42  ? -4.610  46.887  -56.145 1.00 64.72  ? 603  PRO A O    1 
ATOM   635   C CB   . PRO A 1 42  ? -4.959  46.012  -59.377 1.00 73.53  ? 603  PRO A CB   1 
ATOM   636   C CG   . PRO A 1 42  ? -5.725  46.812  -60.363 1.00 67.16  ? 603  PRO A CG   1 
ATOM   637   C CD   . PRO A 1 42  ? -7.165  46.624  -60.004 1.00 66.69  ? 603  PRO A CD   1 
ATOM   638   H HA   . PRO A 1 42  ? -5.736  45.272  -57.609 1.00 86.02  ? 603  PRO A HA   1 
ATOM   639   H HB2  . PRO A 1 42  ? -4.073  46.383  -59.247 1.00 88.24  ? 603  PRO A HB2  1 
ATOM   640   H HB3  . PRO A 1 42  ? -4.907  45.084  -59.654 1.00 88.24  ? 603  PRO A HB3  1 
ATOM   641   H HG2  . PRO A 1 42  ? -5.474  47.747  -60.289 1.00 80.60  ? 603  PRO A HG2  1 
ATOM   642   H HG3  . PRO A 1 42  ? -5.550  46.481  -61.258 1.00 80.60  ? 603  PRO A HG3  1 
ATOM   643   H HD2  . PRO A 1 42  ? -7.674  47.424  -60.212 1.00 80.03  ? 603  PRO A HD2  1 
ATOM   644   H HD3  . PRO A 1 42  ? -7.527  45.844  -60.453 1.00 80.03  ? 603  PRO A HD3  1 
ATOM   645   N N    . ASP A 1 49  ? -3.286  41.310  -56.112 1.00 71.65  ? 610  ASP A N    1 
ATOM   646   C CA   . ASP A 1 49  ? -2.044  40.625  -56.445 1.00 67.57  ? 610  ASP A CA   1 
ATOM   647   C C    . ASP A 1 49  ? -1.649  39.669  -55.328 1.00 62.49  ? 610  ASP A C    1 
ATOM   648   O O    . ASP A 1 49  ? -1.342  38.502  -55.577 1.00 58.03  ? 610  ASP A O    1 
ATOM   649   C CB   . ASP A 1 49  ? -0.924  41.636  -56.699 1.00 78.23  ? 610  ASP A CB   1 
ATOM   650   C CG   . ASP A 1 49  ? 0.358   40.981  -57.180 1.00 78.61  ? 610  ASP A CG   1 
ATOM   651   O OD1  . ASP A 1 49  ? 0.277   40.009  -57.961 1.00 92.33  ? 610  ASP A OD1  1 
ATOM   652   O OD2  . ASP A 1 49  ? 1.448   41.438  -56.776 1.00 70.44  ? 610  ASP A OD2  1 
ATOM   653   H HA   . ASP A 1 49  ? -2.173  40.107  -57.255 1.00 81.08  ? 610  ASP A HA   1 
ATOM   654   H HB2  . ASP A 1 49  ? -1.213  42.264  -57.379 1.00 93.88  ? 610  ASP A HB2  1 
ATOM   655   H HB3  . ASP A 1 49  ? -0.729  42.106  -55.873 1.00 93.88  ? 610  ASP A HB3  1 
ATOM   656   N N    . ARG A 1 50  ? -1.652  40.177  -54.092 1.00 65.85  ? 611  ARG A N    1 
ATOM   657   C CA   . ARG A 1 50  ? -1.372  39.326  -52.940 1.00 53.33  ? 611  ARG A CA   1 
ATOM   658   C C    . ARG A 1 50  ? -2.354  38.160  -52.877 1.00 45.25  ? 611  ARG A C    1 
ATOM   659   O O    . ARG A 1 50  ? -1.948  36.994  -52.820 1.00 46.51  ? 611  ARG A O    1 
ATOM   660   C CB   . ARG A 1 50  ? -1.421  40.153  -51.650 1.00 60.11  ? 611  ARG A CB   1 
ATOM   661   C CG   . ARG A 1 50  ? -2.837  40.489  -51.185 1.00 60.23  ? 611  ARG A CG   1 
ATOM   662   C CD   . ARG A 1 50  ? -2.905  41.528  -50.087 1.00 80.43  ? 611  ARG A CD   1 
ATOM   663   N NE   . ARG A 1 50  ? -4.299  41.808  -49.746 1.00 86.48  ? 611  ARG A NE   1 
ATOM   664   C CZ   . ARG A 1 50  ? -4.748  42.959  -49.256 1.00 86.12  ? 611  ARG A CZ   1 
ATOM   665   N NH1  . ARG A 1 50  ? -3.919  43.972  -49.038 1.00 83.78  ? 611  ARG A NH1  1 
ATOM   666   N NH2  . ARG A 1 50  ? -6.039  43.099  -48.985 1.00 74.72  ? 611  ARG A NH2  1 
ATOM   667   H H    . ARG A 1 50  ? -1.811  41.000  -53.899 1.00 79.02  ? 611  ARG A H    1 
ATOM   668   H HA   . ARG A 1 50  ? -0.478  38.960  -53.028 1.00 63.99  ? 611  ARG A HA   1 
ATOM   669   H HB2  . ARG A 1 50  ? -0.987  39.653  -50.941 1.00 72.13  ? 611  ARG A HB2  1 
ATOM   670   H HB3  . ARG A 1 50  ? -0.951  40.989  -51.797 1.00 72.13  ? 611  ARG A HB3  1 
ATOM   671   H HG2  . ARG A 1 50  ? -3.340  40.828  -51.942 1.00 72.28  ? 611  ARG A HG2  1 
ATOM   672   H HG3  . ARG A 1 50  ? -3.254  39.680  -50.851 1.00 72.28  ? 611  ARG A HG3  1 
ATOM   673   H HD2  . ARG A 1 50  ? -2.455  41.194  -49.295 1.00 96.52  ? 611  ARG A HD2  1 
ATOM   674   H HD3  . ARG A 1 50  ? -2.491  42.351  -50.392 1.00 96.52  ? 611  ARG A HD3  1 
ATOM   675   H HE   . ARG A 1 50  ? -4.872  41.179  -49.873 1.00 103.77 ? 611  ARG A HE   1 
ATOM   676   H HH11 . ARG A 1 50  ? -3.081  43.888  -49.212 1.00 100.53 ? 611  ARG A HH11 1 
ATOM   677   H HH12 . ARG A 1 50  ? -4.220  44.713  -48.721 1.00 100.53 ? 611  ARG A HH12 1 
ATOM   678   H HH21 . ARG A 1 50  ? -6.581  42.446  -49.125 1.00 89.67  ? 611  ARG A HH21 1 
ATOM   679   H HH22 . ARG A 1 50  ? -6.334  43.843  -48.668 1.00 89.67  ? 611  ARG A HH22 1 
ATOM   680   N N    . GLU A 1 51  ? -3.656  38.456  -52.923 1.00 46.76  ? 612  GLU A N    1 
ATOM   681   C CA   . GLU A 1 51  ? -4.666  37.423  -52.747 1.00 47.79  ? 612  GLU A CA   1 
ATOM   682   C C    . GLU A 1 51  ? -4.697  36.452  -53.913 1.00 45.33  ? 612  GLU A C    1 
ATOM   683   O O    . GLU A 1 51  ? -5.130  35.308  -53.743 1.00 37.54  ? 612  GLU A O    1 
ATOM   684   C CB   . GLU A 1 51  ? -6.043  38.063  -52.573 1.00 44.61  ? 612  GLU A CB   1 
ATOM   685   H H    . GLU A 1 51  ? -3.974  39.244  -53.055 1.00 56.11  ? 612  GLU A H    1 
ATOM   686   H HA   . GLU A 1 51  ? -4.466  36.919  -51.942 1.00 57.35  ? 612  GLU A HA   1 
ATOM   687   N N    . VAL A 1 52  ? -4.257  36.883  -55.093 1.00 46.64  ? 613  VAL A N    1 
ATOM   688   C CA   . VAL A 1 52  ? -4.235  35.991  -56.245 1.00 38.39  ? 613  VAL A CA   1 
ATOM   689   C C    . VAL A 1 52  ? -3.111  34.971  -56.101 1.00 38.35  ? 613  VAL A C    1 
ATOM   690   O O    . VAL A 1 52  ? -3.338  33.760  -56.206 1.00 43.20  ? 613  VAL A O    1 
ATOM   691   C CB   . VAL A 1 52  ? -4.102  36.811  -57.543 1.00 46.76  ? 613  VAL A CB   1 
ATOM   692   C CG1  . VAL A 1 52  ? -4.170  35.900  -58.759 1.00 40.39  ? 613  VAL A CG1  1 
ATOM   693   C CG2  . VAL A 1 52  ? -5.194  37.875  -57.609 1.00 47.69  ? 613  VAL A CG2  1 
ATOM   694   H H    . VAL A 1 52  ? -3.969  37.678  -55.250 1.00 55.97  ? 613  VAL A H    1 
ATOM   695   H HA   . VAL A 1 52  ? -5.074  35.506  -56.283 1.00 46.07  ? 613  VAL A HA   1 
ATOM   696   H HB   . VAL A 1 52  ? -3.242  37.261  -57.550 1.00 56.11  ? 613  VAL A HB   1 
ATOM   697   H HG11 . VAL A 1 52  ? -4.084  36.438  -59.561 1.00 48.47  ? 613  VAL A HG11 1 
ATOM   698   H HG12 . VAL A 1 52  ? -3.445  35.257  -58.712 1.00 48.47  ? 613  VAL A HG12 1 
ATOM   699   H HG13 . VAL A 1 52  ? -5.023  35.438  -58.759 1.00 48.47  ? 613  VAL A HG13 1 
ATOM   700   H HG21 . VAL A 1 52  ? -5.094  38.380  -58.431 1.00 57.23  ? 613  VAL A HG21 1 
ATOM   701   H HG22 . VAL A 1 52  ? -6.060  37.439  -57.591 1.00 57.23  ? 613  VAL A HG22 1 
ATOM   702   H HG23 . VAL A 1 52  ? -5.105  38.466  -56.844 1.00 57.23  ? 613  VAL A HG23 1 
ATOM   703   N N    . GLN A 1 53  ? -1.893  35.441  -55.826 1.00 36.39  ? 614  GLN A N    1 
ATOM   704   C CA   . GLN A 1 53  ? -0.753  34.535  -55.728 1.00 39.78  ? 614  GLN A CA   1 
ATOM   705   C C    . GLN A 1 53  ? -0.908  33.562  -54.567 1.00 39.77  ? 614  GLN A C    1 
ATOM   706   O O    . GLN A 1 53  ? -0.489  32.404  -54.671 1.00 42.08  ? 614  GLN A O    1 
ATOM   707   C CB   . GLN A 1 53  ? 0.539   35.335  -55.584 1.00 32.14  ? 614  GLN A CB   1 
ATOM   708   H H    . GLN A 1 53  ? -1.703  36.269  -55.693 1.00 43.67  ? 614  GLN A H    1 
ATOM   709   H HA   . GLN A 1 53  ? -0.694  34.016  -56.546 1.00 47.74  ? 614  GLN A HA   1 
ATOM   710   N N    . LEU A 1 54  ? -1.501  34.007  -53.458 1.00 40.18  ? 615  LEU A N    1 
ATOM   711   C CA   . LEU A 1 54  ? -1.817  33.087  -52.373 1.00 44.96  ? 615  LEU A CA   1 
ATOM   712   C C    . LEU A 1 54  ? -2.820  32.035  -52.827 1.00 35.32  ? 615  LEU A C    1 
ATOM   713   O O    . LEU A 1 54  ? -2.675  30.850  -52.507 1.00 40.90  ? 615  LEU A O    1 
ATOM   714   C CB   . LEU A 1 54  ? -2.357  33.860  -51.169 1.00 42.54  ? 615  LEU A CB   1 
ATOM   715   C CG   . LEU A 1 54  ? -1.395  34.809  -50.449 1.00 39.26  ? 615  LEU A CG   1 
ATOM   716   C CD1  . LEU A 1 54  ? -2.051  35.366  -49.196 1.00 41.39  ? 615  LEU A CD1  1 
ATOM   717   C CD2  . LEU A 1 54  ? -0.076  34.133  -50.105 1.00 41.59  ? 615  LEU A CD2  1 
ATOM   718   H H    . LEU A 1 54  ? -1.726  34.825  -53.314 1.00 48.21  ? 615  LEU A H    1 
ATOM   719   H HA   . LEU A 1 54  ? -1.006  32.631  -52.098 1.00 53.95  ? 615  LEU A HA   1 
ATOM   720   H HB2  . LEU A 1 54  ? -3.110  34.393  -51.468 1.00 51.05  ? 615  LEU A HB2  1 
ATOM   721   H HB3  . LEU A 1 54  ? -2.664  33.216  -50.512 1.00 51.05  ? 615  LEU A HB3  1 
ATOM   722   H HG   . LEU A 1 54  ? -1.199  35.556  -51.036 1.00 47.11  ? 615  LEU A HG   1 
ATOM   723   H HD11 . LEU A 1 54  ? -1.428  35.964  -48.754 1.00 49.67  ? 615  LEU A HD11 1 
ATOM   724   H HD12 . LEU A 1 54  ? -2.853  35.851  -49.449 1.00 49.67  ? 615  LEU A HD12 1 
ATOM   725   H HD13 . LEU A 1 54  ? -2.280  34.631  -48.607 1.00 49.67  ? 615  LEU A HD13 1 
ATOM   726   H HD21 . LEU A 1 54  ? 0.496   34.772  -49.653 1.00 49.90  ? 615  LEU A HD21 1 
ATOM   727   H HD22 . LEU A 1 54  ? -0.252  33.376  -49.525 1.00 49.90  ? 615  LEU A HD22 1 
ATOM   728   H HD23 . LEU A 1 54  ? 0.346   33.832  -50.925 1.00 49.90  ? 615  LEU A HD23 1 
ATOM   729   N N    . LEU A 1 55  ? -3.844  32.448  -53.576 1.00 36.22  ? 616  LEU A N    1 
ATOM   730   C CA   . LEU A 1 55  ? -4.796  31.487  -54.124 1.00 43.94  ? 616  LEU A CA   1 
ATOM   731   C C    . LEU A 1 55  ? -4.107  30.530  -55.088 1.00 41.12  ? 616  LEU A C    1 
ATOM   732   O O    . LEU A 1 55  ? -4.248  29.307  -54.973 1.00 41.54  ? 616  LEU A O    1 
ATOM   733   C CB   . LEU A 1 55  ? -5.941  32.222  -54.822 1.00 40.45  ? 616  LEU A CB   1 
ATOM   734   C CG   . LEU A 1 55  ? -6.824  31.356  -55.729 1.00 44.30  ? 616  LEU A CG   1 
ATOM   735   C CD1  . LEU A 1 55  ? -7.461  30.227  -54.937 1.00 40.38  ? 616  LEU A CD1  1 
ATOM   736   C CD2  . LEU A 1 55  ? -7.886  32.196  -56.420 1.00 44.90  ? 616  LEU A CD2  1 
ATOM   737   H H    . LEU A 1 55  ? -4.008  33.268  -53.777 1.00 43.46  ? 616  LEU A H    1 
ATOM   738   H HA   . LEU A 1 55  ? -5.172  30.965  -53.399 1.00 52.72  ? 616  LEU A HA   1 
ATOM   739   H HB2  . LEU A 1 55  ? -6.515  32.611  -54.144 1.00 48.54  ? 616  LEU A HB2  1 
ATOM   740   H HB3  . LEU A 1 55  ? -5.564  32.927  -55.371 1.00 48.54  ? 616  LEU A HB3  1 
ATOM   741   H HG   . LEU A 1 55  ? -6.268  30.958  -56.417 1.00 53.16  ? 616  LEU A HG   1 
ATOM   742   H HD11 . LEU A 1 55  ? -8.013  29.696  -55.533 1.00 48.45  ? 616  LEU A HD11 1 
ATOM   743   H HD12 . LEU A 1 55  ? -6.761  29.675  -54.555 1.00 48.45  ? 616  LEU A HD12 1 
ATOM   744   H HD13 . LEU A 1 55  ? -8.007  30.606  -54.230 1.00 48.45  ? 616  LEU A HD13 1 
ATOM   745   H HD21 . LEU A 1 55  ? -8.426  31.621  -56.984 1.00 53.88  ? 616  LEU A HD21 1 
ATOM   746   H HD22 . LEU A 1 55  ? -8.443  32.617  -55.746 1.00 53.88  ? 616  LEU A HD22 1 
ATOM   747   H HD23 . LEU A 1 55  ? -7.450  32.874  -56.959 1.00 53.88  ? 616  LEU A HD23 1 
ATOM   748   N N    . ARG A 1 56  ? -3.363  31.074  -56.055 1.00 38.49  ? 617  ARG A N    1 
ATOM   749   C CA   . ARG A 1 56  ? -2.655  30.237  -57.019 1.00 44.82  ? 617  ARG A CA   1 
ATOM   750   C C    . ARG A 1 56  ? -1.754  29.229  -56.323 1.00 41.74  ? 617  ARG A C    1 
ATOM   751   O O    . ARG A 1 56  ? -1.609  28.088  -56.778 1.00 43.39  ? 617  ARG A O    1 
ATOM   752   C CB   . ARG A 1 56  ? -1.827  31.111  -57.960 1.00 46.01  ? 617  ARG A CB   1 
ATOM   753   C CG   . ARG A 1 56  ? -2.647  32.038  -58.832 1.00 48.11  ? 617  ARG A CG   1 
ATOM   754   C CD   . ARG A 1 56  ? -1.770  32.906  -59.720 1.00 50.17  ? 617  ARG A CD   1 
ATOM   755   N NE   . ARG A 1 56  ? -0.895  32.106  -60.573 1.00 62.50  ? 617  ARG A NE   1 
ATOM   756   C CZ   . ARG A 1 56  ? -0.248  32.572  -61.637 1.00 61.69  ? 617  ARG A CZ   1 
ATOM   757   N NH1  . ARG A 1 56  ? -0.377  33.841  -62.000 1.00 57.56  ? 617  ARG A NH1  1 
ATOM   758   N NH2  . ARG A 1 56  ? 0.526   31.762  -62.346 1.00 69.31  ? 617  ARG A NH2  1 
ATOM   759   H H    . ARG A 1 56  ? -3.254  31.919  -56.172 1.00 46.18  ? 617  ARG A H    1 
ATOM   760   H HA   . ARG A 1 56  ? -3.302  29.747  -57.551 1.00 53.79  ? 617  ARG A HA   1 
ATOM   761   H HB2  . ARG A 1 56  ? -1.228  31.659  -57.430 1.00 55.21  ? 617  ARG A HB2  1 
ATOM   762   H HB3  . ARG A 1 56  ? -1.312  30.535  -58.546 1.00 55.21  ? 617  ARG A HB3  1 
ATOM   763   H HG2  . ARG A 1 56  ? -3.226  31.509  -59.403 1.00 57.73  ? 617  ARG A HG2  1 
ATOM   764   H HG3  . ARG A 1 56  ? -3.177  32.621  -58.266 1.00 57.73  ? 617  ARG A HG3  1 
ATOM   765   H HD2  . ARG A 1 56  ? -2.335  33.450  -60.292 1.00 60.21  ? 617  ARG A HD2  1 
ATOM   766   H HD3  . ARG A 1 56  ? -1.214  33.473  -59.163 1.00 60.21  ? 617  ARG A HD3  1 
ATOM   767   H HE   . ARG A 1 56  ? -0.791  31.276  -60.372 1.00 75.00  ? 617  ARG A HE   1 
ATOM   768   H HH11 . ARG A 1 56  ? -0.878  34.370  -61.543 1.00 69.07  ? 617  ARG A HH11 1 
ATOM   769   H HH12 . ARG A 1 56  ? 0.042   34.136  -62.690 1.00 69.07  ? 617  ARG A HH12 1 
ATOM   770   H HH21 . ARG A 1 56  ? 0.611   30.938  -62.116 1.00 83.17  ? 617  ARG A HH21 1 
ATOM   771   H HH22 . ARG A 1 56  ? 0.943   32.061  -63.036 1.00 83.17  ? 617  ARG A HH22 1 
ATOM   772   N N    . GLU A 1 57  ? -1.141  29.634  -55.211 1.00 41.02  ? 618  GLU A N    1 
ATOM   773   C CA   . GLU A 1 57  ? -0.177  28.775  -54.537 1.00 47.24  ? 618  GLU A CA   1 
ATOM   774   C C    . GLU A 1 57  ? -0.859  27.593  -53.856 1.00 39.52  ? 618  GLU A C    1 
ATOM   775   O O    . GLU A 1 57  ? -0.330  26.475  -53.869 1.00 39.86  ? 618  GLU A O    1 
ATOM   776   C CB   . GLU A 1 57  ? 0.624   29.604  -53.530 1.00 47.27  ? 618  GLU A CB   1 
ATOM   777   C CG   . GLU A 1 57  ? 1.540   28.796  -52.624 1.00 59.62  ? 618  GLU A CG   1 
ATOM   778   C CD   . GLU A 1 57  ? 2.480   29.666  -51.804 1.00 68.55  ? 618  GLU A CD   1 
ATOM   779   O OE1  . GLU A 1 57  ? 2.362   30.908  -51.869 1.00 77.08  ? 618  GLU A OE1  1 
ATOM   780   O OE2  . GLU A 1 57  ? 3.338   29.103  -51.093 1.00 62.07  ? 618  GLU A OE2  1 
ATOM   781   H H    . GLU A 1 57  ? -1.267  30.396  -54.831 1.00 49.22  ? 618  GLU A H    1 
ATOM   782   H HA   . GLU A 1 57  ? 0.444   28.422  -55.194 1.00 56.68  ? 618  GLU A HA   1 
ATOM   783   H HB2  . GLU A 1 57  ? 1.176   30.234  -54.019 1.00 56.73  ? 618  GLU A HB2  1 
ATOM   784   H HB3  . GLU A 1 57  ? 0.002   30.087  -52.963 1.00 56.73  ? 618  GLU A HB3  1 
ATOM   785   H HG2  . GLU A 1 57  ? 0.998   28.278  -52.008 1.00 71.54  ? 618  GLU A HG2  1 
ATOM   786   H HG3  . GLU A 1 57  ? 2.080   28.203  -53.169 1.00 71.54  ? 618  GLU A HG3  1 
ATOM   787   N N    . SER A 1 58  ? -2.024  27.817  -53.249 1.00 37.08  ? 619  SER A N    1 
ATOM   788   C CA   . SER A 1 58  ? -2.704  26.797  -52.460 1.00 40.85  ? 619  SER A CA   1 
ATOM   789   C C    . SER A 1 58  ? -3.803  26.047  -53.216 1.00 41.14  ? 619  SER A C    1 
ATOM   790   O O    . SER A 1 58  ? -4.445  25.173  -52.625 1.00 39.30  ? 619  SER A O    1 
ATOM   791   C CB   . SER A 1 58  ? -3.293  27.434  -51.195 1.00 45.67  ? 619  SER A CB   1 
ATOM   792   O OG   . SER A 1 58  ? -4.272  28.404  -51.513 1.00 44.74  ? 619  SER A OG   1 
ATOM   793   H H    . SER A 1 58  ? -2.446  28.566  -53.281 1.00 44.50  ? 619  SER A H    1 
ATOM   794   H HA   . SER A 1 58  ? -2.048  26.141  -52.178 1.00 49.02  ? 619  SER A HA   1 
ATOM   795   H HB2  . SER A 1 58  ? -3.702  26.739  -50.656 1.00 54.80  ? 619  SER A HB2  1 
ATOM   796   H HB3  . SER A 1 58  ? -2.578  27.860  -50.697 1.00 54.80  ? 619  SER A HB3  1 
ATOM   797   H HG   . SER A 1 58  ? -4.582  28.741  -50.808 1.00 53.69  ? 619  SER A HG   1 
ATOM   798   N N    . ASP A 1 59  ? -4.038  26.343  -54.498 1.00 39.87  ? 620  ASP A N    1 
ATOM   799   C CA   . ASP A 1 59  ? -5.220  25.805  -55.169 1.00 29.06  ? 620  ASP A CA   1 
ATOM   800   C C    . ASP A 1 59  ? -5.102  24.325  -55.522 1.00 36.75  ? 620  ASP A C    1 
ATOM   801   O O    . ASP A 1 59  ? -6.100  23.727  -55.940 1.00 34.76  ? 620  ASP A O    1 
ATOM   802   C CB   . ASP A 1 59  ? -5.527  26.595  -56.447 1.00 38.97  ? 620  ASP A CB   1 
ATOM   803   C CG   . ASP A 1 59  ? -4.719  26.120  -57.640 1.00 40.32  ? 620  ASP A CG   1 
ATOM   804   O OD1  . ASP A 1 59  ? -3.542  25.738  -57.465 1.00 42.85  ? 620  ASP A OD1  1 
ATOM   805   O OD2  . ASP A 1 59  ? -5.266  26.132  -58.761 1.00 44.82  ? 620  ASP A OD2  1 
ATOM   806   H H    . ASP A 1 59  ? -3.540  26.843  -54.990 1.00 47.84  ? 620  ASP A H    1 
ATOM   807   H HA   . ASP A 1 59  ? -5.981  25.903  -54.575 1.00 34.87  ? 620  ASP A HA   1 
ATOM   808   H HB2  . ASP A 1 59  ? -6.467  26.495  -56.663 1.00 46.76  ? 620  ASP A HB2  1 
ATOM   809   H HB3  . ASP A 1 59  ? -5.319  27.531  -56.297 1.00 46.76  ? 620  ASP A HB3  1 
ATOM   810   N N    . GLU A 1 60  ? -3.923  23.718  -55.376 1.00 32.72  ? 621  GLU A N    1 
ATOM   811   C CA   . GLU A 1 60  ? -3.747  22.316  -55.737 1.00 31.52  ? 621  GLU A CA   1 
ATOM   812   C C    . GLU A 1 60  ? -4.489  21.358  -54.811 1.00 34.35  ? 621  GLU A C    1 
ATOM   813   O O    . GLU A 1 60  ? -4.611  20.176  -55.149 1.00 40.49  ? 621  GLU A O    1 
ATOM   814   C CB   . GLU A 1 60  ? -2.259  21.966  -55.743 1.00 35.25  ? 621  GLU A CB   1 
ATOM   815   H H    . GLU A 1 60  ? -3.213  24.097  -55.071 1.00 39.27  ? 621  GLU A H    1 
ATOM   816   H HA   . GLU A 1 60  ? -4.086  22.180  -56.636 1.00 37.83  ? 621  GLU A HA   1 
ATOM   817   N N    . HIS A 1 61  ? -4.979  21.826  -53.666 1.00 30.96  ? 622  HIS A N    1 
ATOM   818   C CA   . HIS A 1 61  ? -5.703  20.975  -52.733 1.00 27.31  ? 622  HIS A CA   1 
ATOM   819   C C    . HIS A 1 61  ? -7.150  20.781  -53.194 1.00 25.32  ? 622  HIS A C    1 
ATOM   820   O O    . HIS A 1 61  ? -7.764  21.707  -53.732 1.00 24.09  ? 622  HIS A O    1 
ATOM   821   C CB   . HIS A 1 61  ? -5.681  21.595  -51.340 1.00 29.20  ? 622  HIS A CB   1 
ATOM   822   C CG   . HIS A 1 61  ? -6.103  20.658  -50.252 1.00 25.98  ? 622  HIS A CG   1 
ATOM   823   N ND1  . HIS A 1 61  ? -7.412  20.534  -49.841 1.00 24.59  ? 622  HIS A ND1  1 
ATOM   824   C CD2  . HIS A 1 61  ? -5.387  19.804  -49.485 1.00 20.87  ? 622  HIS A CD2  1 
ATOM   825   C CE1  . HIS A 1 61  ? -7.485  19.641  -48.871 1.00 18.42  ? 622  HIS A CE1  1 
ATOM   826   N NE2  . HIS A 1 61  ? -6.270  19.183  -48.636 1.00 19.87  ? 622  HIS A NE2  1 
ATOM   827   H H    . HIS A 1 61  ? -4.904  22.642  -53.406 1.00 37.16  ? 622  HIS A H    1 
ATOM   828   H HA   . HIS A 1 61  ? -5.275  20.106  -52.690 1.00 32.77  ? 622  HIS A HA   1 
ATOM   829   H HB2  . HIS A 1 61  ? -4.778  21.889  -51.144 1.00 35.04  ? 622  HIS A HB2  1 
ATOM   830   H HB3  . HIS A 1 61  ? -6.284  22.355  -51.327 1.00 35.04  ? 622  HIS A HB3  1 
ATOM   831   H HD2  . HIS A 1 61  ? -4.469  19.662  -49.526 1.00 25.04  ? 622  HIS A HD2  1 
ATOM   832   H HE1  . HIS A 1 61  ? -8.261  19.380  -48.429 1.00 22.10  ? 622  HIS A HE1  1 
ATOM   833   H HE2  . HIS A 1 61  ? -6.064  18.592  -48.046 1.00 23.84  ? 622  HIS A HE2  1 
ATOM   834   N N    . PRO A 1 62  ? -7.719  19.583  -53.004 1.00 23.33  ? 623  PRO A N    1 
ATOM   835   C CA   . PRO A 1 62  ? -9.100  19.357  -53.473 1.00 24.30  ? 623  PRO A CA   1 
ATOM   836   C C    . PRO A 1 62  ? -10.111 20.311  -52.862 1.00 24.47  ? 623  PRO A C    1 
ATOM   837   O O    . PRO A 1 62  ? -11.107 20.653  -53.511 1.00 29.67  ? 623  PRO A O    1 
ATOM   838   C CB   . PRO A 1 62  ? -9.381  17.905  -53.053 1.00 18.60  ? 623  PRO A CB   1 
ATOM   839   C CG   . PRO A 1 62  ? -8.042  17.280  -52.862 1.00 22.68  ? 623  PRO A CG   1 
ATOM   840   C CD   . PRO A 1 62  ? -7.138  18.373  -52.394 1.00 24.49  ? 623  PRO A CD   1 
ATOM   841   H HA   . PRO A 1 62  ? -9.141  19.423  -54.440 1.00 29.17  ? 623  PRO A HA   1 
ATOM   842   H HB2  . PRO A 1 62  ? -9.884  17.897  -52.224 1.00 22.32  ? 623  PRO A HB2  1 
ATOM   843   H HB3  . PRO A 1 62  ? -9.873  17.452  -53.756 1.00 22.32  ? 623  PRO A HB3  1 
ATOM   844   H HG2  . PRO A 1 62  ? -8.103  16.579  -52.194 1.00 27.22  ? 623  PRO A HG2  1 
ATOM   845   H HG3  . PRO A 1 62  ? -7.729  16.919  -53.707 1.00 27.22  ? 623  PRO A HG3  1 
ATOM   846   H HD2  . PRO A 1 62  ? -7.160  18.438  -51.426 1.00 29.39  ? 623  PRO A HD2  1 
ATOM   847   H HD3  . PRO A 1 62  ? -6.236  18.229  -52.720 1.00 29.39  ? 623  PRO A HD3  1 
ATOM   848   N N    . ASN A 1 63  ? -9.883  20.740  -51.626 1.00 23.86  ? 624  ASN A N    1 
ATOM   849   C CA   . ASN A 1 63  ? -10.808 21.566  -50.864 1.00 30.32  ? 624  ASN A CA   1 
ATOM   850   C C    . ASN A 1 63  ? -10.494 23.057  -50.953 1.00 29.21  ? 624  ASN A C    1 
ATOM   851   O O    . ASN A 1 63  ? -11.084 23.846  -50.211 1.00 26.33  ? 624  ASN A O    1 
ATOM   852   C CB   . ASN A 1 63  ? -10.827 21.099  -49.409 1.00 27.49  ? 624  ASN A CB   1 
ATOM   853   C CG   . ASN A 1 63  ? -11.184 19.629  -49.284 1.00 24.54  ? 624  ASN A CG   1 
ATOM   854   O OD1  . ASN A 1 63  ? -10.458 18.849  -48.671 1.00 30.72  ? 624  ASN A OD1  1 
ATOM   855   N ND2  . ASN A 1 63  ? -12.305 19.241  -49.882 1.00 21.97  ? 624  ASN A ND2  1 
ATOM   856   H H    . ASN A 1 63  ? -9.165  20.555  -51.190 1.00 28.63  ? 624  ASN A H    1 
ATOM   857   H HA   . ASN A 1 63  ? -11.699 21.436  -51.223 1.00 36.38  ? 624  ASN A HA   1 
ATOM   858   H HB2  . ASN A 1 63  ? -9.948  21.230  -49.022 1.00 32.99  ? 624  ASN A HB2  1 
ATOM   859   H HB3  . ASN A 1 63  ? -11.488 21.613  -48.920 1.00 32.99  ? 624  ASN A HB3  1 
ATOM   860   H HD21 . ASN A 1 63  ? -12.552 18.419  -49.842 1.00 26.36  ? 624  ASN A HD21 1 
ATOM   861   H HD22 . ASN A 1 63  ? -12.783 19.813  -50.311 1.00 26.36  ? 624  ASN A HD22 1 
ATOM   862   N N    . VAL A 1 64  ? -9.527  23.452  -51.780 1.00 31.67  ? 625  VAL A N    1 
ATOM   863   C CA   . VAL A 1 64  ? -9.265  24.855  -52.087 1.00 31.60  ? 625  VAL A CA   1 
ATOM   864   C C    . VAL A 1 64  ? -9.764  25.136  -53.497 1.00 29.53  ? 625  VAL A C    1 
ATOM   865   O O    . VAL A 1 64  ? -9.632  24.294  -54.394 1.00 31.46  ? 625  VAL A O    1 
ATOM   866   C CB   . VAL A 1 64  ? -7.767  25.196  -51.950 1.00 29.50  ? 625  VAL A CB   1 
ATOM   867   C CG1  . VAL A 1 64  ? -7.489  26.616  -52.433 1.00 26.81  ? 625  VAL A CG1  1 
ATOM   868   C CG2  . VAL A 1 64  ? -7.329  25.038  -50.504 1.00 29.71  ? 625  VAL A CG2  1 
ATOM   869   H H    . VAL A 1 64  ? -8.997  22.909  -52.186 1.00 38.01  ? 625  VAL A H    1 
ATOM   870   H HA   . VAL A 1 64  ? -9.761  25.416  -51.471 1.00 37.93  ? 625  VAL A HA   1 
ATOM   871   H HB   . VAL A 1 64  ? -7.248  24.583  -52.493 1.00 35.40  ? 625  VAL A HB   1 
ATOM   872   H HG11 . VAL A 1 64  ? -6.542  26.802  -52.335 1.00 32.18  ? 625  VAL A HG11 1 
ATOM   873   H HG12 . VAL A 1 64  ? -7.746  26.687  -53.366 1.00 32.18  ? 625  VAL A HG12 1 
ATOM   874   H HG13 . VAL A 1 64  ? -8.006  27.238  -51.898 1.00 32.18  ? 625  VAL A HG13 1 
ATOM   875   H HG21 . VAL A 1 64  ? -6.386  25.256  -50.434 1.00 35.65  ? 625  VAL A HG21 1 
ATOM   876   H HG22 . VAL A 1 64  ? -7.850  25.639  -49.949 1.00 35.65  ? 625  VAL A HG22 1 
ATOM   877   H HG23 . VAL A 1 64  ? -7.478  24.120  -50.228 1.00 35.65  ? 625  VAL A HG23 1 
ATOM   878   N N    . ILE A 1 65  ? -10.342 26.326  -53.690 1.00 31.86  ? 626  ILE A N    1 
ATOM   879   C CA   . ILE A 1 65  ? -10.916 26.681  -54.983 1.00 33.46  ? 626  ILE A CA   1 
ATOM   880   C C    . ILE A 1 65  ? -9.826  26.676  -56.048 1.00 27.47  ? 626  ILE A C    1 
ATOM   881   O O    . ILE A 1 65  ? -8.699  27.136  -55.821 1.00 27.78  ? 626  ILE A O    1 
ATOM   882   C CB   . ILE A 1 65  ? -11.621 28.049  -54.890 1.00 32.33  ? 626  ILE A CB   1 
ATOM   883   C CG1  . ILE A 1 65  ? -12.927 28.040  -55.676 1.00 32.92  ? 626  ILE A CG1  1 
ATOM   884   C CG2  . ILE A 1 65  ? -10.721 29.196  -55.332 1.00 39.36  ? 626  ILE A CG2  1 
ATOM   885   C CD1  . ILE A 1 65  ? -14.046 27.373  -54.932 1.00 54.68  ? 626  ILE A CD1  1 
ATOM   886   H H    . ILE A 1 65  ? -10.412 26.938  -53.090 1.00 38.23  ? 626  ILE A H    1 
ATOM   887   H HA   . ILE A 1 65  ? -11.580 26.017  -55.228 1.00 40.15  ? 626  ILE A HA   1 
ATOM   888   H HB   . ILE A 1 65  ? -11.844 28.198  -53.958 1.00 38.79  ? 626  ILE A HB   1 
ATOM   889   H HG12 . ILE A 1 65  ? -13.192 28.955  -55.859 1.00 39.50  ? 626  ILE A HG12 1 
ATOM   890   H HG13 . ILE A 1 65  ? -12.793 27.561  -56.508 1.00 39.50  ? 626  ILE A HG13 1 
ATOM   891   H HG21 . ILE A 1 65  ? -11.211 30.029  -55.254 1.00 47.23  ? 626  ILE A HG21 1 
ATOM   892   H HG22 . ILE A 1 65  ? -9.936  29.218  -54.762 1.00 47.23  ? 626  ILE A HG22 1 
ATOM   893   H HG23 . ILE A 1 65  ? -10.456 29.052  -56.254 1.00 47.23  ? 626  ILE A HG23 1 
ATOM   894   H HD11 . ILE A 1 65  ? -14.847 27.398  -55.479 1.00 65.61  ? 626  ILE A HD11 1 
ATOM   895   H HD12 . ILE A 1 65  ? -13.799 26.453  -54.749 1.00 65.61  ? 626  ILE A HD12 1 
ATOM   896   H HD13 . ILE A 1 65  ? -14.198 27.847  -54.100 1.00 65.61  ? 626  ILE A HD13 1 
ATOM   897   N N    . ARG A 1 66  ? -10.161 26.147  -57.222 1.00 27.23  ? 627  ARG A N    1 
ATOM   898   C CA   . ARG A 1 66  ? -9.202  26.050  -58.313 1.00 31.40  ? 627  ARG A CA   1 
ATOM   899   C C    . ARG A 1 66  ? -9.130  27.361  -59.088 1.00 27.43  ? 627  ARG A C    1 
ATOM   900   O O    . ARG A 1 66  ? -10.151 27.996  -59.367 1.00 21.56  ? 627  ARG A O    1 
ATOM   901   C CB   . ARG A 1 66  ? -9.581  24.904  -59.252 1.00 29.19  ? 627  ARG A CB   1 
ATOM   902   C CG   . ARG A 1 66  ? -8.632  24.715  -60.421 1.00 40.16  ? 627  ARG A CG   1 
ATOM   903   C CD   . ARG A 1 66  ? -8.929  23.422  -61.164 1.00 45.65  ? 627  ARG A CD   1 
ATOM   904   N NE   . ARG A 1 66  ? -8.127  23.286  -62.376 1.00 56.47  ? 627  ARG A NE   1 
ATOM   905   C CZ   . ARG A 1 66  ? -8.123  22.209  -63.156 1.00 65.83  ? 627  ARG A CZ   1 
ATOM   906   N NH1  . ARG A 1 66  ? -8.878  21.161  -62.853 1.00 63.33  ? 627  ARG A NH1  1 
ATOM   907   N NH2  . ARG A 1 66  ? -7.361  22.179  -64.240 1.00 60.40  ? 627  ARG A NH2  1 
ATOM   908   H H    . ARG A 1 66  ? -10.940 25.836  -57.410 1.00 32.68  ? 627  ARG A H    1 
ATOM   909   H HA   . ARG A 1 66  ? -8.322  25.864  -57.949 1.00 37.67  ? 627  ARG A HA   1 
ATOM   910   H HB2  . ARG A 1 66  ? -9.592  24.077  -58.744 1.00 35.03  ? 627  ARG A HB2  1 
ATOM   911   H HB3  . ARG A 1 66  ? -10.464 25.078  -59.614 1.00 35.03  ? 627  ARG A HB3  1 
ATOM   912   H HG2  . ARG A 1 66  ? -8.735  25.454  -61.041 1.00 48.19  ? 627  ARG A HG2  1 
ATOM   913   H HG3  . ARG A 1 66  ? -7.720  24.675  -60.092 1.00 48.19  ? 627  ARG A HG3  1 
ATOM   914   H HD2  . ARG A 1 66  ? -8.730  22.670  -60.584 1.00 54.78  ? 627  ARG A HD2  1 
ATOM   915   H HD3  . ARG A 1 66  ? -9.865  23.410  -61.418 1.00 54.78  ? 627  ARG A HD3  1 
ATOM   916   H HE   . ARG A 1 66  ? -7.623  23.946  -62.600 1.00 67.76  ? 627  ARG A HE   1 
ATOM   917   H HH11 . ARG A 1 66  ? -9.375  21.176  -62.151 1.00 75.99  ? 627  ARG A HH11 1 
ATOM   918   H HH12 . ARG A 1 66  ? -8.873  20.466  -63.360 1.00 75.99  ? 627  ARG A HH12 1 
ATOM   919   H HH21 . ARG A 1 66  ? -6.869  22.856  -64.439 1.00 72.48  ? 627  ARG A HH21 1 
ATOM   920   H HH22 . ARG A 1 66  ? -7.357  21.482  -64.744 1.00 72.48  ? 627  ARG A HH22 1 
ATOM   921   N N    . TYR A 1 67  ? -7.909  27.762  -59.430 1.00 29.05  ? 628  TYR A N    1 
ATOM   922   C CA   . TYR A 1 67  ? -7.648  28.995  -60.160 1.00 32.78  ? 628  TYR A CA   1 
ATOM   923   C C    . TYR A 1 67  ? -7.299  28.679  -61.610 1.00 31.43  ? 628  TYR A C    1 
ATOM   924   O O    . TYR A 1 67  ? -6.559  27.731  -61.888 1.00 32.86  ? 628  TYR A O    1 
ATOM   925   C CB   . TYR A 1 67  ? -6.511  29.773  -59.494 1.00 30.94  ? 628  TYR A CB   1 
ATOM   926   C CG   . TYR A 1 67  ? -5.823  30.770  -60.397 1.00 36.62  ? 628  TYR A CG   1 
ATOM   927   C CD1  . TYR A 1 67  ? -6.260  32.085  -60.472 1.00 36.53  ? 628  TYR A CD1  1 
ATOM   928   C CD2  . TYR A 1 67  ? -4.731  30.397  -61.169 1.00 36.36  ? 628  TYR A CD2  1 
ATOM   929   C CE1  . TYR A 1 67  ? -5.629  32.999  -61.295 1.00 36.82  ? 628  TYR A CE1  1 
ATOM   930   C CE2  . TYR A 1 67  ? -4.094  31.303  -61.991 1.00 46.40  ? 628  TYR A CE2  1 
ATOM   931   C CZ   . TYR A 1 67  ? -4.544  32.602  -62.053 1.00 39.55  ? 628  TYR A CZ   1 
ATOM   932   O OH   . TYR A 1 67  ? -3.895  33.491  -62.880 1.00 33.67  ? 628  TYR A OH   1 
ATOM   933   H H    . TYR A 1 67  ? -7.195  27.320  -59.244 1.00 34.86  ? 628  TYR A H    1 
ATOM   934   H HA   . TYR A 1 67  ? -8.444  29.549  -60.150 1.00 39.34  ? 628  TYR A HA   1 
ATOM   935   H HB2  . TYR A 1 67  ? -6.870  30.260  -58.737 1.00 37.12  ? 628  TYR A HB2  1 
ATOM   936   H HB3  . TYR A 1 67  ? -5.841  29.142  -59.189 1.00 37.12  ? 628  TYR A HB3  1 
ATOM   937   H HD1  . TYR A 1 67  ? -6.989  32.355  -59.963 1.00 43.84  ? 628  TYR A HD1  1 
ATOM   938   H HD2  . TYR A 1 67  ? -4.422  29.521  -61.130 1.00 43.63  ? 628  TYR A HD2  1 
ATOM   939   H HE1  . TYR A 1 67  ? -5.933  33.878  -61.337 1.00 44.18  ? 628  TYR A HE1  1 
ATOM   940   H HE2  . TYR A 1 67  ? -3.364  31.036  -62.502 1.00 55.68  ? 628  TYR A HE2  1 
ATOM   941   H HH   . TYR A 1 67  ? -4.260  34.246  -62.833 1.00 40.41  ? 628  TYR A HH   1 
ATOM   942   N N    . PHE A 1 68  ? -7.835  29.483  -62.530 1.00 28.79  ? 629  PHE A N    1 
ATOM   943   C CA   . PHE A 1 68  ? -7.662  29.259  -63.963 1.00 34.68  ? 629  PHE A CA   1 
ATOM   944   C C    . PHE A 1 68  ? -6.803  30.344  -64.601 1.00 31.65  ? 629  PHE A C    1 
ATOM   945   O O    . PHE A 1 68  ? -5.703  30.053  -65.078 1.00 32.70  ? 629  PHE A O    1 
ATOM   946   C CB   . PHE A 1 68  ? -9.027  29.169  -64.650 1.00 32.85  ? 629  PHE A CB   1 
ATOM   947   C CG   . PHE A 1 68  ? -9.835  27.973  -64.237 1.00 35.43  ? 629  PHE A CG   1 
ATOM   948   C CD1  . PHE A 1 68  ? -9.424  26.694  -64.573 1.00 38.39  ? 629  PHE A CD1  1 
ATOM   949   C CD2  . PHE A 1 68  ? -11.009 28.127  -63.521 1.00 36.25  ? 629  PHE A CD2  1 
ATOM   950   C CE1  . PHE A 1 68  ? -10.167 25.593  -64.195 1.00 32.94  ? 629  PHE A CE1  1 
ATOM   951   C CE2  . PHE A 1 68  ? -11.755 27.028  -63.142 1.00 34.03  ? 629  PHE A CE2  1 
ATOM   952   C CZ   . PHE A 1 68  ? -11.333 25.761  -63.479 1.00 31.49  ? 629  PHE A CZ   1 
ATOM   953   H H    . PHE A 1 68  ? -8.310  30.175  -62.344 1.00 34.55  ? 629  PHE A H    1 
ATOM   954   H HA   . PHE A 1 68  ? -7.210  28.411  -64.093 1.00 41.61  ? 629  PHE A HA   1 
ATOM   955   H HB2  . PHE A 1 68  ? -9.539  29.963  -64.432 1.00 39.42  ? 629  PHE A HB2  1 
ATOM   956   H HB3  . PHE A 1 68  ? -8.891  29.118  -65.609 1.00 39.42  ? 629  PHE A HB3  1 
ATOM   957   H HD1  . PHE A 1 68  ? -8.637  26.575  -65.055 1.00 46.07  ? 629  PHE A HD1  1 
ATOM   958   H HD2  . PHE A 1 68  ? -11.298 28.981  -63.290 1.00 43.49  ? 629  PHE A HD2  1 
ATOM   959   H HE1  . PHE A 1 68  ? -9.881  24.738  -64.424 1.00 39.53  ? 629  PHE A HE1  1 
ATOM   960   H HE2  . PHE A 1 68  ? -12.541 27.144  -62.659 1.00 40.84  ? 629  PHE A HE2  1 
ATOM   961   H HZ   . PHE A 1 68  ? -11.835 25.020  -63.225 1.00 37.78  ? 629  PHE A HZ   1 
ATOM   962   N N    . CYS A 1 69  ? -7.277  31.588  -64.643 1.00 27.72  ? 630  CYS A N    1 
ATOM   963   C CA   . CYS A 1 69  ? -6.595  32.628  -65.397 1.00 31.73  ? 630  CYS A CA   1 
ATOM   964   C C    . CYS A 1 69  ? -6.889  33.987  -64.780 1.00 32.08  ? 630  CYS A C    1 
ATOM   965   O O    . CYS A 1 69  ? -7.903  34.174  -64.101 1.00 27.86  ? 630  CYS A O    1 
ATOM   966   C CB   . CYS A 1 69  ? -7.029  32.606  -66.870 1.00 23.59  ? 630  CYS A CB   1 
ATOM   967   S SG   . CYS A 1 69  ? -5.905  33.440  -67.999 1.00 39.57  ? 630  CYS A SG   1 
ATOM   968   H H    . CYS A 1 69  ? -7.991  31.852  -64.244 1.00 33.26  ? 630  CYS A H    1 
ATOM   969   H HA   . CYS A 1 69  ? -5.638  32.476  -65.359 1.00 38.08  ? 630  CYS A HA   1 
ATOM   970   H HB2  . CYS A 1 69  ? -7.101  31.682  -67.157 1.00 28.30  ? 630  CYS A HB2  1 
ATOM   971   H HB3  . CYS A 1 69  ? -7.894  33.039  -66.943 1.00 28.30  ? 630  CYS A HB3  1 
ATOM   972   H HG   . CYS A 1 69  ? -5.812  34.593  -67.677 1.00 47.48  ? 630  CYS A HG   1 
ATOM   973   N N    . THR A 1 70  ? -5.977  34.928  -65.012 1.00 34.87  ? 631  THR A N    1 
ATOM   974   C CA   . THR A 1 70  ? -6.198  36.339  -64.729 1.00 41.06  ? 631  THR A CA   1 
ATOM   975   C C    . THR A 1 70  ? -6.152  37.129  -66.027 1.00 42.62  ? 631  THR A C    1 
ATOM   976   O O    . THR A 1 70  ? -5.284  36.900  -66.877 1.00 40.22  ? 631  THR A O    1 
ATOM   977   C CB   . THR A 1 70  ? -5.155  36.913  -63.764 1.00 41.27  ? 631  THR A CB   1 
ATOM   978   O OG1  . THR A 1 70  ? -3.856  36.413  -64.102 1.00 57.85  ? 631  THR A OG1  1 
ATOM   979   C CG2  . THR A 1 70  ? -5.488  36.550  -62.334 1.00 41.64  ? 631  THR A CG2  1 
ATOM   980   H H    . THR A 1 70  ? -5.200  34.766  -65.344 1.00 41.85  ? 631  THR A H    1 
ATOM   981   H HA   . THR A 1 70  ? -7.076  36.453  -64.332 1.00 49.28  ? 631  THR A HA   1 
ATOM   982   H HB   . THR A 1 70  ? -5.152  37.880  -63.838 1.00 49.53  ? 631  THR A HB   1 
ATOM   983   H HG1  . THR A 1 70  ? -3.282  36.726  -63.575 1.00 69.42  ? 631  THR A HG1  1 
ATOM   984   H HG21 . THR A 1 70  ? -4.820  36.920  -61.735 1.00 49.97  ? 631  THR A HG21 1 
ATOM   985   H HG22 . THR A 1 70  ? -6.357  36.907  -62.096 1.00 49.97  ? 631  THR A HG22 1 
ATOM   986   H HG23 . THR A 1 70  ? -5.504  35.586  -62.232 1.00 49.97  ? 631  THR A HG23 1 
ATOM   987   N N    . GLU A 1 71  ? -7.090  38.060  -66.169 1.00 41.02  ? 632  GLU A N    1 
ATOM   988   C CA   . GLU A 1 71  ? -7.132  38.987  -67.288 1.00 47.16  ? 632  GLU A CA   1 
ATOM   989   C C    . GLU A 1 71  ? -7.253  40.396  -66.730 1.00 48.03  ? 632  GLU A C    1 
ATOM   990   O O    . GLU A 1 71  ? -7.691  40.597  -65.595 1.00 42.35  ? 632  GLU A O    1 
ATOM   991   C CB   . GLU A 1 71  ? -8.302  38.685  -68.230 1.00 42.79  ? 632  GLU A CB   1 
ATOM   992   C CG   . GLU A 1 71  ? -7.975  38.886  -69.697 1.00 57.73  ? 632  GLU A CG   1 
ATOM   993   C CD   . GLU A 1 71  ? -7.334  37.659  -70.312 1.00 47.48  ? 632  GLU A CD   1 
ATOM   994   O OE1  . GLU A 1 71  ? -8.017  36.617  -70.409 1.00 47.71  ? 632  GLU A OE1  1 
ATOM   995   O OE2  . GLU A 1 71  ? -6.149  37.734  -70.694 1.00 49.73  ? 632  GLU A OE2  1 
ATOM   996   H H    . GLU A 1 71  ? -7.733  38.175  -65.610 1.00 49.23  ? 632  GLU A H    1 
ATOM   997   H HA   . GLU A 1 71  ? -6.306  38.924  -67.792 1.00 56.59  ? 632  GLU A HA   1 
ATOM   998   H HB2  . GLU A 1 71  ? -8.570  37.761  -68.110 1.00 51.35  ? 632  GLU A HB2  1 
ATOM   999   H HB3  . GLU A 1 71  ? -9.041  39.273  -68.009 1.00 51.35  ? 632  GLU A HB3  1 
ATOM   1000  H HG2  . GLU A 1 71  ? -8.793  39.075  -70.182 1.00 69.28  ? 632  GLU A HG2  1 
ATOM   1001  H HG3  . GLU A 1 71  ? -7.355  39.627  -69.786 1.00 69.28  ? 632  GLU A HG3  1 
ATOM   1002  N N    . LYS A 1 72  ? -6.853  41.377  -67.533 1.00 47.74  ? 633  LYS A N    1 
ATOM   1003  C CA   . LYS A 1 72  ? -6.866  42.762  -67.090 1.00 50.29  ? 633  LYS A CA   1 
ATOM   1004  C C    . LYS A 1 72  ? -7.264  43.683  -68.232 1.00 47.71  ? 633  LYS A C    1 
ATOM   1005  O O    . LYS A 1 72  ? -6.873  43.475  -69.384 1.00 44.86  ? 633  LYS A O    1 
ATOM   1006  C CB   . LYS A 1 72  ? -5.498  43.185  -66.533 1.00 51.25  ? 633  LYS A CB   1 
ATOM   1007  C CG   . LYS A 1 72  ? -4.343  43.065  -67.522 1.00 53.20  ? 633  LYS A CG   1 
ATOM   1008  C CD   . LYS A 1 72  ? -3.020  43.508  -66.904 1.00 61.69  ? 633  LYS A CD   1 
ATOM   1009  C CE   . LYS A 1 72  ? -2.583  42.586  -65.772 1.00 69.97  ? 633  LYS A CE   1 
ATOM   1010  N NZ   . LYS A 1 72  ? -1.273  42.989  -65.192 1.00 83.79  ? 633  LYS A NZ   1 
ATOM   1011  H H    . LYS A 1 72  ? -6.571  41.265  -68.338 1.00 57.29  ? 633  LYS A H    1 
ATOM   1012  H HA   . LYS A 1 72  ? -7.521  42.861  -66.382 1.00 60.35  ? 633  LYS A HA   1 
ATOM   1013  H HB2  . LYS A 1 72  ? -5.550  44.113  -66.255 1.00 61.50  ? 633  LYS A HB2  1 
ATOM   1014  H HB3  . LYS A 1 72  ? -5.288  42.626  -65.769 1.00 61.50  ? 633  LYS A HB3  1 
ATOM   1015  H HG2  . LYS A 1 72  ? -4.254  42.139  -67.798 1.00 63.84  ? 633  LYS A HG2  1 
ATOM   1016  H HG3  . LYS A 1 72  ? -4.522  43.628  -68.292 1.00 63.84  ? 633  LYS A HG3  1 
ATOM   1017  H HD2  . LYS A 1 72  ? -2.331  43.498  -67.586 1.00 74.02  ? 633  LYS A HD2  1 
ATOM   1018  H HD3  . LYS A 1 72  ? -3.121  44.403  -66.543 1.00 74.02  ? 633  LYS A HD3  1 
ATOM   1019  H HE2  . LYS A 1 72  ? -3.247  42.614  -65.066 1.00 83.96  ? 633  LYS A HE2  1 
ATOM   1020  H HE3  . LYS A 1 72  ? -2.497  41.683  -66.114 1.00 83.96  ? 633  LYS A HE3  1 
ATOM   1021  H HZ1  . LYS A 1 72  ? -1.048  42.432  -64.536 1.00 100.55 ? 633  LYS A HZ1  1 
ATOM   1022  H HZ2  . LYS A 1 72  ? -0.643  42.966  -65.820 1.00 100.55 ? 633  LYS A HZ2  1 
ATOM   1023  H HZ3  . LYS A 1 72  ? -1.327  43.815  -64.865 1.00 100.55 ? 633  LYS A HZ3  1 
ATOM   1024  N N    . ASP A 1 73  ? -8.052  44.692  -67.892 1.00 51.39  ? 634  ASP A N    1 
ATOM   1025  C CA   . ASP A 1 73  ? -8.325  45.842  -68.737 1.00 56.14  ? 634  ASP A CA   1 
ATOM   1026  C C    . ASP A 1 73  ? -7.958  47.084  -67.929 1.00 59.98  ? 634  ASP A C    1 
ATOM   1027  O O    . ASP A 1 73  ? -7.366  46.985  -66.848 1.00 58.36  ? 634  ASP A O    1 
ATOM   1028  C CB   . ASP A 1 73  ? -9.779  45.844  -69.232 1.00 51.85  ? 634  ASP A CB   1 
ATOM   1029  C CG   . ASP A 1 73  ? -10.805 46.085  -68.123 1.00 45.39  ? 634  ASP A CG   1 
ATOM   1030  O OD1  . ASP A 1 73  ? -10.446 46.521  -67.010 1.00 51.76  ? 634  ASP A OD1  1 
ATOM   1031  O OD2  . ASP A 1 73  ? -12.001 45.841  -68.385 1.00 57.36  ? 634  ASP A OD2  1 
ATOM   1032  H H    . ASP A 1 73  ? -8.459  44.733  -67.136 1.00 61.67  ? 634  ASP A H    1 
ATOM   1033  H HA   . ASP A 1 73  ? -7.746  45.808  -69.514 1.00 67.37  ? 634  ASP A HA   1 
ATOM   1034  H HB2  . ASP A 1 73  ? -9.885  46.548  -69.891 1.00 62.22  ? 634  ASP A HB2  1 
ATOM   1035  H HB3  . ASP A 1 73  ? -9.974  44.984  -69.635 1.00 62.22  ? 634  ASP A HB3  1 
ATOM   1036  N N    . ARG A 1 74  ? -8.293  48.256  -68.472 1.00 70.50  ? 635  ARG A N    1 
ATOM   1037  C CA   . ARG A 1 74  ? -7.862  49.517  -67.877 1.00 67.90  ? 635  ARG A CA   1 
ATOM   1038  C C    . ARG A 1 74  ? -8.090  49.533  -66.367 1.00 71.86  ? 635  ARG A C    1 
ATOM   1039  O O    . ARG A 1 74  ? -7.134  49.567  -65.582 1.00 81.59  ? 635  ARG A O    1 
ATOM   1040  C CB   . ARG A 1 74  ? -8.593  50.676  -68.561 1.00 77.34  ? 635  ARG A CB   1 
ATOM   1041  C CG   . ARG A 1 74  ? -7.772  51.367  -69.651 1.00 84.89  ? 635  ARG A CG   1 
ATOM   1042  C CD   . ARG A 1 74  ? -8.558  51.525  -70.938 1.00 99.95  ? 635  ARG A CD   1 
ATOM   1043  N NE   . ARG A 1 74  ? -9.942  51.911  -70.686 1.00 104.93 ? 635  ARG A NE   1 
ATOM   1044  C CZ   . ARG A 1 74  ? -10.972 51.565  -71.448 1.00 88.58  ? 635  ARG A CZ   1 
ATOM   1045  N NH1  . ARG A 1 74  ? -10.784 50.818  -72.528 1.00 82.98  ? 635  ARG A NH1  1 
ATOM   1046  N NH2  . ARG A 1 74  ? -12.191 51.969  -71.121 1.00 80.51  ? 635  ARG A NH2  1 
ATOM   1047  H H    . ARG A 1 74  ? -8.768  48.345  -69.184 1.00 84.60  ? 635  ARG A H    1 
ATOM   1048  H HA   . ARG A 1 74  ? -6.912  49.630  -68.036 1.00 81.47  ? 635  ARG A HA   1 
ATOM   1049  H HB2  . ARG A 1 74  ? -9.404  50.336  -68.970 1.00 92.81  ? 635  ARG A HB2  1 
ATOM   1050  H HB3  . ARG A 1 74  ? -8.817  51.341  -67.892 1.00 92.81  ? 635  ARG A HB3  1 
ATOM   1051  H HG2  . ARG A 1 74  ? -7.514  52.250  -69.344 1.00 101.87 ? 635  ARG A HG2  1 
ATOM   1052  H HG3  . ARG A 1 74  ? -6.983  50.836  -69.841 1.00 101.87 ? 635  ARG A HG3  1 
ATOM   1053  H HD2  . ARG A 1 74  ? -8.145  52.214  -71.481 1.00 119.94 ? 635  ARG A HD2  1 
ATOM   1054  H HD3  . ARG A 1 74  ? -8.561  50.680  -71.415 1.00 119.94 ? 635  ARG A HD3  1 
ATOM   1055  H HE   . ARG A 1 74  ? -10.102 52.397  -69.995 1.00 125.92 ? 635  ARG A HE   1 
ATOM   1056  H HH11 . ARG A 1 74  ? -9.992  50.555  -72.737 1.00 99.57  ? 635  ARG A HH11 1 
ATOM   1057  H HH12 . ARG A 1 74  ? -11.454 50.596  -73.020 1.00 99.57  ? 635  ARG A HH12 1 
ATOM   1058  H HH21 . ARG A 1 74  ? -12.310 52.454  -70.421 1.00 96.61  ? 635  ARG A HH21 1 
ATOM   1059  H HH22 . ARG A 1 74  ? -12.863 51.750  -71.611 1.00 96.61  ? 635  ARG A HH22 1 
ATOM   1060  N N    . GLN A 1 75  ? -9.354  49.498  -65.938 1.00 64.47  ? 636  GLN A N    1 
ATOM   1061  C CA   . GLN A 1 75  ? -9.643  49.666  -64.517 1.00 69.14  ? 636  GLN A CA   1 
ATOM   1062  C C    . GLN A 1 75  ? -9.438  48.382  -63.711 1.00 70.42  ? 636  GLN A C    1 
ATOM   1063  O O    . GLN A 1 75  ? -8.886  48.431  -62.605 1.00 70.60  ? 636  GLN A O    1 
ATOM   1064  C CB   . GLN A 1 75  ? -11.071 50.177  -64.321 1.00 72.50  ? 636  GLN A CB   1 
ATOM   1065  C CG   . GLN A 1 75  ? -11.158 51.301  -63.294 1.00 80.78  ? 636  GLN A CG   1 
ATOM   1066  C CD   . GLN A 1 75  ? -12.582 51.688  -62.945 1.00 78.55  ? 636  GLN A CD   1 
ATOM   1067  O OE1  . GLN A 1 75  ? -13.495 51.547  -63.758 1.00 77.55  ? 636  GLN A OE1  1 
ATOM   1068  N NE2  . GLN A 1 75  ? -12.779 52.177  -61.724 1.00 80.34  ? 636  GLN A NE2  1 
ATOM   1069  H H    . GLN A 1 75  ? -10.044 49.380  -66.437 1.00 77.37  ? 636  GLN A H    1 
ATOM   1070  H HA   . GLN A 1 75  ? -9.041  50.335  -64.157 1.00 82.97  ? 636  GLN A HA   1 
ATOM   1071  H HB2  . GLN A 1 75  ? -11.403 50.517  -65.167 1.00 87.01  ? 636  GLN A HB2  1 
ATOM   1072  H HB3  . GLN A 1 75  ? -11.629 49.446  -64.014 1.00 87.01  ? 636  GLN A HB3  1 
ATOM   1073  H HG2  . GLN A 1 75  ? -10.718 51.015  -62.478 1.00 96.93  ? 636  GLN A HG2  1 
ATOM   1074  H HG3  . GLN A 1 75  ? -10.715 52.087  -63.650 1.00 96.93  ? 636  GLN A HG3  1 
ATOM   1075  H HE21 . GLN A 1 75  ? -12.116 52.259  -61.182 1.00 96.41  ? 636  GLN A HE21 1 
ATOM   1076  H HE22 . GLN A 1 75  ? -13.568 52.412  -61.477 1.00 96.41  ? 636  GLN A HE22 1 
ATOM   1077  N N    . PHE A 1 76  ? -9.857  47.229  -64.236 1.00 71.63  ? 637  PHE A N    1 
ATOM   1078  C CA   . PHE A 1 76  ? -10.062 46.039  -63.419 1.00 67.23  ? 637  PHE A CA   1 
ATOM   1079  C C    . PHE A 1 76  ? -9.123  44.902  -63.803 1.00 57.90  ? 637  PHE A C    1 
ATOM   1080  O O    . PHE A 1 76  ? -8.620  44.822  -64.928 1.00 58.62  ? 637  PHE A O    1 
ATOM   1081  C CB   . PHE A 1 76  ? -11.502 45.523  -63.533 1.00 66.24  ? 637  PHE A CB   1 
ATOM   1082  C CG   . PHE A 1 76  ? -12.543 46.524  -63.135 1.00 65.11  ? 637  PHE A CG   1 
ATOM   1083  C CD1  . PHE A 1 76  ? -12.777 46.809  -61.801 1.00 62.81  ? 637  PHE A CD1  1 
ATOM   1084  C CD2  . PHE A 1 76  ? -13.303 47.165  -64.097 1.00 64.67  ? 637  PHE A CD2  1 
ATOM   1085  C CE1  . PHE A 1 76  ? -13.741 47.725  -61.435 1.00 67.62  ? 637  PHE A CE1  1 
ATOM   1086  C CE2  . PHE A 1 76  ? -14.268 48.080  -63.738 1.00 62.15  ? 637  PHE A CE2  1 
ATOM   1087  C CZ   . PHE A 1 76  ? -14.488 48.361  -62.405 1.00 68.77  ? 637  PHE A CZ   1 
ATOM   1088  H H    . PHE A 1 76  ? -10.030 47.112  -65.070 1.00 85.95  ? 637  PHE A H    1 
ATOM   1089  H HA   . PHE A 1 76  ? -9.896  46.263  -62.490 1.00 80.67  ? 637  PHE A HA   1 
ATOM   1090  H HB2  . PHE A 1 76  ? -11.671 45.272  -64.454 1.00 79.49  ? 637  PHE A HB2  1 
ATOM   1091  H HB3  . PHE A 1 76  ? -11.602 44.749  -62.958 1.00 79.49  ? 637  PHE A HB3  1 
ATOM   1092  H HD1  . PHE A 1 76  ? -12.275 46.383  -61.145 1.00 75.37  ? 637  PHE A HD1  1 
ATOM   1093  H HD2  . PHE A 1 76  ? -13.158 46.979  -64.997 1.00 77.60  ? 637  PHE A HD2  1 
ATOM   1094  H HE1  . PHE A 1 76  ? -13.888 47.913  -60.536 1.00 81.15  ? 637  PHE A HE1  1 
ATOM   1095  H HE2  . PHE A 1 76  ? -14.770 48.508  -64.393 1.00 74.58  ? 637  PHE A HE2  1 
ATOM   1096  H HZ   . PHE A 1 76  ? -15.139 48.979  -62.161 1.00 82.53  ? 637  PHE A HZ   1 
ATOM   1097  N N    . GLN A 1 77  ? -8.898  44.025  -62.827 1.00 52.35  ? 638  GLN A N    1 
ATOM   1098  C CA   . GLN A 1 77  ? -8.353  42.693  -63.043 1.00 47.04  ? 638  GLN A CA   1 
ATOM   1099  C C    . GLN A 1 77  ? -9.476  41.672  -62.909 1.00 38.32  ? 638  GLN A C    1 
ATOM   1100  O O    . GLN A 1 77  ? -10.325 41.783  -62.019 1.00 43.03  ? 638  GLN A O    1 
ATOM   1101  C CB   . GLN A 1 77  ? -7.245  42.379  -62.036 1.00 49.47  ? 638  GLN A CB   1 
ATOM   1102  C CG   . GLN A 1 77  ? -5.849  42.285  -62.638 1.00 57.59  ? 638  GLN A CG   1 
ATOM   1103  C CD   . GLN A 1 77  ? -4.758  42.264  -61.581 1.00 67.92  ? 638  GLN A CD   1 
ATOM   1104  O OE1  . GLN A 1 77  ? -3.945  43.184  -61.496 1.00 88.06  ? 638  GLN A OE1  1 
ATOM   1105  N NE2  . GLN A 1 77  ? -4.732  41.209  -60.773 1.00 65.66  ? 638  GLN A NE2  1 
ATOM   1106  H H    . GLN A 1 77  ? -9.061  44.190  -61.999 1.00 62.82  ? 638  GLN A H    1 
ATOM   1107  H HA   . GLN A 1 77  ? -7.985  42.633  -63.939 1.00 56.45  ? 638  GLN A HA   1 
ATOM   1108  H HB2  . GLN A 1 77  ? -7.229  43.080  -61.365 1.00 59.36  ? 638  GLN A HB2  1 
ATOM   1109  H HB3  . GLN A 1 77  ? -7.441  41.528  -61.615 1.00 59.36  ? 638  GLN A HB3  1 
ATOM   1110  H HG2  . GLN A 1 77  ? -5.782  41.468  -63.155 1.00 69.11  ? 638  GLN A HG2  1 
ATOM   1111  H HG3  . GLN A 1 77  ? -5.699  43.054  -63.210 1.00 69.11  ? 638  GLN A HG3  1 
ATOM   1112  H HE21 . GLN A 1 77  ? -5.315  40.583  -60.865 1.00 78.79  ? 638  GLN A HE21 1 
ATOM   1113  H HE22 . GLN A 1 77  ? -4.133  41.152  -60.159 1.00 78.79  ? 638  GLN A HE22 1 
ATOM   1114  N N    . TYR A 1 78  ? -9.477  40.680  -63.795 1.00 41.57  ? 639  TYR A N    1 
ATOM   1115  C CA   . TYR A 1 78  ? -10.511 39.652  -63.846 1.00 41.54  ? 639  TYR A CA   1 
ATOM   1116  C C    . TYR A 1 78  ? -9.866  38.305  -63.558 1.00 36.40  ? 639  TYR A C    1 
ATOM   1117  O O    . TYR A 1 78  ? -8.934  37.901  -64.260 1.00 34.54  ? 639  TYR A O    1 
ATOM   1118  C CB   . TYR A 1 78  ? -11.206 39.638  -65.210 1.00 36.63  ? 639  TYR A CB   1 
ATOM   1119  C CG   . TYR A 1 78  ? -11.920 40.931  -65.546 1.00 34.62  ? 639  TYR A CG   1 
ATOM   1120  C CD1  . TYR A 1 78  ? -11.225 42.017  -66.062 1.00 41.27  ? 639  TYR A CD1  1 
ATOM   1121  C CD2  . TYR A 1 78  ? -13.288 41.065  -65.350 1.00 34.53  ? 639  TYR A CD2  1 
ATOM   1122  C CE1  . TYR A 1 78  ? -11.870 43.200  -66.371 1.00 42.36  ? 639  TYR A CE1  1 
ATOM   1123  C CE2  . TYR A 1 78  ? -13.943 42.244  -65.656 1.00 41.28  ? 639  TYR A CE2  1 
ATOM   1124  C CZ   . TYR A 1 78  ? -13.230 43.309  -66.166 1.00 43.48  ? 639  TYR A CZ   1 
ATOM   1125  O OH   . TYR A 1 78  ? -13.880 44.484  -66.472 1.00 37.56  ? 639  TYR A OH   1 
ATOM   1126  H H    . TYR A 1 78  ? -8.869  40.579  -64.396 1.00 49.88  ? 639  TYR A H    1 
ATOM   1127  H HA   . TYR A 1 78  ? -11.177 39.828  -63.163 1.00 49.85  ? 639  TYR A HA   1 
ATOM   1128  H HB2  . TYR A 1 78  ? -10.541 39.478  -65.898 1.00 43.96  ? 639  TYR A HB2  1 
ATOM   1129  H HB3  . TYR A 1 78  ? -11.865 38.925  -65.217 1.00 43.96  ? 639  TYR A HB3  1 
ATOM   1130  H HD1  . TYR A 1 78  ? -10.308 41.948  -66.201 1.00 49.52  ? 639  TYR A HD1  1 
ATOM   1131  H HD2  . TYR A 1 78  ? -13.772 40.349  -65.006 1.00 41.44  ? 639  TYR A HD2  1 
ATOM   1132  H HE1  . TYR A 1 78  ? -11.390 43.918  -66.715 1.00 50.83  ? 639  TYR A HE1  1 
ATOM   1133  H HE2  . TYR A 1 78  ? -14.860 42.318  -65.519 1.00 49.53  ? 639  TYR A HE2  1 
ATOM   1134  H HH   . TYR A 1 78  ? -13.332 45.046  -66.772 1.00 45.08  ? 639  TYR A HH   1 
ATOM   1135  N N    . ILE A 1 79  ? -10.366 37.614  -62.538 1.00 33.85  ? 640  ILE A N    1 
ATOM   1136  C CA   . ILE A 1 79  ? -9.775  36.371  -62.047 1.00 37.64  ? 640  ILE A CA   1 
ATOM   1137  C C    . ILE A 1 79  ? -10.772 35.249  -62.305 1.00 36.76  ? 640  ILE A C    1 
ATOM   1138  O O    . ILE A 1 79  ? -11.844 35.204  -61.688 1.00 33.06  ? 640  ILE A O    1 
ATOM   1139  C CB   . ILE A 1 79  ? -9.421  36.460  -60.555 1.00 40.44  ? 640  ILE A CB   1 
ATOM   1140  C CG1  . ILE A 1 79  ? -8.570  37.704  -60.274 1.00 43.55  ? 640  ILE A CG1  1 
ATOM   1141  C CG2  . ILE A 1 79  ? -8.675  35.209  -60.112 1.00 38.30  ? 640  ILE A CG2  1 
ATOM   1142  C CD1  . ILE A 1 79  ? -8.620  38.162  -58.841 1.00 43.18  ? 640  ILE A CD1  1 
ATOM   1143  H H    . ILE A 1 79  ? -11.068 37.852  -62.101 1.00 40.62  ? 640  ILE A H    1 
ATOM   1144  H HA   . ILE A 1 79  ? -8.964  36.182  -62.543 1.00 45.17  ? 640  ILE A HA   1 
ATOM   1145  H HB   . ILE A 1 79  ? -10.244 36.527  -60.045 1.00 48.53  ? 640  ILE A HB   1 
ATOM   1146  H HG12 . ILE A 1 79  ? -7.645  37.505  -60.490 1.00 52.26  ? 640  ILE A HG12 1 
ATOM   1147  H HG13 . ILE A 1 79  ? -8.888  38.433  -60.830 1.00 52.26  ? 640  ILE A HG13 1 
ATOM   1148  H HG21 . ILE A 1 79  ? -8.462  35.286  -59.169 1.00 45.96  ? 640  ILE A HG21 1 
ATOM   1149  H HG22 . ILE A 1 79  ? -9.241  34.435  -60.261 1.00 45.96  ? 640  ILE A HG22 1 
ATOM   1150  H HG23 . ILE A 1 79  ? -7.859  35.128  -60.630 1.00 45.96  ? 640  ILE A HG23 1 
ATOM   1151  H HD11 . ILE A 1 79  ? -8.060  38.948  -58.741 1.00 51.82  ? 640  ILE A HD11 1 
ATOM   1152  H HD12 . ILE A 1 79  ? -9.537  38.377  -58.610 1.00 51.82  ? 640  ILE A HD12 1 
ATOM   1153  H HD13 . ILE A 1 79  ? -8.293  37.449  -58.270 1.00 51.82  ? 640  ILE A HD13 1 
ATOM   1154  N N    . ALA A 1 80  ? -10.417 34.334  -63.206 1.00 30.70  ? 641  ALA A N    1 
ATOM   1155  C CA   . ALA A 1 80  ? -11.253 33.182  -63.516 1.00 31.20  ? 641  ALA A CA   1 
ATOM   1156  C C    . ALA A 1 80  ? -10.954 32.076  -62.513 1.00 28.08  ? 641  ALA A C    1 
ATOM   1157  O O    . ALA A 1 80  ? -9.799  31.665  -62.361 1.00 27.04  ? 641  ALA A O    1 
ATOM   1158  C CB   . ALA A 1 80  ? -11.012 32.701  -64.947 1.00 30.23  ? 641  ALA A CB   1 
ATOM   1159  H H    . ALA A 1 80  ? -9.684  34.362  -63.656 1.00 36.84  ? 641  ALA A H    1 
ATOM   1160  H HA   . ALA A 1 80  ? -12.187 33.430  -63.430 1.00 37.44  ? 641  ALA A HA   1 
ATOM   1161  H HB1  . ALA A 1 80  ? -11.582 31.936  -65.122 1.00 36.28  ? 641  ALA A HB1  1 
ATOM   1162  H HB2  . ALA A 1 80  ? -11.226 33.421  -65.562 1.00 36.28  ? 641  ALA A HB2  1 
ATOM   1163  H HB3  . ALA A 1 80  ? -10.080 32.449  -65.042 1.00 36.28  ? 641  ALA A HB3  1 
ATOM   1164  N N    . ILE A 1 81  ? -11.995 31.597  -61.833 1.00 25.17  ? 642  ILE A N    1 
ATOM   1165  C CA   . ILE A 1 81  ? -11.868 30.606  -60.772 1.00 29.72  ? 642  ILE A CA   1 
ATOM   1166  C C    . ILE A 1 81  ? -13.017 29.614  -60.901 1.00 31.43  ? 642  ILE A C    1 
ATOM   1167  O O    . ILE A 1 81  ? -13.984 29.836  -61.634 1.00 27.15  ? 642  ILE A O    1 
ATOM   1168  C CB   . ILE A 1 81  ? -11.858 31.256  -59.371 1.00 23.07  ? 642  ILE A CB   1 
ATOM   1169  C CG1  . ILE A 1 81  ? -12.999 32.273  -59.251 1.00 32.42  ? 642  ILE A CG1  1 
ATOM   1170  C CG2  . ILE A 1 81  ? -10.504 31.903  -59.117 1.00 32.83  ? 642  ILE A CG2  1 
ATOM   1171  C CD1  . ILE A 1 81  ? -12.987 33.114  -57.985 1.00 45.17  ? 642  ILE A CD1  1 
ATOM   1172  H H    . ILE A 1 81  ? -12.808 31.841  -61.975 1.00 30.20  ? 642  ILE A H    1 
ATOM   1173  H HA   . ILE A 1 81  ? -11.036 30.122  -60.887 1.00 35.67  ? 642  ILE A HA   1 
ATOM   1174  H HB   . ILE A 1 81  ? -11.995 30.561  -58.708 1.00 27.69  ? 642  ILE A HB   1 
ATOM   1175  H HG12 . ILE A 1 81  ? -12.950 32.881  -60.006 1.00 38.91  ? 642  ILE A HG12 1 
ATOM   1176  H HG13 . ILE A 1 81  ? -13.842 31.794  -59.275 1.00 38.91  ? 642  ILE A HG13 1 
ATOM   1177  H HG21 . ILE A 1 81  ? -10.508 32.308  -58.236 1.00 39.40  ? 642  ILE A HG21 1 
ATOM   1178  H HG22 . ILE A 1 81  ? -9.815  31.222  -59.166 1.00 39.40  ? 642  ILE A HG22 1 
ATOM   1179  H HG23 . ILE A 1 81  ? -10.347 32.582  -59.792 1.00 39.40  ? 642  ILE A HG23 1 
ATOM   1180  H HD11 . ILE A 1 81  ? -13.743 33.723  -58.003 1.00 54.21  ? 642  ILE A HD11 1 
ATOM   1181  H HD12 . ILE A 1 81  ? -13.053 32.527  -57.216 1.00 54.21  ? 642  ILE A HD12 1 
ATOM   1182  H HD13 . ILE A 1 81  ? -12.158 33.617  -57.948 1.00 54.21  ? 642  ILE A HD13 1 
ATOM   1183  N N    . GLU A 1 82  ? -12.891 28.499  -60.183 1.00 27.18  ? 643  GLU A N    1 
ATOM   1184  C CA   . GLU A 1 82  ? -13.862 27.419  -60.290 1.00 26.09  ? 643  GLU A CA   1 
ATOM   1185  C C    . GLU A 1 82  ? -15.248 27.890  -59.868 1.00 23.99  ? 643  GLU A C    1 
ATOM   1186  O O    . GLU A 1 82  ? -15.414 28.524  -58.823 1.00 27.34  ? 643  GLU A O    1 
ATOM   1187  C CB   . GLU A 1 82  ? -13.423 26.234  -59.432 1.00 33.94  ? 643  GLU A CB   1 
ATOM   1188  C CG   . GLU A 1 82  ? -14.354 25.035  -59.515 1.00 38.83  ? 643  GLU A CG   1 
ATOM   1189  C CD   . GLU A 1 82  ? -13.839 23.842  -58.736 1.00 40.65  ? 643  GLU A CD   1 
ATOM   1190  O OE1  . GLU A 1 82  ? -12.705 23.911  -58.217 1.00 34.57  ? 643  GLU A OE1  1 
ATOM   1191  O OE2  . GLU A 1 82  ? -14.574 22.836  -58.634 1.00 53.06  ? 643  GLU A OE2  1 
ATOM   1192  H H    . GLU A 1 82  ? -12.252 28.347  -59.627 1.00 32.61  ? 643  GLU A H    1 
ATOM   1193  H HA   . GLU A 1 82  ? -13.910 27.124  -61.213 1.00 31.31  ? 643  GLU A HA   1 
ATOM   1194  H HB2  . GLU A 1 82  ? -12.543 25.946  -59.724 1.00 40.73  ? 643  GLU A HB2  1 
ATOM   1195  H HB3  . GLU A 1 82  ? -13.385 26.516  -58.505 1.00 40.73  ? 643  GLU A HB3  1 
ATOM   1196  H HG2  . GLU A 1 82  ? -15.219 25.280  -59.152 1.00 46.59  ? 643  GLU A HG2  1 
ATOM   1197  H HG3  . GLU A 1 82  ? -14.447 24.770  -60.444 1.00 46.59  ? 643  GLU A HG3  1 
ATOM   1198  N N    . LEU A 1 83  ? -16.241 27.584  -60.698 1.00 26.32  ? 644  LEU A N    1 
ATOM   1199  C CA   . LEU A 1 83  ? -17.630 27.868  -60.372 1.00 29.69  ? 644  LEU A CA   1 
ATOM   1200  C C    . LEU A 1 83  ? -18.174 26.789  -59.448 1.00 29.03  ? 644  LEU A C    1 
ATOM   1201  O O    . LEU A 1 83  ? -17.949 25.596  -59.670 1.00 29.82  ? 644  LEU A O    1 
ATOM   1202  C CB   . LEU A 1 83  ? -18.476 27.933  -61.644 1.00 27.23  ? 644  LEU A CB   1 
ATOM   1203  C CG   . LEU A 1 83  ? -19.985 28.119  -61.457 1.00 32.88  ? 644  LEU A CG   1 
ATOM   1204  C CD1  . LEU A 1 83  ? -20.286 29.470  -60.836 1.00 32.18  ? 644  LEU A CD1  1 
ATOM   1205  C CD2  . LEU A 1 83  ? -20.707 27.959  -62.785 1.00 36.86  ? 644  LEU A CD2  1 
ATOM   1206  H H    . LEU A 1 83  ? -16.133 27.208  -61.464 1.00 31.58  ? 644  LEU A H    1 
ATOM   1207  H HA   . LEU A 1 83  ? -17.689 28.723  -59.917 1.00 35.62  ? 644  LEU A HA   1 
ATOM   1208  H HB2  . LEU A 1 83  ? -18.160 28.677  -62.180 1.00 32.68  ? 644  LEU A HB2  1 
ATOM   1209  H HB3  . LEU A 1 83  ? -18.348 27.107  -62.136 1.00 32.68  ? 644  LEU A HB3  1 
ATOM   1210  H HG   . LEU A 1 83  ? -20.313 27.433  -60.854 1.00 39.46  ? 644  LEU A HG   1 
ATOM   1211  H HD11 . LEU A 1 83  ? -21.246 29.561  -60.729 1.00 38.62  ? 644  LEU A HD11 1 
ATOM   1212  H HD12 . LEU A 1 83  ? -19.850 29.524  -59.971 1.00 38.62  ? 644  LEU A HD12 1 
ATOM   1213  H HD13 . LEU A 1 83  ? -19.951 30.168  -61.420 1.00 38.62  ? 644  LEU A HD13 1 
ATOM   1214  H HD21 . LEU A 1 83  ? -21.659 28.080  -62.643 1.00 44.23  ? 644  LEU A HD21 1 
ATOM   1215  H HD22 . LEU A 1 83  ? -20.377 28.627  -63.406 1.00 44.23  ? 644  LEU A HD22 1 
ATOM   1216  H HD23 . LEU A 1 83  ? -20.534 27.070  -63.133 1.00 44.23  ? 644  LEU A HD23 1 
ATOM   1217  N N    . CYS A 1 84  ? -18.892 27.209  -58.411 1.00 30.52  ? 645  CYS A N    1 
ATOM   1218  C CA   . CYS A 1 84  ? -19.489 26.282  -57.463 1.00 33.64  ? 645  CYS A CA   1 
ATOM   1219  C C    . CYS A 1 84  ? -21.006 26.404  -57.495 1.00 35.92  ? 645  CYS A C    1 
ATOM   1220  O O    . CYS A 1 84  ? -21.574 27.259  -58.179 1.00 41.80  ? 645  CYS A O    1 
ATOM   1221  C CB   . CYS A 1 84  ? -18.959 26.543  -56.048 1.00 31.17  ? 645  CYS A CB   1 
ATOM   1222  S SG   . CYS A 1 84  ? -17.197 26.210  -55.874 1.00 31.79  ? 645  CYS A SG   1 
ATOM   1223  H H    . CYS A 1 84  ? -19.048 28.036  -58.235 1.00 36.62  ? 645  CYS A H    1 
ATOM   1224  H HA   . CYS A 1 84  ? -19.252 25.375  -57.712 1.00 40.37  ? 645  CYS A HA   1 
ATOM   1225  H HB2  . CYS A 1 84  ? -19.110 27.474  -55.823 1.00 37.41  ? 645  CYS A HB2  1 
ATOM   1226  H HB3  . CYS A 1 84  ? -19.433 25.971  -55.425 1.00 37.41  ? 645  CYS A HB3  1 
ATOM   1227  H HG   . CYS A 1 84  ? -16.867 26.438  -54.743 1.00 38.14  ? 645  CYS A HG   1 
ATOM   1228  N N    . ALA A 1 85  ? -21.659 25.525  -56.732 1.00 35.36  ? 646  ALA A N    1 
ATOM   1229  C CA   . ALA A 1 85  ? -23.116 25.493  -56.699 1.00 38.92  ? 646  ALA A CA   1 
ATOM   1230  C C    . ALA A 1 85  ? -23.690 26.538  -55.752 1.00 41.46  ? 646  ALA A C    1 
ATOM   1231  O O    . ALA A 1 85  ? -24.678 27.202  -56.084 1.00 53.53  ? 646  ALA A O    1 
ATOM   1232  C CB   . ALA A 1 85  ? -23.597 24.098  -56.300 1.00 34.34  ? 646  ALA A CB   1 
ATOM   1233  H H    . ALA A 1 85  ? -21.280 24.941  -56.226 1.00 42.43  ? 646  ALA A H    1 
ATOM   1234  H HA   . ALA A 1 85  ? -23.453 25.681  -57.589 1.00 46.70  ? 646  ALA A HA   1 
ATOM   1235  H HB1  . ALA A 1 85  ? -24.567 24.092  -56.283 1.00 41.21  ? 646  ALA A HB1  1 
ATOM   1236  H HB2  . ALA A 1 85  ? -23.274 23.455  -56.950 1.00 41.21  ? 646  ALA A HB2  1 
ATOM   1237  H HB3  . ALA A 1 85  ? -23.249 23.884  -55.420 1.00 41.21  ? 646  ALA A HB3  1 
ATOM   1238  N N    . ALA A 1 86  ? -23.096 26.691  -54.577 1.00 38.20  ? 647  ALA A N    1 
ATOM   1239  C CA   . ALA A 1 86  ? -23.701 27.465  -53.496 1.00 42.11  ? 647  ALA A CA   1 
ATOM   1240  C C    . ALA A 1 86  ? -22.638 27.717  -52.430 1.00 38.40  ? 647  ALA A C    1 
ATOM   1241  O O    . ALA A 1 86  ? -21.455 27.406  -52.620 1.00 38.78  ? 647  ALA A O    1 
ATOM   1242  C CB   . ALA A 1 86  ? -24.922 26.740  -52.929 1.00 43.69  ? 647  ALA A CB   1 
ATOM   1243  H H    . ALA A 1 86  ? -22.331 26.353  -54.375 1.00 45.83  ? 647  ALA A H    1 
ATOM   1244  H HA   . ALA A 1 86  ? -23.992 28.323  -53.843 1.00 50.53  ? 647  ALA A HA   1 
ATOM   1245  H HB1  . ALA A 1 86  ? -25.303 27.275  -52.215 1.00 52.42  ? 647  ALA A HB1  1 
ATOM   1246  H HB2  . ALA A 1 86  ? -25.574 26.619  -53.637 1.00 52.42  ? 647  ALA A HB2  1 
ATOM   1247  H HB3  . ALA A 1 86  ? -24.644 25.877  -52.584 1.00 52.42  ? 647  ALA A HB3  1 
ATOM   1248  N N    . THR A 1 87  ? -23.068 28.286  -51.306 1.00 38.33  ? 648  THR A N    1 
ATOM   1249  C CA   . THR A 1 87  ? -22.230 28.532  -50.142 1.00 46.71  ? 648  THR A CA   1 
ATOM   1250  C C    . THR A 1 87  ? -22.705 27.656  -48.992 1.00 44.50  ? 648  THR A C    1 
ATOM   1251  O O    . THR A 1 87  ? -23.856 27.216  -48.954 1.00 43.31  ? 648  THR A O    1 
ATOM   1252  C CB   . THR A 1 87  ? -22.277 30.004  -49.706 1.00 43.41  ? 648  THR A CB   1 
ATOM   1253  O OG1  . THR A 1 87  ? -23.511 30.272  -49.031 1.00 45.81  ? 648  THR A OG1  1 
ATOM   1254  C CG2  . THR A 1 87  ? -22.134 30.942  -50.887 1.00 38.74  ? 648  THR A CG2  1 
ATOM   1255  H H    . THR A 1 87  ? -23.879 28.548  -51.194 1.00 46.00  ? 648  THR A H    1 
ATOM   1256  H HA   . THR A 1 87  ? -21.312 28.300  -50.349 1.00 56.05  ? 648  THR A HA   1 
ATOM   1257  H HB   . THR A 1 87  ? -21.541 30.175  -49.097 1.00 52.10  ? 648  THR A HB   1 
ATOM   1258  H HG1  . THR A 1 87  ? -23.539 31.076  -48.791 1.00 54.97  ? 648  THR A HG1  1 
ATOM   1259  H HG21 . THR A 1 87  ? -22.166 31.863  -50.584 1.00 46.49  ? 648  THR A HG21 1 
ATOM   1260  H HG22 . THR A 1 87  ? -21.286 30.786  -51.333 1.00 46.49  ? 648  THR A HG22 1 
ATOM   1261  H HG23 . THR A 1 87  ? -22.855 30.792  -51.518 1.00 46.49  ? 648  THR A HG23 1 
ATOM   1262  N N    . LEU A 1 88  ? -21.789 27.381  -48.062 1.00 42.58  ? 649  LEU A N    1 
ATOM   1263  C CA   . LEU A 1 88  ? -22.148 26.575  -46.900 1.00 40.05  ? 649  LEU A CA   1 
ATOM   1264  C C    . LEU A 1 88  ? -23.316 27.190  -46.139 1.00 43.18  ? 649  LEU A C    1 
ATOM   1265  O O    . LEU A 1 88  ? -24.150 26.468  -45.580 1.00 49.47  ? 649  LEU A O    1 
ATOM   1266  C CB   . LEU A 1 88  ? -20.940 26.412  -45.977 1.00 41.12  ? 649  LEU A CB   1 
ATOM   1267  C CG   . LEU A 1 88  ? -21.165 25.517  -44.755 1.00 41.76  ? 649  LEU A CG   1 
ATOM   1268  C CD1  . LEU A 1 88  ? -21.578 24.112  -45.169 1.00 43.09  ? 649  LEU A CD1  1 
ATOM   1269  C CD2  . LEU A 1 88  ? -19.916 25.473  -43.896 1.00 40.28  ? 649  LEU A CD2  1 
ATOM   1270  H H    . LEU A 1 88  ? -20.971 27.644  -48.080 1.00 51.10  ? 649  LEU A H    1 
ATOM   1271  H HA   . LEU A 1 88  ? -22.417 25.692  -47.200 1.00 48.06  ? 649  LEU A HA   1 
ATOM   1272  H HB2  . LEU A 1 88  ? -20.212 26.028  -46.489 1.00 49.34  ? 649  LEU A HB2  1 
ATOM   1273  H HB3  . LEU A 1 88  ? -20.682 27.289  -45.652 1.00 49.34  ? 649  LEU A HB3  1 
ATOM   1274  H HG   . LEU A 1 88  ? -21.882 25.892  -44.219 1.00 50.11  ? 649  LEU A HG   1 
ATOM   1275  H HD11 . LEU A 1 88  ? -21.711 23.575  -44.372 1.00 51.71  ? 649  LEU A HD11 1 
ATOM   1276  H HD12 . LEU A 1 88  ? -22.403 24.162  -45.676 1.00 51.71  ? 649  LEU A HD12 1 
ATOM   1277  H HD13 . LEU A 1 88  ? -20.876 23.726  -45.716 1.00 51.71  ? 649  LEU A HD13 1 
ATOM   1278  H HD21 . LEU A 1 88  ? -20.081 24.901  -43.129 1.00 48.34  ? 649  LEU A HD21 1 
ATOM   1279  H HD22 . LEU A 1 88  ? -19.183 25.117  -44.422 1.00 48.34  ? 649  LEU A HD22 1 
ATOM   1280  H HD23 . LEU A 1 88  ? -19.705 26.372  -43.599 1.00 48.34  ? 649  LEU A HD23 1 
ATOM   1281  N N    . GLN A 1 89  ? -23.398 28.524  -46.111 1.00 48.32  ? 650  GLN A N    1 
ATOM   1282  C CA   . GLN A 1 89  ? -24.479 29.189  -45.389 1.00 49.08  ? 650  GLN A CA   1 
ATOM   1283  C C    . GLN A 1 89  ? -25.839 28.772  -45.934 1.00 55.02  ? 650  GLN A C    1 
ATOM   1284  O O    . GLN A 1 89  ? -26.708 28.316  -45.183 1.00 60.60  ? 650  GLN A O    1 
ATOM   1285  C CB   . GLN A 1 89  ? -24.313 30.706  -45.472 1.00 48.69  ? 650  GLN A CB   1 
ATOM   1286  C CG   . GLN A 1 89  ? -25.159 31.466  -44.458 1.00 60.37  ? 650  GLN A CG   1 
ATOM   1287  C CD   . GLN A 1 89  ? -26.582 31.709  -44.924 1.00 67.40  ? 650  GLN A CD   1 
ATOM   1288  O OE1  . GLN A 1 89  ? -26.822 32.052  -46.083 1.00 65.45  ? 650  GLN A OE1  1 
ATOM   1289  N NE2  . GLN A 1 89  ? -27.537 31.537  -44.017 1.00 67.61  ? 650  GLN A NE2  1 
ATOM   1290  H H    . GLN A 1 89  ? -22.845 29.058  -46.498 1.00 57.98  ? 650  GLN A H    1 
ATOM   1291  H HA   . GLN A 1 89  ? -24.439 28.933  -44.455 1.00 58.90  ? 650  GLN A HA   1 
ATOM   1292  H HB2  . GLN A 1 89  ? -23.383 30.929  -45.310 1.00 58.43  ? 650  GLN A HB2  1 
ATOM   1293  H HB3  . GLN A 1 89  ? -24.573 31.003  -46.358 1.00 58.43  ? 650  GLN A HB3  1 
ATOM   1294  H HG2  . GLN A 1 89  ? -25.198 30.953  -43.635 1.00 72.44  ? 650  GLN A HG2  1 
ATOM   1295  H HG3  . GLN A 1 89  ? -24.748 32.329  -44.290 1.00 72.44  ? 650  GLN A HG3  1 
ATOM   1296  H HE21 . GLN A 1 89  ? -27.332 31.301  -43.216 1.00 81.13  ? 650  GLN A HE21 1 
ATOM   1297  H HE22 . GLN A 1 89  ? -28.361 31.663  -44.230 1.00 81.13  ? 650  GLN A HE22 1 
ATOM   1298  N N    . GLU A 1 90  ? -26.044 28.927  -47.242 1.00 50.94  ? 651  GLU A N    1 
ATOM   1299  C CA   . GLU A 1 90  ? -27.310 28.535  -47.847 1.00 52.71  ? 651  GLU A CA   1 
ATOM   1300  C C    . GLU A 1 90  ? -27.491 27.021  -47.921 1.00 53.09  ? 651  GLU A C    1 
ATOM   1301  O O    . GLU A 1 90  ? -28.614 26.566  -48.162 1.00 58.38  ? 651  GLU A O    1 
ATOM   1302  C CB   . GLU A 1 90  ? -27.438 29.151  -49.243 1.00 56.06  ? 651  GLU A CB   1 
ATOM   1303  C CG   . GLU A 1 90  ? -26.301 28.837  -50.196 1.00 56.72  ? 651  GLU A CG   1 
ATOM   1304  C CD   . GLU A 1 90  ? -26.264 29.781  -51.381 1.00 56.07  ? 651  GLU A CD   1 
ATOM   1305  O OE1  . GLU A 1 90  ? -25.210 29.865  -52.044 1.00 51.69  ? 651  GLU A OE1  1 
ATOM   1306  O OE2  . GLU A 1 90  ? -27.290 30.443  -51.651 1.00 57.59  ? 651  GLU A OE2  1 
ATOM   1307  H H    . GLU A 1 90  ? -25.471 29.255  -47.794 1.00 61.13  ? 651  GLU A H    1 
ATOM   1308  H HA   . GLU A 1 90  ? -28.032 28.888  -47.304 1.00 63.26  ? 651  GLU A HA   1 
ATOM   1309  H HB2  . GLU A 1 90  ? -28.257 28.826  -49.649 1.00 67.27  ? 651  GLU A HB2  1 
ATOM   1310  H HB3  . GLU A 1 90  ? -27.483 30.115  -49.150 1.00 67.27  ? 651  GLU A HB3  1 
ATOM   1311  H HG2  . GLU A 1 90  ? -25.459 28.916  -49.721 1.00 68.06  ? 651  GLU A HG2  1 
ATOM   1312  H HG3  . GLU A 1 90  ? -26.410 27.934  -50.533 1.00 68.06  ? 651  GLU A HG3  1 
ATOM   1313  N N    . TYR A 1 91  ? -26.428 26.234  -47.720 1.00 53.38  ? 652  TYR A N    1 
ATOM   1314  C CA   . TYR A 1 91  ? -26.587 24.783  -47.643 1.00 56.65  ? 652  TYR A CA   1 
ATOM   1315  C C    . TYR A 1 91  ? -27.277 24.360  -46.353 1.00 58.72  ? 652  TYR A C    1 
ATOM   1316  O O    . TYR A 1 91  ? -27.960 23.329  -46.326 1.00 63.06  ? 652  TYR A O    1 
ATOM   1317  C CB   . TYR A 1 91  ? -25.230 24.085  -47.754 1.00 51.47  ? 652  TYR A CB   1 
ATOM   1318  C CG   . TYR A 1 91  ? -25.241 22.677  -47.189 1.00 51.13  ? 652  TYR A CG   1 
ATOM   1319  C CD1  . TYR A 1 91  ? -25.689 21.607  -47.950 1.00 52.17  ? 652  TYR A CD1  1 
ATOM   1320  C CD2  . TYR A 1 91  ? -24.825 22.425  -45.886 1.00 54.85  ? 652  TYR A CD2  1 
ATOM   1321  C CE1  . TYR A 1 91  ? -25.711 20.325  -47.437 1.00 52.44  ? 652  TYR A CE1  1 
ATOM   1322  C CE2  . TYR A 1 91  ? -24.846 21.145  -45.364 1.00 52.19  ? 652  TYR A CE2  1 
ATOM   1323  C CZ   . TYR A 1 91  ? -25.289 20.100  -46.144 1.00 56.65  ? 652  TYR A CZ   1 
ATOM   1324  O OH   . TYR A 1 91  ? -25.309 18.823  -45.627 1.00 55.82  ? 652  TYR A OH   1 
ATOM   1325  H H    . TYR A 1 91  ? -25.619 26.512  -47.627 1.00 64.05  ? 652  TYR A H    1 
ATOM   1326  H HA   . TYR A 1 91  ? -27.136 24.488  -48.386 1.00 67.98  ? 652  TYR A HA   1 
ATOM   1327  H HB2  . TYR A 1 91  ? -24.979 24.029  -48.690 1.00 61.77  ? 652  TYR A HB2  1 
ATOM   1328  H HB3  . TYR A 1 91  ? -24.569 24.599  -47.264 1.00 61.77  ? 652  TYR A HB3  1 
ATOM   1329  H HD1  . TYR A 1 91  ? -25.975 21.755  -48.822 1.00 62.60  ? 652  TYR A HD1  1 
ATOM   1330  H HD2  . TYR A 1 91  ? -24.526 23.129  -45.357 1.00 65.82  ? 652  TYR A HD2  1 
ATOM   1331  H HE1  . TYR A 1 91  ? -26.010 19.617  -47.961 1.00 62.93  ? 652  TYR A HE1  1 
ATOM   1332  H HE2  . TYR A 1 91  ? -24.560 20.991  -44.493 1.00 62.63  ? 652  TYR A HE2  1 
ATOM   1333  H HH   . TYR A 1 91  ? -25.027 18.829  -44.835 1.00 66.99  ? 652  TYR A HH   1 
ATOM   1334  N N    . VAL A 1 92  ? -27.120 25.142  -45.282 1.00 59.27  ? 653  VAL A N    1 
ATOM   1335  C CA   . VAL A 1 92  ? -27.717 24.814  -43.994 1.00 61.95  ? 653  VAL A CA   1 
ATOM   1336  C C    . VAL A 1 92  ? -29.235 24.726  -44.081 1.00 66.20  ? 653  VAL A C    1 
ATOM   1337  O O    . VAL A 1 92  ? -29.878 24.184  -43.176 1.00 69.97  ? 653  VAL A O    1 
ATOM   1338  C CB   . VAL A 1 92  ? -27.261 25.862  -42.950 1.00 56.01  ? 653  VAL A CB   1 
ATOM   1339  C CG1  . VAL A 1 92  ? -28.049 25.778  -41.643 1.00 62.92  ? 653  VAL A CG1  1 
ATOM   1340  C CG2  . VAL A 1 92  ? -25.786 25.682  -42.667 1.00 50.12  ? 653  VAL A CG2  1 
ATOM   1341  H H    . VAL A 1 92  ? -26.667 25.873  -45.280 1.00 71.12  ? 653  VAL A H    1 
ATOM   1342  H HA   . VAL A 1 92  ? -27.387 23.948  -43.708 1.00 74.34  ? 653  VAL A HA   1 
ATOM   1343  H HB   . VAL A 1 92  ? -27.388 26.750  -43.318 1.00 67.21  ? 653  VAL A HB   1 
ATOM   1344  H HG11 . VAL A 1 92  ? -27.719 26.455  -41.032 1.00 75.50  ? 653  VAL A HG11 1 
ATOM   1345  H HG12 . VAL A 1 92  ? -28.988 25.930  -41.831 1.00 75.50  ? 653  VAL A HG12 1 
ATOM   1346  H HG13 . VAL A 1 92  ? -27.927 24.896  -41.257 1.00 75.50  ? 653  VAL A HG13 1 
ATOM   1347  H HG21 . VAL A 1 92  ? -25.508 26.341  -42.012 1.00 60.14  ? 653  VAL A HG21 1 
ATOM   1348  H HG22 . VAL A 1 92  ? -25.638 24.788  -42.320 1.00 60.14  ? 653  VAL A HG22 1 
ATOM   1349  H HG23 . VAL A 1 92  ? -25.290 25.804  -43.491 1.00 60.14  ? 653  VAL A HG23 1 
ATOM   1350  N N    . GLU A 1 93  ? -29.819 25.225  -45.168 1.00 72.24  ? 654  GLU A N    1 
ATOM   1351  C CA   . GLU A 1 93  ? -31.243 25.089  -45.443 1.00 74.46  ? 654  GLU A CA   1 
ATOM   1352  C C    . GLU A 1 93  ? -31.459 23.862  -46.319 1.00 88.98  ? 654  GLU A C    1 
ATOM   1353  O O    . GLU A 1 93  ? -30.975 23.812  -47.455 1.00 91.57  ? 654  GLU A O    1 
ATOM   1354  C CB   . GLU A 1 93  ? -31.784 26.343  -46.127 1.00 65.50  ? 654  GLU A CB   1 
ATOM   1355  C CG   . GLU A 1 93  ? -31.924 27.549  -45.204 1.00 63.95  ? 654  GLU A CG   1 
ATOM   1356  C CD   . GLU A 1 93  ? -30.588 28.116  -44.754 1.00 61.27  ? 654  GLU A CD   1 
ATOM   1357  O OE1  . GLU A 1 93  ? -29.542 27.500  -45.047 1.00 60.75  ? 654  GLU A OE1  1 
ATOM   1358  O OE2  . GLU A 1 93  ? -30.586 29.185  -44.107 1.00 61.19  ? 654  GLU A OE2  1 
ATOM   1359  H H    . GLU A 1 93  ? -29.396 25.660  -45.778 1.00 86.69  ? 654  GLU A H    1 
ATOM   1360  H HA   . GLU A 1 93  ? -31.723 24.961  -44.610 1.00 89.35  ? 654  GLU A HA   1 
ATOM   1361  H HB2  . GLU A 1 93  ? -31.182 26.590  -46.846 1.00 78.60  ? 654  GLU A HB2  1 
ATOM   1362  H HB3  . GLU A 1 93  ? -32.662 26.145  -46.489 1.00 78.60  ? 654  GLU A HB3  1 
ATOM   1363  H HG2  . GLU A 1 93  ? -32.403 28.250  -45.673 1.00 76.74  ? 654  GLU A HG2  1 
ATOM   1364  H HG3  . GLU A 1 93  ? -32.418 27.283  -44.412 1.00 76.74  ? 654  GLU A HG3  1 
ATOM   1365  N N    . GLN A 1 94  ? -32.186 22.882  -45.791 1.00 95.99  ? 655  GLN A N    1 
ATOM   1366  C CA   . GLN A 1 94  ? -32.416 21.621  -46.487 1.00 89.71  ? 655  GLN A CA   1 
ATOM   1367  C C    . GLN A 1 94  ? -33.522 21.761  -47.529 1.00 93.80  ? 655  GLN A C    1 
ATOM   1368  O O    . GLN A 1 94  ? -33.303 22.299  -48.614 1.00 95.31  ? 655  GLN A O    1 
ATOM   1369  C CB   . GLN A 1 94  ? -32.777 20.524  -45.482 1.00 84.07  ? 655  GLN A CB   1 
ATOM   1370  C CG   . GLN A 1 94  ? -32.354 19.123  -45.899 1.00 80.69  ? 655  GLN A CG   1 
ATOM   1371  C CD   . GLN A 1 94  ? -32.198 18.187  -44.714 1.00 84.00  ? 655  GLN A CD   1 
ATOM   1372  O OE1  . GLN A 1 94  ? -32.819 18.382  -43.668 1.00 82.19  ? 655  GLN A OE1  1 
ATOM   1373  N NE2  . GLN A 1 94  ? -31.357 17.170  -44.868 1.00 80.05  ? 655  GLN A NE2  1 
ATOM   1374  H H    . GLN A 1 94  ? -32.562 22.925  -45.019 1.00 115.19 ? 655  GLN A H    1 
ATOM   1375  H HA   . GLN A 1 94  ? -31.603 21.357  -46.944 1.00 107.65 ? 655  GLN A HA   1 
ATOM   1376  H HB2  . GLN A 1 94  ? -32.344 20.724  -44.637 1.00 100.89 ? 655  GLN A HB2  1 
ATOM   1377  H HB3  . GLN A 1 94  ? -33.739 20.518  -45.362 1.00 100.89 ? 655  GLN A HB3  1 
ATOM   1378  H HG2  . GLN A 1 94  ? -33.027 18.751  -46.489 1.00 96.83  ? 655  GLN A HG2  1 
ATOM   1379  H HG3  . GLN A 1 94  ? -31.500 19.173  -46.357 1.00 96.83  ? 655  GLN A HG3  1 
ATOM   1380  H HE21 . GLN A 1 94  ? -30.935 17.070  -45.610 1.00 96.06  ? 655  GLN A HE21 1 
ATOM   1381  H HE22 . GLN A 1 94  ? -31.235 16.612  -44.225 1.00 96.06  ? 655  GLN A HE22 1 
ATOM   1382  N N    . GLU A 1 103 ? -22.401 15.013  -46.692 1.00 44.29  ? 664  GLU A N    1 
ATOM   1383  C CA   . GLU A 1 103 ? -22.817 14.983  -45.293 1.00 50.16  ? 664  GLU A CA   1 
ATOM   1384  C C    . GLU A 1 103 ? -22.137 16.095  -44.499 1.00 43.83  ? 664  GLU A C    1 
ATOM   1385  O O    . GLU A 1 103 ? -21.017 16.489  -44.820 1.00 44.49  ? 664  GLU A O    1 
ATOM   1386  C CB   . GLU A 1 103 ? -22.504 13.622  -44.672 1.00 51.22  ? 664  GLU A CB   1 
ATOM   1387  C CG   . GLU A 1 103 ? -23.733 12.753  -44.449 1.00 59.02  ? 664  GLU A CG   1 
ATOM   1388  C CD   . GLU A 1 103 ? -23.429 11.502  -43.647 1.00 67.26  ? 664  GLU A CD   1 
ATOM   1389  O OE1  . GLU A 1 103 ? -22.323 11.410  -43.074 1.00 67.78  ? 664  GLU A OE1  1 
ATOM   1390  O OE2  . GLU A 1 103 ? -24.299 10.608  -43.589 1.00 68.20  ? 664  GLU A OE2  1 
ATOM   1391  H HA   . GLU A 1 103 ? -23.775 15.123  -45.245 1.00 60.19  ? 664  GLU A HA   1 
ATOM   1392  H HB2  . GLU A 1 103 ? -21.903 13.140  -45.261 1.00 61.46  ? 664  GLU A HB2  1 
ATOM   1393  H HB3  . GLU A 1 103 ? -22.079 13.762  -43.811 1.00 61.46  ? 664  GLU A HB3  1 
ATOM   1394  H HG2  . GLU A 1 103 ? -24.399 13.266  -43.964 1.00 70.83  ? 664  GLU A HG2  1 
ATOM   1395  H HG3  . GLU A 1 103 ? -24.087 12.480  -45.309 1.00 70.83  ? 664  GLU A HG3  1 
ATOM   1396  N N    . PRO A 1 104 ? -22.811 16.593  -43.456 1.00 37.90  ? 665  PRO A N    1 
ATOM   1397  C CA   . PRO A 1 104 ? -22.276 17.768  -42.742 1.00 42.98  ? 665  PRO A CA   1 
ATOM   1398  C C    . PRO A 1 104 ? -20.891 17.558  -42.153 1.00 40.04  ? 665  PRO A C    1 
ATOM   1399  O O    . PRO A 1 104 ? -20.040 18.445  -42.278 1.00 39.63  ? 665  PRO A O    1 
ATOM   1400  C CB   . PRO A 1 104 ? -23.328 18.025  -41.651 1.00 44.58  ? 665  PRO A CB   1 
ATOM   1401  C CG   . PRO A 1 104 ? -24.102 16.755  -41.536 1.00 43.78  ? 665  PRO A CG   1 
ATOM   1402  C CD   . PRO A 1 104 ? -24.099 16.151  -42.900 1.00 43.71  ? 665  PRO A CD   1 
ATOM   1403  H HA   . PRO A 1 104 ? -22.249 18.532  -43.339 1.00 51.57  ? 665  PRO A HA   1 
ATOM   1404  H HB2  . PRO A 1 104 ? -22.886 18.233  -40.814 1.00 53.50  ? 665  PRO A HB2  1 
ATOM   1405  H HB3  . PRO A 1 104 ? -23.907 18.755  -41.923 1.00 53.50  ? 665  PRO A HB3  1 
ATOM   1406  H HG2  . PRO A 1 104 ? -23.666 16.165  -40.901 1.00 52.54  ? 665  PRO A HG2  1 
ATOM   1407  H HG3  . PRO A 1 104 ? -25.009 16.951  -41.253 1.00 52.54  ? 665  PRO A HG3  1 
ATOM   1408  H HD2  . PRO A 1 104 ? -24.129 15.183  -42.842 1.00 52.46  ? 665  PRO A HD2  1 
ATOM   1409  H HD3  . PRO A 1 104 ? -24.834 16.501  -43.428 1.00 52.46  ? 665  PRO A HD3  1 
ATOM   1410  N N    . ILE A 1 105 ? -20.631 16.414  -41.518 1.00 37.62  ? 666  ILE A N    1 
ATOM   1411  C CA   . ILE A 1 105 ? -19.326 16.211  -40.897 1.00 36.33  ? 666  ILE A CA   1 
ATOM   1412  C C    . ILE A 1 105 ? -18.239 16.124  -41.962 1.00 35.73  ? 666  ILE A C    1 
ATOM   1413  O O    . ILE A 1 105 ? -17.124 16.622  -41.770 1.00 36.79  ? 666  ILE A O    1 
ATOM   1414  C CB   . ILE A 1 105 ? -19.345 14.961  -39.994 1.00 44.72  ? 666  ILE A CB   1 
ATOM   1415  C CG1  . ILE A 1 105 ? -20.498 15.064  -38.988 1.00 46.92  ? 666  ILE A CG1  1 
ATOM   1416  C CG2  . ILE A 1 105 ? -17.997 14.805  -39.289 1.00 43.93  ? 666  ILE A CG2  1 
ATOM   1417  C CD1  . ILE A 1 105 ? -20.511 13.989  -37.910 1.00 54.81  ? 666  ILE A CD1  1 
ATOM   1418  H H    . ILE A 1 105 ? -21.179 15.757  -41.435 1.00 45.15  ? 666  ILE A H    1 
ATOM   1419  H HA   . ILE A 1 105 ? -19.127 16.976  -40.335 1.00 43.59  ? 666  ILE A HA   1 
ATOM   1420  H HB   . ILE A 1 105 ? -19.492 14.181  -40.552 1.00 53.66  ? 666  ILE A HB   1 
ATOM   1421  H HG12 . ILE A 1 105 ? -20.443 15.924  -38.542 1.00 56.30  ? 666  ILE A HG12 1 
ATOM   1422  H HG13 . ILE A 1 105 ? -21.336 15.002  -39.472 1.00 56.30  ? 666  ILE A HG13 1 
ATOM   1423  H HG21 . ILE A 1 105 ? -18.025 14.016  -38.726 1.00 52.72  ? 666  ILE A HG21 1 
ATOM   1424  H HG22 . ILE A 1 105 ? -17.300 14.711  -39.957 1.00 52.72  ? 666  ILE A HG22 1 
ATOM   1425  H HG23 . ILE A 1 105 ? -17.831 15.593  -38.747 1.00 52.72  ? 666  ILE A HG23 1 
ATOM   1426  H HD11 . ILE A 1 105 ? -21.271 14.138  -37.326 1.00 65.77  ? 666  ILE A HD11 1 
ATOM   1427  H HD12 . ILE A 1 105 ? -20.582 13.119  -38.332 1.00 65.77  ? 666  ILE A HD12 1 
ATOM   1428  H HD13 . ILE A 1 105 ? -19.687 14.043  -37.401 1.00 65.77  ? 666  ILE A HD13 1 
ATOM   1429  N N    . THR A 1 106 ? -18.544 15.503  -43.105 1.00 36.08  ? 667  THR A N    1 
ATOM   1430  C CA   . THR A 1 106 ? -17.561 15.424  -44.180 1.00 37.14  ? 667  THR A CA   1 
ATOM   1431  C C    . THR A 1 106 ? -17.241 16.808  -44.731 1.00 34.27  ? 667  THR A C    1 
ATOM   1432  O O    . THR A 1 106 ? -16.090 17.095  -45.080 1.00 32.22  ? 667  THR A O    1 
ATOM   1433  C CB   . THR A 1 106 ? -18.067 14.511  -45.297 1.00 38.62  ? 667  THR A CB   1 
ATOM   1434  O OG1  . THR A 1 106 ? -18.642 13.327  -44.730 1.00 50.09  ? 667  THR A OG1  1 
ATOM   1435  C CG2  . THR A 1 106 ? -16.924 14.124  -46.226 1.00 37.07  ? 667  THR A CG2  1 
ATOM   1436  H H    . THR A 1 106 ? -19.299 15.129  -43.278 1.00 43.29  ? 667  THR A H    1 
ATOM   1437  H HA   . THR A 1 106 ? -16.740 15.044  -43.830 1.00 44.57  ? 667  THR A HA   1 
ATOM   1438  H HB   . THR A 1 106 ? -18.739 14.979  -45.816 1.00 46.35  ? 667  THR A HB   1 
ATOM   1439  H HG1  . THR A 1 106 ? -18.921 12.823  -45.341 1.00 60.11  ? 667  THR A HG1  1 
ATOM   1440  H HG21 . THR A 1 106 ? -17.253 13.545  -46.932 1.00 44.49  ? 667  THR A HG21 1 
ATOM   1441  H HG22 . THR A 1 106 ? -16.538 14.919  -46.626 1.00 44.49  ? 667  THR A HG22 1 
ATOM   1442  H HG23 . THR A 1 106 ? -16.237 13.655  -45.729 1.00 44.49  ? 667  THR A HG23 1 
ATOM   1443  N N    . LEU A 1 107 ? -18.250 17.680  -44.823 1.00 32.50  ? 668  LEU A N    1 
ATOM   1444  C CA   . LEU A 1 107 ? -18.006 19.053  -45.251 1.00 35.73  ? 668  LEU A CA   1 
ATOM   1445  C C    . LEU A 1 107 ? -17.068 19.766  -44.286 1.00 31.88  ? 668  LEU A C    1 
ATOM   1446  O O    . LEU A 1 107 ? -16.142 20.468  -44.710 1.00 27.88  ? 668  LEU A O    1 
ATOM   1447  C CB   . LEU A 1 107 ? -19.328 19.814  -45.368 1.00 33.98  ? 668  LEU A CB   1 
ATOM   1448  C CG   . LEU A 1 107 ? -20.307 19.375  -46.460 1.00 35.99  ? 668  LEU A CG   1 
ATOM   1449  C CD1  . LEU A 1 107 ? -21.577 20.212  -46.397 1.00 40.95  ? 668  LEU A CD1  1 
ATOM   1450  C CD2  . LEU A 1 107 ? -19.682 19.469  -47.844 1.00 32.62  ? 668  LEU A CD2  1 
ATOM   1451  H H    . LEU A 1 107 ? -19.072 17.501  -44.646 1.00 39.00  ? 668  LEU A H    1 
ATOM   1452  H HA   . LEU A 1 107 ? -17.586 19.043  -46.126 1.00 42.88  ? 668  LEU A HA   1 
ATOM   1453  H HB2  . LEU A 1 107 ? -19.794 19.736  -44.521 1.00 40.77  ? 668  LEU A HB2  1 
ATOM   1454  H HB3  . LEU A 1 107 ? -19.122 20.748  -45.531 1.00 40.77  ? 668  LEU A HB3  1 
ATOM   1455  H HG   . LEU A 1 107 ? -20.553 18.449  -46.306 1.00 43.18  ? 668  LEU A HG   1 
ATOM   1456  H HD11 . LEU A 1 107 ? -22.183 19.918  -47.095 1.00 49.14  ? 668  LEU A HD11 1 
ATOM   1457  H HD12 . LEU A 1 107 ? -21.990 20.093  -45.527 1.00 49.14  ? 668  LEU A HD12 1 
ATOM   1458  H HD13 . LEU A 1 107 ? -21.346 21.145  -46.528 1.00 49.14  ? 668  LEU A HD13 1 
ATOM   1459  H HD21 . LEU A 1 107 ? -20.333 19.183  -48.504 1.00 39.15  ? 668  LEU A HD21 1 
ATOM   1460  H HD22 . LEU A 1 107 ? -19.423 20.389  -48.012 1.00 39.15  ? 668  LEU A HD22 1 
ATOM   1461  H HD23 . LEU A 1 107 ? -18.901 18.894  -47.878 1.00 39.15  ? 668  LEU A HD23 1 
ATOM   1462  N N    . LEU A 1 108 ? -17.297 19.603  -42.980 1.00 33.40  ? 669  LEU A N    1 
ATOM   1463  C CA   . LEU A 1 108 ? -16.416 20.213  -41.991 1.00 28.43  ? 669  LEU A CA   1 
ATOM   1464  C C    . LEU A 1 108 ? -15.010 19.637  -42.083 1.00 27.51  ? 669  LEU A C    1 
ATOM   1465  O O    . LEU A 1 108 ? -14.021 20.376  -42.003 1.00 29.03  ? 669  LEU A O    1 
ATOM   1466  C CB   . LEU A 1 108 ? -16.988 20.014  -40.588 1.00 29.43  ? 669  LEU A CB   1 
ATOM   1467  C CG   . LEU A 1 108 ? -18.388 20.589  -40.358 1.00 31.78  ? 669  LEU A CG   1 
ATOM   1468  C CD1  . LEU A 1 108 ? -18.924 20.185  -38.993 1.00 35.73  ? 669  LEU A CD1  1 
ATOM   1469  C CD2  . LEU A 1 108 ? -18.390 22.101  -40.507 1.00 31.25  ? 669  LEU A CD2  1 
ATOM   1470  H H    . LEU A 1 108 ? -17.948 19.149  -42.648 1.00 40.08  ? 669  LEU A H    1 
ATOM   1471  H HA   . LEU A 1 108 ? -16.362 21.166  -42.161 1.00 34.11  ? 669  LEU A HA   1 
ATOM   1472  H HB2  . LEU A 1 108 ? -17.031 19.063  -40.406 1.00 35.32  ? 669  LEU A HB2  1 
ATOM   1473  H HB3  . LEU A 1 108 ? -16.392 20.439  -39.951 1.00 35.32  ? 669  LEU A HB3  1 
ATOM   1474  H HG   . LEU A 1 108 ? -18.987 20.226  -41.030 1.00 38.13  ? 669  LEU A HG   1 
ATOM   1475  H HD11 . LEU A 1 108 ? -19.810 20.564  -38.878 1.00 42.88  ? 669  LEU A HD11 1 
ATOM   1476  H HD12 . LEU A 1 108 ? -18.969 19.218  -38.945 1.00 42.88  ? 669  LEU A HD12 1 
ATOM   1477  H HD13 . LEU A 1 108 ? -18.328 20.524  -38.307 1.00 42.88  ? 669  LEU A HD13 1 
ATOM   1478  H HD21 . LEU A 1 108 ? -19.289 22.431  -40.356 1.00 37.50  ? 669  LEU A HD21 1 
ATOM   1479  H HD22 . LEU A 1 108 ? -17.782 22.483  -39.854 1.00 37.50  ? 669  LEU A HD22 1 
ATOM   1480  H HD23 . LEU A 1 108 ? -18.099 22.330  -41.403 1.00 37.50  ? 669  LEU A HD23 1 
ATOM   1481  N N    . GLN A 1 109 ? -14.898 18.318  -42.254 1.00 26.27  ? 670  GLN A N    1 
ATOM   1482  C CA   . GLN A 1 109 ? -13.586 17.704  -42.421 1.00 29.27  ? 670  GLN A CA   1 
ATOM   1483  C C    . GLN A 1 109 ? -12.891 18.238  -43.666 1.00 27.38  ? 670  GLN A C    1 
ATOM   1484  O O    . GLN A 1 109 ? -11.681 18.494  -43.651 1.00 26.15  ? 670  GLN A O    1 
ATOM   1485  C CB   . GLN A 1 109 ? -13.726 16.183  -42.500 1.00 36.31  ? 670  GLN A CB   1 
ATOM   1486  C CG   . GLN A 1 109 ? -12.399 15.437  -42.529 1.00 39.19  ? 670  GLN A CG   1 
ATOM   1487  C CD   . GLN A 1 109 ? -12.554 13.985  -42.937 1.00 55.67  ? 670  GLN A CD   1 
ATOM   1488  O OE1  . GLN A 1 109 ? -13.653 13.530  -43.254 1.00 61.62  ? 670  GLN A OE1  1 
ATOM   1489  N NE2  . GLN A 1 109 ? -11.448 13.250  -42.934 1.00 81.02  ? 670  GLN A NE2  1 
ATOM   1490  H H    . GLN A 1 109 ? -15.558 17.766  -42.276 1.00 31.53  ? 670  GLN A H    1 
ATOM   1491  H HA   . GLN A 1 109 ? -13.035 17.917  -41.652 1.00 35.13  ? 670  GLN A HA   1 
ATOM   1492  H HB2  . GLN A 1 109 ? -14.221 15.875  -41.725 1.00 43.58  ? 670  GLN A HB2  1 
ATOM   1493  H HB3  . GLN A 1 109 ? -14.210 15.957  -43.309 1.00 43.58  ? 670  GLN A HB3  1 
ATOM   1494  H HG2  . GLN A 1 109 ? -11.809 15.867  -43.167 1.00 47.03  ? 670  GLN A HG2  1 
ATOM   1495  H HG3  . GLN A 1 109 ? -12.004 15.459  -41.643 1.00 47.03  ? 670  GLN A HG3  1 
ATOM   1496  H HE21 . GLN A 1 109 ? -10.697 13.604  -42.709 1.00 97.23  ? 670  GLN A HE21 1 
ATOM   1497  H HE22 . GLN A 1 109 ? -11.482 12.421  -43.158 1.00 97.23  ? 670  GLN A HE22 1 
ATOM   1498  N N    . GLN A 1 110 ? -13.642 18.408  -44.756 1.00 26.50  ? 671  GLN A N    1 
ATOM   1499  C CA   . GLN A 1 110 ? -13.062 18.938  -45.985 1.00 29.13  ? 671  GLN A CA   1 
ATOM   1500  C C    . GLN A 1 110 ? -12.635 20.388  -45.812 1.00 22.18  ? 671  GLN A C    1 
ATOM   1501  O O    . GLN A 1 110 ? -11.568 20.788  -46.292 1.00 21.59  ? 671  GLN A O    1 
ATOM   1502  C CB   . GLN A 1 110 ? -14.067 18.809  -47.127 1.00 30.07  ? 671  GLN A CB   1 
ATOM   1503  C CG   . GLN A 1 110 ? -14.220 17.386  -47.653 1.00 26.84  ? 671  GLN A CG   1 
ATOM   1504  C CD   . GLN A 1 110 ? -15.474 17.189  -48.484 1.00 31.93  ? 671  GLN A CD   1 
ATOM   1505  O OE1  . GLN A 1 110 ? -16.388 18.011  -48.457 1.00 32.30  ? 671  GLN A OE1  1 
ATOM   1506  N NE2  . GLN A 1 110 ? -15.524 16.088  -49.227 1.00 34.85  ? 671  GLN A NE2  1 
ATOM   1507  H H    . GLN A 1 110 ? -14.481 18.226  -44.807 1.00 31.80  ? 671  GLN A H    1 
ATOM   1508  H HA   . GLN A 1 110 ? -12.276 18.418  -46.215 1.00 34.96  ? 671  GLN A HA   1 
ATOM   1509  H HB2  . GLN A 1 110 ? -14.936 19.105  -46.814 1.00 36.08  ? 671  GLN A HB2  1 
ATOM   1510  H HB3  . GLN A 1 110 ? -13.775 19.368  -47.865 1.00 36.08  ? 671  GLN A HB3  1 
ATOM   1511  H HG2  . GLN A 1 110 ? -13.455 17.172  -48.211 1.00 32.21  ? 671  GLN A HG2  1 
ATOM   1512  H HG3  . GLN A 1 110 ? -14.261 16.775  -46.901 1.00 32.21  ? 671  GLN A HG3  1 
ATOM   1513  H HE21 . GLN A 1 110 ? -14.867 15.534  -49.218 1.00 41.82  ? 671  GLN A HE21 1 
ATOM   1514  H HE22 . GLN A 1 110 ? -16.213 15.930  -49.716 1.00 41.82  ? 671  GLN A HE22 1 
ATOM   1515  N N    . THR A 1 111 ? -13.460 21.192  -45.138 1.00 24.36  ? 672  THR A N    1 
ATOM   1516  C CA   . THR A 1 111 ? -13.082 22.572  -44.855 1.00 24.88  ? 672  THR A CA   1 
ATOM   1517  C C    . THR A 1 111 ? -11.819 22.627  -44.007 1.00 25.58  ? 672  THR A C    1 
ATOM   1518  O O    . THR A 1 111 ? -10.945 23.473  -44.231 1.00 22.61  ? 672  THR A O    1 
ATOM   1519  C CB   . THR A 1 111 ? -14.229 23.297  -44.147 1.00 19.94  ? 672  THR A CB   1 
ATOM   1520  O OG1  . THR A 1 111 ? -15.437 23.146  -44.905 1.00 28.16  ? 672  THR A OG1  1 
ATOM   1521  C CG2  . THR A 1 111 ? -13.912 24.784  -43.980 1.00 25.02  ? 672  THR A CG2  1 
ATOM   1522  H H    . THR A 1 111 ? -14.233 20.964  -44.838 1.00 29.23  ? 672  THR A H    1 
ATOM   1523  H HA   . THR A 1 111 ? -12.905 23.031  -45.691 1.00 29.86  ? 672  THR A HA   1 
ATOM   1524  H HB   . THR A 1 111 ? -14.355 22.913  -43.265 1.00 23.92  ? 672  THR A HB   1 
ATOM   1525  H HG1  . THR A 1 111 ? -15.630 22.332  -44.978 1.00 33.80  ? 672  THR A HG1  1 
ATOM   1526  H HG21 . THR A 1 111 ? -14.646 25.231  -43.530 1.00 30.02  ? 672  THR A HG21 1 
ATOM   1527  H HG22 . THR A 1 111 ? -13.106 24.894  -43.452 1.00 30.02  ? 672  THR A HG22 1 
ATOM   1528  H HG23 . THR A 1 111 ? -13.778 25.194  -44.849 1.00 30.02  ? 672  THR A HG23 1 
ATOM   1529  N N    . THR A 1 112 ? -11.702 21.722  -43.033 1.00 22.43  ? 673  THR A N    1 
ATOM   1530  C CA   . THR A 1 112 ? -10.546 21.730  -42.145 1.00 22.58  ? 673  THR A CA   1 
ATOM   1531  C C    . THR A 1 112 ? -9.293  21.269  -42.874 1.00 21.36  ? 673  THR A C    1 
ATOM   1532  O O    . THR A 1 112 ? -8.208  21.822  -42.665 1.00 21.94  ? 673  THR A O    1 
ATOM   1533  C CB   . THR A 1 112 ? -10.823 20.843  -40.931 1.00 25.48  ? 673  THR A CB   1 
ATOM   1534  O OG1  . THR A 1 112 ? -12.075 21.217  -40.342 1.00 21.55  ? 673  THR A OG1  1 
ATOM   1535  C CG2  . THR A 1 112 ? -9.713  20.974  -39.893 1.00 22.52  ? 673  THR A CG2  1 
ATOM   1536  H H    . THR A 1 112 ? -12.273 21.100  -42.870 1.00 26.92  ? 673  THR A H    1 
ATOM   1537  H HA   . THR A 1 112 ? -10.395 22.635  -41.829 1.00 27.10  ? 673  THR A HA   1 
ATOM   1538  H HB   . THR A 1 112 ? -10.866 19.916  -41.214 1.00 30.57  ? 673  THR A HB   1 
ATOM   1539  H HG1  . THR A 1 112 ? -12.694 21.122  -40.901 1.00 25.86  ? 673  THR A HG1  1 
ATOM   1540  H HG21 . THR A 1 112 ? -9.903  20.405  -39.131 1.00 27.02  ? 673  THR A HG21 1 
ATOM   1541  H HG22 . THR A 1 112 ? -8.864  20.708  -40.281 1.00 27.02  ? 673  THR A HG22 1 
ATOM   1542  H HG23 . THR A 1 112 ? -9.648  21.894  -39.592 1.00 27.02  ? 673  THR A HG23 1 
ATOM   1543  N N    . SER A 1 113 ? -9.422  20.256  -43.733 1.00 21.47  ? 674  SER A N    1 
ATOM   1544  C CA   . SER A 1 113 ? -8.273  19.794  -44.501 1.00 27.36  ? 674  SER A CA   1 
ATOM   1545  C C    . SER A 1 113 ? -7.760  20.892  -45.421 1.00 25.02  ? 674  SER A C    1 
ATOM   1546  O O    . SER A 1 113 ? -6.546  21.090  -45.548 1.00 26.12  ? 674  SER A O    1 
ATOM   1547  C CB   . SER A 1 113 ? -8.649  18.549  -45.301 1.00 24.14  ? 674  SER A CB   1 
ATOM   1548  O OG   . SER A 1 113 ? -7.524  18.030  -45.984 1.00 37.84  ? 674  SER A OG   1 
ATOM   1549  H H    . SER A 1 113 ? -10.152 19.828  -43.885 1.00 25.77  ? 674  SER A H    1 
ATOM   1550  H HA   . SER A 1 113 ? -7.559  19.555  -43.890 1.00 32.84  ? 674  SER A HA   1 
ATOM   1551  H HB2  . SER A 1 113 ? -8.988  17.873  -44.693 1.00 28.97  ? 674  SER A HB2  1 
ATOM   1552  H HB3  . SER A 1 113 ? -9.331  18.784  -45.949 1.00 28.97  ? 674  SER A HB3  1 
ATOM   1553  H HG   . SER A 1 113 ? -7.742  17.347  -46.421 1.00 45.41  ? 674  SER A HG   1 
ATOM   1554  N N    . GLY A 1 114 ? -8.672  21.623  -46.065 1.00 23.60  ? 675  GLY A N    1 
ATOM   1555  C CA   . GLY A 1 114 ? -8.257  22.766  -46.859 1.00 28.01  ? 675  GLY A CA   1 
ATOM   1556  C C    . GLY A 1 114 ? -7.631  23.853  -46.010 1.00 26.56  ? 675  GLY A C    1 
ATOM   1557  O O    . GLY A 1 114 ? -6.651  24.484  -46.413 1.00 27.50  ? 675  GLY A O    1 
ATOM   1558  H H    . GLY A 1 114 ? -9.519  21.478  -46.056 1.00 28.32  ? 675  GLY A H    1 
ATOM   1559  H HA2  . GLY A 1 114 ? -7.609  22.482  -47.523 1.00 33.62  ? 675  GLY A HA2  1 
ATOM   1560  H HA3  . GLY A 1 114 ? -9.026  23.138  -47.318 1.00 33.62  ? 675  GLY A HA3  1 
ATOM   1561  N N    . LEU A 1 115 ? -8.182  24.081  -44.815 1.00 23.67  ? 676  LEU A N    1 
ATOM   1562  C CA   . LEU A 1 115 ? -7.589  25.058  -43.910 1.00 21.68  ? 676  LEU A CA   1 
ATOM   1563  C C    . LEU A 1 115 ? -6.200  24.613  -43.470 1.00 23.77  ? 676  LEU A C    1 
ATOM   1564  O O    . LEU A 1 115 ? -5.271  25.426  -43.402 1.00 27.20  ? 676  LEU A O    1 
ATOM   1565  C CB   . LEU A 1 115 ? -8.495  25.272  -42.698 1.00 24.70  ? 676  LEU A CB   1 
ATOM   1566  C CG   . LEU A 1 115 ? -8.051  26.364  -41.719 1.00 30.20  ? 676  LEU A CG   1 
ATOM   1567  C CD1  . LEU A 1 115 ? -7.970  27.722  -42.413 1.00 26.93  ? 676  LEU A CD1  1 
ATOM   1568  C CD2  . LEU A 1 115 ? -8.990  26.428  -40.522 1.00 29.58  ? 676  LEU A CD2  1 
ATOM   1569  H H    . LEU A 1 115 ? -8.886  23.691  -44.513 1.00 28.41  ? 676  LEU A H    1 
ATOM   1570  H HA   . LEU A 1 115 ? -7.500  25.906  -44.373 1.00 26.01  ? 676  LEU A HA   1 
ATOM   1571  H HB2  . LEU A 1 115 ? -9.380  25.509  -43.015 1.00 29.64  ? 676  LEU A HB2  1 
ATOM   1572  H HB3  . LEU A 1 115 ? -8.543  24.440  -42.201 1.00 29.64  ? 676  LEU A HB3  1 
ATOM   1573  H HG   . LEU A 1 115 ? -7.166  26.146  -41.390 1.00 36.24  ? 676  LEU A HG   1 
ATOM   1574  H HD11 . LEU A 1 115 ? -7.687  28.389  -41.768 1.00 32.32  ? 676  LEU A HD11 1 
ATOM   1575  H HD12 . LEU A 1 115 ? -7.327  27.668  -43.137 1.00 32.32  ? 676  LEU A HD12 1 
ATOM   1576  H HD13 . LEU A 1 115 ? -8.845  27.950  -42.763 1.00 32.32  ? 676  LEU A HD13 1 
ATOM   1577  H HD21 . LEU A 1 115 ? -8.687  27.126  -39.921 1.00 35.49  ? 676  LEU A HD21 1 
ATOM   1578  H HD22 . LEU A 1 115 ? -9.887  26.627  -40.835 1.00 35.49  ? 676  LEU A HD22 1 
ATOM   1579  H HD23 . LEU A 1 115 ? -8.980  25.571  -40.067 1.00 35.49  ? 676  LEU A HD23 1 
ATOM   1580  N N    . ALA A 1 116 ? -6.040  23.320  -43.172 1.00 24.32  ? 677  ALA A N    1 
ATOM   1581  C CA   . ALA A 1 116 ? -4.731  22.804  -42.786 1.00 26.41  ? 677  ALA A CA   1 
ATOM   1582  C C    . ALA A 1 116 ? -3.728  22.925  -43.924 1.00 24.41  ? 677  ALA A C    1 
ATOM   1583  O O    . ALA A 1 116 ? -2.533  23.125  -43.680 1.00 23.37  ? 677  ALA A O    1 
ATOM   1584  C CB   . ALA A 1 116 ? -4.848  21.346  -42.341 1.00 21.69  ? 677  ALA A CB   1 
ATOM   1585  H H    . ALA A 1 116 ? -6.666  22.731  -43.187 1.00 29.18  ? 677  ALA A H    1 
ATOM   1586  H HA   . ALA A 1 116 ? -4.397  23.320  -42.036 1.00 31.69  ? 677  ALA A HA   1 
ATOM   1587  H HB1  . ALA A 1 116 ? -3.969  21.022  -42.089 1.00 26.02  ? 677  ALA A HB1  1 
ATOM   1588  H HB2  . ALA A 1 116 ? -5.450  21.295  -41.582 1.00 26.02  ? 677  ALA A HB2  1 
ATOM   1589  H HB3  . ALA A 1 116 ? -5.197  20.818  -43.076 1.00 26.02  ? 677  ALA A HB3  1 
ATOM   1590  N N    . HIS A 1 117 ? -4.189  22.800  -45.170 1.00 28.21  ? 678  HIS A N    1 
ATOM   1591  C CA   . HIS A 1 117 ? -3.293  23.003  -46.302 1.00 28.02  ? 678  HIS A CA   1 
ATOM   1592  C C    . HIS A 1 117 ? -2.799  24.442  -46.353 1.00 22.24  ? 678  HIS A C    1 
ATOM   1593  O O    . HIS A 1 117 ? -1.614  24.691  -46.602 1.00 21.69  ? 678  HIS A O    1 
ATOM   1594  C CB   . HIS A 1 117 ? -3.991  22.637  -47.610 1.00 25.44  ? 678  HIS A CB   1 
ATOM   1595  C CG   . HIS A 1 117 ? -3.097  22.716  -48.807 1.00 28.93  ? 678  HIS A CG   1 
ATOM   1596  N ND1  . HIS A 1 117 ? -3.341  23.562  -49.867 1.00 29.96  ? 678  HIS A ND1  1 
ATOM   1597  C CD2  . HIS A 1 117 ? -1.950  22.062  -49.104 1.00 30.56  ? 678  HIS A CD2  1 
ATOM   1598  C CE1  . HIS A 1 117 ? -2.386  23.420  -50.770 1.00 33.96  ? 678  HIS A CE1  1 
ATOM   1599  N NE2  . HIS A 1 117 ? -1.530  22.516  -50.330 1.00 33.81  ? 678  HIS A NE2  1 
ATOM   1600  H H    . HIS A 1 117 ? -4.999  22.602  -45.382 1.00 33.85  ? 678  HIS A H    1 
ATOM   1601  H HA   . HIS A 1 117 ? -2.521  22.424  -46.202 1.00 33.62  ? 678  HIS A HA   1 
ATOM   1602  H HB2  . HIS A 1 117 ? -4.321  21.727  -47.544 1.00 30.53  ? 678  HIS A HB2  1 
ATOM   1603  H HB3  . HIS A 1 117 ? -4.732  23.247  -47.751 1.00 30.53  ? 678  HIS A HB3  1 
ATOM   1604  H HD2  . HIS A 1 117 ? -1.527  21.422  -48.578 1.00 36.68  ? 678  HIS A HD2  1 
ATOM   1605  H HE1  . HIS A 1 117 ? -2.327  23.879  -51.576 1.00 40.75  ? 678  HIS A HE1  1 
ATOM   1606  H HE2  . HIS A 1 117 ? -0.823  22.254  -50.745 1.00 40.57  ? 678  HIS A HE2  1 
ATOM   1607  N N    . LEU A 1 118 ? -3.694  25.404  -46.119 1.00 23.10  ? 679  LEU A N    1 
ATOM   1608  C CA   . LEU A 1 118 ? -3.281  26.803  -46.079 1.00 27.91  ? 679  LEU A CA   1 
ATOM   1609  C C    . LEU A 1 118 ? -2.273  27.041  -44.963 1.00 26.82  ? 679  LEU A C    1 
ATOM   1610  O O    . LEU A 1 118 ? -1.234  27.677  -45.174 1.00 26.23  ? 679  LEU A O    1 
ATOM   1611  C CB   . LEU A 1 118 ? -4.501  27.710  -45.900 1.00 28.68  ? 679  LEU A CB   1 
ATOM   1612  C CG   . LEU A 1 118 ? -5.541  27.747  -47.024 1.00 31.73  ? 679  LEU A CG   1 
ATOM   1613  C CD1  . LEU A 1 118 ? -6.571  28.838  -46.759 1.00 35.93  ? 679  LEU A CD1  1 
ATOM   1614  C CD2  . LEU A 1 118 ? -4.891  27.955  -48.382 1.00 39.97  ? 679  LEU A CD2  1 
ATOM   1615  H H    . LEU A 1 118 ? -4.533  25.273  -45.982 1.00 27.72  ? 679  LEU A H    1 
ATOM   1616  H HA   . LEU A 1 118 ? -2.857  27.032  -46.921 1.00 33.50  ? 679  LEU A HA   1 
ATOM   1617  H HB2  . LEU A 1 118 ? -4.965  27.430  -45.095 1.00 34.41  ? 679  LEU A HB2  1 
ATOM   1618  H HB3  . LEU A 1 118 ? -4.182  28.618  -45.781 1.00 34.41  ? 679  LEU A HB3  1 
ATOM   1619  H HG   . LEU A 1 118 ? -6.008  26.897  -47.046 1.00 38.08  ? 679  LEU A HG   1 
ATOM   1620  H HD11 . LEU A 1 118 ? -7.218  28.843  -47.482 1.00 43.12  ? 679  LEU A HD11 1 
ATOM   1621  H HD12 . LEU A 1 118 ? -7.016  28.654  -45.917 1.00 43.12  ? 679  LEU A HD12 1 
ATOM   1622  H HD13 . LEU A 1 118 ? -6.118  29.695  -46.714 1.00 43.12  ? 679  LEU A HD13 1 
ATOM   1623  H HD21 . LEU A 1 118 ? -5.581  27.972  -49.063 1.00 47.97  ? 679  LEU A HD21 1 
ATOM   1624  H HD22 . LEU A 1 118 ? -4.410  28.798  -48.376 1.00 47.97  ? 679  LEU A HD22 1 
ATOM   1625  H HD23 . LEU A 1 118 ? -4.276  27.224  -48.552 1.00 47.97  ? 679  LEU A HD23 1 
ATOM   1626  N N    . HIS A 1 119 ? -2.563  26.535  -43.761 1.00 25.49  ? 680  HIS A N    1 
ATOM   1627  C CA   . HIS A 1 119 ? -1.660  26.744  -42.635 1.00 27.66  ? 680  HIS A CA   1 
ATOM   1628  C C    . HIS A 1 119 ? -0.288  26.133  -42.889 1.00 27.85  ? 680  HIS A C    1 
ATOM   1629  O O    . HIS A 1 119 ? 0.724   26.676  -42.432 1.00 29.72  ? 680  HIS A O    1 
ATOM   1630  C CB   . HIS A 1 119 ? -2.266  26.161  -41.360 1.00 28.01  ? 680  HIS A CB   1 
ATOM   1631  C CG   . HIS A 1 119 ? -3.456  26.917  -40.852 1.00 28.18  ? 680  HIS A CG   1 
ATOM   1632  N ND1  . HIS A 1 119 ? -4.045  26.644  -39.636 1.00 33.83  ? 680  HIS A ND1  1 
ATOM   1633  C CD2  . HIS A 1 119 ? -4.164  27.938  -41.390 1.00 29.32  ? 680  HIS A CD2  1 
ATOM   1634  C CE1  . HIS A 1 119 ? -5.065  27.462  -39.448 1.00 32.41  ? 680  HIS A CE1  1 
ATOM   1635  N NE2  . HIS A 1 119 ? -5.159  28.258  -40.497 1.00 32.22  ? 680  HIS A NE2  1 
ATOM   1636  H H    . HIS A 1 119 ? -3.266  26.075  -43.577 1.00 30.59  ? 680  HIS A H    1 
ATOM   1637  H HA   . HIS A 1 119 ? -1.541  27.698  -42.501 1.00 33.19  ? 680  HIS A HA   1 
ATOM   1638  H HB2  . HIS A 1 119 ? -2.547  25.250  -41.536 1.00 33.61  ? 680  HIS A HB2  1 
ATOM   1639  H HB3  . HIS A 1 119 ? -1.592  26.168  -40.662 1.00 33.61  ? 680  HIS A HB3  1 
ATOM   1640  H HD2  . HIS A 1 119 ? -4.007  28.347  -42.211 1.00 35.18  ? 680  HIS A HD2  1 
ATOM   1641  H HE1  . HIS A 1 119 ? -5.622  27.475  -38.703 1.00 38.89  ? 680  HIS A HE1  1 
ATOM   1642  H HE2  . HIS A 1 119 ? -5.747  28.876  -40.605 1.00 38.66  ? 680  HIS A HE2  1 
ATOM   1643  N N    . SER A 1 120 ? -0.227  25.013  -43.612 1.00 26.03  ? 681  SER A N    1 
ATOM   1644  C CA   . SER A 1 120 ? 1.059   24.395  -43.912 1.00 30.80  ? 681  SER A CA   1 
ATOM   1645  C C    . SER A 1 120 ? 1.886   25.234  -44.878 1.00 31.29  ? 681  SER A C    1 
ATOM   1646  O O    . SER A 1 120 ? 3.105   25.050  -44.955 1.00 34.48  ? 681  SER A O    1 
ATOM   1647  C CB   . SER A 1 120 ? 0.845   22.994  -44.483 1.00 34.27  ? 681  SER A CB   1 
ATOM   1648  O OG   . SER A 1 120 ? 0.146   23.051  -45.713 1.00 37.97  ? 681  SER A OG   1 
ATOM   1649  H H    . SER A 1 120 ? -0.908  24.598  -43.936 1.00 31.24  ? 681  SER A H    1 
ATOM   1650  H HA   . SER A 1 120 ? 1.564   24.306  -43.088 1.00 36.96  ? 681  SER A HA   1 
ATOM   1651  H HB2  . SER A 1 120 ? 1.708   22.577  -44.630 1.00 41.13  ? 681  SER A HB2  1 
ATOM   1652  H HB3  . SER A 1 120 ? 0.328   22.471  -43.851 1.00 41.13  ? 681  SER A HB3  1 
ATOM   1653  H HG   . SER A 1 120 ? -0.605  23.410  -45.600 1.00 45.56  ? 681  SER A HG   1 
ATOM   1654  N N    . LEU A 1 121 ? 1.249   26.145  -45.607 1.00 27.46  ? 682  LEU A N    1 
ATOM   1655  C CA   . LEU A 1 121 ? 1.927   27.086  -46.486 1.00 32.00  ? 682  LEU A CA   1 
ATOM   1656  C C    . LEU A 1 121 ? 2.230   28.411  -45.794 1.00 39.64  ? 682  LEU A C    1 
ATOM   1657  O O    . LEU A 1 121 ? 2.675   29.355  -46.455 1.00 39.45  ? 682  LEU A O    1 
ATOM   1658  C CB   . LEU A 1 121 ? 1.088   27.321  -47.746 1.00 33.30  ? 682  LEU A CB   1 
ATOM   1659  C CG   . LEU A 1 121 ? 0.749   26.044  -48.524 1.00 37.01  ? 682  LEU A CG   1 
ATOM   1660  C CD1  . LEU A 1 121 ? -0.161  26.349  -49.700 1.00 35.62  ? 682  LEU A CD1  1 
ATOM   1661  C CD2  . LEU A 1 121 ? 2.005   25.324  -48.995 1.00 40.39  ? 682  LEU A CD2  1 
ATOM   1662  H H    . LEU A 1 121 ? 0.394   26.238  -45.607 1.00 32.96  ? 682  LEU A H    1 
ATOM   1663  H HA   . LEU A 1 121 ? 2.772   26.699  -46.763 1.00 38.40  ? 682  LEU A HA   1 
ATOM   1664  H HB2  . LEU A 1 121 ? 0.252   27.740  -47.489 1.00 39.97  ? 682  LEU A HB2  1 
ATOM   1665  H HB3  . LEU A 1 121 ? 1.579   27.907  -48.342 1.00 39.97  ? 682  LEU A HB3  1 
ATOM   1666  H HG   . LEU A 1 121 ? 0.271   25.441  -47.933 1.00 44.42  ? 682  LEU A HG   1 
ATOM   1667  H HD11 . LEU A 1 121 ? -0.356  25.524  -50.171 1.00 42.75  ? 682  LEU A HD11 1 
ATOM   1668  H HD12 . LEU A 1 121 ? -0.983  26.744  -49.369 1.00 42.75  ? 682  LEU A HD12 1 
ATOM   1669  H HD13 . LEU A 1 121 ? 0.289   26.970  -50.294 1.00 42.75  ? 682  LEU A HD13 1 
ATOM   1670  H HD21 . LEU A 1 121 ? 1.746   24.525  -49.481 1.00 48.47  ? 682  LEU A HD21 1 
ATOM   1671  H HD22 . LEU A 1 121 ? 2.509   25.916  -49.575 1.00 48.47  ? 682  LEU A HD22 1 
ATOM   1672  H HD23 . LEU A 1 121 ? 2.539   25.083  -48.222 1.00 48.47  ? 682  LEU A HD23 1 
ATOM   1673  N N    . ASN A 1 122 ? 1.974   28.499  -44.487 1.00 37.73  ? 683  ASN A N    1 
ATOM   1674  C CA   . ASN A 1 122 ? 2.122   29.725  -43.706 1.00 38.51  ? 683  ASN A CA   1 
ATOM   1675  C C    . ASN A 1 122 ? 1.120   30.793  -44.127 1.00 35.47  ? 683  ASN A C    1 
ATOM   1676  O O    . ASN A 1 122 ? 1.414   31.988  -44.058 1.00 35.92  ? 683  ASN A O    1 
ATOM   1677  C CB   . ASN A 1 122 ? 3.550   30.283  -43.785 1.00 41.65  ? 683  ASN A CB   1 
ATOM   1678  C CG   . ASN A 1 122 ? 4.595   29.296  -43.300 1.00 45.18  ? 683  ASN A CG   1 
ATOM   1679  O OD1  . ASN A 1 122 ? 4.371   28.086  -43.296 1.00 45.90  ? 683  ASN A OD1  1 
ATOM   1680  N ND2  . ASN A 1 122 ? 5.746   29.813  -42.881 1.00 63.89  ? 683  ASN A ND2  1 
ATOM   1681  H H    . ASN A 1 122 ? 1.703   27.833  -44.015 1.00 45.28  ? 683  ASN A H    1 
ATOM   1682  H HA   . ASN A 1 122 ? 1.946   29.515  -42.776 1.00 46.21  ? 683  ASN A HA   1 
ATOM   1683  H HB2  . ASN A 1 122 ? 3.752   30.504  -44.707 1.00 49.98  ? 683  ASN A HB2  1 
ATOM   1684  H HB3  . ASN A 1 122 ? 3.609   31.078  -43.232 1.00 49.98  ? 683  ASN A HB3  1 
ATOM   1685  H HD21 . ASN A 1 122 ? 6.372   29.296  -42.596 1.00 76.66  ? 683  ASN A HD21 1 
ATOM   1686  H HD22 . ASN A 1 122 ? 5.865   30.665  -42.895 1.00 76.66  ? 683  ASN A HD22 1 
ATOM   1687  N N    . ILE A 1 123 ? -0.074  30.373  -44.543 1.00 31.80  ? 684  ILE A N    1 
ATOM   1688  C CA   . ILE A 1 123 ? -1.141  31.276  -44.959 1.00 33.95  ? 684  ILE A CA   1 
ATOM   1689  C C    . ILE A 1 123 ? -2.250  31.219  -43.915 1.00 33.23  ? 684  ILE A C    1 
ATOM   1690  O O    . ILE A 1 123 ? -2.727  30.133  -43.565 1.00 27.68  ? 684  ILE A O    1 
ATOM   1691  C CB   . ILE A 1 123 ? -1.678  30.911  -46.355 1.00 29.68  ? 684  ILE A CB   1 
ATOM   1692  C CG1  . ILE A 1 123 ? -0.564  31.046  -47.400 1.00 36.94  ? 684  ILE A CG1  1 
ATOM   1693  C CG2  . ILE A 1 123 ? -2.865  31.802  -46.721 1.00 29.64  ? 684  ILE A CG2  1 
ATOM   1694  C CD1  . ILE A 1 123 ? -0.950  30.576  -48.783 1.00 37.26  ? 684  ILE A CD1  1 
ATOM   1695  H H    . ILE A 1 123 ? -0.294  29.543  -44.593 1.00 38.16  ? 684  ILE A H    1 
ATOM   1696  H HA   . ILE A 1 123 ? -0.800  32.183  -44.992 1.00 40.74  ? 684  ILE A HA   1 
ATOM   1697  H HB   . ILE A 1 123 ? -1.977  29.988  -46.340 1.00 35.62  ? 684  ILE A HB   1 
ATOM   1698  H HG12 . ILE A 1 123 ? -0.311  31.980  -47.466 1.00 44.33  ? 684  ILE A HG12 1 
ATOM   1699  H HG13 . ILE A 1 123 ? 0.198   30.520  -47.112 1.00 44.33  ? 684  ILE A HG13 1 
ATOM   1700  H HG21 . ILE A 1 123 ? -3.185  31.554  -47.603 1.00 35.57  ? 684  ILE A HG21 1 
ATOM   1701  H HG22 . ILE A 1 123 ? -3.568  31.675  -46.065 1.00 35.57  ? 684  ILE A HG22 1 
ATOM   1702  H HG23 . ILE A 1 123 ? -2.576  32.727  -46.722 1.00 35.57  ? 684  ILE A HG23 1 
ATOM   1703  H HD11 . ILE A 1 123 ? -0.195  30.695  -49.379 1.00 44.71  ? 684  ILE A HD11 1 
ATOM   1704  H HD12 . ILE A 1 123 ? -1.194  29.638  -48.740 1.00 44.71  ? 684  ILE A HD12 1 
ATOM   1705  H HD13 . ILE A 1 123 ? -1.704  31.100  -49.095 1.00 44.71  ? 684  ILE A HD13 1 
ATOM   1706  N N    . VAL A 1 124 ? -2.644  32.386  -43.411 1.00 28.58  ? 685  VAL A N    1 
ATOM   1707  C CA   . VAL A 1 124 ? -3.780  32.527  -42.505 1.00 29.50  ? 685  VAL A CA   1 
ATOM   1708  C C    . VAL A 1 124 ? -4.936  33.137  -43.287 1.00 29.61  ? 685  VAL A C    1 
ATOM   1709  O O    . VAL A 1 124 ? -4.781  34.197  -43.906 1.00 33.44  ? 685  VAL A O    1 
ATOM   1710  C CB   . VAL A 1 124 ? -3.427  33.402  -41.289 1.00 36.90  ? 685  VAL A CB   1 
ATOM   1711  C CG1  . VAL A 1 124 ? -4.496  33.269  -40.221 1.00 31.00  ? 685  VAL A CG1  1 
ATOM   1712  C CG2  . VAL A 1 124 ? -2.073  33.012  -40.717 1.00 38.58  ? 685  VAL A CG2  1 
ATOM   1713  H H    . VAL A 1 124 ? -2.256  33.133  -43.585 1.00 34.30  ? 685  VAL A H    1 
ATOM   1714  H HA   . VAL A 1 124 ? -4.052  31.652  -42.186 1.00 35.40  ? 685  VAL A HA   1 
ATOM   1715  H HB   . VAL A 1 124 ? -3.385  34.331  -41.563 1.00 44.28  ? 685  VAL A HB   1 
ATOM   1716  H HG11 . VAL A 1 124 ? -4.257  33.826  -39.464 1.00 37.20  ? 685  VAL A HG11 1 
ATOM   1717  H HG12 . VAL A 1 124 ? -5.346  33.557  -40.589 1.00 37.20  ? 685  VAL A HG12 1 
ATOM   1718  H HG13 . VAL A 1 124 ? -4.552  32.341  -39.945 1.00 37.20  ? 685  VAL A HG13 1 
ATOM   1719  H HG21 . VAL A 1 124 ? -1.878  33.579  -39.954 1.00 46.30  ? 685  VAL A HG21 1 
ATOM   1720  H HG22 . VAL A 1 124 ? -2.103  32.083  -40.440 1.00 46.30  ? 685  VAL A HG22 1 
ATOM   1721  H HG23 . VAL A 1 124 ? -1.395  33.133  -41.401 1.00 46.30  ? 685  VAL A HG23 1 
ATOM   1722  N N    . HIS A 1 125 ? -6.096  32.475  -43.252 1.00 25.37  ? 686  HIS A N    1 
ATOM   1723  C CA   . HIS A 1 125 ? -7.251  32.962  -44.003 1.00 32.45  ? 686  HIS A CA   1 
ATOM   1724  C C    . HIS A 1 125 ? -7.803  34.245  -43.391 1.00 30.40  ? 686  HIS A C    1 
ATOM   1725  O O    . HIS A 1 125 ? -8.153  35.187  -44.111 1.00 25.31  ? 686  HIS A O    1 
ATOM   1726  C CB   . HIS A 1 125 ? -8.331  31.881  -44.060 1.00 32.20  ? 686  HIS A CB   1 
ATOM   1727  C CG   . HIS A 1 125 ? -9.300  32.055  -45.190 1.00 33.30  ? 686  HIS A CG   1 
ATOM   1728  N ND1  . HIS A 1 125 ? -10.524 32.671  -45.039 1.00 33.41  ? 686  HIS A ND1  1 
ATOM   1729  C CD2  . HIS A 1 125 ? -9.223  31.688  -46.491 1.00 42.39  ? 686  HIS A CD2  1 
ATOM   1730  C CE1  . HIS A 1 125 ? -11.157 32.677  -46.200 1.00 42.03  ? 686  HIS A CE1  1 
ATOM   1731  N NE2  . HIS A 1 125 ? -10.390 32.087  -47.096 1.00 58.13  ? 686  HIS A NE2  1 
ATOM   1732  H H    . HIS A 1 125 ? -6.236  31.752  -42.808 1.00 30.45  ? 686  HIS A H    1 
ATOM   1733  H HA   . HIS A 1 125 ? -6.976  33.158  -44.912 1.00 38.94  ? 686  HIS A HA   1 
ATOM   1734  H HB2  . HIS A 1 125 ? -7.904  31.017  -44.166 1.00 38.64  ? 686  HIS A HB2  1 
ATOM   1735  H HB3  . HIS A 1 125 ? -8.836  31.899  -43.232 1.00 38.64  ? 686  HIS A HB3  1 
ATOM   1736  H HD2  . HIS A 1 125 ? -8.513  31.249  -46.899 1.00 50.87  ? 686  HIS A HD2  1 
ATOM   1737  H HE1  . HIS A 1 125 ? -12.000 33.036  -46.357 1.00 50.44  ? 686  HIS A HE1  1 
ATOM   1738  H HE2  . HIS A 1 125 ? -10.588 31.971  -47.925 1.00 69.76  ? 686  HIS A HE2  1 
ATOM   1739  N N    . ARG A 1 126 ? -7.925  34.277  -42.063 1.00 31.24  ? 687  ARG A N    1 
ATOM   1740  C CA   . ARG A 1 126 ? -8.283  35.460  -41.281 1.00 30.05  ? 687  ARG A CA   1 
ATOM   1741  C C    . ARG A 1 126 ? -9.733  35.893  -41.463 1.00 32.90  ? 687  ARG A C    1 
ATOM   1742  O O    . ARG A 1 126 ? -10.220 36.725  -40.692 1.00 40.26  ? 687  ARG A O    1 
ATOM   1743  C CB   . ARG A 1 126 ? -7.345  36.632  -41.600 1.00 32.39  ? 687  ARG A CB   1 
ATOM   1744  C CG   . ARG A 1 126 ? -5.987  36.499  -40.931 1.00 36.94  ? 687  ARG A CG   1 
ATOM   1745  C CD   . ARG A 1 126 ? -4.840  37.082  -41.747 1.00 45.93  ? 687  ARG A CD   1 
ATOM   1746  N NE   . ARG A 1 126 ? -4.498  38.440  -41.329 1.00 49.33  ? 687  ARG A NE   1 
ATOM   1747  C CZ   . ARG A 1 126 ? -4.687  39.543  -42.050 1.00 50.79  ? 687  ARG A CZ   1 
ATOM   1748  N NH1  . ARG A 1 126 ? -5.220  39.489  -43.260 1.00 49.98  ? 687  ARG A NH1  1 
ATOM   1749  N NH2  . ARG A 1 126 ? -4.331  40.716  -41.548 1.00 64.17  ? 687  ARG A NH2  1 
ATOM   1750  H H    . ARG A 1 126 ? -7.798  33.585  -41.568 1.00 37.49  ? 687  ARG A H    1 
ATOM   1751  H HA   . ARG A 1 126 ? -8.165  35.247  -40.342 1.00 36.06  ? 687  ARG A HA   1 
ATOM   1752  H HB2  . ARG A 1 126 ? -7.204  36.672  -42.559 1.00 38.87  ? 687  ARG A HB2  1 
ATOM   1753  H HB3  . ARG A 1 126 ? -7.753  37.456  -41.290 1.00 38.87  ? 687  ARG A HB3  1 
ATOM   1754  H HG2  . ARG A 1 126 ? -6.011  36.963  -40.079 1.00 44.32  ? 687  ARG A HG2  1 
ATOM   1755  H HG3  . ARG A 1 126 ? -5.800  35.558  -40.787 1.00 44.32  ? 687  ARG A HG3  1 
ATOM   1756  H HD2  . ARG A 1 126 ? -4.054  36.524  -41.634 1.00 55.12  ? 687  ARG A HD2  1 
ATOM   1757  H HD3  . ARG A 1 126 ? -5.098  37.110  -42.682 1.00 55.12  ? 687  ARG A HD3  1 
ATOM   1758  H HE   . ARG A 1 126 ? -4.145  38.535  -40.551 1.00 59.20  ? 687  ARG A HE   1 
ATOM   1759  H HH11 . ARG A 1 126 ? -5.454  38.732  -43.594 1.00 59.98  ? 687  ARG A HH11 1 
ATOM   1760  H HH12 . ARG A 1 126 ? -5.333  40.212  -43.712 1.00 59.98  ? 687  ARG A HH12 1 
ATOM   1761  H HH21 . ARG A 1 126 ? -3.983  40.761  -40.763 1.00 77.01  ? 687  ARG A HH21 1 
ATOM   1762  H HH22 . ARG A 1 126 ? -4.448  41.434  -42.007 1.00 77.01  ? 687  ARG A HH22 1 
ATOM   1763  N N    . ASP A 1 127 ? -10.442 35.361  -42.455 1.00 35.24  ? 688  ASP A N    1 
ATOM   1764  C CA   . ASP A 1 127 ? -11.892 35.524  -42.522 1.00 39.53  ? 688  ASP A CA   1 
ATOM   1765  C C    . ASP A 1 127 ? -12.482 34.164  -42.859 1.00 35.09  ? 688  ASP A C    1 
ATOM   1766  O O    . ASP A 1 127 ? -12.257 33.649  -43.953 1.00 45.60  ? 688  ASP A O    1 
ATOM   1767  C CB   . ASP A 1 127 ? -12.267 36.582  -43.560 1.00 47.63  ? 688  ASP A CB   1 
ATOM   1768  C CG   . ASP A 1 127 ? -13.761 36.842  -43.642 1.00 51.62  ? 688  ASP A CG   1 
ATOM   1769  O OD1  . ASP A 1 127 ? -14.467 36.670  -42.631 1.00 55.41  ? 688  ASP A OD1  1 
ATOM   1770  O OD2  . ASP A 1 127 ? -14.223 37.240  -44.735 1.00 51.45  ? 688  ASP A OD2  1 
ATOM   1771  H H    . ASP A 1 127 ? -10.109 34.902  -43.102 1.00 42.29  ? 688  ASP A H    1 
ATOM   1772  H HA   . ASP A 1 127 ? -12.230 35.804  -41.657 1.00 47.44  ? 688  ASP A HA   1 
ATOM   1773  H HB2  . ASP A 1 127 ? -11.831 37.417  -43.330 1.00 57.16  ? 688  ASP A HB2  1 
ATOM   1774  H HB3  . ASP A 1 127 ? -11.968 36.284  -44.434 1.00 57.16  ? 688  ASP A HB3  1 
ATOM   1775  N N    . LEU A 1 128 ? -13.242 33.584  -41.938 1.00 44.67  ? 689  LEU A N    1 
ATOM   1776  C CA   . LEU A 1 128 ? -13.816 32.264  -42.164 1.00 36.21  ? 689  LEU A CA   1 
ATOM   1777  C C    . LEU A 1 128 ? -15.236 32.245  -41.634 1.00 35.49  ? 689  LEU A C    1 
ATOM   1778  O O    . LEU A 1 128 ? -15.487 32.666  -40.501 1.00 37.08  ? 689  LEU A O    1 
ATOM   1779  C CB   . LEU A 1 128 ? -12.977 31.168  -41.493 1.00 39.11  ? 689  LEU A CB   1 
ATOM   1780  C CG   . LEU A 1 128 ? -13.147 29.741  -42.027 1.00 39.56  ? 689  LEU A CG   1 
ATOM   1781  C CD1  . LEU A 1 128 ? -12.763 29.641  -43.495 1.00 35.65  ? 689  LEU A CD1  1 
ATOM   1782  C CD2  . LEU A 1 128 ? -12.328 28.751  -41.207 1.00 34.31  ? 689  LEU A CD2  1 
ATOM   1783  H H    . LEU A 1 128 ? -13.439 33.931  -41.176 1.00 53.60  ? 689  LEU A H    1 
ATOM   1784  H HA   . LEU A 1 128 ? -13.844 32.086  -43.117 1.00 43.45  ? 689  LEU A HA   1 
ATOM   1785  H HB2  . LEU A 1 128 ? -12.041 31.401  -41.593 1.00 46.94  ? 689  LEU A HB2  1 
ATOM   1786  H HB3  . LEU A 1 128 ? -13.204 31.149  -40.550 1.00 46.94  ? 689  LEU A HB3  1 
ATOM   1787  H HG   . LEU A 1 128 ? -14.080 29.489  -41.949 1.00 47.47  ? 689  LEU A HG   1 
ATOM   1788  H HD11 . LEU A 1 128 ? -12.885 28.725  -43.791 1.00 42.78  ? 689  LEU A HD11 1 
ATOM   1789  H HD12 . LEU A 1 128 ? -13.332 30.234  -44.011 1.00 42.78  ? 689  LEU A HD12 1 
ATOM   1790  H HD13 . LEU A 1 128 ? -11.834 29.902  -43.597 1.00 42.78  ? 689  LEU A HD13 1 
ATOM   1791  H HD21 . LEU A 1 128 ? -12.456 27.860  -41.568 1.00 41.18  ? 689  LEU A HD21 1 
ATOM   1792  H HD22 . LEU A 1 128 ? -11.392 28.998  -41.257 1.00 41.18  ? 689  LEU A HD22 1 
ATOM   1793  H HD23 . LEU A 1 128 ? -12.629 28.780  -40.285 1.00 41.18  ? 689  LEU A HD23 1 
ATOM   1794  N N    . LYS A 1 129 ? -16.153 31.769  -42.459 1.00 29.46  ? 690  LYS A N    1 
ATOM   1795  C CA   . LYS A 1 129 ? -17.557 31.736  -42.090 1.00 40.85  ? 690  LYS A CA   1 
ATOM   1796  C C    . LYS A 1 129 ? -18.323 30.840  -43.053 1.00 37.52  ? 690  LYS A C    1 
ATOM   1797  O O    . LYS A 1 129 ? -17.746 30.339  -44.025 1.00 42.05  ? 690  LYS A O    1 
ATOM   1798  C CB   . LYS A 1 129 ? -18.119 33.158  -42.103 1.00 43.41  ? 690  LYS A CB   1 
ATOM   1799  C CG   . LYS A 1 129 ? -17.784 33.913  -43.380 1.00 41.58  ? 690  LYS A CG   1 
ATOM   1800  C CD   . LYS A 1 129 ? -18.251 35.352  -43.337 1.00 45.11  ? 690  LYS A CD   1 
ATOM   1801  C CE   . LYS A 1 129 ? -17.794 36.098  -44.579 1.00 45.19  ? 690  LYS A CE   1 
ATOM   1802  N NZ   . LYS A 1 129 ? -18.316 37.490  -44.626 1.00 49.54  ? 690  LYS A NZ   1 
ATOM   1803  H H    . LYS A 1 129 ? -15.988 31.457  -43.243 1.00 35.36  ? 690  LYS A H    1 
ATOM   1804  H HA   . LYS A 1 129 ? -17.649 31.376  -41.194 1.00 49.02  ? 690  LYS A HA   1 
ATOM   1805  H HB2  . LYS A 1 129 ? -19.085 33.116  -42.025 1.00 52.09  ? 690  LYS A HB2  1 
ATOM   1806  H HB3  . LYS A 1 129 ? -17.746 33.652  -41.356 1.00 52.09  ? 690  LYS A HB3  1 
ATOM   1807  H HG2  . LYS A 1 129 ? -16.822 33.912  -43.506 1.00 49.89  ? 690  LYS A HG2  1 
ATOM   1808  H HG3  . LYS A 1 129 ? -18.219 33.478  -44.130 1.00 49.89  ? 690  LYS A HG3  1 
ATOM   1809  H HD2  . LYS A 1 129 ? -19.220 35.377  -43.304 1.00 54.13  ? 690  LYS A HD2  1 
ATOM   1810  H HD3  . LYS A 1 129 ? -17.873 35.791  -42.559 1.00 54.13  ? 690  LYS A HD3  1 
ATOM   1811  H HE2  . LYS A 1 129 ? -16.825 36.140  -44.586 1.00 54.22  ? 690  LYS A HE2  1 
ATOM   1812  H HE3  . LYS A 1 129 ? -18.113 35.630  -45.366 1.00 54.22  ? 690  LYS A HE3  1 
ATOM   1813  H HZ1  . LYS A 1 129 ? -18.030 37.897  -45.364 1.00 59.45  ? 690  LYS A HZ1  1 
ATOM   1814  H HZ2  . LYS A 1 129 ? -19.206 37.481  -44.627 1.00 59.45  ? 690  LYS A HZ2  1 
ATOM   1815  H HZ3  . LYS A 1 129 ? -18.032 37.946  -43.916 1.00 59.45  ? 690  LYS A HZ3  1 
ATOM   1816  N N    . PRO A 1 130 ? -19.622 30.628  -42.834 1.00 35.81  ? 691  PRO A N    1 
ATOM   1817  C CA   . PRO A 1 130 ? -20.398 29.840  -43.803 1.00 42.56  ? 691  PRO A CA   1 
ATOM   1818  C C    . PRO A 1 130 ? -20.491 30.494  -45.167 1.00 40.13  ? 691  PRO A C    1 
ATOM   1819  O O    . PRO A 1 130 ? -20.560 29.788  -46.180 1.00 41.93  ? 691  PRO A O    1 
ATOM   1820  C CB   . PRO A 1 130 ? -21.775 29.728  -43.134 1.00 45.40  ? 691  PRO A CB   1 
ATOM   1821  C CG   . PRO A 1 130 ? -21.503 29.879  -41.682 1.00 39.89  ? 691  PRO A CG   1 
ATOM   1822  C CD   . PRO A 1 130 ? -20.355 30.832  -41.573 1.00 35.96  ? 691  PRO A CD   1 
ATOM   1823  H HA   . PRO A 1 130 ? -20.016 28.954  -43.898 1.00 51.07  ? 691  PRO A HA   1 
ATOM   1824  H HB2  . PRO A 1 130 ? -22.353 30.440  -43.452 1.00 54.47  ? 691  PRO A HB2  1 
ATOM   1825  H HB3  . PRO A 1 130 ? -22.162 28.859  -43.324 1.00 54.47  ? 691  PRO A HB3  1 
ATOM   1826  H HG2  . PRO A 1 130 ? -22.288 30.240  -41.241 1.00 47.87  ? 691  PRO A HG2  1 
ATOM   1827  H HG3  . PRO A 1 130 ? -21.267 29.017  -41.305 1.00 47.87  ? 691  PRO A HG3  1 
ATOM   1828  H HD2  . PRO A 1 130 ? -20.677 31.745  -41.513 1.00 43.15  ? 691  PRO A HD2  1 
ATOM   1829  H HD3  . PRO A 1 130 ? -19.795 30.602  -40.815 1.00 43.15  ? 691  PRO A HD3  1 
ATOM   1830  N N    . HIS A 1 131 ? -20.494 31.827  -45.226 1.00 45.32  ? 692  HIS A N    1 
ATOM   1831  C CA   . HIS A 1 131 ? -20.632 32.510  -46.507 1.00 42.45  ? 692  HIS A CA   1 
ATOM   1832  C C    . HIS A 1 131 ? -19.367 32.384  -47.347 1.00 42.82  ? 692  HIS A C    1 
ATOM   1833  O O    . HIS A 1 131 ? -19.440 32.404  -48.581 1.00 35.46  ? 692  HIS A O    1 
ATOM   1834  C CB   . HIS A 1 131 ? -20.977 33.983  -46.281 1.00 43.30  ? 692  HIS A CB   1 
ATOM   1835  C CG   . HIS A 1 131 ? -21.953 34.216  -45.167 1.00 50.66  ? 692  HIS A CG   1 
ATOM   1836  N ND1  . HIS A 1 131 ? -21.561 34.379  -43.855 1.00 49.18  ? 692  HIS A ND1  1 
ATOM   1837  C CD2  . HIS A 1 131 ? -23.303 34.318  -45.170 1.00 50.40  ? 692  HIS A CD2  1 
ATOM   1838  C CE1  . HIS A 1 131 ? -22.627 34.570  -43.098 1.00 47.44  ? 692  HIS A CE1  1 
ATOM   1839  N NE2  . HIS A 1 131 ? -23.697 34.537  -43.871 1.00 55.90  ? 692  HIS A NE2  1 
ATOM   1840  H H    . HIS A 1 131 ? -20.419 32.350  -44.547 1.00 54.39  ? 692  HIS A H    1 
ATOM   1841  H HA   . HIS A 1 131 ? -21.361 32.105  -47.002 1.00 50.94  ? 692  HIS A HA   1 
ATOM   1842  H HB2  . HIS A 1 131 ? -20.163 34.465  -46.068 1.00 51.96  ? 692  HIS A HB2  1 
ATOM   1843  H HB3  . HIS A 1 131 ? -21.366 34.340  -47.095 1.00 51.96  ? 692  HIS A HB3  1 
ATOM   1844  H HD2  . HIS A 1 131 ? -23.860 34.252  -45.912 1.00 60.48  ? 692  HIS A HD2  1 
ATOM   1845  H HE1  . HIS A 1 131 ? -22.624 34.703  -42.178 1.00 56.93  ? 692  HIS A HE1  1 
ATOM   1846  H HE2  . HIS A 1 131 ? -24.508 34.637  -43.605 1.00 67.08  ? 692  HIS A HE2  1 
ATOM   1847  N N    . ASN A 1 132 ? -18.203 32.248  -46.705 1.00 47.80  ? 693  ASN A N    1 
ATOM   1848  C CA   . ASN A 1 132 ? -16.953 32.074  -47.436 1.00 43.93  ? 693  ASN A CA   1 
ATOM   1849  C C    . ASN A 1 132 ? -16.785 30.657  -47.969 1.00 34.62  ? 693  ASN A C    1 
ATOM   1850  O O    . ASN A 1 132 ? -16.135 30.463  -49.001 1.00 41.28  ? 693  ASN A O    1 
ATOM   1851  C CB   . ASN A 1 132 ? -15.761 32.418  -46.540 1.00 45.80  ? 693  ASN A CB   1 
ATOM   1852  C CG   . ASN A 1 132 ? -15.391 33.890  -46.581 1.00 48.57  ? 693  ASN A CG   1 
ATOM   1853  O OD1  . ASN A 1 132 ? -15.768 34.618  -47.499 1.00 48.84  ? 693  ASN A OD1  1 
ATOM   1854  N ND2  . ASN A 1 132 ? -14.629 34.330  -45.582 1.00 61.68  ? 693  ASN A ND2  1 
ATOM   1855  H H    . ASN A 1 132 ? -18.115 32.253  -45.849 1.00 57.36  ? 693  ASN A H    1 
ATOM   1856  H HA   . ASN A 1 132 ? -16.944 32.680  -48.193 1.00 52.72  ? 693  ASN A HA   1 
ATOM   1857  H HB2  . ASN A 1 132 ? -15.980 32.190  -45.623 1.00 54.96  ? 693  ASN A HB2  1 
ATOM   1858  H HB3  . ASN A 1 132 ? -14.989 31.908  -46.832 1.00 54.96  ? 693  ASN A HB3  1 
ATOM   1859  H HD21 . ASN A 1 132 ? -14.390 35.156  -45.555 1.00 74.02  ? 693  ASN A HD21 1 
ATOM   1860  H HD22 . ASN A 1 132 ? -14.376 33.789  -44.963 1.00 74.02  ? 693  ASN A HD22 1 
ATOM   1861  N N    . ILE A 1 133 ? -17.343 29.665  -47.284 1.00 36.10  ? 694  ILE A N    1 
ATOM   1862  C CA   . ILE A 1 133 ? -17.166 28.271  -47.677 1.00 34.44  ? 694  ILE A CA   1 
ATOM   1863  C C    . ILE A 1 133 ? -18.166 27.946  -48.778 1.00 30.34  ? 694  ILE A C    1 
ATOM   1864  O O    . ILE A 1 133 ? -19.356 28.266  -48.667 1.00 35.02  ? 694  ILE A O    1 
ATOM   1865  C CB   . ILE A 1 133 ? -17.341 27.339  -46.467 1.00 35.80  ? 694  ILE A CB   1 
ATOM   1866  C CG1  . ILE A 1 133 ? -16.368 27.730  -45.348 1.00 33.41  ? 694  ILE A CG1  1 
ATOM   1867  C CG2  . ILE A 1 133 ? -17.119 25.890  -46.881 1.00 28.26  ? 694  ILE A CG2  1 
ATOM   1868  C CD1  . ILE A 1 133 ? -16.630 27.026  -44.045 1.00 40.94  ? 694  ILE A CD1  1 
ATOM   1869  H H    . ILE A 1 133 ? -17.832 29.773  -46.584 1.00 43.32  ? 694  ILE A H    1 
ATOM   1870  H HA   . ILE A 1 133 ? -16.271 28.148  -48.030 1.00 41.33  ? 694  ILE A HA   1 
ATOM   1871  H HB   . ILE A 1 133 ? -18.248 27.430  -46.134 1.00 42.96  ? 694  ILE A HB   1 
ATOM   1872  H HG12 . ILE A 1 133 ? -15.465 27.511  -45.627 1.00 40.09  ? 694  ILE A HG12 1 
ATOM   1873  H HG13 . ILE A 1 133 ? -16.441 28.684  -45.190 1.00 40.09  ? 694  ILE A HG13 1 
ATOM   1874  H HG21 . ILE A 1 133 ? -17.234 25.319  -46.105 1.00 33.91  ? 694  ILE A HG21 1 
ATOM   1875  H HG22 . ILE A 1 133 ? -17.766 25.654  -47.564 1.00 33.91  ? 694  ILE A HG22 1 
ATOM   1876  H HG23 . ILE A 1 133 ? -16.219 25.796  -47.231 1.00 33.91  ? 694  ILE A HG23 1 
ATOM   1877  H HD11 . ILE A 1 133 ? -15.979 27.323  -43.390 1.00 49.12  ? 694  ILE A HD11 1 
ATOM   1878  H HD12 . ILE A 1 133 ? -17.526 27.244  -43.744 1.00 49.12  ? 694  ILE A HD12 1 
ATOM   1879  H HD13 . ILE A 1 133 ? -16.549 26.069  -44.182 1.00 49.12  ? 694  ILE A HD13 1 
ATOM   1880  N N    . LEU A 1 134 ? -17.684 27.317  -49.846 1.00 26.10  ? 695  LEU A N    1 
ATOM   1881  C CA   . LEU A 1 134 ? -18.483 27.033  -51.028 1.00 38.52  ? 695  LEU A CA   1 
ATOM   1882  C C    . LEU A 1 134 ? -18.690 25.533  -51.196 1.00 35.12  ? 695  LEU A C    1 
ATOM   1883  O O    . LEU A 1 134 ? -17.815 24.725  -50.874 1.00 27.31  ? 695  LEU A O    1 
ATOM   1884  C CB   . LEU A 1 134 ? -17.820 27.604  -52.286 1.00 32.61  ? 695  LEU A CB   1 
ATOM   1885  C CG   . LEU A 1 134 ? -17.650 29.124  -52.294 1.00 35.51  ? 695  LEU A CG   1 
ATOM   1886  C CD1  . LEU A 1 134 ? -16.981 29.579  -53.573 1.00 32.54  ? 695  LEU A CD1  1 
ATOM   1887  C CD2  . LEU A 1 134 ? -18.989 29.822  -52.123 1.00 38.93  ? 695  LEU A CD2  1 
ATOM   1888  H H    . LEU A 1 134 ? -16.873 27.038  -49.909 1.00 31.32  ? 695  LEU A H    1 
ATOM   1889  H HA   . LEU A 1 134 ? -19.354 27.449  -50.931 1.00 46.22  ? 695  LEU A HA   1 
ATOM   1890  H HB2  . LEU A 1 134 ? -16.938 27.211  -52.375 1.00 39.13  ? 695  LEU A HB2  1 
ATOM   1891  H HB3  . LEU A 1 134 ? -18.361 27.366  -53.055 1.00 39.13  ? 695  LEU A HB3  1 
ATOM   1892  H HG   . LEU A 1 134 ? -17.082 29.382  -51.552 1.00 42.62  ? 695  LEU A HG   1 
ATOM   1893  H HD11 . LEU A 1 134 ? -16.885 30.544  -53.554 1.00 39.05  ? 695  LEU A HD11 1 
ATOM   1894  H HD12 . LEU A 1 134 ? -16.108 29.161  -53.638 1.00 39.05  ? 695  LEU A HD12 1 
ATOM   1895  H HD13 . LEU A 1 134 ? -17.530 29.315  -54.328 1.00 39.05  ? 695  LEU A HD13 1 
ATOM   1896  H HD21 . LEU A 1 134 ? -18.848 30.782  -52.133 1.00 46.72  ? 695  LEU A HD21 1 
ATOM   1897  H HD22 . LEU A 1 134 ? -19.574 29.566  -52.854 1.00 46.72  ? 695  LEU A HD22 1 
ATOM   1898  H HD23 . LEU A 1 134 ? -19.379 29.553  -51.277 1.00 46.72  ? 695  LEU A HD23 1 
ATOM   1899  N N    . ILE A 1 135 ? -19.863 25.177  -51.709 1.00 33.64  ? 696  ILE A N    1 
ATOM   1900  C CA   . ILE A 1 135 ? -20.221 23.794  -52.005 1.00 36.65  ? 696  ILE A CA   1 
ATOM   1901  C C    . ILE A 1 135 ? -19.993 23.571  -53.493 1.00 35.02  ? 696  ILE A C    1 
ATOM   1902  O O    . ILE A 1 135 ? -20.653 24.196  -54.331 1.00 30.89  ? 696  ILE A O    1 
ATOM   1903  C CB   . ILE A 1 135 ? -21.679 23.496  -51.618 1.00 36.79  ? 696  ILE A CB   1 
ATOM   1904  C CG1  . ILE A 1 135 ? -21.946 23.905  -50.164 1.00 38.35  ? 696  ILE A CG1  1 
ATOM   1905  C CG2  . ILE A 1 135 ? -22.002 22.022  -51.842 1.00 34.45  ? 696  ILE A CG2  1 
ATOM   1906  C CD1  . ILE A 1 135 ? -21.088 23.187  -49.138 1.00 36.18  ? 696  ILE A CD1  1 
ATOM   1907  H H    . ILE A 1 135 ? -20.488 25.736  -51.899 1.00 40.37  ? 696  ILE A H    1 
ATOM   1908  H HA   . ILE A 1 135 ? -19.641 23.195  -51.510 1.00 43.98  ? 696  ILE A HA   1 
ATOM   1909  H HB   . ILE A 1 135 ? -22.257 24.022  -52.192 1.00 44.15  ? 696  ILE A HB   1 
ATOM   1910  H HG12 . ILE A 1 135 ? -21.777 24.856  -50.074 1.00 46.02  ? 696  ILE A HG12 1 
ATOM   1911  H HG13 . ILE A 1 135 ? -22.874 23.717  -49.954 1.00 46.02  ? 696  ILE A HG13 1 
ATOM   1912  H HG21 . ILE A 1 135 ? -22.925 21.860  -51.591 1.00 41.34  ? 696  ILE A HG21 1 
ATOM   1913  H HG22 . ILE A 1 135 ? -21.871 21.809  -52.779 1.00 41.34  ? 696  ILE A HG22 1 
ATOM   1914  H HG23 . ILE A 1 135 ? -21.410 21.483  -51.294 1.00 41.34  ? 696  ILE A HG23 1 
ATOM   1915  H HD11 . ILE A 1 135 ? -21.323 23.506  -48.252 1.00 43.41  ? 696  ILE A HD11 1 
ATOM   1916  H HD12 . ILE A 1 135 ? -21.253 22.233  -49.201 1.00 43.41  ? 696  ILE A HD12 1 
ATOM   1917  H HD13 . ILE A 1 135 ? -20.154 23.374  -49.321 1.00 43.41  ? 696  ILE A HD13 1 
ATOM   1918  N N    . SER A 1 136 ? -19.075 22.669  -53.822 1.00 36.64  ? 697  SER A N    1 
ATOM   1919  C CA   . SER A 1 136 ? -18.677 22.466  -55.205 1.00 32.39  ? 697  SER A CA   1 
ATOM   1920  C C    . SER A 1 136 ? -19.824 21.886  -56.024 1.00 31.74  ? 697  SER A C    1 
ATOM   1921  O O    . SER A 1 136 ? -20.779 21.313  -55.494 1.00 32.81  ? 697  SER A O    1 
ATOM   1922  C CB   . SER A 1 136 ? -17.480 21.522  -55.287 1.00 33.70  ? 697  SER A CB   1 
ATOM   1923  O OG   . SER A 1 136 ? -17.905 20.172  -55.214 1.00 36.06  ? 697  SER A OG   1 
ATOM   1924  H H    . SER A 1 136 ? -18.667 22.162  -53.260 1.00 43.97  ? 697  SER A H    1 
ATOM   1925  H HA   . SER A 1 136 ? -18.422 23.317  -55.595 1.00 38.87  ? 697  SER A HA   1 
ATOM   1926  H HB2  . SER A 1 136 ? -17.022 21.664  -56.130 1.00 40.44  ? 697  SER A HB2  1 
ATOM   1927  H HB3  . SER A 1 136 ? -16.881 21.705  -54.547 1.00 40.44  ? 697  SER A HB3  1 
ATOM   1928  H HG   . SER A 1 136 ? -17.242 19.659  -55.260 1.00 43.27  ? 697  SER A HG   1 
ATOM   1929  N N    . MET A 1 137 ? -19.725 22.061  -57.335 1.00 36.50  ? 698  MET A N    1 
ATOM   1930  C CA   . MET A 1 137 ? -20.607 21.351  -58.241 1.00 38.64  ? 698  MET A CA   1 
ATOM   1931  C C    . MET A 1 137 ? -20.166 19.893  -58.354 1.00 37.34  ? 698  MET A C    1 
ATOM   1932  O O    . MET A 1 137 ? -18.984 19.579  -58.186 1.00 34.68  ? 698  MET A O    1 
ATOM   1933  C CB   . MET A 1 137 ? -20.604 22.008  -59.616 1.00 38.94  ? 698  MET A CB   1 
ATOM   1934  C CG   . MET A 1 137 ? -21.724 23.013  -59.799 1.00 43.49  ? 698  MET A CG   1 
ATOM   1935  S SD   . MET A 1 137 ? -21.439 24.172  -61.146 1.00 67.67  ? 698  MET A SD   1 
ATOM   1936  C CE   . MET A 1 137 ? -22.903 25.196  -61.016 1.00 71.93  ? 698  MET A CE   1 
ATOM   1937  H H    . MET A 1 137 ? -19.159 22.581  -57.721 1.00 43.80  ? 698  MET A H    1 
ATOM   1938  H HA   . MET A 1 137 ? -21.512 21.383  -57.893 1.00 46.37  ? 698  MET A HA   1 
ATOM   1939  H HB2  . MET A 1 137 ? -19.762 22.473  -59.740 1.00 46.73  ? 698  MET A HB2  1 
ATOM   1940  H HB3  . MET A 1 137 ? -20.705 21.321  -60.293 1.00 46.73  ? 698  MET A HB3  1 
ATOM   1941  H HG2  . MET A 1 137 ? -22.546 22.534  -59.987 1.00 52.19  ? 698  MET A HG2  1 
ATOM   1942  H HG3  . MET A 1 137 ? -21.821 23.525  -58.981 1.00 52.19  ? 698  MET A HG3  1 
ATOM   1943  H HE1  . MET A 1 137 ? -22.873 25.879  -61.704 1.00 86.32  ? 698  MET A HE1  1 
ATOM   1944  H HE2  . MET A 1 137 ? -23.689 24.639  -61.136 1.00 86.32  ? 698  MET A HE2  1 
ATOM   1945  H HE3  . MET A 1 137 ? -22.922 25.609  -60.139 1.00 86.32  ? 698  MET A HE3  1 
ATOM   1946  N N    . PRO A 1 138 ? -21.097 18.981  -58.634 1.00 39.11  ? 699  PRO A N    1 
ATOM   1947  C CA   . PRO A 1 138 ? -20.740 17.558  -58.666 1.00 46.43  ? 699  PRO A CA   1 
ATOM   1948  C C    . PRO A 1 138 ? -19.730 17.254  -59.762 1.00 50.40  ? 699  PRO A C    1 
ATOM   1949  O O    . PRO A 1 138 ? -19.835 17.747  -60.887 1.00 49.20  ? 699  PRO A O    1 
ATOM   1950  C CB   . PRO A 1 138 ? -22.081 16.860  -58.921 1.00 46.31  ? 699  PRO A CB   1 
ATOM   1951  C CG   . PRO A 1 138 ? -22.934 17.899  -59.570 1.00 37.06  ? 699  PRO A CG   1 
ATOM   1952  C CD   . PRO A 1 138 ? -22.516 19.203  -58.961 1.00 38.54  ? 699  PRO A CD   1 
ATOM   1953  H HA   . PRO A 1 138 ? -20.385 17.276  -57.808 1.00 55.72  ? 699  PRO A HA   1 
ATOM   1954  H HB2  . PRO A 1 138 ? -21.949 16.104  -59.514 1.00 55.57  ? 699  PRO A HB2  1 
ATOM   1955  H HB3  . PRO A 1 138 ? -22.468 16.574  -58.079 1.00 55.57  ? 699  PRO A HB3  1 
ATOM   1956  H HG2  . PRO A 1 138 ? -22.773 17.901  -60.526 1.00 44.47  ? 699  PRO A HG2  1 
ATOM   1957  H HG3  . PRO A 1 138 ? -23.868 17.718  -59.381 1.00 44.47  ? 699  PRO A HG3  1 
ATOM   1958  H HD2  . PRO A 1 138 ? -22.606 19.922  -59.606 1.00 46.24  ? 699  PRO A HD2  1 
ATOM   1959  H HD3  . PRO A 1 138 ? -23.026 19.380  -58.155 1.00 46.24  ? 699  PRO A HD3  1 
ATOM   1960  N N    . ASN A 1 139 ? -18.741 16.431  -59.416 1.00 53.68  ? 700  ASN A N    1 
ATOM   1961  C CA   . ASN A 1 139 ? -17.713 16.016  -60.361 1.00 57.90  ? 700  ASN A CA   1 
ATOM   1962  C C    . ASN A 1 139 ? -18.245 14.852  -61.198 1.00 61.26  ? 700  ASN A C    1 
ATOM   1963  O O    . ASN A 1 139 ? -19.435 14.527  -61.168 1.00 64.52  ? 700  ASN A O    1 
ATOM   1964  C CB   . ASN A 1 139 ? -16.418 15.679  -59.621 1.00 59.59  ? 700  ASN A CB   1 
ATOM   1965  C CG   . ASN A 1 139 ? -16.595 14.598  -58.561 1.00 51.45  ? 700  ASN A CG   1 
ATOM   1966  O OD1  . ASN A 1 139 ? -17.543 13.813  -58.599 1.00 47.37  ? 700  ASN A OD1  1 
ATOM   1967  N ND2  . ASN A 1 139 ? -15.668 14.554  -57.607 1.00 42.43  ? 700  ASN A ND2  1 
ATOM   1968  H H    . ASN A 1 139 ? -18.645 16.098  -58.630 1.00 64.42  ? 700  ASN A H    1 
ATOM   1969  H HA   . ASN A 1 139 ? -17.526 16.752  -60.963 1.00 69.48  ? 700  ASN A HA   1 
ATOM   1970  H HB2  . ASN A 1 139 ? -15.762 15.364  -60.262 1.00 71.50  ? 700  ASN A HB2  1 
ATOM   1971  H HB3  . ASN A 1 139 ? -16.091 16.478  -59.179 1.00 71.50  ? 700  ASN A HB3  1 
ATOM   1972  H HD21 . ASN A 1 139 ? -15.720 13.964  -56.984 1.00 50.91  ? 700  ASN A HD21 1 
ATOM   1973  H HD22 . ASN A 1 139 ? -15.018 15.117  -57.614 1.00 50.91  ? 700  ASN A HD22 1 
ATOM   1974  N N    . ALA A 1 140 ? -17.359 14.218  -61.972 1.00 59.67  ? 701  ALA A N    1 
ATOM   1975  C CA   . ALA A 1 140 ? -17.786 13.170  -62.896 1.00 69.24  ? 701  ALA A CA   1 
ATOM   1976  C C    . ALA A 1 140 ? -18.528 12.047  -62.184 1.00 64.49  ? 701  ALA A C    1 
ATOM   1977  O O    . ALA A 1 140 ? -19.446 11.450  -62.759 1.00 66.51  ? 701  ALA A O    1 
ATOM   1978  C CB   . ALA A 1 140 ? -16.576 12.609  -63.643 1.00 76.53  ? 701  ALA A CB   1 
ATOM   1979  H H    . ALA A 1 140 ? -16.514 14.377  -61.980 1.00 71.60  ? 701  ALA A H    1 
ATOM   1980  H HA   . ALA A 1 140 ? -18.388 13.556  -63.551 1.00 83.09  ? 701  ALA A HA   1 
ATOM   1981  H HB1  . ALA A 1 140 ? -16.876 11.915  -64.252 1.00 91.83  ? 701  ALA A HB1  1 
ATOM   1982  H HB2  . ALA A 1 140 ? -16.153 13.326  -64.141 1.00 91.83  ? 701  ALA A HB2  1 
ATOM   1983  H HB3  . ALA A 1 140 ? -15.952 12.239  -63.000 1.00 91.83  ? 701  ALA A HB3  1 
ATOM   1984  N N    . HIS A 1 141 ? -18.157 11.747  -60.941 1.00 64.06  ? 702  HIS A N    1 
ATOM   1985  C CA   . HIS A 1 141 ? -18.810 10.698  -60.169 1.00 63.84  ? 702  HIS A CA   1 
ATOM   1986  C C    . HIS A 1 141 ? -19.978 11.213  -59.339 1.00 60.07  ? 702  HIS A C    1 
ATOM   1987  O O    . HIS A 1 141 ? -20.580 10.432  -58.594 1.00 59.43  ? 702  HIS A O    1 
ATOM   1988  C CB   . HIS A 1 141 ? -17.793 10.008  -59.255 1.00 63.75  ? 702  HIS A CB   1 
ATOM   1989  C CG   . HIS A 1 141 ? -16.674 9.346   -59.995 1.00 63.66  ? 702  HIS A CG   1 
ATOM   1990  N ND1  . HIS A 1 141 ? -16.862 8.235   -60.788 1.00 58.47  ? 702  HIS A ND1  1 
ATOM   1991  C CD2  . HIS A 1 141 ? -15.354 9.639   -60.065 1.00 62.58  ? 702  HIS A CD2  1 
ATOM   1992  C CE1  . HIS A 1 141 ? -15.707 7.871   -61.315 1.00 56.51  ? 702  HIS A CE1  1 
ATOM   1993  N NE2  . HIS A 1 141 ? -14.775 8.706   -60.892 1.00 60.71  ? 702  HIS A NE2  1 
ATOM   1994  H H    . HIS A 1 141 ? -17.521 12.144  -60.520 1.00 76.87  ? 702  HIS A H    1 
ATOM   1995  H HA   . HIS A 1 141 ? -19.156 10.031  -60.783 1.00 76.61  ? 702  HIS A HA   1 
ATOM   1996  H HB2  . HIS A 1 141 ? -17.406 10.671  -58.661 1.00 76.50  ? 702  HIS A HB2  1 
ATOM   1997  H HB3  . HIS A 1 141 ? -18.250 9.328   -58.736 1.00 76.50  ? 702  HIS A HB3  1 
ATOM   1998  H HD2  . HIS A 1 141 ? -14.920 10.339  -59.634 1.00 75.10  ? 702  HIS A HD2  1 
ATOM   1999  H HE1  . HIS A 1 141 ? -15.572 7.150   -61.886 1.00 67.81  ? 702  HIS A HE1  1 
ATOM   2000  H HE2  . HIS A 1 141 ? -13.941 8.672   -61.100 1.00 72.85  ? 702  HIS A HE2  1 
ATOM   2001  N N    . GLY A 1 142 ? -20.312 12.497  -59.446 1.00 60.87  ? 703  GLY A N    1 
ATOM   2002  C CA   . GLY A 1 142 ? -21.408 13.054  -58.682 1.00 58.17  ? 703  GLY A CA   1 
ATOM   2003  C C    . GLY A 1 142 ? -21.073 13.372  -57.245 1.00 52.48  ? 703  GLY A C    1 
ATOM   2004  O O    . GLY A 1 142 ? -21.987 13.538  -56.432 1.00 48.57  ? 703  GLY A O    1 
ATOM   2005  H H    . GLY A 1 142 ? -19.914 13.063  -59.958 1.00 73.04  ? 703  GLY A H    1 
ATOM   2006  H HA2  . GLY A 1 142 ? -21.706 13.872  -59.108 1.00 69.80  ? 703  GLY A HA2  1 
ATOM   2007  H HA3  . GLY A 1 142 ? -22.147 12.426  -58.685 1.00 69.80  ? 703  GLY A HA3  1 
ATOM   2008  N N    . LYS A 1 143 ? -19.790 13.463  -56.904 1.00 51.64  ? 704  LYS A N    1 
ATOM   2009  C CA   . LYS A 1 143 ? -19.367 13.774  -55.547 1.00 53.13  ? 704  LYS A CA   1 
ATOM   2010  C C    . LYS A 1 143 ? -19.247 15.280  -55.357 1.00 48.76  ? 704  LYS A C    1 
ATOM   2011  O O    . LYS A 1 143 ? -18.785 16.000  -56.247 1.00 47.13  ? 704  LYS A O    1 
ATOM   2012  C CB   . LYS A 1 143 ? -18.035 13.097  -55.227 1.00 56.96  ? 704  LYS A CB   1 
ATOM   2013  C CG   . LYS A 1 143 ? -18.165 11.631  -54.842 1.00 58.85  ? 704  LYS A CG   1 
ATOM   2014  C CD   . LYS A 1 143 ? -16.808 11.021  -54.542 1.00 69.35  ? 704  LYS A CD   1 
ATOM   2015  C CE   . LYS A 1 143 ? -16.828 9.512   -54.708 1.00 69.62  ? 704  LYS A CE   1 
ATOM   2016  N NZ   . LYS A 1 143 ? -15.455 8.942   -54.713 1.00 65.99  ? 704  LYS A NZ   1 
ATOM   2017  H H    . LYS A 1 143 ? -19.137 13.346  -57.452 1.00 61.97  ? 704  LYS A H    1 
ATOM   2018  H HA   . LYS A 1 143 ? -20.032 13.442  -54.923 1.00 63.76  ? 704  LYS A HA   1 
ATOM   2019  H HB2  . LYS A 1 143 ? -17.463 13.148  -56.009 1.00 68.35  ? 704  LYS A HB2  1 
ATOM   2020  H HB3  . LYS A 1 143 ? -17.618 13.562  -54.485 1.00 68.35  ? 704  LYS A HB3  1 
ATOM   2021  H HG2  . LYS A 1 143 ? -18.715 11.556  -54.047 1.00 70.63  ? 704  LYS A HG2  1 
ATOM   2022  H HG3  . LYS A 1 143 ? -18.565 11.140  -55.576 1.00 70.63  ? 704  LYS A HG3  1 
ATOM   2023  H HD2  . LYS A 1 143 ? -16.150 11.385  -55.155 1.00 83.22  ? 704  LYS A HD2  1 
ATOM   2024  H HD3  . LYS A 1 143 ? -16.561 11.222  -53.626 1.00 83.22  ? 704  LYS A HD3  1 
ATOM   2025  H HE2  . LYS A 1 143 ? -17.318 9.116   -53.971 1.00 83.54  ? 704  LYS A HE2  1 
ATOM   2026  H HE3  . LYS A 1 143 ? -17.252 9.289   -55.551 1.00 83.54  ? 704  LYS A HE3  1 
ATOM   2027  H HZ1  . LYS A 1 143 ? -15.493 8.058   -54.811 1.00 79.18  ? 704  LYS A HZ1  1 
ATOM   2028  H HZ2  . LYS A 1 143 ? -14.985 9.288   -55.384 1.00 79.18  ? 704  LYS A HZ2  1 
ATOM   2029  H HZ3  . LYS A 1 143 ? -15.045 9.130   -53.945 1.00 79.18  ? 704  LYS A HZ3  1 
ATOM   2030  N N    . ILE A 1 144 ? -19.668 15.744  -54.184 1.00 44.14  ? 705  ILE A N    1 
ATOM   2031  C CA   . ILE A 1 144 ? -19.713 17.160  -53.842 1.00 40.23  ? 705  ILE A CA   1 
ATOM   2032  C C    . ILE A 1 144 ? -18.840 17.384  -52.614 1.00 41.12  ? 705  ILE A C    1 
ATOM   2033  O O    . ILE A 1 144 ? -18.819 16.554  -51.698 1.00 47.00  ? 705  ILE A O    1 
ATOM   2034  C CB   . ILE A 1 144 ? -21.168 17.612  -53.592 1.00 44.77  ? 705  ILE A CB   1 
ATOM   2035  C CG1  . ILE A 1 144 ? -21.940 17.595  -54.915 1.00 46.69  ? 705  ILE A CG1  1 
ATOM   2036  C CG2  . ILE A 1 144 ? -21.220 19.005  -52.970 1.00 43.08  ? 705  ILE A CG2  1 
ATOM   2037  C CD1  . ILE A 1 144 ? -23.440 17.519  -54.760 1.00 47.42  ? 705  ILE A CD1  1 
ATOM   2038  H H    . ILE A 1 144 ? -19.942 15.236  -53.546 1.00 52.97  ? 705  ILE A H    1 
ATOM   2039  H HA   . ILE A 1 144 ? -19.351 17.682  -54.575 1.00 48.28  ? 705  ILE A HA   1 
ATOM   2040  H HB   . ILE A 1 144 ? -21.586 16.985  -52.982 1.00 53.72  ? 705  ILE A HB   1 
ATOM   2041  H HG12 . ILE A 1 144 ? -21.735 18.407  -55.405 1.00 56.03  ? 705  ILE A HG12 1 
ATOM   2042  H HG13 . ILE A 1 144 ? -21.658 16.823  -55.430 1.00 56.03  ? 705  ILE A HG13 1 
ATOM   2043  H HG21 . ILE A 1 144 ? -22.148 19.252  -52.829 1.00 51.70  ? 705  ILE A HG21 1 
ATOM   2044  H HG22 . ILE A 1 144 ? -20.749 18.989  -52.122 1.00 51.70  ? 705  ILE A HG22 1 
ATOM   2045  H HG23 . ILE A 1 144 ? -20.797 19.636  -53.573 1.00 51.70  ? 705  ILE A HG23 1 
ATOM   2046  H HD11 . ILE A 1 144 ? -23.848 17.513  -55.640 1.00 56.90  ? 705  ILE A HD11 1 
ATOM   2047  H HD12 . ILE A 1 144 ? -23.667 16.705  -54.283 1.00 56.90  ? 705  ILE A HD12 1 
ATOM   2048  H HD13 . ILE A 1 144 ? -23.745 18.292  -54.259 1.00 56.90  ? 705  ILE A HD13 1 
ATOM   2049  N N    . LYS A 1 145 ? -18.118 18.504  -52.601 1.00 38.34  ? 706  LYS A N    1 
ATOM   2050  C CA   . LYS A 1 145 ? -17.137 18.787  -51.563 1.00 36.82  ? 706  LYS A CA   1 
ATOM   2051  C C    . LYS A 1 145 ? -17.201 20.253  -51.163 1.00 36.04  ? 706  LYS A C    1 
ATOM   2052  O O    . LYS A 1 145 ? -17.566 21.118  -51.963 1.00 36.84  ? 706  LYS A O    1 
ATOM   2053  C CB   . LYS A 1 145 ? -15.716 18.446  -52.033 1.00 36.94  ? 706  LYS A CB   1 
ATOM   2054  C CG   . LYS A 1 145 ? -15.358 19.053  -53.382 1.00 41.22  ? 706  LYS A CG   1 
ATOM   2055  C CD   . LYS A 1 145 ? -13.907 18.794  -53.757 1.00 39.59  ? 706  LYS A CD   1 
ATOM   2056  C CE   . LYS A 1 145 ? -13.597 19.332  -55.147 1.00 33.22  ? 706  LYS A CE   1 
ATOM   2057  N NZ   . LYS A 1 145 ? -12.152 19.223  -55.496 1.00 38.21  ? 706  LYS A NZ   1 
ATOM   2058  H H    . LYS A 1 145 ? -18.181 19.124  -53.193 1.00 46.00  ? 706  LYS A H    1 
ATOM   2059  H HA   . LYS A 1 145 ? -17.336 18.249  -50.780 1.00 44.18  ? 706  LYS A HA   1 
ATOM   2060  H HB2  . LYS A 1 145 ? -15.081 18.780  -51.380 1.00 44.33  ? 706  LYS A HB2  1 
ATOM   2061  H HB3  . LYS A 1 145 ? -15.634 17.483  -52.109 1.00 44.33  ? 706  LYS A HB3  1 
ATOM   2062  H HG2  . LYS A 1 145 ? -15.922 18.661  -54.067 1.00 49.47  ? 706  LYS A HG2  1 
ATOM   2063  H HG3  . LYS A 1 145 ? -15.494 20.012  -53.345 1.00 49.47  ? 706  LYS A HG3  1 
ATOM   2064  H HD2  . LYS A 1 145 ? -13.326 19.239  -53.121 1.00 47.51  ? 706  LYS A HD2  1 
ATOM   2065  H HD3  . LYS A 1 145 ? -13.740 17.838  -53.755 1.00 47.51  ? 706  LYS A HD3  1 
ATOM   2066  H HE2  . LYS A 1 145 ? -14.103 18.826  -55.802 1.00 39.87  ? 706  LYS A HE2  1 
ATOM   2067  H HE3  . LYS A 1 145 ? -13.846 20.268  -55.187 1.00 39.87  ? 706  LYS A HE3  1 
ATOM   2068  H HZ1  . LYS A 1 145 ? -12.011 19.547  -56.313 1.00 45.85  ? 706  LYS A HZ1  1 
ATOM   2069  H HZ2  . LYS A 1 145 ? -11.663 19.686  -54.914 1.00 45.85  ? 706  LYS A HZ2  1 
ATOM   2070  H HZ3  . LYS A 1 145 ? -11.897 18.371  -55.475 1.00 45.85  ? 706  LYS A HZ3  1 
ATOM   2071  N N    . ALA A 1 146 ? -16.840 20.518  -49.910 1.00 34.16  ? 707  ALA A N    1 
ATOM   2072  C CA   . ALA A 1 146 ? -16.706 21.883  -49.425 1.00 30.20  ? 707  ALA A CA   1 
ATOM   2073  C C    . ALA A 1 146 ? -15.361 22.444  -49.865 1.00 28.09  ? 707  ALA A C    1 
ATOM   2074  O O    . ALA A 1 146 ? -14.367 21.716  -49.938 1.00 25.60  ? 707  ALA A O    1 
ATOM   2075  C CB   . ALA A 1 146 ? -16.818 21.928  -47.901 1.00 28.63  ? 707  ALA A CB   1 
ATOM   2076  H H    . ALA A 1 146 ? -16.666 19.918  -49.318 1.00 40.99  ? 707  ALA A H    1 
ATOM   2077  H HA   . ALA A 1 146 ? -17.409 22.433  -49.803 1.00 36.24  ? 707  ALA A HA   1 
ATOM   2078  H HB1  . ALA A 1 146 ? -16.725 22.847  -47.605 1.00 34.35  ? 707  ALA A HB1  1 
ATOM   2079  H HB2  . ALA A 1 146 ? -17.685 21.581  -47.639 1.00 34.35  ? 707  ALA A HB2  1 
ATOM   2080  H HB3  . ALA A 1 146 ? -16.114 21.383  -47.516 1.00 34.35  ? 707  ALA A HB3  1 
ATOM   2081  N N    . MET A 1 147 ? -15.331 23.743  -50.168 1.00 29.57  ? 708  MET A N    1 
ATOM   2082  C CA   . MET A 1 147 ? -14.122 24.365  -50.687 1.00 33.30  ? 708  MET A CA   1 
ATOM   2083  C C    . MET A 1 147 ? -13.951 25.770  -50.126 1.00 31.36  ? 708  MET A C    1 
ATOM   2084  O O    . MET A 1 147 ? -14.928 26.502  -49.941 1.00 29.77  ? 708  MET A O    1 
ATOM   2085  C CB   . MET A 1 147 ? -14.134 24.408  -52.221 1.00 44.50  ? 708  MET A CB   1 
ATOM   2086  C CG   . MET A 1 147 ? -13.926 23.047  -52.857 1.00 32.30  ? 708  MET A CG   1 
ATOM   2087  S SD   . MET A 1 147 ? -13.349 23.156  -54.559 1.00 49.31  ? 708  MET A SD   1 
ATOM   2088  C CE   . MET A 1 147 ? -14.784 23.877  -55.341 1.00 62.85  ? 708  MET A CE   1 
ATOM   2089  H H    . MET A 1 147 ? -15.996 24.280  -50.080 1.00 35.48  ? 708  MET A H    1 
ATOM   2090  H HA   . MET A 1 147 ? -13.359 23.831  -50.415 1.00 39.96  ? 708  MET A HA   1 
ATOM   2091  H HB2  . MET A 1 147 ? -14.991 24.750  -52.519 1.00 53.40  ? 708  MET A HB2  1 
ATOM   2092  H HB3  . MET A 1 147 ? -13.421 24.992  -52.525 1.00 53.40  ? 708  MET A HB3  1 
ATOM   2093  H HG2  . MET A 1 147 ? -13.264 22.557  -52.346 1.00 38.76  ? 708  MET A HG2  1 
ATOM   2094  H HG3  . MET A 1 147 ? -14.769 22.566  -52.857 1.00 38.76  ? 708  MET A HG3  1 
ATOM   2095  H HE1  . MET A 1 147 ? -15.541 23.283  -55.219 1.00 75.42  ? 708  MET A HE1  1 
ATOM   2096  H HE2  . MET A 1 147 ? -14.968 24.737  -54.932 1.00 75.42  ? 708  MET A HE2  1 
ATOM   2097  H HE3  . MET A 1 147 ? -14.603 23.993  -56.287 1.00 75.42  ? 708  MET A HE3  1 
ATOM   2098  N N    . ILE A 1 148 ? -12.693 26.132  -49.866 1.00 32.09  ? 709  ILE A N    1 
ATOM   2099  C CA   . ILE A 1 148 ? -12.318 27.435  -49.324 1.00 32.54  ? 709  ILE A CA   1 
ATOM   2100  C C    . ILE A 1 148 ? -12.114 28.411  -50.474 1.00 30.59  ? 709  ILE A C    1 
ATOM   2101  O O    . ILE A 1 148 ? -11.564 28.054  -51.521 1.00 30.47  ? 709  ILE A O    1 
ATOM   2102  C CB   . ILE A 1 148 ? -11.045 27.310  -48.463 1.00 31.31  ? 709  ILE A CB   1 
ATOM   2103  C CG1  . ILE A 1 148 ? -11.367 26.531  -47.185 1.00 36.04  ? 709  ILE A CG1  1 
ATOM   2104  C CG2  . ILE A 1 148 ? -10.452 28.690  -48.143 1.00 32.36  ? 709  ILE A CG2  1 
ATOM   2105  C CD1  . ILE A 1 148 ? -10.200 26.364  -46.230 1.00 31.24  ? 709  ILE A CD1  1 
ATOM   2106  H H    . ILE A 1 148 ? -12.017 25.619  -50.002 1.00 38.50  ? 709  ILE A H    1 
ATOM   2107  H HA   . ILE A 1 148 ? -13.035 27.768  -48.763 1.00 39.04  ? 709  ILE A HA   1 
ATOM   2108  H HB   . ILE A 1 148 ? -10.386 26.807  -48.967 1.00 37.57  ? 709  ILE A HB   1 
ATOM   2109  H HG12 . ILE A 1 148 ? -12.072 26.997  -46.708 1.00 43.25  ? 709  ILE A HG12 1 
ATOM   2110  H HG13 . ILE A 1 148 ? -11.672 25.644  -47.432 1.00 43.25  ? 709  ILE A HG13 1 
ATOM   2111  H HG21 . ILE A 1 148 ? -9.655  28.573  -47.602 1.00 38.84  ? 709  ILE A HG21 1 
ATOM   2112  H HG22 . ILE A 1 148 ? -10.225 29.136  -48.974 1.00 38.84  ? 709  ILE A HG22 1 
ATOM   2113  H HG23 . ILE A 1 148 ? -11.109 29.210  -47.656 1.00 38.84  ? 709  ILE A HG23 1 
ATOM   2114  H HD11 . ILE A 1 148 ? -10.496 25.862  -45.455 1.00 37.49  ? 709  ILE A HD11 1 
ATOM   2115  H HD12 . ILE A 1 148 ? -9.488  25.886  -46.682 1.00 37.49  ? 709  ILE A HD12 1 
ATOM   2116  H HD13 . ILE A 1 148 ? -9.888  27.241  -45.957 1.00 37.49  ? 709  ILE A HD13 1 
ATOM   2117  N N    . SER A 1 149 ? -12.540 29.654  -50.271 1.00 37.14  ? 710  SER A N    1 
ATOM   2118  C CA   . SER A 1 149 ? -12.419 30.694  -51.285 1.00 37.21  ? 710  SER A CA   1 
ATOM   2119  C C    . SER A 1 149 ? -12.261 32.039  -50.584 1.00 42.25  ? 710  SER A C    1 
ATOM   2120  O O    . SER A 1 149 ? -12.135 32.110  -49.358 1.00 41.25  ? 710  SER A O    1 
ATOM   2121  C CB   . SER A 1 149 ? -13.635 30.684  -52.217 1.00 39.25  ? 710  SER A CB   1 
ATOM   2122  O OG   . SER A 1 149 ? -14.824 30.912  -51.483 1.00 36.71  ? 710  SER A OG   1 
ATOM   2123  H H    . SER A 1 149 ? -12.910 29.923  -49.543 1.00 44.57  ? 710  SER A H    1 
ATOM   2124  H HA   . SER A 1 149 ? -11.624 30.533  -51.817 1.00 44.65  ? 710  SER A HA   1 
ATOM   2125  H HB2  . SER A 1 149 ? -13.532 31.385  -52.879 1.00 47.10  ? 710  SER A HB2  1 
ATOM   2126  H HB3  . SER A 1 149 ? -13.692 29.820  -52.653 1.00 47.10  ? 710  SER A HB3  1 
ATOM   2127  H HG   . SER A 1 149 ? -14.923 30.311  -50.904 1.00 44.05  ? 710  SER A HG   1 
ATOM   2128  N N    . ASP A 1 150 ? -12.274 33.110  -51.377 1.00 42.97  ? 711  ASP A N    1 
ATOM   2129  C CA   . ASP A 1 150 ? -12.186 34.481  -50.880 1.00 53.84  ? 711  ASP A CA   1 
ATOM   2130  C C    . ASP A 1 150 ? -10.909 34.674  -50.058 1.00 43.54  ? 711  ASP A C    1 
ATOM   2131  O O    . ASP A 1 150 ? -10.932 34.901  -48.847 1.00 49.16  ? 711  ASP A O    1 
ATOM   2132  C CB   . ASP A 1 150 ? -13.439 34.849  -50.079 1.00 45.20  ? 711  ASP A CB   1 
ATOM   2133  C CG   . ASP A 1 150 ? -13.649 36.350  -49.985 1.00 41.89  ? 711  ASP A CG   1 
ATOM   2134  O OD1  . ASP A 1 150 ? -12.738 37.109  -50.383 1.00 38.49  ? 711  ASP A OD1  1 
ATOM   2135  O OD2  . ASP A 1 150 ? -14.723 36.772  -49.510 1.00 43.95  ? 711  ASP A OD2  1 
ATOM   2136  H H    . ASP A 1 150 ? -12.334 33.065  -52.234 1.00 51.56  ? 711  ASP A H    1 
ATOM   2137  H HA   . ASP A 1 150 ? -12.137 35.082  -51.640 1.00 64.60  ? 711  ASP A HA   1 
ATOM   2138  H HB2  . ASP A 1 150 ? -14.217 34.463  -50.512 1.00 54.24  ? 711  ASP A HB2  1 
ATOM   2139  H HB3  . ASP A 1 150 ? -13.353 34.500  -49.177 1.00 54.24  ? 711  ASP A HB3  1 
ATOM   2140  N N    . PHE A 1 151 ? -9.781  34.581  -50.761 1.00 39.85  ? 712  PHE A N    1 
ATOM   2141  C CA   . PHE A 1 151 ? -8.450  34.769  -50.196 1.00 36.72  ? 712  PHE A CA   1 
ATOM   2142  C C    . PHE A 1 151 ? -8.100  36.243  -49.983 1.00 37.25  ? 712  PHE A C    1 
ATOM   2143  O O    . PHE A 1 151 ? -7.003  36.522  -49.491 1.00 36.75  ? 712  PHE A O    1 
ATOM   2144  C CB   . PHE A 1 151 ? -7.408  34.093  -51.099 1.00 36.28  ? 712  PHE A CB   1 
ATOM   2145  C CG   . PHE A 1 151 ? -7.441  32.589  -51.033 1.00 38.27  ? 712  PHE A CG   1 
ATOM   2146  C CD1  . PHE A 1 151 ? -8.540  31.885  -51.495 1.00 36.53  ? 712  PHE A CD1  1 
ATOM   2147  C CD2  . PHE A 1 151 ? -6.374  31.880  -50.503 1.00 42.24  ? 712  PHE A CD2  1 
ATOM   2148  C CE1  . PHE A 1 151 ? -8.576  30.503  -51.424 1.00 37.66  ? 712  PHE A CE1  1 
ATOM   2149  C CE2  . PHE A 1 151 ? -6.408  30.503  -50.426 1.00 37.58  ? 712  PHE A CE2  1 
ATOM   2150  C CZ   . PHE A 1 151 ? -7.507  29.814  -50.889 1.00 34.96  ? 712  PHE A CZ   1 
ATOM   2151  H H    . PHE A 1 151 ? -9.765  34.403  -51.602 1.00 47.82  ? 712  PHE A H    1 
ATOM   2152  H HA   . PHE A 1 151 ? -8.417  34.332  -49.331 1.00 44.07  ? 712  PHE A HA   1 
ATOM   2153  H HB2  . PHE A 1 151 ? -7.574  34.354  -52.019 1.00 43.54  ? 712  PHE A HB2  1 
ATOM   2154  H HB3  . PHE A 1 151 ? -6.523  34.384  -50.829 1.00 43.54  ? 712  PHE A HB3  1 
ATOM   2155  H HD1  . PHE A 1 151 ? -9.265  32.346  -51.852 1.00 43.84  ? 712  PHE A HD1  1 
ATOM   2156  H HD2  . PHE A 1 151 ? -5.631  32.340  -50.184 1.00 50.69  ? 712  PHE A HD2  1 
ATOM   2157  H HE1  . PHE A 1 151 ? -9.319  30.040  -51.737 1.00 45.19  ? 712  PHE A HE1  1 
ATOM   2158  H HE2  . PHE A 1 151 ? -5.685  30.039  -50.070 1.00 45.10  ? 712  PHE A HE2  1 
ATOM   2159  H HZ   . PHE A 1 151 ? -7.527  28.885  -50.845 1.00 41.95  ? 712  PHE A HZ   1 
ATOM   2160  N N    . GLY A 1 152 ? -8.987  37.171  -50.360 1.00 33.31  ? 713  GLY A N    1 
ATOM   2161  C CA   . GLY A 1 152 ? -8.655  38.590  -50.320 1.00 41.22  ? 713  GLY A CA   1 
ATOM   2162  C C    . GLY A 1 152 ? -8.021  39.045  -49.017 1.00 43.66  ? 713  GLY A C    1 
ATOM   2163  O O    . GLY A 1 152 ? -7.100  39.866  -49.020 1.00 40.71  ? 713  GLY A O    1 
ATOM   2164  H H    . GLY A 1 152 ? -9.781  37.001  -50.642 1.00 39.97  ? 713  GLY A H    1 
ATOM   2165  H HA2  . GLY A 1 152 ? -8.039  38.792  -51.041 1.00 49.46  ? 713  GLY A HA2  1 
ATOM   2166  H HA3  . GLY A 1 152 ? -9.463  39.108  -50.458 1.00 49.46  ? 713  GLY A HA3  1 
ATOM   2167  N N    . LEU A 1 153 ? -8.493  38.517  -47.890 1.00 41.06  ? 714  LEU A N    1 
ATOM   2168  C CA   . LEU A 1 153 ? -7.971  38.895  -46.582 1.00 43.27  ? 714  LEU A CA   1 
ATOM   2169  C C    . LEU A 1 153 ? -6.818  38.012  -46.120 1.00 43.60  ? 714  LEU A C    1 
ATOM   2170  O O    . LEU A 1 153 ? -6.332  38.192  -44.999 1.00 38.84  ? 714  LEU A O    1 
ATOM   2171  C CB   . LEU A 1 153 ? -9.090  38.861  -45.534 1.00 40.87  ? 714  LEU A CB   1 
ATOM   2172  C CG   . LEU A 1 153 ? -10.212 39.877  -45.758 1.00 46.29  ? 714  LEU A CG   1 
ATOM   2173  C CD1  . LEU A 1 153 ? -11.414 39.533  -44.904 1.00 43.54  ? 714  LEU A CD1  1 
ATOM   2174  C CD2  . LEU A 1 153 ? -9.731  41.289  -45.458 1.00 42.40  ? 714  LEU A CD2  1 
ATOM   2175  H H    . LEU A 1 153 ? -9.123  37.932  -47.858 1.00 49.27  ? 714  LEU A H    1 
ATOM   2176  H HA   . LEU A 1 153 ? -7.642  39.806  -46.632 1.00 51.92  ? 714  LEU A HA   1 
ATOM   2177  H HB2  . LEU A 1 153 ? -9.490  37.977  -45.537 1.00 49.04  ? 714  LEU A HB2  1 
ATOM   2178  H HB3  . LEU A 1 153 ? -8.703  39.040  -44.663 1.00 49.04  ? 714  LEU A HB3  1 
ATOM   2179  H HG   . LEU A 1 153 ? -10.486 39.844  -46.688 1.00 55.55  ? 714  LEU A HG   1 
ATOM   2180  H HD11 . LEU A 1 153 ? -12.111 40.188  -45.063 1.00 52.24  ? 714  LEU A HD11 1 
ATOM   2181  H HD12 . LEU A 1 153 ? -11.731 38.648  -45.146 1.00 52.24  ? 714  LEU A HD12 1 
ATOM   2182  H HD13 . LEU A 1 153 ? -11.152 39.547  -43.970 1.00 52.24  ? 714  LEU A HD13 1 
ATOM   2183  H HD21 . LEU A 1 153 ? -10.461 41.909  -45.609 1.00 50.88  ? 714  LEU A HD21 1 
ATOM   2184  H HD22 . LEU A 1 153 ? -9.443  41.334  -44.533 1.00 50.88  ? 714  LEU A HD22 1 
ATOM   2185  H HD23 . LEU A 1 153 ? -8.989  41.501  -46.047 1.00 50.88  ? 714  LEU A HD23 1 
ATOM   2186  N N    . CYS A 1 154 ? -6.367  37.073  -46.948 1.00 37.43  ? 715  CYS A N    1 
ATOM   2187  C CA   . CYS A 1 154 ? -5.333  36.141  -46.526 1.00 39.48  ? 715  CYS A CA   1 
ATOM   2188  C C    . CYS A 1 154 ? -3.990  36.848  -46.377 1.00 36.39  ? 715  CYS A C    1 
ATOM   2189  O O    . CYS A 1 154 ? -3.735  37.897  -46.974 1.00 36.95  ? 715  CYS A O    1 
ATOM   2190  C CB   . CYS A 1 154 ? -5.203  34.989  -47.524 1.00 34.60  ? 715  CYS A CB   1 
ATOM   2191  S SG   . CYS A 1 154 ? -6.578  33.826  -47.491 1.00 42.22  ? 715  CYS A SG   1 
ATOM   2192  H H    . CYS A 1 154 ? -6.643  36.957  -47.754 1.00 44.92  ? 715  CYS A H    1 
ATOM   2193  H HA   . CYS A 1 154 ? -5.575  35.768  -45.664 1.00 47.38  ? 715  CYS A HA   1 
ATOM   2194  H HB2  . CYS A 1 154 ? -5.149  35.358  -48.419 1.00 41.52  ? 715  CYS A HB2  1 
ATOM   2195  H HB3  . CYS A 1 154 ? -4.393  34.495  -47.324 1.00 41.52  ? 715  CYS A HB3  1 
ATOM   2196  H HG   . CYS A 1 154 ? -6.381  32.966  -48.304 1.00 50.66  ? 715  CYS A HG   1 
ATOM   2197  N N    . LYS A 1 155 ? -3.125  36.247  -45.560 1.00 34.74  ? 716  LYS A N    1 
ATOM   2198  C CA   . LYS A 1 155 ? -1.790  36.763  -45.295 1.00 37.32  ? 716  LYS A CA   1 
ATOM   2199  C C    . LYS A 1 155 ? -0.823  35.596  -45.178 1.00 35.48  ? 716  LYS A C    1 
ATOM   2200  O O    . LYS A 1 155 ? -1.137  34.584  -44.546 1.00 37.64  ? 716  LYS A O    1 
ATOM   2201  C CB   . LYS A 1 155 ? -1.751  37.597  -44.006 1.00 39.24  ? 716  LYS A CB   1 
ATOM   2202  C CG   . LYS A 1 155 ? -0.392  38.203  -43.711 1.00 46.29  ? 716  LYS A CG   1 
ATOM   2203  C CD   . LYS A 1 155 ? -0.403  38.979  -42.408 1.00 54.58  ? 716  LYS A CD   1 
ATOM   2204  C CE   . LYS A 1 155 ? 0.950   39.608  -42.127 1.00 54.23  ? 716  LYS A CE   1 
ATOM   2205  N NZ   . LYS A 1 155 ? 1.330   40.614  -43.154 1.00 48.52  ? 716  LYS A NZ   1 
ATOM   2206  H H    . LYS A 1 155 ? -3.297  35.518  -45.138 1.00 41.69  ? 716  LYS A H    1 
ATOM   2207  H HA   . LYS A 1 155 ? -1.508  37.324  -46.033 1.00 44.78  ? 716  LYS A HA   1 
ATOM   2208  H HB2  . LYS A 1 155 ? -2.389  38.324  -44.084 1.00 47.09  ? 716  LYS A HB2  1 
ATOM   2209  H HB3  . LYS A 1 155 ? -1.991  37.028  -43.258 1.00 47.09  ? 716  LYS A HB3  1 
ATOM   2210  H HG2  . LYS A 1 155 ? 0.266   37.494  -43.637 1.00 55.55  ? 716  LYS A HG2  1 
ATOM   2211  H HG3  . LYS A 1 155 ? -0.151  38.813  -44.426 1.00 55.55  ? 716  LYS A HG3  1 
ATOM   2212  H HD2  . LYS A 1 155 ? -1.063  39.688  -42.462 1.00 65.50  ? 716  LYS A HD2  1 
ATOM   2213  H HD3  . LYS A 1 155 ? -0.616  38.377  -41.678 1.00 65.50  ? 716  LYS A HD3  1 
ATOM   2214  H HE2  . LYS A 1 155 ? 0.921   40.054  -41.266 1.00 65.08  ? 716  LYS A HE2  1 
ATOM   2215  H HE3  . LYS A 1 155 ? 1.628   38.914  -42.120 1.00 65.08  ? 716  LYS A HE3  1 
ATOM   2216  H HZ1  . LYS A 1 155 ? 2.126   40.962  -42.960 1.00 58.22  ? 716  LYS A HZ1  1 
ATOM   2217  H HZ2  . LYS A 1 155 ? 1.371   40.230  -43.956 1.00 58.22  ? 716  LYS A HZ2  1 
ATOM   2218  H HZ3  . LYS A 1 155 ? 0.727   41.268  -43.178 1.00 58.22  ? 716  LYS A HZ3  1 
ATOM   2219  N N    . LYS A 1 156 ? 0.351   35.744  -45.786 1.00 37.20  ? 717  LYS A N    1 
ATOM   2220  C CA   . LYS A 1 156 ? 1.409   34.746  -45.701 1.00 40.27  ? 717  LYS A CA   1 
ATOM   2221  C C    . LYS A 1 156 ? 2.461   35.232  -44.712 1.00 43.66  ? 717  LYS A C    1 
ATOM   2222  O O    . LYS A 1 156 ? 3.026   36.317  -44.884 1.00 48.87  ? 717  LYS A O    1 
ATOM   2223  C CB   . LYS A 1 156 ? 2.031   34.487  -47.072 1.00 40.75  ? 717  LYS A CB   1 
ATOM   2224  C CG   . LYS A 1 156 ? 3.009   33.324  -47.092 1.00 48.33  ? 717  LYS A CG   1 
ATOM   2225  C CD   . LYS A 1 156 ? 3.387   32.944  -48.512 1.00 57.09  ? 717  LYS A CD   1 
ATOM   2226  C CE   . LYS A 1 156 ? 4.377   31.792  -48.535 1.00 59.48  ? 717  LYS A CE   1 
ATOM   2227  N NZ   . LYS A 1 156 ? 4.838   31.486  -49.915 1.00 62.68  ? 717  LYS A NZ   1 
ATOM   2228  H H    . LYS A 1 156 ? 0.561   36.428  -46.263 1.00 44.64  ? 717  LYS A H    1 
ATOM   2229  H HA   . LYS A 1 156 ? 1.040   33.912  -45.371 1.00 48.33  ? 717  LYS A HA   1 
ATOM   2230  H HB2  . LYS A 1 156 ? 1.323   34.290  -47.704 1.00 48.91  ? 717  LYS A HB2  1 
ATOM   2231  H HB3  . LYS A 1 156 ? 2.511   35.282  -47.353 1.00 48.91  ? 717  LYS A HB3  1 
ATOM   2232  H HG2  . LYS A 1 156 ? 3.818   33.577  -46.619 1.00 57.99  ? 717  LYS A HG2  1 
ATOM   2233  H HG3  . LYS A 1 156 ? 2.600   32.553  -46.670 1.00 57.99  ? 717  LYS A HG3  1 
ATOM   2234  H HD2  . LYS A 1 156 ? 2.590   32.671  -48.993 1.00 68.51  ? 717  LYS A HD2  1 
ATOM   2235  H HD3  . LYS A 1 156 ? 3.798   33.707  -48.949 1.00 68.51  ? 717  LYS A HD3  1 
ATOM   2236  H HE2  . LYS A 1 156 ? 5.152   32.027  -48.001 1.00 71.37  ? 717  LYS A HE2  1 
ATOM   2237  H HE3  . LYS A 1 156 ? 3.950   30.998  -48.175 1.00 71.37  ? 717  LYS A HE3  1 
ATOM   2238  H HZ1  . LYS A 1 156 ? 5.415   30.809  -49.900 1.00 75.22  ? 717  LYS A HZ1  1 
ATOM   2239  H HZ2  . LYS A 1 156 ? 4.143   31.262  -50.425 1.00 75.22  ? 717  LYS A HZ2  1 
ATOM   2240  H HZ3  . LYS A 1 156 ? 5.238   32.199  -50.267 1.00 75.22  ? 717  LYS A HZ3  1 
ATOM   2241  N N    . LEU A 1 157 ? 2.720   34.432  -43.683 1.00 43.07  ? 718  LEU A N    1 
ATOM   2242  C CA   . LEU A 1 157 ? 3.626   34.831  -42.619 1.00 55.50  ? 718  LEU A CA   1 
ATOM   2243  C C    . LEU A 1 157 ? 5.081   34.734  -43.069 1.00 60.98  ? 718  LEU A C    1 
ATOM   2244  O O    . LEU A 1 157 ? 5.437   33.977  -43.977 1.00 61.26  ? 718  LEU A O    1 
ATOM   2245  C CB   . LEU A 1 157 ? 3.402   33.969  -41.375 1.00 60.54  ? 718  LEU A CB   1 
ATOM   2246  C CG   . LEU A 1 157 ? 2.455   34.558  -40.326 1.00 56.98  ? 718  LEU A CG   1 
ATOM   2247  C CD1  . LEU A 1 157 ? 1.159   35.051  -40.955 1.00 49.75  ? 718  LEU A CD1  1 
ATOM   2248  C CD2  . LEU A 1 157 ? 2.162   33.526  -39.252 1.00 56.59  ? 718  LEU A CD2  1 
ATOM   2249  H H    . LEU A 1 157 ? 2.380   33.649  -43.580 1.00 51.68  ? 718  LEU A H    1 
ATOM   2250  H HA   . LEU A 1 157 ? 3.447   35.754  -42.381 1.00 66.60  ? 718  LEU A HA   1 
ATOM   2251  H HB2  . LEU A 1 157 ? 3.033   33.117  -41.655 1.00 72.64  ? 718  LEU A HB2  1 
ATOM   2252  H HB3  . LEU A 1 157 ? 4.259   33.824  -40.944 1.00 72.64  ? 718  LEU A HB3  1 
ATOM   2253  H HG   . LEU A 1 157 ? 2.888   35.315  -39.902 1.00 68.38  ? 718  LEU A HG   1 
ATOM   2254  H HD11 . LEU A 1 157 ? 0.589   35.415  -40.259 1.00 59.70  ? 718  LEU A HD11 1 
ATOM   2255  H HD12 . LEU A 1 157 ? 1.366   35.739  -41.606 1.00 59.70  ? 718  LEU A HD12 1 
ATOM   2256  H HD13 . LEU A 1 157 ? 0.716   34.305  -41.389 1.00 59.70  ? 718  LEU A HD13 1 
ATOM   2257  H HD21 . LEU A 1 157 ? 1.562   33.914  -38.596 1.00 67.91  ? 718  LEU A HD21 1 
ATOM   2258  H HD22 . LEU A 1 157 ? 1.748   32.751  -39.663 1.00 67.91  ? 718  LEU A HD22 1 
ATOM   2259  H HD23 . LEU A 1 157 ? 2.995   33.269  -38.826 1.00 67.91  ? 718  LEU A HD23 1 
ATOM   2260  N N    . ALA A 1 158 ? 5.925   35.525  -42.411 1.00 77.76  ? 719  ALA A N    1 
ATOM   2261  C CA   . ALA A 1 158 ? 7.347   35.550  -42.710 1.00 76.77  ? 719  ALA A CA   1 
ATOM   2262  C C    . ALA A 1 158 ? 8.005   34.236  -42.299 1.00 81.67  ? 719  ALA A C    1 
ATOM   2263  O O    . ALA A 1 158 ? 7.474   33.467  -41.491 1.00 81.17  ? 719  ALA A O    1 
ATOM   2264  C CB   . ALA A 1 158 ? 8.021   36.723  -41.999 1.00 80.55  ? 719  ALA A CB   1 
ATOM   2265  H H    . ALA A 1 158 ? 5.693   36.062  -41.781 1.00 93.31  ? 719  ALA A H    1 
ATOM   2266  H HA   . ALA A 1 158 ? 7.470   35.665  -43.665 1.00 92.12  ? 719  ALA A HA   1 
ATOM   2267  H HB1  . ALA A 1 158 ? 8.967   36.720  -42.212 1.00 96.66  ? 719  ALA A HB1  1 
ATOM   2268  H HB2  . ALA A 1 158 ? 7.616   37.551  -42.302 1.00 96.66  ? 719  ALA A HB2  1 
ATOM   2269  H HB3  . ALA A 1 158 ? 7.897   36.625  -41.042 1.00 96.66  ? 719  ALA A HB3  1 
ATOM   2270  N N    . VAL A 1 159 ? 9.172   33.979  -42.883 1.00 84.68  ? 720  VAL A N    1 
ATOM   2271  C CA   . VAL A 1 159 ? 9.917   32.747  -42.640 1.00 82.58  ? 720  VAL A CA   1 
ATOM   2272  C C    . VAL A 1 159 ? 10.133  32.488  -41.152 1.00 88.91  ? 720  VAL A C    1 
ATOM   2273  O O    . VAL A 1 159 ? 9.732   31.446  -40.631 1.00 89.59  ? 720  VAL A O    1 
ATOM   2274  C CB   . VAL A 1 159 ? 11.291  32.780  -43.338 1.00 77.20  ? 720  VAL A CB   1 
ATOM   2275  H H    . VAL A 1 159 ? 9.560   34.513  -43.434 1.00 101.62 ? 720  VAL A H    1 
ATOM   2276  H HA   . VAL A 1 159 ? 9.416   32.000  -43.003 1.00 99.09  ? 720  VAL A HA   1 
ATOM   2277  N N    . ARG A 1 161 ? 8.478   34.096  -38.424 1.00 78.34  ? 722  ARG A N    1 
ATOM   2278  C CA   . ARG A 1 161 ? 7.463   34.435  -37.436 1.00 75.91  ? 722  ARG A CA   1 
ATOM   2279  C C    . ARG A 1 161 ? 6.299   33.456  -37.510 1.00 75.61  ? 722  ARG A C    1 
ATOM   2280  O O    . ARG A 1 161 ? 5.790   33.160  -38.593 1.00 72.97  ? 722  ARG A O    1 
ATOM   2281  C CB   . ARG A 1 161 ? 6.960   35.866  -37.644 1.00 73.01  ? 722  ARG A CB   1 
ATOM   2282  C CG   . ARG A 1 161 ? 7.999   36.937  -37.363 1.00 75.53  ? 722  ARG A CG   1 
ATOM   2283  C CD   . ARG A 1 161 ? 7.482   38.320  -37.723 1.00 70.64  ? 722  ARG A CD   1 
ATOM   2284  N NE   . ARG A 1 161 ? 6.337   38.715  -36.906 1.00 68.70  ? 722  ARG A NE   1 
ATOM   2285  C CZ   . ARG A 1 161 ? 5.629   39.826  -37.094 1.00 77.17  ? 722  ARG A CZ   1 
ATOM   2286  N NH1  . ARG A 1 161 ? 5.937   40.661  -38.079 1.00 75.76  ? 722  ARG A NH1  1 
ATOM   2287  N NH2  . ARG A 1 161 ? 4.605   40.103  -36.298 1.00 76.18  ? 722  ARG A NH2  1 
ATOM   2288  H H    . ARG A 1 161 ? 8.674   34.740  -38.959 1.00 94.01  ? 722  ARG A H    1 
ATOM   2289  H HA   . ARG A 1 161 ? 7.850   34.376  -36.548 1.00 91.10  ? 722  ARG A HA   1 
ATOM   2290  H HB2  . ARG A 1 161 ? 6.675   35.965  -38.566 1.00 87.61  ? 722  ARG A HB2  1 
ATOM   2291  H HB3  . ARG A 1 161 ? 6.208   36.022  -37.051 1.00 87.61  ? 722  ARG A HB3  1 
ATOM   2292  H HG2  . ARG A 1 161 ? 8.219   36.931  -36.419 1.00 90.64  ? 722  ARG A HG2  1 
ATOM   2293  H HG3  . ARG A 1 161 ? 8.792   36.761  -37.894 1.00 90.64  ? 722  ARG A HG3  1 
ATOM   2294  H HD2  . ARG A 1 161 ? 8.189   38.969  -37.584 1.00 84.77  ? 722  ARG A HD2  1 
ATOM   2295  H HD3  . ARG A 1 161 ? 7.204   38.323  -38.652 1.00 84.77  ? 722  ARG A HD3  1 
ATOM   2296  H HE   . ARG A 1 161 ? 6.105   38.195  -36.261 1.00 82.44  ? 722  ARG A HE   1 
ATOM   2297  H HH11 . ARG A 1 161 ? 6.600   40.487  -38.599 1.00 90.91  ? 722  ARG A HH11 1 
ATOM   2298  H HH12 . ARG A 1 161 ? 5.475   41.377  -38.196 1.00 90.91  ? 722  ARG A HH12 1 
ATOM   2299  H HH21 . ARG A 1 161 ? 4.400   39.565  -35.659 1.00 91.41  ? 722  ARG A HH21 1 
ATOM   2300  H HH22 . ARG A 1 161 ? 4.146   40.820  -36.421 1.00 91.41  ? 722  ARG A HH22 1 
ATOM   2301  N N    . HIS A 1 162 ? 5.896   32.949  -36.351 1.00 68.01  ? 723  HIS A N    1 
ATOM   2302  C CA   . HIS A 1 162 ? 4.740   32.068  -36.248 1.00 62.72  ? 723  HIS A CA   1 
ATOM   2303  C C    . HIS A 1 162 ? 3.490   32.876  -35.913 1.00 59.34  ? 723  HIS A C    1 
ATOM   2304  O O    . HIS A 1 162 ? 2.406   32.319  -35.731 1.00 54.22  ? 723  HIS A O    1 
ATOM   2305  C CB   . HIS A 1 162 ? 4.981   30.990  -35.189 1.00 61.93  ? 723  HIS A CB   1 
ATOM   2306  H H    . HIS A 1 162 ? 6.282   33.103  -35.598 1.00 81.62  ? 723  HIS A H    1 
ATOM   2307  H HA   . HIS A 1 162 ? 4.597   31.629  -37.101 1.00 75.26  ? 723  HIS A HA   1 
HETATM 2308  N N    . SEP A 1 163 ? 3.658   34.193  -35.832 1.00 60.78  ? 724  SEP A N    1 
HETATM 2309  C CA   . SEP A 1 163 ? 2.572   35.111  -35.506 1.00 57.04  ? 724  SEP A CA   1 
HETATM 2310  C CB   . SEP A 1 163 ? 2.755   35.655  -34.090 1.00 60.10  ? 724  SEP A CB   1 
HETATM 2311  O OG   . SEP A 1 163 ? 3.535   36.846  -34.098 1.00 68.66  ? 724  SEP A OG   1 
HETATM 2312  C C    . SEP A 1 163 ? 2.569   36.271  -36.491 1.00 60.95  ? 724  SEP A C    1 
HETATM 2313  O O    . SEP A 1 163 ? 3.523   36.454  -37.248 1.00 63.36  ? 724  SEP A O    1 
HETATM 2314  P P    . SEP A 1 163 ? 4.838   36.737  -33.146 1.00 75.59  ? 724  SEP A P    1 
HETATM 2315  O O1P  . SEP A 1 163 ? 5.957   35.817  -33.854 1.00 62.65  ? 724  SEP A O1P  1 
HETATM 2316  O O2P  . SEP A 1 163 ? 5.451   38.209  -32.899 1.00 67.47  ? 724  SEP A O2P  1 
HETATM 2317  O O3P  . SEP A 1 163 ? 4.439   36.090  -31.725 1.00 71.23  ? 724  SEP A O3P  1 
HETATM 2318  H HA   . SEP A 1 163 ? 1.712   34.644  -35.560 1.00 68.45  ? 724  SEP A HA   1 
HETATM 2319  H HB2  . SEP A 1 163 ? 3.206   34.987  -33.551 1.00 72.12  ? 724  SEP A HB2  1 
HETATM 2320  H HB3  . SEP A 1 163 ? 1.883   35.852  -33.713 1.00 72.12  ? 724  SEP A HB3  1 
ATOM   2321  N N    . PHE A 1 164 ? 1.495   37.054  -36.476 1.00 54.04  ? 725  PHE A N    1 
ATOM   2322  C CA   . PHE A 1 164 ? 1.411   38.257  -37.295 1.00 55.96  ? 725  PHE A CA   1 
ATOM   2323  C C    . PHE A 1 164 ? 0.822   39.405  -36.487 1.00 58.53  ? 725  PHE A C    1 
ATOM   2324  O O    . PHE A 1 164 ? -0.006  39.196  -35.602 1.00 52.18  ? 725  PHE A O    1 
ATOM   2325  C CB   . PHE A 1 164 ? 0.574   38.002  -38.550 1.00 48.26  ? 725  PHE A CB   1 
ATOM   2326  C CG   . PHE A 1 164 ? -0.880  37.737  -38.274 1.00 49.81  ? 725  PHE A CG   1 
ATOM   2327  C CD1  . PHE A 1 164 ? -1.330  36.453  -38.008 1.00 41.37  ? 725  PHE A CD1  1 
ATOM   2328  C CD2  . PHE A 1 164 ? -1.801  38.773  -38.292 1.00 44.75  ? 725  PHE A CD2  1 
ATOM   2329  C CE1  . PHE A 1 164 ? -2.669  36.210  -37.760 1.00 34.78  ? 725  PHE A CE1  1 
ATOM   2330  C CE2  . PHE A 1 164 ? -3.139  38.535  -38.044 1.00 47.04  ? 725  PHE A CE2  1 
ATOM   2331  C CZ   . PHE A 1 164 ? -3.573  37.252  -37.778 1.00 45.29  ? 725  PHE A CZ   1 
ATOM   2332  H H    . PHE A 1 164 ? 0.796   36.908  -35.996 1.00 64.85  ? 725  PHE A H    1 
ATOM   2333  H HA   . PHE A 1 164 ? 2.304   38.513  -37.575 1.00 67.15  ? 725  PHE A HA   1 
ATOM   2334  H HB2  . PHE A 1 164 ? 0.629   38.782  -39.124 1.00 57.92  ? 725  PHE A HB2  1 
ATOM   2335  H HB3  . PHE A 1 164 ? 0.933   37.228  -39.012 1.00 57.92  ? 725  PHE A HB3  1 
ATOM   2336  H HD1  . PHE A 1 164 ? -0.724  35.748  -37.995 1.00 49.65  ? 725  PHE A HD1  1 
ATOM   2337  H HD2  . PHE A 1 164 ? -1.514  39.639  -38.471 1.00 53.70  ? 725  PHE A HD2  1 
ATOM   2338  H HE1  . PHE A 1 164 ? -2.959  35.345  -37.580 1.00 41.74  ? 725  PHE A HE1  1 
ATOM   2339  H HE2  . PHE A 1 164 ? -3.747  39.238  -38.057 1.00 56.45  ? 725  PHE A HE2  1 
ATOM   2340  H HZ   . PHE A 1 164 ? -4.474  37.090  -37.611 1.00 54.35  ? 725  PHE A HZ   1 
HETATM 2341  N N    . SEP A 1 165 ? 1.256   40.620  -36.803 1.00 64.32  ? 726  SEP A N    1 
HETATM 2342  C CA   . SEP A 1 165 ? 0.822   41.805  -36.076 1.00 57.59  ? 726  SEP A CA   1 
HETATM 2343  C CB   . SEP A 1 165 ? 1.835   42.930  -36.269 1.00 55.50  ? 726  SEP A CB   1 
HETATM 2344  O OG   . SEP A 1 165 ? 2.168   43.071  -37.638 1.00 67.95  ? 726  SEP A OG   1 
HETATM 2345  C C    . SEP A 1 165 ? -0.557  42.268  -36.526 1.00 55.30  ? 726  SEP A C    1 
HETATM 2346  O O    . SEP A 1 165 ? -1.049  41.866  -37.582 1.00 53.84  ? 726  SEP A O    1 
HETATM 2347  P P    . SEP A 1 165 ? 3.525   43.923  -37.813 1.00 93.15  ? 726  SEP A P    1 
HETATM 2348  O O1P  . SEP A 1 165 ? 3.774   44.212  -39.380 1.00 80.03  ? 726  SEP A O1P  1 
HETATM 2349  O O2P  . SEP A 1 165 ? 4.774   43.094  -37.216 1.00 77.09  ? 726  SEP A O2P  1 
HETATM 2350  O O3P  . SEP A 1 165 ? 3.380   45.324  -37.026 1.00 91.55  ? 726  SEP A O3P  1 
HETATM 2351  H HA   . SEP A 1 165 ? 0.776   41.596  -35.120 1.00 69.11  ? 726  SEP A HA   1 
HETATM 2352  H HB2  . SEP A 1 165 ? 2.638   42.721  -35.767 1.00 66.60  ? 726  SEP A HB2  1 
HETATM 2353  H HB3  . SEP A 1 165 ? 1.449   43.761  -35.949 1.00 66.60  ? 726  SEP A HB3  1 
ATOM   2354  N N    . ARG A 1 166 ? -1.159  43.135  -35.721 1.00 52.15  ? 727  ARG A N    1 
ATOM   2355  C CA   . ARG A 1 166 ? -2.504  43.637  -35.971 1.00 45.02  ? 727  ARG A CA   1 
ATOM   2356  C C    . ARG A 1 166 ? -2.464  44.916  -36.811 1.00 47.59  ? 727  ARG A C    1 
ATOM   2357  O O    . ARG A 1 166 ? -3.493  45.559  -37.032 1.00 45.46  ? 727  ARG A O    1 
ATOM   2358  C CB   . ARG A 1 166 ? -3.228  43.896  -34.650 1.00 50.45  ? 727  ARG A CB   1 
ATOM   2359  C CG   . ARG A 1 166 ? -3.233  42.692  -33.714 1.00 55.55  ? 727  ARG A CG   1 
ATOM   2360  C CD   . ARG A 1 166 ? -3.828  43.015  -32.351 1.00 62.14  ? 727  ARG A CD   1 
ATOM   2361  N NE   . ARG A 1 166 ? -3.907  41.835  -31.492 1.00 66.06  ? 727  ARG A NE   1 
ATOM   2362  C CZ   . ARG A 1 166 ? -2.921  41.395  -30.713 1.00 71.27  ? 727  ARG A CZ   1 
ATOM   2363  N NH1  . ARG A 1 166 ? -1.755  42.027  -30.672 1.00 63.20  ? 727  ARG A NH1  1 
ATOM   2364  N NH2  . ARG A 1 166 ? -3.100  40.310  -29.971 1.00 73.54  ? 727  ARG A NH2  1 
ATOM   2365  H H    . ARG A 1 166 ? -0.801  43.455  -35.007 1.00 62.58  ? 727  ARG A H    1 
ATOM   2366  H HA   . ARG A 1 166 ? -3.006  42.968  -36.463 1.00 54.03  ? 727  ARG A HA   1 
ATOM   2367  H HB2  . ARG A 1 166 ? -2.789  44.629  -34.191 1.00 60.54  ? 727  ARG A HB2  1 
ATOM   2368  H HB3  . ARG A 1 166 ? -4.150  44.131  -34.838 1.00 60.54  ? 727  ARG A HB3  1 
ATOM   2369  H HG2  . ARG A 1 166 ? -3.762  41.983  -34.112 1.00 66.66  ? 727  ARG A HG2  1 
ATOM   2370  H HG3  . ARG A 1 166 ? -2.321  42.392  -33.579 1.00 66.66  ? 727  ARG A HG3  1 
ATOM   2371  H HD2  . ARG A 1 166 ? -3.271  43.674  -31.909 1.00 74.56  ? 727  ARG A HD2  1 
ATOM   2372  H HD3  . ARG A 1 166 ? -4.726  43.362  -32.471 1.00 74.56  ? 727  ARG A HD3  1 
ATOM   2373  H HE   . ARG A 1 166 ? -4.644  41.392  -31.490 1.00 79.27  ? 727  ARG A HE   1 
ATOM   2374  H HH11 . ARG A 1 166 ? -1.631  42.731  -31.150 1.00 75.84  ? 727  ARG A HH11 1 
ATOM   2375  H HH12 . ARG A 1 166 ? -1.125  41.734  -30.166 1.00 75.84  ? 727  ARG A HH12 1 
ATOM   2376  H HH21 . ARG A 1 166 ? -3.852  39.893  -29.993 1.00 88.25  ? 727  ARG A HH21 1 
ATOM   2377  H HH22 . ARG A 1 166 ? -2.464  40.023  -29.468 1.00 88.25  ? 727  ARG A HH22 1 
ATOM   2378  N N    . ARG A 1 167 ? -1.265  45.287  -37.253 1.00 41.57  ? 728  ARG A N    1 
ATOM   2379  C CA   . ARG A 1 167 ? -1.033  46.540  -37.976 1.00 50.40  ? 728  ARG A CA   1 
ATOM   2380  C C    . ARG A 1 167 ? -1.960  46.771  -39.167 1.00 49.54  ? 728  ARG A C    1 
ATOM   2381  O O    . ARG A 1 167 ? -2.322  47.907  -39.468 1.00 47.40  ? 728  ARG A O    1 
ATOM   2382  C CB   . ARG A 1 167 ? 0.416   46.582  -38.465 1.00 55.08  ? 728  ARG A CB   1 
ATOM   2383  H H    . ARG A 1 167 ? -0.552  44.819  -37.144 1.00 49.89  ? 728  ARG A H    1 
ATOM   2384  H HA   . ARG A 1 167 ? -1.158  47.279  -37.360 1.00 60.48  ? 728  ARG A HA   1 
HETATM 2385  N N    . SEP A 1 168 ? -2.316  45.693  -39.856 1.00 44.33  ? 729  SEP A N    1 
HETATM 2386  C CA   . SEP A 1 168 ? -3.133  45.796  -41.064 1.00 43.89  ? 729  SEP A CA   1 
HETATM 2387  C CB   . SEP A 1 168 ? -3.208  44.442  -41.784 1.00 48.25  ? 729  SEP A CB   1 
HETATM 2388  O OG   . SEP A 1 168 ? -2.036  44.238  -42.551 1.00 57.51  ? 729  SEP A OG   1 
HETATM 2389  C C    . SEP A 1 168 ? -4.534  46.313  -40.774 1.00 45.01  ? 729  SEP A C    1 
HETATM 2390  O O    . SEP A 1 168 ? -5.087  47.090  -41.552 1.00 57.65  ? 729  SEP A O    1 
HETATM 2391  P P    . SEP A 1 168 ? -1.882  42.719  -43.041 1.00 39.53  ? 729  SEP A P    1 
HETATM 2392  O O1P  . SEP A 1 168 ? -2.818  42.445  -44.322 1.00 49.95  ? 729  SEP A O1P  1 
HETATM 2393  O O2P  . SEP A 1 168 ? -0.343  42.496  -43.447 1.00 50.51  ? 729  SEP A O2P  1 
HETATM 2394  O O3P  . SEP A 1 168 ? -2.271  41.705  -41.856 1.00 61.01  ? 729  SEP A O3P  1 
HETATM 2395  H H    . SEP A 1 168 ? -2.099  44.888  -39.647 1.00 53.20  ? 729  SEP A H    1 
HETATM 2396  H HA   . SEP A 1 168 ? -2.705  46.432  -41.675 1.00 52.67  ? 729  SEP A HA   1 
HETATM 2397  H HB2  . SEP A 1 168 ? -3.980  44.437  -42.372 1.00 57.91  ? 729  SEP A HB2  1 
HETATM 2398  H HB3  . SEP A 1 168 ? -3.285  43.735  -41.125 1.00 57.91  ? 729  SEP A HB3  1 
ATOM   2399  N N    . GLY A 1 169 ? -5.117  45.876  -39.667 1.00 50.86  ? 730  GLY A N    1 
ATOM   2400  C CA   . GLY A 1 169 ? -6.484  46.236  -39.366 1.00 51.12  ? 730  GLY A CA   1 
ATOM   2401  C C    . GLY A 1 169 ? -7.137  45.172  -38.513 1.00 51.55  ? 730  GLY A C    1 
ATOM   2402  O O    . GLY A 1 169 ? -6.466  44.443  -37.779 1.00 48.83  ? 730  GLY A O    1 
ATOM   2403  H H    . GLY A 1 169 ? -4.742  45.372  -39.080 1.00 61.03  ? 730  GLY A H    1 
ATOM   2404  H HA2  . GLY A 1 169 ? -6.504  47.079  -38.886 1.00 61.35  ? 730  GLY A HA2  1 
ATOM   2405  H HA3  . GLY A 1 169 ? -6.988  46.332  -40.189 1.00 61.35  ? 730  GLY A HA3  1 
ATOM   2406  N N    . VAL A 1 170 ? -8.460  45.099  -38.612 1.00 52.38  ? 731  VAL A N    1 
ATOM   2407  C CA   . VAL A 1 170 ? -9.242  44.010  -38.033 1.00 46.50  ? 731  VAL A CA   1 
ATOM   2408  C C    . VAL A 1 170 ? -9.910  43.275  -39.190 1.00 45.40  ? 731  VAL A C    1 
ATOM   2409  O O    . VAL A 1 170 ? -11.086 43.532  -39.490 1.00 44.34  ? 731  VAL A O    1 
ATOM   2410  C CB   . VAL A 1 170 ? -10.285 44.527  -37.030 1.00 47.57  ? 731  VAL A CB   1 
ATOM   2411  C CG1  . VAL A 1 170 ? -11.054 43.361  -36.424 1.00 53.11  ? 731  VAL A CG1  1 
ATOM   2412  C CG2  . VAL A 1 170 ? -9.616  45.344  -35.942 1.00 48.95  ? 731  VAL A CG2  1 
ATOM   2413  H H    . VAL A 1 170 ? -8.941  45.684  -39.021 1.00 62.86  ? 731  VAL A H    1 
ATOM   2414  H HA   . VAL A 1 170 ? -8.650  43.393  -37.575 1.00 55.80  ? 731  VAL A HA   1 
ATOM   2415  H HB   . VAL A 1 170 ? -10.917 45.098  -37.493 1.00 57.08  ? 731  VAL A HB   1 
ATOM   2416  H HG11 . VAL A 1 170 ? -11.706 43.707  -35.795 1.00 63.73  ? 731  VAL A HG11 1 
ATOM   2417  H HG12 . VAL A 1 170 ? -11.503 42.876  -37.134 1.00 63.73  ? 731  VAL A HG12 1 
ATOM   2418  H HG13 . VAL A 1 170 ? -10.430 42.776  -35.967 1.00 63.73  ? 731  VAL A HG13 1 
ATOM   2419  H HG21 . VAL A 1 170 ? -10.293 45.658  -35.323 1.00 58.74  ? 731  VAL A HG21 1 
ATOM   2420  H HG22 . VAL A 1 170 ? -8.975  44.784  -35.477 1.00 58.74  ? 731  VAL A HG22 1 
ATOM   2421  H HG23 . VAL A 1 170 ? -9.163  46.099  -36.349 1.00 58.74  ? 731  VAL A HG23 1 
ATOM   2422  N N    . PRO A 1 171 ? -9.210  42.368  -39.869 1.00 46.14  ? 732  PRO A N    1 
ATOM   2423  C CA   . PRO A 1 171 ? -9.852  41.585  -40.927 1.00 44.57  ? 732  PRO A CA   1 
ATOM   2424  C C    . PRO A 1 171 ? -10.863 40.618  -40.333 1.00 46.84  ? 732  PRO A C    1 
ATOM   2425  O O    . PRO A 1 171 ? -10.829 40.291  -39.145 1.00 52.87  ? 732  PRO A O    1 
ATOM   2426  C CB   . PRO A 1 171 ? -8.683  40.838  -41.588 1.00 49.29  ? 732  PRO A CB   1 
ATOM   2427  C CG   . PRO A 1 171 ? -7.429  41.304  -40.878 1.00 52.07  ? 732  PRO A CG   1 
ATOM   2428  C CD   . PRO A 1 171 ? -7.861  41.866  -39.574 1.00 52.80  ? 732  PRO A CD   1 
ATOM   2429  H HA   . PRO A 1 171 ? -10.284 42.164  -41.574 1.00 53.48  ? 732  PRO A HA   1 
ATOM   2430  H HB2  . PRO A 1 171 ? -8.804  39.882  -41.473 1.00 59.14  ? 732  PRO A HB2  1 
ATOM   2431  H HB3  . PRO A 1 171 ? -8.645  41.065  -42.530 1.00 59.14  ? 732  PRO A HB3  1 
ATOM   2432  H HG2  . PRO A 1 171 ? -6.836  40.549  -40.741 1.00 62.49  ? 732  PRO A HG2  1 
ATOM   2433  H HG3  . PRO A 1 171 ? -6.991  41.986  -41.412 1.00 62.49  ? 732  PRO A HG3  1 
ATOM   2434  H HD2  . PRO A 1 171 ? -7.897  41.170  -38.899 1.00 63.35  ? 732  PRO A HD2  1 
ATOM   2435  H HD3  . PRO A 1 171 ? -7.278  42.594  -39.307 1.00 63.35  ? 732  PRO A HD3  1 
ATOM   2436  N N    . GLY A 1 172 ? -11.768 40.156  -41.182 1.00 43.56  ? 733  GLY A N    1 
ATOM   2437  C CA   . GLY A 1 172 ? -12.806 39.230  -40.780 1.00 46.23  ? 733  GLY A CA   1 
ATOM   2438  C C    . GLY A 1 172 ? -14.170 39.895  -40.700 1.00 39.43  ? 733  GLY A C    1 
ATOM   2439  O O    . GLY A 1 172 ? -14.317 41.116  -40.751 1.00 60.15  ? 733  GLY A O    1 
ATOM   2440  H H    . GLY A 1 172 ? -11.799 40.370  -42.015 1.00 52.27  ? 733  GLY A H    1 
ATOM   2441  H HA2  . GLY A 1 172 ? -12.856 38.501  -41.418 1.00 55.47  ? 733  GLY A HA2  1 
ATOM   2442  H HA3  . GLY A 1 172 ? -12.592 38.862  -39.908 1.00 55.47  ? 733  GLY A HA3  1 
ATOM   2443  N N    . THR A 1 173 ? -15.179 39.039  -40.565 1.00 37.29  ? 734  THR A N    1 
ATOM   2444  C CA   . THR A 1 173 ? -16.579 39.435  -40.570 1.00 41.24  ? 734  THR A CA   1 
ATOM   2445  C C    . THR A 1 173 ? -17.138 39.375  -39.155 1.00 41.80  ? 734  THR A C    1 
ATOM   2446  O O    . THR A 1 173 ? -16.809 38.464  -38.389 1.00 38.87  ? 734  THR A O    1 
ATOM   2447  C CB   . THR A 1 173 ? -17.394 38.525  -41.492 1.00 39.73  ? 734  THR A CB   1 
ATOM   2448  O OG1  . THR A 1 173 ? -16.751 38.439  -42.771 1.00 41.57  ? 734  THR A OG1  1 
ATOM   2449  C CG2  . THR A 1 173 ? -18.803 39.063  -41.671 1.00 36.50  ? 734  THR A CG2  1 
ATOM   2450  H H    . THR A 1 173 ? -15.070 38.192  -40.465 1.00 44.75  ? 734  THR A H    1 
ATOM   2451  H HA   . THR A 1 173 ? -16.656 40.347  -40.892 1.00 49.49  ? 734  THR A HA   1 
ATOM   2452  H HB   . THR A 1 173 ? -17.452 37.640  -41.101 1.00 47.67  ? 734  THR A HB   1 
ATOM   2453  H HG1  . THR A 1 173 ? -15.978 38.122  -42.683 1.00 49.89  ? 734  THR A HG1  1 
ATOM   2454  H HG21 . THR A 1 173 ? -19.310 38.479  -42.256 1.00 43.80  ? 734  THR A HG21 1 
ATOM   2455  H HG22 . THR A 1 173 ? -19.251 39.113  -40.811 1.00 43.80  ? 734  THR A HG22 1 
ATOM   2456  H HG23 . THR A 1 173 ? -18.772 39.951  -42.061 1.00 43.80  ? 734  THR A HG23 1 
ATOM   2457  N N    . GLU A 1 174 ? -18.000 40.337  -38.827 1.00 40.72  ? 735  GLU A N    1 
ATOM   2458  C CA   . GLU A 1 174 ? -18.487 40.500  -37.462 1.00 42.99  ? 735  GLU A CA   1 
ATOM   2459  C C    . GLU A 1 174 ? -19.115 39.214  -36.938 1.00 38.91  ? 735  GLU A C    1 
ATOM   2460  O O    . GLU A 1 174 ? -19.940 38.587  -37.610 1.00 39.44  ? 735  GLU A O    1 
ATOM   2461  C CB   . GLU A 1 174 ? -19.504 41.640  -37.406 1.00 48.01  ? 735  GLU A CB   1 
ATOM   2462  C CG   . GLU A 1 174 ? -19.765 42.168  -36.005 1.00 51.73  ? 735  GLU A CG   1 
ATOM   2463  C CD   . GLU A 1 174 ? -20.892 43.178  -35.966 1.00 60.38  ? 735  GLU A CD   1 
ATOM   2464  O OE1  . GLU A 1 174 ? -20.695 44.268  -35.390 1.00 70.56  ? 735  GLU A OE1  1 
ATOM   2465  O OE2  . GLU A 1 174 ? -21.978 42.880  -36.507 1.00 69.47  ? 735  GLU A OE2  1 
ATOM   2466  H H    . GLU A 1 174 ? -18.319 40.911  -39.382 1.00 48.87  ? 735  GLU A H    1 
ATOM   2467  H HA   . GLU A 1 174 ? -17.743 40.730  -36.884 1.00 51.58  ? 735  GLU A HA   1 
ATOM   2468  H HB2  . GLU A 1 174 ? -19.175 42.377  -37.944 1.00 57.61  ? 735  GLU A HB2  1 
ATOM   2469  H HB3  . GLU A 1 174 ? -20.348 41.323  -37.764 1.00 57.61  ? 735  GLU A HB3  1 
ATOM   2470  H HG2  . GLU A 1 174 ? -20.005 41.427  -35.427 1.00 62.08  ? 735  GLU A HG2  1 
ATOM   2471  H HG3  . GLU A 1 174 ? -18.962 42.601  -35.675 1.00 62.08  ? 735  GLU A HG3  1 
ATOM   2472  N N    . GLY A 1 175 ? -18.717 38.829  -35.726 1.00 40.78  ? 736  GLY A N    1 
ATOM   2473  C CA   . GLY A 1 175 ? -19.209 37.636  -35.077 1.00 46.75  ? 736  GLY A CA   1 
ATOM   2474  C C    . GLY A 1 175 ? -18.395 36.387  -35.343 1.00 36.78  ? 736  GLY A C    1 
ATOM   2475  O O    . GLY A 1 175 ? -18.511 35.418  -34.587 1.00 46.26  ? 736  GLY A O    1 
ATOM   2476  H H    . GLY A 1 175 ? -18.145 39.262  -35.253 1.00 48.94  ? 736  GLY A H    1 
ATOM   2477  H HA2  . GLY A 1 175 ? -19.226 37.784  -34.118 1.00 56.11  ? 736  GLY A HA2  1 
ATOM   2478  H HA3  . GLY A 1 175 ? -20.118 37.469  -35.371 1.00 56.11  ? 736  GLY A HA3  1 
ATOM   2479  N N    . TRP A 1 176 ? -17.623 36.359  -36.425 1.00 33.69  ? 737  TRP A N    1 
ATOM   2480  C CA   . TRP A 1 176 ? -16.695 35.272  -36.711 1.00 34.73  ? 737  TRP A CA   1 
ATOM   2481  C C    . TRP A 1 176 ? -15.251 35.589  -36.324 1.00 33.92  ? 737  TRP A C    1 
ATOM   2482  O O    . TRP A 1 176 ? -14.371 34.747  -36.532 1.00 31.90  ? 737  TRP A O    1 
ATOM   2483  C CB   . TRP A 1 176 ? -16.803 34.901  -38.192 1.00 31.54  ? 737  TRP A CB   1 
ATOM   2484  C CG   . TRP A 1 176 ? -18.248 34.691  -38.553 1.00 31.92  ? 737  TRP A CG   1 
ATOM   2485  C CD1  . TRP A 1 176 ? -19.121 35.630  -39.023 1.00 34.34  ? 737  TRP A CD1  1 
ATOM   2486  C CD2  . TRP A 1 176 ? -19.000 33.478  -38.417 1.00 35.64  ? 737  TRP A CD2  1 
ATOM   2487  N NE1  . TRP A 1 176 ? -20.364 35.074  -39.202 1.00 38.32  ? 737  TRP A NE1  1 
ATOM   2488  C CE2  . TRP A 1 176 ? -20.316 33.754  -38.839 1.00 40.38  ? 737  TRP A CE2  1 
ATOM   2489  C CE3  . TRP A 1 176 ? -18.687 32.184  -37.989 1.00 31.63  ? 737  TRP A CE3  1 
ATOM   2490  C CZ2  . TRP A 1 176 ? -21.317 32.782  -38.849 1.00 34.72  ? 737  TRP A CZ2  1 
ATOM   2491  C CZ3  . TRP A 1 176 ? -19.682 31.222  -38.000 1.00 32.76  ? 737  TRP A CZ3  1 
ATOM   2492  C CH2  . TRP A 1 176 ? -20.981 31.527  -38.427 1.00 34.36  ? 737  TRP A CH2  1 
ATOM   2493  H H    . TRP A 1 176 ? -17.620 36.976  -37.024 1.00 40.42  ? 737  TRP A H    1 
ATOM   2494  H HA   . TRP A 1 176 ? -16.967 34.495  -36.197 1.00 41.67  ? 737  TRP A HA   1 
ATOM   2495  H HB2  . TRP A 1 176 ? -16.449 35.622  -38.736 1.00 37.84  ? 737  TRP A HB2  1 
ATOM   2496  H HB3  . TRP A 1 176 ? -16.319 34.077  -38.359 1.00 37.84  ? 737  TRP A HB3  1 
ATOM   2497  H HD1  . TRP A 1 176 ? -18.905 36.518  -39.195 1.00 41.21  ? 737  TRP A HD1  1 
ATOM   2498  H HE1  . TRP A 1 176 ? -21.058 35.486  -39.498 1.00 45.98  ? 737  TRP A HE1  1 
ATOM   2499  H HE3  . TRP A 1 176 ? -17.827 31.973  -37.704 1.00 37.96  ? 737  TRP A HE3  1 
ATOM   2500  H HZ2  . TRP A 1 176 ? -22.179 32.981  -39.134 1.00 41.66  ? 737  TRP A HZ2  1 
ATOM   2501  H HZ3  . TRP A 1 176 ? -19.485 30.358  -37.718 1.00 39.31  ? 737  TRP A HZ3  1 
ATOM   2502  H HH2  . TRP A 1 176 ? -21.628 30.859  -38.424 1.00 41.23  ? 737  TRP A HH2  1 
ATOM   2503  N N    . ILE A 1 177 ? -14.983 36.773  -35.753 1.00 36.93  ? 738  ILE A N    1 
ATOM   2504  C CA   . ILE A 1 177 ? -13.620 37.219  -35.474 1.00 39.05  ? 738  ILE A CA   1 
ATOM   2505  C C    . ILE A 1 177 ? -13.179 36.682  -34.120 1.00 40.97  ? 738  ILE A C    1 
ATOM   2506  O O    . ILE A 1 177 ? -13.941 36.701  -33.146 1.00 40.15  ? 738  ILE A O    1 
ATOM   2507  C CB   . ILE A 1 177 ? -13.525 38.759  -35.513 1.00 37.86  ? 738  ILE A CB   1 
ATOM   2508  C CG1  . ILE A 1 177 ? -14.116 39.294  -36.819 1.00 44.34  ? 738  ILE A CG1  1 
ATOM   2509  C CG2  . ILE A 1 177 ? -12.075 39.202  -35.356 1.00 32.94  ? 738  ILE A CG2  1 
ATOM   2510  C CD1  . ILE A 1 177 ? -14.183 40.808  -36.908 1.00 42.97  ? 738  ILE A CD1  1 
ATOM   2511  H H    . ILE A 1 177 ? -15.586 37.339  -35.517 1.00 44.31  ? 738  ILE A H    1 
ATOM   2512  H HA   . ILE A 1 177 ? -13.023 36.863  -36.150 1.00 46.86  ? 738  ILE A HA   1 
ATOM   2513  H HB   . ILE A 1 177 ? -14.039 39.118  -34.773 1.00 45.43  ? 738  ILE A HB   1 
ATOM   2514  H HG12 . ILE A 1 177 ? -13.571 38.980  -37.557 1.00 53.20  ? 738  ILE A HG12 1 
ATOM   2515  H HG13 . ILE A 1 177 ? -15.020 38.954  -36.913 1.00 53.20  ? 738  ILE A HG13 1 
ATOM   2516  H HG21 . ILE A 1 177 ? -12.036 40.171  -35.383 1.00 39.53  ? 738  ILE A HG21 1 
ATOM   2517  H HG22 . ILE A 1 177 ? -11.737 38.880  -34.505 1.00 39.53  ? 738  ILE A HG22 1 
ATOM   2518  H HG23 . ILE A 1 177 ? -11.551 38.829  -36.082 1.00 39.53  ? 738  ILE A HG23 1 
ATOM   2519  H HD11 . ILE A 1 177 ? -14.568 41.057  -37.762 1.00 51.56  ? 738  ILE A HD11 1 
ATOM   2520  H HD12 . ILE A 1 177 ? -14.737 41.142  -36.185 1.00 51.56  ? 738  ILE A HD12 1 
ATOM   2521  H HD13 . ILE A 1 177 ? -13.285 41.168  -36.831 1.00 51.56  ? 738  ILE A HD13 1 
ATOM   2522  N N    . ALA A 1 178 ? -11.936 36.211  -34.054 1.00 42.76  ? 739  ALA A N    1 
ATOM   2523  C CA   . ALA A 1 178 ? -11.388 35.729  -32.799 1.00 42.72  ? 739  ALA A CA   1 
ATOM   2524  C C    . ALA A 1 178 ? -11.196 36.894  -31.826 1.00 44.68  ? 739  ALA A C    1 
ATOM   2525  O O    . ALA A 1 178 ? -10.947 38.027  -32.246 1.00 40.57  ? 739  ALA A O    1 
ATOM   2526  C CB   . ALA A 1 178 ? -10.058 35.019  -33.030 1.00 37.04  ? 739  ALA A CB   1 
ATOM   2527  H H    . ALA A 1 178 ? -11.394 36.162  -34.721 1.00 51.31  ? 739  ALA A H    1 
ATOM   2528  H HA   . ALA A 1 178 ? -12.007 35.097  -32.400 1.00 51.26  ? 739  ALA A HA   1 
ATOM   2529  H HB1  . ALA A 1 178 ? -9.715  34.708  -32.178 1.00 44.45  ? 739  ALA A HB1  1 
ATOM   2530  H HB2  . ALA A 1 178 ? -10.202 34.266  -33.624 1.00 44.45  ? 739  ALA A HB2  1 
ATOM   2531  H HB3  . ALA A 1 178 ? -9.433  35.643  -33.431 1.00 44.45  ? 739  ALA A HB3  1 
ATOM   2532  N N    . PRO A 1 179 ? -11.308 36.642  -30.516 1.00 45.46  ? 740  PRO A N    1 
ATOM   2533  C CA   . PRO A 1 179 ? -11.259 37.769  -29.567 1.00 43.82  ? 740  PRO A CA   1 
ATOM   2534  C C    . PRO A 1 179 ? -9.914  38.470  -29.521 1.00 40.80  ? 740  PRO A C    1 
ATOM   2535  O O    . PRO A 1 179 ? -9.873  39.699  -29.385 1.00 45.31  ? 740  PRO A O    1 
ATOM   2536  C CB   . PRO A 1 179 ? -11.602 37.113  -28.219 1.00 42.82  ? 740  PRO A CB   1 
ATOM   2537  C CG   . PRO A 1 179 ? -12.171 35.771  -28.557 1.00 42.97  ? 740  PRO A CG   1 
ATOM   2538  C CD   . PRO A 1 179 ? -11.519 35.360  -29.826 1.00 45.11  ? 740  PRO A CD   1 
ATOM   2539  H HA   . PRO A 1 179 ? -11.946 38.418  -29.786 1.00 52.59  ? 740  PRO A HA   1 
ATOM   2540  H HB2  . PRO A 1 179 ? -10.795 37.018  -27.688 1.00 51.39  ? 740  PRO A HB2  1 
ATOM   2541  H HB3  . PRO A 1 179 ? -12.257 37.653  -27.751 1.00 51.39  ? 740  PRO A HB3  1 
ATOM   2542  H HG2  . PRO A 1 179 ? -11.963 35.142  -27.848 1.00 51.56  ? 740  PRO A HG2  1 
ATOM   2543  H HG3  . PRO A 1 179 ? -13.131 35.846  -28.675 1.00 51.56  ? 740  PRO A HG3  1 
ATOM   2544  H HD2  . PRO A 1 179 ? -10.670 34.926  -29.648 1.00 54.13  ? 740  PRO A HD2  1 
ATOM   2545  H HD3  . PRO A 1 179 ? -12.110 34.790  -30.343 1.00 54.13  ? 740  PRO A HD3  1 
ATOM   2546  N N    . GLU A 1 180 ? -8.806  37.733  -29.632 1.00 39.30  ? 741  GLU A N    1 
ATOM   2547  C CA   . GLU A 1 180 ? -7.493  38.364  -29.568 1.00 37.91  ? 741  GLU A CA   1 
ATOM   2548  C C    . GLU A 1 180 ? -7.244  39.316  -30.732 1.00 50.80  ? 741  GLU A C    1 
ATOM   2549  O O    . GLU A 1 180 ? -6.275  40.083  -30.688 1.00 52.32  ? 741  GLU A O    1 
ATOM   2550  C CB   . GLU A 1 180 ? -6.388  37.301  -29.520 1.00 37.81  ? 741  GLU A CB   1 
ATOM   2551  C CG   . GLU A 1 180 ? -6.239  36.447  -30.781 1.00 43.00  ? 741  GLU A CG   1 
ATOM   2552  C CD   . GLU A 1 180 ? -7.201  35.273  -30.821 1.00 36.18  ? 741  GLU A CD   1 
ATOM   2553  O OE1  . GLU A 1 180 ? -8.208  35.297  -30.087 1.00 35.87  ? 741  GLU A OE1  1 
ATOM   2554  O OE2  . GLU A 1 180 ? -6.942  34.323  -31.588 1.00 41.98  ? 741  GLU A OE2  1 
ATOM   2555  H H    . GLU A 1 180 ? -8.790  36.880  -29.743 1.00 47.16  ? 741  GLU A H    1 
ATOM   2556  H HA   . GLU A 1 180 ? -7.438  38.881  -28.749 1.00 45.50  ? 741  GLU A HA   1 
ATOM   2557  H HB2  . GLU A 1 180 ? -5.539  37.747  -29.370 1.00 45.37  ? 741  GLU A HB2  1 
ATOM   2558  H HB3  . GLU A 1 180 ? -6.572  36.700  -28.782 1.00 45.37  ? 741  GLU A HB3  1 
ATOM   2559  H HG2  . GLU A 1 180 ? -6.411  37.000  -31.559 1.00 51.60  ? 741  GLU A HG2  1 
ATOM   2560  H HG3  . GLU A 1 180 ? -5.336  36.095  -30.819 1.00 51.60  ? 741  GLU A HG3  1 
ATOM   2561  N N    . MET A 1 181 ? -8.082  39.279  -31.770 1.00 51.84  ? 742  MET A N    1 
ATOM   2562  C CA   . MET A 1 181 ? -7.953  40.220  -32.877 1.00 58.32  ? 742  MET A CA   1 
ATOM   2563  C C    . MET A 1 181 ? -8.530  41.588  -32.529 1.00 63.07  ? 742  MET A C    1 
ATOM   2564  O O    . MET A 1 181 ? -7.953  42.617  -32.898 1.00 66.45  ? 742  MET A O    1 
ATOM   2565  C CB   . MET A 1 181 ? -8.648  39.660  -34.118 1.00 55.21  ? 742  MET A CB   1 
ATOM   2566  C CG   . MET A 1 181 ? -7.934  38.473  -34.746 1.00 55.91  ? 742  MET A CG   1 
ATOM   2567  S SD   . MET A 1 181 ? -6.316  38.902  -35.417 1.00 67.43  ? 742  MET A SD   1 
ATOM   2568  C CE   . MET A 1 181 ? -6.770  40.023  -36.738 1.00 71.37  ? 742  MET A CE   1 
ATOM   2569  H H    . MET A 1 181 ? -8.730  38.721  -31.854 1.00 62.20  ? 742  MET A H    1 
ATOM   2570  H HA   . MET A 1 181 ? -7.012  40.325  -33.088 1.00 69.99  ? 742  MET A HA   1 
ATOM   2571  H HB2  . MET A 1 181 ? -9.541  39.372  -33.872 1.00 66.25  ? 742  MET A HB2  1 
ATOM   2572  H HB3  . MET A 1 181 ? -8.703  40.360  -34.788 1.00 66.25  ? 742  MET A HB3  1 
ATOM   2573  H HG2  . MET A 1 181 ? -7.806  37.788  -34.071 1.00 67.09  ? 742  MET A HG2  1 
ATOM   2574  H HG3  . MET A 1 181 ? -8.476  38.125  -35.472 1.00 67.09  ? 742  MET A HG3  1 
ATOM   2575  H HE1  . MET A 1 181 ? -5.964  40.329  -37.183 1.00 85.64  ? 742  MET A HE1  1 
ATOM   2576  H HE2  . MET A 1 181 ? -7.339  39.554  -37.368 1.00 85.64  ? 742  MET A HE2  1 
ATOM   2577  H HE3  . MET A 1 181 ? -7.247  40.779  -36.360 1.00 85.64  ? 742  MET A HE3  1 
ATOM   2578  N N    . LEU A 1 182 ? -9.663  41.620  -31.826 1.00 61.43  ? 743  LEU A N    1 
ATOM   2579  C CA   . LEU A 1 182 ? -10.354 42.864  -31.509 1.00 62.44  ? 743  LEU A CA   1 
ATOM   2580  C C    . LEU A 1 182 ? -9.853  43.534  -30.238 1.00 74.63  ? 743  LEU A C    1 
ATOM   2581  O O    . LEU A 1 182 ? -10.189 44.700  -30.001 1.00 76.33  ? 743  LEU A O    1 
ATOM   2582  C CB   . LEU A 1 182 ? -11.860 42.609  -31.367 1.00 64.81  ? 743  LEU A CB   1 
ATOM   2583  C CG   . LEU A 1 182 ? -12.748 42.811  -32.598 1.00 63.09  ? 743  LEU A CG   1 
ATOM   2584  C CD1  . LEU A 1 182 ? -14.185 42.491  -32.241 1.00 61.52  ? 743  LEU A CD1  1 
ATOM   2585  C CD2  . LEU A 1 182 ? -12.644 44.230  -33.141 1.00 62.01  ? 743  LEU A CD2  1 
ATOM   2586  H H    . LEU A 1 182 ? -10.056 40.920  -31.517 1.00 73.71  ? 743  LEU A H    1 
ATOM   2587  H HA   . LEU A 1 182 ? -10.226 43.486  -32.242 1.00 74.92  ? 743  LEU A HA   1 
ATOM   2588  H HB2  . LEU A 1 182 ? -11.980 41.690  -31.082 1.00 77.77  ? 743  LEU A HB2  1 
ATOM   2589  H HB3  . LEU A 1 182 ? -12.198 43.201  -30.677 1.00 77.77  ? 743  LEU A HB3  1 
ATOM   2590  H HG   . LEU A 1 182 ? -12.467 42.199  -33.296 1.00 75.71  ? 743  LEU A HG   1 
ATOM   2591  H HD11 . LEU A 1 182 ? -14.741 42.621  -33.025 1.00 73.82  ? 743  LEU A HD11 1 
ATOM   2592  H HD12 . LEU A 1 182 ? -14.239 41.569  -31.946 1.00 73.82  ? 743  LEU A HD12 1 
ATOM   2593  H HD13 . LEU A 1 182 ? -14.473 43.084  -31.529 1.00 73.82  ? 743  LEU A HD13 1 
ATOM   2594  H HD21 . LEU A 1 182 ? -13.220 44.313  -33.917 1.00 74.41  ? 743  LEU A HD21 1 
ATOM   2595  H HD22 . LEU A 1 182 ? -12.924 44.852  -32.452 1.00 74.41  ? 743  LEU A HD22 1 
ATOM   2596  H HD23 . LEU A 1 182 ? -11.723 44.405  -33.391 1.00 74.41  ? 743  LEU A HD23 1 
ATOM   2597  N N    . SER A 1 183 ? -9.056  42.846  -29.429 1.00 63.51  ? 744  SER A N    1 
ATOM   2598  C CA   . SER A 1 183 ? -8.640  43.377  -28.136 1.00 66.39  ? 744  SER A CA   1 
ATOM   2599  C C    . SER A 1 183 ? -7.315  44.121  -28.260 1.00 69.55  ? 744  SER A C    1 
ATOM   2600  O O    . SER A 1 183 ? -6.244  43.516  -28.230 1.00 72.37  ? 744  SER A O    1 
ATOM   2601  C CB   . SER A 1 183 ? -8.529  42.246  -27.109 1.00 64.15  ? 744  SER A CB   1 
ATOM   2602  O OG   . SER A 1 183 ? -9.805  41.686  -26.843 1.00 61.21  ? 744  SER A OG   1 
ATOM   2603  H H    . SER A 1 183 ? -8.740  42.066  -29.606 1.00 76.21  ? 744  SER A H    1 
ATOM   2604  H HA   . SER A 1 183 ? -9.309  44.004  -27.822 1.00 79.67  ? 744  SER A HA   1 
ATOM   2605  H HB2  . SER A 1 183 ? -7.947  41.554  -27.462 1.00 76.98  ? 744  SER A HB2  1 
ATOM   2606  H HB3  . SER A 1 183 ? -8.161  42.602  -26.285 1.00 76.98  ? 744  SER A HB3  1 
ATOM   2607  H HG   . SER A 1 183 ? -9.735  41.067  -26.279 1.00 73.46  ? 744  SER A HG   1 
ATOM   2608  N N    . CYS A 1 186 ? -3.673  42.892  -25.783 1.00 83.75  ? 747  CYS A N    1 
ATOM   2609  C CA   . CYS A 1 186 ? -2.979  41.732  -25.232 1.00 93.24  ? 747  CYS A CA   1 
ATOM   2610  C C    . CYS A 1 186 ? -1.582  41.589  -25.831 1.00 89.14  ? 747  CYS A C    1 
ATOM   2611  O O    . CYS A 1 186 ? -1.351  41.953  -26.985 1.00 89.32  ? 747  CYS A O    1 
ATOM   2612  C CB   . CYS A 1 186 ? -3.787  40.456  -25.479 1.00 93.02  ? 747  CYS A CB   1 
ATOM   2613  H H    . CYS A 1 186 ? -3.737  42.887  -26.641 1.00 100.50 ? 747  CYS A H    1 
ATOM   2614  H HA   . CYS A 1 186 ? -2.884  41.847  -24.274 1.00 111.89 ? 747  CYS A HA   1 
ATOM   2615  N N    . LYS A 1 187 ? -0.653  41.048  -25.038 1.00 92.81  ? 748  LYS A N    1 
ATOM   2616  C CA   . LYS A 1 187 ? 0.735   40.950  -25.478 1.00 86.10  ? 748  LYS A CA   1 
ATOM   2617  C C    . LYS A 1 187 ? 0.882   39.994  -26.656 1.00 84.76  ? 748  LYS A C    1 
ATOM   2618  O O    . LYS A 1 187 ? 1.642   40.265  -27.593 1.00 76.89  ? 748  LYS A O    1 
ATOM   2619  C CB   . LYS A 1 187 ? 1.622   40.502  -24.315 1.00 83.56  ? 748  LYS A CB   1 
ATOM   2620  H H    . LYS A 1 187 ? -0.801  40.736  -24.250 1.00 111.38 ? 748  LYS A H    1 
ATOM   2621  H HA   . LYS A 1 187 ? 1.037   41.826  -25.765 1.00 103.32 ? 748  LYS A HA   1 
ATOM   2622  N N    . GLU A 1 188 ? 0.159   38.877  -26.632 1.00 81.48  ? 749  GLU A N    1 
ATOM   2623  C CA   . GLU A 1 188 ? 0.353   37.838  -27.635 1.00 77.83  ? 749  GLU A CA   1 
ATOM   2624  C C    . GLU A 1 188 ? -0.256  38.251  -28.969 1.00 71.98  ? 749  GLU A C    1 
ATOM   2625  O O    . GLU A 1 188 ? -1.424  38.647  -29.037 1.00 74.87  ? 749  GLU A O    1 
ATOM   2626  C CB   . GLU A 1 188 ? -0.269  36.527  -27.159 1.00 71.68  ? 749  GLU A CB   1 
ATOM   2627  H H    . GLU A 1 188 ? -0.447  38.698  -26.048 1.00 97.78  ? 749  GLU A H    1 
ATOM   2628  H HA   . GLU A 1 188 ? 1.303   37.694  -27.766 1.00 93.40  ? 749  GLU A HA   1 
ATOM   2629  N N    . ASN A 1 189 ? 0.540   38.156  -30.033 1.00 61.83  ? 750  ASN A N    1 
ATOM   2630  C CA   . ASN A 1 189 ? 0.036   38.424  -31.369 1.00 64.73  ? 750  ASN A CA   1 
ATOM   2631  C C    . ASN A 1 189 ? -0.865  37.278  -31.827 1.00 58.51  ? 750  ASN A C    1 
ATOM   2632  O O    . ASN A 1 189 ? -0.704  36.136  -31.388 1.00 58.02  ? 750  ASN A O    1 
ATOM   2633  C CB   . ASN A 1 189 ? 1.185   38.592  -32.364 1.00 63.00  ? 750  ASN A CB   1 
ATOM   2634  C CG   . ASN A 1 189 ? 1.743   40.005  -32.398 1.00 62.77  ? 750  ASN A CG   1 
ATOM   2635  O OD1  . ASN A 1 189 ? 1.065   40.970  -32.043 1.00 59.09  ? 750  ASN A OD1  1 
ATOM   2636  N ND2  . ASN A 1 189 ? 2.988   40.132  -32.848 1.00 59.03  ? 750  ASN A ND2  1 
ATOM   2637  H H    . ASN A 1 189 ? 1.372   37.939  -30.004 1.00 74.19  ? 750  ASN A H    1 
ATOM   2638  H HA   . ASN A 1 189 ? -0.486  39.241  -31.360 1.00 77.67  ? 750  ASN A HA   1 
ATOM   2639  H HB2  . ASN A 1 189 ? 1.906   37.992  -32.116 1.00 75.60  ? 750  ASN A HB2  1 
ATOM   2640  H HB3  . ASN A 1 189 ? 0.866   38.376  -33.253 1.00 75.60  ? 750  ASN A HB3  1 
ATOM   2641  H HD21 . ASN A 1 189 ? 3.354   40.910  -32.889 1.00 70.83  ? 750  ASN A HD21 1 
ATOM   2642  H HD22 . ASN A 1 189 ? 3.428   39.437  -33.099 1.00 70.83  ? 750  ASN A HD22 1 
ATOM   2643  N N    . PRO A 1 190 ? -1.819  37.554  -32.711 1.00 55.21  ? 751  PRO A N    1 
ATOM   2644  C CA   . PRO A 1 190 ? -2.618  36.472  -33.287 1.00 52.12  ? 751  PRO A CA   1 
ATOM   2645  C C    . PRO A 1 190 ? -1.763  35.574  -34.166 1.00 50.31  ? 751  PRO A C    1 
ATOM   2646  O O    . PRO A 1 190 ? -0.685  35.949  -34.635 1.00 50.51  ? 751  PRO A O    1 
ATOM   2647  C CB   . PRO A 1 190 ? -3.676  37.213  -34.108 1.00 53.83  ? 751  PRO A CB   1 
ATOM   2648  C CG   . PRO A 1 190 ? -2.989  38.466  -34.508 1.00 56.34  ? 751  PRO A CG   1 
ATOM   2649  C CD   . PRO A 1 190 ? -2.167  38.854  -33.310 1.00 59.12  ? 751  PRO A CD   1 
ATOM   2650  H HA   . PRO A 1 190 ? -3.045  35.948  -32.591 1.00 62.54  ? 751  PRO A HA   1 
ATOM   2651  H HB2  . PRO A 1 190 ? -3.921  36.687  -34.885 1.00 64.59  ? 751  PRO A HB2  1 
ATOM   2652  H HB3  . PRO A 1 190 ? -4.451  37.403  -33.556 1.00 64.59  ? 751  PRO A HB3  1 
ATOM   2653  H HG2  . PRO A 1 190 ? -2.420  38.297  -35.275 1.00 67.61  ? 751  PRO A HG2  1 
ATOM   2654  H HG3  . PRO A 1 190 ? -3.646  39.149  -34.710 1.00 67.61  ? 751  PRO A HG3  1 
ATOM   2655  H HD2  . PRO A 1 190 ? -1.365  39.326  -33.586 1.00 70.94  ? 751  PRO A HD2  1 
ATOM   2656  H HD3  . PRO A 1 190 ? -2.696  39.382  -32.691 1.00 70.94  ? 751  PRO A HD3  1 
ATOM   2657  N N    . THR A 1 191 ? -2.269  34.366  -34.381 1.00 47.16  ? 752  THR A N    1 
ATOM   2658  C CA   . THR A 1 191 ? -1.581  33.357  -35.170 1.00 45.75  ? 752  THR A CA   1 
ATOM   2659  C C    . THR A 1 191 ? -2.643  32.532  -35.882 1.00 40.83  ? 752  THR A C    1 
ATOM   2660  O O    . THR A 1 191 ? -3.819  32.903  -35.911 1.00 35.33  ? 752  THR A O    1 
ATOM   2661  C CB   . THR A 1 191 ? -0.655  32.501  -34.294 1.00 51.41  ? 752  THR A CB   1 
ATOM   2662  O OG1  . THR A 1 191 ? 0.153   31.661  -35.128 1.00 55.35  ? 752  THR A OG1  1 
ATOM   2663  C CG2  . THR A 1 191 ? -1.450  31.640  -33.323 1.00 42.25  ? 752  THR A CG2  1 
ATOM   2664  H H    . THR A 1 191 ? -3.027  34.103  -34.073 1.00 56.59  ? 752  THR A H    1 
ATOM   2665  H HA   . THR A 1 191 ? -1.037  33.795  -35.843 1.00 54.90  ? 752  THR A HA   1 
ATOM   2666  H HB   . THR A 1 191 ? -0.078  33.084  -33.776 1.00 61.69  ? 752  THR A HB   1 
ATOM   2667  H HG1  . THR A 1 191 ? 0.662   31.190  -34.654 1.00 66.42  ? 752  THR A HG1  1 
ATOM   2668  H HG21 . THR A 1 191 ? -0.847  31.108  -32.781 1.00 50.70  ? 752  THR A HG21 1 
ATOM   2669  H HG22 . THR A 1 191 ? -1.984  32.203  -32.742 1.00 50.70  ? 752  THR A HG22 1 
ATOM   2670  H HG23 . THR A 1 191 ? -2.039  31.046  -33.814 1.00 50.70  ? 752  THR A HG23 1 
ATOM   2671  N N    . TYR A 1 192 ? -2.222  31.405  -36.460 1.00 39.33  ? 753  TYR A N    1 
ATOM   2672  C CA   . TYR A 1 192 ? -3.123  30.575  -37.252 1.00 29.74  ? 753  TYR A CA   1 
ATOM   2673  C C    . TYR A 1 192 ? -4.393  30.206  -36.498 1.00 31.78  ? 753  TYR A C    1 
ATOM   2674  O O    . TYR A 1 192 ? -5.407  29.893  -37.130 1.00 29.89  ? 753  TYR A O    1 
ATOM   2675  C CB   . TYR A 1 192 ? -2.403  29.297  -37.689 1.00 36.05  ? 753  TYR A CB   1 
ATOM   2676  C CG   . TYR A 1 192 ? -1.111  29.542  -38.436 1.00 38.68  ? 753  TYR A CG   1 
ATOM   2677  C CD1  . TYR A 1 192 ? -1.105  29.720  -39.813 1.00 34.61  ? 753  TYR A CD1  1 
ATOM   2678  C CD2  . TYR A 1 192 ? 0.103   29.593  -37.764 1.00 39.38  ? 753  TYR A CD2  1 
ATOM   2679  C CE1  . TYR A 1 192 ? 0.073   29.946  -40.500 1.00 33.43  ? 753  TYR A CE1  1 
ATOM   2680  C CE2  . TYR A 1 192 ? 1.286   29.817  -38.441 1.00 43.36  ? 753  TYR A CE2  1 
ATOM   2681  C CZ   . TYR A 1 192 ? 1.266   29.993  -39.808 1.00 43.13  ? 753  TYR A CZ   1 
ATOM   2682  O OH   . TYR A 1 192 ? 2.445   30.217  -40.479 1.00 41.13  ? 753  TYR A OH   1 
ATOM   2683  H H    . TYR A 1 192 ? -1.419  31.101  -36.407 1.00 47.19  ? 753  TYR A H    1 
ATOM   2684  H HA   . TYR A 1 192 ? -3.380  31.063  -38.050 1.00 35.69  ? 753  TYR A HA   1 
ATOM   2685  H HB2  . TYR A 1 192 ? -2.194  28.772  -36.901 1.00 43.25  ? 753  TYR A HB2  1 
ATOM   2686  H HB3  . TYR A 1 192 ? -2.991  28.793  -38.273 1.00 43.25  ? 753  TYR A HB3  1 
ATOM   2687  H HD1  . TYR A 1 192 ? -1.908  29.690  -40.280 1.00 41.53  ? 753  TYR A HD1  1 
ATOM   2688  H HD2  . TYR A 1 192 ? 0.120   29.476  -36.842 1.00 47.25  ? 753  TYR A HD2  1 
ATOM   2689  H HE1  . TYR A 1 192 ? 0.061   30.065  -41.422 1.00 40.12  ? 753  TYR A HE1  1 
ATOM   2690  H HE2  . TYR A 1 192 ? 2.091   29.850  -37.978 1.00 52.04  ? 753  TYR A HE2  1 
ATOM   2691  H HH   . TYR A 1 192 ? 3.088   30.220  -39.937 1.00 49.36  ? 753  TYR A HH   1 
ATOM   2692  N N    . THR A 1 193 ? -4.367  30.241  -35.164 1.00 35.49  ? 754  THR A N    1 
ATOM   2693  C CA   . THR A 1 193 ? -5.523  29.832  -34.374 1.00 33.95  ? 754  THR A CA   1 
ATOM   2694  C C    . THR A 1 193 ? -6.707  30.785  -34.490 1.00 31.27  ? 754  THR A C    1 
ATOM   2695  O O    . THR A 1 193 ? -7.786  30.452  -33.989 1.00 31.53  ? 754  THR A O    1 
ATOM   2696  C CB   . THR A 1 193 ? -5.138  29.682  -32.900 1.00 39.74  ? 754  THR A CB   1 
ATOM   2697  O OG1  . THR A 1 193 ? -4.299  30.773  -32.501 1.00 40.01  ? 754  THR A OG1  1 
ATOM   2698  C CG2  . THR A 1 193 ? -4.405  28.368  -32.675 1.00 32.97  ? 754  THR A CG2  1 
ATOM   2699  H H    . THR A 1 193 ? -3.693  30.498  -34.695 1.00 42.59  ? 754  THR A H    1 
ATOM   2700  H HA   . THR A 1 193 ? -5.817  28.963  -34.689 1.00 40.74  ? 754  THR A HA   1 
ATOM   2701  H HB   . THR A 1 193 ? -5.942  29.680  -32.357 1.00 47.68  ? 754  THR A HB   1 
ATOM   2702  H HG1  . THR A 1 193 ? -4.087  30.692  -31.693 1.00 48.02  ? 754  THR A HG1  1 
ATOM   2703  H HG21 . THR A 1 193 ? -4.164  28.279  -31.740 1.00 39.56  ? 754  THR A HG21 1 
ATOM   2704  H HG22 . THR A 1 193 ? -4.975  27.624  -32.926 1.00 39.56  ? 754  THR A HG22 1 
ATOM   2705  H HG23 . THR A 1 193 ? -3.598  28.343  -33.213 1.00 39.56  ? 754  THR A HG23 1 
ATOM   2706  N N    . VAL A 1 194 ? -6.548  31.958  -35.110 1.00 27.54  ? 755  VAL A N    1 
ATOM   2707  C CA   . VAL A 1 194 ? -7.717  32.793  -35.377 1.00 27.19  ? 755  VAL A CA   1 
ATOM   2708  C C    . VAL A 1 194 ? -8.678  32.062  -36.304 1.00 33.16  ? 755  VAL A C    1 
ATOM   2709  O O    . VAL A 1 194 ? -9.903  32.149  -36.150 1.00 31.46  ? 755  VAL A O    1 
ATOM   2710  C CB   . VAL A 1 194 ? -7.305  34.157  -35.967 1.00 33.51  ? 755  VAL A CB   1 
ATOM   2711  C CG1  . VAL A 1 194 ? -6.460  34.943  -34.980 1.00 39.39  ? 755  VAL A CG1  1 
ATOM   2712  C CG2  . VAL A 1 194 ? -6.583  33.989  -37.299 1.00 41.49  ? 755  VAL A CG2  1 
ATOM   2713  H H    . VAL A 1 194 ? -5.798  32.282  -35.378 1.00 33.05  ? 755  VAL A H    1 
ATOM   2714  H HA   . VAL A 1 194 ? -8.180  32.960  -34.541 1.00 32.63  ? 755  VAL A HA   1 
ATOM   2715  H HB   . VAL A 1 194 ? -8.109  34.673  -36.137 1.00 40.21  ? 755  VAL A HB   1 
ATOM   2716  H HG11 . VAL A 1 194 ? -6.218  35.793  -35.379 1.00 47.26  ? 755  VAL A HG11 1 
ATOM   2717  H HG12 . VAL A 1 194 ? -6.976  35.092  -34.172 1.00 47.26  ? 755  VAL A HG12 1 
ATOM   2718  H HG13 . VAL A 1 194 ? -5.661  34.434  -34.773 1.00 47.26  ? 755  VAL A HG13 1 
ATOM   2719  H HG21 . VAL A 1 194 ? -6.340  34.864  -37.639 1.00 49.79  ? 755  VAL A HG21 1 
ATOM   2720  H HG22 . VAL A 1 194 ? -5.786  33.454  -37.160 1.00 49.79  ? 755  VAL A HG22 1 
ATOM   2721  H HG23 . VAL A 1 194 ? -7.176  33.543  -37.925 1.00 49.79  ? 755  VAL A HG23 1 
ATOM   2722  N N    . ASP A 1 195 ? -8.138  31.338  -37.289 1.00 27.63  ? 756  ASP A N    1 
ATOM   2723  C CA   . ASP A 1 195 ? -8.975  30.535  -38.172 1.00 28.28  ? 756  ASP A CA   1 
ATOM   2724  C C    . ASP A 1 195 ? -9.622  29.375  -37.429 1.00 31.49  ? 756  ASP A C    1 
ATOM   2725  O O    . ASP A 1 195 ? -10.742 28.974  -37.765 1.00 29.37  ? 756  ASP A O    1 
ATOM   2726  C CB   . ASP A 1 195 ? -8.145  30.007  -39.342 1.00 29.70  ? 756  ASP A CB   1 
ATOM   2727  C CG   . ASP A 1 195 ? -7.687  31.108  -40.282 1.00 35.21  ? 756  ASP A CG   1 
ATOM   2728  O OD1  . ASP A 1 195 ? -8.376  32.146  -40.375 1.00 37.07  ? 756  ASP A OD1  1 
ATOM   2729  O OD2  . ASP A 1 195 ? -6.634  30.930  -40.930 1.00 34.19  ? 756  ASP A OD2  1 
ATOM   2730  H H    . ASP A 1 195 ? -7.297  31.297  -37.462 1.00 33.16  ? 756  ASP A H    1 
ATOM   2731  H HA   . ASP A 1 195 ? -9.682  31.093  -38.532 1.00 33.93  ? 756  ASP A HA   1 
ATOM   2732  H HB2  . ASP A 1 195 ? -7.357  29.562  -38.994 1.00 35.64  ? 756  ASP A HB2  1 
ATOM   2733  H HB3  . ASP A 1 195 ? -8.682  29.381  -39.852 1.00 35.64  ? 756  ASP A HB3  1 
ATOM   2734  N N    . ILE A 1 196 ? -8.937  28.822  -36.426 1.00 27.34  ? 757  ILE A N    1 
ATOM   2735  C CA   . ILE A 1 196 ? -9.513  27.723  -35.655 1.00 28.23  ? 757  ILE A CA   1 
ATOM   2736  C C    . ILE A 1 196 ? -10.739 28.204  -34.888 1.00 30.59  ? 757  ILE A C    1 
ATOM   2737  O O    . ILE A 1 196 ? -11.747 27.493  -34.790 1.00 28.32  ? 757  ILE A O    1 
ATOM   2738  C CB   . ILE A 1 196 ? -8.450  27.121  -34.715 1.00 29.65  ? 757  ILE A CB   1 
ATOM   2739  C CG1  . ILE A 1 196 ? -7.276  26.556  -35.523 1.00 24.66  ? 757  ILE A CG1  1 
ATOM   2740  C CG2  . ILE A 1 196 ? -9.060  26.053  -33.815 1.00 32.95  ? 757  ILE A CG2  1 
ATOM   2741  C CD1  . ILE A 1 196 ? -7.634  25.400  -36.445 1.00 24.20  ? 757  ILE A CD1  1 
ATOM   2742  H H    . ILE A 1 196 ? -8.150  29.061  -36.176 1.00 32.81  ? 757  ILE A H    1 
ATOM   2743  H HA   . ILE A 1 196 ? -9.799  27.027  -36.266 1.00 33.88  ? 757  ILE A HA   1 
ATOM   2744  H HB   . ILE A 1 196 ? -8.111  27.833  -34.149 1.00 35.58  ? 757  ILE A HB   1 
ATOM   2745  H HG12 . ILE A 1 196 ? -6.908  27.266  -36.072 1.00 29.59  ? 757  ILE A HG12 1 
ATOM   2746  H HG13 . ILE A 1 196 ? -6.599  26.238  -34.905 1.00 29.59  ? 757  ILE A HG13 1 
ATOM   2747  H HG21 . ILE A 1 196 ? -8.368  25.694  -33.237 1.00 39.54  ? 757  ILE A HG21 1 
ATOM   2748  H HG22 . ILE A 1 196 ? -9.763  26.454  -33.281 1.00 39.54  ? 757  ILE A HG22 1 
ATOM   2749  H HG23 . ILE A 1 196 ? -9.427  25.346  -34.369 1.00 39.54  ? 757  ILE A HG23 1 
ATOM   2750  H HD11 . ILE A 1 196 ? -6.834  25.110  -36.912 1.00 29.04  ? 757  ILE A HD11 1 
ATOM   2751  H HD12 . ILE A 1 196 ? -7.990  24.671  -35.913 1.00 29.04  ? 757  ILE A HD12 1 
ATOM   2752  H HD13 . ILE A 1 196 ? -8.299  25.701  -37.083 1.00 29.04  ? 757  ILE A HD13 1 
ATOM   2753  N N    . PHE A 1 197 ? -10.678 29.421  -34.341 1.00 26.70  ? 758  PHE A N    1 
ATOM   2754  C CA   . PHE A 1 197 ? -11.838 29.993  -33.664 1.00 28.22  ? 758  PHE A CA   1 
ATOM   2755  C C    . PHE A 1 197 ? -13.003 30.151  -34.623 1.00 32.19  ? 758  PHE A C    1 
ATOM   2756  O O    . PHE A 1 197 ? -14.124 29.710  -34.336 1.00 26.28  ? 758  PHE A O    1 
ATOM   2757  C CB   . PHE A 1 197 ? -11.469 31.332  -33.022 1.00 32.32  ? 758  PHE A CB   1 
ATOM   2758  C CG   . PHE A 1 197 ? -12.612 31.992  -32.304 1.00 35.91  ? 758  PHE A CG   1 
ATOM   2759  C CD1  . PHE A 1 197 ? -13.512 32.788  -32.992 1.00 34.02  ? 758  PHE A CD1  1 
ATOM   2760  C CD2  . PHE A 1 197 ? -12.790 31.813  -30.943 1.00 41.78  ? 758  PHE A CD2  1 
ATOM   2761  C CE1  . PHE A 1 197 ? -14.567 33.390  -32.338 1.00 39.52  ? 758  PHE A CE1  1 
ATOM   2762  C CE2  . PHE A 1 197 ? -13.843 32.414  -30.280 1.00 39.73  ? 758  PHE A CE2  1 
ATOM   2763  C CZ   . PHE A 1 197 ? -14.733 33.204  -30.980 1.00 41.64  ? 758  PHE A CZ   1 
ATOM   2764  H H    . PHE A 1 197 ? -9.983  29.929  -34.349 1.00 32.04  ? 758  PHE A H    1 
ATOM   2765  H HA   . PHE A 1 197 ? -12.115 29.390  -32.956 1.00 33.86  ? 758  PHE A HA   1 
ATOM   2766  H HB2  . PHE A 1 197 ? -10.759 31.185  -32.378 1.00 38.78  ? 758  PHE A HB2  1 
ATOM   2767  H HB3  . PHE A 1 197 ? -11.165 31.938  -33.715 1.00 38.78  ? 758  PHE A HB3  1 
ATOM   2768  H HD1  . PHE A 1 197 ? -13.406 32.915  -33.907 1.00 40.83  ? 758  PHE A HD1  1 
ATOM   2769  H HD2  . PHE A 1 197 ? -12.193 31.280  -30.468 1.00 50.13  ? 758  PHE A HD2  1 
ATOM   2770  H HE1  . PHE A 1 197 ? -15.164 33.923  -32.811 1.00 47.43  ? 758  PHE A HE1  1 
ATOM   2771  H HE2  . PHE A 1 197 ? -13.952 32.287  -29.365 1.00 47.67  ? 758  PHE A HE2  1 
ATOM   2772  H HZ   . PHE A 1 197 ? -15.442 33.612  -30.537 1.00 49.97  ? 758  PHE A HZ   1 
ATOM   2773  N N    . SER A 1 198 ? -12.758 30.781  -35.771 1.00 26.87  ? 759  SER A N    1 
ATOM   2774  C CA   . SER A 1 198 ? -13.813 30.925  -36.762 1.00 29.51  ? 759  SER A CA   1 
ATOM   2775  C C    . SER A 1 198 ? -14.343 29.562  -37.189 1.00 27.37  ? 759  SER A C    1 
ATOM   2776  O O    . SER A 1 198 ? -15.559 29.375  -37.322 1.00 25.97  ? 759  SER A O    1 
ATOM   2777  C CB   . SER A 1 198 ? -13.287 31.705  -37.962 1.00 36.38  ? 759  SER A CB   1 
ATOM   2778  O OG   . SER A 1 198 ? -12.635 32.891  -37.543 1.00 43.37  ? 759  SER A OG   1 
ATOM   2779  H H    . SER A 1 198 ? -12.003 31.127  -35.994 1.00 32.24  ? 759  SER A H    1 
ATOM   2780  H HA   . SER A 1 198 ? -14.548 31.426  -36.374 1.00 35.41  ? 759  SER A HA   1 
ATOM   2781  H HB2  . SER A 1 198 ? -12.656 31.151  -38.447 1.00 43.66  ? 759  SER A HB2  1 
ATOM   2782  H HB3  . SER A 1 198 ? -14.032 31.940  -38.536 1.00 43.66  ? 759  SER A HB3  1 
ATOM   2783  H HG   . SER A 1 198 ? -13.171 33.380  -37.121 1.00 52.04  ? 759  SER A HG   1 
ATOM   2784  N N    . ALA A 1 199 ? -13.446 28.590  -37.379 1.00 24.53  ? 760  ALA A N    1 
ATOM   2785  C CA   . ALA A 1 199 ? -13.874 27.256  -37.788 1.00 26.76  ? 760  ALA A CA   1 
ATOM   2786  C C    . ALA A 1 199 ? -14.741 26.605  -36.718 1.00 31.14  ? 760  ALA A C    1 
ATOM   2787  O O    . ALA A 1 199 ? -15.735 25.941  -37.034 1.00 31.00  ? 760  ALA A O    1 
ATOM   2788  C CB   . ALA A 1 199 ? -12.655 26.387  -38.099 1.00 25.12  ? 760  ALA A CB   1 
ATOM   2789  H H    . ALA A 1 199 ? -12.596 28.679  -37.279 1.00 29.43  ? 760  ALA A H    1 
ATOM   2790  H HA   . ALA A 1 199 ? -14.403 27.330  -38.598 1.00 32.11  ? 760  ALA A HA   1 
ATOM   2791  H HB1  . ALA A 1 199 ? -12.956 25.506  -38.368 1.00 30.15  ? 760  ALA A HB1  1 
ATOM   2792  H HB2  . ALA A 1 199 ? -12.149 26.799  -38.817 1.00 30.15  ? 760  ALA A HB2  1 
ATOM   2793  H HB3  . ALA A 1 199 ? -12.104 26.320  -37.303 1.00 30.15  ? 760  ALA A HB3  1 
ATOM   2794  N N    . GLY A 1 200 ? -14.384 26.786  -35.445 1.00 29.10  ? 761  GLY A N    1 
ATOM   2795  C CA   . GLY A 1 200 ? -15.213 26.253  -34.376 1.00 30.38  ? 761  GLY A CA   1 
ATOM   2796  C C    . GLY A 1 200 ? -16.626 26.805  -34.405 1.00 32.42  ? 761  GLY A C    1 
ATOM   2797  O O    . GLY A 1 200 ? -17.595 26.066  -34.209 1.00 26.57  ? 761  GLY A O    1 
ATOM   2798  H H    . GLY A 1 200 ? -13.681 27.206  -35.183 1.00 34.92  ? 761  GLY A H    1 
ATOM   2799  H HA2  . GLY A 1 200 ? -15.259 25.287  -34.454 1.00 36.46  ? 761  GLY A HA2  1 
ATOM   2800  H HA3  . GLY A 1 200 ? -14.815 26.473  -33.519 1.00 36.46  ? 761  GLY A HA3  1 
ATOM   2801  N N    . CYS A 1 201 ? -16.763 28.112  -34.645 1.00 30.12  ? 762  CYS A N    1 
ATOM   2802  C CA   . CYS A 1 201 ? -18.088 28.697  -34.820 1.00 31.86  ? 762  CYS A CA   1 
ATOM   2803  C C    . CYS A 1 201 ? -18.790 28.108  -36.039 1.00 35.59  ? 762  CYS A C    1 
ATOM   2804  O O    . CYS A 1 201 ? -20.007 27.890  -36.019 1.00 34.75  ? 762  CYS A O    1 
ATOM   2805  C CB   . CYS A 1 201 ? -17.975 30.215  -34.944 1.00 39.65  ? 762  CYS A CB   1 
ATOM   2806  S SG   . CYS A 1 201 ? -17.329 31.036  -33.467 1.00 32.76  ? 762  CYS A SG   1 
ATOM   2807  H H    . CYS A 1 201 ? -16.113 28.672  -34.709 1.00 36.14  ? 762  CYS A H    1 
ATOM   2808  H HA   . CYS A 1 201 ? -18.628 28.499  -34.038 1.00 38.23  ? 762  CYS A HA   1 
ATOM   2809  H HB2  . CYS A 1 201 ? -17.379 30.423  -35.681 1.00 47.58  ? 762  CYS A HB2  1 
ATOM   2810  H HB3  . CYS A 1 201 ? -18.856 30.579  -35.123 1.00 47.58  ? 762  CYS A HB3  1 
ATOM   2811  H HG   . CYS A 1 201 ? -17.280 32.219  -33.667 1.00 39.31  ? 762  CYS A HG   1 
ATOM   2812  N N    . VAL A 1 202 ? -18.038 27.843  -37.110 1.00 29.45  ? 763  VAL A N    1 
ATOM   2813  C CA   . VAL A 1 202 ? -18.622 27.221  -38.295 1.00 34.20  ? 763  VAL A CA   1 
ATOM   2814  C C    . VAL A 1 202 ? -19.040 25.787  -37.992 1.00 30.48  ? 763  VAL A C    1 
ATOM   2815  O O    . VAL A 1 202 ? -20.086 25.320  -38.459 1.00 31.62  ? 763  VAL A O    1 
ATOM   2816  C CB   . VAL A 1 202 ? -17.633 27.284  -39.474 1.00 30.18  ? 763  VAL A CB   1 
ATOM   2817  C CG1  . VAL A 1 202 ? -18.126 26.435  -40.648 1.00 22.76  ? 763  VAL A CG1  1 
ATOM   2818  C CG2  . VAL A 1 202 ? -17.430 28.724  -39.918 1.00 27.51  ? 763  VAL A CG2  1 
ATOM   2819  H H    . VAL A 1 202 ? -17.197 28.012  -37.174 1.00 35.34  ? 763  VAL A H    1 
ATOM   2820  H HA   . VAL A 1 202 ? -19.418 27.715  -38.548 1.00 41.04  ? 763  VAL A HA   1 
ATOM   2821  H HB   . VAL A 1 202 ? -16.775 26.933  -39.188 1.00 36.21  ? 763  VAL A HB   1 
ATOM   2822  H HG11 . VAL A 1 202 ? -17.483 26.495  -41.372 1.00 27.31  ? 763  VAL A HG11 1 
ATOM   2823  H HG12 . VAL A 1 202 ? -18.211 25.514  -40.356 1.00 27.31  ? 763  VAL A HG12 1 
ATOM   2824  H HG13 . VAL A 1 202 ? -18.987 26.771  -40.940 1.00 27.31  ? 763  VAL A HG13 1 
ATOM   2825  H HG21 . VAL A 1 202 ? -16.805 28.740  -40.659 1.00 33.01  ? 763  VAL A HG21 1 
ATOM   2826  H HG22 . VAL A 1 202 ? -18.283 29.091  -40.196 1.00 33.01  ? 763  VAL A HG22 1 
ATOM   2827  H HG23 . VAL A 1 202 ? -17.075 29.236  -39.174 1.00 33.01  ? 763  VAL A HG23 1 
ATOM   2828  N N    . PHE A 1 203 ? -18.222 25.061  -37.227 1.00 28.88  ? 764  PHE A N    1 
ATOM   2829  C CA   . PHE A 1 203 ? -18.568 23.695  -36.849 1.00 30.63  ? 764  PHE A CA   1 
ATOM   2830  C C    . PHE A 1 203 ? -19.911 23.649  -36.134 1.00 32.64  ? 764  PHE A C    1 
ATOM   2831  O O    . PHE A 1 203 ? -20.787 22.847  -36.481 1.00 36.88  ? 764  PHE A O    1 
ATOM   2832  C CB   . PHE A 1 203 ? -17.474 23.104  -35.961 1.00 31.30  ? 764  PHE A CB   1 
ATOM   2833  C CG   . PHE A 1 203 ? -16.350 22.464  -36.723 1.00 31.33  ? 764  PHE A CG   1 
ATOM   2834  C CD1  . PHE A 1 203 ? -15.833 23.061  -37.857 1.00 34.42  ? 764  PHE A CD1  1 
ATOM   2835  C CD2  . PHE A 1 203 ? -15.801 21.268  -36.293 1.00 30.45  ? 764  PHE A CD2  1 
ATOM   2836  C CE1  . PHE A 1 203 ? -14.797 22.476  -38.552 1.00 28.83  ? 764  PHE A CE1  1 
ATOM   2837  C CE2  . PHE A 1 203 ? -14.764 20.676  -36.985 1.00 33.51  ? 764  PHE A CE2  1 
ATOM   2838  C CZ   . PHE A 1 203 ? -14.261 21.281  -38.115 1.00 34.08  ? 764  PHE A CZ   1 
ATOM   2839  H H    . PHE A 1 203 ? -17.468 25.336  -36.917 1.00 34.66  ? 764  PHE A H    1 
ATOM   2840  H HA   . PHE A 1 203 ? -18.634 23.151  -37.649 1.00 36.75  ? 764  PHE A HA   1 
ATOM   2841  H HB2  . PHE A 1 203 ? -17.097 23.814  -35.418 1.00 37.56  ? 764  PHE A HB2  1 
ATOM   2842  H HB3  . PHE A 1 203 ? -17.868 22.427  -35.390 1.00 37.56  ? 764  PHE A HB3  1 
ATOM   2843  H HD1  . PHE A 1 203 ? -16.190 23.866  -38.156 1.00 41.30  ? 764  PHE A HD1  1 
ATOM   2844  H HD2  . PHE A 1 203 ? -16.138 20.856  -35.530 1.00 36.54  ? 764  PHE A HD2  1 
ATOM   2845  H HE1  . PHE A 1 203 ? -14.459 22.885  -39.316 1.00 34.60  ? 764  PHE A HE1  1 
ATOM   2846  H HE2  . PHE A 1 203 ? -14.405 19.871  -36.688 1.00 40.21  ? 764  PHE A HE2  1 
ATOM   2847  H HZ   . PHE A 1 203 ? -13.563 20.885  -38.584 1.00 40.89  ? 764  PHE A HZ   1 
ATOM   2848  N N    . TYR A 1 204 ? -20.091 24.501  -35.122 1.00 31.55  ? 765  TYR A N    1 
ATOM   2849  C CA   . TYR A 1 204 ? -21.366 24.533  -34.415 1.00 38.44  ? 765  TYR A CA   1 
ATOM   2850  C C    . TYR A 1 204 ? -22.486 25.017  -35.325 1.00 40.07  ? 765  TYR A C    1 
ATOM   2851  O O    . TYR A 1 204 ? -23.620 24.536  -35.226 1.00 42.76  ? 765  TYR A O    1 
ATOM   2852  C CB   . TYR A 1 204 ? -21.267 25.420  -33.176 1.00 42.28  ? 765  TYR A CB   1 
ATOM   2853  C CG   . TYR A 1 204 ? -22.498 25.360  -32.300 1.00 44.97  ? 765  TYR A CG   1 
ATOM   2854  C CD1  . TYR A 1 204 ? -22.675 24.326  -31.390 1.00 45.03  ? 765  TYR A CD1  1 
ATOM   2855  C CD2  . TYR A 1 204 ? -23.488 26.330  -32.387 1.00 45.12  ? 765  TYR A CD2  1 
ATOM   2856  C CE1  . TYR A 1 204 ? -23.799 24.263  -30.589 1.00 50.67  ? 765  TYR A CE1  1 
ATOM   2857  C CE2  . TYR A 1 204 ? -24.614 26.277  -31.589 1.00 45.84  ? 765  TYR A CE2  1 
ATOM   2858  C CZ   . TYR A 1 204 ? -24.765 25.242  -30.692 1.00 52.75  ? 765  TYR A CZ   1 
ATOM   2859  O OH   . TYR A 1 204 ? -25.887 25.187  -29.898 1.00 56.04  ? 765  TYR A OH   1 
ATOM   2860  H H    . TYR A 1 204 ? -19.503 25.058  -34.833 1.00 37.86  ? 765  TYR A H    1 
ATOM   2861  H HA   . TYR A 1 204 ? -21.586 23.634  -34.123 1.00 46.13  ? 765  TYR A HA   1 
ATOM   2862  H HB2  . TYR A 1 204 ? -20.508 25.133  -32.644 1.00 50.74  ? 765  TYR A HB2  1 
ATOM   2863  H HB3  . TYR A 1 204 ? -21.145 26.340  -33.457 1.00 50.74  ? 765  TYR A HB3  1 
ATOM   2864  H HD1  . TYR A 1 204 ? -22.025 23.665  -31.317 1.00 54.04  ? 765  TYR A HD1  1 
ATOM   2865  H HD2  . TYR A 1 204 ? -23.389 27.031  -32.990 1.00 54.15  ? 765  TYR A HD2  1 
ATOM   2866  H HE1  . TYR A 1 204 ? -23.903 23.566  -29.983 1.00 60.80  ? 765  TYR A HE1  1 
ATOM   2867  H HE2  . TYR A 1 204 ? -25.267 26.935  -31.658 1.00 55.01  ? 765  TYR A HE2  1 
ATOM   2868  H HH   . TYR A 1 204 ? -26.388 25.841  -30.064 1.00 67.25  ? 765  TYR A HH   1 
ATOM   2869  N N    . TYR A 1 205 ? -22.187 25.962  -36.220 1.00 43.60  ? 766  TYR A N    1 
ATOM   2870  C CA   . TYR A 1 205 ? -23.205 26.478  -37.131 1.00 40.90  ? 766  TYR A CA   1 
ATOM   2871  C C    . TYR A 1 205 ? -23.799 25.364  -37.982 1.00 38.37  ? 766  TYR A C    1 
ATOM   2872  O O    . TYR A 1 205 ? -25.014 25.329  -38.212 1.00 44.65  ? 766  TYR A O    1 
ATOM   2873  C CB   . TYR A 1 205 ? -22.603 27.574  -38.011 1.00 43.69  ? 766  TYR A CB   1 
ATOM   2874  C CG   . TYR A 1 205 ? -23.578 28.224  -38.967 1.00 41.35  ? 766  TYR A CG   1 
ATOM   2875  C CD1  . TYR A 1 205 ? -24.471 29.194  -38.531 1.00 48.91  ? 766  TYR A CD1  1 
ATOM   2876  C CD2  . TYR A 1 205 ? -23.594 27.876  -40.308 1.00 47.44  ? 766  TYR A CD2  1 
ATOM   2877  C CE1  . TYR A 1 205 ? -25.357 29.792  -39.407 1.00 49.89  ? 766  TYR A CE1  1 
ATOM   2878  C CE2  . TYR A 1 205 ? -24.469 28.472  -41.189 1.00 55.11  ? 766  TYR A CE2  1 
ATOM   2879  C CZ   . TYR A 1 205 ? -25.351 29.424  -40.734 1.00 56.72  ? 766  TYR A CZ   1 
ATOM   2880  O OH   . TYR A 1 205 ? -26.225 30.008  -41.620 1.00 66.64  ? 766  TYR A OH   1 
ATOM   2881  H H    . TYR A 1 205 ? -21.409 26.317  -36.318 1.00 52.32  ? 766  TYR A H    1 
ATOM   2882  H HA   . TYR A 1 205 ? -23.923 26.872  -36.611 1.00 49.08  ? 766  TYR A HA   1 
ATOM   2883  H HB2  . TYR A 1 205 ? -22.246 28.270  -37.438 1.00 52.43  ? 766  TYR A HB2  1 
ATOM   2884  H HB3  . TYR A 1 205 ? -21.888 27.188  -38.540 1.00 52.43  ? 766  TYR A HB3  1 
ATOM   2885  H HD1  . TYR A 1 205 ? -24.475 29.442  -37.635 1.00 58.69  ? 766  TYR A HD1  1 
ATOM   2886  H HD2  . TYR A 1 205 ? -23.000 27.232  -40.620 1.00 56.93  ? 766  TYR A HD2  1 
ATOM   2887  H HE1  . TYR A 1 205 ? -25.952 30.438  -39.103 1.00 59.87  ? 766  TYR A HE1  1 
ATOM   2888  H HE2  . TYR A 1 205 ? -24.470 28.224  -42.086 1.00 66.13  ? 766  TYR A HE2  1 
ATOM   2889  H HH   . TYR A 1 205 ? -26.705 30.571  -41.221 1.00 79.96  ? 766  TYR A HH   1 
ATOM   2890  N N    . VAL A 1 206 ? -22.961 24.439  -38.451 1.00 38.21  ? 767  VAL A N    1 
ATOM   2891  C CA   . VAL A 1 206 ? -23.456 23.324  -39.252 1.00 40.41  ? 767  VAL A CA   1 
ATOM   2892  C C    . VAL A 1 206 ? -24.171 22.310  -38.363 1.00 43.54  ? 767  VAL A C    1 
ATOM   2893  O O    . VAL A 1 206 ? -25.280 21.860  -38.675 1.00 45.94  ? 767  VAL A O    1 
ATOM   2894  C CB   . VAL A 1 206 ? -22.297 22.678  -40.033 1.00 35.73  ? 767  VAL A CB   1 
ATOM   2895  C CG1  . VAL A 1 206 ? -22.763 21.433  -40.774 1.00 40.88  ? 767  VAL A CG1  1 
ATOM   2896  C CG2  . VAL A 1 206 ? -21.697 23.685  -41.008 1.00 38.76  ? 767  VAL A CG2  1 
ATOM   2897  H H    . VAL A 1 206 ? -22.110 24.436  -38.321 1.00 45.85  ? 767  VAL A H    1 
ATOM   2898  H HA   . VAL A 1 206 ? -24.098 23.660  -39.896 1.00 48.50  ? 767  VAL A HA   1 
ATOM   2899  H HB   . VAL A 1 206 ? -21.603 22.414  -39.409 1.00 42.88  ? 767  VAL A HB   1 
ATOM   2900  H HG11 . VAL A 1 206 ? -22.012 21.051  -41.255 1.00 49.06  ? 767  VAL A HG11 1 
ATOM   2901  H HG12 . VAL A 1 206 ? -23.104 20.792  -40.131 1.00 49.06  ? 767  VAL A HG12 1 
ATOM   2902  H HG13 . VAL A 1 206 ? -23.464 21.680  -41.398 1.00 49.06  ? 767  VAL A HG13 1 
ATOM   2903  H HG21 . VAL A 1 206 ? -20.970 23.263  -41.490 1.00 46.51  ? 767  VAL A HG21 1 
ATOM   2904  H HG22 . VAL A 1 206 ? -22.385 23.971  -41.629 1.00 46.51  ? 767  VAL A HG22 1 
ATOM   2905  H HG23 . VAL A 1 206 ? -21.364 24.447  -40.508 1.00 46.51  ? 767  VAL A HG23 1 
ATOM   2906  N N    . ILE A 1 207 ? -23.547 21.939  -37.243 1.00 42.60  ? 768  ILE A N    1 
ATOM   2907  C CA   . ILE A 1 207 ? -24.143 20.952  -36.342 1.00 49.27  ? 768  ILE A CA   1 
ATOM   2908  C C    . ILE A 1 207 ? -25.476 21.460  -35.809 1.00 49.35  ? 768  ILE A C    1 
ATOM   2909  O O    . ILE A 1 207 ? -26.488 20.750  -35.831 1.00 47.57  ? 768  ILE A O    1 
ATOM   2910  C CB   . ILE A 1 207 ? -23.169 20.623  -35.196 1.00 51.70  ? 768  ILE A CB   1 
ATOM   2911  C CG1  . ILE A 1 207 ? -21.932 19.912  -35.742 1.00 47.44  ? 768  ILE A CG1  1 
ATOM   2912  C CG2  . ILE A 1 207 ? -23.835 19.748  -34.137 1.00 58.54  ? 768  ILE A CG2  1 
ATOM   2913  C CD1  . ILE A 1 207 ? -20.754 20.008  -34.820 1.00 66.32  ? 768  ILE A CD1  1 
ATOM   2914  H H    . ILE A 1 207 ? -22.785 22.242  -36.984 1.00 51.12  ? 768  ILE A H    1 
ATOM   2915  H HA   . ILE A 1 207 ? -24.310 20.134  -36.837 1.00 59.13  ? 768  ILE A HA   1 
ATOM   2916  H HB   . ILE A 1 207 ? -22.890 21.454  -34.780 1.00 62.04  ? 768  ILE A HB   1 
ATOM   2917  H HG12 . ILE A 1 207 ? -22.138 18.973  -35.869 1.00 56.93  ? 768  ILE A HG12 1 
ATOM   2918  H HG13 . ILE A 1 207 ? -21.684 20.315  -36.588 1.00 56.93  ? 768  ILE A HG13 1 
ATOM   2919  H HG21 . ILE A 1 207 ? -23.193 19.562  -33.433 1.00 70.25  ? 768  ILE A HG21 1 
ATOM   2920  H HG22 . ILE A 1 207 ? -24.599 20.220  -33.772 1.00 70.25  ? 768  ILE A HG22 1 
ATOM   2921  H HG23 . ILE A 1 207 ? -24.123 18.919  -34.549 1.00 70.25  ? 768  ILE A HG23 1 
ATOM   2922  H HD11 . ILE A 1 207 ? -20.004 19.540  -35.219 1.00 79.59  ? 768  ILE A HD11 1 
ATOM   2923  H HD12 . ILE A 1 207 ? -20.531 20.942  -34.690 1.00 79.59  ? 768  ILE A HD12 1 
ATOM   2924  H HD13 . ILE A 1 207 ? -20.985 19.601  -33.971 1.00 79.59  ? 768  ILE A HD13 1 
ATOM   2925  N N    . SER A 1 208 ? -25.495 22.704  -35.332 1.00 47.00  ? 769  SER A N    1 
ATOM   2926  C CA   . SER A 1 208 ? -26.702 23.289  -34.762 1.00 47.91  ? 769  SER A CA   1 
ATOM   2927  C C    . SER A 1 208 ? -27.756 23.614  -35.810 1.00 52.92  ? 769  SER A C    1 
ATOM   2928  O O    . SER A 1 208 ? -28.863 24.022  -35.438 1.00 54.37  ? 769  SER A O    1 
ATOM   2929  C CB   . SER A 1 208 ? -26.352 24.558  -33.985 1.00 45.04  ? 769  SER A CB   1 
ATOM   2930  O OG   . SER A 1 208 ? -25.770 25.543  -34.824 1.00 50.81  ? 769  SER A OG   1 
ATOM   2931  H H    . SER A 1 208 ? -24.816 23.232  -35.327 1.00 56.40  ? 769  SER A H    1 
ATOM   2932  H HA   . SER A 1 208 ? -27.090 22.656  -34.137 1.00 57.49  ? 769  SER A HA   1 
ATOM   2933  H HB2  . SER A 1 208 ? -27.164 24.919  -33.594 1.00 54.05  ? 769  SER A HB2  1 
ATOM   2934  H HB3  . SER A 1 208 ? -25.722 24.332  -33.283 1.00 54.05  ? 769  SER A HB3  1 
ATOM   2935  H HG   . SER A 1 208 ? -25.064 25.246  -35.168 1.00 60.98  ? 769  SER A HG   1 
ATOM   2936  N N    . GLU A 1 209 ? -27.444 23.449  -37.096 1.00 52.07  ? 770  GLU A N    1 
ATOM   2937  C CA   . GLU A 1 209 ? -28.362 23.791  -38.182 1.00 52.80  ? 770  GLU A CA   1 
ATOM   2938  C C    . GLU A 1 209 ? -28.764 25.265  -38.122 1.00 53.20  ? 770  GLU A C    1 
ATOM   2939  O O    . GLU A 1 209 ? -29.947 25.613  -38.101 1.00 54.35  ? 770  GLU A O    1 
ATOM   2940  C CB   . GLU A 1 209 ? -29.595 22.882  -38.168 1.00 56.18  ? 770  GLU A CB   1 
ATOM   2941  C CG   . GLU A 1 209 ? -29.273 21.398  -38.299 1.00 59.49  ? 770  GLU A CG   1 
ATOM   2942  C CD   . GLU A 1 209 ? -30.511 20.547  -38.513 1.00 67.82  ? 770  GLU A CD   1 
ATOM   2943  O OE1  . GLU A 1 209 ? -31.380 20.949  -39.315 1.00 80.13  ? 770  GLU A OE1  1 
ATOM   2944  O OE2  . GLU A 1 209 ? -30.617 19.478  -37.876 1.00 69.27  ? 770  GLU A OE2  1 
ATOM   2945  H H    . GLU A 1 209 ? -26.691 23.135  -37.370 1.00 62.49  ? 770  GLU A H    1 
ATOM   2946  H HA   . GLU A 1 209 ? -27.906 23.648  -39.026 1.00 63.36  ? 770  GLU A HA   1 
ATOM   2947  H HB2  . GLU A 1 209 ? -30.067 23.009  -37.330 1.00 67.41  ? 770  GLU A HB2  1 
ATOM   2948  H HB3  . GLU A 1 209 ? -30.171 23.126  -38.909 1.00 67.41  ? 770  GLU A HB3  1 
ATOM   2949  H HG2  . GLU A 1 209 ? -28.685 21.268  -39.059 1.00 71.39  ? 770  GLU A HG2  1 
ATOM   2950  H HG3  . GLU A 1 209 ? -28.838 21.096  -37.487 1.00 71.39  ? 770  GLU A HG3  1 
ATOM   2951  N N    . GLY A 1 210 ? -27.753 26.136  -38.084 1.00 54.54  ? 771  GLY A N    1 
ATOM   2952  C CA   . GLY A 1 210 ? -27.924 27.566  -38.252 1.00 59.42  ? 771  GLY A CA   1 
ATOM   2953  C C    . GLY A 1 210 ? -27.739 28.394  -36.996 1.00 49.67  ? 771  GLY A C    1 
ATOM   2954  O O    . GLY A 1 210 ? -27.589 29.619  -37.101 1.00 55.61  ? 771  GLY A O    1 
ATOM   2955  H H    . GLY A 1 210 ? -26.935 25.906  -37.957 1.00 65.45  ? 771  GLY A H    1 
ATOM   2956  H HA2  . GLY A 1 210 ? -27.287 27.881  -38.912 1.00 71.31  ? 771  GLY A HA2  1 
ATOM   2957  H HA3  . GLY A 1 210 ? -28.816 27.737  -38.592 1.00 71.31  ? 771  GLY A HA3  1 
ATOM   2958  N N    . SER A 1 211 ? -27.739 27.778  -35.818 1.00 55.27  ? 772  SER A N    1 
ATOM   2959  C CA   . SER A 1 211 ? -27.473 28.524  -34.597 1.00 53.35  ? 772  SER A CA   1 
ATOM   2960  C C    . SER A 1 211 ? -25.975 28.767  -34.431 1.00 49.19  ? 772  SER A C    1 
ATOM   2961  O O    . SER A 1 211 ? -25.138 28.024  -34.947 1.00 47.56  ? 772  SER A O    1 
ATOM   2962  C CB   . SER A 1 211 ? -28.023 27.791  -33.375 1.00 48.02  ? 772  SER A CB   1 
ATOM   2963  O OG   . SER A 1 211 ? -29.439 27.801  -33.367 1.00 55.68  ? 772  SER A OG   1 
ATOM   2964  H H    . SER A 1 211 ? -27.887 26.939  -35.700 1.00 66.32  ? 772  SER A H    1 
ATOM   2965  H HA   . SER A 1 211 ? -27.913 29.387  -34.652 1.00 64.02  ? 772  SER A HA   1 
ATOM   2966  H HB2  . SER A 1 211 ? -27.715 26.871  -33.395 1.00 57.62  ? 772  SER A HB2  1 
ATOM   2967  H HB3  . SER A 1 211 ? -27.701 28.230  -32.573 1.00 57.62  ? 772  SER A HB3  1 
ATOM   2968  H HG   . SER A 1 211 ? -29.726 27.395  -32.690 1.00 66.81  ? 772  SER A HG   1 
ATOM   2969  N N    . HIS A 1 212 ? -25.646 29.820  -33.683 1.00 47.81  ? 773  HIS A N    1 
ATOM   2970  C CA   . HIS A 1 212 ? -24.273 30.246  -33.465 1.00 47.96  ? 773  HIS A CA   1 
ATOM   2971  C C    . HIS A 1 212 ? -23.923 30.110  -31.986 1.00 48.55  ? 773  HIS A C    1 
ATOM   2972  O O    . HIS A 1 212 ? -24.790 30.304  -31.127 1.00 50.82  ? 773  HIS A O    1 
ATOM   2973  C CB   . HIS A 1 212 ? -24.091 31.705  -33.910 1.00 51.68  ? 773  HIS A CB   1 
ATOM   2974  C CG   . HIS A 1 212 ? -22.661 32.138  -34.026 1.00 51.28  ? 773  HIS A CG   1 
ATOM   2975  N ND1  . HIS A 1 212 ? -21.974 32.730  -32.989 1.00 45.26  ? 773  HIS A ND1  1 
ATOM   2976  C CD2  . HIS A 1 212 ? -21.796 32.081  -35.066 1.00 52.95  ? 773  HIS A CD2  1 
ATOM   2977  C CE1  . HIS A 1 212 ? -20.742 33.006  -33.380 1.00 43.95  ? 773  HIS A CE1  1 
ATOM   2978  N NE2  . HIS A 1 212 ? -20.609 32.624  -34.637 1.00 46.15  ? 773  HIS A NE2  1 
ATOM   2979  H H    . HIS A 1 212 ? -26.223 30.316  -33.280 1.00 57.38  ? 773  HIS A H    1 
ATOM   2980  H HA   . HIS A 1 212 ? -23.671 29.685  -33.980 1.00 57.55  ? 773  HIS A HA   1 
ATOM   2981  H HB2  . HIS A 1 212 ? -24.505 31.819  -34.780 1.00 62.01  ? 773  HIS A HB2  1 
ATOM   2982  H HB3  . HIS A 1 212 ? -24.523 32.284  -33.263 1.00 62.01  ? 773  HIS A HB3  1 
ATOM   2983  H HD2  . HIS A 1 212 ? -21.970 31.733  -35.910 1.00 63.54  ? 773  HIS A HD2  1 
ATOM   2984  H HE1  . HIS A 1 212 ? -20.083 33.406  -32.860 1.00 52.74  ? 773  HIS A HE1  1 
ATOM   2985  H HE2  . HIS A 1 212 ? -19.895 32.702  -35.110 1.00 55.38  ? 773  HIS A HE2  1 
ATOM   2986  N N    . PRO A 1 213 ? -22.671 29.765  -31.652 1.00 47.51  ? 774  PRO A N    1 
ATOM   2987  C CA   . PRO A 1 213 ? -22.309 29.643  -30.228 1.00 50.18  ? 774  PRO A CA   1 
ATOM   2988  C C    . PRO A 1 213 ? -22.645 30.880  -29.416 1.00 51.90  ? 774  PRO A C    1 
ATOM   2989  O O    . PRO A 1 213 ? -23.128 30.776  -28.281 1.00 51.05  ? 774  PRO A O    1 
ATOM   2990  C CB   . PRO A 1 213 ? -20.792 29.400  -30.261 1.00 49.14  ? 774  PRO A CB   1 
ATOM   2991  C CG   . PRO A 1 213 ? -20.454 29.002  -31.652 1.00 46.89  ? 774  PRO A CG   1 
ATOM   2992  C CD   . PRO A 1 213 ? -21.622 29.247  -32.549 1.00 46.42  ? 774  PRO A CD   1 
ATOM   2993  H HA   . PRO A 1 213 ? -22.748 28.872  -29.834 1.00 60.22  ? 774  PRO A HA   1 
ATOM   2994  H HB2  . PRO A 1 213 ? -20.330 30.218  -30.021 1.00 58.97  ? 774  PRO A HB2  1 
ATOM   2995  H HB3  . PRO A 1 213 ? -20.566 28.689  -29.641 1.00 58.97  ? 774  PRO A HB3  1 
ATOM   2996  H HG2  . PRO A 1 213 ? -19.694 29.526  -31.951 1.00 56.27  ? 774  PRO A HG2  1 
ATOM   2997  H HG3  . PRO A 1 213 ? -20.226 28.059  -31.660 1.00 56.27  ? 774  PRO A HG3  1 
ATOM   2998  H HD2  . PRO A 1 213 ? -21.396 29.910  -33.220 1.00 55.70  ? 774  PRO A HD2  1 
ATOM   2999  H HD3  . PRO A 1 213 ? -21.911 28.416  -32.958 1.00 55.70  ? 774  PRO A HD3  1 
ATOM   3000  N N    . PHE A 1 214 ? -22.393 32.056  -29.982 1.00 50.47  ? 775  PHE A N    1 
ATOM   3001  C CA   . PHE A 1 214 ? -22.629 33.337  -29.335 1.00 50.87  ? 775  PHE A CA   1 
ATOM   3002  C C    . PHE A 1 214 ? -23.992 33.927  -29.687 1.00 57.89  ? 775  PHE A C    1 
ATOM   3003  O O    . PHE A 1 214 ? -24.292 35.056  -29.287 1.00 63.14  ? 775  PHE A O    1 
ATOM   3004  C CB   . PHE A 1 214 ? -21.487 34.290  -29.690 1.00 48.17  ? 775  PHE A CB   1 
ATOM   3005  C CG   . PHE A 1 214 ? -20.125 33.721  -29.367 1.00 49.59  ? 775  PHE A CG   1 
ATOM   3006  C CD1  . PHE A 1 214 ? -19.492 32.861  -30.251 1.00 49.89  ? 775  PHE A CD1  1 
ATOM   3007  C CD2  . PHE A 1 214 ? -19.495 34.015  -28.168 1.00 47.07  ? 775  PHE A CD2  1 
ATOM   3008  C CE1  . PHE A 1 214 ? -18.254 32.320  -29.956 1.00 44.37  ? 775  PHE A CE1  1 
ATOM   3009  C CE2  . PHE A 1 214 ? -18.254 33.476  -27.868 1.00 47.32  ? 775  PHE A CE2  1 
ATOM   3010  C CZ   . PHE A 1 214 ? -17.634 32.629  -28.764 1.00 47.67  ? 775  PHE A CZ   1 
ATOM   3011  H H    . PHE A 1 214 ? -22.071 32.136  -30.775 1.00 60.56  ? 775  PHE A H    1 
ATOM   3012  H HA   . PHE A 1 214 ? -22.610 33.204  -28.375 1.00 61.04  ? 775  PHE A HA   1 
ATOM   3013  H HB2  . PHE A 1 214 ? -21.515 34.476  -30.642 1.00 57.81  ? 775  PHE A HB2  1 
ATOM   3014  H HB3  . PHE A 1 214 ? -21.594 35.112  -29.188 1.00 57.81  ? 775  PHE A HB3  1 
ATOM   3015  H HD1  . PHE A 1 214 ? -19.904 32.648  -31.057 1.00 59.87  ? 775  PHE A HD1  1 
ATOM   3016  H HD2  . PHE A 1 214 ? -19.908 34.585  -27.560 1.00 56.48  ? 775  PHE A HD2  1 
ATOM   3017  H HE1  . PHE A 1 214 ? -17.838 31.751  -30.562 1.00 53.24  ? 775  PHE A HE1  1 
ATOM   3018  H HE2  . PHE A 1 214 ? -17.838 33.686  -27.063 1.00 56.79  ? 775  PHE A HE2  1 
ATOM   3019  H HZ   . PHE A 1 214 ? -16.800 32.268  -28.565 1.00 57.20  ? 775  PHE A HZ   1 
ATOM   3020  N N    . GLY A 1 215 ? -24.820 33.185  -30.418 1.00 66.14  ? 776  GLY A N    1 
ATOM   3021  C CA   . GLY A 1 215 ? -26.203 33.558  -30.656 1.00 66.90  ? 776  GLY A CA   1 
ATOM   3022  C C    . GLY A 1 215 ? -26.457 34.672  -31.650 1.00 57.73  ? 776  GLY A C    1 
ATOM   3023  O O    . GLY A 1 215 ? -25.857 34.701  -32.729 1.00 54.52  ? 776  GLY A O    1 
ATOM   3024  N N    . LYS A 1 216 ? -27.367 35.582  -31.300 1.00 63.95  ? 777  LYS A N    1 
ATOM   3025  C CA   . LYS A 1 216 ? -27.896 36.543  -32.260 1.00 59.80  ? 777  LYS A CA   1 
ATOM   3026  C C    . LYS A 1 216 ? -26.796 37.433  -32.824 1.00 57.40  ? 777  LYS A C    1 
ATOM   3027  O O    . LYS A 1 216 ? -25.876 37.841  -32.111 1.00 57.98  ? 777  LYS A O    1 
ATOM   3028  C CB   . LYS A 1 216 ? -28.973 37.406  -31.599 1.00 68.94  ? 777  LYS A CB   1 
ATOM   3029  H H    . LYS A 1 216 ? -27.693 35.662  -30.508 1.00 76.74  ? 777  LYS A H    1 
ATOM   3030  H HA   . LYS A 1 216 ? -28.304 36.063  -32.998 1.00 71.76  ? 777  LYS A HA   1 
ATOM   3031  N N    . SER A 1 217 ? -26.919 37.750  -34.118 1.00 63.19  ? 778  SER A N    1 
ATOM   3032  C CA   . SER A 1 217 ? -25.878 38.490  -34.827 1.00 63.45  ? 778  SER A CA   1 
ATOM   3033  C C    . SER A 1 217 ? -25.585 39.828  -34.160 1.00 65.92  ? 778  SER A C    1 
ATOM   3034  O O    . SER A 1 217 ? -24.428 40.266  -34.114 1.00 66.82  ? 778  SER A O    1 
ATOM   3035  C CB   . SER A 1 217 ? -26.298 38.707  -36.282 1.00 61.74  ? 778  SER A CB   1 
ATOM   3036  O OG   . SER A 1 217 ? -26.943 37.560  -36.806 1.00 68.97  ? 778  SER A OG   1 
ATOM   3037  H H    . SER A 1 217 ? -27.598 37.546  -34.605 1.00 75.83  ? 778  SER A H    1 
ATOM   3038  H HA   . SER A 1 217 ? -25.061 37.967  -34.825 1.00 76.14  ? 778  SER A HA   1 
ATOM   3039  H HB2  . SER A 1 217 ? -26.910 39.459  -36.324 1.00 74.09  ? 778  SER A HB2  1 
ATOM   3040  H HB3  . SER A 1 217 ? -25.508 38.894  -36.813 1.00 74.09  ? 778  SER A HB3  1 
ATOM   3041  H HG   . SER A 1 217 ? -27.167 37.696  -37.605 1.00 82.76  ? 778  SER A HG   1 
ATOM   3042  N N    . LEU A 1 218 ? -26.621 40.499  -33.653 1.00 68.93  ? 779  LEU A N    1 
ATOM   3043  C CA   . LEU A 1 218 ? -26.447 41.806  -33.026 1.00 69.62  ? 779  LEU A CA   1 
ATOM   3044  C C    . LEU A 1 218 ? -25.410 41.749  -31.908 1.00 66.44  ? 779  LEU A C    1 
ATOM   3045  O O    . LEU A 1 218 ? -24.352 42.383  -31.985 1.00 62.43  ? 779  LEU A O    1 
ATOM   3046  C CB   . LEU A 1 218 ? -27.791 42.307  -32.492 1.00 69.20  ? 779  LEU A CB   1 
ATOM   3047  H H    . LEU A 1 218 ? -27.434 40.218  -33.660 1.00 82.71  ? 779  LEU A H    1 
ATOM   3048  H HA   . LEU A 1 218 ? -26.134 42.437  -33.692 1.00 83.55  ? 779  LEU A HA   1 
ATOM   3049  N N    . GLN A 1 219 ? -25.703 40.984  -30.859 1.00 66.80  ? 780  GLN A N    1 
ATOM   3050  C CA   . GLN A 1 219 ? -24.816 40.865  -29.709 1.00 66.27  ? 780  GLN A CA   1 
ATOM   3051  C C    . GLN A 1 219 ? -23.730 39.814  -29.902 1.00 58.52  ? 780  GLN A C    1 
ATOM   3052  O O    . GLN A 1 219 ? -22.945 39.588  -28.974 1.00 61.04  ? 780  GLN A O    1 
ATOM   3053  C CB   . GLN A 1 219 ? -25.631 40.533  -28.454 1.00 66.02  ? 780  GLN A CB   1 
ATOM   3054  H H    . GLN A 1 219 ? -26.422 40.517  -30.790 1.00 80.16  ? 780  GLN A H    1 
ATOM   3055  H HA   . GLN A 1 219 ? -24.379 41.718  -29.561 1.00 79.52  ? 780  GLN A HA   1 
ATOM   3056  N N    . ARG A 1 220 ? -23.674 39.168  -31.071 1.00 54.97  ? 781  ARG A N    1 
ATOM   3057  C CA   . ARG A 1 220 ? -22.726 38.080  -31.295 1.00 52.30  ? 781  ARG A CA   1 
ATOM   3058  C C    . ARG A 1 220 ? -21.294 38.510  -31.002 1.00 46.83  ? 781  ARG A C    1 
ATOM   3059  O O    . ARG A 1 220 ? -20.586 37.863  -30.223 1.00 44.70  ? 781  ARG A O    1 
ATOM   3060  C CB   . ARG A 1 220 ? -22.843 37.580  -32.737 1.00 53.93  ? 781  ARG A CB   1 
ATOM   3061  C CG   . ARG A 1 220 ? -21.978 36.379  -33.062 1.00 45.72  ? 781  ARG A CG   1 
ATOM   3062  C CD   . ARG A 1 220 ? -22.275 35.877  -34.467 1.00 42.50  ? 781  ARG A CD   1 
ATOM   3063  N NE   . ARG A 1 220 ? -23.661 35.440  -34.608 1.00 43.41  ? 781  ARG A NE   1 
ATOM   3064  C CZ   . ARG A 1 220 ? -24.210 35.041  -35.751 1.00 47.05  ? 781  ARG A CZ   1 
ATOM   3065  N NH1  . ARG A 1 220 ? -23.493 35.018  -36.867 1.00 49.24  ? 781  ARG A NH1  1 
ATOM   3066  N NH2  . ARG A 1 220 ? -25.482 34.666  -35.781 1.00 52.97  ? 781  ARG A NH2  1 
ATOM   3067  H H    . ARG A 1 220 ? -24.175 39.344  -31.748 1.00 65.97  ? 781  ARG A H    1 
ATOM   3068  H HA   . ARG A 1 220 ? -22.945 37.343  -30.704 1.00 62.76  ? 781  ARG A HA   1 
ATOM   3069  H HB2  . ARG A 1 220 ? -23.765 37.332  -32.905 1.00 64.72  ? 781  ARG A HB2  1 
ATOM   3070  H HB3  . ARG A 1 220 ? -22.584 38.299  -33.335 1.00 64.72  ? 781  ARG A HB3  1 
ATOM   3071  H HG2  . ARG A 1 220 ? -21.043 36.632  -33.017 1.00 54.86  ? 781  ARG A HG2  1 
ATOM   3072  H HG3  . ARG A 1 220 ? -22.167 35.664  -32.434 1.00 54.86  ? 781  ARG A HG3  1 
ATOM   3073  H HD2  . ARG A 1 220 ? -22.117 36.594  -35.101 1.00 51.00  ? 781  ARG A HD2  1 
ATOM   3074  H HD3  . ARG A 1 220 ? -21.698 35.123  -34.664 1.00 51.00  ? 781  ARG A HD3  1 
ATOM   3075  H HE   . ARG A 1 220 ? -24.156 35.441  -33.905 1.00 52.09  ? 781  ARG A HE   1 
ATOM   3076  H HH11 . ARG A 1 220 ? -22.668 35.262  -36.852 1.00 59.09  ? 781  ARG A HH11 1 
ATOM   3077  H HH12 . ARG A 1 220 ? -23.852 34.759  -37.604 1.00 59.09  ? 781  ARG A HH12 1 
ATOM   3078  H HH21 . ARG A 1 220 ? -25.951 34.679  -35.060 1.00 63.56  ? 781  ARG A HH21 1 
ATOM   3079  H HH22 . ARG A 1 220 ? -25.837 34.406  -36.520 1.00 63.56  ? 781  ARG A HH22 1 
ATOM   3080  N N    . GLN A 1 221 ? -20.847 39.605  -31.623 1.00 50.66  ? 782  GLN A N    1 
ATOM   3081  C CA   . GLN A 1 221 ? -19.450 40.002  -31.486 1.00 50.24  ? 782  GLN A CA   1 
ATOM   3082  C C    . GLN A 1 221 ? -19.142 40.512  -30.084 1.00 53.42  ? 782  GLN A C    1 
ATOM   3083  O O    . GLN A 1 221 ? -18.013 40.359  -29.606 1.00 53.40  ? 782  GLN A O    1 
ATOM   3084  C CB   . GLN A 1 221 ? -19.098 41.064  -32.526 1.00 49.67  ? 782  GLN A CB   1 
ATOM   3085  C CG   . GLN A 1 221 ? -17.605 41.344  -32.635 1.00 51.80  ? 782  GLN A CG   1 
ATOM   3086  C CD   . GLN A 1 221 ? -16.804 40.117  -33.042 1.00 54.98  ? 782  GLN A CD   1 
ATOM   3087  O OE1  . GLN A 1 221 ? -17.019 39.548  -34.110 1.00 46.39  ? 782  GLN A OE1  1 
ATOM   3088  N NE2  . GLN A 1 221 ? -15.879 39.701  -32.186 1.00 49.43  ? 782  GLN A NE2  1 
ATOM   3089  H H    . GLN A 1 221 ? -21.323 40.123  -32.118 1.00 60.79  ? 782  GLN A H    1 
ATOM   3090  H HA   . GLN A 1 221 ? -18.888 39.228  -31.650 1.00 60.29  ? 782  GLN A HA   1 
ATOM   3091  H HB2  . GLN A 1 221 ? -19.408 40.765  -33.395 1.00 59.60  ? 782  GLN A HB2  1 
ATOM   3092  H HB3  . GLN A 1 221 ? -19.539 41.894  -32.287 1.00 59.60  ? 782  GLN A HB3  1 
ATOM   3093  H HG2  . GLN A 1 221 ? -17.461 42.032  -33.304 1.00 62.16  ? 782  GLN A HG2  1 
ATOM   3094  H HG3  . GLN A 1 221 ? -17.276 41.646  -31.774 1.00 62.16  ? 782  GLN A HG3  1 
ATOM   3095  H HE21 . GLN A 1 221 ? -15.759 40.122  -31.445 1.00 59.31  ? 782  GLN A HE21 1 
ATOM   3096  H HE22 . GLN A 1 221 ? -15.401 39.011  -32.371 1.00 59.31  ? 782  GLN A HE22 1 
ATOM   3097  N N    . ALA A 1 222 ? -20.120 41.124  -29.414 1.00 51.14  ? 783  ALA A N    1 
ATOM   3098  C CA   . ALA A 1 222 ? -19.910 41.535  -28.031 1.00 54.13  ? 783  ALA A CA   1 
ATOM   3099  C C    . ALA A 1 222 ? -19.734 40.326  -27.124 1.00 54.71  ? 783  ALA A C    1 
ATOM   3100  O O    . ALA A 1 222 ? -18.831 40.300  -26.282 1.00 57.44  ? 783  ALA A O    1 
ATOM   3101  C CB   . ALA A 1 222 ? -21.077 42.398  -27.554 1.00 51.90  ? 783  ALA A CB   1 
ATOM   3102  H H    . ALA A 1 222 ? -20.898 41.308  -29.732 1.00 61.37  ? 783  ALA A H    1 
ATOM   3103  H HA   . ALA A 1 222 ? -19.102 42.069  -27.979 1.00 64.96  ? 783  ALA A HA   1 
ATOM   3104  H HB1  . ALA A 1 222 ? -20.920 42.661  -26.634 1.00 62.27  ? 783  ALA A HB1  1 
ATOM   3105  H HB2  . ALA A 1 222 ? -21.139 43.185  -28.118 1.00 62.27  ? 783  ALA A HB2  1 
ATOM   3106  H HB3  . ALA A 1 222 ? -21.896 41.882  -27.615 1.00 62.27  ? 783  ALA A HB3  1 
ATOM   3107  N N    . ASN A 1 223 ? -20.581 39.307  -27.292 1.00 54.21  ? 784  ASN A N    1 
ATOM   3108  C CA   . ASN A 1 223 ? -20.466 38.103  -26.476 1.00 51.96  ? 784  ASN A CA   1 
ATOM   3109  C C    . ASN A 1 223 ? -19.137 37.393  -26.702 1.00 49.83  ? 784  ASN A C    1 
ATOM   3110  O O    . ASN A 1 223 ? -18.606 36.769  -25.776 1.00 49.43  ? 784  ASN A O    1 
ATOM   3111  C CB   . ASN A 1 223 ? -21.632 37.161  -26.771 1.00 50.98  ? 784  ASN A CB   1 
ATOM   3112  C CG   . ASN A 1 223 ? -22.959 37.702  -26.274 1.00 51.03  ? 784  ASN A CG   1 
ATOM   3113  O OD1  . ASN A 1 223 ? -23.005 38.508  -25.345 1.00 57.45  ? 784  ASN A OD1  1 
ATOM   3114  N ND2  . ASN A 1 223 ? -24.048 37.254  -26.888 1.00 52.52  ? 784  ASN A ND2  1 
ATOM   3115  H H    . ASN A 1 223 ? -21.222 39.290  -27.865 1.00 65.05  ? 784  ASN A H    1 
ATOM   3116  H HA   . ASN A 1 223 ? -20.515 38.353  -25.540 1.00 62.35  ? 784  ASN A HA   1 
ATOM   3117  H HB2  . ASN A 1 223 ? -21.701 37.033  -27.731 1.00 61.17  ? 784  ASN A HB2  1 
ATOM   3118  H HB3  . ASN A 1 223 ? -21.471 36.311  -26.333 1.00 61.17  ? 784  ASN A HB3  1 
ATOM   3119  H HD21 . ASN A 1 223 ? -24.824 37.531  -26.643 1.00 63.03  ? 784  ASN A HD21 1 
ATOM   3120  H HD22 . ASN A 1 223 ? -23.977 36.688  -27.532 1.00 63.03  ? 784  ASN A HD22 1 
ATOM   3121  N N    . ILE A 1 224 ? -18.585 37.475  -27.914 1.00 48.33  ? 785  ILE A N    1 
ATOM   3122  C CA   . ILE A 1 224 ? -17.255 36.921  -28.164 1.00 50.11  ? 785  ILE A CA   1 
ATOM   3123  C C    . ILE A 1 224 ? -16.222 37.637  -27.305 1.00 52.69  ? 785  ILE A C    1 
ATOM   3124  O O    . ILE A 1 224 ? -15.395 37.005  -26.637 1.00 46.49  ? 785  ILE A O    1 
ATOM   3125  C CB   . ILE A 1 224 ? -16.905 37.014  -29.661 1.00 49.08  ? 785  ILE A CB   1 
ATOM   3126  C CG1  . ILE A 1 224 ? -17.746 36.014  -30.450 1.00 46.38  ? 785  ILE A CG1  1 
ATOM   3127  C CG2  . ILE A 1 224 ? -15.417 36.742  -29.891 1.00 46.39  ? 785  ILE A CG2  1 
ATOM   3128  C CD1  . ILE A 1 224 ? -17.543 36.062  -31.935 1.00 40.99  ? 785  ILE A CD1  1 
ATOM   3129  H H    . ILE A 1 224 ? -18.954 37.841  -28.599 1.00 58.00  ? 785  ILE A H    1 
ATOM   3130  H HA   . ILE A 1 224 ? -17.253 35.984  -27.914 1.00 60.13  ? 785  ILE A HA   1 
ATOM   3131  H HB   . ILE A 1 224 ? -17.111 37.909  -29.974 1.00 58.90  ? 785  ILE A HB   1 
ATOM   3132  H HG12 . ILE A 1 224 ? -17.523 35.118  -30.152 1.00 55.66  ? 785  ILE A HG12 1 
ATOM   3133  H HG13 . ILE A 1 224 ? -18.684 36.191  -30.276 1.00 55.66  ? 785  ILE A HG13 1 
ATOM   3134  H HG21 . ILE A 1 224 ? -15.228 36.808  -30.840 1.00 55.66  ? 785  ILE A HG21 1 
ATOM   3135  H HG22 . ILE A 1 224 ? -14.897 37.400  -29.403 1.00 55.66  ? 785  ILE A HG22 1 
ATOM   3136  H HG23 . ILE A 1 224 ? -15.206 35.851  -29.572 1.00 55.66  ? 785  ILE A HG23 1 
ATOM   3137  H HD11 . ILE A 1 224 ? -18.112 35.398  -32.353 1.00 49.19  ? 785  ILE A HD11 1 
ATOM   3138  H HD12 . ILE A 1 224 ? -17.775 36.947  -32.256 1.00 49.19  ? 785  ILE A HD12 1 
ATOM   3139  H HD13 . ILE A 1 224 ? -16.612 35.872  -32.132 1.00 49.19  ? 785  ILE A HD13 1 
ATOM   3140  N N    . LEU A 1 225 ? -16.252 38.972  -27.316 1.00 55.67  ? 786  LEU A N    1 
ATOM   3141  C CA   . LEU A 1 225 ? -15.298 39.743  -26.525 1.00 54.55  ? 786  LEU A CA   1 
ATOM   3142  C C    . LEU A 1 225 ? -15.443 39.437  -25.042 1.00 57.18  ? 786  LEU A C    1 
ATOM   3143  O O    . LEU A 1 225 ? -14.451 39.413  -24.304 1.00 55.55  ? 786  LEU A O    1 
ATOM   3144  C CB   . LEU A 1 225 ? -15.490 41.235  -26.789 1.00 57.51  ? 786  LEU A CB   1 
ATOM   3145  C CG   . LEU A 1 225 ? -14.327 41.917  -27.508 1.00 64.39  ? 786  LEU A CG   1 
ATOM   3146  C CD1  . LEU A 1 225 ? -14.715 43.319  -27.954 1.00 57.70  ? 786  LEU A CD1  1 
ATOM   3147  C CD2  . LEU A 1 225 ? -13.101 41.959  -26.609 1.00 61.36  ? 786  LEU A CD2  1 
ATOM   3148  H H    . LEU A 1 225 ? -16.808 39.448  -27.769 1.00 66.80  ? 786  LEU A H    1 
ATOM   3149  H HA   . LEU A 1 225 ? -14.398 39.504  -26.795 1.00 65.46  ? 786  LEU A HA   1 
ATOM   3150  H HB2  . LEU A 1 225 ? -16.282 41.353  -27.336 1.00 69.01  ? 786  LEU A HB2  1 
ATOM   3151  H HB3  . LEU A 1 225 ? -15.613 41.685  -25.938 1.00 69.01  ? 786  LEU A HB3  1 
ATOM   3152  H HG   . LEU A 1 225 ? -14.100 41.404  -28.299 1.00 77.26  ? 786  LEU A HG   1 
ATOM   3153  H HD11 . LEU A 1 225 ? -13.960 43.726  -28.406 1.00 69.24  ? 786  LEU A HD11 1 
ATOM   3154  H HD12 . LEU A 1 225 ? -15.470 43.259  -28.559 1.00 69.24  ? 786  LEU A HD12 1 
ATOM   3155  H HD13 . LEU A 1 225 ? -14.956 43.842  -27.173 1.00 69.24  ? 786  LEU A HD13 1 
ATOM   3156  H HD21 . LEU A 1 225 ? -12.376 42.395  -27.084 1.00 73.63  ? 786  LEU A HD21 1 
ATOM   3157  H HD22 . LEU A 1 225 ? -13.317 42.457  -25.805 1.00 73.63  ? 786  LEU A HD22 1 
ATOM   3158  H HD23 . LEU A 1 225 ? -12.847 41.052  -26.379 1.00 73.63  ? 786  LEU A HD23 1 
ATOM   3159  N N    . LEU A 1 226 ? -16.674 39.199  -24.588 1.00 55.70  ? 787  LEU A N    1 
ATOM   3160  C CA   . LEU A 1 226 ? -16.917 38.813  -23.205 1.00 58.79  ? 787  LEU A CA   1 
ATOM   3161  C C    . LEU A 1 226 ? -16.635 37.339  -22.949 1.00 54.31  ? 787  LEU A C    1 
ATOM   3162  O O    . LEU A 1 226 ? -16.526 36.937  -21.786 1.00 60.77  ? 787  LEU A O    1 
ATOM   3163  C CB   . LEU A 1 226 ? -18.365 39.122  -22.823 1.00 55.36  ? 787  LEU A CB   1 
ATOM   3164  C CG   . LEU A 1 226 ? -18.703 40.557  -22.410 1.00 59.13  ? 787  LEU A CG   1 
ATOM   3165  C CD1  . LEU A 1 226 ? -18.038 41.590  -23.309 1.00 59.10  ? 787  LEU A CD1  1 
ATOM   3166  C CD2  . LEU A 1 226 ? -20.213 40.739  -22.419 1.00 58.30  ? 787  LEU A CD2  1 
ATOM   3167  H H    . LEU A 1 226 ? -17.387 39.255  -25.066 1.00 66.84  ? 787  LEU A H    1 
ATOM   3168  H HA   . LEU A 1 226 ? -16.337 39.333  -22.626 1.00 70.55  ? 787  LEU A HA   1 
ATOM   3169  H HB2  . LEU A 1 226 ? -18.927 38.906  -23.583 1.00 66.44  ? 787  LEU A HB2  1 
ATOM   3170  H HB3  . LEU A 1 226 ? -18.606 38.550  -22.078 1.00 66.44  ? 787  LEU A HB3  1 
ATOM   3171  H HG   . LEU A 1 226 ? -18.390 40.705  -21.504 1.00 70.95  ? 787  LEU A HG   1 
ATOM   3172  H HD11 . LEU A 1 226 ? -18.285 42.478  -23.005 1.00 70.92  ? 787  LEU A HD11 1 
ATOM   3173  H HD12 . LEU A 1 226 ? -17.076 41.479  -23.260 1.00 70.92  ? 787  LEU A HD12 1 
ATOM   3174  H HD13 . LEU A 1 226 ? -18.341 41.457  -24.221 1.00 70.92  ? 787  LEU A HD13 1 
ATOM   3175  H HD21 . LEU A 1 226 ? -20.422 41.649  -22.157 1.00 69.96  ? 787  LEU A HD21 1 
ATOM   3176  H HD22 . LEU A 1 226 ? -20.546 40.566  -23.313 1.00 69.96  ? 787  LEU A HD22 1 
ATOM   3177  H HD23 . LEU A 1 226 ? -20.609 40.114  -21.791 1.00 69.96  ? 787  LEU A HD23 1 
ATOM   3178  N N    . GLY A 1 227 ? -16.516 36.531  -23.999 1.00 55.90  ? 788  GLY A N    1 
ATOM   3179  C CA   . GLY A 1 227 ? -16.337 35.105  -23.827 1.00 54.41  ? 788  GLY A CA   1 
ATOM   3180  C C    . GLY A 1 227 ? -17.585 34.365  -23.415 1.00 51.00  ? 788  GLY A C    1 
ATOM   3181  O O    . GLY A 1 227 ? -17.487 33.257  -22.879 1.00 43.07  ? 788  GLY A O    1 
ATOM   3182  H H    . GLY A 1 227 ? -16.537 36.789  -24.819 1.00 67.08  ? 788  GLY A H    1 
ATOM   3183  H HA2  . GLY A 1 227 ? -16.023 34.723  -24.662 1.00 65.29  ? 788  GLY A HA2  1 
ATOM   3184  H HA3  . GLY A 1 227 ? -15.659 34.951  -23.151 1.00 65.29  ? 788  GLY A HA3  1 
ATOM   3185  N N    . ALA A 1 228 ? -18.762 34.940  -23.654 1.00 52.71  ? 789  ALA A N    1 
ATOM   3186  C CA   . ALA A 1 228 ? -20.025 34.324  -23.265 1.00 52.29  ? 789  ALA A CA   1 
ATOM   3187  C C    . ALA A 1 228 ? -20.545 33.515  -24.446 1.00 47.97  ? 789  ALA A C    1 
ATOM   3188  O O    . ALA A 1 228 ? -20.935 34.080  -25.472 1.00 44.70  ? 789  ALA A O    1 
ATOM   3189  C CB   . ALA A 1 228 ? -21.033 35.387  -22.835 1.00 46.41  ? 789  ALA A CB   1 
ATOM   3190  H H    . ALA A 1 228 ? -18.855 35.699  -24.047 1.00 63.25  ? 789  ALA A H    1 
ATOM   3191  H HA   . ALA A 1 228 ? -19.876 33.721  -22.520 1.00 62.74  ? 789  ALA A HA   1 
ATOM   3192  H HB1  . ALA A 1 228 ? -21.862 34.951  -22.582 1.00 55.69  ? 789  ALA A HB1  1 
ATOM   3193  H HB2  . ALA A 1 228 ? -20.673 35.876  -22.080 1.00 55.69  ? 789  ALA A HB2  1 
ATOM   3194  H HB3  . ALA A 1 228 ? -21.190 35.991  -23.577 1.00 55.69  ? 789  ALA A HB3  1 
ATOM   3195  N N    . CYS A 1 229 ? -20.560 32.193  -24.295 1.00 49.91  ? 790  CYS A N    1 
ATOM   3196  C CA   . CYS A 1 229 ? -20.987 31.288  -25.350 1.00 50.37  ? 790  CYS A CA   1 
ATOM   3197  C C    . CYS A 1 229 ? -21.871 30.208  -24.751 1.00 51.41  ? 790  CYS A C    1 
ATOM   3198  O O    . CYS A 1 229 ? -21.724 29.838  -23.583 1.00 54.75  ? 790  CYS A O    1 
ATOM   3199  C CB   . CYS A 1 229 ? -19.791 30.649  -26.066 1.00 47.65  ? 790  CYS A CB   1 
ATOM   3200  S SG   . CYS A 1 229 ? -18.596 29.870  -24.960 1.00 55.92  ? 790  CYS A SG   1 
ATOM   3201  H H    . CYS A 1 229 ? -20.320 31.791  -23.574 1.00 59.89  ? 790  CYS A H    1 
ATOM   3202  H HA   . CYS A 1 229 ? -21.507 31.781  -26.004 1.00 60.45  ? 790  CYS A HA   1 
ATOM   3203  H HB2  . CYS A 1 229 ? -20.120 29.967  -26.673 1.00 57.18  ? 790  CYS A HB2  1 
ATOM   3204  H HB3  . CYS A 1 229 ? -19.325 31.336  -26.567 1.00 57.18  ? 790  CYS A HB3  1 
ATOM   3205  H HG   . CYS A 1 229 ? -17.705 29.403  -25.614 1.00 67.10  ? 790  CYS A HG   1 
ATOM   3206  N N    . SER A 1 230 ? -22.799 29.713  -25.565 1.00 56.17  ? 791  SER A N    1 
ATOM   3207  C CA   . SER A 1 230 ? -23.731 28.678  -25.144 1.00 49.91  ? 791  SER A CA   1 
ATOM   3208  C C    . SER A 1 230 ? -23.940 27.706  -26.290 1.00 54.87  ? 791  SER A C    1 
ATOM   3209  O O    . SER A 1 230 ? -24.152 28.128  -27.431 1.00 52.07  ? 791  SER A O    1 
ATOM   3210  C CB   . SER A 1 230 ? -25.072 29.283  -24.714 1.00 54.80  ? 791  SER A CB   1 
ATOM   3211  O OG   . SER A 1 230 ? -26.026 28.271  -24.443 1.00 68.68  ? 791  SER A OG   1 
ATOM   3212  H H    . SER A 1 230 ? -22.910 29.966  -26.379 1.00 67.41  ? 791  SER A H    1 
ATOM   3213  H HA   . SER A 1 230 ? -23.357 28.192  -24.392 1.00 59.89  ? 791  SER A HA   1 
ATOM   3214  H HB2  . SER A 1 230 ? -24.937 29.811  -23.912 1.00 65.76  ? 791  SER A HB2  1 
ATOM   3215  H HB3  . SER A 1 230 ? -25.406 29.847  -25.429 1.00 65.76  ? 791  SER A HB3  1 
ATOM   3216  H HG   . SER A 1 230 ? -26.154 27.805  -25.130 1.00 82.41  ? 791  SER A HG   1 
ATOM   3217  N N    . LEU A 1 231 ? -23.876 26.413  -25.988 1.00 49.73  ? 792  LEU A N    1 
ATOM   3218  C CA   . LEU A 1 231 ? -24.274 25.370  -26.926 1.00 53.56  ? 792  LEU A CA   1 
ATOM   3219  C C    . LEU A 1 231 ? -25.518 24.724  -26.326 1.00 58.98  ? 792  LEU A C    1 
ATOM   3220  O O    . LEU A 1 231 ? -25.427 23.961  -25.359 1.00 64.40  ? 792  LEU A O    1 
ATOM   3221  C CB   . LEU A 1 231 ? -23.140 24.365  -27.126 1.00 53.74  ? 792  LEU A CB   1 
ATOM   3222  C CG   . LEU A 1 231 ? -21.722 24.951  -27.129 1.00 49.06  ? 792  LEU A CG   1 
ATOM   3223  C CD1  . LEU A 1 231 ? -20.678 23.845  -27.153 1.00 46.40  ? 792  LEU A CD1  1 
ATOM   3224  C CD2  . LEU A 1 231 ? -21.517 25.899  -28.299 1.00 50.02  ? 792  LEU A CD2  1 
ATOM   3225  H H    . LEU A 1 231 ? -23.601 26.109  -25.232 1.00 59.68  ? 792  LEU A H    1 
ATOM   3226  H HA   . LEU A 1 231 ? -24.504 25.763  -27.783 1.00 64.27  ? 792  LEU A HA   1 
ATOM   3227  H HB2  . LEU A 1 231 ? -23.182 23.711  -26.411 1.00 64.48  ? 792  LEU A HB2  1 
ATOM   3228  H HB3  . LEU A 1 231 ? -23.272 23.921  -27.978 1.00 64.48  ? 792  LEU A HB3  1 
ATOM   3229  H HG   . LEU A 1 231 ? -21.594 25.459  -26.312 1.00 58.87  ? 792  LEU A HG   1 
ATOM   3230  H HD11 . LEU A 1 231 ? -19.794 24.245  -27.154 1.00 55.68  ? 792  LEU A HD11 1 
ATOM   3231  H HD12 . LEU A 1 231 ? -20.789 23.289  -26.365 1.00 55.68  ? 792  LEU A HD12 1 
ATOM   3232  H HD13 . LEU A 1 231 ? -20.801 23.312  -27.954 1.00 55.68  ? 792  LEU A HD13 1 
ATOM   3233  H HD21 . LEU A 1 231 ? -20.612 26.248  -28.267 1.00 60.02  ? 792  LEU A HD21 1 
ATOM   3234  H HD22 . LEU A 1 231 ? -21.656 25.413  -29.127 1.00 60.02  ? 792  LEU A HD22 1 
ATOM   3235  H HD23 . LEU A 1 231 ? -22.155 26.627  -28.231 1.00 60.02  ? 792  LEU A HD23 1 
ATOM   3236  N N    . ASP A 1 232 ? -26.680 25.031  -26.902 1.00 62.80  ? 793  ASP A N    1 
ATOM   3237  C CA   . ASP A 1 232 ? -27.938 24.451  -26.453 1.00 66.13  ? 793  ASP A CA   1 
ATOM   3238  C C    . ASP A 1 232 ? -28.341 23.217  -27.243 1.00 60.69  ? 793  ASP A C    1 
ATOM   3239  O O    . ASP A 1 232 ? -29.261 22.505  -26.824 1.00 53.27  ? 793  ASP A O    1 
ATOM   3240  C CB   . ASP A 1 232 ? -29.054 25.496  -26.547 1.00 76.76  ? 793  ASP A CB   1 
ATOM   3241  C CG   . ASP A 1 232 ? -28.646 26.836  -25.968 1.00 75.26  ? 793  ASP A CG   1 
ATOM   3242  O OD1  . ASP A 1 232 ? -27.846 26.850  -25.009 1.00 66.34  ? 793  ASP A OD1  1 
ATOM   3243  O OD2  . ASP A 1 232 ? -29.120 27.874  -26.475 1.00 88.43  ? 793  ASP A OD2  1 
ATOM   3244  H H    . ASP A 1 232 ? -26.764 25.577  -27.561 1.00 75.36  ? 793  ASP A H    1 
ATOM   3245  H HA   . ASP A 1 232 ? -27.849 24.193  -25.522 1.00 79.36  ? 793  ASP A HA   1 
ATOM   3246  H HB2  . ASP A 1 232 ? -29.285 25.629  -27.480 1.00 92.11  ? 793  ASP A HB2  1 
ATOM   3247  H HB3  . ASP A 1 232 ? -29.827 25.178  -26.055 1.00 92.11  ? 793  ASP A HB3  1 
ATOM   3248  N N    . CYS A 1 233 ? -27.674 22.946  -28.360 1.00 57.42  ? 794  CYS A N    1 
ATOM   3249  C CA   . CYS A 1 233 ? -28.024 21.836  -29.232 1.00 54.05  ? 794  CYS A CA   1 
ATOM   3250  C C    . CYS A 1 233 ? -27.238 20.572  -28.926 1.00 47.99  ? 794  CYS A C    1 
ATOM   3251  O O    . CYS A 1 233 ? -27.537 19.520  -29.501 1.00 49.28  ? 794  CYS A O    1 
ATOM   3252  C CB   . CYS A 1 233 ? -27.812 22.254  -30.686 1.00 54.51  ? 794  CYS A CB   1 
ATOM   3253  S SG   . CYS A 1 233 ? -28.479 23.899  -31.011 1.00 79.42  ? 794  CYS A SG   1 
ATOM   3254  H H    . CYS A 1 233 ? -27.001 23.402  -28.638 1.00 68.90  ? 794  CYS A H    1 
ATOM   3255  H HA   . CYS A 1 233 ? -28.966 21.634  -29.116 1.00 64.86  ? 794  CYS A HA   1 
ATOM   3256  H HB2  . CYS A 1 233 ? -26.861 22.268  -30.879 1.00 65.42  ? 794  CYS A HB2  1 
ATOM   3257  H HB3  . CYS A 1 233 ? -28.263 21.623  -31.269 1.00 65.42  ? 794  CYS A HB3  1 
ATOM   3258  H HG   . CYS A 1 233 ? -28.287 24.178  -32.162 1.00 95.31  ? 794  CYS A HG   1 
ATOM   3259  N N    . LEU A 1 234 ? -26.250 20.650  -28.040 1.00 46.39  ? 795  LEU A N    1 
ATOM   3260  C CA   . LEU A 1 234 ? -25.407 19.514  -27.693 1.00 50.56  ? 795  LEU A CA   1 
ATOM   3261  C C    . LEU A 1 234 ? -25.838 18.996  -26.326 1.00 46.71  ? 795  LEU A C    1 
ATOM   3262  O O    . LEU A 1 234 ? -25.667 19.679  -25.311 1.00 38.20  ? 795  LEU A O    1 
ATOM   3263  C CB   . LEU A 1 234 ? -23.936 19.919  -27.704 1.00 43.46  ? 795  LEU A CB   1 
ATOM   3264  C CG   . LEU A 1 234 ? -23.475 20.598  -28.998 1.00 43.39  ? 795  LEU A CG   1 
ATOM   3265  C CD1  . LEU A 1 234 ? -21.977 20.842  -28.964 1.00 45.53  ? 795  LEU A CD1  1 
ATOM   3266  C CD2  . LEU A 1 234 ? -23.855 19.786  -30.231 1.00 46.68  ? 795  LEU A CD2  1 
ATOM   3267  H H    . LEU A 1 234 ? -26.045 21.370  -27.617 1.00 55.66  ? 795  LEU A H    1 
ATOM   3268  H HA   . LEU A 1 234 ? -25.535 18.806  -28.344 1.00 60.67  ? 795  LEU A HA   1 
ATOM   3269  H HB2  . LEU A 1 234 ? -23.779 20.539  -26.974 1.00 52.15  ? 795  LEU A HB2  1 
ATOM   3270  H HB3  . LEU A 1 234 ? -23.394 19.124  -27.580 1.00 52.15  ? 795  LEU A HB3  1 
ATOM   3271  H HG   . LEU A 1 234 ? -23.912 21.461  -29.068 1.00 52.06  ? 795  LEU A HG   1 
ATOM   3272  H HD11 . LEU A 1 234 ? -21.709 21.272  -29.791 1.00 54.64  ? 795  LEU A HD11 1 
ATOM   3273  H HD12 . LEU A 1 234 ? -21.768 21.415  -28.210 1.00 54.64  ? 795  LEU A HD12 1 
ATOM   3274  H HD13 . LEU A 1 234 ? -21.521 19.991  -28.870 1.00 54.64  ? 795  LEU A HD13 1 
ATOM   3275  H HD21 . LEU A 1 234 ? -23.545 20.252  -31.024 1.00 56.01  ? 795  LEU A HD21 1 
ATOM   3276  H HD22 . LEU A 1 234 ? -23.436 18.913  -30.175 1.00 56.01  ? 795  LEU A HD22 1 
ATOM   3277  H HD23 . LEU A 1 234 ? -24.820 19.689  -30.261 1.00 56.01  ? 795  LEU A HD23 1 
ATOM   3278  N N    . HIS A 1 235 ? -26.397 17.792  -26.308 1.00 48.45  ? 796  HIS A N    1 
ATOM   3279  C CA   . HIS A 1 235 ? -26.876 17.208  -25.068 1.00 52.05  ? 796  HIS A CA   1 
ATOM   3280  C C    . HIS A 1 235 ? -25.689 16.742  -24.226 1.00 58.56  ? 796  HIS A C    1 
ATOM   3281  O O    . HIS A 1 235 ? -24.755 16.133  -24.757 1.00 57.09  ? 796  HIS A O    1 
ATOM   3282  C CB   . HIS A 1 235 ? -27.801 16.030  -25.369 1.00 53.85  ? 796  HIS A CB   1 
ATOM   3283  C CG   . HIS A 1 235 ? -28.737 15.689  -24.252 1.00 64.00  ? 796  HIS A CG   1 
ATOM   3284  N ND1  . HIS A 1 235 ? -28.324 15.050  -23.103 1.00 63.81  ? 796  HIS A ND1  1 
ATOM   3285  C CD2  . HIS A 1 235 ? -30.069 15.890  -24.113 1.00 68.88  ? 796  HIS A CD2  1 
ATOM   3286  C CE1  . HIS A 1 235 ? -29.359 14.878  -22.301 1.00 66.54  ? 796  HIS A CE1  1 
ATOM   3287  N NE2  . HIS A 1 235 ? -30.430 15.379  -22.890 1.00 72.86  ? 796  HIS A NE2  1 
ATOM   3288  H H    . HIS A 1 235 ? -26.510 17.295  -27.001 1.00 58.14  ? 796  HIS A H    1 
ATOM   3289  H HA   . HIS A 1 235 ? -27.373 17.872  -24.565 1.00 62.46  ? 796  HIS A HA   1 
ATOM   3290  H HB2  . HIS A 1 235 ? -28.337 16.246  -26.148 1.00 64.62  ? 796  HIS A HB2  1 
ATOM   3291  H HB3  . HIS A 1 235 ? -27.259 15.246  -25.550 1.00 64.62  ? 796  HIS A HB3  1 
ATOM   3292  H HD2  . HIS A 1 235 ? -30.633 16.301  -24.728 1.00 82.65  ? 796  HIS A HD2  1 
ATOM   3293  H HE1  . HIS A 1 235 ? -29.338 14.472  -21.465 1.00 79.85  ? 796  HIS A HE1  1 
ATOM   3294  H HE2  . HIS A 1 235 ? -31.225 15.383  -22.562 1.00 87.43  ? 796  HIS A HE2  1 
ATOM   3295  N N    . PRO A 1 236 ? -25.684 17.018  -22.917 1.00 59.73  ? 797  PRO A N    1 
ATOM   3296  C CA   . PRO A 1 236 ? -24.536 16.589  -22.101 1.00 57.95  ? 797  PRO A CA   1 
ATOM   3297  C C    . PRO A 1 236 ? -24.394 15.080  -22.006 1.00 56.79  ? 797  PRO A C    1 
ATOM   3298  O O    . PRO A 1 236 ? -23.267 14.584  -21.897 1.00 58.69  ? 797  PRO A O    1 
ATOM   3299  C CB   . PRO A 1 236 ? -24.821 17.216  -20.725 1.00 58.25  ? 797  PRO A CB   1 
ATOM   3300  C CG   . PRO A 1 236 ? -25.849 18.271  -20.974 1.00 60.10  ? 797  PRO A CG   1 
ATOM   3301  C CD   . PRO A 1 236 ? -26.660 17.785  -22.124 1.00 55.98  ? 797  PRO A CD   1 
ATOM   3302  H HA   . PRO A 1 236 ? -23.716 16.964  -22.457 1.00 69.54  ? 797  PRO A HA   1 
ATOM   3303  H HB2  . PRO A 1 236 ? -25.166 16.539  -20.123 1.00 69.91  ? 797  PRO A HB2  1 
ATOM   3304  H HB3  . PRO A 1 236 ? -24.008 17.608  -20.371 1.00 69.91  ? 797  PRO A HB3  1 
ATOM   3305  H HG2  . PRO A 1 236 ? -26.404 18.377  -20.186 1.00 72.11  ? 797  PRO A HG2  1 
ATOM   3306  H HG3  . PRO A 1 236 ? -25.409 19.107  -21.197 1.00 72.11  ? 797  PRO A HG3  1 
ATOM   3307  H HD2  . PRO A 1 236 ? -27.375 17.207  -21.814 1.00 67.17  ? 797  PRO A HD2  1 
ATOM   3308  H HD3  . PRO A 1 236 ? -27.003 18.532  -22.638 1.00 67.17  ? 797  PRO A HD3  1 
ATOM   3309  N N    . GLU A 1 237 ? -25.502 14.340  -22.019 1.00 57.89  ? 798  GLU A N    1 
ATOM   3310  C CA   . GLU A 1 237 ? -25.502 12.891  -21.861 1.00 62.66  ? 798  GLU A CA   1 
ATOM   3311  C C    . GLU A 1 237 ? -25.544 12.122  -23.180 1.00 58.34  ? 798  GLU A C    1 
ATOM   3312  O O    . GLU A 1 237 ? -25.671 10.894  -23.155 1.00 62.08  ? 798  GLU A O    1 
ATOM   3313  C CB   . GLU A 1 237 ? -26.678 12.469  -20.973 1.00 61.75  ? 798  GLU A CB   1 
ATOM   3314  C CG   . GLU A 1 237 ? -26.623 13.074  -19.573 1.00 65.88  ? 798  GLU A CG   1 
ATOM   3315  C CD   . GLU A 1 237 ? -25.298 12.815  -18.878 1.00 69.31  ? 798  GLU A CD   1 
ATOM   3316  O OE1  . GLU A 1 237 ? -24.863 11.645  -18.837 1.00 70.36  ? 798  GLU A OE1  1 
ATOM   3317  O OE2  . GLU A 1 237 ? -24.685 13.786  -18.384 1.00 69.20  ? 798  GLU A OE2  1 
ATOM   3318  H H    . GLU A 1 237 ? -26.290 14.669  -22.120 1.00 69.47  ? 798  GLU A H    1 
ATOM   3319  H HA   . GLU A 1 237 ? -24.686 12.634  -21.403 1.00 75.19  ? 798  GLU A HA   1 
ATOM   3320  H HB2  . GLU A 1 237 ? -27.505 12.757  -21.390 1.00 74.10  ? 798  GLU A HB2  1 
ATOM   3321  H HB3  . GLU A 1 237 ? -26.673 11.504  -20.882 1.00 74.10  ? 798  GLU A HB3  1 
ATOM   3322  H HG2  . GLU A 1 237 ? -26.747 14.034  -19.638 1.00 79.06  ? 798  GLU A HG2  1 
ATOM   3323  H HG3  . GLU A 1 237 ? -27.327 12.684  -19.032 1.00 79.06  ? 798  GLU A HG3  1 
ATOM   3324  N N    . LYS A 1 238 ? -25.480 12.798  -24.323 1.00 57.75  ? 799  LYS A N    1 
ATOM   3325  C CA   . LYS A 1 238 ? -25.539 12.139  -25.624 1.00 51.47  ? 799  LYS A CA   1 
ATOM   3326  C C    . LYS A 1 238 ? -24.137 12.046  -26.218 1.00 47.19  ? 799  LYS A C    1 
ATOM   3327  O O    . LYS A 1 238 ? -23.435 13.057  -26.321 1.00 49.15  ? 799  LYS A O    1 
ATOM   3328  C CB   . LYS A 1 238 ? -26.474 12.896  -26.564 1.00 55.01  ? 799  LYS A CB   1 
ATOM   3329  C CG   . LYS A 1 238 ? -26.943 12.090  -27.756 1.00 56.28  ? 799  LYS A CG   1 
ATOM   3330  C CD   . LYS A 1 238 ? -27.957 12.875  -28.572 1.00 59.80  ? 799  LYS A CD   1 
ATOM   3331  C CE   . LYS A 1 238 ? -28.148 12.282  -29.957 1.00 67.12  ? 799  LYS A CE   1 
ATOM   3332  N NZ   . LYS A 1 238 ? -26.893 12.325  -30.758 1.00 63.74  ? 799  LYS A NZ   1 
ATOM   3333  H H    . LYS A 1 238 ? -25.401 13.653  -24.373 1.00 69.30  ? 799  LYS A H    1 
ATOM   3334  H HA   . LYS A 1 238 ? -25.882 11.239  -25.512 1.00 61.76  ? 799  LYS A HA   1 
ATOM   3335  H HB2  . LYS A 1 238 ? -27.260 13.171  -26.067 1.00 66.01  ? 799  LYS A HB2  1 
ATOM   3336  H HB3  . LYS A 1 238 ? -26.011 13.678  -26.902 1.00 66.01  ? 799  LYS A HB3  1 
ATOM   3337  H HG2  . LYS A 1 238 ? -26.185 11.885  -28.325 1.00 67.53  ? 799  LYS A HG2  1 
ATOM   3338  H HG3  . LYS A 1 238 ? -27.365 11.273  -27.447 1.00 67.53  ? 799  LYS A HG3  1 
ATOM   3339  H HD2  . LYS A 1 238 ? -28.813 12.861  -28.116 1.00 71.76  ? 799  LYS A HD2  1 
ATOM   3340  H HD3  . LYS A 1 238 ? -27.646 13.788  -28.674 1.00 71.76  ? 799  LYS A HD3  1 
ATOM   3341  H HE2  . LYS A 1 238 ? -28.421 11.355  -29.872 1.00 80.54  ? 799  LYS A HE2  1 
ATOM   3342  H HE3  . LYS A 1 238 ? -28.826 12.788  -30.430 1.00 80.54  ? 799  LYS A HE3  1 
ATOM   3343  H HZ1  . LYS A 1 238 ? -27.034 11.972  -31.563 1.00 76.49  ? 799  LYS A HZ1  1 
ATOM   3344  H HZ2  . LYS A 1 238 ? -26.623 13.167  -30.855 1.00 76.49  ? 799  LYS A HZ2  1 
ATOM   3345  H HZ3  . LYS A 1 238 ? -26.254 11.862  -30.347 1.00 76.49  ? 799  LYS A HZ3  1 
ATOM   3346  N N    . HIS A 1 239 ? -23.747 10.834  -26.628 1.00 44.59  ? 800  HIS A N    1 
ATOM   3347  C CA   . HIS A 1 239 ? -22.358 10.576  -27.007 1.00 44.45  ? 800  HIS A CA   1 
ATOM   3348  C C    . HIS A 1 239 ? -21.917 11.459  -28.168 1.00 46.21  ? 800  HIS A C    1 
ATOM   3349  O O    . HIS A 1 239 ? -20.866 12.107  -28.104 1.00 46.90  ? 800  HIS A O    1 
ATOM   3350  C CB   . HIS A 1 239 ? -22.176 9.101   -27.367 1.00 41.63  ? 800  HIS A CB   1 
ATOM   3351  C CG   . HIS A 1 239 ? -20.865 8.801   -28.027 1.00 43.08  ? 800  HIS A CG   1 
ATOM   3352  N ND1  . HIS A 1 239 ? -20.771 8.357   -29.328 1.00 43.03  ? 800  HIS A ND1  1 
ATOM   3353  C CD2  . HIS A 1 239 ? -19.594 8.890   -27.567 1.00 41.96  ? 800  HIS A CD2  1 
ATOM   3354  C CE1  . HIS A 1 239 ? -19.500 8.180   -29.641 1.00 38.57  ? 800  HIS A CE1  1 
ATOM   3355  N NE2  . HIS A 1 239 ? -18.765 8.496   -28.590 1.00 39.83  ? 800  HIS A NE2  1 
ATOM   3356  H H    . HIS A 1 239 ? -24.265 10.151  -26.696 1.00 53.51  ? 800  HIS A H    1 
ATOM   3357  H HA   . HIS A 1 239 ? -21.785 10.771  -26.249 1.00 53.34  ? 800  HIS A HA   1 
ATOM   3358  H HB2  . HIS A 1 239 ? -22.228 8.572   -26.555 1.00 49.95  ? 800  HIS A HB2  1 
ATOM   3359  H HB3  . HIS A 1 239 ? -22.883 8.838   -27.977 1.00 49.95  ? 800  HIS A HB3  1 
ATOM   3360  H HD1  . HIS A 1 239 ? -21.436 8.215   -29.854 1.00 51.64  ? 800  HIS A HD1  1 
ATOM   3361  H HD2  . HIS A 1 239 ? -19.332 9.163   -26.718 1.00 50.36  ? 800  HIS A HD2  1 
ATOM   3362  H HE1  . HIS A 1 239 ? -19.177 7.884   -30.461 1.00 46.28  ? 800  HIS A HE1  1 
ATOM   3363  N N    . GLU A 1 240 ? -22.699 11.482  -29.250 1.00 46.67  ? 801  GLU A N    1 
ATOM   3364  C CA   A GLU A 1 240 ? -22.329 12.287  -30.410 0.56 59.10  ? 801  GLU A CA   1 
ATOM   3365  C CA   B GLU A 1 240 ? -22.336 12.289  -30.412 0.44 69.34  ? 801  GLU A CA   1 
ATOM   3366  C C    . GLU A 1 240 ? -22.154 13.751  -30.028 1.00 46.54  ? 801  GLU A C    1 
ATOM   3367  O O    . GLU A 1 240 ? -21.252 14.429  -30.534 1.00 44.07  ? 801  GLU A O    1 
ATOM   3368  C CB   A GLU A 1 240 ? -23.382 12.148  -31.510 0.56 47.06  ? 801  GLU A CB   1 
ATOM   3369  C CB   B GLU A 1 240 ? -23.406 12.159  -31.495 0.44 51.36  ? 801  GLU A CB   1 
ATOM   3370  C CG   A GLU A 1 240 ? -23.420 10.780  -32.184 0.56 48.13  ? 801  GLU A CG   1 
ATOM   3371  C CG   B GLU A 1 240 ? -22.858 12.147  -32.915 0.44 47.56  ? 801  GLU A CG   1 
ATOM   3372  C CD   A GLU A 1 240 ? -24.046 9.698   -31.322 0.56 46.45  ? 801  GLU A CD   1 
ATOM   3373  C CD   B GLU A 1 240 ? -23.949 12.234  -33.968 0.44 50.86  ? 801  GLU A CD   1 
ATOM   3374  O OE1  A GLU A 1 240 ? -24.588 10.023  -30.244 0.56 45.29  ? 801  GLU A OE1  1 
ATOM   3375  O OE1  B GLU A 1 240 ? -25.117 12.485  -33.602 0.44 51.07  ? 801  GLU A OE1  1 
ATOM   3376  O OE2  A GLU A 1 240 ? -23.996 8.516   -31.725 0.56 49.42  ? 801  GLU A OE2  1 
ATOM   3377  O OE2  B GLU A 1 240 ? -23.638 12.049  -35.163 0.44 46.15  ? 801  GLU A OE2  1 
ATOM   3378  H H    A GLU A 1 240 ? -23.436 11.047  -29.335 0.56 56.01  ? 801  GLU A H    1 
ATOM   3379  H H    B GLU A 1 240 ? -23.435 11.045  -29.334 0.44 56.01  ? 801  GLU A H    1 
ATOM   3380  H HA   A GLU A 1 240 ? -21.484 11.965  -30.761 0.56 70.92  ? 801  GLU A HA   1 
ATOM   3381  H HA   B GLU A 1 240 ? -21.497 11.965  -30.775 0.44 83.21  ? 801  GLU A HA   1 
ATOM   3382  H HB2  A GLU A 1 240 ? -24.257 12.310  -31.124 0.56 56.47  ? 801  GLU A HB2  1 
ATOM   3383  H HB2  B GLU A 1 240 ? -23.889 11.329  -31.358 0.44 61.64  ? 801  GLU A HB2  1 
ATOM   3384  H HB3  A GLU A 1 240 ? -23.201 12.809  -32.197 0.56 56.47  ? 801  GLU A HB3  1 
ATOM   3385  H HB3  B GLU A 1 240 ? -24.017 12.909  -31.421 0.44 61.64  ? 801  GLU A HB3  1 
ATOM   3386  H HG2  A GLU A 1 240 ? -23.940 10.848  -33.001 0.56 57.76  ? 801  GLU A HG2  1 
ATOM   3387  H HG2  B GLU A 1 240 ? -22.268 12.907  -33.032 0.44 57.08  ? 801  GLU A HG2  1 
ATOM   3388  H HG3  A GLU A 1 240 ? -22.513 10.508  -32.392 0.56 57.76  ? 801  GLU A HG3  1 
ATOM   3389  H HG3  B GLU A 1 240 ? -22.369 11.322  -33.058 0.44 57.08  ? 801  GLU A HG3  1 
ATOM   3390  N N    . ASP A 1 241 ? -23.005 14.254  -29.132 1.00 45.46  ? 802  ASP A N    1 
ATOM   3391  C CA   . ASP A 1 241 ? -22.925 15.652  -28.729 1.00 42.71  ? 802  ASP A CA   1 
ATOM   3392  C C    . ASP A 1 241 ? -21.771 15.900  -27.766 1.00 46.65  ? 802  ASP A C    1 
ATOM   3393  O O    . ASP A 1 241 ? -21.204 16.999  -27.758 1.00 45.66  ? 802  ASP A O    1 
ATOM   3394  C CB   . ASP A 1 241 ? -24.250 16.081  -28.100 1.00 43.64  ? 802  ASP A CB   1 
ATOM   3395  C CG   . ASP A 1 241 ? -25.429 15.882  -29.033 1.00 42.66  ? 802  ASP A CG   1 
ATOM   3396  O OD1  . ASP A 1 241 ? -25.270 15.173  -30.051 1.00 47.01  ? 802  ASP A OD1  1 
ATOM   3397  O OD2  . ASP A 1 241 ? -26.517 16.429  -28.750 1.00 41.18  ? 802  ASP A OD2  1 
ATOM   3398  H H    . ASP A 1 241 ? -23.631 13.808  -28.747 1.00 54.55  ? 802  ASP A H    1 
ATOM   3399  H HA   . ASP A 1 241 ? -22.778 16.198  -29.517 1.00 51.25  ? 802  ASP A HA   1 
ATOM   3400  H HB2  . ASP A 1 241 ? -24.407 15.554  -27.301 1.00 52.37  ? 802  ASP A HB2  1 
ATOM   3401  H HB3  . ASP A 1 241 ? -24.202 17.023  -27.873 1.00 52.37  ? 802  ASP A HB3  1 
ATOM   3402  N N    . VAL A 1 242 ? -21.407 14.907  -26.949 1.00 44.26  ? 803  VAL A N    1 
ATOM   3403  C CA   . VAL A 1 242 ? -20.291 15.090  -26.024 1.00 44.08  ? 803  VAL A CA   1 
ATOM   3404  C C    . VAL A 1 242 ? -18.985 15.241  -26.793 1.00 39.00  ? 803  VAL A C    1 
ATOM   3405  O O    . VAL A 1 242 ? -18.152 16.097  -26.466 1.00 33.26  ? 803  VAL A O    1 
ATOM   3406  C CB   . VAL A 1 242 ? -20.224 13.923  -25.019 1.00 45.60  ? 803  VAL A CB   1 
ATOM   3407  C CG1  . VAL A 1 242 ? -18.897 13.922  -24.259 1.00 38.42  ? 803  VAL A CG1  1 
ATOM   3408  C CG2  . VAL A 1 242 ? -21.375 14.008  -24.032 1.00 46.61  ? 803  VAL A CG2  1 
ATOM   3409  H H    . VAL A 1 242 ? -21.782 14.134  -26.913 1.00 53.12  ? 803  VAL A H    1 
ATOM   3410  H HA   . VAL A 1 242 ? -20.434 15.907  -25.520 1.00 52.90  ? 803  VAL A HA   1 
ATOM   3411  H HB   . VAL A 1 242 ? -20.298 13.084  -25.499 1.00 54.72  ? 803  VAL A HB   1 
ATOM   3412  H HG11 . VAL A 1 242 ? -18.890 13.177  -23.638 1.00 46.10  ? 803  VAL A HG11 1 
ATOM   3413  H HG12 . VAL A 1 242 ? -18.170 13.830  -24.895 1.00 46.10  ? 803  VAL A HG12 1 
ATOM   3414  H HG13 . VAL A 1 242 ? -18.810 14.758  -23.775 1.00 46.10  ? 803  VAL A HG13 1 
ATOM   3415  H HG21 . VAL A 1 242 ? -21.313 13.265  -23.411 1.00 55.94  ? 803  VAL A HG21 1 
ATOM   3416  H HG22 . VAL A 1 242 ? -21.317 14.848  -23.551 1.00 55.94  ? 803  VAL A HG22 1 
ATOM   3417  H HG23 . VAL A 1 242 ? -22.212 13.962  -24.519 1.00 55.94  ? 803  VAL A HG23 1 
ATOM   3418  N N    . ILE A 1 243 ? -18.781 14.414  -27.820 1.00 41.00  ? 804  ILE A N    1 
ATOM   3419  C CA   . ILE A 1 243 ? -17.569 14.511  -28.628 1.00 44.63  ? 804  ILE A CA   1 
ATOM   3420  C C    . ILE A 1 243 ? -17.533 15.843  -29.367 1.00 39.88  ? 804  ILE A C    1 
ATOM   3421  O O    . ILE A 1 243 ? -16.491 16.509  -29.428 1.00 35.76  ? 804  ILE A O    1 
ATOM   3422  C CB   . ILE A 1 243 ? -17.483 13.312  -29.596 1.00 42.66  ? 804  ILE A CB   1 
ATOM   3423  C CG1  . ILE A 1 243 ? -17.188 12.019  -28.826 1.00 37.62  ? 804  ILE A CG1  1 
ATOM   3424  C CG2  . ILE A 1 243 ? -16.431 13.541  -30.678 1.00 38.12  ? 804  ILE A CG2  1 
ATOM   3425  C CD1  . ILE A 1 243 ? -15.838 11.990  -28.122 1.00 38.45  ? 804  ILE A CD1  1 
ATOM   3426  H H    . ILE A 1 243 ? -19.325 13.795  -28.067 1.00 49.20  ? 804  ILE A H    1 
ATOM   3427  H HA   . ILE A 1 243 ? -16.797 14.476  -28.041 1.00 53.55  ? 804  ILE A HA   1 
ATOM   3428  H HB   . ILE A 1 243 ? -18.345 13.214  -30.030 1.00 51.20  ? 804  ILE A HB   1 
ATOM   3429  H HG12 . ILE A 1 243 ? -17.873 11.897  -28.151 1.00 45.14  ? 804  ILE A HG12 1 
ATOM   3430  H HG13 . ILE A 1 243 ? -17.209 11.276  -29.450 1.00 45.14  ? 804  ILE A HG13 1 
ATOM   3431  H HG21 . ILE A 1 243 ? -16.408 12.768  -31.264 1.00 45.74  ? 804  ILE A HG21 1 
ATOM   3432  H HG22 . ILE A 1 243 ? -16.667 14.334  -31.185 1.00 45.74  ? 804  ILE A HG22 1 
ATOM   3433  H HG23 . ILE A 1 243 ? -15.566 13.662  -30.256 1.00 45.74  ? 804  ILE A HG23 1 
ATOM   3434  H HD11 . ILE A 1 243 ? -15.739 11.140  -27.665 1.00 46.14  ? 804  ILE A HD11 1 
ATOM   3435  H HD12 . ILE A 1 243 ? -15.136 12.094  -28.783 1.00 46.14  ? 804  ILE A HD12 1 
ATOM   3436  H HD13 . ILE A 1 243 ? -15.801 12.717  -27.481 1.00 46.14  ? 804  ILE A HD13 1 
ATOM   3437  N N    . ALA A 1 244 ? -18.669 16.258  -29.934 1.00 42.48  ? 805  ALA A N    1 
ATOM   3438  C CA   . ALA A 1 244 ? -18.714 17.525  -30.656 1.00 46.80  ? 805  ALA A CA   1 
ATOM   3439  C C    . ALA A 1 244 ? -18.471 18.701  -29.718 1.00 39.79  ? 805  ALA A C    1 
ATOM   3440  O O    . ALA A 1 244 ? -17.759 19.649  -30.070 1.00 33.23  ? 805  ALA A O    1 
ATOM   3441  C CB   . ALA A 1 244 ? -20.057 17.672  -31.371 1.00 52.95  ? 805  ALA A CB   1 
ATOM   3442  H H    . ALA A 1 244 ? -19.414 15.829  -29.914 1.00 50.97  ? 805  ALA A H    1 
ATOM   3443  H HA   . ALA A 1 244 ? -18.015 17.530  -31.328 1.00 56.16  ? 805  ALA A HA   1 
ATOM   3444  H HB1  . ALA A 1 244 ? -20.070 18.519  -31.845 1.00 63.54  ? 805  ALA A HB1  1 
ATOM   3445  H HB2  . ALA A 1 244 ? -20.162 16.940  -31.997 1.00 63.54  ? 805  ALA A HB2  1 
ATOM   3446  H HB3  . ALA A 1 244 ? -20.769 17.650  -30.712 1.00 63.54  ? 805  ALA A HB3  1 
ATOM   3447  N N    . ARG A 1 245 ? -19.055 18.659  -28.517 1.00 42.04  ? 806  ARG A N    1 
ATOM   3448  C CA   . ARG A 1 245 ? -18.834 19.728  -27.548 1.00 41.29  ? 806  ARG A CA   1 
ATOM   3449  C C    . ARG A 1 245 ? -17.377 19.781  -27.109 1.00 37.55  ? 806  ARG A C    1 
ATOM   3450  O O    . ARG A 1 245 ? -16.790 20.865  -27.014 1.00 35.65  ? 806  ARG A O    1 
ATOM   3451  C CB   . ARG A 1 245 ? -19.744 19.538  -26.335 1.00 40.46  ? 806  ARG A CB   1 
ATOM   3452  C CG   . ARG A 1 245 ? -19.458 20.500  -25.183 1.00 41.96  ? 806  ARG A CG   1 
ATOM   3453  C CD   . ARG A 1 245 ? -20.281 20.166  -23.956 1.00 42.37  ? 806  ARG A CD   1 
ATOM   3454  N NE   . ARG A 1 245 ? -21.707 20.399  -24.161 1.00 38.46  ? 806  ARG A NE   1 
ATOM   3455  C CZ   . ARG A 1 245 ? -22.318 21.564  -23.969 1.00 37.09  ? 806  ARG A CZ   1 
ATOM   3456  N NH1  . ARG A 1 245 ? -21.634 22.627  -23.568 1.00 38.59  ? 806  ARG A NH1  1 
ATOM   3457  N NH2  . ARG A 1 245 ? -23.622 21.667  -24.182 1.00 40.36  ? 806  ARG A NH2  1 
ATOM   3458  H H    . ARG A 1 245 ? -19.576 18.031  -28.245 1.00 50.44  ? 806  ARG A H    1 
ATOM   3459  H HA   . ARG A 1 245 ? -19.054 20.579  -27.959 1.00 49.55  ? 806  ARG A HA   1 
ATOM   3460  H HB2  . ARG A 1 245 ? -20.664 19.674  -26.612 1.00 48.55  ? 806  ARG A HB2  1 
ATOM   3461  H HB3  . ARG A 1 245 ? -19.633 18.634  -26.000 1.00 48.55  ? 806  ARG A HB3  1 
ATOM   3462  H HG2  . ARG A 1 245 ? -18.520 20.442  -24.944 1.00 50.35  ? 806  ARG A HG2  1 
ATOM   3463  H HG3  . ARG A 1 245 ? -19.678 21.403  -25.459 1.00 50.35  ? 806  ARG A HG3  1 
ATOM   3464  H HD2  . ARG A 1 245 ? -20.157 19.230  -23.736 1.00 50.85  ? 806  ARG A HD2  1 
ATOM   3465  H HD3  . ARG A 1 245 ? -19.988 20.723  -23.217 1.00 50.85  ? 806  ARG A HD3  1 
ATOM   3466  H HE   . ARG A 1 245 ? -22.186 19.736  -24.426 1.00 46.15  ? 806  ARG A HE   1 
ATOM   3467  H HH11 . ARG A 1 245 ? -20.788 22.567  -23.427 1.00 46.31  ? 806  ARG A HH11 1 
ATOM   3468  H HH12 . ARG A 1 245 ? -22.038 23.377  -23.446 1.00 46.31  ? 806  ARG A HH12 1 
ATOM   3469  H HH21 . ARG A 1 245 ? -24.070 20.981  -24.444 1.00 48.43  ? 806  ARG A HH21 1 
ATOM   3470  H HH22 . ARG A 1 245 ? -24.019 22.420  -24.061 1.00 48.43  ? 806  ARG A HH22 1 
ATOM   3471  N N    . GLU A 1 246 ? -16.782 18.622  -26.825 1.00 38.98  ? 807  GLU A N    1 
ATOM   3472  C CA   . GLU A 1 246 ? -15.394 18.590  -26.379 1.00 43.44  ? 807  GLU A CA   1 
ATOM   3473  C C    . GLU A 1 246 ? -14.474 19.214  -27.420 1.00 41.02  ? 807  GLU A C    1 
ATOM   3474  O O    . GLU A 1 246 ? -13.533 19.940  -27.074 1.00 27.82  ? 807  GLU A O    1 
ATOM   3475  C CB   . GLU A 1 246 ? -14.984 17.148  -26.073 1.00 41.93  ? 807  GLU A CB   1 
ATOM   3476  C CG   . GLU A 1 246 ? -13.712 17.019  -25.251 1.00 44.96  ? 807  GLU A CG   1 
ATOM   3477  C CD   . GLU A 1 246 ? -12.457 17.056  -26.096 1.00 60.38  ? 807  GLU A CD   1 
ATOM   3478  O OE1  . GLU A 1 246 ? -12.421 16.389  -27.151 1.00 42.84  ? 807  GLU A OE1  1 
ATOM   3479  O OE2  . GLU A 1 246 ? -11.500 17.752  -25.701 1.00 63.75  ? 807  GLU A OE2  1 
ATOM   3480  H H    . GLU A 1 246 ? -17.156 17.850  -26.881 1.00 46.77  ? 807  GLU A H    1 
ATOM   3481  H HA   . GLU A 1 246 ? -15.313 19.105  -25.561 1.00 52.13  ? 807  GLU A HA   1 
ATOM   3482  H HB2  . GLU A 1 246 ? -15.700 16.721  -25.577 1.00 50.32  ? 807  GLU A HB2  1 
ATOM   3483  H HB3  . GLU A 1 246 ? -14.842 16.681  -26.911 1.00 50.32  ? 807  GLU A HB3  1 
ATOM   3484  H HG2  . GLU A 1 246 ? -13.668 17.754  -24.619 1.00 53.95  ? 807  GLU A HG2  1 
ATOM   3485  H HG3  . GLU A 1 246 ? -13.728 16.173  -24.775 1.00 53.95  ? 807  GLU A HG3  1 
ATOM   3486  N N    . LEU A 1 247 ? -14.742 18.959  -28.705 1.00 41.14  ? 808  LEU A N    1 
ATOM   3487  C CA   . LEU A 1 247 ? -13.952 19.580  -29.762 1.00 37.47  ? 808  LEU A CA   1 
ATOM   3488  C C    . LEU A 1 247 ? -14.313 21.049  -29.930 1.00 34.42  ? 808  LEU A C    1 
ATOM   3489  O O    . LEU A 1 247 ? -13.425 21.891  -30.073 1.00 25.49  ? 808  LEU A O    1 
ATOM   3490  C CB   . LEU A 1 247 ? -14.142 18.843  -31.086 1.00 37.30  ? 808  LEU A CB   1 
ATOM   3491  C CG   . LEU A 1 247 ? -13.426 19.448  -32.302 1.00 30.58  ? 808  LEU A CG   1 
ATOM   3492  C CD1  . LEU A 1 247 ? -11.915 19.515  -32.093 1.00 33.58  ? 808  LEU A CD1  1 
ATOM   3493  C CD2  . LEU A 1 247 ? -13.753 18.664  -33.564 1.00 37.92  ? 808  LEU A CD2  1 
ATOM   3494  H H    . LEU A 1 247 ? -15.367 18.438  -28.983 1.00 49.37  ? 808  LEU A H    1 
ATOM   3495  H HA   . LEU A 1 247 ? -13.013 19.529  -29.524 1.00 44.96  ? 808  LEU A HA   1 
ATOM   3496  H HB2  . LEU A 1 247 ? -13.816 17.935  -30.980 1.00 44.76  ? 808  LEU A HB2  1 
ATOM   3497  H HB3  . LEU A 1 247 ? -15.090 18.822  -31.290 1.00 44.76  ? 808  LEU A HB3  1 
ATOM   3498  H HG   . LEU A 1 247 ? -13.745 20.355  -32.429 1.00 36.70  ? 808  LEU A HG   1 
ATOM   3499  H HD11 . LEU A 1 247 ? -11.505 19.902  -32.883 1.00 40.30  ? 808  LEU A HD11 1 
ATOM   3500  H HD12 . LEU A 1 247 ? -11.728 20.067  -31.318 1.00 40.30  ? 808  LEU A HD12 1 
ATOM   3501  H HD13 . LEU A 1 247 ? -11.576 18.617  -31.950 1.00 40.30  ? 808  LEU A HD13 1 
ATOM   3502  H HD21 . LEU A 1 247 ? -13.289 19.067  -34.314 1.00 45.51  ? 808  LEU A HD21 1 
ATOM   3503  H HD22 . LEU A 1 247 ? -13.463 17.746  -33.449 1.00 45.51  ? 808  LEU A HD22 1 
ATOM   3504  H HD23 . LEU A 1 247 ? -14.711 18.693  -33.713 1.00 45.51  ? 808  LEU A HD23 1 
ATOM   3505  N N    . ILE A 1 248 ? -15.613 21.373  -29.931 1.00 36.79  ? 809  ILE A N    1 
ATOM   3506  C CA   . ILE A 1 248 ? -16.053 22.739  -30.232 1.00 37.46  ? 809  ILE A CA   1 
ATOM   3507  C C    . ILE A 1 248 ? -15.813 23.679  -29.062 1.00 40.19  ? 809  ILE A C    1 
ATOM   3508  O O    . ILE A 1 248 ? -15.640 24.884  -29.267 1.00 40.79  ? 809  ILE A O    1 
ATOM   3509  C CB   . ILE A 1 248 ? -17.539 22.773  -30.634 1.00 35.94  ? 809  ILE A CB   1 
ATOM   3510  C CG1  . ILE A 1 248 ? -17.733 22.138  -32.005 1.00 32.88  ? 809  ILE A CG1  1 
ATOM   3511  C CG2  . ILE A 1 248 ? -18.056 24.227  -30.676 1.00 34.70  ? 809  ILE A CG2  1 
ATOM   3512  C CD1  . ILE A 1 248 ? -19.179 21.985  -32.386 1.00 35.56  ? 809  ILE A CD1  1 
ATOM   3513  H H    . ILE A 1 248 ? -16.254 20.824  -29.762 1.00 44.15  ? 809  ILE A H    1 
ATOM   3514  H HA   . ILE A 1 248 ? -15.538 23.070  -30.984 1.00 44.95  ? 809  ILE A HA   1 
ATOM   3515  H HB   . ILE A 1 248 ? -18.053 22.275  -29.980 1.00 43.13  ? 809  ILE A HB   1 
ATOM   3516  H HG12 . ILE A 1 248 ? -17.306 22.696  -32.674 1.00 39.46  ? 809  ILE A HG12 1 
ATOM   3517  H HG13 . ILE A 1 248 ? -17.330 21.256  -32.003 1.00 39.46  ? 809  ILE A HG13 1 
ATOM   3518  H HG21 . ILE A 1 248 ? -18.992 24.221  -30.932 1.00 41.64  ? 809  ILE A HG21 1 
ATOM   3519  H HG22 . ILE A 1 248 ? -17.955 24.623  -29.796 1.00 41.64  ? 809  ILE A HG22 1 
ATOM   3520  H HG23 . ILE A 1 248 ? -17.538 24.727  -31.326 1.00 41.64  ? 809  ILE A HG23 1 
ATOM   3521  H HD11 . ILE A 1 248 ? -19.232 21.577  -33.264 1.00 42.68  ? 809  ILE A HD11 1 
ATOM   3522  H HD12 . ILE A 1 248 ? -19.620 21.421  -31.731 1.00 42.68  ? 809  ILE A HD12 1 
ATOM   3523  H HD13 . ILE A 1 248 ? -19.595 22.861  -32.402 1.00 42.68  ? 809  ILE A HD13 1 
ATOM   3524  N N    . GLU A 1 249 ? -15.853 23.186  -27.825 1.00 38.91  ? 810  GLU A N    1 
ATOM   3525  C CA   . GLU A 1 249 ? -15.461 24.042  -26.711 1.00 42.45  ? 810  GLU A CA   1 
ATOM   3526  C C    . GLU A 1 249 ? -13.984 24.384  -26.812 1.00 41.66  ? 810  GLU A C    1 
ATOM   3527  O O    . GLU A 1 249 ? -13.579 25.527  -26.571 1.00 38.96  ? 810  GLU A O    1 
ATOM   3528  C CB   . GLU A 1 249 ? -15.782 23.366  -25.384 1.00 46.81  ? 810  GLU A CB   1 
ATOM   3529  C CG   . GLU A 1 249 ? -17.257 23.414  -25.034 1.00 54.77  ? 810  GLU A CG   1 
ATOM   3530  C CD   . GLU A 1 249 ? -17.550 22.791  -23.688 1.00 60.67  ? 810  GLU A CD   1 
ATOM   3531  O OE1  . GLU A 1 249 ? -16.660 22.099  -23.149 1.00 60.72  ? 810  GLU A OE1  1 
ATOM   3532  O OE2  . GLU A 1 249 ? -18.665 22.996  -23.166 1.00 44.90  ? 810  GLU A OE2  1 
ATOM   3533  H H    . GLU A 1 249 ? -16.093 22.389  -27.611 1.00 46.69  ? 810  GLU A H    1 
ATOM   3534  H HA   . GLU A 1 249 ? -15.965 24.870  -26.756 1.00 50.94  ? 810  GLU A HA   1 
ATOM   3535  H HB2  . GLU A 1 249 ? -15.517 22.434  -25.432 1.00 56.17  ? 810  GLU A HB2  1 
ATOM   3536  H HB3  . GLU A 1 249 ? -15.292 23.813  -24.676 1.00 56.17  ? 810  GLU A HB3  1 
ATOM   3537  H HG2  . GLU A 1 249 ? -17.546 24.340  -25.007 1.00 65.73  ? 810  GLU A HG2  1 
ATOM   3538  H HG3  . GLU A 1 249 ? -17.759 22.928  -25.706 1.00 65.73  ? 810  GLU A HG3  1 
ATOM   3539  N N    . LYS A 1 250 ? -13.168 23.403  -27.175 1.00 38.19  ? 811  LYS A N    1 
ATOM   3540  C CA   . LYS A 1 250 ? -11.886 23.687  -27.790 1.00 46.04  ? 811  LYS A CA   1 
ATOM   3541  C C    . LYS A 1 250 ? -12.121 24.369  -29.138 1.00 46.34  ? 811  LYS A C    1 
ATOM   3542  O O    . LYS A 1 250 ? -13.193 24.296  -29.728 1.00 53.44  ? 811  LYS A O    1 
ATOM   3543  C CB   . LYS A 1 250 ? -11.081 22.392  -27.948 1.00 63.03  ? 811  LYS A CB   1 
ATOM   3544  C CG   . LYS A 1 250 ? -9.707  22.387  -27.278 1.00 43.80  ? 811  LYS A CG   1 
ATOM   3545  C CD   . LYS A 1 250 ? -9.359  20.998  -26.773 1.00 51.99  ? 811  LYS A CD   1 
ATOM   3546  H H    . LYS A 1 250 ? -13.335 22.565  -27.076 1.00 45.83  ? 811  LYS A H    1 
ATOM   3547  H HA   . LYS A 1 250 ? -11.384 24.293  -27.223 1.00 55.25  ? 811  LYS A HA   1 
ATOM   3548  H HB2  . LYS A 1 250 ? -11.594 21.663  -27.566 1.00 75.64  ? 811  LYS A HB2  1 
ATOM   3549  H HB3  . LYS A 1 250 ? -10.944 22.230  -28.895 1.00 75.64  ? 811  LYS A HB3  1 
ATOM   3550  H HG2  . LYS A 1 250 ? -9.033  22.657  -27.922 1.00 52.56  ? 811  LYS A HG2  1 
ATOM   3551  H HG3  . LYS A 1 250 ? -9.714  22.995  -26.522 1.00 52.56  ? 811  LYS A HG3  1 
ATOM   3552  H HD2  . LYS A 1 250 ? -8.419  20.973  -26.538 1.00 62.39  ? 811  LYS A HD2  1 
ATOM   3553  H HD3  . LYS A 1 250 ? -9.902  20.800  -25.993 1.00 62.39  ? 811  LYS A HD3  1 
ATOM   3554  N N    . MET A 1 251 ? -11.114 25.095  -29.586 1.00 41.26  ? 812  MET A N    1 
ATOM   3555  C CA   . MET A 1 251 ? -11.122 25.890  -30.811 1.00 47.58  ? 812  MET A CA   1 
ATOM   3556  C C    . MET A 1 251 ? -11.897 27.199  -30.726 1.00 34.20  ? 812  MET A C    1 
ATOM   3557  O O    . MET A 1 251 ? -11.534 28.134  -31.435 1.00 39.22  ? 812  MET A O    1 
ATOM   3558  C CB   . MET A 1 251 ? -11.779 25.133  -31.984 1.00 39.97  ? 812  MET A CB   1 
ATOM   3559  C CG   . MET A 1 251 ? -11.424 23.670  -32.211 1.00 40.79  ? 812  MET A CG   1 
ATOM   3560  S SD   . MET A 1 251 ? -12.095 23.065  -33.796 1.00 48.89  ? 812  MET A SD   1 
ATOM   3561  C CE   . MET A 1 251 ? -13.869 23.028  -33.499 1.00 31.21  ? 812  MET A CE   1 
ATOM   3562  H H    . MET A 1 251 ? -10.363 25.148  -29.170 1.00 49.51  ? 812  MET A H    1 
ATOM   3563  H HA   . MET A 1 251 ? -10.206 26.085  -31.060 1.00 57.09  ? 812  MET A HA   1 
ATOM   3564  H HB2  . MET A 1 251 ? -12.740 25.171  -31.858 1.00 47.97  ? 812  MET A HB2  1 
ATOM   3565  H HB3  . MET A 1 251 ? -11.552 25.604  -32.802 1.00 47.97  ? 812  MET A HB3  1 
ATOM   3566  H HG2  . MET A 1 251 ? -10.459 23.573  -32.231 1.00 48.95  ? 812  MET A HG2  1 
ATOM   3567  H HG3  . MET A 1 251 ? -11.802 23.134  -31.496 1.00 48.95  ? 812  MET A HG3  1 
ATOM   3568  H HE1  . MET A 1 251 ? -14.317 22.714  -34.300 1.00 37.45  ? 812  MET A HE1  1 
ATOM   3569  H HE2  . MET A 1 251 ? -14.052 22.427  -32.760 1.00 37.45  ? 812  MET A HE2  1 
ATOM   3570  H HE3  . MET A 1 251 ? -14.171 23.923  -33.280 1.00 37.45  ? 812  MET A HE3  1 
ATOM   3571  N N    . ILE A 1 252 ? -12.901 27.329  -29.849 1.00 40.49  ? 813  ILE A N    1 
ATOM   3572  C CA   . ILE A 1 252 ? -13.485 28.639  -29.548 1.00 40.17  ? 813  ILE A CA   1 
ATOM   3573  C C    . ILE A 1 252 ? -13.005 29.182  -28.214 1.00 36.38  ? 813  ILE A C    1 
ATOM   3574  O O    . ILE A 1 252 ? -13.459 30.255  -27.790 1.00 41.78  ? 813  ILE A O    1 
ATOM   3575  C CB   . ILE A 1 252 ? -15.033 28.655  -29.629 1.00 37.93  ? 813  ILE A CB   1 
ATOM   3576  C CG1  . ILE A 1 252 ? -15.704 27.901  -28.482 1.00 32.25  ? 813  ILE A CG1  1 
ATOM   3577  C CG2  . ILE A 1 252 ? -15.497 28.179  -31.012 1.00 33.35  ? 813  ILE A CG2  1 
ATOM   3578  C CD1  . ILE A 1 252 ? -17.242 27.935  -28.542 1.00 30.62  ? 813  ILE A CD1  1 
ATOM   3579  H H    . ILE A 1 252 ? -13.258 26.676  -29.418 1.00 48.59  ? 813  ILE A H    1 
ATOM   3580  H HA   . ILE A 1 252 ? -13.170 29.258  -30.225 1.00 48.21  ? 813  ILE A HA   1 
ATOM   3581  H HB   . ILE A 1 252 ? -15.306 29.582  -29.548 1.00 45.52  ? 813  ILE A HB   1 
ATOM   3582  H HG12 . ILE A 1 252 ? -15.425 26.972  -28.511 1.00 38.70  ? 813  ILE A HG12 1 
ATOM   3583  H HG13 . ILE A 1 252 ? -15.430 28.301  -27.641 1.00 38.70  ? 813  ILE A HG13 1 
ATOM   3584  H HG21 . ILE A 1 252 ? -16.466 28.196  -31.042 1.00 40.02  ? 813  ILE A HG21 1 
ATOM   3585  H HG22 . ILE A 1 252 ? -15.133 28.773  -31.687 1.00 40.02  ? 813  ILE A HG22 1 
ATOM   3586  H HG23 . ILE A 1 252 ? -15.176 27.275  -31.158 1.00 40.02  ? 813  ILE A HG23 1 
ATOM   3587  H HD11 . ILE A 1 252 ? -17.598 27.440  -27.788 1.00 36.75  ? 813  ILE A HD11 1 
ATOM   3588  H HD12 . ILE A 1 252 ? -17.539 28.858  -28.503 1.00 36.75  ? 813  ILE A HD12 1 
ATOM   3589  H HD13 . ILE A 1 252 ? -17.534 27.529  -29.373 1.00 36.75  ? 813  ILE A HD13 1 
ATOM   3590  N N    . ALA A 1 253 ? -12.134 28.451  -27.520 1.00 38.55  ? 814  ALA A N    1 
ATOM   3591  C CA   . ALA A 1 253 ? -11.649 28.874  -26.215 1.00 39.65  ? 814  ALA A CA   1 
ATOM   3592  C C    . ALA A 1 253 ? -11.081 30.284  -26.289 1.00 43.53  ? 814  ALA A C    1 
ATOM   3593  O O    . ALA A 1 253 ? -10.398 30.646  -27.251 1.00 41.63  ? 814  ALA A O    1 
ATOM   3594  C CB   . ALA A 1 253 ? -10.582 27.902  -25.711 1.00 32.11  ? 814  ALA A CB   1 
ATOM   3595  H H    . ALA A 1 253 ? -11.808 27.701  -27.788 1.00 46.26  ? 814  ALA A H    1 
ATOM   3596  H HA   . ALA A 1 253 ? -12.385 28.874  -25.583 1.00 47.58  ? 814  ALA A HA   1 
ATOM   3597  H HB1  . ALA A 1 253 ? -10.271 28.199  -24.842 1.00 38.53  ? 814  ALA A HB1  1 
ATOM   3598  H HB2  . ALA A 1 253 ? -10.971 27.017  -25.639 1.00 38.53  ? 814  ALA A HB2  1 
ATOM   3599  H HB3  . ALA A 1 253 ? -9.844  27.890  -26.341 1.00 38.53  ? 814  ALA A HB3  1 
ATOM   3600  N N    . MET A 1 254 ? -11.387 31.086  -25.267 1.00 44.16  ? 815  MET A N    1 
ATOM   3601  C CA   . MET A 1 254 ? -10.881 32.453  -25.207 1.00 38.04  ? 815  MET A CA   1 
ATOM   3602  C C    . MET A 1 254 ? -9.362  32.482  -25.314 1.00 39.62  ? 815  MET A C    1 
ATOM   3603  O O    . MET A 1 254 ? -8.795  33.290  -26.058 1.00 40.79  ? 815  MET A O    1 
ATOM   3604  C CB   . MET A 1 254 ? -11.338 33.117  -23.908 1.00 40.13  ? 815  MET A CB   1 
ATOM   3605  C CG   . MET A 1 254 ? -12.772 33.624  -23.914 1.00 53.13  ? 815  MET A CG   1 
ATOM   3606  S SD   . MET A 1 254 ? -13.090 34.890  -25.160 1.00 89.37  ? 815  MET A SD   1 
ATOM   3607  C CE   . MET A 1 254 ? -13.940 33.930  -26.410 1.00 57.18  ? 815  MET A CE   1 
ATOM   3608  H H    . MET A 1 254 ? -11.883 30.862  -24.601 1.00 52.99  ? 815  MET A H    1 
ATOM   3609  H HA   . MET A 1 254 ? -11.256 32.957  -25.946 1.00 45.65  ? 815  MET A HA   1 
ATOM   3610  H HB2  . MET A 1 254 ? -11.258 32.472  -23.188 1.00 48.16  ? 815  MET A HB2  1 
ATOM   3611  H HB3  . MET A 1 254 ? -10.760 33.876  -23.731 1.00 48.16  ? 815  MET A HB3  1 
ATOM   3612  H HG2  . MET A 1 254 ? -13.367 32.878  -24.091 1.00 63.76  ? 815  MET A HG2  1 
ATOM   3613  H HG3  . MET A 1 254 ? -12.973 34.005  -23.045 1.00 63.76  ? 815  MET A HG3  1 
ATOM   3614  H HE1  . MET A 1 254 ? -14.170 34.512  -27.152 1.00 68.61  ? 815  MET A HE1  1 
ATOM   3615  H HE2  . MET A 1 254 ? -13.355 33.220  -26.715 1.00 68.61  ? 815  MET A HE2  1 
ATOM   3616  H HE3  . MET A 1 254 ? -14.746 33.552  -26.024 1.00 68.61  ? 815  MET A HE3  1 
ATOM   3617  N N    . ASP A 1 255 ? -8.689  31.612  -24.579 1.00 42.00  ? 816  ASP A N    1 
ATOM   3618  C CA   . ASP A 1 255 ? -7.235  31.547  -24.632 1.00 43.50  ? 816  ASP A CA   1 
ATOM   3619  C C    . ASP A 1 255 ? -6.807  30.884  -25.936 1.00 43.34  ? 816  ASP A C    1 
ATOM   3620  O O    . ASP A 1 255 ? -7.075  29.689  -26.123 1.00 41.09  ? 816  ASP A O    1 
ATOM   3621  C CB   . ASP A 1 255 ? -6.702  30.768  -23.429 1.00 43.44  ? 816  ASP A CB   1 
ATOM   3622  C CG   . ASP A 1 255 ? -5.187  30.776  -23.348 1.00 43.98  ? 816  ASP A CG   1 
ATOM   3623  O OD1  . ASP A 1 255 ? -4.549  31.539  -24.101 1.00 44.47  ? 816  ASP A OD1  1 
ATOM   3624  O OD2  . ASP A 1 255 ? -4.634  30.023  -22.518 1.00 46.95  ? 816  ASP A OD2  1 
ATOM   3625  H H    . ASP A 1 255 ? -9.049  31.047  -24.040 1.00 50.40  ? 816  ASP A H    1 
ATOM   3626  H HA   . ASP A 1 255 ? -6.868  32.444  -24.606 1.00 52.21  ? 816  ASP A HA   1 
ATOM   3627  H HB2  . ASP A 1 255 ? -7.048  31.168  -22.616 1.00 52.12  ? 816  ASP A HB2  1 
ATOM   3628  H HB3  . ASP A 1 255 ? -6.994  29.846  -23.496 1.00 52.12  ? 816  ASP A HB3  1 
ATOM   3629  N N    . PRO A 1 256 ? -6.145  31.596  -26.855 1.00 46.08  ? 817  PRO A N    1 
ATOM   3630  C CA   . PRO A 1 256 ? -5.842  30.983  -28.158 1.00 43.02  ? 817  PRO A CA   1 
ATOM   3631  C C    . PRO A 1 256 ? -4.820  29.863  -28.084 1.00 39.07  ? 817  PRO A C    1 
ATOM   3632  O O    . PRO A 1 256 ? -4.868  28.947  -28.915 1.00 38.46  ? 817  PRO A O    1 
ATOM   3633  C CB   . PRO A 1 256 ? -5.328  32.166  -28.989 1.00 39.43  ? 817  PRO A CB   1 
ATOM   3634  C CG   . PRO A 1 256 ? -4.801  33.129  -27.987 1.00 38.12  ? 817  PRO A CG   1 
ATOM   3635  C CD   . PRO A 1 256 ? -5.686  32.995  -26.786 1.00 40.47  ? 817  PRO A CD   1 
ATOM   3636  H HA   . PRO A 1 256 ? -6.656  30.643  -28.562 1.00 51.62  ? 817  PRO A HA   1 
ATOM   3637  H HB2  . PRO A 1 256 ? -4.622  31.867  -29.584 1.00 47.31  ? 817  PRO A HB2  1 
ATOM   3638  H HB3  . PRO A 1 256 ? -6.059  32.558  -29.491 1.00 47.31  ? 817  PRO A HB3  1 
ATOM   3639  H HG2  . PRO A 1 256 ? -3.886  32.897  -27.764 1.00 45.75  ? 817  PRO A HG2  1 
ATOM   3640  H HG3  . PRO A 1 256 ? -4.847  34.029  -28.346 1.00 45.75  ? 817  PRO A HG3  1 
ATOM   3641  H HD2  . PRO A 1 256 ? -5.178  33.144  -25.973 1.00 48.56  ? 817  PRO A HD2  1 
ATOM   3642  H HD3  . PRO A 1 256 ? -6.439  33.602  -26.851 1.00 48.56  ? 817  PRO A HD3  1 
ATOM   3643  N N    . GLN A 1 257 ? -3.900  29.899  -27.119 1.00 46.01  ? 818  GLN A N    1 
ATOM   3644  C CA   . GLN A 1 257 ? -2.899  28.845  -27.012 1.00 52.91  ? 818  GLN A CA   1 
ATOM   3645  C C    . GLN A 1 257 ? -3.477  27.534  -26.497 1.00 43.07  ? 818  GLN A C    1 
ATOM   3646  O O    . GLN A 1 257 ? -2.765  26.524  -26.496 1.00 47.48  ? 818  GLN A O    1 
ATOM   3647  C CB   . GLN A 1 257 ? -1.747  29.303  -26.115 1.00 56.87  ? 818  GLN A CB   1 
ATOM   3648  C CG   . GLN A 1 257 ? -0.574  29.888  -26.894 1.00 63.94  ? 818  GLN A CG   1 
ATOM   3649  C CD   . GLN A 1 257 ? 0.562   30.349  -26.002 1.00 73.09  ? 818  GLN A CD   1 
ATOM   3650  O OE1  . GLN A 1 257 ? 0.354   30.699  -24.841 1.00 72.05  ? 818  GLN A OE1  1 
ATOM   3651  N NE2  . GLN A 1 257 ? 1.775   30.346  -26.544 1.00 90.50  ? 818  GLN A NE2  1 
ATOM   3652  H H    . GLN A 1 257 ? -3.837  30.515  -26.522 1.00 55.21  ? 818  GLN A H    1 
ATOM   3653  H HA   . GLN A 1 257 ? -2.533  28.676  -27.895 1.00 63.49  ? 818  GLN A HA   1 
ATOM   3654  H HB2  . GLN A 1 257 ? -2.073  29.987  -25.509 1.00 68.24  ? 818  GLN A HB2  1 
ATOM   3655  H HB3  . GLN A 1 257 ? -1.420  28.542  -25.610 1.00 68.24  ? 818  GLN A HB3  1 
ATOM   3656  H HG2  . GLN A 1 257 ? -0.227  29.210  -27.495 1.00 76.72  ? 818  GLN A HG2  1 
ATOM   3657  H HG3  . GLN A 1 257 ? -0.885  30.653  -27.403 1.00 76.72  ? 818  GLN A HG3  1 
ATOM   3658  H HE21 . GLN A 1 257 ? 1.882   30.092  -27.358 1.00 108.60 ? 818  GLN A HE21 1 
ATOM   3659  H HE22 . GLN A 1 257 ? 2.454   30.599  -26.080 1.00 108.60 ? 818  GLN A HE22 1 
ATOM   3660  N N    . LYS A 1 258 ? -4.737  27.524  -26.065 1.00 39.38  ? 819  LYS A N    1 
ATOM   3661  C CA   . LYS A 1 258 ? -5.439  26.292  -25.730 1.00 44.04  ? 819  LYS A CA   1 
ATOM   3662  C C    . LYS A 1 258 ? -6.191  25.705  -26.916 1.00 34.41  ? 819  LYS A C    1 
ATOM   3663  O O    . LYS A 1 258 ? -6.788  24.633  -26.783 1.00 39.96  ? 819  LYS A O    1 
ATOM   3664  C CB   . LYS A 1 258 ? -6.421  26.537  -24.581 1.00 46.89  ? 819  LYS A CB   1 
ATOM   3665  C CG   . LYS A 1 258 ? -5.762  26.704  -23.228 1.00 45.59  ? 819  LYS A CG   1 
ATOM   3666  C CD   . LYS A 1 258 ? -6.801  26.799  -22.125 1.00 50.50  ? 819  LYS A CD   1 
ATOM   3667  C CE   . LYS A 1 258 ? -6.213  27.382  -20.854 1.00 57.82  ? 819  LYS A CE   1 
ATOM   3668  N NZ   . LYS A 1 258 ? -6.729  28.754  -20.587 1.00 70.56  ? 819  LYS A NZ   1 
ATOM   3669  H H    . LYS A 1 258 ? -5.213  28.232  -25.957 1.00 47.26  ? 819  LYS A H    1 
ATOM   3670  H HA   . LYS A 1 258 ? -4.791  25.634  -25.433 1.00 52.84  ? 819  LYS A HA   1 
ATOM   3671  H HB2  . LYS A 1 258 ? -6.922  27.346  -24.767 1.00 56.27  ? 819  LYS A HB2  1 
ATOM   3672  H HB3  . LYS A 1 258 ? -7.027  25.782  -24.523 1.00 56.27  ? 819  LYS A HB3  1 
ATOM   3673  H HG2  . LYS A 1 258 ? -5.196  25.937  -23.050 1.00 54.71  ? 819  LYS A HG2  1 
ATOM   3674  H HG3  . LYS A 1 258 ? -5.237  27.519  -23.225 1.00 54.71  ? 819  LYS A HG3  1 
ATOM   3675  H HD2  . LYS A 1 258 ? -7.525  27.374  -22.417 1.00 60.60  ? 819  LYS A HD2  1 
ATOM   3676  H HD3  . LYS A 1 258 ? -7.137  25.911  -21.925 1.00 60.60  ? 819  LYS A HD3  1 
ATOM   3677  H HE2  . LYS A 1 258 ? -6.452  26.816  -20.102 1.00 69.39  ? 819  LYS A HE2  1 
ATOM   3678  H HE3  . LYS A 1 258 ? -5.248  27.432  -20.942 1.00 69.39  ? 819  LYS A HE3  1 
ATOM   3679  H HZ1  . LYS A 1 258 ? -6.370  29.074  -19.838 1.00 84.68  ? 819  LYS A HZ1  1 
ATOM   3680  H HZ2  . LYS A 1 258 ? -6.518  29.294  -21.262 1.00 84.68  ? 819  LYS A HZ2  1 
ATOM   3681  H HZ3  . LYS A 1 258 ? -7.614  28.734  -20.498 1.00 84.68  ? 819  LYS A HZ3  1 
ATOM   3682  N N    . ARG A 1 259 ? -6.176  26.386  -28.085 1.00 38.59  ? 820  ARG A N    1 
ATOM   3683  C CA   . ARG A 1 259 ? -6.911  25.906  -29.247 1.00 35.90  ? 820  ARG A CA   1 
ATOM   3684  C C    . ARG A 1 259 ? -6.062  24.911  -30.031 1.00 31.56  ? 820  ARG A C    1 
ATOM   3685  O O    . ARG A 1 259 ? -4.839  25.065  -30.108 1.00 30.06  ? 820  ARG A O    1 
ATOM   3686  C CB   . ARG A 1 259 ? -7.300  27.062  -30.159 1.00 37.72  ? 820  ARG A CB   1 
ATOM   3687  C CG   . ARG A 1 259 ? -8.182  28.100  -29.500 1.00 40.02  ? 820  ARG A CG   1 
ATOM   3688  C CD   . ARG A 1 259 ? -8.457  29.240  -30.452 1.00 37.34  ? 820  ARG A CD   1 
ATOM   3689  N NE   . ARG A 1 259 ? -9.041  30.393  -29.776 1.00 40.19  ? 820  ARG A NE   1 
ATOM   3690  C CZ   . ARG A 1 259 ? -8.894  31.652  -30.175 1.00 42.41  ? 820  ARG A CZ   1 
ATOM   3691  N NH1  . ARG A 1 259 ? -8.173  31.939  -31.252 1.00 39.33  ? 820  ARG A NH1  1 
ATOM   3692  N NH2  . ARG A 1 259 ? -9.464  32.632  -29.492 1.00 45.72  ? 820  ARG A NH2  1 
ATOM   3693  H H    . ARG A 1 259 ? -5.747  27.120  -28.217 1.00 46.31  ? 820  ARG A H    1 
ATOM   3694  H HA   . ARG A 1 259 ? -7.720  25.458  -28.955 1.00 43.08  ? 820  ARG A HA   1 
ATOM   3695  H HB2  . ARG A 1 259 ? -6.492  27.508  -30.459 1.00 45.26  ? 820  ARG A HB2  1 
ATOM   3696  H HB3  . ARG A 1 259 ? -7.781  26.708  -30.923 1.00 45.26  ? 820  ARG A HB3  1 
ATOM   3697  H HG2  . ARG A 1 259 ? -9.028  27.695  -29.252 1.00 48.03  ? 820  ARG A HG2  1 
ATOM   3698  H HG3  . ARG A 1 259 ? -7.734  28.455  -28.716 1.00 48.03  ? 820  ARG A HG3  1 
ATOM   3699  H HD2  . ARG A 1 259 ? -7.623  29.521  -30.861 1.00 44.81  ? 820  ARG A HD2  1 
ATOM   3700  H HD3  . ARG A 1 259 ? -9.080  28.942  -31.134 1.00 44.81  ? 820  ARG A HD3  1 
ATOM   3701  H HE   . ARG A 1 259 ? -9.513  30.248  -29.071 1.00 48.23  ? 820  ARG A HE   1 
ATOM   3702  H HH11 . ARG A 1 259 ? -7.800  31.308  -31.700 1.00 47.19  ? 820  ARG A HH11 1 
ATOM   3703  H HH12 . ARG A 1 259 ? -8.083  32.757  -31.503 1.00 47.19  ? 820  ARG A HH12 1 
ATOM   3704  H HH21 . ARG A 1 259 ? -9.932  32.453  -28.793 1.00 54.86  ? 820  ARG A HH21 1 
ATOM   3705  H HH22 . ARG A 1 259 ? -9.369  33.447  -29.749 1.00 54.86  ? 820  ARG A HH22 1 
ATOM   3706  N N    . PRO A 1 260 ? -6.677  23.890  -30.619 1.00 27.87  ? 821  PRO A N    1 
ATOM   3707  C CA   . PRO A 1 260 ? -5.916  22.940  -31.432 1.00 28.84  ? 821  PRO A CA   1 
ATOM   3708  C C    . PRO A 1 260 ? -5.598  23.508  -32.805 1.00 29.24  ? 821  PRO A C    1 
ATOM   3709  O O    . PRO A 1 260 ? -6.315  24.357  -33.336 1.00 25.15  ? 821  PRO A O    1 
ATOM   3710  C CB   . PRO A 1 260 ? -6.862  21.739  -31.536 1.00 28.12  ? 821  PRO A CB   1 
ATOM   3711  C CG   . PRO A 1 260 ? -8.219  22.349  -31.495 1.00 30.49  ? 821  PRO A CG   1 
ATOM   3712  C CD   . PRO A 1 260 ? -8.122  23.606  -30.661 1.00 27.62  ? 821  PRO A CD   1 
ATOM   3713  H HA   . PRO A 1 260 ? -5.097  22.678  -30.983 1.00 34.60  ? 821  PRO A HA   1 
ATOM   3714  H HB2  . PRO A 1 260 ? -6.716  21.275  -32.376 1.00 33.74  ? 821  PRO A HB2  1 
ATOM   3715  H HB3  . PRO A 1 260 ? -6.726  21.144  -30.782 1.00 33.74  ? 821  PRO A HB3  1 
ATOM   3716  H HG2  . PRO A 1 260 ? -8.501  22.565  -32.397 1.00 36.58  ? 821  PRO A HG2  1 
ATOM   3717  H HG3  . PRO A 1 260 ? -8.839  21.723  -31.089 1.00 36.58  ? 821  PRO A HG3  1 
ATOM   3718  H HD2  . PRO A 1 260 ? -8.596  24.334  -31.093 1.00 33.15  ? 821  PRO A HD2  1 
ATOM   3719  H HD3  . PRO A 1 260 ? -8.460  23.444  -29.766 1.00 33.15  ? 821  PRO A HD3  1 
ATOM   3720  N N    . SER A 1 261 ? -4.496  23.031  -33.375 1.00 33.11  ? 822  SER A N    1 
ATOM   3721  C CA   . SER A 1 261 ? -4.195  23.325  -34.766 1.00 25.32  ? 822  SER A CA   1 
ATOM   3722  C C    . SER A 1 261 ? -5.146  22.552  -35.676 1.00 27.94  ? 822  SER A C    1 
ATOM   3723  O O    . SER A 1 261 ? -5.789  21.583  -35.264 1.00 31.36  ? 822  SER A O    1 
ATOM   3724  C CB   . SER A 1 261 ? -2.747  22.970  -35.095 1.00 18.69  ? 822  SER A CB   1 
ATOM   3725  O OG   . SER A 1 261 ? -2.608  21.581  -35.326 1.00 31.27  ? 822  SER A OG   1 
ATOM   3726  H H    . SER A 1 261 ? -3.911  22.540  -32.979 1.00 39.73  ? 822  SER A H    1 
ATOM   3727  H HA   . SER A 1 261 ? -4.321  24.273  -34.929 1.00 30.39  ? 822  SER A HA   1 
ATOM   3728  H HB2  . SER A 1 261 ? -2.478  23.451  -35.893 1.00 22.43  ? 822  SER A HB2  1 
ATOM   3729  H HB3  . SER A 1 261 ? -2.183  23.223  -34.348 1.00 22.43  ? 822  SER A HB3  1 
ATOM   3730  H HG   . SER A 1 261 ? -2.839  21.152  -34.643 1.00 37.53  ? 822  SER A HG   1 
ATOM   3731  N N    . ALA A 1 262 ? -5.256  23.014  -36.925 1.00 29.72  ? 823  ALA A N    1 
ATOM   3732  C CA   . ALA A 1 262 ? -6.126  22.346  -37.889 1.00 26.38  ? 823  ALA A CA   1 
ATOM   3733  C C    . ALA A 1 262 ? -5.820  20.857  -37.977 1.00 28.68  ? 823  ALA A C    1 
ATOM   3734  O O    . ALA A 1 262 ? -6.734  20.032  -38.095 1.00 29.29  ? 823  ALA A O    1 
ATOM   3735  C CB   . ALA A 1 262 ? -5.987  22.998  -39.264 1.00 24.82  ? 823  ALA A CB   1 
ATOM   3736  H H    . ALA A 1 262 ? -4.842  23.703  -37.232 1.00 35.67  ? 823  ALA A H    1 
ATOM   3737  H HA   . ALA A 1 262 ? -7.048  22.446  -37.603 1.00 31.66  ? 823  ALA A HA   1 
ATOM   3738  H HB1  . ALA A 1 262 ? -6.571  22.542  -39.890 1.00 29.78  ? 823  ALA A HB1  1 
ATOM   3739  H HB2  . ALA A 1 262 ? -6.238  23.933  -39.197 1.00 29.78  ? 823  ALA A HB2  1 
ATOM   3740  H HB3  . ALA A 1 262 ? -5.065  22.923  -39.557 1.00 29.78  ? 823  ALA A HB3  1 
ATOM   3741  N N    . LYS A 1 263 ? -4.538  20.490  -37.912 1.00 30.90  ? 824  LYS A N    1 
ATOM   3742  C CA   . LYS A 1 263 ? -4.175  19.078  -37.948 1.00 29.67  ? 824  LYS A CA   1 
ATOM   3743  C C    . LYS A 1 263 ? -4.662  18.348  -36.702 1.00 33.96  ? 824  LYS A C    1 
ATOM   3744  O O    . LYS A 1 263 ? -5.108  17.198  -36.790 1.00 33.84  ? 824  LYS A O    1 
ATOM   3745  C CB   . LYS A 1 263 ? -2.662  18.927  -38.107 1.00 38.56  ? 824  LYS A CB   1 
ATOM   3746  C CG   . LYS A 1 263 ? -2.168  19.250  -39.511 1.00 33.27  ? 824  LYS A CG   1 
ATOM   3747  C CD   . LYS A 1 263 ? -0.663  19.078  -39.646 1.00 41.82  ? 824  LYS A CD   1 
ATOM   3748  C CE   . LYS A 1 263 ? -0.200  19.363  -41.069 1.00 56.06  ? 824  LYS A CE   1 
ATOM   3749  N NZ   . LYS A 1 263 ? 1.279   19.260  -41.220 1.00 68.02  ? 824  LYS A NZ   1 
ATOM   3750  H H    . LYS A 1 263 ? -3.873  21.032  -37.847 1.00 37.08  ? 824  LYS A H    1 
ATOM   3751  H HA   . LYS A 1 263 ? -4.597  18.665  -38.718 1.00 35.60  ? 824  LYS A HA   1 
ATOM   3752  H HB2  . LYS A 1 263 ? -2.220  19.531  -37.489 1.00 46.27  ? 824  LYS A HB2  1 
ATOM   3753  H HB3  . LYS A 1 263 ? -2.415  18.011  -37.907 1.00 46.27  ? 824  LYS A HB3  1 
ATOM   3754  H HG2  . LYS A 1 263 ? -2.597  18.652  -40.143 1.00 39.92  ? 824  LYS A HG2  1 
ATOM   3755  H HG3  . LYS A 1 263 ? -2.387  20.171  -39.721 1.00 39.92  ? 824  LYS A HG3  1 
ATOM   3756  H HD2  . LYS A 1 263 ? -0.214  19.699  -39.050 1.00 50.18  ? 824  LYS A HD2  1 
ATOM   3757  H HD3  . LYS A 1 263 ? -0.422  18.165  -39.424 1.00 50.18  ? 824  LYS A HD3  1 
ATOM   3758  H HE2  . LYS A 1 263 ? -0.609  18.721  -41.670 1.00 67.27  ? 824  LYS A HE2  1 
ATOM   3759  H HE3  . LYS A 1 263 ? -0.465  20.264  -41.314 1.00 67.27  ? 824  LYS A HE3  1 
ATOM   3760  H HZ1  . LYS A 1 263 ? 1.512   19.432  -42.061 1.00 81.63  ? 824  LYS A HZ1  1 
ATOM   3761  H HZ2  . LYS A 1 263 ? 1.681   19.845  -40.683 1.00 81.63  ? 824  LYS A HZ2  1 
ATOM   3762  H HZ3  . LYS A 1 263 ? 1.549   18.439  -41.007 1.00 81.63  ? 824  LYS A HZ3  1 
ATOM   3763  N N    . HIS A 1 264 ? -4.585  18.994  -35.534 1.00 31.87  ? 825  HIS A N    1 
ATOM   3764  C CA   . HIS A 1 264 ? -5.156  18.402  -34.326 1.00 30.49  ? 825  HIS A CA   1 
ATOM   3765  C C    . HIS A 1 264 ? -6.646  18.142  -34.500 1.00 29.66  ? 825  HIS A C    1 
ATOM   3766  O O    . HIS A 1 264 ? -7.150  17.083  -34.105 1.00 28.09  ? 825  HIS A O    1 
ATOM   3767  C CB   . HIS A 1 264 ? -4.919  19.315  -33.120 1.00 35.80  ? 825  HIS A CB   1 
ATOM   3768  C CG   . HIS A 1 264 ? -3.594  19.116  -32.451 1.00 37.30  ? 825  HIS A CG   1 
ATOM   3769  N ND1  . HIS A 1 264 ? -2.531  19.974  -32.634 1.00 47.85  ? 825  HIS A ND1  1 
ATOM   3770  C CD2  . HIS A 1 264 ? -3.165  18.164  -31.590 1.00 39.18  ? 825  HIS A CD2  1 
ATOM   3771  C CE1  . HIS A 1 264 ? -1.502  19.556  -31.918 1.00 51.47  ? 825  HIS A CE1  1 
ATOM   3772  N NE2  . HIS A 1 264 ? -1.860  18.458  -31.277 1.00 55.70  ? 825  HIS A NE2  1 
ATOM   3773  H H    . HIS A 1 264 ? -4.214  19.761  -35.417 1.00 38.25  ? 825  HIS A H    1 
ATOM   3774  H HA   . HIS A 1 264 ? -4.720  17.554  -34.152 1.00 36.59  ? 825  HIS A HA   1 
ATOM   3775  H HB2  . HIS A 1 264 ? -4.966  20.238  -33.414 1.00 42.96  ? 825  HIS A HB2  1 
ATOM   3776  H HB3  . HIS A 1 264 ? -5.611  19.145  -32.461 1.00 42.96  ? 825  HIS A HB3  1 
ATOM   3777  H HD2  . HIS A 1 264 ? -3.659  17.443  -31.273 1.00 47.02  ? 825  HIS A HD2  1 
ATOM   3778  H HE1  . HIS A 1 264 ? -0.667  19.964  -31.875 1.00 61.77  ? 825  HIS A HE1  1 
ATOM   3779  H HE2  . HIS A 1 264 ? -1.358  18.003  -30.747 1.00 66.84  ? 825  HIS A HE2  1 
ATOM   3780  N N    . VAL A 1 265 ? -7.366  19.094  -35.100 1.00 27.22  ? 826  VAL A N    1 
ATOM   3781  C CA   . VAL A 1 265 ? -8.806  18.940  -35.293 1.00 28.53  ? 826  VAL A CA   1 
ATOM   3782  C C    . VAL A 1 265 ? -9.097  17.759  -36.211 1.00 28.85  ? 826  VAL A C    1 
ATOM   3783  O O    . VAL A 1 265 ? -10.093 17.047  -36.032 1.00 25.68  ? 826  VAL A O    1 
ATOM   3784  C CB   . VAL A 1 265 ? -9.408  20.247  -35.845 1.00 26.16  ? 826  VAL A CB   1 
ATOM   3785  C CG1  . VAL A 1 265 ? -10.897 20.083  -36.137 1.00 33.22  ? 826  VAL A CG1  1 
ATOM   3786  C CG2  . VAL A 1 265 ? -9.181  21.395  -34.861 1.00 28.87  ? 826  VAL A CG2  1 
ATOM   3787  H H    . VAL A 1 265 ? -7.045  19.833  -35.401 1.00 32.67  ? 826  VAL A H    1 
ATOM   3788  H HA   . VAL A 1 265 ? -9.221  18.760  -34.435 1.00 34.23  ? 826  VAL A HA   1 
ATOM   3789  H HB   . VAL A 1 265 ? -8.963  20.473  -36.676 1.00 31.39  ? 826  VAL A HB   1 
ATOM   3790  H HG11 . VAL A 1 265 ? -11.245 20.920  -36.481 1.00 39.86  ? 826  VAL A HG11 1 
ATOM   3791  H HG12 . VAL A 1 265 ? -11.013 19.380  -36.795 1.00 39.86  ? 826  VAL A HG12 1 
ATOM   3792  H HG13 . VAL A 1 265 ? -11.355 19.846  -35.315 1.00 39.86  ? 826  VAL A HG13 1 
ATOM   3793  H HG21 . VAL A 1 265 ? -9.566  22.206  -35.228 1.00 34.64  ? 826  VAL A HG21 1 
ATOM   3794  H HG22 . VAL A 1 265 ? -9.608  21.177  -34.018 1.00 34.64  ? 826  VAL A HG22 1 
ATOM   3795  H HG23 . VAL A 1 265 ? -8.227  21.512  -34.729 1.00 34.64  ? 826  VAL A HG23 1 
ATOM   3796  N N    . LEU A 1 266 ? -8.236  17.532  -37.206 1.00 30.87  ? 827  LEU A N    1 
ATOM   3797  C CA   . LEU A 1 266 ? -8.450  16.424  -38.133 1.00 29.63  ? 827  LEU A CA   1 
ATOM   3798  C C    . LEU A 1 266 ? -8.354  15.077  -37.432 1.00 28.13  ? 827  LEU A C    1 
ATOM   3799  O O    . LEU A 1 266 ? -9.050  14.129  -37.815 1.00 29.66  ? 827  LEU A O    1 
ATOM   3800  C CB   . LEU A 1 266 ? -7.440  16.497  -39.279 1.00 29.02  ? 827  LEU A CB   1 
ATOM   3801  C CG   . LEU A 1 266 ? -7.666  17.595  -40.320 1.00 25.67  ? 827  LEU A CG   1 
ATOM   3802  C CD1  . LEU A 1 266 ? -6.483  17.676  -41.274 1.00 24.03  ? 827  LEU A CD1  1 
ATOM   3803  C CD2  . LEU A 1 266 ? -8.954  17.357  -41.093 1.00 23.15  ? 827  LEU A CD2  1 
ATOM   3804  H H    . LEU A 1 266 ? -7.530  17.998  -37.363 1.00 37.04  ? 827  LEU A H    1 
ATOM   3805  H HA   . LEU A 1 266 ? -9.339  16.500  -38.513 1.00 35.56  ? 827  LEU A HA   1 
ATOM   3806  H HB2  . LEU A 1 266 ? -6.559  16.638  -38.898 1.00 34.82  ? 827  LEU A HB2  1 
ATOM   3807  H HB3  . LEU A 1 266 ? -7.453  15.648  -39.749 1.00 34.82  ? 827  LEU A HB3  1 
ATOM   3808  H HG   . LEU A 1 266 ? -7.743  18.448  -39.866 1.00 30.80  ? 827  LEU A HG   1 
ATOM   3809  H HD11 . LEU A 1 266 ? -6.650  18.377  -41.923 1.00 28.83  ? 827  LEU A HD11 1 
ATOM   3810  H HD12 . LEU A 1 266 ? -5.682  17.877  -40.766 1.00 28.83  ? 827  LEU A HD12 1 
ATOM   3811  H HD13 . LEU A 1 266 ? -6.384  16.823  -41.726 1.00 28.83  ? 827  LEU A HD13 1 
ATOM   3812  H HD21 . LEU A 1 266 ? -9.068  18.068  -41.743 1.00 27.78  ? 827  LEU A HD21 1 
ATOM   3813  H HD22 . LEU A 1 266 ? -8.897  16.501  -41.545 1.00 27.78  ? 827  LEU A HD22 1 
ATOM   3814  H HD23 . LEU A 1 266 ? -9.699  17.354  -40.471 1.00 27.78  ? 827  LEU A HD23 1 
ATOM   3815  N N    . LYS A 1 267 ? -7.506  14.970  -36.408 1.00 34.09  ? 828  LYS A N    1 
ATOM   3816  C CA   . LYS A 1 267 ? -7.353  13.731  -35.658 1.00 29.61  ? 828  LYS A CA   1 
ATOM   3817  C C    . LYS A 1 267 ? -8.452  13.511  -34.627 1.00 27.62  ? 828  LYS A C    1 
ATOM   3818  O O    . LYS A 1 267 ? -8.507  12.431  -34.033 1.00 34.56  ? 828  LYS A O    1 
ATOM   3819  C CB   . LYS A 1 267 ? -6.002  13.717  -34.940 1.00 33.14  ? 828  LYS A CB   1 
ATOM   3820  C CG   . LYS A 1 267 ? -4.790  13.674  -35.852 1.00 40.13  ? 828  LYS A CG   1 
ATOM   3821  C CD   . LYS A 1 267 ? -4.579  12.296  -36.450 1.00 46.07  ? 828  LYS A CD   1 
ATOM   3822  C CE   . LYS A 1 267 ? -3.262  12.229  -37.206 1.00 43.99  ? 828  LYS A CE   1 
ATOM   3823  N NZ   . LYS A 1 267 ? -3.037  10.899  -37.841 1.00 48.70  ? 828  LYS A NZ   1 
ATOM   3824  H H    . LYS A 1 267 ? -7.005  15.611  -36.128 1.00 40.91  ? 828  LYS A H    1 
ATOM   3825  H HA   . LYS A 1 267 ? -7.370  12.985  -36.277 1.00 35.53  ? 828  LYS A HA   1 
ATOM   3826  H HB2  . LYS A 1 267 ? -5.932  14.519  -34.399 1.00 39.76  ? 828  LYS A HB2  1 
ATOM   3827  H HB3  . LYS A 1 267 ? -5.965  12.935  -34.367 1.00 39.76  ? 828  LYS A HB3  1 
ATOM   3828  H HG2  . LYS A 1 267 ? -4.917  14.303  -36.579 1.00 48.15  ? 828  LYS A HG2  1 
ATOM   3829  H HG3  . LYS A 1 267 ? -3.999  13.906  -35.342 1.00 48.15  ? 828  LYS A HG3  1 
ATOM   3830  H HD2  . LYS A 1 267 ? -4.558  11.636  -35.740 1.00 55.28  ? 828  LYS A HD2  1 
ATOM   3831  H HD3  . LYS A 1 267 ? -5.298  12.101  -37.071 1.00 55.28  ? 828  LYS A HD3  1 
ATOM   3832  H HE2  . LYS A 1 267 ? -3.263  12.900  -37.906 1.00 52.78  ? 828  LYS A HE2  1 
ATOM   3833  H HE3  . LYS A 1 267 ? -2.533  12.394  -36.588 1.00 52.78  ? 828  LYS A HE3  1 
ATOM   3834  H HZ1  . LYS A 1 267 ? -2.259  10.896  -38.273 1.00 58.44  ? 828  LYS A HZ1  1 
ATOM   3835  H HZ2  . LYS A 1 267 ? -3.024  10.263  -37.219 1.00 58.44  ? 828  LYS A HZ2  1 
ATOM   3836  H HZ3  . LYS A 1 267 ? -3.690  10.725  -38.420 1.00 58.44  ? 828  LYS A HZ3  1 
ATOM   3837  N N    . HIS A 1 268 ? -9.320  14.492  -34.395 1.00 31.33  ? 829  HIS A N    1 
ATOM   3838  C CA   . HIS A 1 268 ? -10.234 14.410  -33.268 1.00 36.62  ? 829  HIS A CA   1 
ATOM   3839  C C    . HIS A 1 268 ? -11.274 13.311  -33.494 1.00 35.11  ? 829  HIS A C    1 
ATOM   3840  O O    . HIS A 1 268 ? -11.660 13.037  -34.633 1.00 33.31  ? 829  HIS A O    1 
ATOM   3841  C CB   . HIS A 1 268 ? -10.938 15.745  -33.042 1.00 31.17  ? 829  HIS A CB   1 
ATOM   3842  C CG   . HIS A 1 268 ? -11.639 15.835  -31.723 1.00 35.92  ? 829  HIS A CG   1 
ATOM   3843  N ND1  . HIS A 1 268 ? -12.926 15.383  -31.530 1.00 38.83  ? 829  HIS A ND1  1 
ATOM   3844  C CD2  . HIS A 1 268 ? -11.219 16.293  -30.521 1.00 34.38  ? 829  HIS A CD2  1 
ATOM   3845  C CE1  . HIS A 1 268 ? -13.273 15.567  -30.269 1.00 35.00  ? 829  HIS A CE1  1 
ATOM   3846  N NE2  . HIS A 1 268 ? -12.257 16.124  -29.637 1.00 38.04  ? 829  HIS A NE2  1 
ATOM   3847  H H    . HIS A 1 268 ? -9.397  15.205  -34.870 1.00 37.60  ? 829  HIS A H    1 
ATOM   3848  H HA   . HIS A 1 268 ? -9.733  14.192  -32.467 1.00 43.94  ? 829  HIS A HA   1 
ATOM   3849  H HB2  . HIS A 1 268 ? -10.280 16.457  -33.078 1.00 37.40  ? 829  HIS A HB2  1 
ATOM   3850  H HB3  . HIS A 1 268 ? -11.600 15.873  -33.740 1.00 37.40  ? 829  HIS A HB3  1 
ATOM   3851  H HD2  . HIS A 1 268 ? -10.387 16.662  -30.331 1.00 41.26  ? 829  HIS A HD2  1 
ATOM   3852  H HE1  . HIS A 1 268 ? -14.096 15.352  -29.894 1.00 42.00  ? 829  HIS A HE1  1 
ATOM   3853  H HE2  . HIS A 1 268 ? -12.245 16.342  -28.805 1.00 45.64  ? 829  HIS A HE2  1 
ATOM   3854  N N    . PRO A 1 269 ? -11.750 12.671  -32.418 1.00 36.48  ? 830  PRO A N    1 
ATOM   3855  C CA   . PRO A 1 269 ? -12.777 11.627  -32.578 1.00 33.40  ? 830  PRO A CA   1 
ATOM   3856  C C    . PRO A 1 269 ? -14.059 12.107  -33.231 1.00 32.27  ? 830  PRO A C    1 
ATOM   3857  O O    . PRO A 1 269 ? -14.873 11.268  -33.634 1.00 29.18  ? 830  PRO A O    1 
ATOM   3858  C CB   . PRO A 1 269 ? -13.023 11.139  -31.139 1.00 36.34  ? 830  PRO A CB   1 
ATOM   3859  C CG   . PRO A 1 269 ? -12.327 12.119  -30.249 1.00 35.93  ? 830  PRO A CG   1 
ATOM   3860  C CD   . PRO A 1 269 ? -11.200 12.662  -31.053 1.00 35.70  ? 830  PRO A CD   1 
ATOM   3861  H HA   . PRO A 1 269 ? -12.419 10.892  -33.099 1.00 40.08  ? 830  PRO A HA   1 
ATOM   3862  H HB2  . PRO A 1 269 ? -13.976 11.132  -30.957 1.00 43.61  ? 830  PRO A HB2  1 
ATOM   3863  H HB3  . PRO A 1 269 ? -12.648 10.252  -31.028 1.00 43.61  ? 830  PRO A HB3  1 
ATOM   3864  H HG2  . PRO A 1 269 ? -12.941 12.828  -30.001 1.00 43.11  ? 830  PRO A HG2  1 
ATOM   3865  H HG3  . PRO A 1 269 ? -11.995 11.663  -29.460 1.00 43.11  ? 830  PRO A HG3  1 
ATOM   3866  H HD2  . PRO A 1 269 ? -10.981 13.563  -30.768 1.00 42.84  ? 830  PRO A HD2  1 
ATOM   3867  H HD3  . PRO A 1 269 ? -10.430 12.073  -31.000 1.00 42.84  ? 830  PRO A HD3  1 
ATOM   3868  N N    . PHE A 1 270 ? -14.270 13.417  -33.327 1.00 35.07  ? 831  PHE A N    1 
ATOM   3869  C CA   . PHE A 1 270 ? -15.456 13.942  -33.990 1.00 34.44  ? 831  PHE A CA   1 
ATOM   3870  C C    . PHE A 1 270 ? -15.571 13.420  -35.419 1.00 32.24  ? 831  PHE A C    1 
ATOM   3871  O O    . PHE A 1 270 ? -16.684 13.274  -35.938 1.00 31.42  ? 831  PHE A O    1 
ATOM   3872  C CB   . PHE A 1 270 ? -15.408 15.472  -33.961 1.00 36.19  ? 831  PHE A CB   1 
ATOM   3873  C CG   . PHE A 1 270 ? -16.568 16.136  -34.639 1.00 42.75  ? 831  PHE A CG   1 
ATOM   3874  C CD1  . PHE A 1 270 ? -17.849 16.013  -34.129 1.00 44.68  ? 831  PHE A CD1  1 
ATOM   3875  C CD2  . PHE A 1 270 ? -16.373 16.907  -35.773 1.00 41.03  ? 831  PHE A CD2  1 
ATOM   3876  C CE1  . PHE A 1 270 ? -18.916 16.632  -34.749 1.00 45.56  ? 831  PHE A CE1  1 
ATOM   3877  C CE2  . PHE A 1 270 ? -17.437 17.529  -36.397 1.00 40.41  ? 831  PHE A CE2  1 
ATOM   3878  C CZ   . PHE A 1 270 ? -18.710 17.389  -35.885 1.00 40.77  ? 831  PHE A CZ   1 
ATOM   3879  H H    . PHE A 1 270 ? -13.743 14.021  -33.016 1.00 42.08  ? 831  PHE A H    1 
ATOM   3880  H HA   . PHE A 1 270 ? -16.244 13.656  -33.502 1.00 41.33  ? 831  PHE A HA   1 
ATOM   3881  H HB2  . PHE A 1 270 ? -15.399 15.766  -33.037 1.00 43.42  ? 831  PHE A HB2  1 
ATOM   3882  H HB3  . PHE A 1 270 ? -14.598 15.767  -34.406 1.00 43.42  ? 831  PHE A HB3  1 
ATOM   3883  H HD1  . PHE A 1 270 ? -17.993 15.501  -33.366 1.00 53.61  ? 831  PHE A HD1  1 
ATOM   3884  H HD2  . PHE A 1 270 ? -15.517 17.001  -36.123 1.00 49.23  ? 831  PHE A HD2  1 
ATOM   3885  H HE1  . PHE A 1 270 ? -19.774 16.538  -34.402 1.00 54.68  ? 831  PHE A HE1  1 
ATOM   3886  H HE2  . PHE A 1 270 ? -17.296 18.040  -37.162 1.00 48.49  ? 831  PHE A HE2  1 
ATOM   3887  H HZ   . PHE A 1 270 ? -19.428 17.808  -36.302 1.00 48.92  ? 831  PHE A HZ   1 
ATOM   3888  N N    . PHE A 1 271 ? -14.440 13.139  -36.070 1.00 27.55  ? 832  PHE A N    1 
ATOM   3889  C CA   . PHE A 1 271 ? -14.418 12.628  -37.435 1.00 30.45  ? 832  PHE A CA   1 
ATOM   3890  C C    . PHE A 1 271 ? -14.265 11.111  -37.527 1.00 31.19  ? 832  PHE A C    1 
ATOM   3891  O O    . PHE A 1 271 ? -14.254 10.577  -38.640 1.00 23.73  ? 832  PHE A O    1 
ATOM   3892  C CB   . PHE A 1 271 ? -13.295 13.306  -38.227 1.00 30.04  ? 832  PHE A CB   1 
ATOM   3893  C CG   . PHE A 1 271 ? -13.454 14.794  -38.343 1.00 33.88  ? 832  PHE A CG   1 
ATOM   3894  C CD1  . PHE A 1 271 ? -14.541 15.336  -39.008 1.00 32.60  ? 832  PHE A CD1  1 
ATOM   3895  C CD2  . PHE A 1 271 ? -12.519 15.651  -37.791 1.00 32.42  ? 832  PHE A CD2  1 
ATOM   3896  C CE1  . PHE A 1 271 ? -14.694 16.702  -39.116 1.00 33.02  ? 832  PHE A CE1  1 
ATOM   3897  C CE2  . PHE A 1 271 ? -12.666 17.020  -37.898 1.00 39.87  ? 832  PHE A CE2  1 
ATOM   3898  C CZ   . PHE A 1 271 ? -13.755 17.546  -38.563 1.00 34.96  ? 832  PHE A CZ   1 
ATOM   3899  H H    . PHE A 1 271 ? -13.657 13.240  -35.730 1.00 33.06  ? 832  PHE A H    1 
ATOM   3900  H HA   . PHE A 1 271 ? -15.257 12.861  -37.863 1.00 36.54  ? 832  PHE A HA   1 
ATOM   3901  H HB2  . PHE A 1 271 ? -12.450 13.131  -37.783 1.00 36.05  ? 832  PHE A HB2  1 
ATOM   3902  H HB3  . PHE A 1 271 ? -13.278 12.938  -39.124 1.00 36.05  ? 832  PHE A HB3  1 
ATOM   3903  H HD1  . PHE A 1 271 ? -15.178 14.771  -39.383 1.00 39.12  ? 832  PHE A HD1  1 
ATOM   3904  H HD2  . PHE A 1 271 ? -11.783 15.302  -37.342 1.00 38.90  ? 832  PHE A HD2  1 
ATOM   3905  H HE1  . PHE A 1 271 ? -15.428 17.054  -39.565 1.00 39.63  ? 832  PHE A HE1  1 
ATOM   3906  H HE2  . PHE A 1 271 ? -12.032 17.587  -37.523 1.00 47.84  ? 832  PHE A HE2  1 
ATOM   3907  H HZ   . PHE A 1 271 ? -13.856 18.467  -38.636 1.00 41.95  ? 832  PHE A HZ   1 
ATOM   3908  N N    . TRP A 1 272 ? -14.147 10.402  -36.406 1.00 31.29  ? 833  TRP A N    1 
ATOM   3909  C CA   . TRP A 1 272 ? -13.900 8.965   -36.451 1.00 32.48  ? 833  TRP A CA   1 
ATOM   3910  C C    . TRP A 1 272 ? -15.156 8.200   -36.842 1.00 33.17  ? 833  TRP A C    1 
ATOM   3911  O O    . TRP A 1 272 ? -16.262 8.510   -36.387 1.00 32.44  ? 833  TRP A O    1 
ATOM   3912  C CB   . TRP A 1 272 ? -13.416 8.445   -35.098 1.00 36.80  ? 833  TRP A CB   1 
ATOM   3913  C CG   . TRP A 1 272 ? -12.086 8.949   -34.678 1.00 37.05  ? 833  TRP A CG   1 
ATOM   3914  C CD1  . TRP A 1 272 ? -11.282 9.817   -35.356 1.00 34.33  ? 833  TRP A CD1  1 
ATOM   3915  C CD2  . TRP A 1 272 ? -11.399 8.627   -33.464 1.00 36.04  ? 833  TRP A CD2  1 
ATOM   3916  N NE1  . TRP A 1 272 ? -10.135 10.055  -34.638 1.00 35.15  ? 833  TRP A NE1  1 
ATOM   3917  C CE2  . TRP A 1 272 ? -10.184 9.337   -33.472 1.00 35.78  ? 833  TRP A CE2  1 
ATOM   3918  C CE3  . TRP A 1 272 ? -11.699 7.813   -32.368 1.00 38.83  ? 833  TRP A CE3  1 
ATOM   3919  C CZ2  . TRP A 1 272 ? -9.266  9.253   -32.432 1.00 33.50  ? 833  TRP A CZ2  1 
ATOM   3920  C CZ3  . TRP A 1 272 ? -10.785 7.730   -31.336 1.00 34.65  ? 833  TRP A CZ3  1 
ATOM   3921  C CH2  . TRP A 1 272 ? -9.584  8.446   -31.374 1.00 36.26  ? 833  TRP A CH2  1 
ATOM   3922  H H    . TRP A 1 272 ? -14.205 10.728  -35.612 1.00 37.55  ? 833  TRP A H    1 
ATOM   3923  H HA   . TRP A 1 272 ? -13.214 8.779   -37.110 1.00 38.97  ? 833  TRP A HA   1 
ATOM   3924  H HB2  . TRP A 1 272 ? -14.057 8.707   -34.419 1.00 44.15  ? 833  TRP A HB2  1 
ATOM   3925  H HB3  . TRP A 1 272 ? -13.363 7.477   -35.139 1.00 44.15  ? 833  TRP A HB3  1 
ATOM   3926  H HD1  . TRP A 1 272 ? -11.481 10.192  -36.183 1.00 41.19  ? 833  TRP A HD1  1 
ATOM   3927  H HE1  . TRP A 1 272 ? -9.490  10.569  -34.882 1.00 42.18  ? 833  TRP A HE1  1 
ATOM   3928  H HE3  . TRP A 1 272 ? -12.496 7.336   -32.335 1.00 46.60  ? 833  TRP A HE3  1 
ATOM   3929  H HZ2  . TRP A 1 272 ? -8.465  9.725   -32.455 1.00 40.20  ? 833  TRP A HZ2  1 
ATOM   3930  H HZ3  . TRP A 1 272 ? -10.972 7.190   -30.602 1.00 41.57  ? 833  TRP A HZ3  1 
ATOM   3931  H HH2  . TRP A 1 272 ? -8.987  8.369   -30.666 1.00 43.51  ? 833  TRP A HH2  1 
ATOM   3932  N N    . SER A 1 273 ? -14.975 7.181   -37.677 1.00 35.78  ? 834  SER A N    1 
ATOM   3933  C CA   . SER A 1 273 ? -16.037 6.223   -37.927 1.00 40.40  ? 834  SER A CA   1 
ATOM   3934  C C    . SER A 1 273 ? -16.192 5.309   -36.714 1.00 44.24  ? 834  SER A C    1 
ATOM   3935  O O    . SER A 1 273 ? -15.447 5.395   -35.735 1.00 37.22  ? 834  SER A O    1 
ATOM   3936  C CB   . SER A 1 273 ? -15.734 5.411   -39.183 1.00 35.18  ? 834  SER A CB   1 
ATOM   3937  O OG   . SER A 1 273 ? -14.520 4.693   -39.037 1.00 31.95  ? 834  SER A OG   1 
ATOM   3938  H H    . SER A 1 273 ? -14.247 7.025   -38.108 1.00 42.94  ? 834  SER A H    1 
ATOM   3939  H HA   . SER A 1 273 ? -16.873 6.697   -38.063 1.00 48.48  ? 834  SER A HA   1 
ATOM   3940  H HB2  . SER A 1 273 ? -16.457 4.782   -39.334 1.00 42.22  ? 834  SER A HB2  1 
ATOM   3941  H HB3  . SER A 1 273 ? -15.655 6.015   -39.938 1.00 42.22  ? 834  SER A HB3  1 
ATOM   3942  H HG   . SER A 1 273 ? -14.363 4.250   -39.733 1.00 38.34  ? 834  SER A HG   1 
ATOM   3943  N N    . LEU A 1 274 ? -17.163 4.399   -36.788 1.00 49.61  ? 835  LEU A N    1 
ATOM   3944  C CA   . LEU A 1 274 ? -17.402 3.498   -35.666 1.00 43.34  ? 835  LEU A CA   1 
ATOM   3945  C C    . LEU A 1 274 ? -16.287 2.470   -35.522 1.00 43.45  ? 835  LEU A C    1 
ATOM   3946  O O    . LEU A 1 274 ? -15.957 2.074   -34.398 1.00 46.81  ? 835  LEU A O    1 
ATOM   3947  C CB   . LEU A 1 274 ? -18.753 2.807   -35.834 1.00 47.05  ? 835  LEU A CB   1 
ATOM   3948  C CG   . LEU A 1 274 ? -19.943 3.753   -36.033 1.00 44.65  ? 835  LEU A CG   1 
ATOM   3949  C CD1  . LEU A 1 274 ? -21.247 2.972   -36.101 1.00 54.66  ? 835  LEU A CD1  1 
ATOM   3950  C CD2  . LEU A 1 274 ? -20.016 4.815   -34.939 1.00 45.22  ? 835  LEU A CD2  1 
ATOM   3951  H H    . LEU A 1 274 ? -17.686 4.285   -37.461 1.00 59.53  ? 835  LEU A H    1 
ATOM   3952  H HA   . LEU A 1 274 ? -17.433 4.019   -34.848 1.00 52.01  ? 835  LEU A HA   1 
ATOM   3953  H HB2  . LEU A 1 274 ? -18.709 2.226   -36.609 1.00 56.46  ? 835  LEU A HB2  1 
ATOM   3954  H HB3  . LEU A 1 274 ? -18.930 2.278   -35.040 1.00 56.46  ? 835  LEU A HB3  1 
ATOM   3955  H HG   . LEU A 1 274 ? -19.833 4.213   -36.880 1.00 53.58  ? 835  LEU A HG   1 
ATOM   3956  H HD11 . LEU A 1 274 ? -21.981 3.593   -36.227 1.00 65.59  ? 835  LEU A HD11 1 
ATOM   3957  H HD12 . LEU A 1 274 ? -21.205 2.353   -36.847 1.00 65.59  ? 835  LEU A HD12 1 
ATOM   3958  H HD13 . LEU A 1 274 ? -21.365 2.483   -35.271 1.00 65.59  ? 835  LEU A HD13 1 
ATOM   3959  H HD21 . LEU A 1 274 ? -20.781 5.387   -35.105 1.00 54.26  ? 835  LEU A HD21 1 
ATOM   3960  H HD22 . LEU A 1 274 ? -20.112 4.376   -34.079 1.00 54.26  ? 835  LEU A HD22 1 
ATOM   3961  H HD23 . LEU A 1 274 ? -19.200 5.339   -34.953 1.00 54.26  ? 835  LEU A HD23 1 
ATOM   3962  N N    . GLU A 1 275 ? -15.691 2.034   -36.633 1.00 42.09  ? 836  GLU A N    1 
ATOM   3963  C CA   . GLU A 1 275 ? -14.575 1.098   -36.550 1.00 44.32  ? 836  GLU A CA   1 
ATOM   3964  C C    . GLU A 1 275 ? -13.372 1.739   -35.870 1.00 37.60  ? 836  GLU A C    1 
ATOM   3965  O O    . GLU A 1 275 ? -12.689 1.096   -35.064 1.00 35.85  ? 836  GLU A O    1 
ATOM   3966  C CB   . GLU A 1 275 ? -14.197 0.605   -37.946 1.00 44.75  ? 836  GLU A CB   1 
ATOM   3967  C CG   . GLU A 1 275 ? -15.382 0.251   -38.829 1.00 54.65  ? 836  GLU A CG   1 
ATOM   3968  C CD   . GLU A 1 275 ? -14.982 -0.593  -40.023 1.00 60.46  ? 836  GLU A CD   1 
ATOM   3969  O OE1  . GLU A 1 275 ? -13.765 -0.778  -40.242 1.00 56.85  ? 836  GLU A OE1  1 
ATOM   3970  O OE2  . GLU A 1 275 ? -15.882 -1.075  -40.740 1.00 61.08  ? 836  GLU A OE2  1 
ATOM   3971  H H    . GLU A 1 275 ? -15.910 2.263   -37.433 1.00 50.50  ? 836  GLU A H    1 
ATOM   3972  H HA   . GLU A 1 275 ? -14.845 0.330   -36.022 1.00 53.19  ? 836  GLU A HA   1 
ATOM   3973  H HB2  . GLU A 1 275 ? -13.693 1.302   -38.395 1.00 53.70  ? 836  GLU A HB2  1 
ATOM   3974  H HB3  . GLU A 1 275 ? -13.649 -0.190  -37.857 1.00 53.70  ? 836  GLU A HB3  1 
ATOM   3975  H HG2  . GLU A 1 275 ? -16.027 -0.251  -38.307 1.00 65.57  ? 836  GLU A HG2  1 
ATOM   3976  H HG3  . GLU A 1 275 ? -15.786 1.069   -39.160 1.00 65.57  ? 836  GLU A HG3  1 
ATOM   3977  N N    . LYS A 1 276 ? -13.100 3.009   -36.181 1.00 42.04  ? 837  LYS A N    1 
ATOM   3978  C CA   . LYS A 1 276 ? -11.959 3.696   -35.585 1.00 41.40  ? 837  LYS A CA   1 
ATOM   3979  C C    . LYS A 1 276 ? -12.166 3.917   -34.092 1.00 35.54  ? 837  LYS A C    1 
ATOM   3980  O O    . LYS A 1 276 ? -11.218 3.802   -33.305 1.00 30.99  ? 837  LYS A O    1 
ATOM   3981  C CB   . LYS A 1 276 ? -11.725 5.027   -36.298 1.00 35.98  ? 837  LYS A CB   1 
ATOM   3982  C CG   . LYS A 1 276 ? -10.381 5.670   -36.001 1.00 40.64  ? 837  LYS A CG   1 
ATOM   3983  C CD   . LYS A 1 276 ? -10.145 6.881   -36.892 1.00 45.44  ? 837  LYS A CD   1 
ATOM   3984  C CE   . LYS A 1 276 ? -8.841  7.586   -36.556 1.00 46.86  ? 837  LYS A CE   1 
ATOM   3985  N NZ   . LYS A 1 276 ? -7.656  6.718   -36.788 1.00 54.91  ? 837  LYS A NZ   1 
ATOM   3986  H H    . LYS A 1 276 ? -13.557 3.489   -36.730 1.00 50.45  ? 837  LYS A H    1 
ATOM   3987  H HA   . LYS A 1 276 ? -11.165 3.150   -35.700 1.00 49.68  ? 837  LYS A HA   1 
ATOM   3988  H HB2  . LYS A 1 276 ? -11.776 4.879   -37.255 1.00 43.17  ? 837  LYS A HB2  1 
ATOM   3989  H HB3  . LYS A 1 276 ? -12.417 5.650   -36.027 1.00 43.17  ? 837  LYS A HB3  1 
ATOM   3990  H HG2  . LYS A 1 276 ? -10.362 5.963   -35.077 1.00 48.76  ? 837  LYS A HG2  1 
ATOM   3991  H HG3  . LYS A 1 276 ? -9.673  5.028   -36.166 1.00 48.76  ? 837  LYS A HG3  1 
ATOM   3992  H HD2  . LYS A 1 276 ? -10.104 6.593   -37.817 1.00 54.52  ? 837  LYS A HD2  1 
ATOM   3993  H HD3  . LYS A 1 276 ? -10.871 7.513   -36.770 1.00 54.52  ? 837  LYS A HD3  1 
ATOM   3994  H HE2  . LYS A 1 276 ? -8.753  8.373   -37.115 1.00 56.24  ? 837  LYS A HE2  1 
ATOM   3995  H HE3  . LYS A 1 276 ? -8.850  7.840   -35.620 1.00 56.24  ? 837  LYS A HE3  1 
ATOM   3996  H HZ1  . LYS A 1 276 ? -6.911  7.160   -36.582 1.00 65.90  ? 837  LYS A HZ1  1 
ATOM   3997  H HZ2  . LYS A 1 276 ? -7.709  5.988   -36.281 1.00 65.90  ? 837  LYS A HZ2  1 
ATOM   3998  H HZ3  . LYS A 1 276 ? -7.621  6.474   -37.643 1.00 65.90  ? 837  LYS A HZ3  1 
ATOM   3999  N N    . GLN A 1 277 ? -13.394 4.244   -33.684 1.00 37.61  ? 838  GLN A N    1 
ATOM   4000  C CA   . GLN A 1 277 ? -13.698 4.374   -32.262 1.00 38.25  ? 838  GLN A CA   1 
ATOM   4001  C C    . GLN A 1 277 ? -13.473 3.055   -31.536 1.00 39.91  ? 838  GLN A C    1 
ATOM   4002  O O    . GLN A 1 277 ? -12.825 3.014   -30.483 1.00 35.57  ? 838  GLN A O    1 
ATOM   4003  C CB   . GLN A 1 277 ? -15.142 4.837   -32.072 1.00 40.56  ? 838  GLN A CB   1 
ATOM   4004  C CG   . GLN A 1 277 ? -15.431 6.242   -32.567 1.00 36.87  ? 838  GLN A CG   1 
ATOM   4005  C CD   . GLN A 1 277 ? -16.900 6.601   -32.449 1.00 38.10  ? 838  GLN A CD   1 
ATOM   4006  O OE1  . GLN A 1 277 ? -17.617 6.051   -31.613 1.00 43.77  ? 838  GLN A OE1  1 
ATOM   4007  N NE2  . GLN A 1 277 ? -17.357 7.518   -33.291 1.00 37.03  ? 838  GLN A NE2  1 
ATOM   4008  H H    . GLN A 1 277 ? -14.061 4.395   -34.206 1.00 45.13  ? 838  GLN A H    1 
ATOM   4009  H HA   . GLN A 1 277 ? -13.112 5.040   -31.870 1.00 45.90  ? 838  GLN A HA   1 
ATOM   4010  H HB2  . GLN A 1 277 ? -15.727 4.231   -32.552 1.00 48.67  ? 838  GLN A HB2  1 
ATOM   4011  H HB3  . GLN A 1 277 ? -15.352 4.811   -31.125 1.00 48.67  ? 838  GLN A HB3  1 
ATOM   4012  H HG2  . GLN A 1 277 ? -14.922 6.877   -32.039 1.00 44.24  ? 838  GLN A HG2  1 
ATOM   4013  H HG3  . GLN A 1 277 ? -15.179 6.308   -33.502 1.00 44.24  ? 838  GLN A HG3  1 
ATOM   4014  H HE21 . GLN A 1 277 ? -16.827 7.877   -33.866 1.00 44.44  ? 838  GLN A HE21 1 
ATOM   4015  H HE22 . GLN A 1 277 ? -18.183 7.755   -33.262 1.00 44.44  ? 838  GLN A HE22 1 
ATOM   4016  N N    . LEU A 1 278 ? -14.010 1.963   -32.085 1.00 41.00  ? 839  LEU A N    1 
ATOM   4017  C CA   . LEU A 1 278 ? -13.844 0.660   -31.453 1.00 37.93  ? 839  LEU A CA   1 
ATOM   4018  C C    . LEU A 1 278 ? -12.384 0.229   -31.461 1.00 35.27  ? 839  LEU A C    1 
ATOM   4019  O O    . LEU A 1 278 ? -11.902 -0.366  -30.490 1.00 32.35  ? 839  LEU A O    1 
ATOM   4020  C CB   . LEU A 1 278 ? -14.711 -0.379  -32.160 1.00 40.59  ? 839  LEU A CB   1 
ATOM   4021  C CG   . LEU A 1 278 ? -14.739 -1.770  -31.524 1.00 45.80  ? 839  LEU A CG   1 
ATOM   4022  C CD1  . LEU A 1 278 ? -15.343 -1.719  -30.124 1.00 42.40  ? 839  LEU A CD1  1 
ATOM   4023  C CD2  . LEU A 1 278 ? -15.504 -2.743  -32.407 1.00 47.38  ? 839  LEU A CD2  1 
ATOM   4024  H H    . LEU A 1 278 ? -14.470 1.953   -32.812 1.00 49.20  ? 839  LEU A H    1 
ATOM   4025  H HA   . LEU A 1 278 ? -14.135 0.716   -30.529 1.00 45.51  ? 839  LEU A HA   1 
ATOM   4026  H HB2  . LEU A 1 278 ? -15.624 -0.052  -32.181 1.00 48.71  ? 839  LEU A HB2  1 
ATOM   4027  H HB3  . LEU A 1 278 ? -14.385 -0.482  -33.068 1.00 48.71  ? 839  LEU A HB3  1 
ATOM   4028  H HG   . LEU A 1 278 ? -13.829 -2.096  -31.443 1.00 54.96  ? 839  LEU A HG   1 
ATOM   4029  H HD11 . LEU A 1 278 ? -15.347 -2.614  -29.749 1.00 50.88  ? 839  LEU A HD11 1 
ATOM   4030  H HD12 . LEU A 1 278 ? -14.806 -1.130  -29.571 1.00 50.88  ? 839  LEU A HD12 1 
ATOM   4031  H HD13 . LEU A 1 278 ? -16.250 -1.381  -30.184 1.00 50.88  ? 839  LEU A HD13 1 
ATOM   4032  H HD21 . LEU A 1 278 ? -15.509 -3.616  -31.985 1.00 56.86  ? 839  LEU A HD21 1 
ATOM   4033  H HD22 . LEU A 1 278 ? -16.413 -2.422  -32.516 1.00 56.86  ? 839  LEU A HD22 1 
ATOM   4034  H HD23 . LEU A 1 278 ? -15.066 -2.795  -33.271 1.00 56.86  ? 839  LEU A HD23 1 
ATOM   4035  N N    . GLN A 1 279 ? -11.665 0.517   -32.547 1.00 34.41  ? 840  GLN A N    1 
ATOM   4036  C CA   . GLN A 1 279 ? -10.246 0.182   -32.597 1.00 36.57  ? 840  GLN A CA   1 
ATOM   4037  C C    . GLN A 1 279 ? -9.457  1.002   -31.585 1.00 37.79  ? 840  GLN A C    1 
ATOM   4038  O O    . GLN A 1 279 ? -8.509  0.497   -30.972 1.00 35.08  ? 840  GLN A O    1 
ATOM   4039  C CB   . GLN A 1 279 ? -9.704  0.401   -34.009 1.00 28.46  ? 840  GLN A CB   1 
ATOM   4040  C CG   . GLN A 1 279 ? -8.277  -0.089  -34.205 1.00 31.88  ? 840  GLN A CG   1 
ATOM   4041  C CD   . GLN A 1 279 ? -8.144  -1.586  -34.016 1.00 38.19  ? 840  GLN A CD   1 
ATOM   4042  O OE1  . GLN A 1 279 ? -9.086  -2.340  -34.265 1.00 36.81  ? 840  GLN A OE1  1 
ATOM   4043  N NE2  . GLN A 1 279 ? -6.974  -2.024  -33.564 1.00 42.29  ? 840  GLN A NE2  1 
ATOM   4044  H H    . GLN A 1 279 ? -11.970 0.899   -33.255 1.00 41.30  ? 840  GLN A H    1 
ATOM   4045  H HA   . GLN A 1 279 ? -10.135 -0.756  -32.375 1.00 43.88  ? 840  GLN A HA   1 
ATOM   4046  H HB2  . GLN A 1 279 ? -10.269 -0.075  -34.638 1.00 34.15  ? 840  GLN A HB2  1 
ATOM   4047  H HB3  . GLN A 1 279 ? -9.721  1.350   -34.207 1.00 34.15  ? 840  GLN A HB3  1 
ATOM   4048  H HG2  . GLN A 1 279 ? -7.989  0.128   -35.105 1.00 38.25  ? 840  GLN A HG2  1 
ATOM   4049  H HG3  . GLN A 1 279 ? -7.701  0.348   -33.557 1.00 38.25  ? 840  GLN A HG3  1 
ATOM   4050  H HE21 . GLN A 1 279 ? -6.342  -1.466  -33.395 1.00 50.75  ? 840  GLN A HE21 1 
ATOM   4051  H HE22 . GLN A 1 279 ? -6.849  -2.866  -33.440 1.00 50.75  ? 840  GLN A HE22 1 
ATOM   4052  N N    . PHE A 1 280 ? -9.834  2.270   -31.395 1.00 38.21  ? 841  PHE A N    1 
ATOM   4053  C CA   . PHE A 1 280 ? -9.212  3.082   -30.354 1.00 34.70  ? 841  PHE A CA   1 
ATOM   4054  C C    . PHE A 1 280 ? -9.418  2.451   -28.983 1.00 36.55  ? 841  PHE A C    1 
ATOM   4055  O O    . PHE A 1 280 ? -8.473  2.323   -28.197 1.00 34.28  ? 841  PHE A O    1 
ATOM   4056  C CB   . PHE A 1 280 ? -9.779  4.502   -30.387 1.00 33.82  ? 841  PHE A CB   1 
ATOM   4057  C CG   . PHE A 1 280 ? -9.281  5.376   -29.274 1.00 31.74  ? 841  PHE A CG   1 
ATOM   4058  C CD1  . PHE A 1 280 ? -7.946  5.739   -29.201 1.00 30.29  ? 841  PHE A CD1  1 
ATOM   4059  C CD2  . PHE A 1 280 ? -10.150 5.842   -28.303 1.00 29.19  ? 841  PHE A CD2  1 
ATOM   4060  C CE1  . PHE A 1 280 ? -7.488  6.543   -28.175 1.00 31.92  ? 841  PHE A CE1  1 
ATOM   4061  C CE2  . PHE A 1 280 ? -9.697  6.646   -27.277 1.00 31.25  ? 841  PHE A CE2  1 
ATOM   4062  C CZ   . PHE A 1 280 ? -8.366  6.997   -27.213 1.00 29.87  ? 841  PHE A CZ   1 
ATOM   4063  H H    . PHE A 1 280 ? -10.440 2.676   -31.852 1.00 45.85  ? 841  PHE A H    1 
ATOM   4064  H HA   . PHE A 1 280 ? -8.258  3.134   -30.521 1.00 41.64  ? 841  PHE A HA   1 
ATOM   4065  H HB2  . PHE A 1 280 ? -9.529  4.919   -31.226 1.00 40.58  ? 841  PHE A HB2  1 
ATOM   4066  H HB3  . PHE A 1 280 ? -10.745 4.455   -30.317 1.00 40.58  ? 841  PHE A HB3  1 
ATOM   4067  H HD1  . PHE A 1 280 ? -7.350  5.434   -29.846 1.00 36.35  ? 841  PHE A HD1  1 
ATOM   4068  H HD2  . PHE A 1 280 ? -11.049 5.607   -28.340 1.00 35.03  ? 841  PHE A HD2  1 
ATOM   4069  H HE1  . PHE A 1 280 ? -6.590  6.780   -28.134 1.00 38.31  ? 841  PHE A HE1  1 
ATOM   4070  H HE2  . PHE A 1 280 ? -10.291 6.951   -26.629 1.00 37.50  ? 841  PHE A HE2  1 
ATOM   4071  H HZ   . PHE A 1 280 ? -8.060  7.540   -26.523 1.00 35.84  ? 841  PHE A HZ   1 
ATOM   4072  N N    . PHE A 1 281 ? -10.653 2.038   -28.684 1.00 34.46  ? 842  PHE A N    1 
ATOM   4073  C CA   . PHE A 1 281 ? -10.928 1.379   -27.411 1.00 33.58  ? 842  PHE A CA   1 
ATOM   4074  C C    . PHE A 1 281 ? -10.122 0.095   -27.266 1.00 34.19  ? 842  PHE A C    1 
ATOM   4075  O O    . PHE A 1 281 ? -9.650  -0.229  -26.169 1.00 36.43  ? 842  PHE A O    1 
ATOM   4076  C CB   . PHE A 1 281 ? -12.426 1.086   -27.284 1.00 33.44  ? 842  PHE A CB   1 
ATOM   4077  C CG   . PHE A 1 281 ? -13.260 2.283   -26.897 1.00 32.95  ? 842  PHE A CG   1 
ATOM   4078  C CD1  . PHE A 1 281 ? -12.790 3.217   -25.987 1.00 33.22  ? 842  PHE A CD1  1 
ATOM   4079  C CD2  . PHE A 1 281 ? -14.522 2.466   -27.440 1.00 31.67  ? 842  PHE A CD2  1 
ATOM   4080  C CE1  . PHE A 1 281 ? -13.558 4.309   -25.630 1.00 31.69  ? 842  PHE A CE1  1 
ATOM   4081  C CE2  . PHE A 1 281 ? -15.296 3.558   -27.086 1.00 34.98  ? 842  PHE A CE2  1 
ATOM   4082  C CZ   . PHE A 1 281 ? -14.812 4.480   -26.180 1.00 31.07  ? 842  PHE A CZ   1 
ATOM   4083  H H    . PHE A 1 281 ? -11.338 2.126   -29.196 1.00 41.35  ? 842  PHE A H    1 
ATOM   4084  H HA   . PHE A 1 281 ? -10.677 1.974   -26.687 1.00 40.29  ? 842  PHE A HA   1 
ATOM   4085  H HB2  . PHE A 1 281 ? -12.753 0.763   -28.138 1.00 40.12  ? 842  PHE A HB2  1 
ATOM   4086  H HB3  . PHE A 1 281 ? -12.554 0.406   -26.605 1.00 40.12  ? 842  PHE A HB3  1 
ATOM   4087  H HD1  . PHE A 1 281 ? -11.946 3.108   -25.612 1.00 39.87  ? 842  PHE A HD1  1 
ATOM   4088  H HD2  . PHE A 1 281 ? -14.853 1.848   -28.051 1.00 38.01  ? 842  PHE A HD2  1 
ATOM   4089  H HE1  . PHE A 1 281 ? -13.229 4.929   -25.020 1.00 38.02  ? 842  PHE A HE1  1 
ATOM   4090  H HE2  . PHE A 1 281 ? -16.141 3.671   -27.459 1.00 41.98  ? 842  PHE A HE2  1 
ATOM   4091  H HZ   . PHE A 1 281 ? -15.329 5.215   -25.941 1.00 37.29  ? 842  PHE A HZ   1 
ATOM   4092  N N    . GLN A 1 282 ? -9.955  -0.652  -28.360 1.00 36.13  ? 843  GLN A N    1 
ATOM   4093  C CA   . GLN A 1 282 ? -9.155  -1.871  -28.306 1.00 40.03  ? 843  GLN A CA   1 
ATOM   4094  C C    . GLN A 1 282 ? -7.697  -1.555  -27.996 1.00 39.94  ? 843  GLN A C    1 
ATOM   4095  O O    . GLN A 1 282 ? -7.095  -2.157  -27.099 1.00 41.49  ? 843  GLN A O    1 
ATOM   4096  C CB   . GLN A 1 282 ? -9.266  -2.638  -29.625 1.00 40.38  ? 843  GLN A CB   1 
ATOM   4097  C CG   . GLN A 1 282 ? -8.177  -3.694  -29.810 1.00 46.49  ? 843  GLN A CG   1 
ATOM   4098  C CD   . GLN A 1 282 ? -8.400  -4.578  -31.021 1.00 46.37  ? 843  GLN A CD   1 
ATOM   4099  O OE1  . GLN A 1 282 ? -9.501  -4.645  -31.564 1.00 38.74  ? 843  GLN A OE1  1 
ATOM   4100  N NE2  . GLN A 1 282 ? -7.348  -5.264  -31.453 1.00 60.06  ? 843  GLN A NE2  1 
ATOM   4101  H H    . GLN A 1 282 ? -10.291 -0.477  -29.132 1.00 43.35  ? 843  GLN A H    1 
ATOM   4102  H HA   . GLN A 1 282 ? -9.494  -2.441  -27.598 1.00 48.04  ? 843  GLN A HA   1 
ATOM   4103  H HB2  . GLN A 1 282 ? -10.125 -3.087  -29.654 1.00 48.45  ? 843  GLN A HB2  1 
ATOM   4104  H HB3  . GLN A 1 282 ? -9.198  -2.008  -30.359 1.00 48.45  ? 843  GLN A HB3  1 
ATOM   4105  H HG2  . GLN A 1 282 ? -7.322  -3.249  -29.920 1.00 55.79  ? 843  GLN A HG2  1 
ATOM   4106  H HG3  . GLN A 1 282 ? -8.154  -4.264  -29.026 1.00 55.79  ? 843  GLN A HG3  1 
ATOM   4107  H HE21 . GLN A 1 282 ? -6.592  -5.192  -31.048 1.00 72.07  ? 843  GLN A HE21 1 
ATOM   4108  H HE22 . GLN A 1 282 ? -7.422  -5.780  -32.137 1.00 72.07  ? 843  GLN A HE22 1 
ATOM   4109  N N    . ASP A 1 283 ? -7.110  -0.611  -28.736 1.00 34.84  ? 844  ASP A N    1 
ATOM   4110  C CA   . ASP A 1 283 ? -5.700  -0.291  -28.541 1.00 36.30  ? 844  ASP A CA   1 
ATOM   4111  C C    . ASP A 1 283 ? -5.447  0.328   -27.173 1.00 38.90  ? 844  ASP A C    1 
ATOM   4112  O O    . ASP A 1 283 ? -4.388  0.095   -26.579 1.00 40.69  ? 844  ASP A O    1 
ATOM   4113  C CB   . ASP A 1 283 ? -5.220  0.646   -29.649 1.00 44.17  ? 844  ASP A CB   1 
ATOM   4114  C CG   . ASP A 1 283 ? -5.374  0.039   -31.030 1.00 46.46  ? 844  ASP A CG   1 
ATOM   4115  O OD1  . ASP A 1 283 ? -5.422  -1.205  -31.132 1.00 47.29  ? 844  ASP A OD1  1 
ATOM   4116  O OD2  . ASP A 1 283 ? -5.447  0.803   -32.015 1.00 48.41  ? 844  ASP A OD2  1 
ATOM   4117  H H    . ASP A 1 283 ? -7.501  -0.150  -29.347 1.00 41.81  ? 844  ASP A H    1 
ATOM   4118  H HA   . ASP A 1 283 ? -5.182  -1.109  -28.598 1.00 43.56  ? 844  ASP A HA   1 
ATOM   4119  H HB2  . ASP A 1 283 ? -5.740  1.464   -29.620 1.00 53.01  ? 844  ASP A HB2  1 
ATOM   4120  H HB3  . ASP A 1 283 ? -4.280  0.844   -29.511 1.00 53.01  ? 844  ASP A HB3  1 
ATOM   4121  N N    . VAL A 1 284 ? -6.394  1.117   -26.661 1.00 38.96  ? 845  VAL A N    1 
ATOM   4122  C CA   . VAL A 1 284 ? -6.273  1.637   -25.301 1.00 41.85  ? 845  VAL A CA   1 
ATOM   4123  C C    . VAL A 1 284 ? -6.262  0.488   -24.303 1.00 37.84  ? 845  VAL A C    1 
ATOM   4124  O O    . VAL A 1 284 ? -5.383  0.400   -23.439 1.00 39.22  ? 845  VAL A O    1 
ATOM   4125  C CB   . VAL A 1 284 ? -7.412  2.631   -25.002 1.00 39.49  ? 845  VAL A CB   1 
ATOM   4126  C CG1  . VAL A 1 284 ? -7.504  2.934   -23.505 1.00 39.83  ? 845  VAL A CG1  1 
ATOM   4127  C CG2  . VAL A 1 284 ? -7.211  3.919   -25.783 1.00 44.05  ? 845  VAL A CG2  1 
ATOM   4128  H H    . VAL A 1 284 ? -7.106  1.363   -27.076 1.00 46.75  ? 845  VAL A H    1 
ATOM   4129  H HA   . VAL A 1 284 ? -5.431  2.113   -25.219 1.00 50.22  ? 845  VAL A HA   1 
ATOM   4130  H HB   . VAL A 1 284 ? -8.254  2.239   -25.281 1.00 47.38  ? 845  VAL A HB   1 
ATOM   4131  H HG11 . VAL A 1 284 ? -8.229  3.560   -23.354 1.00 47.80  ? 845  VAL A HG11 1 
ATOM   4132  H HG12 . VAL A 1 284 ? -7.675  2.108   -23.026 1.00 47.80  ? 845  VAL A HG12 1 
ATOM   4133  H HG13 . VAL A 1 284 ? -6.665  3.321   -23.209 1.00 47.80  ? 845  VAL A HG13 1 
ATOM   4134  H HG21 . VAL A 1 284 ? -7.938  4.528   -25.580 1.00 52.86  ? 845  VAL A HG21 1 
ATOM   4135  H HG22 . VAL A 1 284 ? -6.365  4.316   -25.525 1.00 52.86  ? 845  VAL A HG22 1 
ATOM   4136  H HG23 . VAL A 1 284 ? -7.206  3.715   -26.732 1.00 52.86  ? 845  VAL A HG23 1 
ATOM   4137  N N    . SER A 1 285 ? -7.244  -0.410  -24.410 1.00 38.37  ? 846  SER A N    1 
ATOM   4138  C CA   . SER A 1 285 ? -7.340  -1.533  -23.481 1.00 38.63  ? 846  SER A CA   1 
ATOM   4139  C C    . SER A 1 285 ? -6.093  -2.409  -23.534 1.00 41.63  ? 846  SER A C    1 
ATOM   4140  O O    . SER A 1 285 ? -5.560  -2.803  -22.491 1.00 45.62  ? 846  SER A O    1 
ATOM   4141  C CB   . SER A 1 285 ? -8.590  -2.358  -23.790 1.00 34.82  ? 846  SER A CB   1 
ATOM   4142  O OG   . SER A 1 285 ? -8.669  -3.503  -22.961 1.00 36.80  ? 846  SER A OG   1 
ATOM   4143  H H    . SER A 1 285 ? -7.863  -0.390  -25.007 1.00 46.04  ? 846  SER A H    1 
ATOM   4144  H HA   . SER A 1 285 ? -7.424  -1.188  -22.579 1.00 46.36  ? 846  SER A HA   1 
ATOM   4145  H HB2  . SER A 1 285 ? -9.374  -1.807  -23.641 1.00 41.79  ? 846  SER A HB2  1 
ATOM   4146  H HB3  . SER A 1 285 ? -8.557  -2.642  -24.717 1.00 41.79  ? 846  SER A HB3  1 
ATOM   4147  H HG   . SER A 1 285 ? -7.996  -3.991  -23.081 1.00 44.16  ? 846  SER A HG   1 
ATOM   4148  N N    . ASP A 1 286 ? -5.613  -2.726  -24.739 1.00 42.04  ? 847  ASP A N    1 
ATOM   4149  C CA   . ASP A 1 286 ? -4.392  -3.517  -24.858 1.00 42.53  ? 847  ASP A CA   1 
ATOM   4150  C C    . ASP A 1 286 ? -3.178  -2.755  -24.346 1.00 44.03  ? 847  ASP A C    1 
ATOM   4151  O O    . ASP A 1 286 ? -2.225  -3.369  -23.851 1.00 50.45  ? 847  ASP A O    1 
ATOM   4152  C CB   . ASP A 1 286 ? -4.168  -3.933  -26.312 1.00 46.99  ? 847  ASP A CB   1 
ATOM   4153  C CG   . ASP A 1 286 ? -5.172  -4.965  -26.787 1.00 51.05  ? 847  ASP A CG   1 
ATOM   4154  O OD1  . ASP A 1 286 ? -5.832  -5.600  -25.939 1.00 58.09  ? 847  ASP A OD1  1 
ATOM   4155  O OD2  . ASP A 1 286 ? -5.296  -5.149  -28.017 1.00 53.00  ? 847  ASP A OD2  1 
ATOM   4156  H H    . ASP A 1 286 ? -5.969  -2.499  -25.488 1.00 50.45  ? 847  ASP A H    1 
ATOM   4157  H HA   . ASP A 1 286 ? -4.485  -4.323  -24.327 1.00 51.03  ? 847  ASP A HA   1 
ATOM   4158  H HB2  . ASP A 1 286 ? -4.250  -3.151  -26.881 1.00 56.39  ? 847  ASP A HB2  1 
ATOM   4159  H HB3  . ASP A 1 286 ? -3.281  -4.316  -26.399 1.00 56.39  ? 847  ASP A HB3  1 
ATOM   4160  N N    . ARG A 1 287 ? -3.191  -1.426  -24.456 1.00 47.74  ? 848  ARG A N    1 
ATOM   4161  C CA   . ARG A 1 287 ? -2.054  -0.636  -23.997 1.00 48.28  ? 848  ARG A CA   1 
ATOM   4162  C C    . ARG A 1 287 ? -1.970  -0.613  -22.476 1.00 47.49  ? 848  ARG A C    1 
ATOM   4163  O O    . ARG A 1 287 ? -0.871  -0.647  -21.910 1.00 48.03  ? 848  ARG A O    1 
ATOM   4164  C CB   . ARG A 1 287 ? -2.152  0.787   -24.548 1.00 48.29  ? 848  ARG A CB   1 
ATOM   4165  C CG   . ARG A 1 287 ? -1.097  1.743   -24.008 1.00 47.18  ? 848  ARG A CG   1 
ATOM   4166  C CD   . ARG A 1 287 ? 0.312   1.269   -24.326 1.00 45.96  ? 848  ARG A CD   1 
ATOM   4167  N NE   . ARG A 1 287 ? 1.322   2.224   -23.879 1.00 52.65  ? 848  ARG A NE   1 
ATOM   4168  C CZ   . ARG A 1 287 ? 1.822   2.272   -22.646 1.00 60.24  ? 848  ARG A CZ   1 
ATOM   4169  N NH1  . ARG A 1 287 ? 1.411   1.418   -21.717 1.00 57.38  ? 848  ARG A NH1  1 
ATOM   4170  N NH2  . ARG A 1 287 ? 2.738   3.181   -22.339 1.00 56.07  ? 848  ARG A NH2  1 
ATOM   4171  H H    . ARG A 1 287 ? -3.837  -0.965  -24.788 1.00 57.28  ? 848  ARG A H    1 
ATOM   4172  H HA   . ARG A 1 287 ? -1.237  -1.033  -24.336 1.00 57.93  ? 848  ARG A HA   1 
ATOM   4173  H HB2  . ARG A 1 287 ? -2.054  0.754   -25.512 1.00 57.94  ? 848  ARG A HB2  1 
ATOM   4174  H HB3  . ARG A 1 287 ? -3.022  1.149   -24.320 1.00 57.94  ? 848  ARG A HB3  1 
ATOM   4175  H HG2  . ARG A 1 287 ? -1.221  2.616   -24.413 1.00 56.62  ? 848  ARG A HG2  1 
ATOM   4176  H HG3  . ARG A 1 287 ? -1.186  1.805   -23.044 1.00 56.62  ? 848  ARG A HG3  1 
ATOM   4177  H HD2  . ARG A 1 287 ? 0.473   0.424   -23.877 1.00 55.15  ? 848  ARG A HD2  1 
ATOM   4178  H HD3  . ARG A 1 287 ? 0.403   1.159   -25.286 1.00 55.15  ? 848  ARG A HD3  1 
ATOM   4179  H HE   . ARG A 1 287 ? 1.614   2.795   -24.451 1.00 63.18  ? 848  ARG A HE   1 
ATOM   4180  H HH11 . ARG A 1 287 ? 0.818   0.826   -21.910 1.00 68.86  ? 848  ARG A HH11 1 
ATOM   4181  H HH12 . ARG A 1 287 ? 1.739   1.456   -20.923 1.00 68.86  ? 848  ARG A HH12 1 
ATOM   4182  H HH21 . ARG A 1 287 ? 3.008   3.737   -22.937 1.00 67.28  ? 848  ARG A HH21 1 
ATOM   4183  H HH22 . ARG A 1 287 ? 3.062   3.213   -21.543 1.00 67.28  ? 848  ARG A HH22 1 
ATOM   4184  N N    . ILE A 1 288 ? -3.122  -0.561  -21.795 1.00 45.88  ? 849  ILE A N    1 
ATOM   4185  C CA   . ILE A 1 288 ? -3.146  -0.397  -20.344 1.00 50.22  ? 849  ILE A CA   1 
ATOM   4186  C C    . ILE A 1 288 ? -3.214  -1.723  -19.600 1.00 58.67  ? 849  ILE A C    1 
ATOM   4187  O O    . ILE A 1 288 ? -3.228  -1.722  -18.361 1.00 60.11  ? 849  ILE A O    1 
ATOM   4188  C CB   . ILE A 1 288 ? -4.332  0.494   -19.909 1.00 44.23  ? 849  ILE A CB   1 
ATOM   4189  C CG1  . ILE A 1 288 ? -5.667  -0.175  -20.256 1.00 41.67  ? 849  ILE A CG1  1 
ATOM   4190  C CG2  . ILE A 1 288 ? -4.200  1.877   -20.539 1.00 47.29  ? 849  ILE A CG2  1 
ATOM   4191  C CD1  . ILE A 1 288 ? -6.894  0.656   -19.925 1.00 38.37  ? 849  ILE A CD1  1 
ATOM   4192  H H    . ILE A 1 288 ? -3.901  -0.619  -22.154 1.00 55.06  ? 849  ILE A H    1 
ATOM   4193  H HA   . ILE A 1 288 ? -2.330  0.050   -20.071 1.00 60.27  ? 849  ILE A HA   1 
ATOM   4194  H HB   . ILE A 1 288 ? -4.291  0.599   -18.946 1.00 53.08  ? 849  ILE A HB   1 
ATOM   4195  H HG12 . ILE A 1 288 ? -5.684  -0.357  -21.209 1.00 50.01  ? 849  ILE A HG12 1 
ATOM   4196  H HG13 . ILE A 1 288 ? -5.734  -1.007  -19.763 1.00 50.01  ? 849  ILE A HG13 1 
ATOM   4197  H HG21 . ILE A 1 288 ? -4.950  2.424   -20.257 1.00 56.75  ? 849  ILE A HG21 1 
ATOM   4198  H HG22 . ILE A 1 288 ? -3.368  2.279   -20.245 1.00 56.75  ? 849  ILE A HG22 1 
ATOM   4199  H HG23 . ILE A 1 288 ? -4.201  1.785   -21.504 1.00 56.75  ? 849  ILE A HG23 1 
ATOM   4200  H HD11 . ILE A 1 288 ? -7.688  0.160   -20.175 1.00 46.05  ? 849  ILE A HD11 1 
ATOM   4201  H HD12 . ILE A 1 288 ? -6.903  0.838   -18.972 1.00 46.05  ? 849  ILE A HD12 1 
ATOM   4202  H HD13 . ILE A 1 288 ? -6.853  1.489   -20.420 1.00 46.05  ? 849  ILE A HD13 1 
ATOM   4203  N N    . GLU A 1 289 ? -3.261  -2.851  -20.309 1.00 61.02  ? 850  GLU A N    1 
ATOM   4204  C CA   . GLU A 1 289 ? -3.252  -4.161  -19.658 1.00 65.80  ? 850  GLU A CA   1 
ATOM   4205  C C    . GLU A 1 289 ? -2.002  -4.963  -20.031 1.00 75.95  ? 850  GLU A C    1 
ATOM   4206  O O    . GLU A 1 289 ? -1.806  -5.242  -21.208 1.00 83.80  ? 850  GLU A O    1 
ATOM   4207  C CB   . GLU A 1 289 ? -4.498  -4.965  -20.021 1.00 68.52  ? 850  GLU A CB   1 
ATOM   4208  C CG   . GLU A 1 289 ? -4.598  -6.280  -19.254 1.00 68.24  ? 850  GLU A CG   1 
ATOM   4209  C CD   . GLU A 1 289 ? -5.885  -7.032  -19.521 1.00 69.42  ? 850  GLU A CD   1 
ATOM   4210  O OE1  . GLU A 1 289 ? -6.622  -6.639  -20.447 1.00 70.34  ? 850  GLU A OE1  1 
ATOM   4211  O OE2  . GLU A 1 289 ? -6.161  -8.016  -18.798 1.00 65.46  ? 850  GLU A OE2  1 
ATOM   4212  H H    . GLU A 1 289 ? -3.299  -2.884  -21.167 1.00 73.22  ? 850  GLU A H    1 
ATOM   4213  H HA   . GLU A 1 289 ? -3.248  -4.034  -18.697 1.00 78.97  ? 850  GLU A HA   1 
ATOM   4214  H HB2  . GLU A 1 289 ? -5.285  -4.437  -19.814 1.00 82.23  ? 850  GLU A HB2  1 
ATOM   4215  H HB3  . GLU A 1 289 ? -4.477  -5.171  -20.968 1.00 82.23  ? 850  GLU A HB3  1 
ATOM   4216  H HG2  . GLU A 1 289 ? -3.859  -6.852  -19.513 1.00 81.88  ? 850  GLU A HG2  1 
ATOM   4217  H HG3  . GLU A 1 289 ? -4.553  -6.093  -18.303 1.00 81.88  ? 850  GLU A HG3  1 
ATOM   4218  N N    . LYS A 1 290 ? -1.143  -5.340  -19.078 1.00 74.07  ? 851  LYS A N    1 
ATOM   4219  C CA   . LYS A 1 290 ? -1.256  -5.009  -17.662 1.00 71.29  ? 851  LYS A CA   1 
ATOM   4220  C C    . LYS A 1 290 ? -0.303  -3.885  -17.295 1.00 73.62  ? 851  LYS A C    1 
ATOM   4221  O O    . LYS A 1 290 ? 0.909   -4.087  -17.248 1.00 75.39  ? 851  LYS A O    1 
ATOM   4222  C CB   . LYS A 1 290 ? -0.964  -6.242  -16.800 1.00 78.18  ? 851  LYS A CB   1 
ATOM   4223  H H    . LYS A 1 290 ? -0.447  -5.816  -19.246 1.00 88.88  ? 851  LYS A H    1 
ATOM   4224  H HA   . LYS A 1 290 ? -2.161  -4.714  -17.474 1.00 85.55  ? 851  LYS A HA   1 
ATOM   4225  N N    . GLU A 1 291 ? -0.857  -2.702  -17.036 1.00 71.42  ? 852  GLU A N    1 
ATOM   4226  C CA   . GLU A 1 291 ? -0.101  -1.617  -16.438 1.00 69.08  ? 852  GLU A CA   1 
ATOM   4227  C C    . GLU A 1 291 ? -0.300  -1.654  -14.926 1.00 73.57  ? 852  GLU A C    1 
ATOM   4228  O O    . GLU A 1 291 ? -1.036  -2.487  -14.392 1.00 72.46  ? 852  GLU A O    1 
ATOM   4229  C CB   . GLU A 1 291 ? -0.528  -0.269  -17.023 1.00 69.95  ? 852  GLU A CB   1 
ATOM   4230  C CG   . GLU A 1 291 ? 0.300   0.203   -18.214 1.00 68.54  ? 852  GLU A CG   1 
ATOM   4231  C CD   . GLU A 1 291 ? 1.659   0.750   -17.808 1.00 68.29  ? 852  GLU A CD   1 
ATOM   4232  O OE1  . GLU A 1 291 ? 1.977   1.892   -18.199 1.00 61.72  ? 852  GLU A OE1  1 
ATOM   4233  O OE2  . GLU A 1 291 ? 2.413   0.042   -17.108 1.00 83.75  ? 852  GLU A OE2  1 
ATOM   4234  H H    . GLU A 1 291 ? -1.678  -2.506  -17.201 1.00 85.70  ? 852  GLU A H    1 
ATOM   4235  H HA   . GLU A 1 291 ? 0.843   -1.743  -16.624 1.00 82.90  ? 852  GLU A HA   1 
ATOM   4236  H HB2  . GLU A 1 291 ? -1.450  -0.338  -17.316 1.00 83.94  ? 852  GLU A HB2  1 
ATOM   4237  H HB3  . GLU A 1 291 ? -0.455  0.405   -16.330 1.00 83.94  ? 852  GLU A HB3  1 
ATOM   4238  H HG2  . GLU A 1 291 ? 0.445   -0.544  -18.814 1.00 82.25  ? 852  GLU A HG2  1 
ATOM   4239  H HG3  . GLU A 1 291 ? -0.182  0.909   -18.673 1.00 82.25  ? 852  GLU A HG3  1 
ATOM   4240  N N    . SER A 1 292 ? 0.358   -0.738  -14.225 1.00 71.85  ? 853  SER A N    1 
ATOM   4241  C CA   . SER A 1 292 ? 0.208   -0.627  -12.782 1.00 75.80  ? 853  SER A CA   1 
ATOM   4242  C C    . SER A 1 292 ? -0.964  0.295   -12.475 1.00 75.79  ? 853  SER A C    1 
ATOM   4243  O O    . SER A 1 292 ? -1.031  1.416   -12.990 1.00 73.83  ? 853  SER A O    1 
ATOM   4244  C CB   . SER A 1 292 ? 1.492   -0.094  -12.146 1.00 83.30  ? 853  SER A CB   1 
ATOM   4245  O OG   . SER A 1 292 ? 1.592   1.309   -12.300 1.00 87.83  ? 853  SER A OG   1 
ATOM   4246  H H    . SER A 1 292 ? 0.901   -0.165  -14.565 1.00 86.22  ? 853  SER A H    1 
ATOM   4247  H HA   . SER A 1 292 ? 0.019   -1.501  -12.408 1.00 90.96  ? 853  SER A HA   1 
ATOM   4248  H HB2  . SER A 1 292 ? 1.486   -0.307  -11.200 1.00 99.95  ? 853  SER A HB2  1 
ATOM   4249  H HB3  . SER A 1 292 ? 2.254   -0.514  -12.575 1.00 99.95  ? 853  SER A HB3  1 
ATOM   4250  H HG   . SER A 1 292 ? 2.301   1.587   -11.946 1.00 105.39 ? 853  SER A HG   1 
ATOM   4251  N N    . LEU A 1 293 ? -1.897  -0.186  -11.651 1.00 73.58  ? 854  LEU A N    1 
ATOM   4252  C CA   . LEU A 1 293 ? -3.062  0.618   -11.304 1.00 74.56  ? 854  LEU A CA   1 
ATOM   4253  C C    . LEU A 1 293 ? -2.683  1.857   -10.505 1.00 71.51  ? 854  LEU A C    1 
ATOM   4254  O O    . LEU A 1 293 ? -3.491  2.786   -10.405 1.00 65.53  ? 854  LEU A O    1 
ATOM   4255  C CB   . LEU A 1 293 ? -4.070  -0.230  -10.524 1.00 71.65  ? 854  LEU A CB   1 
ATOM   4256  C CG   . LEU A 1 293 ? -4.530  -1.525  -11.203 1.00 66.74  ? 854  LEU A CG   1 
ATOM   4257  C CD1  . LEU A 1 293 ? -5.776  -2.065  -10.517 1.00 69.39  ? 854  LEU A CD1  1 
ATOM   4258  C CD2  . LEU A 1 293 ? -4.784  -1.335  -12.696 1.00 66.66  ? 854  LEU A CD2  1 
ATOM   4259  H H    . LEU A 1 293 ? -1.877  -0.964  -11.286 1.00 88.30  ? 854  LEU A H    1 
ATOM   4260  H HA   . LEU A 1 293 ? -3.493  0.913   -12.121 1.00 89.47  ? 854  LEU A HA   1 
ATOM   4261  H HB2  . LEU A 1 293 ? -3.670  -0.475  -9.676  1.00 85.98  ? 854  LEU A HB2  1 
ATOM   4262  H HB3  . LEU A 1 293 ? -4.861  0.308   -10.363 1.00 85.98  ? 854  LEU A HB3  1 
ATOM   4263  H HG   . LEU A 1 293 ? -3.831  -2.191  -11.107 1.00 80.09  ? 854  LEU A HG   1 
ATOM   4264  H HD11 . LEU A 1 293 ? -6.052  -2.883  -10.959 1.00 83.27  ? 854  LEU A HD11 1 
ATOM   4265  H HD12 . LEU A 1 293 ? -5.571  -2.245  -9.586  1.00 83.27  ? 854  LEU A HD12 1 
ATOM   4266  H HD13 . LEU A 1 293 ? -6.482  -1.402  -10.577 1.00 83.27  ? 854  LEU A HD13 1 
ATOM   4267  H HD21 . LEU A 1 293 ? -5.072  -2.180  -13.077 1.00 79.99  ? 854  LEU A HD21 1 
ATOM   4268  H HD22 . LEU A 1 293 ? -5.476  -0.665  -12.816 1.00 79.99  ? 854  LEU A HD22 1 
ATOM   4269  H HD23 . LEU A 1 293 ? -3.963  -1.043  -13.121 1.00 79.99  ? 854  LEU A HD23 1 
ATOM   4270  N N    . ASP A 1 294 ? -1.478  1.888   -9.937  1.00 80.27  ? 855  ASP A N    1 
ATOM   4271  C CA   . ASP A 1 294 ? -0.946  3.080   -9.289  1.00 80.83  ? 855  ASP A CA   1 
ATOM   4272  C C    . ASP A 1 294 ? -0.145  3.960   -10.240 1.00 76.30  ? 855  ASP A C    1 
ATOM   4273  O O    . ASP A 1 294 ? 0.267   5.056   -9.844  1.00 77.85  ? 855  ASP A O    1 
ATOM   4274  C CB   . ASP A 1 294 ? -0.063  2.690   -8.094  1.00 83.50  ? 855  ASP A CB   1 
ATOM   4275  C CG   . ASP A 1 294 ? 0.913   1.576   -8.422  1.00 88.75  ? 855  ASP A CG   1 
ATOM   4276  O OD1  . ASP A 1 294 ? 0.534   0.655   -9.172  1.00 86.03  ? 855  ASP A OD1  1 
ATOM   4277  O OD2  . ASP A 1 294 ? 2.058   1.620   -7.925  1.00 98.66  ? 855  ASP A OD2  1 
ATOM   4278  H H    . ASP A 1 294 ? -0.941  1.217   -9.915  1.00 96.32  ? 855  ASP A H    1 
ATOM   4279  H HA   . ASP A 1 294 ? -1.687  3.607   -8.952  1.00 97.00  ? 855  ASP A HA   1 
ATOM   4280  H HB2  . ASP A 1 294 ? 0.449   3.465   -7.814  1.00 100.20 ? 855  ASP A HB2  1 
ATOM   4281  H HB3  . ASP A 1 294 ? -0.631  2.388   -7.368  1.00 100.20 ? 855  ASP A HB3  1 
ATOM   4282  N N    . GLY A 1 295 ? 0.077   3.519   -11.478 1.00 74.12  ? 856  GLY A N    1 
ATOM   4283  C CA   . GLY A 1 295 ? 0.895   4.253   -12.414 1.00 70.35  ? 856  GLY A CA   1 
ATOM   4284  C C    . GLY A 1 295 ? 0.202   5.481   -12.971 1.00 61.49  ? 856  GLY A C    1 
ATOM   4285  O O    . GLY A 1 295 ? -1.008  5.668   -12.807 1.00 61.90  ? 856  GLY A O    1 
ATOM   4286  H H    . GLY A 1 295 ? -0.244  2.787   -11.794 1.00 88.94  ? 856  GLY A H    1 
ATOM   4287  H HA2  . GLY A 1 295 ? 1.712   4.536   -11.974 1.00 84.42  ? 856  GLY A HA2  1 
ATOM   4288  H HA3  . GLY A 1 295 ? 1.132   3.674   -13.156 1.00 84.42  ? 856  GLY A HA3  1 
ATOM   4289  N N    . PRO A 1 296 ? 0.965   6.348   -13.644 1.00 59.93  ? 857  PRO A N    1 
ATOM   4290  C CA   . PRO A 1 296 ? 0.360   7.581   -14.182 1.00 61.29  ? 857  PRO A CA   1 
ATOM   4291  C C    . PRO A 1 296 ? -0.727  7.334   -15.216 1.00 55.13  ? 857  PRO A C    1 
ATOM   4292  O O    . PRO A 1 296 ? -1.753  8.025   -15.199 1.00 54.01  ? 857  PRO A O    1 
ATOM   4293  C CB   . PRO A 1 296 ? 1.563   8.320   -14.789 1.00 57.29  ? 857  PRO A CB   1 
ATOM   4294  C CG   . PRO A 1 296 ? 2.756   7.754   -14.103 1.00 57.88  ? 857  PRO A CG   1 
ATOM   4295  C CD   . PRO A 1 296 ? 2.426   6.324   -13.830 1.00 57.50  ? 857  PRO A CD   1 
ATOM   4296  H HA   . PRO A 1 296 ? -0.006  8.114   -13.459 1.00 73.55  ? 857  PRO A HA   1 
ATOM   4297  H HB2  . PRO A 1 296 ? 1.603   8.150   -15.743 1.00 68.75  ? 857  PRO A HB2  1 
ATOM   4298  H HB3  . PRO A 1 296 ? 1.485   9.271   -14.613 1.00 68.75  ? 857  PRO A HB3  1 
ATOM   4299  H HG2  . PRO A 1 296 ? 3.528   7.821   -14.685 1.00 69.45  ? 857  PRO A HG2  1 
ATOM   4300  H HG3  . PRO A 1 296 ? 2.911   8.232   -13.273 1.00 69.45  ? 857  PRO A HG3  1 
ATOM   4301  H HD2  . PRO A 1 296 ? 2.662   5.771   -14.591 1.00 69.00  ? 857  PRO A HD2  1 
ATOM   4302  H HD3  . PRO A 1 296 ? 2.866   6.023   -13.019 1.00 69.00  ? 857  PRO A HD3  1 
ATOM   4303  N N    . ILE A 1 297 ? -0.528  6.374   -16.123 1.00 48.64  ? 858  ILE A N    1 
ATOM   4304  C CA   . ILE A 1 297 ? -1.486  6.158   -17.209 1.00 52.42  ? 858  ILE A CA   1 
ATOM   4305  C C    . ILE A 1 297 ? -2.842  5.740   -16.649 1.00 48.80  ? 858  ILE A C    1 
ATOM   4306  O O    . ILE A 1 297 ? -3.866  6.385   -16.903 1.00 45.04  ? 858  ILE A O    1 
ATOM   4307  C CB   . ILE A 1 297 ? -0.945  5.114   -18.205 1.00 53.63  ? 858  ILE A CB   1 
ATOM   4308  C CG1  . ILE A 1 297 ? 0.269   5.684   -18.946 1.00 50.46  ? 858  ILE A CG1  1 
ATOM   4309  C CG2  . ILE A 1 297 ? -2.030  4.703   -19.205 1.00 49.89  ? 858  ILE A CG2  1 
ATOM   4310  C CD1  . ILE A 1 297 ? 0.950   4.710   -19.893 1.00 51.55  ? 858  ILE A CD1  1 
ATOM   4311  H H    . ILE A 1 297 ? 0.146   5.840   -16.132 1.00 58.37  ? 858  ILE A H    1 
ATOM   4312  H HA   . ILE A 1 297 ? -1.607  6.991   -17.690 1.00 62.90  ? 858  ILE A HA   1 
ATOM   4313  H HB   . ILE A 1 297 ? -0.666  4.328   -17.710 1.00 64.35  ? 858  ILE A HB   1 
ATOM   4314  H HG12 . ILE A 1 297 ? -0.018  6.449   -19.469 1.00 60.55  ? 858  ILE A HG12 1 
ATOM   4315  H HG13 . ILE A 1 297 ? 0.927   5.965   -18.291 1.00 60.55  ? 858  ILE A HG13 1 
ATOM   4316  H HG21 . ILE A 1 297 ? -1.662  4.048   -19.818 1.00 59.87  ? 858  ILE A HG21 1 
ATOM   4317  H HG22 . ILE A 1 297 ? -2.778  4.320   -18.720 1.00 59.87  ? 858  ILE A HG22 1 
ATOM   4318  H HG23 . ILE A 1 297 ? -2.321  5.488   -19.695 1.00 59.87  ? 858  ILE A HG23 1 
ATOM   4319  H HD11 . ILE A 1 297 ? 1.702   5.154   -20.314 1.00 61.86  ? 858  ILE A HD11 1 
ATOM   4320  H HD12 . ILE A 1 297 ? 1.259   3.942   -19.386 1.00 61.86  ? 858  ILE A HD12 1 
ATOM   4321  H HD13 . ILE A 1 297 ? 0.312   4.427   -20.566 1.00 61.86  ? 858  ILE A HD13 1 
ATOM   4322  N N    . VAL A 1 298 ? -2.867  4.650   -15.879 1.00 53.45  ? 859  VAL A N    1 
ATOM   4323  C CA   . VAL A 1 298 ? -4.138  4.119   -15.394 1.00 55.11  ? 859  VAL A CA   1 
ATOM   4324  C C    . VAL A 1 298 ? -4.748  5.045   -14.349 1.00 52.82  ? 859  VAL A C    1 
ATOM   4325  O O    . VAL A 1 298 ? -5.977  5.144   -14.241 1.00 49.55  ? 859  VAL A O    1 
ATOM   4326  C CB   . VAL A 1 298 ? -3.942  2.697   -14.837 1.00 56.99  ? 859  VAL A CB   1 
ATOM   4327  H H    . VAL A 1 298 ? -2.173  4.208   -15.628 1.00 64.14  ? 859  VAL A H    1 
ATOM   4328  H HA   . VAL A 1 298 ? -4.757  4.063   -16.138 1.00 66.13  ? 859  VAL A HA   1 
ATOM   4329  N N    . LYS A 1 299 ? -3.916  5.734   -13.566 1.00 56.58  ? 860  LYS A N    1 
ATOM   4330  C CA   . LYS A 1 299 ? -4.439  6.720   -12.626 1.00 55.87  ? 860  LYS A CA   1 
ATOM   4331  C C    . LYS A 1 299 ? -5.097  7.877   -13.364 1.00 51.21  ? 860  LYS A C    1 
ATOM   4332  O O    . LYS A 1 299 ? -6.133  8.393   -12.928 1.00 47.43  ? 860  LYS A O    1 
ATOM   4333  C CB   . LYS A 1 299 ? -3.318  7.229   -11.720 1.00 58.09  ? 860  LYS A CB   1 
ATOM   4334  H H    . LYS A 1 299 ? -3.060  5.650   -13.560 1.00 67.89  ? 860  LYS A H    1 
ATOM   4335  H HA   . LYS A 1 299 ? -5.110  6.299   -12.066 1.00 67.05  ? 860  LYS A HA   1 
ATOM   4336  N N    . GLN A 1 300 ? -4.509  8.297   -14.486 1.00 55.01  ? 861  GLN A N    1 
ATOM   4337  C CA   . GLN A 1 300 ? -5.110  9.355   -15.290 1.00 50.71  ? 861  GLN A CA   1 
ATOM   4338  C C    . GLN A 1 300 ? -6.436  8.902   -15.888 1.00 45.42  ? 861  GLN A C    1 
ATOM   4339  O O    . GLN A 1 300 ? -7.380  9.695   -15.992 1.00 42.25  ? 861  GLN A O    1 
ATOM   4340  C CB   . GLN A 1 300 ? -4.140  9.786   -16.391 1.00 53.66  ? 861  GLN A CB   1 
ATOM   4341  C CG   . GLN A 1 300 ? -4.638  10.922  -17.279 1.00 55.90  ? 861  GLN A CG   1 
ATOM   4342  C CD   . GLN A 1 300 ? -4.610  12.269  -16.583 1.00 66.86  ? 861  GLN A CD   1 
ATOM   4343  O OE1  . GLN A 1 300 ? -5.651  12.879  -16.341 1.00 66.20  ? 861  GLN A OE1  1 
ATOM   4344  N NE2  . GLN A 1 300 ? -3.411  12.744  -16.264 1.00 66.71  ? 861  GLN A NE2  1 
ATOM   4345  H H    . GLN A 1 300 ? -3.770  7.988   -14.799 1.00 66.01  ? 861  GLN A H    1 
ATOM   4346  H HA   . GLN A 1 300 ? -5.283  10.124  -14.724 1.00 60.85  ? 861  GLN A HA   1 
ATOM   4347  H HB2  . GLN A 1 300 ? -3.314  10.079  -15.977 1.00 64.39  ? 861  GLN A HB2  1 
ATOM   4348  H HB3  . GLN A 1 300 ? -3.965  9.023   -16.964 1.00 64.39  ? 861  GLN A HB3  1 
ATOM   4349  H HG2  . GLN A 1 300 ? -4.074  10.979  -18.065 1.00 67.08  ? 861  GLN A HG2  1 
ATOM   4350  H HG3  . GLN A 1 300 ? -5.554  10.739  -17.541 1.00 67.08  ? 861  GLN A HG3  1 
ATOM   4351  H HE21 . GLN A 1 300 ? -2.705  12.291  -16.453 1.00 80.05  ? 861  GLN A HE21 1 
ATOM   4352  H HE22 . GLN A 1 300 ? -3.341  13.504  -15.868 1.00 80.05  ? 861  GLN A HE22 1 
ATOM   4353  N N    . LEU A 1 301 ? -6.527  7.630   -16.281 1.00 42.89  ? 862  LEU A N    1 
ATOM   4354  C CA   . LEU A 1 301 ? -7.757  7.125   -16.878 1.00 39.66  ? 862  LEU A CA   1 
ATOM   4355  C C    . LEU A 1 301 ? -8.871  6.999   -15.847 1.00 39.98  ? 862  LEU A C    1 
ATOM   4356  O O    . LEU A 1 301 ? -10.044 7.211   -16.174 1.00 40.10  ? 862  LEU A O    1 
ATOM   4357  C CB   . LEU A 1 301 ? -7.499  5.773   -17.546 1.00 38.73  ? 862  LEU A CB   1 
ATOM   4358  C CG   . LEU A 1 301 ? -8.689  5.107   -18.241 1.00 38.25  ? 862  LEU A CG   1 
ATOM   4359  C CD1  . LEU A 1 301 ? -9.254  5.999   -19.336 1.00 37.52  ? 862  LEU A CD1  1 
ATOM   4360  C CD2  . LEU A 1 301 ? -8.279  3.758   -18.812 1.00 40.13  ? 862  LEU A CD2  1 
ATOM   4361  H H    . LEU A 1 301 ? -5.898  7.048   -16.212 1.00 51.47  ? 862  LEU A H    1 
ATOM   4362  H HA   . LEU A 1 301 ? -8.053  7.745   -17.563 1.00 47.59  ? 862  LEU A HA   1 
ATOM   4363  H HB2  . LEU A 1 301 ? -6.808  5.894   -18.215 1.00 46.48  ? 862  LEU A HB2  1 
ATOM   4364  H HB3  . LEU A 1 301 ? -7.182  5.157   -16.867 1.00 46.48  ? 862  LEU A HB3  1 
ATOM   4365  H HG   . LEU A 1 301 ? -9.391  4.954   -17.588 1.00 45.91  ? 862  LEU A HG   1 
ATOM   4366  H HD11 . LEU A 1 301 ? -10.004 5.549   -19.755 1.00 45.02  ? 862  LEU A HD11 1 
ATOM   4367  H HD12 . LEU A 1 301 ? -9.548  6.835   -18.942 1.00 45.02  ? 862  LEU A HD12 1 
ATOM   4368  H HD13 . LEU A 1 301 ? -8.561  6.169   -19.993 1.00 45.02  ? 862  LEU A HD13 1 
ATOM   4369  H HD21 . LEU A 1 301 ? -9.046  3.353   -19.247 1.00 48.16  ? 862  LEU A HD21 1 
ATOM   4370  H HD22 . LEU A 1 301 ? -7.566  3.892   -19.455 1.00 48.16  ? 862  LEU A HD22 1 
ATOM   4371  H HD23 . LEU A 1 301 ? -7.971  3.190   -18.089 1.00 48.16  ? 862  LEU A HD23 1 
ATOM   4372  N N    . GLU A 1 302 ? -8.531  6.664   -14.605 1.00 42.20  ? 863  GLU A N    1 
ATOM   4373  C CA   . GLU A 1 302 ? -9.526  6.462   -13.560 1.00 44.16  ? 863  GLU A CA   1 
ATOM   4374  C C    . GLU A 1 302 ? -9.855  7.728   -12.781 1.00 40.29  ? 863  GLU A C    1 
ATOM   4375  O O    . GLU A 1 302 ? -10.801 7.711   -11.986 1.00 66.32  ? 863  GLU A O    1 
ATOM   4376  C CB   . GLU A 1 302 ? -9.050  5.388   -12.577 1.00 38.25  ? 863  GLU A CB   1 
ATOM   4377  C CG   . GLU A 1 302 ? -8.905  3.999   -13.178 1.00 32.43  ? 863  GLU A CG   1 
ATOM   4378  C CD   . GLU A 1 302 ? -10.229 3.397   -13.609 1.00 33.88  ? 863  GLU A CD   1 
ATOM   4379  O OE1  . GLU A 1 302 ? -11.289 3.962   -13.264 1.00 30.99  ? 863  GLU A OE1  1 
ATOM   4380  O OE2  . GLU A 1 302 ? -10.209 2.354   -14.295 1.00 35.29  ? 863  GLU A OE2  1 
ATOM   4381  H H    . GLU A 1 302 ? -7.721  6.547   -14.341 1.00 50.64  ? 863  GLU A H    1 
ATOM   4382  H HA   . GLU A 1 302 ? -10.347 6.146   -13.970 1.00 52.99  ? 863  GLU A HA   1 
ATOM   4383  H HB2  . GLU A 1 302 ? -8.183  5.649   -12.228 1.00 45.90  ? 863  GLU A HB2  1 
ATOM   4384  H HB3  . GLU A 1 302 ? -9.689  5.328   -11.850 1.00 45.90  ? 863  GLU A HB3  1 
ATOM   4385  H HG2  . GLU A 1 302 ? -8.333  4.052   -13.959 1.00 38.91  ? 863  GLU A HG2  1 
ATOM   4386  H HG3  . GLU A 1 302 ? -8.510  3.409   -12.517 1.00 38.91  ? 863  GLU A HG3  1 
ATOM   4387  N N    . ARG A 1 303 ? -9.115  8.818   -12.991 1.00 47.30  ? 864  ARG A N    1 
ATOM   4388  C CA   . ARG A 1 303 ? -9.276  10.001  -12.150 1.00 52.21  ? 864  ARG A CA   1 
ATOM   4389  C C    . ARG A 1 303 ? -10.700 10.543  -12.220 1.00 52.75  ? 864  ARG A C    1 
ATOM   4390  O O    . ARG A 1 303 ? -11.388 10.654  -11.199 1.00 67.37  ? 864  ARG A O    1 
ATOM   4391  C CB   . ARG A 1 303 ? -8.268  11.076  -12.559 1.00 59.63  ? 864  ARG A CB   1 
ATOM   4392  C CG   . ARG A 1 303 ? -8.351  12.334  -11.712 1.00 68.41  ? 864  ARG A CG   1 
ATOM   4393  C CD   . ARG A 1 303 ? -7.120  13.216  -11.866 1.00 77.85  ? 864  ARG A CD   1 
ATOM   4394  N NE   . ARG A 1 303 ? -5.903  12.544  -11.411 1.00 96.12  ? 864  ARG A NE   1 
ATOM   4395  C CZ   . ARG A 1 303 ? -4.934  12.085  -12.201 1.00 83.19  ? 864  ARG A CZ   1 
ATOM   4396  N NH1  . ARG A 1 303 ? -5.003  12.222  -13.516 1.00 89.47  ? 864  ARG A NH1  1 
ATOM   4397  N NH2  . ARG A 1 303 ? -3.877  11.489  -11.667 1.00 76.50  ? 864  ARG A NH2  1 
ATOM   4398  H H    . ARG A 1 303 ? -8.519  8.897   -13.606 1.00 56.77  ? 864  ARG A H    1 
ATOM   4399  H HA   . ARG A 1 303 ? -9.095  9.758   -11.228 1.00 62.65  ? 864  ARG A HA   1 
ATOM   4400  H HB2  . ARG A 1 303 ? -7.372  10.716  -12.470 1.00 71.56  ? 864  ARG A HB2  1 
ATOM   4401  H HB3  . ARG A 1 303 ? -8.434  11.326  -13.481 1.00 71.56  ? 864  ARG A HB3  1 
ATOM   4402  H HG2  . ARG A 1 303 ? -9.127  12.849  -11.983 1.00 82.09  ? 864  ARG A HG2  1 
ATOM   4403  H HG3  . ARG A 1 303 ? -8.427  12.084  -10.778 1.00 82.09  ? 864  ARG A HG3  1 
ATOM   4404  H HD2  . ARG A 1 303 ? -7.008  13.444  -12.802 1.00 93.42  ? 864  ARG A HD2  1 
ATOM   4405  H HD3  . ARG A 1 303 ? -7.237  14.020  -11.337 1.00 93.42  ? 864  ARG A HD3  1 
ATOM   4406  H HE   . ARG A 1 303 ? -5.804  12.438  -10.564 1.00 115.35 ? 864  ARG A HE   1 
ATOM   4407  H HH11 . ARG A 1 303 ? -5.684  12.606  -13.874 1.00 107.36 ? 864  ARG A HH11 1 
ATOM   4408  H HH12 . ARG A 1 303 ? -4.369  11.922  -14.014 1.00 107.36 ? 864  ARG A HH12 1 
ATOM   4409  H HH21 . ARG A 1 303 ? -3.821  11.397  -10.813 1.00 91.79  ? 864  ARG A HH21 1 
ATOM   4410  H HH22 . ARG A 1 303 ? -3.248  11.194  -12.173 1.00 91.79  ? 864  ARG A HH22 1 
ATOM   4411  N N    . GLY A 1 304 ? -11.163 10.877  -13.420 1.00 49.99  ? 865  GLY A N    1 
ATOM   4412  C CA   . GLY A 1 304 ? -12.527 11.323  -13.603 1.00 47.43  ? 865  GLY A CA   1 
ATOM   4413  C C    . GLY A 1 304 ? -13.548 10.213  -13.644 1.00 51.34  ? 865  GLY A C    1 
ATOM   4414  O O    . GLY A 1 304 ? -14.716 10.461  -13.952 1.00 45.18  ? 865  GLY A O    1 
ATOM   4415  H H    . GLY A 1 304 ? -10.701 10.851  -14.145 1.00 59.99  ? 865  GLY A H    1 
ATOM   4416  H HA2  . GLY A 1 304 ? -12.763 11.921  -12.877 1.00 56.92  ? 865  GLY A HA2  1 
ATOM   4417  H HA3  . GLY A 1 304 ? -12.588 11.819  -14.434 1.00 56.92  ? 865  GLY A HA3  1 
ATOM   4418  N N    . GLY A 1 305 ? -13.138 8.988   -13.333 1.00 54.16  ? 866  GLY A N    1 
ATOM   4419  C CA   . GLY A 1 305 ? -14.000 7.840   -13.500 1.00 50.47  ? 866  GLY A CA   1 
ATOM   4420  C C    . GLY A 1 305 ? -15.161 7.805   -12.522 1.00 52.53  ? 866  GLY A C    1 
ATOM   4421  O O    . GLY A 1 305 ? -15.253 8.566   -11.558 1.00 67.11  ? 866  GLY A O    1 
ATOM   4422  H H    . GLY A 1 305 ? -12.359 8.801   -13.021 1.00 64.99  ? 866  GLY A H    1 
ATOM   4423  H HA2  . GLY A 1 305 ? -14.362 7.841   -14.400 1.00 60.57  ? 866  GLY A HA2  1 
ATOM   4424  H HA3  . GLY A 1 305 ? -13.479 7.031   -13.382 1.00 60.57  ? 866  GLY A HA3  1 
ATOM   4425  N N    . ARG A 1 306 ? -16.078 6.884   -12.817 1.00 59.44  ? 867  ARG A N    1 
ATOM   4426  C CA   . ARG A 1 306 ? -17.279 6.616   -12.033 1.00 64.28  ? 867  ARG A CA   1 
ATOM   4427  C C    . ARG A 1 306 ? -18.360 7.668   -12.260 1.00 55.66  ? 867  ARG A C    1 
ATOM   4428  O O    . ARG A 1 306 ? -19.533 7.423   -11.958 1.00 61.22  ? 867  ARG A O    1 
ATOM   4429  C CB   . ARG A 1 306 ? -16.934 6.527   -10.543 1.00 66.96  ? 867  ARG A CB   1 
ATOM   4430  H H    . ARG A 1 306 ? -16.018 6.375   -13.507 1.00 71.32  ? 867  ARG A H    1 
ATOM   4431  H HA   . ARG A 1 306 ? -17.641 5.758   -12.303 1.00 77.14  ? 867  ARG A HA   1 
ATOM   4432  N N    . ALA A 1 307 ? -17.990 8.834   -12.798 1.00 53.68  ? 868  ALA A N    1 
ATOM   4433  C CA   . ALA A 1 307 ? -18.972 9.704   -13.437 1.00 55.10  ? 868  ALA A CA   1 
ATOM   4434  C C    . ALA A 1 307 ? -19.226 9.272   -14.875 1.00 50.37  ? 868  ALA A C    1 
ATOM   4435  O O    . ALA A 1 307 ? -20.377 9.228   -15.323 1.00 50.36  ? 868  ALA A O    1 
ATOM   4436  C CB   . ALA A 1 307 ? -18.507 11.159  -13.385 1.00 50.51  ? 868  ALA A CB   1 
ATOM   4437  H H    . ALA A 1 307 ? -17.186 9.138   -12.804 1.00 64.42  ? 868  ALA A H    1 
ATOM   4438  H HA   . ALA A 1 307 ? -19.811 9.641   -12.954 1.00 66.12  ? 868  ALA A HA   1 
ATOM   4439  H HB1  . ALA A 1 307 ? -19.173 11.718  -13.815 1.00 60.61  ? 868  ALA A HB1  1 
ATOM   4440  H HB2  . ALA A 1 307 ? -18.400 11.423  -12.458 1.00 60.61  ? 868  ALA A HB2  1 
ATOM   4441  H HB3  . ALA A 1 307 ? -17.659 11.235  -13.851 1.00 60.61  ? 868  ALA A HB3  1 
ATOM   4442  N N    . VAL A 1 308 ? -18.156 8.950   -15.606 1.00 49.14  ? 869  VAL A N    1 
ATOM   4443  C CA   . VAL A 1 308 ? -18.299 8.397   -16.948 1.00 55.13  ? 869  VAL A CA   1 
ATOM   4444  C C    . VAL A 1 308 ? -18.922 7.013   -16.873 1.00 52.20  ? 869  VAL A C    1 
ATOM   4445  O O    . VAL A 1 308 ? -19.727 6.627   -17.729 1.00 59.04  ? 869  VAL A O    1 
ATOM   4446  C CB   . VAL A 1 308 ? -16.931 8.358   -17.657 1.00 50.21  ? 869  VAL A CB   1 
ATOM   4447  C CG1  . VAL A 1 308 ? -16.273 9.734   -17.655 1.00 47.49  ? 869  VAL A CG1  1 
ATOM   4448  C CG2  . VAL A 1 308 ? -16.007 7.338   -16.999 1.00 54.62  ? 869  VAL A CG2  1 
ATOM   4449  H H    . VAL A 1 308 ? -17.341 9.043   -15.347 1.00 58.97  ? 869  VAL A H    1 
ATOM   4450  H HA   . VAL A 1 308 ? -18.891 8.967   -17.465 1.00 66.16  ? 869  VAL A HA   1 
ATOM   4451  H HB   . VAL A 1 308 ? -17.062 8.091   -18.580 1.00 60.25  ? 869  VAL A HB   1 
ATOM   4452  H HG11 . VAL A 1 308 ? -15.417 9.675   -18.107 1.00 56.99  ? 869  VAL A HG11 1 
ATOM   4453  H HG12 . VAL A 1 308 ? -16.850 10.360  -18.120 1.00 56.99  ? 869  VAL A HG12 1 
ATOM   4454  H HG13 . VAL A 1 308 ? -16.144 10.021  -16.738 1.00 56.99  ? 869  VAL A HG13 1 
ATOM   4455  H HG21 . VAL A 1 308 ? -15.156 7.337   -17.465 1.00 65.54  ? 869  VAL A HG21 1 
ATOM   4456  H HG22 . VAL A 1 308 ? -15.875 7.585   -16.070 1.00 65.54  ? 869  VAL A HG22 1 
ATOM   4457  H HG23 . VAL A 1 308 ? -16.416 6.461   -17.054 1.00 65.54  ? 869  VAL A HG23 1 
ATOM   4458  N N    . VAL A 1 309 ? -18.565 6.253   -15.837 1.00 51.13  ? 870  VAL A N    1 
ATOM   4459  C CA   . VAL A 1 309 ? -19.024 4.877   -15.689 1.00 53.71  ? 870  VAL A CA   1 
ATOM   4460  C C    . VAL A 1 309 ? -20.421 4.785   -15.103 1.00 52.42  ? 870  VAL A C    1 
ATOM   4461  O O    . VAL A 1 309 ? -21.040 3.718   -15.195 1.00 50.81  ? 870  VAL A O    1 
ATOM   4462  C CB   . VAL A 1 309 ? -17.975 4.137   -14.834 1.00 52.22  ? 870  VAL A CB   1 
ATOM   4463  C CG1  . VAL A 1 309 ? -18.494 2.835   -14.288 1.00 49.33  ? 870  VAL A CG1  1 
ATOM   4464  C CG2  . VAL A 1 309 ? -16.720 3.876   -15.648 1.00 47.37  ? 870  VAL A CG2  1 
ATOM   4465  H H    . VAL A 1 309 ? -18.051 6.517   -15.200 1.00 61.36  ? 870  VAL A H    1 
ATOM   4466  H HA   . VAL A 1 309 ? -19.042 4.458   -16.564 1.00 64.45  ? 870  VAL A HA   1 
ATOM   4467  H HB   . VAL A 1 309 ? -17.730 4.698   -14.082 1.00 62.66  ? 870  VAL A HB   1 
ATOM   4468  H HG11 . VAL A 1 309 ? -17.796 2.414   -13.761 1.00 59.20  ? 870  VAL A HG11 1 
ATOM   4469  H HG12 . VAL A 1 309 ? -19.268 3.013   -13.731 1.00 59.20  ? 870  VAL A HG12 1 
ATOM   4470  H HG13 . VAL A 1 309 ? -18.743 2.260   -15.028 1.00 59.20  ? 870  VAL A HG13 1 
ATOM   4471  H HG21 . VAL A 1 309 ? -16.075 3.411   -15.093 1.00 56.84  ? 870  VAL A HG21 1 
ATOM   4472  H HG22 . VAL A 1 309 ? -16.950 3.331   -16.417 1.00 56.84  ? 870  VAL A HG22 1 
ATOM   4473  H HG23 . VAL A 1 309 ? -16.353 4.725   -15.942 1.00 56.84  ? 870  VAL A HG23 1 
ATOM   4474  N N    . LYS A 1 310 ? -20.942 5.872   -14.526 1.00 53.25  ? 871  LYS A N    1 
ATOM   4475  C CA   . LYS A 1 310 ? -22.209 5.896   -13.793 1.00 57.79  ? 871  LYS A CA   1 
ATOM   4476  C C    . LYS A 1 310 ? -22.008 5.266   -12.418 1.00 58.11  ? 871  LYS A C    1 
ATOM   4477  O O    . LYS A 1 310 ? -22.989 5.074   -11.681 1.00 57.86  ? 871  LYS A O    1 
ATOM   4478  C CB   . LYS A 1 310 ? -23.376 5.254   -14.558 1.00 57.52  ? 871  LYS A CB   1 
ATOM   4479  C CG   . LYS A 1 310 ? -23.728 6.074   -15.792 1.00 58.42  ? 871  LYS A CG   1 
ATOM   4480  C CD   . LYS A 1 310 ? -24.729 5.411   -16.710 1.00 58.09  ? 871  LYS A CD   1 
ATOM   4481  C CE   . LYS A 1 310 ? -25.099 6.366   -17.838 1.00 66.33  ? 871  LYS A CE   1 
ATOM   4482  N NZ   . LYS A 1 310 ? -25.874 5.716   -18.929 1.00 56.80  ? 871  LYS A NZ   1 
ATOM   4483  H H    . LYS A 1 310 ? -20.560 6.641   -14.549 1.00 63.90  ? 871  LYS A H    1 
ATOM   4484  H HA   . LYS A 1 310 ? -22.449 6.825   -13.645 1.00 69.34  ? 871  LYS A HA   1 
ATOM   4485  H HB2  . LYS A 1 310 ? -23.123 4.363   -14.844 1.00 69.02  ? 871  LYS A HB2  1 
ATOM   4486  H HB3  . LYS A 1 310 ? -24.157 5.216   -13.983 1.00 69.02  ? 871  LYS A HB3  1 
ATOM   4487  H HG2  . LYS A 1 310 ? -24.104 6.921   -15.507 1.00 70.11  ? 871  LYS A HG2  1 
ATOM   4488  H HG3  . LYS A 1 310 ? -22.918 6.230   -16.303 1.00 70.11  ? 871  LYS A HG3  1 
ATOM   4489  H HD2  . LYS A 1 310 ? -24.338 4.612   -17.097 1.00 69.71  ? 871  LYS A HD2  1 
ATOM   4490  H HD3  . LYS A 1 310 ? -25.533 5.193   -16.213 1.00 69.71  ? 871  LYS A HD3  1 
ATOM   4491  H HE2  . LYS A 1 310 ? -25.640 7.085   -17.476 1.00 79.60  ? 871  LYS A HE2  1 
ATOM   4492  H HE3  . LYS A 1 310 ? -24.286 6.726   -18.224 1.00 79.60  ? 871  LYS A HE3  1 
ATOM   4493  H HZ1  . LYS A 1 310 ? -26.066 6.311   -19.562 1.00 68.16  ? 871  LYS A HZ1  1 
ATOM   4494  H HZ2  . LYS A 1 310 ? -25.398 5.055   -19.288 1.00 68.16  ? 871  LYS A HZ2  1 
ATOM   4495  H HZ3  . LYS A 1 310 ? -26.633 5.382   -18.605 1.00 68.16  ? 871  LYS A HZ3  1 
ATOM   4496  N N    . MET A 1 311 ? -20.778 4.855   -12.101 1.00 59.88  ? 872  MET A N    1 
ATOM   4497  C CA   . MET A 1 311 ? -20.303 4.418   -10.791 1.00 59.24  ? 872  MET A CA   1 
ATOM   4498  C C    . MET A 1 311 ? -20.571 2.952   -10.504 1.00 53.35  ? 872  MET A C    1 
ATOM   4499  O O    . MET A 1 311 ? -19.975 2.389   -9.581  1.00 52.08  ? 872  MET A O    1 
ATOM   4500  C CB   . MET A 1 311 ? -20.930 5.255   -9.674  1.00 60.77  ? 872  MET A CB   1 
ATOM   4501  C CG   . MET A 1 311 ? -19.962 6.145   -8.961  1.00 67.05  ? 872  MET A CG   1 
ATOM   4502  S SD   . MET A 1 311 ? -20.897 7.333   -8.007  1.00 69.29  ? 872  MET A SD   1 
ATOM   4503  C CE   . MET A 1 311 ? -19.597 8.029   -7.015  1.00 82.00  ? 872  MET A CE   1 
ATOM   4504  H H    . MET A 1 311 ? -20.150 4.820   -12.688 1.00 71.85  ? 872  MET A H    1 
ATOM   4505  H HA   . MET A 1 311 ? -19.344 4.563   -10.754 1.00 71.09  ? 872  MET A HA   1 
ATOM   4506  H HB2  . MET A 1 311 ? -21.622 5.817   -10.056 1.00 72.93  ? 872  MET A HB2  1 
ATOM   4507  H HB3  . MET A 1 311 ? -21.320 4.657   -9.017  1.00 72.93  ? 872  MET A HB3  1 
ATOM   4508  H HG2  . MET A 1 311 ? -19.413 5.620   -8.358  1.00 80.46  ? 872  MET A HG2  1 
ATOM   4509  H HG3  . MET A 1 311 ? -19.414 6.620   -9.605  1.00 80.46  ? 872  MET A HG3  1 
ATOM   4510  H HE1  . MET A 1 311 ? -19.973 8.708   -6.433  1.00 98.40  ? 872  MET A HE1  1 
ATOM   4511  H HE2  . MET A 1 311 ? -19.193 7.325   -6.485  1.00 98.40  ? 872  MET A HE2  1 
ATOM   4512  H HE3  . MET A 1 311 ? -18.932 8.426   -7.600  1.00 98.40  ? 872  MET A HE3  1 
ATOM   4513  N N    . ASP A 1 312 ? -21.449 2.319   -11.273 1.00 49.60  ? 873  ASP A N    1 
ATOM   4514  C CA   . ASP A 1 312 ? -21.345 0.893   -11.545 1.00 46.75  ? 873  ASP A CA   1 
ATOM   4515  C C    . ASP A 1 312 ? -21.751 0.708   -12.997 1.00 44.56  ? 873  ASP A C    1 
ATOM   4516  O O    . ASP A 1 312 ? -22.888 1.032   -13.350 1.00 49.38  ? 873  ASP A O    1 
ATOM   4517  C CB   . ASP A 1 312 ? -22.232 0.077   -10.596 1.00 54.01  ? 873  ASP A CB   1 
ATOM   4518  C CG   . ASP A 1 312 ? -21.804 -1.372  -10.500 1.00 51.43  ? 873  ASP A CG   1 
ATOM   4519  O OD1  . ASP A 1 312 ? -21.295 -1.912  -11.504 1.00 47.60  ? 873  ASP A OD1  1 
ATOM   4520  O OD2  . ASP A 1 312 ? -21.977 -1.972  -9.418  1.00 56.29  ? 873  ASP A OD2  1 
ATOM   4521  H H    . ASP A 1 312 ? -22.121 2.698   -11.653 1.00 59.52  ? 873  ASP A H    1 
ATOM   4522  H HA   . ASP A 1 312 ? -20.425 0.604   -11.439 1.00 56.10  ? 873  ASP A HA   1 
ATOM   4523  H HB2  . ASP A 1 312 ? -22.184 0.464   -9.708  1.00 64.81  ? 873  ASP A HB2  1 
ATOM   4524  H HB3  . ASP A 1 312 ? -23.146 0.099   -10.920 1.00 64.81  ? 873  ASP A HB3  1 
ATOM   4525  N N    . TRP A 1 313 ? -20.864 0.165   -13.835 1.00 42.18  ? 874  TRP A N    1 
ATOM   4526  C CA   . TRP A 1 313 ? -21.257 -0.048  -15.224 1.00 46.43  ? 874  TRP A CA   1 
ATOM   4527  C C    . TRP A 1 313 ? -21.875 -1.417  -15.453 1.00 46.22  ? 874  TRP A C    1 
ATOM   4528  O O    . TRP A 1 313 ? -22.421 -1.655  -16.534 1.00 45.62  ? 874  TRP A O    1 
ATOM   4529  C CB   . TRP A 1 313 ? -20.073 0.132   -16.191 1.00 39.31  ? 874  TRP A CB   1 
ATOM   4530  C CG   . TRP A 1 313 ? -18.831 -0.666  -15.919 1.00 37.13  ? 874  TRP A CG   1 
ATOM   4531  C CD1  . TRP A 1 313 ? -17.672 -0.224  -15.341 1.00 34.88  ? 874  TRP A CD1  1 
ATOM   4532  C CD2  . TRP A 1 313 ? -18.611 -2.040  -16.259 1.00 35.81  ? 874  TRP A CD2  1 
ATOM   4533  N NE1  . TRP A 1 313 ? -16.752 -1.247  -15.287 1.00 37.43  ? 874  TRP A NE1  1 
ATOM   4534  C CE2  . TRP A 1 313 ? -17.306 -2.370  -15.844 1.00 37.09  ? 874  TRP A CE2  1 
ATOM   4535  C CE3  . TRP A 1 313 ? -19.395 -3.024  -16.868 1.00 39.66  ? 874  TRP A CE3  1 
ATOM   4536  C CZ2  . TRP A 1 313 ? -16.769 -3.645  -16.015 1.00 41.29  ? 874  TRP A CZ2  1 
ATOM   4537  C CZ3  . TRP A 1 313 ? -18.862 -4.290  -17.037 1.00 39.53  ? 874  TRP A CZ3  1 
ATOM   4538  C CH2  . TRP A 1 313 ? -17.559 -4.588  -16.612 1.00 39.71  ? 874  TRP A CH2  1 
ATOM   4539  H H    . TRP A 1 313 ? -20.064 -0.077  -13.634 1.00 50.61  ? 874  TRP A H    1 
ATOM   4540  H HA   . TRP A 1 313 ? -21.926 0.615   -15.457 1.00 55.72  ? 874  TRP A HA   1 
ATOM   4541  H HB2  . TRP A 1 313 ? -20.375 -0.106  -17.082 1.00 47.17  ? 874  TRP A HB2  1 
ATOM   4542  H HB3  . TRP A 1 313 ? -19.818 1.068   -16.182 1.00 47.17  ? 874  TRP A HB3  1 
ATOM   4543  H HD1  . TRP A 1 313 ? -17.528 0.639   -15.026 1.00 41.85  ? 874  TRP A HD1  1 
ATOM   4544  H HE1  . TRP A 1 313 ? -15.961 -1.191  -14.957 1.00 44.91  ? 874  TRP A HE1  1 
ATOM   4545  H HE3  . TRP A 1 313 ? -20.261 -2.833  -17.151 1.00 47.59  ? 874  TRP A HE3  1 
ATOM   4546  H HZ2  . TRP A 1 313 ? -15.906 -3.846  -15.734 1.00 49.55  ? 874  TRP A HZ2  1 
ATOM   4547  H HZ3  . TRP A 1 313 ? -19.375 -4.953  -17.440 1.00 47.43  ? 874  TRP A HZ3  1 
ATOM   4548  H HH2  . TRP A 1 313 ? -17.225 -5.447  -16.738 1.00 47.65  ? 874  TRP A HH2  1 
ATOM   4549  N N    . ARG A 1 314 ? -21.829 -2.308  -14.462 1.00 49.60  ? 875  ARG A N    1 
ATOM   4550  C CA   . ARG A 1 314 ? -22.502 -3.594  -14.591 1.00 47.19  ? 875  ARG A CA   1 
ATOM   4551  C C    . ARG A 1 314 ? -24.010 -3.454  -14.434 1.00 51.19  ? 875  ARG A C    1 
ATOM   4552  O O    . ARG A 1 314 ? -24.763 -4.259  -14.993 1.00 54.06  ? 875  ARG A O    1 
ATOM   4553  C CB   . ARG A 1 314 ? -21.952 -4.576  -13.558 1.00 56.38  ? 875  ARG A CB   1 
ATOM   4554  C CG   . ARG A 1 314 ? -20.430 -4.623  -13.494 1.00 54.73  ? 875  ARG A CG   1 
ATOM   4555  C CD   . ARG A 1 314 ? -19.958 -5.754  -12.596 1.00 56.15  ? 875  ARG A CD   1 
ATOM   4556  N NE   . ARG A 1 314 ? -20.667 -5.765  -11.318 1.00 66.01  ? 875  ARG A NE   1 
ATOM   4557  C CZ   . ARG A 1 314 ? -20.241 -5.179  -10.201 1.00 65.25  ? 875  ARG A CZ   1 
ATOM   4558  N NH1  . ARG A 1 314 ? -19.090 -4.525  -10.176 1.00 65.70  ? 875  ARG A NH1  1 
ATOM   4559  N NH2  . ARG A 1 314 ? -20.974 -5.253  -9.098  1.00 69.26  ? 875  ARG A NH2  1 
ATOM   4560  H H    . ARG A 1 314 ? -21.420 -2.191  -13.715 1.00 59.52  ? 875  ARG A H    1 
ATOM   4561  H HA   . ARG A 1 314 ? -22.324 -3.955  -15.473 1.00 56.62  ? 875  ARG A HA   1 
ATOM   4562  H HB2  . ARG A 1 314 ? -22.277 -4.321  -12.681 1.00 67.66  ? 875  ARG A HB2  1 
ATOM   4563  H HB3  . ARG A 1 314 ? -22.266 -5.467  -13.778 1.00 67.66  ? 875  ARG A HB3  1 
ATOM   4564  H HG2  . ARG A 1 314 ? -20.075 -4.771  -14.385 1.00 65.68  ? 875  ARG A HG2  1 
ATOM   4565  H HG3  . ARG A 1 314 ? -20.098 -3.786  -13.133 1.00 65.68  ? 875  ARG A HG3  1 
ATOM   4566  H HD2  . ARG A 1 314 ? -20.118 -6.602  -13.039 1.00 67.38  ? 875  ARG A HD2  1 
ATOM   4567  H HD3  . ARG A 1 314 ? -19.011 -5.644  -12.416 1.00 67.38  ? 875  ARG A HD3  1 
ATOM   4568  H HE   . ARG A 1 314 ? -21.418 -6.183  -11.285 1.00 79.21  ? 875  ARG A HE   1 
ATOM   4569  H HH11 . ARG A 1 314 ? -18.609 -4.473  -10.887 1.00 78.84  ? 875  ARG A HH11 1 
ATOM   4570  H HH12 . ARG A 1 314 ? -18.824 -4.151  -9.448  1.00 78.84  ? 875  ARG A HH12 1 
ATOM   4571  H HH21 . ARG A 1 314 ? -21.722 -5.677  -9.106  1.00 83.11  ? 875  ARG A HH21 1 
ATOM   4572  H HH22 . ARG A 1 314 ? -20.700 -4.877  -8.375  1.00 83.11  ? 875  ARG A HH22 1 
ATOM   4573  N N    . GLU A 1 315 ? -24.468 -2.448  -13.685 1.00 54.28  ? 876  GLU A N    1 
ATOM   4574  C CA   . GLU A 1 315 ? -25.896 -2.196  -13.538 1.00 60.44  ? 876  GLU A CA   1 
ATOM   4575  C C    . GLU A 1 315 ? -26.478 -1.431  -14.719 1.00 61.95  ? 876  GLU A C    1 
ATOM   4576  O O    . GLU A 1 315 ? -27.696 -1.469  -14.926 1.00 67.91  ? 876  GLU A O    1 
ATOM   4577  C CB   . GLU A 1 315 ? -26.162 -1.415  -12.248 1.00 63.00  ? 876  GLU A CB   1 
ATOM   4578  C CG   . GLU A 1 315 ? -25.553 -2.037  -10.999 1.00 64.17  ? 876  GLU A CG   1 
ATOM   4579  C CD   . GLU A 1 315 ? -26.107 -3.417  -10.694 1.00 79.08  ? 876  GLU A CD   1 
ATOM   4580  O OE1  . GLU A 1 315 ? -27.202 -3.748  -11.195 1.00 75.48  ? 876  GLU A OE1  1 
ATOM   4581  O OE2  . GLU A 1 315 ? -25.445 -4.172  -9.951  1.00 76.53  ? 876  GLU A OE2  1 
ATOM   4582  H H    . GLU A 1 315 ? -23.968 -1.898  -13.252 1.00 65.13  ? 876  GLU A H    1 
ATOM   4583  H HA   . GLU A 1 315 ? -26.360 -3.045  -13.474 1.00 72.53  ? 876  GLU A HA   1 
ATOM   4584  H HB2  . GLU A 1 315 ? -25.791 -0.523  -12.344 1.00 75.60  ? 876  GLU A HB2  1 
ATOM   4585  H HB3  . GLU A 1 315 ? -27.120 -1.358  -12.112 1.00 75.60  ? 876  GLU A HB3  1 
ATOM   4586  H HG2  . GLU A 1 315 ? -24.594 -2.121  -11.123 1.00 77.00  ? 876  GLU A HG2  1 
ATOM   4587  H HG3  . GLU A 1 315 ? -25.739 -1.465  -10.238 1.00 77.00  ? 876  GLU A HG3  1 
ATOM   4588  N N    . ASN A 1 316 ? -25.640 -0.743  -15.490 1.00 60.83  ? 877  ASN A N    1 
ATOM   4589  C CA   . ASN A 1 316 ? -26.074 0.074   -16.615 1.00 54.88  ? 877  ASN A CA   1 
ATOM   4590  C C    . ASN A 1 316 ? -26.033 -0.672  -17.945 1.00 55.86  ? 877  ASN A C    1 
ATOM   4591  O O    . ASN A 1 316 ? -26.274 -0.059  -18.991 1.00 55.77  ? 877  ASN A O    1 
ATOM   4592  C CB   . ASN A 1 316 ? -25.228 1.345   -16.685 1.00 51.57  ? 877  ASN A CB   1 
ATOM   4593  C CG   . ASN A 1 316 ? -25.516 2.289   -15.535 1.00 54.03  ? 877  ASN A CG   1 
ATOM   4594  O OD1  . ASN A 1 316 ? -24.662 2.529   -14.688 1.00 52.52  ? 877  ASN A OD1  1 
ATOM   4595  N ND2  . ASN A 1 316 ? -26.731 2.818   -15.494 1.00 53.16  ? 877  ASN A ND2  1 
ATOM   4596  H H    . ASN A 1 316 ? -24.788 -0.735  -15.375 1.00 72.99  ? 877  ASN A H    1 
ATOM   4597  H HA   . ASN A 1 316 ? -26.993 0.343   -16.461 1.00 65.86  ? 877  ASN A HA   1 
ATOM   4598  H HB2  . ASN A 1 316 ? -24.289 1.105   -16.650 1.00 61.88  ? 877  ASN A HB2  1 
ATOM   4599  H HB3  . ASN A 1 316 ? -25.423 1.811   -17.513 1.00 61.88  ? 877  ASN A HB3  1 
ATOM   4600  H HD21 . ASN A 1 316 ? -26.943 3.360   -14.860 1.00 63.80  ? 877  ASN A HD21 1 
ATOM   4601  H HD22 . ASN A 1 316 ? -27.308 2.619   -16.100 1.00 63.80  ? 877  ASN A HD22 1 
ATOM   4602  N N    . ILE A 1 317 ? -25.735 -1.969  -17.929 1.00 55.25  ? 878  ILE A N    1 
ATOM   4603  C CA   . ILE A 1 317 ? -25.643 -2.772  -19.141 1.00 58.94  ? 878  ILE A CA   1 
ATOM   4604  C C    . ILE A 1 317 ? -26.776 -3.790  -19.144 1.00 58.34  ? 878  ILE A C    1 
ATOM   4605  O O    . ILE A 1 317 ? -27.316 -4.172  -18.101 1.00 58.33  ? 878  ILE A O    1 
ATOM   4606  C CB   . ILE A 1 317 ? -24.279 -3.484  -19.272 1.00 58.65  ? 878  ILE A CB   1 
ATOM   4607  C CG1  . ILE A 1 317 ? -23.974 -4.316  -18.024 1.00 57.08  ? 878  ILE A CG1  1 
ATOM   4608  C CG2  . ILE A 1 317 ? -23.177 -2.468  -19.540 1.00 55.03  ? 878  ILE A CG2  1 
ATOM   4609  C CD1  . ILE A 1 317 ? -22.901 -5.361  -18.245 1.00 53.43  ? 878  ILE A CD1  1 
ATOM   4610  H H    . ILE A 1 317 ? -25.578 -2.414  -17.210 1.00 66.30  ? 878  ILE A H    1 
ATOM   4611  H HA   . ILE A 1 317 ? -25.756 -2.194  -19.912 1.00 70.73  ? 878  ILE A HA   1 
ATOM   4612  H HB   . ILE A 1 317 ? -24.325 -4.085  -20.032 1.00 70.38  ? 878  ILE A HB   1 
ATOM   4613  H HG12 . ILE A 1 317 ? -23.672 -3.724  -17.318 1.00 68.49  ? 878  ILE A HG12 1 
ATOM   4614  H HG13 . ILE A 1 317 ? -24.783 -4.775  -17.747 1.00 68.49  ? 878  ILE A HG13 1 
ATOM   4615  H HG21 . ILE A 1 317 ? -22.330 -2.935  -19.619 1.00 66.03  ? 878  ILE A HG21 1 
ATOM   4616  H HG22 . ILE A 1 317 ? -23.374 -1.998  -20.365 1.00 66.03  ? 878  ILE A HG22 1 
ATOM   4617  H HG23 . ILE A 1 317 ? -23.141 -1.840  -18.801 1.00 66.03  ? 878  ILE A HG23 1 
ATOM   4618  H HD11 . ILE A 1 317 ? -22.760 -5.848  -17.418 1.00 64.11  ? 878  ILE A HD11 1 
ATOM   4619  H HD12 . ILE A 1 317 ? -23.192 -5.969  -18.943 1.00 64.11  ? 878  ILE A HD12 1 
ATOM   4620  H HD13 . ILE A 1 317 ? -22.080 -4.918  -18.513 1.00 64.11  ? 878  ILE A HD13 1 
ATOM   4621  N N    . THR A 1 318 ? -27.143 -4.220  -20.350 1.00 63.37  ? 879  THR A N    1 
ATOM   4622  C CA   . THR A 1 318 ? -28.210 -5.196  -20.519 1.00 65.78  ? 879  THR A CA   1 
ATOM   4623  C C    . THR A 1 318 ? -27.885 -6.482  -19.765 1.00 64.47  ? 879  THR A C    1 
ATOM   4624  O O    . THR A 1 318 ? -26.724 -6.881  -19.645 1.00 67.66  ? 879  THR A O    1 
ATOM   4625  C CB   . THR A 1 318 ? -28.413 -5.497  -22.004 1.00 63.23  ? 879  THR A CB   1 
ATOM   4626  O OG1  . THR A 1 318 ? -27.198 -6.028  -22.549 1.00 68.83  ? 879  THR A OG1  1 
ATOM   4627  H H    . THR A 1 318 ? -26.786 -3.959  -21.087 1.00 76.04  ? 879  THR A H    1 
ATOM   4628  H HA   . THR A 1 318 ? -29.037 -4.834  -20.165 1.00 78.94  ? 879  THR A HA   1 
ATOM   4629  H HB   . THR A 1 318 ? -29.117 -6.157  -22.099 1.00 75.88  ? 879  THR A HB   1 
ATOM   4630  H HG1  . THR A 1 318 ? -27.300 -6.196  -23.366 1.00 82.60  ? 879  THR A HG1  1 
ATOM   4631  N N    . VAL A 1 319 ? -28.927 -7.130  -19.250 1.00 70.96  ? 880  VAL A N    1 
ATOM   4632  C CA   . VAL A 1 319 ? -28.755 -8.292  -18.379 1.00 69.21  ? 880  VAL A CA   1 
ATOM   4633  C C    . VAL A 1 319 ? -28.117 -9.460  -19.130 1.00 66.07  ? 880  VAL A C    1 
ATOM   4634  O O    . VAL A 1 319 ? -27.308 -10.180 -18.527 1.00 64.14  ? 880  VAL A O    1 
ATOM   4635  C CB   . VAL A 1 319 ? -30.082 -8.707  -17.711 1.00 64.11  ? 880  VAL A CB   1 
ATOM   4636  C CG1  . VAL A 1 319 ? -31.183 -8.984  -18.718 1.00 57.09  ? 880  VAL A CG1  1 
ATOM   4637  C CG2  . VAL A 1 319 ? -29.870 -9.921  -16.805 1.00 66.91  ? 880  VAL A CG2  1 
ATOM   4638  H H    . VAL A 1 319 ? -29.748 -6.916  -19.391 1.00 85.15  ? 880  VAL A H    1 
ATOM   4639  H HA   . VAL A 1 319 ? -28.145 -8.045  -17.667 1.00 83.05  ? 880  VAL A HA   1 
ATOM   4640  H HB   . VAL A 1 319 ? -30.382 -7.976  -17.149 1.00 76.93  ? 880  VAL A HB   1 
ATOM   4641  H HG11 . VAL A 1 319 ? -31.989 -9.239  -18.242 1.00 68.50  ? 880  VAL A HG11 1 
ATOM   4642  H HG12 . VAL A 1 319 ? -31.346 -8.181  -19.237 1.00 68.50  ? 880  VAL A HG12 1 
ATOM   4643  H HG13 . VAL A 1 319 ? -30.902 -9.705  -19.303 1.00 68.50  ? 880  VAL A HG13 1 
ATOM   4644  H HG21 . VAL A 1 319 ? -30.716 -10.162 -16.398 1.00 80.29  ? 880  VAL A HG21 1 
ATOM   4645  H HG22 . VAL A 1 319 ? -29.537 -10.659 -17.340 1.00 80.29  ? 880  VAL A HG22 1 
ATOM   4646  H HG23 . VAL A 1 319 ? -29.224 -9.692  -16.118 1.00 80.29  ? 880  VAL A HG23 1 
ATOM   4647  N N    . PRO A 1 320 ? -28.429 -9.717  -20.412 1.00 63.76  ? 881  PRO A N    1 
ATOM   4648  C CA   . PRO A 1 320 ? -27.750 -10.843 -21.081 1.00 63.05  ? 881  PRO A CA   1 
ATOM   4649  C C    . PRO A 1 320 ? -26.238 -10.714 -21.062 1.00 66.00  ? 881  PRO A C    1 
ATOM   4650  O O    . PRO A 1 320 ? -25.533 -11.723 -20.942 1.00 69.14  ? 881  PRO A O    1 
ATOM   4651  C CB   . PRO A 1 320 ? -28.308 -10.794 -22.513 1.00 62.87  ? 881  PRO A CB   1 
ATOM   4652  C CG   . PRO A 1 320 ? -29.566 -10.024 -22.406 1.00 64.33  ? 881  PRO A CG   1 
ATOM   4653  C CD   . PRO A 1 320 ? -29.283 -8.992  -21.369 1.00 63.23  ? 881  PRO A CD   1 
ATOM   4654  H HA   . PRO A 1 320 ? -28.005 -11.682 -20.667 1.00 75.66  ? 881  PRO A HA   1 
ATOM   4655  H HB2  . PRO A 1 320 ? -27.677 -10.342 -23.095 1.00 75.44  ? 881  PRO A HB2  1 
ATOM   4656  H HB3  . PRO A 1 320 ? -28.482 -11.695 -22.827 1.00 75.44  ? 881  PRO A HB3  1 
ATOM   4657  H HG2  . PRO A 1 320 ? -29.772 -9.609  -23.259 1.00 77.20  ? 881  PRO A HG2  1 
ATOM   4658  H HG3  . PRO A 1 320 ? -30.287 -10.608 -22.124 1.00 77.20  ? 881  PRO A HG3  1 
ATOM   4659  H HD2  . PRO A 1 320 ? -28.801 -8.244  -21.757 1.00 75.87  ? 881  PRO A HD2  1 
ATOM   4660  H HD3  . PRO A 1 320 ? -30.105 -8.705  -20.942 1.00 75.87  ? 881  PRO A HD3  1 
ATOM   4661  N N    . LEU A 1 321 ? -25.721 -9.491  -21.180 1.00 67.06  ? 882  LEU A N    1 
ATOM   4662  C CA   . LEU A 1 321 ? -24.291 -9.259  -21.017 1.00 61.99  ? 882  LEU A CA   1 
ATOM   4663  C C    . LEU A 1 321 ? -23.886 -9.262  -19.549 1.00 61.72  ? 882  LEU A C    1 
ATOM   4664  O O    . LEU A 1 321 ? -22.759 -9.650  -19.220 1.00 59.14  ? 882  LEU A O    1 
ATOM   4665  C CB   . LEU A 1 321 ? -23.903 -7.927  -21.661 1.00 58.80  ? 882  LEU A CB   1 
ATOM   4666  C CG   . LEU A 1 321 ? -22.408 -7.613  -21.703 1.00 52.59  ? 882  LEU A CG   1 
ATOM   4667  C CD1  . LEU A 1 321 ? -21.703 -8.531  -22.687 1.00 54.76  ? 882  LEU A CD1  1 
ATOM   4668  C CD2  . LEU A 1 321 ? -22.184 -6.154  -22.061 1.00 58.22  ? 882  LEU A CD2  1 
ATOM   4669  H H    . LEU A 1 321 ? -26.177 -8.783  -21.354 1.00 80.47  ? 882  LEU A H    1 
ATOM   4670  H HA   . LEU A 1 321 ? -23.802 -9.965  -21.467 1.00 74.39  ? 882  LEU A HA   1 
ATOM   4671  H HB2  . LEU A 1 321 ? -24.225 -7.925  -22.576 1.00 70.56  ? 882  LEU A HB2  1 
ATOM   4672  H HB3  . LEU A 1 321 ? -24.335 -7.212  -21.167 1.00 70.56  ? 882  LEU A HB3  1 
ATOM   4673  H HG   . LEU A 1 321 ? -22.028 -7.768  -20.824 1.00 63.11  ? 882  LEU A HG   1 
ATOM   4674  H HD11 . LEU A 1 321 ? -20.757 -8.315  -22.698 1.00 65.71  ? 882  LEU A HD11 1 
ATOM   4675  H HD12 . LEU A 1 321 ? -21.829 -9.451  -22.407 1.00 65.71  ? 882  LEU A HD12 1 
ATOM   4676  H HD13 . LEU A 1 321 ? -22.083 -8.398  -23.570 1.00 65.71  ? 882  LEU A HD13 1 
ATOM   4677  H HD21 . LEU A 1 321 ? -21.231 -5.977  -22.082 1.00 69.86  ? 882  LEU A HD21 1 
ATOM   4678  H HD22 . LEU A 1 321 ? -22.573 -5.980  -22.932 1.00 69.86  ? 882  LEU A HD22 1 
ATOM   4679  H HD23 . LEU A 1 321 ? -22.610 -5.596  -21.391 1.00 69.86  ? 882  LEU A HD23 1 
ATOM   4680  N N    . GLN A 1 322 ? -24.785 -8.832  -18.661 1.00 63.96  ? 883  GLN A N    1 
ATOM   4681  C CA   . GLN A 1 322 ? -24.475 -8.813  -17.236 1.00 65.90  ? 883  GLN A CA   1 
ATOM   4682  C C    . GLN A 1 322 ? -24.304 -10.225 -16.692 1.00 64.20  ? 883  GLN A C    1 
ATOM   4683  O O    . GLN A 1 322 ? -23.431 -10.472 -15.852 1.00 60.49  ? 883  GLN A O    1 
ATOM   4684  C CB   . GLN A 1 322 ? -25.575 -8.072  -16.478 1.00 68.19  ? 883  GLN A CB   1 
ATOM   4685  C CG   . GLN A 1 322 ? -25.312 -7.896  -14.994 1.00 66.03  ? 883  GLN A CG   1 
ATOM   4686  C CD   . GLN A 1 322 ? -26.344 -7.008  -14.326 1.00 73.62  ? 883  GLN A CD   1 
ATOM   4687  O OE1  . GLN A 1 322 ? -27.232 -6.465  -14.985 1.00 70.02  ? 883  GLN A OE1  1 
ATOM   4688  N NE2  . GLN A 1 322 ? -26.234 -6.857  -13.010 1.00 71.35  ? 883  GLN A NE2  1 
ATOM   4689  H H    . GLN A 1 322 ? -25.574 -8.551  -18.858 1.00 76.76  ? 883  GLN A H    1 
ATOM   4690  H HA   . GLN A 1 322 ? -23.641 -8.335  -17.100 1.00 79.08  ? 883  GLN A HA   1 
ATOM   4691  H HB2  . GLN A 1 322 ? -25.677 -7.188  -16.865 1.00 81.83  ? 883  GLN A HB2  1 
ATOM   4692  H HB3  . GLN A 1 322 ? -26.404 -8.567  -16.572 1.00 81.83  ? 883  GLN A HB3  1 
ATOM   4693  H HG2  . GLN A 1 322 ? -25.336 -8.764  -14.562 1.00 79.23  ? 883  GLN A HG2  1 
ATOM   4694  H HG3  . GLN A 1 322 ? -24.440 -7.488  -14.873 1.00 79.23  ? 883  GLN A HG3  1 
ATOM   4695  H HE21 . GLN A 1 322 ? -25.601 -7.253  -12.583 1.00 85.62  ? 883  GLN A HE21 1 
ATOM   4696  H HE22 . GLN A 1 322 ? -26.796 -6.363  -12.586 1.00 85.62  ? 883  GLN A HE22 1 
ATOM   4697  N N    . THR A 1 323 ? -25.131 -11.164 -17.157 1.00 73.86  ? 884  THR A N    1 
ATOM   4698  C CA   . THR A 1 323 ? -24.995 -12.563 -16.775 1.00 65.68  ? 884  THR A CA   1 
ATOM   4699  C C    . THR A 1 323 ? -23.920 -13.287 -17.573 1.00 65.29  ? 884  THR A C    1 
ATOM   4700  O O    . THR A 1 323 ? -23.583 -14.426 -17.230 1.00 69.16  ? 884  THR A O    1 
ATOM   4701  C CB   . THR A 1 323 ? -26.329 -13.293 -16.951 1.00 61.54  ? 884  THR A CB   1 
ATOM   4702  O OG1  . THR A 1 323 ? -26.675 -13.338 -18.341 1.00 66.14  ? 884  THR A OG1  1 
ATOM   4703  C CG2  . THR A 1 323 ? -27.435 -12.592 -16.172 1.00 61.45  ? 884  THR A CG2  1 
ATOM   4704  H H    . THR A 1 323 ? -25.781 -11.011 -17.698 1.00 88.63  ? 884  THR A H    1 
ATOM   4705  H HA   . THR A 1 323 ? -24.751 -12.609 -15.837 1.00 78.82  ? 884  THR A HA   1 
ATOM   4706  H HB   . THR A 1 323 ? -26.245 -14.198 -16.612 1.00 73.85  ? 884  THR A HB   1 
ATOM   4707  H HG1  . THR A 1 323 ? -27.407 -13.738 -18.442 1.00 79.37  ? 884  THR A HG1  1 
ATOM   4708  H HG21 . THR A 1 323 ? -28.274 -13.064 -16.291 1.00 73.74  ? 884  THR A HG21 1 
ATOM   4709  H HG22 . THR A 1 323 ? -27.214 -12.575 -15.227 1.00 73.74  ? 884  THR A HG22 1 
ATOM   4710  H HG23 . THR A 1 323 ? -27.537 -11.681 -16.489 1.00 73.74  ? 884  THR A HG23 1 
ATOM   4711  N N    . ASP A 1 324 ? -23.411 -12.682 -18.645 1.00 64.95  ? 885  ASP A N    1 
ATOM   4712  C CA   . ASP A 1 324 ? -22.264 -13.218 -19.363 1.00 66.01  ? 885  ASP A CA   1 
ATOM   4713  C C    . ASP A 1 324 ? -20.935 -12.686 -18.840 1.00 66.84  ? 885  ASP A C    1 
ATOM   4714  O O    . ASP A 1 324 ? -19.884 -13.219 -19.213 1.00 66.66  ? 885  ASP A O    1 
ATOM   4715  C CB   . ASP A 1 324 ? -22.388 -12.902 -20.857 1.00 65.03  ? 885  ASP A CB   1 
ATOM   4716  C CG   . ASP A 1 324 ? -21.542 -13.820 -21.719 1.00 67.73  ? 885  ASP A CG   1 
ATOM   4717  O OD1  . ASP A 1 324 ? -21.983 -14.956 -21.987 1.00 68.50  ? 885  ASP A OD1  1 
ATOM   4718  O OD2  . ASP A 1 324 ? -20.442 -13.403 -22.132 1.00 71.11  ? 885  ASP A OD2  1 
ATOM   4719  H H    . ASP A 1 324 ? -23.718 -11.950 -18.977 1.00 77.93  ? 885  ASP A H    1 
ATOM   4720  H HA   . ASP A 1 324 ? -22.257 -14.183 -19.263 1.00 79.22  ? 885  ASP A HA   1 
ATOM   4721  H HB2  . ASP A 1 324 ? -23.314 -13.005 -21.127 1.00 78.03  ? 885  ASP A HB2  1 
ATOM   4722  H HB3  . ASP A 1 324 ? -22.096 -11.990 -21.013 1.00 78.03  ? 885  ASP A HB3  1 
ATOM   4723  N N    . LEU A 1 325 ? -20.954 -11.658 -17.990 1.00 71.74  ? 886  LEU A N    1 
ATOM   4724  C CA   . LEU A 1 325 ? -19.740 -11.095 -17.412 1.00 77.01  ? 886  LEU A CA   1 
ATOM   4725  C C    . LEU A 1 325 ? -19.365 -11.725 -16.077 1.00 77.99  ? 886  LEU A C    1 
ATOM   4726  O O    . LEU A 1 325 ? -18.276 -11.447 -15.565 1.00 77.70  ? 886  LEU A O    1 
ATOM   4727  C CB   . LEU A 1 325 ? -19.898 -9.582  -17.226 1.00 66.41  ? 886  LEU A CB   1 
ATOM   4728  H H    . LEU A 1 325 ? -21.673 -11.264 -17.731 1.00 86.09  ? 886  LEU A H    1 
ATOM   4729  H HA   . LEU A 1 325 ? -19.004 -11.243 -18.027 1.00 92.41  ? 886  LEU A HA   1 
ATOM   4730  N N    . ARG A 1 326 ? -20.229 -12.568 -15.508 1.00 78.01  ? 887  ARG A N    1 
ATOM   4731  C CA   . ARG A 1 326 ? -19.955 -13.174 -14.209 1.00 77.81  ? 887  ARG A CA   1 
ATOM   4732  C C    . ARG A 1 326 ? -18.893 -14.262 -14.279 1.00 80.13  ? 887  ARG A C    1 
ATOM   4733  O O    . ARG A 1 326 ? -18.471 -14.754 -13.226 1.00 82.40  ? 887  ARG A O    1 
ATOM   4734  C CB   . ARG A 1 326 ? -21.237 -13.747 -13.589 1.00 76.58  ? 887  ARG A CB   1 
ATOM   4735  C CG   . ARG A 1 326 ? -22.234 -14.359 -14.566 1.00 77.02  ? 887  ARG A CG   1 
ATOM   4736  C CD   . ARG A 1 326 ? -23.526 -14.752 -13.872 1.00 75.80  ? 887  ARG A CD   1 
ATOM   4737  N NE   . ARG A 1 326 ? -24.169 -13.596 -13.252 1.00 78.18  ? 887  ARG A NE   1 
ATOM   4738  C CZ   . ARG A 1 326 ? -25.312 -13.642 -12.577 1.00 74.88  ? 887  ARG A CZ   1 
ATOM   4739  N NH1  . ARG A 1 326 ? -25.956 -14.791 -12.423 1.00 73.27  ? 887  ARG A NH1  1 
ATOM   4740  N NH2  . ARG A 1 326 ? -25.814 -12.532 -12.053 1.00 74.94  ? 887  ARG A NH2  1 
ATOM   4741  H H    . ARG A 1 326 ? -20.979 -12.803 -15.855 1.00 93.61  ? 887  ARG A H    1 
ATOM   4742  H HA   . ARG A 1 326 ? -19.625 -12.484 -13.612 1.00 93.38  ? 887  ARG A HA   1 
ATOM   4743  H HB2  . ARG A 1 326 ? -20.987 -14.440 -12.958 1.00 91.90  ? 887  ARG A HB2  1 
ATOM   4744  H HB3  . ARG A 1 326 ? -21.694 -13.033 -13.118 1.00 91.90  ? 887  ARG A HB3  1 
ATOM   4745  H HG2  . ARG A 1 326 ? -22.444 -13.711 -15.256 1.00 92.42  ? 887  ARG A HG2  1 
ATOM   4746  H HG3  . ARG A 1 326 ? -21.846 -15.156 -14.961 1.00 92.42  ? 887  ARG A HG3  1 
ATOM   4747  H HD2  . ARG A 1 326 ? -24.139 -15.128 -14.524 1.00 90.96  ? 887  ARG A HD2  1 
ATOM   4748  H HD3  . ARG A 1 326 ? -23.333 -15.402 -13.178 1.00 90.96  ? 887  ARG A HD3  1 
ATOM   4749  H HE   . ARG A 1 326 ? -23.780 -12.833 -13.330 1.00 93.81  ? 887  ARG A HE   1 
ATOM   4750  H HH11 . ARG A 1 326 ? -25.634 -15.513 -12.762 1.00 87.92  ? 887  ARG A HH11 1 
ATOM   4751  H HH12 . ARG A 1 326 ? -26.696 -14.814 -11.985 1.00 87.92  ? 887  ARG A HH12 1 
ATOM   4752  H HH21 . ARG A 1 326 ? -25.400 -11.785 -12.150 1.00 89.93  ? 887  ARG A HH21 1 
ATOM   4753  H HH22 . ARG A 1 326 ? -26.554 -12.560 -11.615 1.00 89.93  ? 887  ARG A HH22 1 
ATOM   4754  N N    . LYS A 1 327 ? -18.450 -14.647 -15.478 1.00 82.39  ? 888  LYS A N    1 
ATOM   4755  C CA   . LYS A 1 327 ? -17.354 -15.602 -15.592 1.00 83.20  ? 888  LYS A CA   1 
ATOM   4756  C C    . LYS A 1 327 ? -16.078 -15.086 -14.941 1.00 87.23  ? 888  LYS A C    1 
ATOM   4757  O O    . LYS A 1 327 ? -15.181 -15.883 -14.647 1.00 99.00  ? 888  LYS A O    1 
ATOM   4758  C CB   . LYS A 1 327 ? -17.092 -15.929 -17.063 1.00 79.60  ? 888  LYS A CB   1 
ATOM   4759  C CG   . LYS A 1 327 ? -16.702 -14.727 -17.914 1.00 76.99  ? 888  LYS A CG   1 
ATOM   4760  C CD   . LYS A 1 327 ? -16.419 -15.120 -19.359 1.00 72.37  ? 888  LYS A CD   1 
ATOM   4761  C CE   . LYS A 1 327 ? -17.670 -15.622 -20.066 1.00 76.30  ? 888  LYS A CE   1 
ATOM   4762  N NZ   . LYS A 1 327 ? -17.428 -15.934 -21.501 1.00 78.37  ? 888  LYS A NZ   1 
ATOM   4763  H H    . LYS A 1 327 ? -18.765 -14.373 -16.230 1.00 98.87  ? 888  LYS A H    1 
ATOM   4764  H HA   . LYS A 1 327 ? -17.606 -16.424 -15.143 1.00 99.84  ? 888  LYS A HA   1 
ATOM   4765  H HB2  . LYS A 1 327 ? -16.369 -16.574 -17.113 1.00 95.51  ? 888  LYS A HB2  1 
ATOM   4766  H HB3  . LYS A 1 327 ? -17.898 -16.312 -17.444 1.00 95.51  ? 888  LYS A HB3  1 
ATOM   4767  H HG2  . LYS A 1 327 ? -17.430 -14.086 -17.912 1.00 92.39  ? 888  LYS A HG2  1 
ATOM   4768  H HG3  . LYS A 1 327 ? -15.900 -14.323 -17.547 1.00 92.39  ? 888  LYS A HG3  1 
ATOM   4769  H HD2  . LYS A 1 327 ? -16.088 -14.347 -19.841 1.00 86.84  ? 888  LYS A HD2  1 
ATOM   4770  H HD3  . LYS A 1 327 ? -15.758 -15.831 -19.372 1.00 86.84  ? 888  LYS A HD3  1 
ATOM   4771  H HE2  . LYS A 1 327 ? -17.978 -16.431 -19.630 1.00 91.56  ? 888  LYS A HE2  1 
ATOM   4772  H HE3  . LYS A 1 327 ? -18.356 -14.937 -20.019 1.00 91.56  ? 888  LYS A HE3  1 
ATOM   4773  H HZ1  . LYS A 1 327 ? -18.179 -16.223 -21.880 1.00 94.05  ? 888  LYS A HZ1  1 
ATOM   4774  H HZ2  . LYS A 1 327 ? -17.150 -15.204 -21.928 1.00 94.05  ? 888  LYS A HZ2  1 
ATOM   4775  H HZ3  . LYS A 1 327 ? -16.805 -16.566 -21.573 1.00 94.05  ? 888  LYS A HZ3  1 
ATOM   4776  N N    . PHE A 1 328 ? -15.972 -13.776 -14.721 1.00 80.76  ? 889  PHE A N    1 
ATOM   4777  C CA   . PHE A 1 328 ? -14.821 -13.178 -14.056 1.00 82.37  ? 889  PHE A CA   1 
ATOM   4778  C C    . PHE A 1 328 ? -15.310 -12.205 -12.997 1.00 85.04  ? 889  PHE A C    1 
ATOM   4779  O O    . PHE A 1 328 ? -15.960 -11.206 -13.322 1.00 75.11  ? 889  PHE A O    1 
ATOM   4780  C CB   . PHE A 1 328 ? -13.916 -12.461 -15.063 1.00 75.15  ? 889  PHE A CB   1 
ATOM   4781  H H    . PHE A 1 328 ? -16.569 -13.202 -14.954 1.00 96.92  ? 889  PHE A H    1 
ATOM   4782  H HA   . PHE A 1 328 ? -14.303 -13.873 -13.620 1.00 98.84  ? 889  PHE A HA   1 
ATOM   4783  N N    . ARG A 1 329 ? -15.000 -12.498 -11.733 1.00 83.22  ? 890  ARG A N    1 
ATOM   4784  C CA   . ARG A 1 329 ? -15.146 -11.508 -10.675 1.00 78.98  ? 890  ARG A CA   1 
ATOM   4785  C C    . ARG A 1 329 ? -14.124 -10.387 -10.800 1.00 73.79  ? 890  ARG A C    1 
ATOM   4786  O O    . ARG A 1 329 ? -14.221 -9.396  -10.068 1.00 69.23  ? 890  ARG A O    1 
ATOM   4787  C CB   . ARG A 1 329 ? -15.015 -12.179 -9.306  1.00 72.69  ? 890  ARG A CB   1 
ATOM   4788  H H    . ARG A 1 329 ? -14.704 -13.260 -11.467 1.00 99.86  ? 890  ARG A H    1 
ATOM   4789  H HA   . ARG A 1 329 ? -16.030 -11.115 -10.732 1.00 94.77  ? 890  ARG A HA   1 
ATOM   4790  N N    . THR A 1 330 ? -13.150 -10.528 -11.703 1.00 75.01  ? 891  THR A N    1 
ATOM   4791  C CA   . THR A 1 330 ? -12.094 -9.541  -11.887 1.00 71.21  ? 891  THR A CA   1 
ATOM   4792  C C    . THR A 1 330 ? -12.590 -8.233  -12.489 1.00 64.48  ? 891  THR A C    1 
ATOM   4793  O O    . THR A 1 330 ? -11.814 -7.271  -12.543 1.00 64.89  ? 891  THR A O    1 
ATOM   4794  C CB   . THR A 1 330 ? -10.991 -10.117 -12.777 1.00 69.94  ? 891  THR A CB   1 
ATOM   4795  H H    . THR A 1 330 ? -13.082 -11.204 -12.230 1.00 90.02  ? 891  THR A H    1 
ATOM   4796  H HA   . THR A 1 330 ? -11.703 -9.339  -11.022 1.00 85.46  ? 891  THR A HA   1 
ATOM   4797  N N    . TYR A 1 331 ? -13.843 -8.165  -12.938 1.00 60.48  ? 892  TYR A N    1 
ATOM   4798  C CA   . TYR A 1 331 ? -14.379 -6.959  -13.563 1.00 58.61  ? 892  TYR A CA   1 
ATOM   4799  C C    . TYR A 1 331 ? -14.988 -6.085  -12.474 1.00 52.38  ? 892  TYR A C    1 
ATOM   4800  O O    . TYR A 1 331 ? -15.970 -6.472  -11.831 1.00 57.46  ? 892  TYR A O    1 
ATOM   4801  C CB   . TYR A 1 331 ? -15.412 -7.314  -14.631 1.00 58.10  ? 892  TYR A CB   1 
ATOM   4802  C CG   . TYR A 1 331 ? -14.827 -7.771  -15.954 1.00 51.75  ? 892  TYR A CG   1 
ATOM   4803  C CD1  . TYR A 1 331 ? -13.689 -7.173  -16.482 1.00 49.26  ? 892  TYR A CD1  1 
ATOM   4804  C CD2  . TYR A 1 331 ? -15.422 -8.796  -16.678 1.00 54.35  ? 892  TYR A CD2  1 
ATOM   4805  C CE1  . TYR A 1 331 ? -13.158 -7.587  -17.688 1.00 44.54  ? 892  TYR A CE1  1 
ATOM   4806  C CE2  . TYR A 1 331 ? -14.898 -9.218  -17.885 1.00 50.37  ? 892  TYR A CE2  1 
ATOM   4807  C CZ   . TYR A 1 331 ? -13.767 -8.609  -18.385 1.00 46.60  ? 892  TYR A CZ   1 
ATOM   4808  O OH   . TYR A 1 331 ? -13.240 -9.023  -19.586 1.00 41.42  ? 892  TYR A OH   1 
ATOM   4809  H H    . TYR A 1 331 ? -14.407 -8.812  -12.891 1.00 72.58  ? 892  TYR A H    1 
ATOM   4810  H HA   . TYR A 1 331 ? -13.658 -6.467  -13.984 1.00 70.34  ? 892  TYR A HA   1 
ATOM   4811  H HB2  . TYR A 1 331 ? -15.971 -8.031  -14.295 1.00 69.72  ? 892  TYR A HB2  1 
ATOM   4812  H HB3  . TYR A 1 331 ? -15.957 -6.531  -14.806 1.00 69.72  ? 892  TYR A HB3  1 
ATOM   4813  H HD1  . TYR A 1 331 ? -13.276 -6.484  -16.014 1.00 59.12  ? 892  TYR A HD1  1 
ATOM   4814  H HD2  . TYR A 1 331 ? -16.185 -9.209  -16.343 1.00 65.22  ? 892  TYR A HD2  1 
ATOM   4815  H HE1  . TYR A 1 331 ? -12.395 -7.178  -18.028 1.00 53.45  ? 892  TYR A HE1  1 
ATOM   4816  H HE2  . TYR A 1 331 ? -15.307 -9.907  -18.358 1.00 60.44  ? 892  TYR A HE2  1 
ATOM   4817  H HH   . TYR A 1 331 ? -13.704 -9.647  -19.903 1.00 49.70  ? 892  TYR A HH   1 
ATOM   4818  N N    . LYS A 1 332 ? -14.406 -4.904  -12.275 1.00 46.59  ? 893  LYS A N    1 
ATOM   4819  C CA   . LYS A 1 332 ? -14.821 -3.977  -11.230 1.00 47.04  ? 893  LYS A CA   1 
ATOM   4820  C C    . LYS A 1 332 ? -15.683 -2.884  -11.851 1.00 42.91  ? 893  LYS A C    1 
ATOM   4821  O O    . LYS A 1 332 ? -15.231 -2.160  -12.744 1.00 41.28  ? 893  LYS A O    1 
ATOM   4822  C CB   . LYS A 1 332 ? -13.603 -3.381  -10.525 1.00 43.29  ? 893  LYS A CB   1 
ATOM   4823  C CG   . LYS A 1 332 ? -12.892 -4.347  -9.593  1.00 44.64  ? 893  LYS A CG   1 
ATOM   4824  H H    . LYS A 1 332 ? -13.750 -4.612  -12.747 1.00 55.91  ? 893  LYS A H    1 
ATOM   4825  H HA   . LYS A 1 332 ? -15.354 -4.450  -10.573 1.00 56.45  ? 893  LYS A HA   1 
ATOM   4826  H HB2  . LYS A 1 332 ? -12.964 -3.093  -11.195 1.00 51.95  ? 893  LYS A HB2  1 
ATOM   4827  H HB3  . LYS A 1 332 ? -13.890 -2.619  -9.997  1.00 51.95  ? 893  LYS A HB3  1 
ATOM   4828  H HG2  . LYS A 1 332 ? -12.191 -4.802  -10.085 1.00 53.57  ? 893  LYS A HG2  1 
ATOM   4829  H HG3  . LYS A 1 332 ? -12.508 -3.849  -8.854  1.00 53.57  ? 893  LYS A HG3  1 
ATOM   4830  N N    . GLY A 1 333 ? -16.918 -2.765  -11.369 1.00 48.47  ? 894  GLY A N    1 
ATOM   4831  C CA   . GLY A 1 333 ? -17.896 -1.865  -11.957 1.00 45.41  ? 894  GLY A CA   1 
ATOM   4832  C C    . GLY A 1 333 ? -17.576 -0.392  -11.809 1.00 45.78  ? 894  GLY A C    1 
ATOM   4833  O O    . GLY A 1 333 ? -18.216 0.427   -12.475 1.00 44.36  ? 894  GLY A O    1 
ATOM   4834  H H    . GLY A 1 333 ? -17.215 -3.203  -10.691 1.00 58.17  ? 894  GLY A H    1 
ATOM   4835  H HA2  . GLY A 1 333 ? -17.974 -2.060  -12.904 1.00 54.49  ? 894  GLY A HA2  1 
ATOM   4836  H HA3  . GLY A 1 333 ? -18.759 -2.026  -11.545 1.00 54.49  ? 894  GLY A HA3  1 
ATOM   4837  N N    . GLY A 1 334 ? -16.623 -0.037  -10.953 1.00 45.78  ? 895  GLY A N    1 
ATOM   4838  C CA   . GLY A 1 334 ? -16.191 1.334   -10.787 1.00 37.38  ? 895  GLY A CA   1 
ATOM   4839  C C    . GLY A 1 334 ? -14.902 1.682   -11.499 1.00 31.69  ? 895  GLY A C    1 
ATOM   4840  O O    . GLY A 1 334 ? -14.346 2.757   -11.244 1.00 38.50  ? 895  GLY A O    1 
ATOM   4841  H H    . GLY A 1 334 ? -16.204 -0.592  -10.447 1.00 54.93  ? 895  GLY A H    1 
ATOM   4842  H HA2  . GLY A 1 334 ? -16.884 1.926   -11.118 1.00 44.86  ? 895  GLY A HA2  1 
ATOM   4843  H HA3  . GLY A 1 334 ? -16.068 1.513   -9.842  1.00 44.86  ? 895  GLY A HA3  1 
ATOM   4844  N N    . SER A 1 335 ? -14.408 0.815   -12.381 1.00 32.44  ? 896  SER A N    1 
ATOM   4845  C CA   . SER A 1 335 ? -13.146 1.017   -13.082 1.00 35.36  ? 896  SER A CA   1 
ATOM   4846  C C    . SER A 1 335 ? -13.416 1.212   -14.569 1.00 34.27  ? 896  SER A C    1 
ATOM   4847  O O    . SER A 1 335 ? -14.050 0.364   -15.206 1.00 28.12  ? 896  SER A O    1 
ATOM   4848  C CB   . SER A 1 335 ? -12.210 -0.170  -12.864 1.00 34.04  ? 896  SER A CB   1 
ATOM   4849  O OG   . SER A 1 335 ? -11.068 -0.074  -13.699 1.00 33.26  ? 896  SER A OG   1 
ATOM   4850  H H    . SER A 1 335 ? -14.801 0.080   -12.594 1.00 38.93  ? 896  SER A H    1 
ATOM   4851  H HA   . SER A 1 335 ? -12.713 1.816   -12.742 1.00 42.43  ? 896  SER A HA   1 
ATOM   4852  H HB2  . SER A 1 335 ? -11.923 -0.179  -11.938 1.00 40.85  ? 896  SER A HB2  1 
ATOM   4853  H HB3  . SER A 1 335 ? -12.685 -0.989  -13.072 1.00 40.85  ? 896  SER A HB3  1 
ATOM   4854  H HG   . SER A 1 335 ? -10.646 0.632   -13.529 1.00 39.91  ? 896  SER A HG   1 
ATOM   4855  N N    . VAL A 1 336 ? -12.933 2.332   -15.114 1.00 31.17  ? 897  VAL A N    1 
ATOM   4856  C CA   . VAL A 1 336 ? -12.987 2.545   -16.559 1.00 33.88  ? 897  VAL A CA   1 
ATOM   4857  C C    . VAL A 1 336 ? -12.136 1.505   -17.273 1.00 29.33  ? 897  VAL A C    1 
ATOM   4858  O O    . VAL A 1 336 ? -12.531 0.962   -18.312 1.00 26.98  ? 897  VAL A O    1 
ATOM   4859  C CB   . VAL A 1 336 ? -12.528 3.975   -16.904 1.00 31.42  ? 897  VAL A CB   1 
ATOM   4860  C CG1  . VAL A 1 336 ? -12.477 4.181   -18.415 1.00 29.99  ? 897  VAL A CG1  1 
ATOM   4861  C CG2  . VAL A 1 336 ? -13.446 4.999   -16.261 1.00 34.51  ? 897  VAL A CG2  1 
ATOM   4862  H H    . VAL A 1 336 ? -12.573 2.976   -14.673 1.00 37.40  ? 897  VAL A H    1 
ATOM   4863  H HA   . VAL A 1 336 ? -13.904 2.443   -16.860 1.00 40.66  ? 897  VAL A HA   1 
ATOM   4864  H HB   . VAL A 1 336 ? -11.634 4.112   -16.553 1.00 37.71  ? 897  VAL A HB   1 
ATOM   4865  H HG11 . VAL A 1 336 ? -12.186 5.088   -18.600 1.00 35.99  ? 897  VAL A HG11 1 
ATOM   4866  H HG12 . VAL A 1 336 ? -11.852 3.547   -18.799 1.00 35.99  ? 897  VAL A HG12 1 
ATOM   4867  H HG13 . VAL A 1 336 ? -13.363 4.037   -18.782 1.00 35.99  ? 897  VAL A HG13 1 
ATOM   4868  H HG21 . VAL A 1 336 ? -13.136 5.889   -16.492 1.00 41.42  ? 897  VAL A HG21 1 
ATOM   4869  H HG22 . VAL A 1 336 ? -14.348 4.865   -16.591 1.00 41.42  ? 897  VAL A HG22 1 
ATOM   4870  H HG23 . VAL A 1 336 ? -13.425 4.881   -15.298 1.00 41.42  ? 897  VAL A HG23 1 
ATOM   4871  N N    . ARG A 1 337 ? -10.947 1.228   -16.734 1.00 29.20  ? 898  ARG A N    1 
ATOM   4872  C CA   . ARG A 1 337 ? -10.073 0.206   -17.303 1.00 32.90  ? 898  ARG A CA   1 
ATOM   4873  C C    . ARG A 1 337 ? -10.806 -1.123  -17.446 1.00 34.23  ? 898  ARG A C    1 
ATOM   4874  O O    . ARG A 1 337 ? -10.775 -1.752  -18.509 1.00 33.76  ? 898  ARG A O    1 
ATOM   4875  C CB   . ARG A 1 337 ? -8.828  0.057   -16.425 1.00 33.67  ? 898  ARG A CB   1 
ATOM   4876  C CG   . ARG A 1 337 ? -7.862  -1.049  -16.831 1.00 39.67  ? 898  ARG A CG   1 
ATOM   4877  C CD   . ARG A 1 337 ? -6.729  -1.145  -15.822 1.00 52.50  ? 898  ARG A CD   1 
ATOM   4878  N NE   . ARG A 1 337 ? -5.662  -2.049  -16.243 1.00 56.29  ? 898  ARG A NE   1 
ATOM   4879  C CZ   . ARG A 1 337 ? -5.645  -3.360  -16.017 1.00 69.96  ? 898  ARG A CZ   1 
ATOM   4880  N NH1  . ARG A 1 337 ? -6.647  -3.950  -15.377 1.00 65.62  ? 898  ARG A NH1  1 
ATOM   4881  N NH2  . ARG A 1 337 ? -4.621  -4.087  -16.440 1.00 67.57  ? 898  ARG A NH2  1 
ATOM   4882  H H    . ARG A 1 337 ? -10.625 1.618   -16.039 1.00 35.04  ? 898  ARG A H    1 
ATOM   4883  H HA   . ARG A 1 337 ? -9.788  0.489   -18.186 1.00 39.48  ? 898  ARG A HA   1 
ATOM   4884  H HB2  . ARG A 1 337 ? -8.337  0.894   -16.447 1.00 40.41  ? 898  ARG A HB2  1 
ATOM   4885  H HB3  . ARG A 1 337 ? -9.114  -0.126  -15.517 1.00 40.41  ? 898  ARG A HB3  1 
ATOM   4886  H HG2  . ARG A 1 337 ? -8.331  -1.898  -16.851 1.00 47.60  ? 898  ARG A HG2  1 
ATOM   4887  H HG3  . ARG A 1 337 ? -7.485  -0.847  -17.701 1.00 47.60  ? 898  ARG A HG3  1 
ATOM   4888  H HD2  . ARG A 1 337 ? -6.343  -0.264  -15.697 1.00 63.00  ? 898  ARG A HD2  1 
ATOM   4889  H HD3  . ARG A 1 337 ? -7.084  -1.473  -14.981 1.00 63.00  ? 898  ARG A HD3  1 
ATOM   4890  H HE   . ARG A 1 337 ? -4.996  -1.709  -16.667 1.00 67.55  ? 898  ARG A HE   1 
ATOM   4891  H HH11 . ARG A 1 337 ? -7.314  -3.484  -15.100 1.00 78.74  ? 898  ARG A HH11 1 
ATOM   4892  H HH12 . ARG A 1 337 ? -6.628  -4.798  -15.238 1.00 78.74  ? 898  ARG A HH12 1 
ATOM   4893  H HH21 . ARG A 1 337 ? -3.970  -3.711  -16.857 1.00 81.08  ? 898  ARG A HH21 1 
ATOM   4894  H HH22 . ARG A 1 337 ? -4.609  -4.935  -16.299 1.00 81.08  ? 898  ARG A HH22 1 
ATOM   4895  N N    . ASP A 1 338 ? -11.487 -1.559  -16.384 1.00 36.10  ? 899  ASP A N    1 
ATOM   4896  C CA   . ASP A 1 338 ? -12.197 -2.832  -16.438 1.00 38.82  ? 899  ASP A CA   1 
ATOM   4897  C C    . ASP A 1 338 ? -13.375 -2.781  -17.401 1.00 28.79  ? 899  ASP A C    1 
ATOM   4898  O O    . ASP A 1 338 ? -13.750 -3.812  -17.971 1.00 31.42  ? 899  ASP A O    1 
ATOM   4899  C CB   . ASP A 1 338 ? -12.665 -3.235  -15.040 1.00 37.85  ? 899  ASP A CB   1 
ATOM   4900  C CG   . ASP A 1 338 ? -11.530 -3.742  -14.170 1.00 40.77  ? 899  ASP A CG   1 
ATOM   4901  O OD1  . ASP A 1 338 ? -10.355 -3.513  -14.527 1.00 40.56  ? 899  ASP A OD1  1 
ATOM   4902  O OD2  . ASP A 1 338 ? -11.813 -4.374  -13.129 1.00 49.55  ? 899  ASP A OD2  1 
ATOM   4903  H H    . ASP A 1 338 ? -11.551 -1.143  -15.634 1.00 43.32  ? 899  ASP A H    1 
ATOM   4904  H HA   . ASP A 1 338 ? -11.586 -3.516  -16.754 1.00 46.58  ? 899  ASP A HA   1 
ATOM   4905  H HB2  . ASP A 1 338 ? -13.058 -2.463  -14.602 1.00 45.42  ? 899  ASP A HB2  1 
ATOM   4906  H HB3  . ASP A 1 338 ? -13.324 -3.943  -15.118 1.00 45.42  ? 899  ASP A HB3  1 
ATOM   4907  N N    . LEU A 1 339 ? -13.974 -1.604  -17.596 1.00 25.85  ? 900  LEU A N    1 
ATOM   4908  C CA   . LEU A 1 339 ? -15.008 -1.477  -18.617 1.00 31.99  ? 900  LEU A CA   1 
ATOM   4909  C C    . LEU A 1 339 ? -14.419 -1.654  -20.009 1.00 31.71  ? 900  LEU A C    1 
ATOM   4910  O O    . LEU A 1 339 ? -14.999 -2.349  -20.851 1.00 28.19  ? 900  LEU A O    1 
ATOM   4911  C CB   . LEU A 1 339 ? -15.709 -0.124  -18.502 1.00 33.54  ? 900  LEU A CB   1 
ATOM   4912  C CG   . LEU A 1 339 ? -16.755 0.186   -19.578 1.00 39.73  ? 900  LEU A CG   1 
ATOM   4913  C CD1  . LEU A 1 339 ? -17.796 -0.919  -19.677 1.00 36.64  ? 900  LEU A CD1  1 
ATOM   4914  C CD2  . LEU A 1 339 ? -17.425 1.521   -19.299 1.00 37.30  ? 900  LEU A CD2  1 
ATOM   4915  H H    . LEU A 1 339 ? -13.803 -0.882  -17.161 1.00 31.03  ? 900  LEU A H    1 
ATOM   4916  H HA   . LEU A 1 339 ? -15.672 -2.171  -18.482 1.00 38.39  ? 900  LEU A HA   1 
ATOM   4917  H HB2  . LEU A 1 339 ? -16.159 -0.085  -17.643 1.00 40.25  ? 900  LEU A HB2  1 
ATOM   4918  H HB3  . LEU A 1 339 ? -15.036 0.573   -18.544 1.00 40.25  ? 900  LEU A HB3  1 
ATOM   4919  H HG   . LEU A 1 339 ? -16.309 0.251   -20.438 1.00 47.68  ? 900  LEU A HG   1 
ATOM   4920  H HD11 . LEU A 1 339 ? -18.437 -0.687  -20.366 1.00 43.96  ? 900  LEU A HD11 1 
ATOM   4921  H HD12 . LEU A 1 339 ? -17.352 -1.751  -19.903 1.00 43.96  ? 900  LEU A HD12 1 
ATOM   4922  H HD13 . LEU A 1 339 ? -18.245 -1.005  -18.821 1.00 43.96  ? 900  LEU A HD13 1 
ATOM   4923  H HD21 . LEU A 1 339 ? -18.081 1.696   -19.992 1.00 44.76  ? 900  LEU A HD21 1 
ATOM   4924  H HD22 . LEU A 1 339 ? -17.861 1.481   -18.433 1.00 44.76  ? 900  LEU A HD22 1 
ATOM   4925  H HD23 . LEU A 1 339 ? -16.751 2.219   -19.299 1.00 44.76  ? 900  LEU A HD23 1 
ATOM   4926  N N    . LEU A 1 340 ? -13.262 -1.040  -20.266 1.00 31.32  ? 901  LEU A N    1 
ATOM   4927  C CA   . LEU A 1 340 ? -12.600 -1.217  -21.552 1.00 29.94  ? 901  LEU A CA   1 
ATOM   4928  C C    . LEU A 1 340 ? -12.108 -2.647  -21.738 1.00 30.89  ? 901  LEU A C    1 
ATOM   4929  O O    . LEU A 1 340 ? -12.104 -3.156  -22.864 1.00 32.97  ? 901  LEU A O    1 
ATOM   4930  C CB   . LEU A 1 340 ? -11.437 -0.232  -21.680 1.00 32.03  ? 901  LEU A CB   1 
ATOM   4931  C CG   . LEU A 1 340 ? -11.806 1.252   -21.595 1.00 35.86  ? 901  LEU A CG   1 
ATOM   4932  C CD1  . LEU A 1 340 ? -10.554 2.114   -21.558 1.00 35.81  ? 901  LEU A CD1  1 
ATOM   4933  C CD2  . LEU A 1 340 ? -12.702 1.662   -22.756 1.00 36.37  ? 901  LEU A CD2  1 
ATOM   4934  H H    . LEU A 1 340 ? -12.848 -0.523  -19.718 1.00 37.58  ? 901  LEU A H    1 
ATOM   4935  H HA   . LEU A 1 340 ? -13.233 -1.025  -22.261 1.00 35.93  ? 901  LEU A HA   1 
ATOM   4936  H HB2  . LEU A 1 340 ? -10.803 -0.414  -20.969 1.00 38.43  ? 901  LEU A HB2  1 
ATOM   4937  H HB3  . LEU A 1 340 ? -11.009 -0.376  -22.539 1.00 38.43  ? 901  LEU A HB3  1 
ATOM   4938  H HG   . LEU A 1 340 ? -12.297 1.406   -20.773 1.00 43.03  ? 901  LEU A HG   1 
ATOM   4939  H HD11 . LEU A 1 340 ? -10.814 3.046   -21.505 1.00 42.97  ? 901  LEU A HD11 1 
ATOM   4940  H HD12 . LEU A 1 340 ? -10.027 1.871   -20.781 1.00 42.97  ? 901  LEU A HD12 1 
ATOM   4941  H HD13 . LEU A 1 340 ? -10.041 1.959   -22.367 1.00 42.97  ? 901  LEU A HD13 1 
ATOM   4942  H HD21 . LEU A 1 340 ? -12.915 2.604   -22.671 1.00 43.64  ? 901  LEU A HD21 1 
ATOM   4943  H HD22 . LEU A 1 340 ? -12.231 1.503   -23.589 1.00 43.64  ? 901  LEU A HD22 1 
ATOM   4944  H HD23 . LEU A 1 340 ? -13.515 1.134   -22.728 1.00 43.64  ? 901  LEU A HD23 1 
ATOM   4945  N N    . ARG A 1 341 ? -11.692 -3.309  -20.655 1.00 33.04  ? 902  ARG A N    1 
ATOM   4946  C CA   . ARG A 1 341 ? -11.273 -4.703  -20.761 1.00 32.66  ? 902  ARG A CA   1 
ATOM   4947  C C    . ARG A 1 341 ? -12.454 -5.608  -21.090 1.00 31.52  ? 902  ARG A C    1 
ATOM   4948  O O    . ARG A 1 341 ? -12.308 -6.575  -21.847 1.00 32.67  ? 902  ARG A O    1 
ATOM   4949  C CB   . ARG A 1 341 ? -10.596 -5.155  -19.468 1.00 38.83  ? 902  ARG A CB   1 
ATOM   4950  C CG   . ARG A 1 341 ? -9.224  -4.534  -19.239 1.00 51.24  ? 902  ARG A CG   1 
ATOM   4951  C CD   . ARG A 1 341 ? -8.463  -5.207  -18.105 1.00 55.81  ? 902  ARG A CD   1 
ATOM   4952  N NE   . ARG A 1 341 ? -9.291  -5.437  -16.924 1.00 58.45  ? 902  ARG A NE   1 
ATOM   4953  C CZ   . ARG A 1 341 ? -9.736  -6.624  -16.517 1.00 63.98  ? 902  ARG A CZ   1 
ATOM   4954  N NH1  . ARG A 1 341 ? -9.441  -7.731  -17.183 1.00 56.26  ? 902  ARG A NH1  1 
ATOM   4955  N NH2  . ARG A 1 341 ? -10.481 -6.706  -15.424 1.00 67.90  ? 902  ARG A NH2  1 
ATOM   4956  H H    . ARG A 1 341 ? -11.643 -2.979  -19.862 1.00 39.65  ? 902  ARG A H    1 
ATOM   4957  H HA   . ARG A 1 341 ? -10.627 -4.783  -21.480 1.00 39.19  ? 902  ARG A HA   1 
ATOM   4958  H HB2  . ARG A 1 341 ? -11.160 -4.909  -18.718 1.00 46.60  ? 902  ARG A HB2  1 
ATOM   4959  H HB3  . ARG A 1 341 ? -10.485 -6.118  -19.493 1.00 46.60  ? 902  ARG A HB3  1 
ATOM   4960  H HG2  . ARG A 1 341 ? -8.698  -4.622  -20.049 1.00 61.48  ? 902  ARG A HG2  1 
ATOM   4961  H HG3  . ARG A 1 341 ? -9.334  -3.597  -19.014 1.00 61.48  ? 902  ARG A HG3  1 
ATOM   4962  H HD2  . ARG A 1 341 ? -8.135  -6.067  -18.412 1.00 66.97  ? 902  ARG A HD2  1 
ATOM   4963  H HD3  . ARG A 1 341 ? -7.720  -4.642  -17.845 1.00 66.97  ? 902  ARG A HD3  1 
ATOM   4964  H HE   . ARG A 1 341 ? -9.509  -4.750  -16.453 1.00 70.14  ? 902  ARG A HE   1 
ATOM   4965  H HH11 . ARG A 1 341 ? -8.958  -7.689  -17.893 1.00 67.52  ? 902  ARG A HH11 1 
ATOM   4966  H HH12 . ARG A 1 341 ? -9.736  -8.490  -16.907 1.00 67.52  ? 902  ARG A HH12 1 
ATOM   4967  H HH21 . ARG A 1 341 ? -10.678 -5.994  -14.983 1.00 81.48  ? 902  ARG A HH21 1 
ATOM   4968  H HH22 . ARG A 1 341 ? -10.770 -7.470  -15.156 1.00 81.48  ? 902  ARG A HH22 1 
ATOM   4969  N N    . ALA A 1 342 ? -13.629 -5.315  -20.528 1.00 30.03  ? 903  ALA A N    1 
ATOM   4970  C CA   . ALA A 1 342 ? -14.825 -6.075  -20.879 1.00 28.44  ? 903  ALA A CA   1 
ATOM   4971  C C    . ALA A 1 342 ? -15.151 -5.922  -22.359 1.00 32.72  ? 903  ALA A C    1 
ATOM   4972  O O    . ALA A 1 342 ? -15.490 -6.903  -23.034 1.00 29.12  ? 903  ALA A O    1 
ATOM   4973  C CB   . ALA A 1 342 ? -16.005 -5.620  -20.020 1.00 30.21  ? 903  ALA A CB   1 
ATOM   4974  H H    . ALA A 1 342 ? -13.757 -4.691  -19.951 1.00 36.03  ? 903  ALA A H    1 
ATOM   4975  H HA   . ALA A 1 342 ? -14.667 -7.015  -20.701 1.00 34.13  ? 903  ALA A HA   1 
ATOM   4976  H HB1  . ALA A 1 342 ? -16.790 -6.134  -20.266 1.00 36.26  ? 903  ALA A HB1  1 
ATOM   4977  H HB2  . ALA A 1 342 ? -15.791 -5.769  -19.086 1.00 36.26  ? 903  ALA A HB2  1 
ATOM   4978  H HB3  . ALA A 1 342 ? -16.165 -4.676  -20.177 1.00 36.26  ? 903  ALA A HB3  1 
ATOM   4979  N N    . MET A 1 343 ? -15.053 -4.697  -22.880 1.00 34.86  ? 904  MET A N    1 
ATOM   4980  C CA   . MET A 1 343 ? -15.288 -4.463  -24.301 1.00 35.43  ? 904  MET A CA   1 
ATOM   4981  C C    . MET A 1 343 ? -14.257 -5.194  -25.151 1.00 34.74  ? 904  MET A C    1 
ATOM   4982  O O    . MET A 1 343 ? -14.600 -5.842  -26.147 1.00 32.75  ? 904  MET A O    1 
ATOM   4983  C CB   . MET A 1 343 ? -15.249 -2.964  -24.592 1.00 35.89  ? 904  MET A CB   1 
ATOM   4984  C CG   . MET A 1 343 ? -16.294 -2.158  -23.845 1.00 35.56  ? 904  MET A CG   1 
ATOM   4985  S SD   . MET A 1 343 ? -16.035 -0.381  -23.974 1.00 41.52  ? 904  MET A SD   1 
ATOM   4986  C CE   . MET A 1 343 ? -16.087 -0.168  -25.750 1.00 33.84  ? 904  MET A CE   1 
ATOM   4987  H H    . MET A 1 343 ? -14.853 -3.990  -22.433 1.00 41.83  ? 904  MET A H    1 
ATOM   4988  H HA   . MET A 1 343 ? -16.172 -4.789  -24.531 1.00 42.52  ? 904  MET A HA   1 
ATOM   4989  H HB2  . MET A 1 343 ? -14.377 -2.621  -24.342 1.00 43.07  ? 904  MET A HB2  1 
ATOM   4990  H HB3  . MET A 1 343 ? -15.394 -2.828  -25.542 1.00 43.07  ? 904  MET A HB3  1 
ATOM   4991  H HG2  . MET A 1 343 ? -17.169 -2.360  -24.211 1.00 42.67  ? 904  MET A HG2  1 
ATOM   4992  H HG3  . MET A 1 343 ? -16.265 -2.397  -22.905 1.00 42.67  ? 904  MET A HG3  1 
ATOM   4993  H HE1  . MET A 1 343 ? -15.957 0.770   -25.959 1.00 40.61  ? 904  MET A HE1  1 
ATOM   4994  H HE2  . MET A 1 343 ? -15.381 -0.698  -26.152 1.00 40.61  ? 904  MET A HE2  1 
ATOM   4995  H HE3  . MET A 1 343 ? -16.951 -0.464  -26.078 1.00 40.61  ? 904  MET A HE3  1 
ATOM   4996  N N    . ARG A 1 344 ? -12.980 -5.084  -24.776 1.00 34.08  ? 905  ARG A N    1 
ATOM   4997  C CA   . ARG A 1 344 ? -11.922 -5.770  -25.510 1.00 36.18  ? 905  ARG A CA   1 
ATOM   4998  C C    . ARG A 1 344 ? -12.166 -7.272  -25.556 1.00 40.00  ? 905  ARG A C    1 
ATOM   4999  O O    . ARG A 1 344 ? -11.990 -7.905  -26.603 1.00 38.07  ? 905  ARG A O    1 
ATOM   5000  C CB   . ARG A 1 344 ? -10.568 -5.470  -24.866 1.00 39.45  ? 905  ARG A CB   1 
ATOM   5001  C CG   . ARG A 1 344 ? -9.386  -6.199  -25.490 1.00 49.38  ? 905  ARG A CG   1 
ATOM   5002  C CD   . ARG A 1 344 ? -9.051  -5.647  -26.864 1.00 53.85  ? 905  ARG A CD   1 
ATOM   5003  N NE   . ARG A 1 344 ? -7.975  -6.396  -27.507 1.00 58.01  ? 905  ARG A NE   1 
ATOM   5004  C CZ   . ARG A 1 344 ? -8.135  -7.291  -28.479 1.00 57.36  ? 905  ARG A CZ   1 
ATOM   5005  N NH1  . ARG A 1 344 ? -9.339  -7.568  -28.960 1.00 52.64  ? 905  ARG A NH1  1 
ATOM   5006  N NH2  . ARG A 1 344 ? -7.074  -7.909  -28.982 1.00 63.86  ? 905  ARG A NH2  1 
ATOM   5007  H H    . ARG A 1 344 ? -12.705 -4.622  -24.105 1.00 40.90  ? 905  ARG A H    1 
ATOM   5008  H HA   . ARG A 1 344 ? -11.902 -5.440  -26.421 1.00 43.42  ? 905  ARG A HA   1 
ATOM   5009  H HB2  . ARG A 1 344 ? -10.396 -4.518  -24.938 1.00 47.34  ? 905  ARG A HB2  1 
ATOM   5010  H HB3  . ARG A 1 344 ? -10.608 -5.724  -23.931 1.00 47.34  ? 905  ARG A HB3  1 
ATOM   5011  H HG2  . ARG A 1 344 ? -8.608  -6.092  -24.922 1.00 59.26  ? 905  ARG A HG2  1 
ATOM   5012  H HG3  . ARG A 1 344 ? -9.605  -7.139  -25.586 1.00 59.26  ? 905  ARG A HG3  1 
ATOM   5013  H HD2  . ARG A 1 344 ? -9.837  -5.701  -27.430 1.00 64.62  ? 905  ARG A HD2  1 
ATOM   5014  H HD3  . ARG A 1 344 ? -8.766  -4.724  -26.775 1.00 64.62  ? 905  ARG A HD3  1 
ATOM   5015  H HE   . ARG A 1 344 ? -7.173  -6.248  -27.234 1.00 69.62  ? 905  ARG A HE   1 
ATOM   5016  H HH11 . ARG A 1 344 ? -10.032 -7.172  -28.640 1.00 63.16  ? 905  ARG A HH11 1 
ATOM   5017  H HH12 . ARG A 1 344 ? -9.427  -8.147  -29.590 1.00 63.16  ? 905  ARG A HH12 1 
ATOM   5018  H HH21 . ARG A 1 344 ? -6.289  -7.733  -28.677 1.00 76.64  ? 905  ARG A HH21 1 
ATOM   5019  H HH22 . ARG A 1 344 ? -7.171  -8.486  -29.612 1.00 76.64  ? 905  ARG A HH22 1 
ATOM   5020  N N    . ASN A 1 345 ? -12.570 -7.861  -24.429 1.00 36.58  ? 906  ASN A N    1 
ATOM   5021  C CA   . ASN A 1 345 ? -12.740 -9.307  -24.372 1.00 38.07  ? 906  ASN A CA   1 
ATOM   5022  C C    . ASN A 1 345 ? -13.942 -9.757  -25.194 1.00 37.88  ? 906  ASN A C    1 
ATOM   5023  O O    . ASN A 1 345 ? -13.854 -10.737 -25.943 1.00 36.21  ? 906  ASN A O    1 
ATOM   5024  C CB   . ASN A 1 345 ? -12.878 -9.756  -22.918 1.00 40.78  ? 906  ASN A CB   1 
ATOM   5025  C CG   . ASN A 1 345 ? -12.888 -11.265 -22.772 1.00 52.69  ? 906  ASN A CG   1 
ATOM   5026  O OD1  . ASN A 1 345 ? -13.926 -11.910 -22.924 1.00 51.87  ? 906  ASN A OD1  1 
ATOM   5027  N ND2  . ASN A 1 345 ? -11.727 -11.837 -22.475 1.00 48.42  ? 906  ASN A ND2  1 
ATOM   5028  H H    . ASN A 1 345 ? -12.749 -7.450  -23.695 1.00 43.89  ? 906  ASN A H    1 
ATOM   5029  H HA   . ASN A 1 345 ? -11.950 -9.731  -24.742 1.00 45.69  ? 906  ASN A HA   1 
ATOM   5030  H HB2  . ASN A 1 345 ? -12.129 -9.410  -22.408 1.00 48.94  ? 906  ASN A HB2  1 
ATOM   5031  H HB3  . ASN A 1 345 ? -13.712 -9.414  -22.559 1.00 48.94  ? 906  ASN A HB3  1 
ATOM   5032  H HD21 . ASN A 1 345 ? -11.680 -12.690 -22.381 1.00 58.11  ? 906  ASN A HD21 1 
ATOM   5033  H HD22 . ASN A 1 345 ? -11.022 -11.354 -22.376 1.00 58.11  ? 906  ASN A HD22 1 
ATOM   5034  N N    . LYS A 1 346 ? -15.070 -9.051  -25.077 1.00 36.04  ? 907  LYS A N    1 
ATOM   5035  C CA   . LYS A 1 346 ? -16.267 -9.439  -25.815 1.00 40.46  ? 907  LYS A CA   1 
ATOM   5036  C C    . LYS A 1 346 ? -16.131 -9.189  -27.310 1.00 44.31  ? 907  LYS A C    1 
ATOM   5037  O O    . LYS A 1 346 ? -16.856 -9.806  -28.097 1.00 42.25  ? 907  LYS A O    1 
ATOM   5038  C CB   . LYS A 1 346 ? -17.488 -8.695  -25.269 1.00 38.78  ? 907  LYS A CB   1 
ATOM   5039  C CG   . LYS A 1 346 ? -17.829 -9.033  -23.823 1.00 45.75  ? 907  LYS A CG   1 
ATOM   5040  C CD   . LYS A 1 346 ? -18.231 -10.492 -23.662 1.00 53.24  ? 907  LYS A CD   1 
ATOM   5041  C CE   . LYS A 1 346 ? -18.161 -10.933 -22.213 1.00 50.71  ? 907  LYS A CE   1 
ATOM   5042  N NZ   . LYS A 1 346 ? -18.187 -12.414 -22.108 1.00 71.05  ? 907  LYS A NZ   1 
ATOM   5043  H H    . LYS A 1 346 ? -15.165 -8.354  -24.583 1.00 43.25  ? 907  LYS A H    1 
ATOM   5044  H HA   . LYS A 1 346 ? -16.417 -10.389 -25.687 1.00 48.55  ? 907  LYS A HA   1 
ATOM   5045  H HB2  . LYS A 1 346 ? -17.318 -7.741  -25.318 1.00 46.54  ? 907  LYS A HB2  1 
ATOM   5046  H HB3  . LYS A 1 346 ? -18.258 -8.918  -25.815 1.00 46.54  ? 907  LYS A HB3  1 
ATOM   5047  H HG2  . LYS A 1 346 ? -17.052 -8.869  -23.266 1.00 54.90  ? 907  LYS A HG2  1 
ATOM   5048  H HG3  . LYS A 1 346 ? -18.571 -8.480  -23.533 1.00 54.90  ? 907  LYS A HG3  1 
ATOM   5049  H HD2  . LYS A 1 346 ? -19.143 -10.609 -23.971 1.00 63.89  ? 907  LYS A HD2  1 
ATOM   5050  H HD3  . LYS A 1 346 ? -17.628 -11.049 -24.178 1.00 63.89  ? 907  LYS A HD3  1 
ATOM   5051  H HE2  . LYS A 1 346 ? -17.334 -10.613 -21.819 1.00 60.86  ? 907  LYS A HE2  1 
ATOM   5052  H HE3  . LYS A 1 346 ? -18.924 -10.578 -21.732 1.00 60.86  ? 907  LYS A HE3  1 
ATOM   5053  H HZ1  . LYS A 1 346 ? -17.493 -12.762 -22.542 1.00 85.26  ? 907  LYS A HZ1  1 
ATOM   5054  H HZ2  . LYS A 1 346 ? -18.145 -12.659 -21.253 1.00 85.26  ? 907  LYS A HZ2  1 
ATOM   5055  H HZ3  . LYS A 1 346 ? -18.939 -12.731 -22.463 1.00 85.26  ? 907  LYS A HZ3  1 
ATOM   5056  N N    . LYS A 1 347 ? -15.227 -8.299  -27.720 1.00 46.90  ? 908  LYS A N    1 
ATOM   5057  C CA   . LYS A 1 347 ? -14.957 -8.121  -29.141 1.00 47.66  ? 908  LYS A CA   1 
ATOM   5058  C C    . LYS A 1 347 ? -14.133 -9.275  -29.695 1.00 44.54  ? 908  LYS A C    1 
ATOM   5059  O O    . LYS A 1 347 ? -14.432 -9.792  -30.776 1.00 44.94  ? 908  LYS A O    1 
ATOM   5060  C CB   . LYS A 1 347 ? -14.228 -6.797  -29.379 1.00 44.79  ? 908  LYS A CB   1 
ATOM   5061  C CG   . LYS A 1 347 ? -13.854 -6.548  -30.836 1.00 48.57  ? 908  LYS A CG   1 
ATOM   5062  C CD   . LYS A 1 347 ? -12.895 -5.383  -30.981 1.00 49.53  ? 908  LYS A CD   1 
ATOM   5063  C CE   . LYS A 1 347 ? -12.533 -5.164  -32.439 1.00 53.02  ? 908  LYS A CE   1 
ATOM   5064  N NZ   . LYS A 1 347 ? -11.647 -3.986  -32.633 1.00 52.49  ? 908  LYS A NZ   1 
ATOM   5065  H H    . LYS A 1 347 ? -14.764 -7.793  -27.201 1.00 56.28  ? 908  LYS A H    1 
ATOM   5066  H HA   . LYS A 1 347 ? -15.799 -8.093  -29.623 1.00 57.20  ? 908  LYS A HA   1 
ATOM   5067  H HB2  . LYS A 1 347 ? -14.802 -6.069  -29.093 1.00 53.75  ? 908  LYS A HB2  1 
ATOM   5068  H HB3  . LYS A 1 347 ? -13.410 -6.794  -28.859 1.00 53.75  ? 908  LYS A HB3  1 
ATOM   5069  H HG2  . LYS A 1 347 ? -13.424 -7.340  -31.194 1.00 58.29  ? 908  LYS A HG2  1 
ATOM   5070  H HG3  . LYS A 1 347 ? -14.656 -6.345  -31.341 1.00 58.29  ? 908  LYS A HG3  1 
ATOM   5071  H HD2  . LYS A 1 347 ? -13.315 -4.576  -30.645 1.00 59.44  ? 908  LYS A HD2  1 
ATOM   5072  H HD3  . LYS A 1 347 ? -12.081 -5.571  -30.489 1.00 59.44  ? 908  LYS A HD3  1 
ATOM   5073  H HE2  . LYS A 1 347 ? -12.069 -5.948  -32.772 1.00 63.62  ? 908  LYS A HE2  1 
ATOM   5074  H HE3  . LYS A 1 347 ? -13.345 -5.016  -32.948 1.00 63.62  ? 908  LYS A HE3  1 
ATOM   5075  H HZ1  . LYS A 1 347 ? -11.456 -3.888  -33.497 1.00 62.99  ? 908  LYS A HZ1  1 
ATOM   5076  H HZ2  . LYS A 1 347 ? -12.052 -3.249  -32.341 1.00 62.99  ? 908  LYS A HZ2  1 
ATOM   5077  H HZ3  . LYS A 1 347 ? -10.889 -4.098  -32.180 1.00 62.99  ? 908  LYS A HZ3  1 
ATOM   5078  N N    . HIS A 1 348 ? -13.096 -9.688  -28.965 1.00 40.71  ? 909  HIS A N    1 
ATOM   5079  C CA   . HIS A 1 348 ? -12.208 -10.738 -29.451 1.00 48.42  ? 909  HIS A CA   1 
ATOM   5080  C C    . HIS A 1 348 ? -12.912 -12.088 -29.482 1.00 47.80  ? 909  HIS A C    1 
ATOM   5081  O O    . HIS A 1 348 ? -12.694 -12.888 -30.398 1.00 49.88  ? 909  HIS A O    1 
ATOM   5082  C CB   . HIS A 1 348 ? -10.964 -10.796 -28.567 1.00 49.91  ? 909  HIS A CB   1 
ATOM   5083  C CG   . HIS A 1 348 ? -9.846  -11.604 -29.145 1.00 52.65  ? 909  HIS A CG   1 
ATOM   5084  N ND1  . HIS A 1 348 ? -9.717  -12.958 -28.928 1.00 51.28  ? 909  HIS A ND1  1 
ATOM   5085  C CD2  . HIS A 1 348 ? -8.799  -11.245 -29.925 1.00 55.99  ? 909  HIS A CD2  1 
ATOM   5086  C CE1  . HIS A 1 348 ? -8.641  -13.401 -29.553 1.00 62.47  ? 909  HIS A CE1  1 
ATOM   5087  N NE2  . HIS A 1 348 ? -8.066  -12.382 -30.165 1.00 59.63  ? 909  HIS A NE2  1 
ATOM   5088  H H    . HIS A 1 348 ? -12.888 -9.377  -28.191 1.00 48.85  ? 909  HIS A H    1 
ATOM   5089  H HA   . HIS A 1 348 ? -11.927 -10.523 -30.354 1.00 58.10  ? 909  HIS A HA   1 
ATOM   5090  H HB2  . HIS A 1 348 ? -10.637 -9.893  -28.430 1.00 59.89  ? 909  HIS A HB2  1 
ATOM   5091  H HB3  . HIS A 1 348 ? -11.205 -11.191 -27.715 1.00 59.89  ? 909  HIS A HB3  1 
ATOM   5092  H HD2  . HIS A 1 348 ? -8.612  -10.391 -30.240 1.00 67.19  ? 909  HIS A HD2  1 
ATOM   5093  H HE1  . HIS A 1 348 ? -8.339  -14.281 -29.561 1.00 74.96  ? 909  HIS A HE1  1 
ATOM   5094  H HE2  . HIS A 1 348 ? -7.349  -12.423 -30.638 1.00 71.55  ? 909  HIS A HE2  1 
ATOM   5095  N N    . HIS A 1 349 ? -13.758 -12.355 -28.492 1.00 46.23  ? 910  HIS A N    1 
ATOM   5096  C CA   . HIS A 1 349 ? -14.493 -13.606 -28.374 1.00 48.91  ? 910  HIS A CA   1 
ATOM   5097  C C    . HIS A 1 349 ? -15.876 -13.539 -29.013 1.00 52.99  ? 910  HIS A C    1 
ATOM   5098  O O    . HIS A 1 349 ? -16.653 -14.488 -28.870 1.00 57.68  ? 910  HIS A O    1 
ATOM   5099  C CB   . HIS A 1 349 ? -14.612 -13.999 -26.900 1.00 48.97  ? 910  HIS A CB   1 
ATOM   5100  C CG   . HIS A 1 349 ? -13.290 -14.217 -26.231 1.00 47.33  ? 910  HIS A CG   1 
ATOM   5101  N ND1  . HIS A 1 349 ? -13.055 -13.882 -24.915 1.00 54.28  ? 910  HIS A ND1  1 
ATOM   5102  C CD2  . HIS A 1 349 ? -12.130 -14.733 -26.701 1.00 49.70  ? 910  HIS A CD2  1 
ATOM   5103  C CE1  . HIS A 1 349 ? -11.807 -14.183 -24.602 1.00 59.03  ? 910  HIS A CE1  1 
ATOM   5104  N NE2  . HIS A 1 349 ? -11.224 -14.702 -25.668 1.00 52.60  ? 910  HIS A NE2  1 
ATOM   5105  H H    . HIS A 1 349 ? -13.928 -11.803 -27.854 1.00 55.47  ? 910  HIS A H    1 
ATOM   5106  H HA   . HIS A 1 349 ? -13.994 -14.303 -28.826 1.00 58.69  ? 910  HIS A HA   1 
ATOM   5107  H HB2  . HIS A 1 349 ? -15.073 -13.292 -26.423 1.00 58.77  ? 910  HIS A HB2  1 
ATOM   5108  H HB3  . HIS A 1 349 ? -15.117 -14.824 -26.835 1.00 58.77  ? 910  HIS A HB3  1 
ATOM   5109  H HD1  . HIS A 1 349 ? -13.631 -13.531 -24.381 1.00 65.14  ? 910  HIS A HD1  1 
ATOM   5110  H HD2  . HIS A 1 349 ? -11.975 -15.051 -27.561 1.00 59.64  ? 910  HIS A HD2  1 
ATOM   5111  H HE1  . HIS A 1 349 ? -11.408 -14.054 -23.773 1.00 70.84  ? 910  HIS A HE1  1 
ATOM   5112  N N    . TYR A 1 350 ? -16.195 -12.435 -29.697 1.00 51.00  ? 911  TYR A N    1 
ATOM   5113  C CA   . TYR A 1 350 ? -17.567 -12.147 -30.110 1.00 54.94  ? 911  TYR A CA   1 
ATOM   5114  C C    . TYR A 1 350 ? -18.226 -13.327 -30.818 1.00 56.41  ? 911  TYR A C    1 
ATOM   5115  O O    . TYR A 1 350 ? -19.334 -13.739 -30.455 1.00 59.36  ? 911  TYR A O    1 
ATOM   5116  C CB   . TYR A 1 350 ? -17.584 -10.917 -31.019 1.00 53.44  ? 911  TYR A CB   1 
ATOM   5117  C CG   . TYR A 1 350 ? -18.959 -10.584 -31.545 1.00 52.14  ? 911  TYR A CG   1 
ATOM   5118  C CD1  . TYR A 1 350 ? -19.885 -9.921  -30.752 1.00 50.50  ? 911  TYR A CD1  1 
ATOM   5119  C CD2  . TYR A 1 350 ? -19.335 -10.940 -32.833 1.00 53.70  ? 911  TYR A CD2  1 
ATOM   5120  C CE1  . TYR A 1 350 ? -21.146 -9.620  -31.227 1.00 55.84  ? 911  TYR A CE1  1 
ATOM   5121  C CE2  . TYR A 1 350 ? -20.593 -10.643 -33.317 1.00 54.63  ? 911  TYR A CE2  1 
ATOM   5122  C CZ   . TYR A 1 350 ? -21.495 -9.983  -32.510 1.00 56.26  ? 911  TYR A CZ   1 
ATOM   5123  O OH   . TYR A 1 350 ? -22.750 -9.687  -32.989 1.00 59.94  ? 911  TYR A OH   1 
ATOM   5124  H H    . TYR A 1 350 ? -15.627 -11.835 -29.935 1.00 61.20  ? 911  TYR A H    1 
ATOM   5125  H HA   . TYR A 1 350 ? -18.094 -11.942 -29.322 1.00 65.93  ? 911  TYR A HA   1 
ATOM   5126  H HB2  . TYR A 1 350 ? -17.263 -10.151 -30.517 1.00 64.13  ? 911  TYR A HB2  1 
ATOM   5127  H HB3  . TYR A 1 350 ? -17.004 -11.080 -31.779 1.00 64.13  ? 911  TYR A HB3  1 
ATOM   5128  H HD1  . TYR A 1 350 ? -19.653 -9.676  -29.886 1.00 60.61  ? 911  TYR A HD1  1 
ATOM   5129  H HD2  . TYR A 1 350 ? -18.729 -11.386 -33.379 1.00 64.44  ? 911  TYR A HD2  1 
ATOM   5130  H HE1  . TYR A 1 350 ? -21.756 -9.175  -30.684 1.00 67.01  ? 911  TYR A HE1  1 
ATOM   5131  H HE2  . TYR A 1 350 ? -20.832 -10.887 -34.182 1.00 65.56  ? 911  TYR A HE2  1 
ATOM   5132  H HH   . TYR A 1 350 ? -23.196 -9.288  -32.399 1.00 71.93  ? 911  TYR A HH   1 
ATOM   5133  N N    . ARG A 1 351 ? -17.562 -13.886 -31.835 1.00 61.11  ? 912  ARG A N    1 
ATOM   5134  C CA   . ARG A 1 351 ? -18.197 -14.927 -32.642 1.00 66.48  ? 912  ARG A CA   1 
ATOM   5135  C C    . ARG A 1 351 ? -18.528 -16.163 -31.814 1.00 71.84  ? 912  ARG A C    1 
ATOM   5136  O O    . ARG A 1 351 ? -19.445 -16.915 -32.166 1.00 70.30  ? 912  ARG A O    1 
ATOM   5137  C CB   . ARG A 1 351 ? -17.299 -15.301 -33.824 1.00 71.41  ? 912  ARG A CB   1 
ATOM   5138  C CG   . ARG A 1 351 ? -17.834 -16.430 -34.711 1.00 79.77  ? 912  ARG A CG   1 
ATOM   5139  C CD   . ARG A 1 351 ? -19.192 -16.099 -35.322 1.00 81.47  ? 912  ARG A CD   1 
ATOM   5140  N NE   . ARG A 1 351 ? -19.662 -17.156 -36.215 1.00 83.84  ? 912  ARG A NE   1 
ATOM   5141  C CZ   . ARG A 1 351 ? -20.887 -17.217 -36.731 1.00 83.68  ? 912  ARG A CZ   1 
ATOM   5142  N NH1  . ARG A 1 351 ? -21.785 -16.283 -36.443 1.00 87.23  ? 912  ARG A NH1  1 
ATOM   5143  N NH2  . ARG A 1 351 ? -21.220 -18.218 -37.535 1.00 76.35  ? 912  ARG A NH2  1 
ATOM   5144  H H    . ARG A 1 351 ? -16.760 -13.685 -32.072 1.00 73.33  ? 912  ARG A H    1 
ATOM   5145  H HA   . ARG A 1 351 ? -19.029 -14.579 -33.000 1.00 79.77  ? 912  ARG A HA   1 
ATOM   5146  H HB2  . ARG A 1 351 ? -17.185 -14.517 -34.385 1.00 85.69  ? 912  ARG A HB2  1 
ATOM   5147  H HB3  . ARG A 1 351 ? -16.437 -15.583 -33.480 1.00 85.69  ? 912  ARG A HB3  1 
ATOM   5148  H HG2  . ARG A 1 351 ? -17.208 -16.587 -35.436 1.00 95.72  ? 912  ARG A HG2  1 
ATOM   5149  H HG3  . ARG A 1 351 ? -17.932 -17.233 -34.177 1.00 95.72  ? 912  ARG A HG3  1 
ATOM   5150  H HD2  . ARG A 1 351 ? -19.843 -15.992 -34.611 1.00 97.77  ? 912  ARG A HD2  1 
ATOM   5151  H HD3  . ARG A 1 351 ? -19.120 -15.279 -35.835 1.00 97.77  ? 912  ARG A HD3  1 
ATOM   5152  H HE   . ARG A 1 351 ? -19.109 -17.782 -36.422 1.00 100.61 ? 912  ARG A HE   1 
ATOM   5153  H HH11 . ARG A 1 351 ? -21.575 -15.632 -35.922 1.00 104.67 ? 912  ARG A HH11 1 
ATOM   5154  H HH12 . ARG A 1 351 ? -22.575 -16.329 -36.778 1.00 104.67 ? 912  ARG A HH12 1 
ATOM   5155  H HH21 . ARG A 1 351 ? -20.643 -18.827 -37.725 1.00 91.61  ? 912  ARG A HH21 1 
ATOM   5156  H HH22 . ARG A 1 351 ? -22.013 -18.257 -37.867 1.00 91.61  ? 912  ARG A HH22 1 
ATOM   5157  N N    . GLU A 1 352 ? -17.811 -16.384 -30.713 1.00 69.53  ? 913  GLU A N    1 
ATOM   5158  C CA   . GLU A 1 352 ? -18.034 -17.551 -29.871 1.00 65.54  ? 913  GLU A CA   1 
ATOM   5159  C C    . GLU A 1 352 ? -19.070 -17.314 -28.781 1.00 59.81  ? 913  GLU A C    1 
ATOM   5160  O O    . GLU A 1 352 ? -19.438 -18.264 -28.084 1.00 58.82  ? 913  GLU A O    1 
ATOM   5161  C CB   . GLU A 1 352 ? -16.720 -17.991 -29.216 1.00 66.15  ? 913  GLU A CB   1 
ATOM   5162  C CG   . GLU A 1 352 ? -15.498 -17.903 -30.119 1.00 72.40  ? 913  GLU A CG   1 
ATOM   5163  C CD   . GLU A 1 352 ? -15.773 -18.356 -31.543 1.00 88.85  ? 913  GLU A CD   1 
ATOM   5164  O OE1  . GLU A 1 352 ? -16.443 -19.394 -31.723 1.00 101.76 ? 913  GLU A OE1  1 
ATOM   5165  O OE2  . GLU A 1 352 ? -15.322 -17.667 -32.481 1.00 83.98  ? 913  GLU A OE2  1 
ATOM   5166  H H    . GLU A 1 352 ? -17.184 -15.867 -30.433 1.00 83.44  ? 913  GLU A H    1 
ATOM   5167  H HA   . GLU A 1 352 ? -18.349 -18.282 -30.426 1.00 78.65  ? 913  GLU A HA   1 
ATOM   5168  H HB2  . GLU A 1 352 ? -16.555 -17.427 -28.444 1.00 79.37  ? 913  GLU A HB2  1 
ATOM   5169  H HB3  . GLU A 1 352 ? -16.810 -18.914 -28.932 1.00 79.37  ? 913  GLU A HB3  1 
ATOM   5170  H HG2  . GLU A 1 352 ? -15.197 -16.982 -30.152 1.00 86.88  ? 913  GLU A HG2  1 
ATOM   5171  H HG3  . GLU A 1 352 ? -14.798 -18.468 -29.757 1.00 86.88  ? 913  GLU A HG3  1 
ATOM   5172  N N    . LEU A 1 353 ? -19.552 -16.084 -28.619 1.00 63.80  ? 914  LEU A N    1 
ATOM   5173  C CA   . LEU A 1 353 ? -20.461 -15.771 -27.531 1.00 60.19  ? 914  LEU A CA   1 
ATOM   5174  C C    . LEU A 1 353 ? -21.828 -16.408 -27.767 1.00 60.80  ? 914  LEU A C    1 
ATOM   5175  O O    . LEU A 1 353 ? -22.177 -16.754 -28.898 1.00 59.00  ? 914  LEU A O    1 
ATOM   5176  C CB   . LEU A 1 353 ? -20.625 -14.261 -27.390 1.00 57.80  ? 914  LEU A CB   1 
ATOM   5177  C CG   . LEU A 1 353 ? -19.385 -13.434 -27.055 1.00 58.23  ? 914  LEU A CG   1 
ATOM   5178  C CD1  . LEU A 1 353 ? -19.715 -11.950 -27.140 1.00 55.92  ? 914  LEU A CD1  1 
ATOM   5179  C CD2  . LEU A 1 353 ? -18.849 -13.784 -25.680 1.00 55.00  ? 914  LEU A CD2  1 
ATOM   5180  H H    . LEU A 1 353 ? -19.366 -15.415 -29.127 1.00 76.55  ? 914  LEU A H    1 
ATOM   5181  H HA   . LEU A 1 353 ? -20.100 -16.119 -26.700 1.00 72.23  ? 914  LEU A HA   1 
ATOM   5182  H HB2  . LEU A 1 353 ? -20.974 -13.919 -28.227 1.00 69.35  ? 914  LEU A HB2  1 
ATOM   5183  H HB3  . LEU A 1 353 ? -21.272 -14.096 -26.686 1.00 69.35  ? 914  LEU A HB3  1 
ATOM   5184  H HG   . LEU A 1 353 ? -18.692 -13.625 -27.706 1.00 69.88  ? 914  LEU A HG   1 
ATOM   5185  H HD11 . LEU A 1 353 ? -18.919 -11.437 -26.926 1.00 67.11  ? 914  LEU A HD11 1 
ATOM   5186  H HD12 . LEU A 1 353 ? -20.009 -11.743 -28.041 1.00 67.11  ? 914  LEU A HD12 1 
ATOM   5187  H HD13 . LEU A 1 353 ? -20.420 -11.747 -26.506 1.00 67.11  ? 914  LEU A HD13 1 
ATOM   5188  H HD21 . LEU A 1 353 ? -18.064 -13.242 -25.500 1.00 66.00  ? 914  LEU A HD21 1 
ATOM   5189  H HD22 . LEU A 1 353 ? -19.535 -13.604 -25.018 1.00 66.00  ? 914  LEU A HD22 1 
ATOM   5190  H HD23 . LEU A 1 353 ? -18.612 -14.725 -25.664 1.00 66.00  ? 914  LEU A HD23 1 
ATOM   5191  N N    . PRO A 1 354 ? -22.621 -16.576 -26.708 1.00 60.40  ? 915  PRO A N    1 
ATOM   5192  C CA   . PRO A 1 354 ? -24.017 -16.986 -26.897 1.00 63.56  ? 915  PRO A CA   1 
ATOM   5193  C C    . PRO A 1 354 ? -24.756 -16.001 -27.791 1.00 66.84  ? 915  PRO A C    1 
ATOM   5194  O O    . PRO A 1 354 ? -24.513 -14.793 -27.746 1.00 69.92  ? 915  PRO A O    1 
ATOM   5195  C CB   . PRO A 1 354 ? -24.581 -16.995 -25.472 1.00 55.91  ? 915  PRO A CB   1 
ATOM   5196  C CG   . PRO A 1 354 ? -23.395 -17.211 -24.599 1.00 55.05  ? 915  PRO A CG   1 
ATOM   5197  C CD   . PRO A 1 354 ? -22.248 -16.526 -25.283 1.00 57.33  ? 915  PRO A CD   1 
ATOM   5198  H HA   . PRO A 1 354 ? -24.066 -17.877 -27.276 1.00 76.28  ? 915  PRO A HA   1 
ATOM   5199  H HB2  . PRO A 1 354 ? -25.000 -16.142 -25.279 1.00 67.10  ? 915  PRO A HB2  1 
ATOM   5200  H HB3  . PRO A 1 354 ? -25.216 -17.721 -25.375 1.00 67.10  ? 915  PRO A HB3  1 
ATOM   5201  H HG2  . PRO A 1 354 ? -23.557 -16.816 -23.728 1.00 66.06  ? 915  PRO A HG2  1 
ATOM   5202  H HG3  . PRO A 1 354 ? -23.222 -18.162 -24.515 1.00 66.06  ? 915  PRO A HG3  1 
ATOM   5203  H HD2  . PRO A 1 354 ? -22.177 -15.606 -24.984 1.00 68.80  ? 915  PRO A HD2  1 
ATOM   5204  H HD3  . PRO A 1 354 ? -21.424 -17.014 -25.132 1.00 68.80  ? 915  PRO A HD3  1 
ATOM   5205  N N    . ALA A 1 355 ? -25.661 -16.535 -28.616 1.00 68.19  ? 916  ALA A N    1 
ATOM   5206  C CA   . ALA A 1 355 ? -26.396 -15.701 -29.563 1.00 69.95  ? 916  ALA A CA   1 
ATOM   5207  C C    . ALA A 1 355 ? -27.101 -14.545 -28.869 1.00 74.33  ? 916  ALA A C    1 
ATOM   5208  O O    . ALA A 1 355 ? -27.236 -13.462 -29.450 1.00 86.49  ? 916  ALA A O    1 
ATOM   5209  C CB   . ALA A 1 355 ? -27.410 -16.549 -30.333 1.00 75.46  ? 916  ALA A CB   1 
ATOM   5210  H H    . ALA A 1 355 ? -25.865 -17.370 -28.646 1.00 81.83  ? 916  ALA A H    1 
ATOM   5211  H HA   . ALA A 1 355 ? -25.771 -15.328 -30.204 1.00 83.94  ? 916  ALA A HA   1 
ATOM   5212  H HB1  . ALA A 1 355 ? -27.888 -15.980 -30.956 1.00 90.55  ? 916  ALA A HB1  1 
ATOM   5213  H HB2  . ALA A 1 355 ? -26.937 -17.245 -30.816 1.00 90.55  ? 916  ALA A HB2  1 
ATOM   5214  H HB3  . ALA A 1 355 ? -28.032 -16.947 -29.703 1.00 90.55  ? 916  ALA A HB3  1 
ATOM   5215  N N    . GLU A 1 356 ? -27.552 -14.748 -27.629 1.00 73.43  ? 917  GLU A N    1 
ATOM   5216  C CA   . GLU A 1 356 ? -28.197 -13.666 -26.893 1.00 75.45  ? 917  GLU A CA   1 
ATOM   5217  C C    . GLU A 1 356 ? -27.214 -12.541 -26.598 1.00 74.86  ? 917  GLU A C    1 
ATOM   5218  O O    . GLU A 1 356 ? -27.580 -11.361 -26.644 1.00 79.11  ? 917  GLU A O    1 
ATOM   5219  C CB   . GLU A 1 356 ? -28.802 -14.203 -25.597 1.00 66.18  ? 917  GLU A CB   1 
ATOM   5220  H H    . GLU A 1 356 ? -27.497 -15.492 -27.201 1.00 88.11  ? 917  GLU A H    1 
ATOM   5221  H HA   . GLU A 1 356 ? -28.917 -13.302 -27.432 1.00 90.54  ? 917  GLU A HA   1 
ATOM   5222  N N    . VAL A 1 357 ? -25.959 -12.884 -26.302 1.00 70.56  ? 918  VAL A N    1 
ATOM   5223  C CA   . VAL A 1 357 ? -24.961 -11.860 -26.008 1.00 74.27  ? 918  VAL A CA   1 
ATOM   5224  C C    . VAL A 1 357 ? -24.466 -11.191 -27.289 1.00 67.34  ? 918  VAL A C    1 
ATOM   5225  O O    . VAL A 1 357 ? -24.142 -9.999  -27.281 1.00 67.25  ? 918  VAL A O    1 
ATOM   5226  C CB   . VAL A 1 357 ? -23.796 -12.462 -25.204 1.00 68.32  ? 918  VAL A CB   1 
ATOM   5227  C CG1  . VAL A 1 357 ? -22.750 -11.394 -24.893 1.00 63.30  ? 918  VAL A CG1  1 
ATOM   5228  C CG2  . VAL A 1 357 ? -24.319 -13.071 -23.915 1.00 67.13  ? 918  VAL A CG2  1 
ATOM   5229  H H    . VAL A 1 357 ? -25.665 -13.691 -26.265 1.00 84.67  ? 918  VAL A H    1 
ATOM   5230  H HA   . VAL A 1 357 ? -25.373 -11.175 -25.459 1.00 89.12  ? 918  VAL A HA   1 
ATOM   5231  H HB   . VAL A 1 357 ? -23.374 -13.163 -25.725 1.00 81.99  ? 918  VAL A HB   1 
ATOM   5232  H HG11 . VAL A 1 357 ? -22.028 -11.799 -24.387 1.00 75.96  ? 918  VAL A HG11 1 
ATOM   5233  H HG12 . VAL A 1 357 ? -22.408 -11.035 -25.727 1.00 75.96  ? 918  VAL A HG12 1 
ATOM   5234  H HG13 . VAL A 1 357 ? -23.164 -10.689 -24.373 1.00 75.96  ? 918  VAL A HG13 1 
ATOM   5235  H HG21 . VAL A 1 357 ? -23.574 -13.446 -23.419 1.00 80.55  ? 918  VAL A HG21 1 
ATOM   5236  H HG22 . VAL A 1 357 ? -24.750 -12.378 -23.391 1.00 80.55  ? 918  VAL A HG22 1 
ATOM   5237  H HG23 . VAL A 1 357 ? -24.957 -13.768 -24.132 1.00 80.55  ? 918  VAL A HG23 1 
ATOM   5238  N N    . ARG A 1 358 ? -24.387 -11.932 -28.398 1.00 68.64  ? 919  ARG A N    1 
ATOM   5239  C CA   . ARG A 1 358 ? -24.015 -11.320 -29.672 1.00 68.54  ? 919  ARG A CA   1 
ATOM   5240  C C    . ARG A 1 358 ? -25.107 -10.385 -30.173 1.00 69.48  ? 919  ARG A C    1 
ATOM   5241  O O    . ARG A 1 358 ? -24.814 -9.333  -30.753 1.00 67.36  ? 919  ARG A O    1 
ATOM   5242  C CB   . ARG A 1 358 ? -23.730 -12.399 -30.716 1.00 66.40  ? 919  ARG A CB   1 
ATOM   5243  C CG   . ARG A 1 358 ? -22.431 -13.151 -30.500 1.00 64.47  ? 919  ARG A CG   1 
ATOM   5244  C CD   . ARG A 1 358 ? -22.177 -14.150 -31.618 1.00 66.20  ? 919  ARG A CD   1 
ATOM   5245  N NE   . ARG A 1 358 ? -23.289 -15.079 -31.779 1.00 74.45  ? 919  ARG A NE   1 
ATOM   5246  C CZ   . ARG A 1 358 ? -23.295 -16.106 -32.622 1.00 77.07  ? 919  ARG A CZ   1 
ATOM   5247  N NH1  . ARG A 1 358 ? -22.243 -16.348 -33.393 1.00 76.20  ? 919  ARG A NH1  1 
ATOM   5248  N NH2  . ARG A 1 358 ? -24.358 -16.893 -32.693 1.00 88.10  ? 919  ARG A NH2  1 
ATOM   5249  H H    . ARG A 1 358 ? -24.541 -12.777 -28.438 1.00 82.36  ? 919  ARG A H    1 
ATOM   5250  H HA   . ARG A 1 358 ? -23.206 -10.799 -29.549 1.00 82.25  ? 919  ARG A HA   1 
ATOM   5251  H HB2  . ARG A 1 358 ? -24.451 -13.047 -30.698 1.00 79.68  ? 919  ARG A HB2  1 
ATOM   5252  H HB3  . ARG A 1 358 ? -23.686 -11.982 -31.590 1.00 79.68  ? 919  ARG A HB3  1 
ATOM   5253  H HG2  . ARG A 1 358 ? -21.694 -12.520 -30.482 1.00 77.36  ? 919  ARG A HG2  1 
ATOM   5254  H HG3  . ARG A 1 358 ? -22.477 -13.638 -29.662 1.00 77.36  ? 919  ARG A HG3  1 
ATOM   5255  H HD2  . ARG A 1 358 ? -22.059 -13.670 -32.453 1.00 79.44  ? 919  ARG A HD2  1 
ATOM   5256  H HD3  . ARG A 1 358 ? -21.380 -14.663 -31.412 1.00 79.44  ? 919  ARG A HD3  1 
ATOM   5257  H HE   . ARG A 1 358 ? -23.989 -14.954 -31.295 1.00 89.34  ? 919  ARG A HE   1 
ATOM   5258  H HH11 . ARG A 1 358 ? -21.551 -15.839 -33.349 1.00 91.44  ? 919  ARG A HH11 1 
ATOM   5259  H HH12 . ARG A 1 358 ? -22.252 -17.015 -33.936 1.00 91.44  ? 919  ARG A HH12 1 
ATOM   5260  H HH21 . ARG A 1 358 ? -25.042 -16.739 -32.195 1.00 105.72 ? 919  ARG A HH21 1 
ATOM   5261  H HH22 . ARG A 1 358 ? -24.365 -17.559 -33.238 1.00 105.72 ? 919  ARG A HH22 1 
ATOM   5262  N N    . GLU A 1 359 ? -26.373 -10.751 -29.962 1.00 73.10  ? 920  GLU A N    1 
ATOM   5263  C CA   . GLU A 1 359 ? -27.472 -9.923  -30.448 1.00 72.38  ? 920  GLU A CA   1 
ATOM   5264  C C    . GLU A 1 359 ? -27.647 -8.677  -29.589 1.00 72.43  ? 920  GLU A C    1 
ATOM   5265  O O    . GLU A 1 359 ? -27.912 -7.589  -30.115 1.00 84.31  ? 920  GLU A O    1 
ATOM   5266  C CB   . GLU A 1 359 ? -28.767 -10.735 -30.489 1.00 74.08  ? 920  GLU A CB   1 
ATOM   5267  C CG   . GLU A 1 359 ? -28.855 -11.691 -31.670 1.00 73.47  ? 920  GLU A CG   1 
ATOM   5268  C CD   . GLU A 1 359 ? -30.283 -12.050 -32.030 1.00 75.97  ? 920  GLU A CD   1 
ATOM   5269  O OE1  . GLU A 1 359 ? -31.118 -12.172 -31.110 1.00 73.25  ? 920  GLU A OE1  1 
ATOM   5270  O OE2  . GLU A 1 359 ? -30.572 -12.204 -33.236 1.00 70.54  ? 920  GLU A OE2  1 
ATOM   5271  H H    . GLU A 1 359 ? -26.618 -11.463 -29.546 1.00 87.72  ? 920  GLU A H    1 
ATOM   5272  H HA   . GLU A 1 359 ? -27.271 -9.635  -31.352 1.00 86.85  ? 920  GLU A HA   1 
ATOM   5273  H HB2  . GLU A 1 359 ? -28.832 -11.260 -29.677 1.00 88.90  ? 920  GLU A HB2  1 
ATOM   5274  H HB3  . GLU A 1 359 ? -29.517 -10.123 -30.547 1.00 88.90  ? 920  GLU A HB3  1 
ATOM   5275  H HG2  . GLU A 1 359 ? -28.446 -11.274 -32.445 1.00 88.17  ? 920  GLU A HG2  1 
ATOM   5276  H HG3  . GLU A 1 359 ? -28.386 -12.511 -31.448 1.00 88.17  ? 920  GLU A HG3  1 
ATOM   5277  N N    . THR A 1 360 ? -27.506 -8.811  -28.268 1.00 74.17  ? 921  THR A N    1 
ATOM   5278  C CA   . THR A 1 360 ? -27.613 -7.649  -27.392 1.00 70.59  ? 921  THR A CA   1 
ATOM   5279  C C    . THR A 1 360 ? -26.439 -6.694  -27.563 1.00 65.37  ? 921  THR A C    1 
ATOM   5280  O O    . THR A 1 360 ? -26.536 -5.534  -27.150 1.00 68.10  ? 921  THR A O    1 
ATOM   5281  C CB   . THR A 1 360 ? -27.713 -8.095  -25.930 1.00 69.07  ? 921  THR A CB   1 
ATOM   5282  O OG1  . THR A 1 360 ? -28.095 -6.990  -25.101 1.00 67.44  ? 921  THR A OG1  1 
ATOM   5283  C CG2  . THR A 1 360 ? -26.397 -8.661  -25.448 1.00 66.97  ? 921  THR A CG2  1 
ATOM   5284  H H    . THR A 1 360 ? -27.349 -9.553  -27.862 1.00 89.00  ? 921  THR A H    1 
ATOM   5285  H HA   . THR A 1 360 ? -28.425 -7.166  -27.612 1.00 84.70  ? 921  THR A HA   1 
ATOM   5286  H HB   . THR A 1 360 ? -28.384 -8.791  -25.857 1.00 82.88  ? 921  THR A HB   1 
ATOM   5287  H HG1  . THR A 1 360 ? -28.148 -7.237  -24.300 1.00 80.93  ? 921  THR A HG1  1 
ATOM   5288  H HG21 . THR A 1 360 ? -26.475 -8.938  -24.522 1.00 80.37  ? 921  THR A HG21 1 
ATOM   5289  H HG22 . THR A 1 360 ? -26.149 -9.428  -25.987 1.00 80.37  ? 921  THR A HG22 1 
ATOM   5290  H HG23 . THR A 1 360 ? -25.701 -7.989  -25.518 1.00 80.37  ? 921  THR A HG23 1 
ATOM   5291  N N    . LEU A 1 361 ? -25.338 -7.156  -28.158 1.00 70.28  ? 922  LEU A N    1 
ATOM   5292  C CA   . LEU A 1 361 ? -24.149 -6.337  -28.372 1.00 63.06  ? 922  LEU A CA   1 
ATOM   5293  C C    . LEU A 1 361 ? -24.036 -5.884  -29.819 1.00 64.65  ? 922  LEU A C    1 
ATOM   5294  O O    . LEU A 1 361 ? -24.235 -4.706  -30.132 1.00 58.52  ? 922  LEU A O    1 
ATOM   5295  C CB   . LEU A 1 361 ? -22.884 -7.114  -28.002 1.00 61.24  ? 922  LEU A CB   1 
ATOM   5296  C CG   . LEU A 1 361 ? -22.524 -7.289  -26.532 1.00 60.27  ? 922  LEU A CG   1 
ATOM   5297  C CD1  . LEU A 1 361 ? -21.341 -8.234  -26.424 1.00 57.91  ? 922  LEU A CD1  1 
ATOM   5298  C CD2  . LEU A 1 361 ? -22.198 -5.950  -25.901 1.00 55.53  ? 922  LEU A CD2  1 
ATOM   5299  H H    . LEU A 1 361 ? -25.256 -7.961  -28.451 1.00 84.33  ? 922  LEU A H    1 
ATOM   5300  H HA   . LEU A 1 361 ? -24.198 -5.549  -27.809 1.00 75.67  ? 922  LEU A HA   1 
ATOM   5301  H HB2  . LEU A 1 361 ? -22.967 -8.005  -28.376 1.00 73.49  ? 922  LEU A HB2  1 
ATOM   5302  H HB3  . LEU A 1 361 ? -22.132 -6.667  -28.421 1.00 73.49  ? 922  LEU A HB3  1 
ATOM   5303  H HG   . LEU A 1 361 ? -23.275 -7.679  -26.058 1.00 72.32  ? 922  LEU A HG   1 
ATOM   5304  H HD11 . LEU A 1 361 ? -21.111 -8.346  -25.488 1.00 69.49  ? 922  LEU A HD11 1 
ATOM   5305  H HD12 . LEU A 1 361 ? -21.586 -9.090  -26.810 1.00 69.49  ? 922  LEU A HD12 1 
ATOM   5306  H HD13 . LEU A 1 361 ? -20.590 -7.856  -26.907 1.00 69.49  ? 922  LEU A HD13 1 
ATOM   5307  H HD21 . LEU A 1 361 ? -21.972 -6.088  -24.968 1.00 66.63  ? 922  LEU A HD21 1 
ATOM   5308  H HD22 . LEU A 1 361 ? -21.445 -5.556  -26.369 1.00 66.63  ? 922  LEU A HD22 1 
ATOM   5309  H HD23 . LEU A 1 361 ? -22.972 -5.370  -25.973 1.00 66.63  ? 922  LEU A HD23 1 
ATOM   5310  N N    . GLY A 1 362 ? -23.715 -6.824  -30.702 1.00 62.68  ? 923  GLY A N    1 
ATOM   5311  C CA   . GLY A 1 362 ? -23.362 -6.518  -32.074 1.00 62.01  ? 923  GLY A CA   1 
ATOM   5312  C C    . GLY A 1 362 ? -24.565 -6.191  -32.937 1.00 64.28  ? 923  GLY A C    1 
ATOM   5313  O O    . GLY A 1 362 ? -25.627 -5.869  -32.405 1.00 69.42  ? 923  GLY A O    1 
ATOM   5314  H H    . GLY A 1 362 ? -23.696 -7.665  -30.522 1.00 75.22  ? 923  GLY A H    1 
ATOM   5315  H HA2  . GLY A 1 362 ? -22.761 -5.757  -32.089 1.00 74.41  ? 923  GLY A HA2  1 
ATOM   5316  H HA3  . GLY A 1 362 ? -22.903 -7.277  -32.466 1.00 74.41  ? 923  GLY A HA3  1 
ATOM   5317  N N    . SER A 1 363 ? -24.424 -6.268  -34.262 1.00 60.94  ? 924  SER A N    1 
ATOM   5318  C CA   . SER A 1 363 ? -23.239 -6.814  -34.926 1.00 57.34  ? 924  SER A CA   1 
ATOM   5319  C C    . SER A 1 363 ? -21.997 -5.940  -34.805 1.00 57.48  ? 924  SER A C    1 
ATOM   5320  O O    . SER A 1 363 ? -22.081 -4.746  -34.524 1.00 53.41  ? 924  SER A O    1 
ATOM   5321  C CB   . SER A 1 363 ? -23.530 -7.040  -36.407 1.00 60.21  ? 924  SER A CB   1 
ATOM   5322  O OG   . SER A 1 363 ? -23.678 -5.806  -37.090 1.00 54.05  ? 924  SER A OG   1 
ATOM   5323  H H    . SER A 1 363 ? -25.025 -6.001  -34.816 1.00 73.13  ? 924  SER A H    1 
ATOM   5324  H HA   . SER A 1 363 ? -23.031 -7.675  -34.531 1.00 68.80  ? 924  SER A HA   1 
ATOM   5325  H HB2  . SER A 1 363 ? -22.794 -7.533  -36.802 1.00 72.26  ? 924  SER A HB2  1 
ATOM   5326  H HB3  . SER A 1 363 ? -24.353 -7.548  -36.493 1.00 72.26  ? 924  SER A HB3  1 
ATOM   5327  H HG   . SER A 1 363 ? -24.313 -5.368  -36.758 1.00 64.86  ? 924  SER A HG   1 
ATOM   5328  N N    . LEU A 1 364 ? -20.841 -6.561  -35.007 1.00 57.90  ? 925  LEU A N    1 
ATOM   5329  C CA   . LEU A 1 364 ? -19.574 -5.843  -35.041 1.00 55.78  ? 925  LEU A CA   1 
ATOM   5330  C C    . LEU A 1 364 ? -19.328 -5.162  -36.387 1.00 62.37  ? 925  LEU A C    1 
ATOM   5331  O O    . LEU A 1 364 ? -19.971 -5.490  -37.384 1.00 67.66  ? 925  LEU A O    1 
ATOM   5332  C CB   . LEU A 1 364 ? -18.405 -6.802  -34.749 1.00 59.99  ? 925  LEU A CB   1 
ATOM   5333  C CG   . LEU A 1 364 ? -17.996 -7.101  -33.304 1.00 53.00  ? 925  LEU A CG   1 
ATOM   5334  C CD1  . LEU A 1 364 ? -16.966 -8.224  -33.263 1.00 53.07  ? 925  LEU A CD1  1 
ATOM   5335  C CD2  . LEU A 1 364 ? -17.421 -5.866  -32.645 1.00 57.97  ? 925  LEU A CD2  1 
ATOM   5336  H H    . LEU A 1 364 ? -20.763 -7.409  -35.129 1.00 69.48  ? 925  LEU A H    1 
ATOM   5337  H HA   . LEU A 1 364 ? -19.581 -5.158  -34.355 1.00 66.94  ? 925  LEU A HA   1 
ATOM   5338  H HB2  . LEU A 1 364 ? -18.622 -7.656  -35.155 1.00 71.98  ? 925  LEU A HB2  1 
ATOM   5339  H HB3  . LEU A 1 364 ? -17.618 -6.441  -35.188 1.00 71.98  ? 925  LEU A HB3  1 
ATOM   5340  H HG   . LEU A 1 364 ? -18.775 -7.383  -32.800 1.00 63.59  ? 925  LEU A HG   1 
ATOM   5341  H HD11 . LEU A 1 364 ? -16.722 -8.396  -32.340 1.00 63.69  ? 925  LEU A HD11 1 
ATOM   5342  H HD12 . LEU A 1 364 ? -17.353 -9.021  -33.657 1.00 63.69  ? 925  LEU A HD12 1 
ATOM   5343  H HD13 . LEU A 1 364 ? -16.183 -7.952  -33.767 1.00 63.69  ? 925  LEU A HD13 1 
ATOM   5344  H HD21 . LEU A 1 364 ? -17.171 -6.083  -31.733 1.00 69.56  ? 925  LEU A HD21 1 
ATOM   5345  H HD22 . LEU A 1 364 ? -16.641 -5.577  -33.143 1.00 69.56  ? 925  LEU A HD22 1 
ATOM   5346  H HD23 . LEU A 1 364 ? -18.093 -5.167  -32.647 1.00 69.56  ? 925  LEU A HD23 1 
ATOM   5347  N N    . PRO A 1 365 ? -18.404 -4.190  -36.413 1.00 59.38  ? 926  PRO A N    1 
ATOM   5348  C CA   . PRO A 1 365 ? -17.952 -3.378  -35.280 1.00 62.34  ? 926  PRO A CA   1 
ATOM   5349  C C    . PRO A 1 365 ? -18.996 -2.322  -34.883 1.00 55.00  ? 926  PRO A C    1 
ATOM   5350  O O    . PRO A 1 365 ? -19.002 -1.855  -33.745 1.00 57.81  ? 926  PRO A O    1 
ATOM   5351  C CB   . PRO A 1 365 ? -16.662 -2.748  -35.802 1.00 57.29  ? 926  PRO A CB   1 
ATOM   5352  C CG   . PRO A 1 365 ? -16.884 -2.612  -37.265 1.00 57.92  ? 926  PRO A CG   1 
ATOM   5353  C CD   . PRO A 1 365 ? -17.881 -3.673  -37.688 1.00 57.60  ? 926  PRO A CD   1 
ATOM   5354  H HA   . PRO A 1 365 ? -17.752 -3.941  -34.516 1.00 74.81  ? 926  PRO A HA   1 
ATOM   5355  H HB2  . PRO A 1 365 ? -16.530 -1.880  -35.391 1.00 68.75  ? 926  PRO A HB2  1 
ATOM   5356  H HB3  . PRO A 1 365 ? -15.912 -3.336  -35.620 1.00 68.75  ? 926  PRO A HB3  1 
ATOM   5357  H HG2  . PRO A 1 365 ? -17.237 -1.728  -37.453 1.00 69.50  ? 926  PRO A HG2  1 
ATOM   5358  H HG3  . PRO A 1 365 ? -16.042 -2.741  -37.728 1.00 69.50  ? 926  PRO A HG3  1 
ATOM   5359  H HD2  . PRO A 1 365 ? -18.595 -3.275  -38.209 1.00 69.12  ? 926  PRO A HD2  1 
ATOM   5360  H HD3  . PRO A 1 365 ? -17.433 -4.379  -38.180 1.00 69.12  ? 926  PRO A HD3  1 
ATOM   5361  N N    . ASP A 1 366 ? -19.877 -1.980  -35.830 1.00 58.19  ? 927  ASP A N    1 
ATOM   5362  C CA   . ASP A 1 366 ? -20.660 -0.747  -35.737 1.00 59.29  ? 927  ASP A CA   1 
ATOM   5363  C C    . ASP A 1 366 ? -21.644 -0.779  -34.572 1.00 52.86  ? 927  ASP A C    1 
ATOM   5364  O O    . ASP A 1 366 ? -21.621 0.099   -33.702 1.00 57.81  ? 927  ASP A O    1 
ATOM   5365  C CB   . ASP A 1 366 ? -21.401 -0.504  -37.056 1.00 58.24  ? 927  ASP A CB   1 
ATOM   5366  C CG   . ASP A 1 366 ? -20.493 0.035   -38.150 1.00 61.96  ? 927  ASP A CG   1 
ATOM   5367  O OD1  . ASP A 1 366 ? -19.259 -0.131  -38.046 1.00 59.20  ? 927  ASP A OD1  1 
ATOM   5368  O OD2  . ASP A 1 366 ? -21.017 0.624   -39.120 1.00 69.11  ? 927  ASP A OD2  1 
ATOM   5369  H H    . ASP A 1 366 ? -20.038 -2.445  -36.535 1.00 69.82  ? 927  ASP A H    1 
ATOM   5370  H HA   . ASP A 1 366 ? -20.055 -0.002  -35.595 1.00 71.14  ? 927  ASP A HA   1 
ATOM   5371  H HB2  . ASP A 1 366 ? -21.778 -1.343  -37.365 1.00 69.89  ? 927  ASP A HB2  1 
ATOM   5372  H HB3  . ASP A 1 366 ? -22.108 0.143   -36.906 1.00 69.89  ? 927  ASP A HB3  1 
ATOM   5373  N N    . ASP A 1 367 ? -22.527 -1.780  -34.538 1.00 56.46  ? 928  ASP A N    1 
ATOM   5374  C CA   . ASP A 1 367 ? -23.528 -1.834  -33.478 1.00 59.62  ? 928  ASP A CA   1 
ATOM   5375  C C    . ASP A 1 367 ? -22.912 -2.201  -32.135 1.00 55.27  ? 928  ASP A C    1 
ATOM   5376  O O    . ASP A 1 367 ? -23.482 -1.872  -31.090 1.00 49.16  ? 928  ASP A O    1 
ATOM   5377  C CB   . ASP A 1 367 ? -24.627 -2.832  -33.844 1.00 60.84  ? 928  ASP A CB   1 
ATOM   5378  C CG   . ASP A 1 367 ? -25.185 -2.600  -35.236 1.00 62.79  ? 928  ASP A CG   1 
ATOM   5379  O OD1  . ASP A 1 367 ? -26.087 -1.747  -35.385 1.00 60.17  ? 928  ASP A OD1  1 
ATOM   5380  O OD2  . ASP A 1 367 ? -24.724 -3.274  -36.182 1.00 63.68  ? 928  ASP A OD2  1 
ATOM   5381  H H    . ASP A 1 367 ? -22.565 -2.426  -35.104 1.00 67.75  ? 928  ASP A H    1 
ATOM   5382  H HA   . ASP A 1 367 ? -23.937 -0.959  -33.388 1.00 71.55  ? 928  ASP A HA   1 
ATOM   5383  H HB2  . ASP A 1 367 ? -24.262 -3.730  -33.813 1.00 73.01  ? 928  ASP A HB2  1 
ATOM   5384  H HB3  . ASP A 1 367 ? -25.356 -2.747  -33.210 1.00 73.01  ? 928  ASP A HB3  1 
ATOM   5385  N N    . PHE A 1 368 ? -21.755 -2.864  -32.149 1.00 55.73  ? 929  PHE A N    1 
ATOM   5386  C CA   . PHE A 1 368 ? -21.074 -3.234  -30.914 1.00 54.34  ? 929  PHE A CA   1 
ATOM   5387  C C    . PHE A 1 368 ? -20.568 -2.002  -30.173 1.00 53.80  ? 929  PHE A C    1 
ATOM   5388  O O    . PHE A 1 368 ? -20.790 -1.856  -28.966 1.00 49.42  ? 929  PHE A O    1 
ATOM   5389  C CB   . PHE A 1 368 ? -19.922 -4.178  -31.247 1.00 53.76  ? 929  PHE A CB   1 
ATOM   5390  C CG   . PHE A 1 368 ? -19.146 -4.656  -30.055 1.00 54.89  ? 929  PHE A CG   1 
ATOM   5391  C CD1  . PHE A 1 368 ? -18.122 -3.889  -29.525 1.00 48.52  ? 929  PHE A CD1  1 
ATOM   5392  C CD2  . PHE A 1 368 ? -19.414 -5.891  -29.489 1.00 54.74  ? 929  PHE A CD2  1 
ATOM   5393  C CE1  . PHE A 1 368 ? -17.396 -4.332  -28.438 1.00 47.17  ? 929  PHE A CE1  1 
ATOM   5394  C CE2  . PHE A 1 368 ? -18.691 -6.339  -28.403 1.00 55.28  ? 929  PHE A CE2  1 
ATOM   5395  C CZ   . PHE A 1 368 ? -17.680 -5.561  -27.877 1.00 51.72  ? 929  PHE A CZ   1 
ATOM   5396  H H    . PHE A 1 368 ? -21.344 -3.110  -32.864 1.00 66.88  ? 929  PHE A H    1 
ATOM   5397  H HA   . PHE A 1 368 ? -21.695 -3.704  -30.335 1.00 65.21  ? 929  PHE A HA   1 
ATOM   5398  H HB2  . PHE A 1 368 ? -20.281 -4.959  -31.698 1.00 64.51  ? 929  PHE A HB2  1 
ATOM   5399  H HB3  . PHE A 1 368 ? -19.303 -3.717  -31.835 1.00 64.51  ? 929  PHE A HB3  1 
ATOM   5400  H HD1  . PHE A 1 368 ? -17.928 -3.060  -29.900 1.00 58.22  ? 929  PHE A HD1  1 
ATOM   5401  H HD2  . PHE A 1 368 ? -20.094 -6.419  -29.839 1.00 65.69  ? 929  PHE A HD2  1 
ATOM   5402  H HE1  . PHE A 1 368 ? -16.716 -3.805  -28.086 1.00 56.61  ? 929  PHE A HE1  1 
ATOM   5403  H HE2  . PHE A 1 368 ? -18.884 -7.167  -28.026 1.00 66.34  ? 929  PHE A HE2  1 
ATOM   5404  H HZ   . PHE A 1 368 ? -17.193 -5.862  -27.144 1.00 62.06  ? 929  PHE A HZ   1 
ATOM   5405  N N    . VAL A 1 369 ? -19.869 -1.109  -30.879 1.00 51.66  ? 930  VAL A N    1 
ATOM   5406  C CA   . VAL A 1 369 ? -19.318 0.077   -30.229 1.00 52.01  ? 930  VAL A CA   1 
ATOM   5407  C C    . VAL A 1 369 ? -20.431 1.035   -29.826 1.00 49.34  ? 930  VAL A C    1 
ATOM   5408  O O    . VAL A 1 369 ? -20.298 1.774   -28.843 1.00 50.53  ? 930  VAL A O    1 
ATOM   5409  C CB   . VAL A 1 369 ? -18.287 0.762   -31.147 1.00 50.20  ? 930  VAL A CB   1 
ATOM   5410  C CG1  . VAL A 1 369 ? -18.951 1.323   -32.402 1.00 52.86  ? 930  VAL A CG1  1 
ATOM   5411  C CG2  . VAL A 1 369 ? -17.541 1.856   -30.393 1.00 43.57  ? 930  VAL A CG2  1 
ATOM   5412  H H    . VAL A 1 369 ? -19.704 -1.166  -31.721 1.00 62.00  ? 930  VAL A H    1 
ATOM   5413  H HA   . VAL A 1 369 ? -18.857 -0.197  -29.420 1.00 62.41  ? 930  VAL A HA   1 
ATOM   5414  H HB   . VAL A 1 369 ? -17.635 0.101   -31.430 1.00 60.23  ? 930  VAL A HB   1 
ATOM   5415  H HG11 . VAL A 1 369 ? -18.275 1.745   -32.954 1.00 63.43  ? 930  VAL A HG11 1 
ATOM   5416  H HG12 . VAL A 1 369 ? -19.371 0.596   -32.888 1.00 63.43  ? 930  VAL A HG12 1 
ATOM   5417  H HG13 . VAL A 1 369 ? -19.620 1.975   -32.140 1.00 63.43  ? 930  VAL A HG13 1 
ATOM   5418  H HG21 . VAL A 1 369 ? -16.900 2.271   -30.992 1.00 52.28  ? 930  VAL A HG21 1 
ATOM   5419  H HG22 . VAL A 1 369 ? -18.180 2.517   -30.083 1.00 52.28  ? 930  VAL A HG22 1 
ATOM   5420  H HG23 . VAL A 1 369 ? -17.081 1.460   -29.637 1.00 52.28  ? 930  VAL A HG23 1 
ATOM   5421  N N    . CYS A 1 370 ? -21.541 1.041   -30.568 1.00 50.53  ? 931  CYS A N    1 
ATOM   5422  C CA   . CYS A 1 370 ? -22.664 1.902   -30.216 1.00 53.10  ? 931  CYS A CA   1 
ATOM   5423  C C    . CYS A 1 370 ? -23.366 1.422   -28.954 1.00 47.49  ? 931  CYS A C    1 
ATOM   5424  O O    . CYS A 1 370 ? -23.929 2.236   -28.214 1.00 42.82  ? 931  CYS A O    1 
ATOM   5425  C CB   . CYS A 1 370 ? -23.656 1.974   -31.376 1.00 56.48  ? 931  CYS A CB   1 
ATOM   5426  S SG   . CYS A 1 370 ? -23.033 2.854   -32.826 1.00 53.66  ? 931  CYS A SG   1 
ATOM   5427  H H    . CYS A 1 370 ? -21.665 0.561   -31.271 1.00 60.63  ? 931  CYS A H    1 
ATOM   5428  H HA   . CYS A 1 370 ? -22.333 2.799   -30.050 1.00 63.72  ? 931  CYS A HA   1 
ATOM   5429  H HB2  . CYS A 1 370 ? -23.879 1.071   -31.652 1.00 67.78  ? 931  CYS A HB2  1 
ATOM   5430  H HB3  . CYS A 1 370 ? -24.456 2.432   -31.074 1.00 67.78  ? 931  CYS A HB3  1 
ATOM   5431  H HG   . CYS A 1 370 ? -23.880 2.855   -33.676 1.00 64.39  ? 931  CYS A HG   1 
ATOM   5432  N N    . TYR A 1 371 ? -23.354 0.110   -28.700 1.00 53.77  ? 932  TYR A N    1 
ATOM   5433  C CA   . TYR A 1 371 ? -23.949 -0.422  -27.478 1.00 52.50  ? 932  TYR A CA   1 
ATOM   5434  C C    . TYR A 1 371 ? -23.344 0.230   -26.241 1.00 49.21  ? 932  TYR A C    1 
ATOM   5435  O O    . TYR A 1 371 ? -24.055 0.525   -25.272 1.00 52.63  ? 932  TYR A O    1 
ATOM   5436  C CB   . TYR A 1 371 ? -23.762 -1.939  -27.433 1.00 55.56  ? 932  TYR A CB   1 
ATOM   5437  C CG   . TYR A 1 371 ? -24.059 -2.564  -26.091 1.00 59.14  ? 932  TYR A CG   1 
ATOM   5438  C CD1  . TYR A 1 371 ? -23.066 -2.692  -25.128 1.00 61.42  ? 932  TYR A CD1  1 
ATOM   5439  C CD2  . TYR A 1 371 ? -25.329 -3.035  -25.789 1.00 62.35  ? 932  TYR A CD2  1 
ATOM   5440  C CE1  . TYR A 1 371 ? -23.332 -3.264  -23.903 1.00 63.08  ? 932  TYR A CE1  1 
ATOM   5441  C CE2  . TYR A 1 371 ? -25.603 -3.610  -24.566 1.00 67.49  ? 932  TYR A CE2  1 
ATOM   5442  C CZ   . TYR A 1 371 ? -24.601 -3.721  -23.628 1.00 67.69  ? 932  TYR A CZ   1 
ATOM   5443  O OH   . TYR A 1 371 ? -24.865 -4.293  -22.409 1.00 68.16  ? 932  TYR A OH   1 
ATOM   5444  H H    . TYR A 1 371 ? -23.010 -0.485  -29.217 1.00 64.52  ? 932  TYR A H    1 
ATOM   5445  H HA   . TYR A 1 371 ? -24.901 -0.235  -27.481 1.00 63.00  ? 932  TYR A HA   1 
ATOM   5446  H HB2  . TYR A 1 371 ? -24.356 -2.344  -28.084 1.00 66.68  ? 932  TYR A HB2  1 
ATOM   5447  H HB3  . TYR A 1 371 ? -22.841 -2.145  -27.656 1.00 66.68  ? 932  TYR A HB3  1 
ATOM   5448  H HD1  . TYR A 1 371 ? -22.208 -2.383  -25.311 1.00 73.71  ? 932  TYR A HD1  1 
ATOM   5449  H HD2  . TYR A 1 371 ? -26.007 -2.960  -26.421 1.00 74.82  ? 932  TYR A HD2  1 
ATOM   5450  H HE1  . TYR A 1 371 ? -22.659 -3.342  -23.266 1.00 75.69  ? 932  TYR A HE1  1 
ATOM   5451  H HE2  . TYR A 1 371 ? -26.458 -3.920  -24.376 1.00 80.98  ? 932  TYR A HE2  1 
ATOM   5452  H HH   . TYR A 1 371 ? -24.170 -4.297  -21.937 1.00 81.79  ? 932  TYR A HH   1 
ATOM   5453  N N    . PHE A 1 372 ? -22.032 0.464   -26.258 1.00 45.22  ? 933  PHE A N    1 
ATOM   5454  C CA   . PHE A 1 372 ? -21.343 1.062   -25.119 1.00 46.83  ? 933  PHE A CA   1 
ATOM   5455  C C    . PHE A 1 372 ? -21.456 2.583   -25.137 1.00 46.39  ? 933  PHE A C    1 
ATOM   5456  O O    . PHE A 1 372 ? -21.997 3.183   -24.202 1.00 38.85  ? 933  PHE A O    1 
ATOM   5457  C CB   . PHE A 1 372 ? -19.882 0.608   -25.101 1.00 44.33  ? 933  PHE A CB   1 
ATOM   5458  C CG   . PHE A 1 372 ? -19.724 -0.868  -24.877 1.00 45.49  ? 933  PHE A CG   1 
ATOM   5459  C CD1  . PHE A 1 372 ? -19.859 -1.405  -23.607 1.00 45.73  ? 933  PHE A CD1  1 
ATOM   5460  C CD2  . PHE A 1 372 ? -19.466 -1.722  -25.936 1.00 46.23  ? 933  PHE A CD2  1 
ATOM   5461  C CE1  . PHE A 1 372 ? -19.727 -2.764  -23.395 1.00 41.08  ? 933  PHE A CE1  1 
ATOM   5462  C CE2  . PHE A 1 372 ? -19.332 -3.084  -25.731 1.00 43.93  ? 933  PHE A CE2  1 
ATOM   5463  C CZ   . PHE A 1 372 ? -19.465 -3.605  -24.458 1.00 46.20  ? 933  PHE A CZ   1 
ATOM   5464  H H    . PHE A 1 372 ? -21.517 0.284   -26.922 1.00 54.27  ? 933  PHE A H    1 
ATOM   5465  H HA   . PHE A 1 372 ? -21.760 0.745   -24.302 1.00 56.20  ? 933  PHE A HA   1 
ATOM   5466  H HB2  . PHE A 1 372 ? -19.475 0.826   -25.954 1.00 53.19  ? 933  PHE A HB2  1 
ATOM   5467  H HB3  . PHE A 1 372 ? -19.418 1.070   -24.386 1.00 53.19  ? 933  PHE A HB3  1 
ATOM   5468  H HD1  . PHE A 1 372 ? -20.037 -0.844  -22.888 1.00 54.87  ? 933  PHE A HD1  1 
ATOM   5469  H HD2  . PHE A 1 372 ? -19.377 -1.376  -26.795 1.00 55.47  ? 933  PHE A HD2  1 
ATOM   5470  H HE1  . PHE A 1 372 ? -19.816 -3.112  -22.537 1.00 49.30  ? 933  PHE A HE1  1 
ATOM   5471  H HE2  . PHE A 1 372 ? -19.155 -3.648  -26.449 1.00 52.72  ? 933  PHE A HE2  1 
ATOM   5472  H HZ   . PHE A 1 372 ? -19.374 -4.520  -24.317 1.00 55.44  ? 933  PHE A HZ   1 
ATOM   5473  N N    . THR A 1 373 ? -20.921 3.223   -26.184 1.00 51.73  ? 934  THR A N    1 
ATOM   5474  C CA   . THR A 1 373 ? -20.930 4.682   -26.262 1.00 44.82  ? 934  THR A CA   1 
ATOM   5475  C C    . THR A 1 373 ? -22.313 5.265   -26.001 1.00 43.29  ? 934  THR A C    1 
ATOM   5476  O O    . THR A 1 373 ? -22.428 6.349   -25.420 1.00 40.94  ? 934  THR A O    1 
ATOM   5477  C CB   . THR A 1 373 ? -20.431 5.143   -27.634 1.00 47.46  ? 934  THR A CB   1 
ATOM   5478  O OG1  . THR A 1 373 ? -21.237 4.557   -28.664 1.00 50.14  ? 934  THR A OG1  1 
ATOM   5479  C CG2  . THR A 1 373 ? -18.972 4.748   -27.848 1.00 47.59  ? 934  THR A CG2  1 
ATOM   5480  H H    . THR A 1 373 ? -20.549 2.835   -26.855 1.00 62.07  ? 934  THR A H    1 
ATOM   5481  H HA   . THR A 1 373 ? -20.326 5.036   -25.591 1.00 53.79  ? 934  THR A HA   1 
ATOM   5482  H HB   . THR A 1 373 ? -20.495 6.109   -27.689 1.00 56.96  ? 934  THR A HB   1 
ATOM   5483  H HG1  . THR A 1 373 ? -21.191 3.719   -28.623 1.00 60.17  ? 934  THR A HG1  1 
ATOM   5484  H HG21 . THR A 1 373 ? -18.673 5.047   -28.721 1.00 57.10  ? 934  THR A HG21 1 
ATOM   5485  H HG22 . THR A 1 373 ? -18.415 5.156   -27.167 1.00 57.10  ? 934  THR A HG22 1 
ATOM   5486  H HG23 . THR A 1 373 ? -18.879 3.784   -27.796 1.00 57.10  ? 934  THR A HG23 1 
ATOM   5487  N N    . SER A 1 374 ? -23.373 4.567   -26.413 1.00 42.54  ? 935  SER A N    1 
ATOM   5488  C CA   . SER A 1 374 ? -24.723 5.048   -26.130 1.00 43.87  ? 935  SER A CA   1 
ATOM   5489  C C    . SER A 1 374 ? -25.033 4.977   -24.639 1.00 44.55  ? 935  SER A C    1 
ATOM   5490  O O    . SER A 1 374 ? -25.644 5.898   -24.083 1.00 48.74  ? 935  SER A O    1 
ATOM   5491  C CB   . SER A 1 374 ? -25.748 4.244   -26.931 1.00 44.51  ? 935  SER A CB   1 
ATOM   5492  O OG   . SER A 1 374 ? -25.533 2.850   -26.788 1.00 49.75  ? 935  SER A OG   1 
ATOM   5493  H H    . SER A 1 374 ? -23.339 3.826   -26.848 1.00 51.04  ? 935  SER A H    1 
ATOM   5494  H HA   . SER A 1 374 ? -24.790 5.976   -26.405 1.00 52.64  ? 935  SER A HA   1 
ATOM   5495  H HB2  . SER A 1 374 ? -26.637 4.459   -26.609 1.00 53.41  ? 935  SER A HB2  1 
ATOM   5496  H HB3  . SER A 1 374 ? -25.669 4.480   -27.868 1.00 53.41  ? 935  SER A HB3  1 
ATOM   5497  H HG   . SER A 1 374 ? -26.104 2.424   -27.234 1.00 59.70  ? 935  SER A HG   1 
ATOM   5498  N N    . ARG A 1 375 ? -24.624 3.893   -23.976 1.00 45.61  ? 936  ARG A N    1 
ATOM   5499  C CA   . ARG A 1 375 ? -24.859 3.745   -22.544 1.00 46.58  ? 936  ARG A CA   1 
ATOM   5500  C C    . ARG A 1 375 ? -23.842 4.496   -21.696 1.00 43.69  ? 936  ARG A C    1 
ATOM   5501  O O    . ARG A 1 375 ? -24.113 4.760   -20.520 1.00 44.84  ? 936  ARG A O    1 
ATOM   5502  C CB   . ARG A 1 375 ? -24.850 2.264   -22.164 1.00 59.08  ? 936  ARG A CB   1 
ATOM   5503  C CG   . ARG A 1 375 ? -26.040 1.497   -22.717 1.00 53.59  ? 936  ARG A CG   1 
ATOM   5504  C CD   . ARG A 1 375 ? -25.797 -0.002  -22.770 1.00 58.49  ? 936  ARG A CD   1 
ATOM   5505  N NE   . ARG A 1 375 ? -26.433 -0.592  -23.945 1.00 61.97  ? 936  ARG A NE   1 
ATOM   5506  C CZ   . ARG A 1 375 ? -27.683 -1.045  -23.988 1.00 62.92  ? 936  ARG A CZ   1 
ATOM   5507  N NH1  . ARG A 1 375 ? -28.459 -0.996  -22.914 1.00 66.78  ? 936  ARG A NH1  1 
ATOM   5508  N NH2  . ARG A 1 375 ? -28.159 -1.556  -25.116 1.00 54.08  ? 936  ARG A NH2  1 
ATOM   5509  H H    . ARG A 1 375 ? -24.208 3.232   -24.335 1.00 54.74  ? 936  ARG A H    1 
ATOM   5510  H HA   . ARG A 1 375 ? -25.738 4.099   -22.335 1.00 55.89  ? 936  ARG A HA   1 
ATOM   5511  H HB2  . ARG A 1 375 ? -24.043 1.854   -22.513 1.00 70.90  ? 936  ARG A HB2  1 
ATOM   5512  H HB3  . ARG A 1 375 ? -24.868 2.187   -21.197 1.00 70.90  ? 936  ARG A HB3  1 
ATOM   5513  H HG2  . ARG A 1 375 ? -26.810 1.657   -22.150 1.00 64.31  ? 936  ARG A HG2  1 
ATOM   5514  H HG3  . ARG A 1 375 ? -26.222 1.804   -23.619 1.00 64.31  ? 936  ARG A HG3  1 
ATOM   5515  H HD2  . ARG A 1 375 ? -24.843 -0.173  -22.820 1.00 70.18  ? 936  ARG A HD2  1 
ATOM   5516  H HD3  . ARG A 1 375 ? -26.173 -0.418  -21.978 1.00 70.18  ? 936  ARG A HD3  1 
ATOM   5517  H HE   . ARG A 1 375 ? -25.963 -0.651  -24.664 1.00 74.36  ? 936  ARG A HE   1 
ATOM   5518  H HH11 . ARG A 1 375 ? -28.157 -0.665  -22.180 1.00 80.14  ? 936  ARG A HH11 1 
ATOM   5519  H HH12 . ARG A 1 375 ? -29.265 -1.293  -22.952 1.00 80.14  ? 936  ARG A HH12 1 
ATOM   5520  H HH21 . ARG A 1 375 ? -27.660 -1.593  -25.816 1.00 64.89  ? 936  ARG A HH21 1 
ATOM   5521  H HH22 . ARG A 1 375 ? -28.965 -1.853  -25.147 1.00 64.89  ? 936  ARG A HH22 1 
ATOM   5522  N N    . PHE A 1 376 ? -22.685 4.839   -22.259 1.00 43.55  ? 937  PHE A N    1 
ATOM   5523  C CA   . PHE A 1 376 ? -21.632 5.564   -21.548 1.00 44.19  ? 937  PHE A CA   1 
ATOM   5524  C C    . PHE A 1 376 ? -21.179 6.705   -22.449 1.00 43.54  ? 937  PHE A C    1 
ATOM   5525  O O    . PHE A 1 376 ? -20.161 6.603   -23.148 1.00 40.26  ? 937  PHE A O    1 
ATOM   5526  C CB   . PHE A 1 376 ? -20.492 4.623   -21.164 1.00 41.62  ? 937  PHE A CB   1 
ATOM   5527  C CG   . PHE A 1 376 ? -20.953 3.416   -20.396 1.00 46.30  ? 937  PHE A CG   1 
ATOM   5528  C CD1  . PHE A 1 376 ? -21.126 3.473   -19.024 1.00 47.77  ? 937  PHE A CD1  1 
ATOM   5529  C CD2  . PHE A 1 376 ? -21.237 2.230   -21.052 1.00 40.62  ? 937  PHE A CD2  1 
ATOM   5530  C CE1  . PHE A 1 376 ? -21.561 2.365   -18.319 1.00 41.64  ? 937  PHE A CE1  1 
ATOM   5531  C CE2  . PHE A 1 376 ? -21.671 1.121   -20.353 1.00 50.68  ? 937  PHE A CE2  1 
ATOM   5532  C CZ   . PHE A 1 376 ? -21.834 1.189   -18.985 1.00 47.38  ? 937  PHE A CZ   1 
ATOM   5533  H H    . PHE A 1 376 ? -22.482 4.658   -23.075 1.00 52.26  ? 937  PHE A H    1 
ATOM   5534  H HA   . PHE A 1 376 ? -21.999 5.945   -20.735 1.00 53.03  ? 937  PHE A HA   1 
ATOM   5535  H HB2  . PHE A 1 376 ? -20.053 4.314   -21.972 1.00 49.94  ? 937  PHE A HB2  1 
ATOM   5536  H HB3  . PHE A 1 376 ? -19.860 5.106   -20.608 1.00 49.94  ? 937  PHE A HB3  1 
ATOM   5537  H HD1  . PHE A 1 376 ? -20.943 4.264   -18.570 1.00 57.32  ? 937  PHE A HD1  1 
ATOM   5538  H HD2  . PHE A 1 376 ? -21.129 2.178   -21.974 1.00 48.74  ? 937  PHE A HD2  1 
ATOM   5539  H HE1  . PHE A 1 376 ? -21.669 2.414   -17.397 1.00 49.96  ? 937  PHE A HE1  1 
ATOM   5540  H HE2  . PHE A 1 376 ? -21.854 0.329   -20.804 1.00 60.82  ? 937  PHE A HE2  1 
ATOM   5541  H HZ   . PHE A 1 376 ? -22.125 0.443   -18.513 1.00 56.86  ? 937  PHE A HZ   1 
ATOM   5542  N N    . PRO A 1 377 ? -21.921 7.817   -22.455 1.00 43.64  ? 938  PRO A N    1 
ATOM   5543  C CA   . PRO A 1 377 ? -21.658 8.873   -23.445 1.00 44.50  ? 938  PRO A CA   1 
ATOM   5544  C C    . PRO A 1 377 ? -20.341 9.600   -23.236 1.00 40.89  ? 938  PRO A C    1 
ATOM   5545  O O    . PRO A 1 377 ? -19.783 10.129  -24.205 1.00 42.59  ? 938  PRO A O    1 
ATOM   5546  C CB   . PRO A 1 377 ? -22.858 9.812   -23.266 1.00 48.01  ? 938  PRO A CB   1 
ATOM   5547  C CG   . PRO A 1 377 ? -23.227 9.638   -21.823 1.00 49.73  ? 938  PRO A CG   1 
ATOM   5548  C CD   . PRO A 1 377 ? -23.007 8.186   -21.530 1.00 46.23  ? 938  PRO A CD   1 
ATOM   5549  H HA   . PRO A 1 377 ? -21.677 8.502   -24.341 1.00 53.40  ? 938  PRO A HA   1 
ATOM   5550  H HB2  . PRO A 1 377 ? -22.594 10.727  -23.449 1.00 57.61  ? 938  PRO A HB2  1 
ATOM   5551  H HB3  . PRO A 1 377 ? -23.585 9.537   -23.846 1.00 57.61  ? 938  PRO A HB3  1 
ATOM   5552  H HG2  . PRO A 1 377 ? -22.652 10.190  -21.270 1.00 59.67  ? 938  PRO A HG2  1 
ATOM   5553  H HG3  . PRO A 1 377 ? -24.159 9.876   -21.694 1.00 59.67  ? 938  PRO A HG3  1 
ATOM   5554  H HD2  . PRO A 1 377 ? -22.724 8.066   -20.610 1.00 55.47  ? 938  PRO A HD2  1 
ATOM   5555  H HD3  . PRO A 1 377 ? -23.808 7.676   -21.727 1.00 55.47  ? 938  PRO A HD3  1 
ATOM   5556  N N    . HIS A 1 378 ? -19.835 9.655   -22.008 1.00 40.77  ? 939  HIS A N    1 
ATOM   5557  C CA   . HIS A 1 378 ? -18.575 10.325  -21.717 1.00 44.26  ? 939  HIS A CA   1 
ATOM   5558  C C    . HIS A 1 378 ? -17.375 9.396   -21.830 1.00 37.56  ? 939  HIS A C    1 
ATOM   5559  O O    . HIS A 1 378 ? -16.247 9.833   -21.579 1.00 40.75  ? 939  HIS A O    1 
ATOM   5560  C CB   . HIS A 1 378 ? -18.614 10.934  -20.311 1.00 46.45  ? 939  HIS A CB   1 
ATOM   5561  C CG   . HIS A 1 378 ? -19.709 11.936  -20.116 1.00 47.30  ? 939  HIS A CG   1 
ATOM   5562  N ND1  . HIS A 1 378 ? -19.545 13.279  -20.380 1.00 53.17  ? 939  HIS A ND1  1 
ATOM   5563  C CD2  . HIS A 1 378 ? -20.983 11.791  -19.683 1.00 48.74  ? 939  HIS A CD2  1 
ATOM   5564  C CE1  . HIS A 1 378 ? -20.671 13.918  -20.118 1.00 56.78  ? 939  HIS A CE1  1 
ATOM   5565  N NE2  . HIS A 1 378 ? -21.560 13.038  -19.694 1.00 58.17  ? 939  HIS A NE2  1 
ATOM   5566  H H    . HIS A 1 378 ? -20.209 9.306   -21.316 1.00 48.93  ? 939  HIS A H    1 
ATOM   5567  H HA   . HIS A 1 378 ? -18.452 11.049  -22.351 1.00 53.11  ? 939  HIS A HA   1 
ATOM   5568  H HB2  . HIS A 1 378 ? -18.746 10.221  -19.666 1.00 55.74  ? 939  HIS A HB2  1 
ATOM   5569  H HB3  . HIS A 1 378 ? -17.770 11.380  -20.139 1.00 55.74  ? 939  HIS A HB3  1 
ATOM   5570  H HD2  . HIS A 1 378 ? -21.392 10.996  -19.427 1.00 58.49  ? 939  HIS A HD2  1 
ATOM   5571  H HE1  . HIS A 1 378 ? -20.814 14.832  -20.216 1.00 68.13  ? 939  HIS A HE1  1 
ATOM   5572  H HE2  . HIS A 1 378 ? -22.369 13.216  -19.462 1.00 69.81  ? 939  HIS A HE2  1 
ATOM   5573  N N    . LEU A 1 379 ? -17.587 8.134   -22.207 1.00 34.10  ? 940  LEU A N    1 
ATOM   5574  C CA   . LEU A 1 379 ? -16.499 7.161   -22.204 1.00 34.86  ? 940  LEU A CA   1 
ATOM   5575  C C    . LEU A 1 379 ? -15.429 7.522   -23.226 1.00 30.52  ? 940  LEU A C    1 
ATOM   5576  O O    . LEU A 1 379 ? -14.240 7.597   -22.893 1.00 28.47  ? 940  LEU A O    1 
ATOM   5577  C CB   . LEU A 1 379 ? -17.052 5.761   -22.473 1.00 38.27  ? 940  LEU A CB   1 
ATOM   5578  C CG   . LEU A 1 379 ? -16.029 4.622   -22.502 1.00 29.92  ? 940  LEU A CG   1 
ATOM   5579  C CD1  . LEU A 1 379 ? -15.273 4.530   -21.181 1.00 27.94  ? 940  LEU A CD1  1 
ATOM   5580  C CD2  . LEU A 1 379 ? -16.712 3.303   -22.821 1.00 34.98  ? 940  LEU A CD2  1 
ATOM   5581  H H    . LEU A 1 379 ? -18.345 7.820   -22.465 1.00 40.92  ? 940  LEU A H    1 
ATOM   5582  H HA   . LEU A 1 379 ? -16.085 7.155   -21.327 1.00 41.83  ? 940  LEU A HA   1 
ATOM   5583  H HB2  . LEU A 1 379 ? -17.698 5.551   -21.781 1.00 45.93  ? 940  LEU A HB2  1 
ATOM   5584  H HB3  . LEU A 1 379 ? -17.497 5.770   -23.335 1.00 45.93  ? 940  LEU A HB3  1 
ATOM   5585  H HG   . LEU A 1 379 ? -15.382 4.799   -23.203 1.00 35.90  ? 940  LEU A HG   1 
ATOM   5586  H HD11 . LEU A 1 379 ? -14.635 3.801   -21.233 1.00 33.53  ? 940  LEU A HD11 1 
ATOM   5587  H HD12 . LEU A 1 379 ? -14.807 5.367   -21.025 1.00 33.53  ? 940  LEU A HD12 1 
ATOM   5588  H HD13 . LEU A 1 379 ? -15.906 4.365   -20.465 1.00 33.53  ? 940  LEU A HD13 1 
ATOM   5589  H HD21 . LEU A 1 379 ? -16.046 2.598   -22.833 1.00 41.98  ? 940  LEU A HD21 1 
ATOM   5590  H HD22 . LEU A 1 379 ? -17.376 3.119   -22.138 1.00 41.98  ? 940  LEU A HD22 1 
ATOM   5591  H HD23 . LEU A 1 379 ? -17.139 3.371   -23.689 1.00 41.98  ? 940  LEU A HD23 1 
ATOM   5592  N N    . LEU A 1 380 ? -15.830 7.747   -24.480 1.00 33.30  ? 941  LEU A N    1 
ATOM   5593  C CA   . LEU A 1 380 ? -14.858 8.016   -25.536 1.00 30.70  ? 941  LEU A CA   1 
ATOM   5594  C C    . LEU A 1 380 ? -14.109 9.320   -25.280 1.00 27.46  ? 941  LEU A C    1 
ATOM   5595  O O    . LEU A 1 380 ? -12.875 9.365   -25.355 1.00 24.67  ? 941  LEU A O    1 
ATOM   5596  C CB   . LEU A 1 380 ? -15.560 8.054   -26.894 1.00 38.31  ? 941  LEU A CB   1 
ATOM   5597  C CG   . LEU A 1 380 ? -14.682 8.311   -28.123 1.00 36.76  ? 941  LEU A CG   1 
ATOM   5598  C CD1  . LEU A 1 380 ? -13.457 7.405   -28.142 1.00 38.76  ? 941  LEU A CD1  1 
ATOM   5599  C CD2  . LEU A 1 380 ? -15.497 8.119   -29.392 1.00 42.36  ? 941  LEU A CD2  1 
ATOM   5600  H H    . LEU A 1 380 ? -16.650 7.750   -24.740 1.00 39.96  ? 941  LEU A H    1 
ATOM   5601  H HA   . LEU A 1 380 ? -14.207 7.297   -25.555 1.00 36.84  ? 941  LEU A HA   1 
ATOM   5602  H HB2  . LEU A 1 380 ? -15.999 7.199   -27.031 1.00 45.98  ? 941  LEU A HB2  1 
ATOM   5603  H HB3  . LEU A 1 380 ? -16.229 8.755   -26.869 1.00 45.98  ? 941  LEU A HB3  1 
ATOM   5604  H HG   . LEU A 1 380 ? -14.373 9.231   -28.103 1.00 44.11  ? 941  LEU A HG   1 
ATOM   5605  H HD11 . LEU A 1 380 ? -12.932 7.601   -28.933 1.00 46.52  ? 941  LEU A HD11 1 
ATOM   5606  H HD12 . LEU A 1 380 ? -12.930 7.571   -27.345 1.00 46.52  ? 941  LEU A HD12 1 
ATOM   5607  H HD13 . LEU A 1 380 ? -13.749 6.480   -28.159 1.00 46.52  ? 941  LEU A HD13 1 
ATOM   5608  H HD21 . LEU A 1 380 ? -14.928 8.285   -30.160 1.00 50.83  ? 941  LEU A HD21 1 
ATOM   5609  H HD22 . LEU A 1 380 ? -15.830 7.208   -29.418 1.00 50.83  ? 941  LEU A HD22 1 
ATOM   5610  H HD23 . LEU A 1 380 ? -16.239 8.743   -29.388 1.00 50.83  ? 941  LEU A HD23 1 
ATOM   5611  N N    . ALA A 1 381 ? -14.842 10.396  -24.979 1.00 27.93  ? 942  ALA A N    1 
ATOM   5612  C CA   . ALA A 1 381 ? -14.208 11.687  -24.731 1.00 29.44  ? 942  ALA A CA   1 
ATOM   5613  C C    . ALA A 1 381 ? -13.246 11.612  -23.552 1.00 30.43  ? 942  ALA A C    1 
ATOM   5614  O O    . ALA A 1 381 ? -12.110 12.093  -23.629 1.00 27.78  ? 942  ALA A O    1 
ATOM   5615  C CB   . ALA A 1 381 ? -15.270 12.756  -24.481 1.00 25.69  ? 942  ALA A CB   1 
ATOM   5616  H H    . ALA A 1 381 ? -15.700 10.402  -24.913 1.00 33.52  ? 942  ALA A H    1 
ATOM   5617  H HA   . ALA A 1 381 ? -13.700 11.946  -25.516 1.00 35.32  ? 942  ALA A HA   1 
ATOM   5618  H HB1  . ALA A 1 381 ? -14.831 13.605  -24.318 1.00 30.83  ? 942  ALA A HB1  1 
ATOM   5619  H HB2  . ALA A 1 381 ? -15.841 12.822  -25.262 1.00 30.83  ? 942  ALA A HB2  1 
ATOM   5620  H HB3  . ALA A 1 381 ? -15.796 12.502  -23.706 1.00 30.83  ? 942  ALA A HB3  1 
ATOM   5621  N N    . HIS A 1 382 ? -13.690 11.016  -22.443 1.00 29.09  ? 943  HIS A N    1 
ATOM   5622  C CA   . HIS A 1 382 ? -12.828 10.890  -21.273 1.00 26.88  ? 943  HIS A CA   1 
ATOM   5623  C C    . HIS A 1 382 ? -11.586 10.068  -21.594 1.00 29.20  ? 943  HIS A C    1 
ATOM   5624  O O    . HIS A 1 382 ? -10.463 10.455  -21.249 1.00 27.60  ? 943  HIS A O    1 
ATOM   5625  C CB   . HIS A 1 382 ? -13.601 10.256  -20.117 1.00 38.73  ? 943  HIS A CB   1 
ATOM   5626  C CG   . HIS A 1 382 ? -12.740 9.887   -18.950 1.00 37.91  ? 943  HIS A CG   1 
ATOM   5627  N ND1  . HIS A 1 382 ? -12.510 10.741  -17.893 1.00 36.45  ? 943  HIS A ND1  1 
ATOM   5628  C CD2  . HIS A 1 382 ? -12.042 8.759   -18.681 1.00 33.32  ? 943  HIS A CD2  1 
ATOM   5629  C CE1  . HIS A 1 382 ? -11.713 10.152  -17.020 1.00 42.26  ? 943  HIS A CE1  1 
ATOM   5630  N NE2  . HIS A 1 382 ? -11.414 8.949   -17.475 1.00 44.22  ? 943  HIS A NE2  1 
ATOM   5631  H H    . HIS A 1 382 ? -14.477 10.681  -22.346 1.00 34.90  ? 943  HIS A H    1 
ATOM   5632  H HA   . HIS A 1 382 ? -12.541 11.773  -20.994 1.00 32.26  ? 943  HIS A HA   1 
ATOM   5633  H HB2  . HIS A 1 382 ? -14.270 10.886  -19.805 1.00 46.48  ? 943  HIS A HB2  1 
ATOM   5634  H HB3  . HIS A 1 382 ? -14.033 9.448   -20.435 1.00 46.48  ? 943  HIS A HB3  1 
ATOM   5635  H HD2  . HIS A 1 382 ? -11.998 7.997   -19.212 1.00 39.98  ? 943  HIS A HD2  1 
ATOM   5636  H HE1  . HIS A 1 382 ? -11.413 10.522  -16.221 1.00 50.71  ? 943  HIS A HE1  1 
ATOM   5637  H HE2  . HIS A 1 382 ? -10.909 8.377   -17.079 1.00 53.06  ? 943  HIS A HE2  1 
ATOM   5638  N N    . THR A 1 383 ? -11.770 8.924   -22.255 1.00 30.81  ? 944  THR A N    1 
ATOM   5639  C CA   . THR A 1 383 ? -10.636 8.062   -22.570 1.00 29.72  ? 944  THR A CA   1 
ATOM   5640  C C    . THR A 1 383 ? -9.670  8.753   -23.524 1.00 29.56  ? 944  THR A C    1 
ATOM   5641  O O    . THR A 1 383 ? -8.449  8.617   -23.386 1.00 27.97  ? 944  THR A O    1 
ATOM   5642  C CB   . THR A 1 383 ? -11.129 6.742   -23.164 1.00 31.62  ? 944  THR A CB   1 
ATOM   5643  O OG1  . THR A 1 383 ? -12.159 6.192   -22.331 1.00 32.50  ? 944  THR A OG1  1 
ATOM   5644  C CG2  . THR A 1 383 ? -9.990  5.740   -23.271 1.00 31.76  ? 944  THR A CG2  1 
ATOM   5645  H H    . THR A 1 383 ? -12.530 8.629   -22.527 1.00 36.98  ? 944  THR A H    1 
ATOM   5646  H HA   . THR A 1 383 ? -10.155 7.861   -21.751 1.00 35.66  ? 944  THR A HA   1 
ATOM   5647  H HB   . THR A 1 383 ? -11.483 6.900   -24.053 1.00 37.94  ? 944  THR A HB   1 
ATOM   5648  H HG1  . THR A 1 383 ? -12.804 6.728   -22.279 1.00 39.00  ? 944  THR A HG1  1 
ATOM   5649  H HG21 . THR A 1 383 ? -10.314 4.908   -23.649 1.00 38.11  ? 944  THR A HG21 1 
ATOM   5650  H HG22 . THR A 1 383 ? -9.290  6.094   -23.842 1.00 38.11  ? 944  THR A HG22 1 
ATOM   5651  H HG23 . THR A 1 383 ? -9.620  5.564   -22.392 1.00 38.11  ? 944  THR A HG23 1 
ATOM   5652  N N    . TYR A 1 384 ? -10.198 9.511   -24.488 1.00 29.93  ? 945  TYR A N    1 
ATOM   5653  C CA   . TYR A 1 384 ? -9.342  10.205  -25.445 1.00 31.13  ? 945  TYR A CA   1 
ATOM   5654  C C    . TYR A 1 384 ? -8.433  11.209  -24.744 1.00 33.65  ? 945  TYR A C    1 
ATOM   5655  O O    . TYR A 1 384 ? -7.227  11.268  -25.015 1.00 37.04  ? 945  TYR A O    1 
ATOM   5656  C CB   . TYR A 1 384 ? -10.203 10.898  -26.501 1.00 29.85  ? 945  TYR A CB   1 
ATOM   5657  C CG   . TYR A 1 384 ? -9.415  11.488  -27.650 1.00 33.90  ? 945  TYR A CG   1 
ATOM   5658  C CD1  . TYR A 1 384 ? -8.855  10.671  -28.624 1.00 39.48  ? 945  TYR A CD1  1 
ATOM   5659  C CD2  . TYR A 1 384 ? -9.241  12.862  -27.770 1.00 34.02  ? 945  TYR A CD2  1 
ATOM   5660  C CE1  . TYR A 1 384 ? -8.138  11.204  -29.681 1.00 39.53  ? 945  TYR A CE1  1 
ATOM   5661  C CE2  . TYR A 1 384 ? -8.525  13.403  -28.824 1.00 36.95  ? 945  TYR A CE2  1 
ATOM   5662  C CZ   . TYR A 1 384 ? -7.977  12.570  -29.776 1.00 37.81  ? 945  TYR A CZ   1 
ATOM   5663  O OH   . TYR A 1 384 ? -7.266  13.108  -30.823 1.00 34.91  ? 945  TYR A OH   1 
ATOM   5664  H H    . TYR A 1 384 ? -11.040 9.637   -24.606 1.00 35.92  ? 945  TYR A H    1 
ATOM   5665  H HA   . TYR A 1 384 ? -8.780  9.555   -25.896 1.00 37.35  ? 945  TYR A HA   1 
ATOM   5666  H HB2  . TYR A 1 384 ? -10.825 10.251  -26.870 1.00 35.83  ? 945  TYR A HB2  1 
ATOM   5667  H HB3  . TYR A 1 384 ? -10.695 11.620  -26.078 1.00 35.83  ? 945  TYR A HB3  1 
ATOM   5668  H HD1  . TYR A 1 384 ? -8.962  9.749   -28.563 1.00 47.38  ? 945  TYR A HD1  1 
ATOM   5669  H HD2  . TYR A 1 384 ? -9.610  13.427  -27.130 1.00 40.82  ? 945  TYR A HD2  1 
ATOM   5670  H HE1  . TYR A 1 384 ? -7.767  10.644  -30.324 1.00 47.43  ? 945  TYR A HE1  1 
ATOM   5671  H HE2  . TYR A 1 384 ? -8.415  14.324  -28.891 1.00 44.34  ? 945  TYR A HE2  1 
ATOM   5672  H HH   . TYR A 1 384 ? -6.988  12.495  -31.327 1.00 41.89  ? 945  TYR A HH   1 
ATOM   5673  N N    . ARG A 1 385 ? -8.992  12.008  -23.831 1.00 34.21  ? 946  ARG A N    1 
ATOM   5674  C CA   . ARG A 1 385 ? -8.183  13.014  -23.149 1.00 40.35  ? 946  ARG A CA   1 
ATOM   5675  C C    . ARG A 1 385 ? -7.218  12.379  -22.156 1.00 34.03  ? 946  ARG A C    1 
ATOM   5676  O O    . ARG A 1 385 ? -6.089  12.857  -21.990 1.00 39.72  ? 946  ARG A O    1 
ATOM   5677  C CB   . ARG A 1 385 ? -9.082  14.038  -22.449 1.00 43.42  ? 946  ARG A CB   1 
ATOM   5678  C CG   . ARG A 1 385 ? -9.756  15.052  -23.383 1.00 58.63  ? 946  ARG A CG   1 
ATOM   5679  C CD   . ARG A 1 385 ? -8.737  15.842  -24.209 1.00 75.62  ? 946  ARG A CD   1 
ATOM   5680  N NE   . ARG A 1 385 ? -9.341  16.531  -25.343 1.00 69.71  ? 946  ARG A NE   1 
ATOM   5681  C CZ   . ARG A 1 385 ? -8.700  16.836  -26.469 1.00 59.22  ? 946  ARG A CZ   1 
ATOM   5682  N NH1  . ARG A 1 385 ? -7.422  16.515  -26.633 1.00 61.86  ? 946  ARG A NH1  1 
ATOM   5683  N NH2  . ARG A 1 385 ? -9.342  17.464  -27.443 1.00 53.04  ? 946  ARG A NH2  1 
ATOM   5684  H H    . ARG A 1 385 ? -9.819  11.987  -23.594 1.00 41.05  ? 946  ARG A H    1 
ATOM   5685  H HA   . ARG A 1 385 ? -7.655  13.488  -23.810 1.00 48.42  ? 946  ARG A HA   1 
ATOM   5686  H HB2  . ARG A 1 385 ? -9.783  13.563  -21.978 1.00 52.11  ? 946  ARG A HB2  1 
ATOM   5687  H HB3  . ARG A 1 385 ? -8.544  14.538  -21.814 1.00 52.11  ? 946  ARG A HB3  1 
ATOM   5688  H HG2  . ARG A 1 385 ? -10.340 14.579  -23.996 1.00 70.35  ? 946  ARG A HG2  1 
ATOM   5689  H HG3  . ARG A 1 385 ? -10.268 15.682  -22.852 1.00 70.35  ? 946  ARG A HG3  1 
ATOM   5690  H HD2  . ARG A 1 385 ? -8.319  16.508  -23.641 1.00 90.74  ? 946  ARG A HD2  1 
ATOM   5691  H HD3  . ARG A 1 385 ? -8.066  15.231  -24.552 1.00 90.74  ? 946  ARG A HD3  1 
ATOM   5692  H HE   . ARG A 1 385 ? -10.168 16.755  -25.279 1.00 83.66  ? 946  ARG A HE   1 
ATOM   5693  H HH11 . ARG A 1 385 ? -6.997  16.106  -26.006 1.00 74.23  ? 946  ARG A HH11 1 
ATOM   5694  H HH12 . ARG A 1 385 ? -7.018  16.716  -27.365 1.00 74.23  ? 946  ARG A HH12 1 
ATOM   5695  H HH21 . ARG A 1 385 ? -10.170 17.675  -27.346 1.00 63.64  ? 946  ARG A HH21 1 
ATOM   5696  H HH22 . ARG A 1 385 ? -8.931  17.662  -28.172 1.00 63.64  ? 946  ARG A HH22 1 
ATOM   5697  N N    . ALA A 1 386 ? -7.635  11.305  -21.487 1.00 30.80  ? 947  ALA A N    1 
ATOM   5698  C CA   . ALA A 1 386 ? -6.752  10.659  -20.523 1.00 39.82  ? 947  ALA A CA   1 
ATOM   5699  C C    . ALA A 1 386 ? -5.553  10.006  -21.200 1.00 40.89  ? 947  ALA A C    1 
ATOM   5700  O O    . ALA A 1 386 ? -4.454  9.992   -20.631 1.00 46.60  ? 947  ALA A O    1 
ATOM   5701  C CB   . ALA A 1 386 ? -7.526  9.620   -19.715 1.00 36.06  ? 947  ALA A CB   1 
ATOM   5702  H H    . ALA A 1 386 ? -8.408  10.938  -21.572 1.00 36.96  ? 947  ALA A H    1 
ATOM   5703  H HA   . ALA A 1 386 ? -6.418  11.329  -19.907 1.00 47.78  ? 947  ALA A HA   1 
ATOM   5704  H HB1  . ALA A 1 386 ? -6.923  9.202   -19.080 1.00 43.27  ? 947  ALA A HB1  1 
ATOM   5705  H HB2  . ALA A 1 386 ? -8.249  10.063  -19.243 1.00 43.27  ? 947  ALA A HB2  1 
ATOM   5706  H HB3  . ALA A 1 386 ? -7.884  8.953   -20.320 1.00 43.27  ? 947  ALA A HB3  1 
ATOM   5707  N N    . MET A 1 387 ? -5.733  9.478   -22.410 1.00 37.83  ? 948  MET A N    1 
ATOM   5708  C CA   . MET A 1 387 ? -4.694  8.699   -23.071 1.00 46.87  ? 948  MET A CA   1 
ATOM   5709  C C    . MET A 1 387 ? -3.696  9.551   -23.846 1.00 48.12  ? 948  MET A C    1 
ATOM   5710  O O    . MET A 1 387 ? -2.802  8.990   -24.490 1.00 54.09  ? 948  MET A O    1 
ATOM   5711  C CB   . MET A 1 387 ? -5.329  7.667   -24.011 1.00 50.74  ? 948  MET A CB   1 
ATOM   5712  C CG   . MET A 1 387 ? -6.073  6.542   -23.297 1.00 46.84  ? 948  MET A CG   1 
ATOM   5713  S SD   . MET A 1 387 ? -5.079  5.675   -22.066 1.00 43.13  ? 948  MET A SD   1 
ATOM   5714  C CE   . MET A 1 387 ? -3.788  4.974   -23.090 1.00 42.21  ? 948  MET A CE   1 
ATOM   5715  H H    . MET A 1 387 ? -6.455  9.560   -22.871 1.00 45.40  ? 948  MET A H    1 
ATOM   5716  H HA   . MET A 1 387 ? -4.207  8.207   -22.391 1.00 56.25  ? 948  MET A HA   1 
ATOM   5717  H HB2  . MET A 1 387 ? -5.963  8.120   -24.588 1.00 60.89  ? 948  MET A HB2  1 
ATOM   5718  H HB3  . MET A 1 387 ? -4.629  7.263   -24.548 1.00 60.89  ? 948  MET A HB3  1 
ATOM   5719  H HG2  . MET A 1 387 ? -6.844  6.917   -22.844 1.00 56.21  ? 948  MET A HG2  1 
ATOM   5720  H HG3  . MET A 1 387 ? -6.362  5.892   -23.956 1.00 56.21  ? 948  MET A HG3  1 
ATOM   5721  H HE1  . MET A 1 387 ? -3.177  4.473   -22.528 1.00 50.65  ? 948  MET A HE1  1 
ATOM   5722  H HE2  . MET A 1 387 ? -4.191  4.386   -23.748 1.00 50.65  ? 948  MET A HE2  1 
ATOM   5723  H HE3  . MET A 1 387 ? -3.314  5.693   -23.536 1.00 50.65  ? 948  MET A HE3  1 
ATOM   5724  N N    . GLU A 1 388 ? -3.823  10.880  -23.816 1.00 53.53  ? 949  GLU A N    1 
ATOM   5725  C CA   . GLU A 1 388 ? -2.831  11.729  -24.466 1.00 56.22  ? 949  GLU A CA   1 
ATOM   5726  C C    . GLU A 1 388 ? -1.427  11.502  -23.920 1.00 56.07  ? 949  GLU A C    1 
ATOM   5727  O O    . GLU A 1 388 ? -0.451  11.857  -24.590 1.00 55.73  ? 949  GLU A O    1 
ATOM   5728  C CB   . GLU A 1 388 ? -3.202  13.203  -24.305 1.00 56.39  ? 949  GLU A CB   1 
ATOM   5729  C CG   . GLU A 1 388 ? -4.415  13.634  -25.105 1.00 58.04  ? 949  GLU A CG   1 
ATOM   5730  C CD   . GLU A 1 388 ? -4.642  15.131  -25.039 1.00 67.04  ? 949  GLU A CD   1 
ATOM   5731  O OE1  . GLU A 1 388 ? -3.781  15.885  -25.540 1.00 63.82  ? 949  GLU A OE1  1 
ATOM   5732  O OE2  . GLU A 1 388 ? -5.672  15.555  -24.478 1.00 78.07  ? 949  GLU A OE2  1 
ATOM   5733  H H    . GLU A 1 388 ? -4.464  11.305  -23.432 1.00 64.24  ? 949  GLU A H    1 
ATOM   5734  H HA   . GLU A 1 388 ? -2.818  11.527  -25.415 1.00 67.46  ? 949  GLU A HA   1 
ATOM   5735  H HB2  . GLU A 1 388 ? -3.389  13.376  -23.369 1.00 67.66  ? 949  GLU A HB2  1 
ATOM   5736  H HB3  . GLU A 1 388 ? -2.451  13.746  -24.593 1.00 67.66  ? 949  GLU A HB3  1 
ATOM   5737  H HG2  . GLU A 1 388 ? -4.287  13.389  -26.034 1.00 69.65  ? 949  GLU A HG2  1 
ATOM   5738  H HG3  . GLU A 1 388 ? -5.203  13.194  -24.749 1.00 69.65  ? 949  GLU A HG3  1 
ATOM   5739  N N    . LEU A 1 389 ? -1.301  10.929  -22.719 1.00 52.45  ? 950  LEU A N    1 
ATOM   5740  C CA   . LEU A 1 389 ? 0.019   10.604  -22.189 1.00 53.46  ? 950  LEU A CA   1 
ATOM   5741  C C    . LEU A 1 389 ? 0.768   9.649   -23.110 1.00 58.22  ? 950  LEU A C    1 
ATOM   5742  O O    . LEU A 1 389 ? 2.004   9.644   -23.128 1.00 57.64  ? 950  LEU A O    1 
ATOM   5743  C CB   . LEU A 1 389 ? -0.114  10.001  -20.789 1.00 53.36  ? 950  LEU A CB   1 
ATOM   5744  C CG   . LEU A 1 389 ? -0.464  10.974  -19.659 1.00 54.28  ? 950  LEU A CG   1 
ATOM   5745  C CD1  . LEU A 1 389 ? -0.968  10.220  -18.438 1.00 57.47  ? 950  LEU A CD1  1 
ATOM   5746  C CD2  . LEU A 1 389 ? 0.740   11.828  -19.292 1.00 54.93  ? 950  LEU A CD2  1 
ATOM   5747  H H    . LEU A 1 389 ? -1.956  10.723  -22.201 1.00 62.94  ? 950  LEU A H    1 
ATOM   5748  H HA   . LEU A 1 389 ? 0.540   11.419  -22.116 1.00 64.15  ? 950  LEU A HA   1 
ATOM   5749  H HB2  . LEU A 1 389 ? -0.810  9.326   -20.814 1.00 64.03  ? 950  LEU A HB2  1 
ATOM   5750  H HB3  . LEU A 1 389 ? 0.730   9.583   -20.557 1.00 64.03  ? 950  LEU A HB3  1 
ATOM   5751  H HG   . LEU A 1 389 ? -1.172  11.566  -19.959 1.00 65.14  ? 950  LEU A HG   1 
ATOM   5752  H HD11 . LEU A 1 389 ? -1.182  10.858  -17.740 1.00 68.96  ? 950  LEU A HD11 1 
ATOM   5753  H HD12 . LEU A 1 389 ? -1.761  9.718   -18.683 1.00 68.96  ? 950  LEU A HD12 1 
ATOM   5754  H HD13 . LEU A 1 389 ? -0.274  9.615   -18.133 1.00 68.96  ? 950  LEU A HD13 1 
ATOM   5755  H HD21 . LEU A 1 389 ? 0.491   12.433  -18.576 1.00 65.91  ? 950  LEU A HD21 1 
ATOM   5756  H HD22 . LEU A 1 389 ? 1.461   11.248  -18.999 1.00 65.91  ? 950  LEU A HD22 1 
ATOM   5757  H HD23 . LEU A 1 389 ? 1.018   12.334  -20.071 1.00 65.91  ? 950  LEU A HD23 1 
ATOM   5758  N N    . CYS A 1 390 ? 0.039   8.832   -23.871 1.00 56.87  ? 951  CYS A N    1 
ATOM   5759  C CA   . CYS A 1 390 ? 0.615   7.919   -24.851 1.00 59.12  ? 951  CYS A CA   1 
ATOM   5760  C C    . CYS A 1 390 ? 0.634   8.494   -26.262 1.00 60.36  ? 951  CYS A C    1 
ATOM   5761  O O    . CYS A 1 390 ? 1.020   7.785   -27.197 1.00 62.82  ? 951  CYS A O    1 
ATOM   5762  C CB   . CYS A 1 390 ? -0.158  6.595   -24.845 1.00 57.03  ? 951  CYS A CB   1 
ATOM   5763  S SG   . CYS A 1 390 ? -0.184  5.775   -23.234 1.00 53.60  ? 951  CYS A SG   1 
ATOM   5764  H H    . CYS A 1 390 ? -0.819  8.789   -23.833 1.00 68.25  ? 951  CYS A H    1 
ATOM   5765  H HA   . CYS A 1 390 ? 1.531   7.727   -24.597 1.00 70.94  ? 951  CYS A HA   1 
ATOM   5766  H HB2  . CYS A 1 390 ? -1.076  6.768   -25.105 1.00 68.44  ? 951  CYS A HB2  1 
ATOM   5767  H HB3  . CYS A 1 390 ? 0.255   5.990   -25.480 1.00 68.44  ? 951  CYS A HB3  1 
ATOM   5768  H HG   . CYS A 1 390 ? -0.807  4.753   -23.326 1.00 64.32  ? 951  CYS A HG   1 
ATOM   5769  N N    . SER A 1 391 ? 0.215   9.751   -26.439 1.00 63.89  ? 952  SER A N    1 
ATOM   5770  C CA   . SER A 1 391 ? 0.059   10.317  -27.777 1.00 60.67  ? 952  SER A CA   1 
ATOM   5771  C C    . SER A 1 391 ? 1.348   10.246  -28.588 1.00 61.71  ? 952  SER A C    1 
ATOM   5772  O O    . SER A 1 391 ? 1.298   10.172  -29.821 1.00 59.44  ? 952  SER A O    1 
ATOM   5773  C CB   . SER A 1 391 ? -0.415  11.768  -27.676 1.00 57.80  ? 952  SER A CB   1 
ATOM   5774  O OG   . SER A 1 391 ? 0.547   12.575  -27.019 1.00 70.34  ? 952  SER A OG   1 
ATOM   5775  H H    . SER A 1 391 ? 0.016   10.293  -25.801 1.00 76.67  ? 952  SER A H    1 
ATOM   5776  H HA   . SER A 1 391 ? -0.620  9.814   -28.253 1.00 72.81  ? 952  SER A HA   1 
ATOM   5777  H HB2  . SER A 1 391 ? -0.559  12.115  -28.571 1.00 69.36  ? 952  SER A HB2  1 
ATOM   5778  H HB3  . SER A 1 391 ? -1.244  11.793  -27.174 1.00 69.36  ? 952  SER A HB3  1 
ATOM   5779  H HG   . SER A 1 391 ? 0.681   12.286  -26.241 1.00 84.41  ? 952  SER A HG   1 
ATOM   5780  N N    . HIS A 1 392 ? 2.505   10.268  -27.925 1.00 64.63  ? 953  HIS A N    1 
ATOM   5781  C CA   . HIS A 1 392 ? 3.772   10.222  -28.649 1.00 68.45  ? 953  HIS A CA   1 
ATOM   5782  C C    . HIS A 1 392 ? 4.042   8.839   -29.227 1.00 68.87  ? 953  HIS A C    1 
ATOM   5783  O O    . HIS A 1 392 ? 4.752   8.717   -30.232 1.00 68.89  ? 953  HIS A O    1 
ATOM   5784  C CB   . HIS A 1 392 ? 4.919   10.637  -27.728 1.00 70.63  ? 953  HIS A CB   1 
ATOM   5785  C CG   . HIS A 1 392 ? 5.072   9.761   -26.523 1.00 70.95  ? 953  HIS A CG   1 
ATOM   5786  N ND1  . HIS A 1 392 ? 4.303   9.914   -25.389 1.00 67.75  ? 953  HIS A ND1  1 
ATOM   5787  C CD2  . HIS A 1 392 ? 5.905   8.723   -26.275 1.00 72.29  ? 953  HIS A CD2  1 
ATOM   5788  C CE1  . HIS A 1 392 ? 4.656   9.008   -24.495 1.00 69.62  ? 953  HIS A CE1  1 
ATOM   5789  N NE2  . HIS A 1 392 ? 5.625   8.273   -25.007 1.00 74.94  ? 953  HIS A NE2  1 
ATOM   5790  H H    . HIS A 1 392 ? 2.582   10.309  -27.069 1.00 77.55  ? 953  HIS A H    1 
ATOM   5791  H HA   . HIS A 1 392 ? 3.736   10.852  -29.385 1.00 82.13  ? 953  HIS A HA   1 
ATOM   5792  H HB2  . HIS A 1 392 ? 5.749   10.602  -28.227 1.00 84.75  ? 953  HIS A HB2  1 
ATOM   5793  H HB3  . HIS A 1 392 ? 4.759   11.542  -27.418 1.00 84.75  ? 953  HIS A HB3  1 
ATOM   5794  H HD2  . HIS A 1 392 ? 6.546   8.379   -26.854 1.00 86.75  ? 953  HIS A HD2  1 
ATOM   5795  H HE1  . HIS A 1 392 ? 4.284   8.906   -23.648 1.00 83.54  ? 953  HIS A HE1  1 
ATOM   5796  H HE2  . HIS A 1 392 ? 6.019   7.618   -24.611 1.00 89.93  ? 953  HIS A HE2  1 
ATOM   5797  N N    . GLU A 1 393 ? 3.488   7.796   -28.616 1.00 71.21  ? 954  GLU A N    1 
ATOM   5798  C CA   . GLU A 1 393 ? 3.772   6.435   -29.042 1.00 68.83  ? 954  GLU A CA   1 
ATOM   5799  C C    . GLU A 1 393 ? 3.137   6.144   -30.398 1.00 63.44  ? 954  GLU A C    1 
ATOM   5800  O O    . GLU A 1 393 ? 2.084   6.683   -30.750 1.00 59.30  ? 954  GLU A O    1 
ATOM   5801  C CB   . GLU A 1 393 ? 3.272   5.445   -27.991 1.00 63.88  ? 954  GLU A CB   1 
ATOM   5802  C CG   . GLU A 1 393 ? 3.958   5.610   -26.637 1.00 68.60  ? 954  GLU A CG   1 
ATOM   5803  C CD   . GLU A 1 393 ? 3.281   4.828   -25.528 1.00 67.56  ? 954  GLU A CD   1 
ATOM   5804  O OE1  . GLU A 1 393 ? 2.206   4.243   -25.775 1.00 67.03  ? 954  GLU A OE1  1 
ATOM   5805  O OE2  . GLU A 1 393 ? 3.827   4.802   -24.405 1.00 65.35  ? 954  GLU A OE2  1 
ATOM   5806  H H    . GLU A 1 393 ? 2.944   7.852   -27.953 1.00 85.45  ? 954  GLU A H    1 
ATOM   5807  H HA   . GLU A 1 393 ? 4.732   6.323   -29.128 1.00 82.60  ? 954  GLU A HA   1 
ATOM   5808  H HB2  . GLU A 1 393 ? 2.320   5.577   -27.862 1.00 76.66  ? 954  GLU A HB2  1 
ATOM   5809  H HB3  . GLU A 1 393 ? 3.441   4.542   -28.304 1.00 76.66  ? 954  GLU A HB3  1 
ATOM   5810  H HG2  . GLU A 1 393 ? 4.873   5.297   -26.708 1.00 82.32  ? 954  GLU A HG2  1 
ATOM   5811  H HG3  . GLU A 1 393 ? 3.947   6.548   -26.392 1.00 82.32  ? 954  GLU A HG3  1 
ATOM   5812  N N    . ARG A 1 394 ? 3.800   5.273   -31.163 1.00 63.59  ? 955  ARG A N    1 
ATOM   5813  C CA   . ARG A 1 394 ? 3.376   4.970   -32.525 1.00 58.91  ? 955  ARG A CA   1 
ATOM   5814  C C    . ARG A 1 394 ? 2.025   4.271   -32.577 1.00 58.74  ? 955  ARG A C    1 
ATOM   5815  O O    . ARG A 1 394 ? 1.350   4.336   -33.610 1.00 56.46  ? 955  ARG A O    1 
ATOM   5816  C CB   . ARG A 1 394 ? 4.439   4.107   -33.208 1.00 64.40  ? 955  ARG A CB   1 
ATOM   5817  C CG   . ARG A 1 394 ? 4.118   3.711   -34.638 1.00 57.40  ? 955  ARG A CG   1 
ATOM   5818  C CD   . ARG A 1 394 ? 5.335   3.100   -35.315 1.00 58.46  ? 955  ARG A CD   1 
ATOM   5819  N NE   . ARG A 1 394 ? 5.027   2.584   -36.644 1.00 61.82  ? 955  ARG A NE   1 
ATOM   5820  C CZ   . ARG A 1 394 ? 5.939   2.217   -37.539 1.00 62.00  ? 955  ARG A CZ   1 
ATOM   5821  N NH1  . ARG A 1 394 ? 7.231   2.315   -37.262 1.00 58.74  ? 955  ARG A NH1  1 
ATOM   5822  N NH2  . ARG A 1 394 ? 5.556   1.756   -38.723 1.00 69.25  ? 955  ARG A NH2  1 
ATOM   5823  H H    . ARG A 1 394 ? 4.503   4.845   -30.912 1.00 76.31  ? 955  ARG A H    1 
ATOM   5824  H HA   . ARG A 1 394 ? 3.302   5.800   -33.022 1.00 70.69  ? 955  ARG A HA   1 
ATOM   5825  H HB2  . ARG A 1 394 ? 5.275   4.598   -33.221 1.00 77.28  ? 955  ARG A HB2  1 
ATOM   5826  H HB3  . ARG A 1 394 ? 4.549   3.290   -32.696 1.00 77.28  ? 955  ARG A HB3  1 
ATOM   5827  H HG2  . ARG A 1 394 ? 3.405   3.053   -34.638 1.00 68.88  ? 955  ARG A HG2  1 
ATOM   5828  H HG3  . ARG A 1 394 ? 3.852   4.498   -35.138 1.00 68.88  ? 955  ARG A HG3  1 
ATOM   5829  H HD2  . ARG A 1 394 ? 6.021   3.779   -35.407 1.00 70.15  ? 955  ARG A HD2  1 
ATOM   5830  H HD3  . ARG A 1 394 ? 5.664   2.365   -34.774 1.00 70.15  ? 955  ARG A HD3  1 
ATOM   5831  H HE   . ARG A 1 394 ? 4.198   2.511   -36.863 1.00 74.18  ? 955  ARG A HE   1 
ATOM   5832  H HH11 . ARG A 1 394 ? 7.485   2.613   -36.496 1.00 70.48  ? 955  ARG A HH11 1 
ATOM   5833  H HH12 . ARG A 1 394 ? 7.816   2.077   -37.846 1.00 70.48  ? 955  ARG A HH12 1 
ATOM   5834  H HH21 . ARG A 1 394 ? 4.718   1.692   -38.909 1.00 83.09  ? 955  ARG A HH21 1 
ATOM   5835  H HH22 . ARG A 1 394 ? 6.145   1.521   -39.304 1.00 83.09  ? 955  ARG A HH22 1 
ATOM   5836  N N    . LEU A 1 395 ? 1.614   3.609   -31.494 1.00 57.35  ? 956  LEU A N    1 
ATOM   5837  C CA   . LEU A 1 395 ? 0.342   2.895   -31.508 1.00 52.86  ? 956  LEU A CA   1 
ATOM   5838  C C    . LEU A 1 395 ? -0.831  3.861   -31.624 1.00 49.19  ? 956  LEU A C    1 
ATOM   5839  O O    . LEU A 1 395 ? -1.814  3.572   -32.315 1.00 50.18  ? 956  LEU A O    1 
ATOM   5840  C CB   . LEU A 1 395 ? 0.215   2.036   -30.248 1.00 53.55  ? 956  LEU A CB   1 
ATOM   5841  C CG   . LEU A 1 395 ? -1.006  1.117   -30.144 1.00 52.39  ? 956  LEU A CG   1 
ATOM   5842  C CD1  . LEU A 1 395 ? -1.052  0.124   -31.296 1.00 44.64  ? 956  LEU A CD1  1 
ATOM   5843  C CD2  . LEU A 1 395 ? -1.003  0.382   -28.810 1.00 44.94  ? 956  LEU A CD2  1 
ATOM   5844  H H    . LEU A 1 395 ? 2.046   3.560   -30.752 1.00 68.82  ? 956  LEU A H    1 
ATOM   5845  H HA   . LEU A 1 395 ? 0.321   2.304   -32.277 1.00 63.43  ? 956  LEU A HA   1 
ATOM   5846  H HB2  . LEU A 1 395 ? 1.002   1.471   -30.189 1.00 64.26  ? 956  LEU A HB2  1 
ATOM   5847  H HB3  . LEU A 1 395 ? 0.191   2.629   -29.481 1.00 64.26  ? 956  LEU A HB3  1 
ATOM   5848  H HG   . LEU A 1 395 ? -1.810  1.658   -30.185 1.00 62.87  ? 956  LEU A HG   1 
ATOM   5849  H HD11 . LEU A 1 395 ? -1.836  -0.439  -31.196 1.00 53.56  ? 956  LEU A HD11 1 
ATOM   5850  H HD12 . LEU A 1 395 ? -1.099  0.613   -32.132 1.00 53.56  ? 956  LEU A HD12 1 
ATOM   5851  H HD13 . LEU A 1 395 ? -0.249  -0.420  -31.276 1.00 53.56  ? 956  LEU A HD13 1 
ATOM   5852  H HD21 . LEU A 1 395 ? -1.783  -0.193  -28.765 1.00 53.93  ? 956  LEU A HD21 1 
ATOM   5853  H HD22 . LEU A 1 395 ? -0.195  -0.150  -28.744 1.00 53.93  ? 956  LEU A HD22 1 
ATOM   5854  H HD23 . LEU A 1 395 ? -1.030  1.034   -28.091 1.00 53.93  ? 956  LEU A HD23 1 
ATOM   5855  N N    . PHE A 1 396 ? -0.747  5.007   -30.950 1.00 52.73  ? 957  PHE A N    1 
ATOM   5856  C CA   . PHE A 1 396 ? -1.831  5.979   -30.905 1.00 52.86  ? 957  PHE A CA   1 
ATOM   5857  C C    . PHE A 1 396 ? -1.678  7.116   -31.909 1.00 53.36  ? 957  PHE A C    1 
ATOM   5858  O O    . PHE A 1 396 ? -2.517  8.023   -31.923 1.00 48.35  ? 957  PHE A O    1 
ATOM   5859  C CB   . PHE A 1 396 ? -1.955  6.539   -29.488 1.00 48.68  ? 957  PHE A CB   1 
ATOM   5860  C CG   . PHE A 1 396 ? -2.352  5.506   -28.482 1.00 49.23  ? 957  PHE A CG   1 
ATOM   5861  C CD1  . PHE A 1 396 ? -3.682  5.154   -28.324 1.00 46.59  ? 957  PHE A CD1  1 
ATOM   5862  C CD2  . PHE A 1 396 ? -1.397  4.862   -27.716 1.00 50.60  ? 957  PHE A CD2  1 
ATOM   5863  C CE1  . PHE A 1 396 ? -4.053  4.193   -27.410 1.00 44.51  ? 957  PHE A CE1  1 
ATOM   5864  C CE2  . PHE A 1 396 ? -1.763  3.900   -26.800 1.00 52.30  ? 957  PHE A CE2  1 
ATOM   5865  C CZ   . PHE A 1 396 ? -3.093  3.564   -26.646 1.00 48.88  ? 957  PHE A CZ   1 
ATOM   5866  H H    . PHE A 1 396 ? -0.055  5.246   -30.500 1.00 63.28  ? 957  PHE A H    1 
ATOM   5867  H HA   . PHE A 1 396 ? -2.661  5.521   -31.111 1.00 63.43  ? 957  PHE A HA   1 
ATOM   5868  H HB2  . PHE A 1 396 ? -1.099  6.906   -29.218 1.00 58.41  ? 957  PHE A HB2  1 
ATOM   5869  H HB3  . PHE A 1 396 ? -2.630  7.236   -29.483 1.00 58.41  ? 957  PHE A HB3  1 
ATOM   5870  H HD1  . PHE A 1 396 ? -4.332  5.576   -28.837 1.00 55.90  ? 957  PHE A HD1  1 
ATOM   5871  H HD2  . PHE A 1 396 ? -0.500  5.085   -27.816 1.00 60.72  ? 957  PHE A HD2  1 
ATOM   5872  H HE1  . PHE A 1 396 ? -4.950  3.970   -27.308 1.00 53.41  ? 957  PHE A HE1  1 
ATOM   5873  H HE2  . PHE A 1 396 ? -1.114  3.477   -26.285 1.00 62.76  ? 957  PHE A HE2  1 
ATOM   5874  H HZ   . PHE A 1 396 ? -3.342  2.916   -26.027 1.00 58.66  ? 957  PHE A HZ   1 
ATOM   5875  N N    . GLN A 1 397 ? -0.635  7.101   -32.739 1.00 57.71  ? 958  GLN A N    1 
ATOM   5876  C CA   . GLN A 1 397 ? -0.481  8.151   -33.738 1.00 60.72  ? 958  GLN A CA   1 
ATOM   5877  C C    . GLN A 1 397 ? -1.682  8.271   -34.673 1.00 52.65  ? 958  GLN A C    1 
ATOM   5878  O O    . GLN A 1 397 ? -1.978  9.402   -35.095 1.00 59.70  ? 958  GLN A O    1 
ATOM   5879  C CB   . GLN A 1 397 ? 0.805   7.926   -34.547 1.00 62.72  ? 958  GLN A CB   1 
ATOM   5880  C CG   . GLN A 1 397 ? 1.473   9.224   -34.988 1.00 74.66  ? 958  GLN A CG   1 
ATOM   5881  C CD   . GLN A 1 397 ? 2.003   10.029  -33.814 1.00 81.01  ? 958  GLN A CD   1 
ATOM   5882  O OE1  . GLN A 1 397 ? 2.534   9.472   -32.854 1.00 67.78  ? 958  GLN A OE1  1 
ATOM   5883  N NE2  . GLN A 1 397 ? 1.847   11.348  -33.881 1.00 85.04  ? 958  GLN A NE2  1 
ATOM   5884  H H    . GLN A 1 397 ? -0.016  6.505   -32.743 1.00 69.25  ? 958  GLN A H    1 
ATOM   5885  H HA   . GLN A 1 397 ? -0.388  8.999   -33.277 1.00 72.87  ? 958  GLN A HA   1 
ATOM   5886  H HB2  . GLN A 1 397 ? 1.438   7.434   -34.001 1.00 75.27  ? 958  GLN A HB2  1 
ATOM   5887  H HB3  . GLN A 1 397 ? 0.590   7.416   -35.344 1.00 75.27  ? 958  GLN A HB3  1 
ATOM   5888  H HG2  . GLN A 1 397 ? 2.220   9.014   -35.570 1.00 89.60  ? 958  GLN A HG2  1 
ATOM   5889  H HG3  . GLN A 1 397 ? 0.825   9.770   -35.460 1.00 89.60  ? 958  GLN A HG3  1 
ATOM   5890  H HE21 . GLN A 1 397 ? 1.463   11.701  -34.564 1.00 102.05 ? 958  GLN A HE21 1 
ATOM   5891  H HE22 . GLN A 1 397 ? 2.131   11.847  -33.241 1.00 102.05 ? 958  GLN A HE22 1 
ATOM   5892  N N    . PRO A 1 398 ? -2.373  7.195   -35.060 1.00 51.21  ? 959  PRO A N    1 
ATOM   5893  C CA   . PRO A 1 398 ? -3.621  7.386   -35.817 1.00 48.99  ? 959  PRO A CA   1 
ATOM   5894  C C    . PRO A 1 398 ? -4.615  8.300   -35.116 1.00 45.28  ? 959  PRO A C    1 
ATOM   5895  O O    . PRO A 1 398 ? -5.324  9.063   -35.784 1.00 46.49  ? 959  PRO A O    1 
ATOM   5896  C CB   . PRO A 1 398 ? -4.162  5.956   -35.958 1.00 43.81  ? 959  PRO A CB   1 
ATOM   5897  C CG   . PRO A 1 398 ? -2.957  5.087   -35.881 1.00 45.72  ? 959  PRO A CG   1 
ATOM   5898  C CD   . PRO A 1 398 ? -2.014  5.771   -34.936 1.00 50.02  ? 959  PRO A CD   1 
ATOM   5899  H HA   . PRO A 1 398 ? -3.427  7.742   -36.699 1.00 58.79  ? 959  PRO A HA   1 
ATOM   5900  H HB2  . PRO A 1 398 ? -4.773  5.763   -35.229 1.00 52.57  ? 959  PRO A HB2  1 
ATOM   5901  H HB3  . PRO A 1 398 ? -4.604  5.855   -36.815 1.00 52.57  ? 959  PRO A HB3  1 
ATOM   5902  H HG2  . PRO A 1 398 ? -3.208  4.214   -35.539 1.00 54.87  ? 959  PRO A HG2  1 
ATOM   5903  H HG3  . PRO A 1 398 ? -2.559  5.006   -36.761 1.00 54.87  ? 959  PRO A HG3  1 
ATOM   5904  H HD2  . PRO A 1 398 ? -2.162  5.464   -34.028 1.00 60.03  ? 959  PRO A HD2  1 
ATOM   5905  H HD3  . PRO A 1 398 ? -1.095  5.629   -35.213 1.00 60.03  ? 959  PRO A HD3  1 
ATOM   5906  N N    . TYR A 1 399 ? -4.690  8.240   -33.784 1.00 46.11  ? 960  TYR A N    1 
ATOM   5907  C CA   . TYR A 1 399 ? -5.699  8.962   -33.018 1.00 45.09  ? 960  TYR A CA   1 
ATOM   5908  C C    . TYR A 1 399 ? -5.251  10.337  -32.528 1.00 41.85  ? 960  TYR A C    1 
ATOM   5909  O O    . TYR A 1 399 ? -6.094  11.103  -32.047 1.00 38.08  ? 960  TYR A O    1 
ATOM   5910  C CB   . TYR A 1 399 ? -6.116  8.116   -31.815 1.00 46.48  ? 960  TYR A CB   1 
ATOM   5911  C CG   . TYR A 1 399 ? -6.298  6.657   -32.155 1.00 39.13  ? 960  TYR A CG   1 
ATOM   5912  C CD1  . TYR A 1 399 ? -7.449  6.199   -32.782 1.00 35.50  ? 960  TYR A CD1  1 
ATOM   5913  C CD2  . TYR A 1 399 ? -5.306  5.737   -31.855 1.00 43.37  ? 960  TYR A CD2  1 
ATOM   5914  C CE1  . TYR A 1 399 ? -7.603  4.862   -33.095 1.00 39.76  ? 960  TYR A CE1  1 
ATOM   5915  C CE2  . TYR A 1 399 ? -5.450  4.401   -32.163 1.00 38.52  ? 960  TYR A CE2  1 
ATOM   5916  C CZ   . TYR A 1 399 ? -6.602  3.969   -32.783 1.00 37.53  ? 960  TYR A CZ   1 
ATOM   5917  O OH   . TYR A 1 399 ? -6.748  2.637   -33.091 1.00 42.01  ? 960  TYR A OH   1 
ATOM   5918  H H    . TYR A 1 399 ? -4.155  7.777   -33.296 1.00 55.33  ? 960  TYR A H    1 
ATOM   5919  H HA   . TYR A 1 399 ? -6.482  9.089   -33.577 1.00 54.11  ? 960  TYR A HA   1 
ATOM   5920  H HB2  . TYR A 1 399 ? -5.431  8.181   -31.132 1.00 55.78  ? 960  TYR A HB2  1 
ATOM   5921  H HB3  . TYR A 1 399 ? -6.959  8.451   -31.471 1.00 55.78  ? 960  TYR A HB3  1 
ATOM   5922  H HD1  . TYR A 1 399 ? -8.126  6.800   -32.993 1.00 42.61  ? 960  TYR A HD1  1 
ATOM   5923  H HD2  . TYR A 1 399 ? -4.527  6.027   -31.437 1.00 52.05  ? 960  TYR A HD2  1 
ATOM   5924  H HE1  . TYR A 1 399 ? -8.379  4.566   -33.513 1.00 47.72  ? 960  TYR A HE1  1 
ATOM   5925  H HE2  . TYR A 1 399 ? -4.775  3.797   -31.953 1.00 46.23  ? 960  TYR A HE2  1 
ATOM   5926  H HH   . TYR A 1 399 ? -6.068  2.210   -32.846 1.00 50.42  ? 960  TYR A HH   1 
ATOM   5927  N N    . TYR A 1 400 ? -3.967  10.672  -32.640 1.00 48.57  ? 961  TYR A N    1 
ATOM   5928  C CA   . TYR A 1 400 ? -3.443  11.931  -32.124 1.00 46.58  ? 961  TYR A CA   1 
ATOM   5929  C C    . TYR A 1 400 ? -2.468  12.521  -33.133 1.00 51.46  ? 961  TYR A C    1 
ATOM   5930  O O    . TYR A 1 400 ? -2.006  11.841  -34.051 1.00 55.38  ? 961  TYR A O    1 
ATOM   5931  C CB   . TYR A 1 400 ? -2.732  11.750  -30.772 1.00 49.82  ? 961  TYR A CB   1 
ATOM   5932  C CG   . TYR A 1 400 ? -3.611  11.253  -29.643 1.00 51.42  ? 961  TYR A CG   1 
ATOM   5933  C CD1  . TYR A 1 400 ? -4.575  12.072  -29.072 1.00 44.19  ? 961  TYR A CD1  1 
ATOM   5934  C CD2  . TYR A 1 400 ? -3.457  9.971   -29.130 1.00 50.80  ? 961  TYR A CD2  1 
ATOM   5935  C CE1  . TYR A 1 400 ? -5.371  11.622  -28.033 1.00 44.95  ? 961  TYR A CE1  1 
ATOM   5936  C CE2  . TYR A 1 400 ? -4.249  9.512   -28.092 1.00 46.86  ? 961  TYR A CE2  1 
ATOM   5937  C CZ   . TYR A 1 400 ? -5.204  10.342  -27.549 1.00 44.47  ? 961  TYR A CZ   1 
ATOM   5938  O OH   . TYR A 1 400 ? -5.992  9.891   -26.517 1.00 40.97  ? 961  TYR A OH   1 
ATOM   5939  H H    . TYR A 1 400 ? -3.372  10.179  -33.017 1.00 58.29  ? 961  TYR A H    1 
ATOM   5940  H HA   . TYR A 1 400 ? -4.173  12.557  -32.003 1.00 55.90  ? 961  TYR A HA   1 
ATOM   5941  H HB2  . TYR A 1 400 ? -2.013  11.109  -30.886 1.00 59.78  ? 961  TYR A HB2  1 
ATOM   5942  H HB3  . TYR A 1 400 ? -2.365  12.605  -30.501 1.00 59.78  ? 961  TYR A HB3  1 
ATOM   5943  H HD1  . TYR A 1 400 ? -4.692  12.935  -29.396 1.00 53.02  ? 961  TYR A HD1  1 
ATOM   5944  H HD2  . TYR A 1 400 ? -2.814  9.407   -29.497 1.00 60.97  ? 961  TYR A HD2  1 
ATOM   5945  H HE1  . TYR A 1 400 ? -6.017  12.181  -27.663 1.00 53.94  ? 961  TYR A HE1  1 
ATOM   5946  H HE2  . TYR A 1 400 ? -4.137  8.649   -27.764 1.00 56.23  ? 961  TYR A HE2  1 
ATOM   5947  H HH   . TYR A 1 400 ? -6.527  10.493  -26.280 1.00 49.17  ? 961  TYR A HH   1 
ATOM   5948  N N    . PHE A 1 401 ? -2.156  13.801  -32.947 1.00 54.73  ? 962  PHE A N    1 
ATOM   5949  C CA   . PHE A 1 401 ? -1.198  14.511  -33.783 1.00 53.73  ? 962  PHE A CA   1 
ATOM   5950  C C    . PHE A 1 401 ? -0.039  14.989  -32.922 1.00 54.60  ? 962  PHE A C    1 
ATOM   5951  O O    . PHE A 1 401 ? -0.250  15.661  -31.907 1.00 55.01  ? 962  PHE A O    1 
ATOM   5952  C CB   . PHE A 1 401 ? -1.847  15.700  -34.497 1.00 52.47  ? 962  PHE A CB   1 
ATOM   5953  C CG   . PHE A 1 401 ? -0.865  16.563  -35.230 1.00 49.03  ? 962  PHE A CG   1 
ATOM   5954  C CD1  . PHE A 1 401 ? -0.340  16.157  -36.444 1.00 52.01  ? 962  PHE A CD1  1 
ATOM   5955  C CD2  . PHE A 1 401 ? -0.458  17.774  -34.700 1.00 49.53  ? 962  PHE A CD2  1 
ATOM   5956  C CE1  . PHE A 1 401 ? 0.571   16.945  -37.119 1.00 54.08  ? 962  PHE A CE1  1 
ATOM   5957  C CE2  . PHE A 1 401 ? 0.452   18.568  -35.370 1.00 49.70  ? 962  PHE A CE2  1 
ATOM   5958  C CZ   . PHE A 1 401 ? 0.967   18.153  -36.581 1.00 52.00  ? 962  PHE A CZ   1 
ATOM   5959  H H    . PHE A 1 401 ? -2.496  14.290  -32.326 1.00 65.68  ? 962  PHE A H    1 
ATOM   5960  H HA   . PHE A 1 401 ? -0.849  13.905  -34.456 1.00 64.47  ? 962  PHE A HA   1 
ATOM   5961  H HB2  . PHE A 1 401 ? -2.489  15.366  -35.143 1.00 62.97  ? 962  PHE A HB2  1 
ATOM   5962  H HB3  . PHE A 1 401 ? -2.297  16.253  -33.840 1.00 62.97  ? 962  PHE A HB3  1 
ATOM   5963  H HD1  . PHE A 1 401 ? -0.603  15.343  -36.810 1.00 62.41  ? 962  PHE A HD1  1 
ATOM   5964  H HD2  . PHE A 1 401 ? -0.802  18.058  -33.884 1.00 59.43  ? 962  PHE A HD2  1 
ATOM   5965  H HE1  . PHE A 1 401 ? 0.916   16.664  -37.936 1.00 64.89  ? 962  PHE A HE1  1 
ATOM   5966  H HE2  . PHE A 1 401 ? 0.717   19.381  -35.005 1.00 59.64  ? 962  PHE A HE2  1 
ATOM   5967  H HZ   . PHE A 1 401 ? 1.579   18.687  -37.034 1.00 62.40  ? 962  PHE A HZ   1 
ATOM   5968  N N    . HIS A 1 402 ? 1.177   14.639  -33.332 1.00 65.99  ? 963  HIS A N    1 
ATOM   5969  C CA   . HIS A 1 402 ? 2.389   15.055  -32.633 1.00 70.22  ? 963  HIS A CA   1 
ATOM   5970  C C    . HIS A 1 402 ? 3.493   15.396  -33.629 1.00 86.40  ? 963  HIS A C    1 
ATOM   5971  O O    . HIS A 1 402 ? 3.732   14.656  -34.586 1.00 71.48  ? 963  HIS A O    1 
ATOM   5972  C CB   . HIS A 1 402 ? 2.863   13.957  -31.679 1.00 66.97  ? 963  HIS A CB   1 
ATOM   5973  H H    . HIS A 1 402 ? 1.328   14.152  -34.024 1.00 79.18  ? 963  HIS A H    1 
ATOM   5974  H HA   . HIS A 1 402 ? 2.199   15.849  -32.110 1.00 84.26  ? 963  HIS A HA   1 
ATOM   5975  N N    . SER B 1 1   ? 14.114  33.515  -80.726 1.00 39.83  ? 562  SER B N    1 
ATOM   5976  C CA   . SER B 1 1   ? 12.830  33.485  -81.415 1.00 45.72  ? 562  SER B CA   1 
ATOM   5977  C C    . SER B 1 1   ? 11.699  33.202  -80.429 1.00 48.41  ? 562  SER B C    1 
ATOM   5978  O O    . SER B 1 1   ? 11.803  32.289  -79.625 1.00 44.44  ? 562  SER B O    1 
ATOM   5979  C CB   . SER B 1 1   ? 12.837  32.427  -82.519 1.00 47.62  ? 562  SER B CB   1 
ATOM   5980  O OG   . SER B 1 1   ? 11.586  32.374  -83.180 1.00 50.38  ? 562  SER B OG   1 
ATOM   5981  H HA   . SER B 1 1   ? 12.667  34.349  -81.824 1.00 54.86  ? 562  SER B HA   1 
ATOM   5982  H HB2  . SER B 1 1   ? 13.526  32.651  -83.165 1.00 57.14  ? 562  SER B HB2  1 
ATOM   5983  H HB3  . SER B 1 1   ? 13.022  31.561  -82.124 1.00 57.14  ? 562  SER B HB3  1 
ATOM   5984  H HG   . SER B 1 1   ? 11.604  31.790  -83.783 1.00 60.45  ? 562  SER B HG   1 
ATOM   5985  N N    . VAL B 1 2   ? 10.619  33.980  -80.491 1.00 45.09  ? 563  VAL B N    1 
ATOM   5986  C CA   . VAL B 1 2   ? 9.477   33.811  -79.599 1.00 45.64  ? 563  VAL B CA   1 
ATOM   5987  C C    . VAL B 1 2   ? 8.205   33.737  -80.432 1.00 40.18  ? 563  VAL B C    1 
ATOM   5988  O O    . VAL B 1 2   ? 8.016   34.514  -81.375 1.00 46.43  ? 563  VAL B O    1 
ATOM   5989  C CB   . VAL B 1 2   ? 9.384   34.952  -78.561 1.00 42.98  ? 563  VAL B CB   1 
ATOM   5990  C CG1  . VAL B 1 2   ? 8.132   34.803  -77.699 1.00 45.03  ? 563  VAL B CG1  1 
ATOM   5991  C CG2  . VAL B 1 2   ? 10.628  34.973  -77.686 1.00 45.09  ? 563  VAL B CG2  1 
ATOM   5992  H H    . VAL B 1 2   ? 10.524  34.624  -81.053 1.00 54.11  ? 563  VAL B H    1 
ATOM   5993  H HA   . VAL B 1 2   ? 9.571   32.974  -79.119 1.00 54.76  ? 563  VAL B HA   1 
ATOM   5994  H HB   . VAL B 1 2   ? 9.329   35.801  -79.027 1.00 51.57  ? 563  VAL B HB   1 
ATOM   5995  H HG11 . VAL B 1 2   ? 8.101   35.531  -77.059 1.00 54.03  ? 563  VAL B HG11 1 
ATOM   5996  H HG12 . VAL B 1 2   ? 7.350   34.832  -78.272 1.00 54.03  ? 563  VAL B HG12 1 
ATOM   5997  H HG13 . VAL B 1 2   ? 8.170   33.954  -77.233 1.00 54.03  ? 563  VAL B HG13 1 
ATOM   5998  H HG21 . VAL B 1 2   ? 10.548  35.695  -77.043 1.00 54.11  ? 563  VAL B HG21 1 
ATOM   5999  H HG22 . VAL B 1 2   ? 10.702  34.124  -77.223 1.00 54.11  ? 563  VAL B HG22 1 
ATOM   6000  H HG23 . VAL B 1 2   ? 11.406  35.114  -78.248 1.00 54.11  ? 563  VAL B HG23 1 
ATOM   6001  N N    . VAL B 1 3   ? 7.339   32.792  -80.077 1.00 40.71  ? 564  VAL B N    1 
ATOM   6002  C CA   . VAL B 1 3   ? 6.021   32.634  -80.681 1.00 40.83  ? 564  VAL B CA   1 
ATOM   6003  C C    . VAL B 1 3   ? 4.987   32.916  -79.602 1.00 39.09  ? 564  VAL B C    1 
ATOM   6004  O O    . VAL B 1 3   ? 5.057   32.350  -78.504 1.00 44.32  ? 564  VAL B O    1 
ATOM   6005  C CB   . VAL B 1 3   ? 5.833   31.222  -81.265 1.00 37.67  ? 564  VAL B CB   1 
ATOM   6006  C CG1  . VAL B 1 3   ? 4.426   31.054  -81.827 1.00 37.37  ? 564  VAL B CG1  1 
ATOM   6007  C CG2  . VAL B 1 3   ? 6.874   30.950  -82.335 1.00 35.61  ? 564  VAL B CG2  1 
ATOM   6008  H H    . VAL B 1 3   ? 7.500   32.210  -79.466 1.00 48.85  ? 564  VAL B H    1 
ATOM   6009  H HA   . VAL B 1 3   ? 5.910   33.282  -81.394 1.00 49.00  ? 564  VAL B HA   1 
ATOM   6010  H HB   . VAL B 1 3   ? 5.953   30.570  -80.558 1.00 45.20  ? 564  VAL B HB   1 
ATOM   6011  H HG11 . VAL B 1 3   ? 4.336   30.158  -82.188 1.00 44.84  ? 564  VAL B HG11 1 
ATOM   6012  H HG12 . VAL B 1 3   ? 3.783   31.190  -81.113 1.00 44.84  ? 564  VAL B HG12 1 
ATOM   6013  H HG13 . VAL B 1 3   ? 4.286   31.709  -82.528 1.00 44.84  ? 564  VAL B HG13 1 
ATOM   6014  H HG21 . VAL B 1 3   ? 6.737   30.057  -82.689 1.00 42.73  ? 564  VAL B HG21 1 
ATOM   6015  H HG22 . VAL B 1 3   ? 6.777   31.606  -83.044 1.00 42.73  ? 564  VAL B HG22 1 
ATOM   6016  H HG23 . VAL B 1 3   ? 7.758   31.018  -81.940 1.00 42.73  ? 564  VAL B HG23 1 
ATOM   6017  N N    . ILE B 1 4   ? 4.033   33.788  -79.912 1.00 37.80  ? 565  ILE B N    1 
ATOM   6018  C CA   . ILE B 1 4   ? 2.967   34.165  -78.991 1.00 39.24  ? 565  ILE B CA   1 
ATOM   6019  C C    . ILE B 1 4   ? 1.647   33.870  -79.687 1.00 39.54  ? 565  ILE B C    1 
ATOM   6020  O O    . ILE B 1 4   ? 1.322   34.493  -80.706 1.00 47.04  ? 565  ILE B O    1 
ATOM   6021  C CB   . ILE B 1 4   ? 3.054   35.643  -78.581 1.00 33.65  ? 565  ILE B CB   1 
ATOM   6022  C CG1  . ILE B 1 4   ? 4.395   35.926  -77.897 1.00 37.98  ? 565  ILE B CG1  1 
ATOM   6023  C CG2  . ILE B 1 4   ? 1.893   36.012  -77.658 1.00 37.12  ? 565  ILE B CG2  1 
ATOM   6024  C CD1  . ILE B 1 4   ? 4.649   37.394  -77.603 1.00 33.74  ? 565  ILE B CD1  1 
ATOM   6025  H H    . ILE B 1 4   ? 3.982   34.186  -80.673 1.00 45.36  ? 565  ILE B H    1 
ATOM   6026  H HA   . ILE B 1 4   ? 3.022   33.620  -78.191 1.00 47.09  ? 565  ILE B HA   1 
ATOM   6027  H HB   . ILE B 1 4   ? 2.995   36.188  -79.381 1.00 40.38  ? 565  ILE B HB   1 
ATOM   6028  H HG12 . ILE B 1 4   ? 4.421   35.447  -77.054 1.00 45.57  ? 565  ILE B HG12 1 
ATOM   6029  H HG13 . ILE B 1 4   ? 5.110   35.613  -78.474 1.00 45.57  ? 565  ILE B HG13 1 
ATOM   6030  H HG21 . ILE B 1 4   ? 1.970   36.947  -77.414 1.00 44.54  ? 565  ILE B HG21 1 
ATOM   6031  H HG22 . ILE B 1 4   ? 1.057   35.859  -78.127 1.00 44.54  ? 565  ILE B HG22 1 
ATOM   6032  H HG23 . ILE B 1 4   ? 1.933   35.457  -76.864 1.00 44.54  ? 565  ILE B HG23 1 
ATOM   6033  H HD11 . ILE B 1 4   ? 5.514   37.484  -77.173 1.00 40.49  ? 565  ILE B HD11 1 
ATOM   6034  H HD12 . ILE B 1 4   ? 4.641   37.889  -78.437 1.00 40.49  ? 565  ILE B HD12 1 
ATOM   6035  H HD13 . ILE B 1 4   ? 3.951   37.723  -77.016 1.00 40.49  ? 565  ILE B HD13 1 
ATOM   6036  N N    . VAL B 1 5   ? 0.893   32.919  -79.146 1.00 39.25  ? 566  VAL B N    1 
ATOM   6037  C CA   . VAL B 1 5   ? -0.465  32.628  -79.587 1.00 41.41  ? 566  VAL B CA   1 
ATOM   6038  C C    . VAL B 1 5   ? -1.365  32.860  -78.381 1.00 40.36  ? 566  VAL B C    1 
ATOM   6039  O O    . VAL B 1 5   ? -1.315  32.098  -77.406 1.00 38.26  ? 566  VAL B O    1 
ATOM   6040  C CB   . VAL B 1 5   ? -0.609  31.195  -80.119 1.00 44.89  ? 566  VAL B CB   1 
ATOM   6041  C CG1  . VAL B 1 5   ? -1.963  31.010  -80.790 1.00 41.45  ? 566  VAL B CG1  1 
ATOM   6042  C CG2  . VAL B 1 5   ? 0.511   30.870  -81.099 1.00 42.35  ? 566  VAL B CG2  1 
ATOM   6043  H H    . VAL B 1 5   ? 1.156   32.414  -78.501 1.00 47.10  ? 566  VAL B H    1 
ATOM   6044  H HA   . VAL B 1 5   ? -0.720  33.248  -80.288 1.00 49.69  ? 566  VAL B HA   1 
ATOM   6045  H HB   . VAL B 1 5   ? -0.551  30.573  -79.378 1.00 53.87  ? 566  VAL B HB   1 
ATOM   6046  H HG11 . VAL B 1 5   ? -2.031  30.100  -81.118 1.00 49.73  ? 566  VAL B HG11 1 
ATOM   6047  H HG12 . VAL B 1 5   ? -2.663  31.181  -80.141 1.00 49.73  ? 566  VAL B HG12 1 
ATOM   6048  H HG13 . VAL B 1 5   ? -2.037  31.634  -81.529 1.00 49.73  ? 566  VAL B HG13 1 
ATOM   6049  H HG21 . VAL B 1 5   ? 0.397   29.962  -81.419 1.00 50.82  ? 566  VAL B HG21 1 
ATOM   6050  H HG22 . VAL B 1 5   ? 0.469   31.491  -81.843 1.00 50.82  ? 566  VAL B HG22 1 
ATOM   6051  H HG23 . VAL B 1 5   ? 1.363   30.956  -80.643 1.00 50.82  ? 566  VAL B HG23 1 
ATOM   6052  N N    . GLY B 1 6   ? -2.184  33.905  -78.444 1.00 40.30  ? 567  GLY B N    1 
ATOM   6053  C CA   . GLY B 1 6   ? -3.050  34.237  -77.323 1.00 42.18  ? 567  GLY B CA   1 
ATOM   6054  C C    . GLY B 1 6   ? -2.249  34.456  -76.054 1.00 41.15  ? 567  GLY B C    1 
ATOM   6055  O O    . GLY B 1 6   ? -1.302  35.249  -76.018 1.00 35.19  ? 567  GLY B O    1 
ATOM   6056  H H    . GLY B 1 6   ? -2.255  34.433  -79.119 1.00 48.36  ? 567  GLY B H    1 
ATOM   6057  H HA2  . GLY B 1 6   ? -3.546  35.047  -77.521 1.00 50.61  ? 567  GLY B HA2  1 
ATOM   6058  H HA3  . GLY B 1 6   ? -3.680  33.516  -77.172 1.00 50.61  ? 567  GLY B HA3  1 
ATOM   6059  N N    . LYS B 1 7   ? -2.630  33.743  -74.993 1.00 43.97  ? 568  LYS B N    1 
ATOM   6060  C CA   . LYS B 1 7   ? -1.927  33.808  -73.719 1.00 42.08  ? 568  LYS B CA   1 
ATOM   6061  C C    . LYS B 1 7   ? -0.733  32.868  -73.653 1.00 38.87  ? 568  LYS B C    1 
ATOM   6062  O O    . LYS B 1 7   ? 0.071   32.975  -72.719 1.00 35.33  ? 568  LYS B O    1 
ATOM   6063  C CB   . LYS B 1 7   ? -2.882  33.478  -72.569 1.00 39.81  ? 568  LYS B CB   1 
ATOM   6064  C CG   . LYS B 1 7   ? -4.123  34.349  -72.533 1.00 44.21  ? 568  LYS B CG   1 
ATOM   6065  C CD   . LYS B 1 7   ? -4.617  34.567  -71.114 1.00 51.54  ? 568  LYS B CD   1 
ATOM   6066  C CE   . LYS B 1 7   ? -3.627  35.393  -70.307 1.00 54.55  ? 568  LYS B CE   1 
ATOM   6067  N NZ   . LYS B 1 7   ? -4.283  36.516  -69.589 1.00 59.65  ? 568  LYS B NZ   1 
ATOM   6068  H H    . LYS B 1 7   ? -3.303  33.207  -74.990 1.00 52.77  ? 568  LYS B H    1 
ATOM   6069  H HA   . LYS B 1 7   ? -1.602  34.712  -73.586 1.00 50.50  ? 568  LYS B HA   1 
ATOM   6070  H HB2  . LYS B 1 7   ? -3.170  32.556  -72.657 1.00 47.77  ? 568  LYS B HB2  1 
ATOM   6071  H HB3  . LYS B 1 7   ? -2.412  33.597  -71.729 1.00 47.77  ? 568  LYS B HB3  1 
ATOM   6072  H HG2  . LYS B 1 7   ? -3.917  35.215  -72.918 1.00 53.05  ? 568  LYS B HG2  1 
ATOM   6073  H HG3  . LYS B 1 7   ? -4.830  33.917  -73.037 1.00 53.05  ? 568  LYS B HG3  1 
ATOM   6074  H HD2  . LYS B 1 7   ? -5.462  35.042  -71.138 1.00 61.85  ? 568  LYS B HD2  1 
ATOM   6075  H HD3  . LYS B 1 7   ? -4.726  33.708  -70.677 1.00 61.85  ? 568  LYS B HD3  1 
ATOM   6076  H HE2  . LYS B 1 7   ? -3.201  34.822  -69.649 1.00 65.46  ? 568  LYS B HE2  1 
ATOM   6077  H HE3  . LYS B 1 7   ? -2.962  35.766  -70.906 1.00 65.46  ? 568  LYS B HE3  1 
ATOM   6078  H HZ1  . LYS B 1 7   ? -3.677  36.977  -69.128 1.00 71.58  ? 568  LYS B HZ1  1 
ATOM   6079  H HZ2  . LYS B 1 7   ? -4.678  37.060  -70.172 1.00 71.58  ? 568  LYS B HZ2  1 
ATOM   6080  H HZ3  . LYS B 1 7   ? -4.896  36.200  -69.026 1.00 71.58  ? 568  LYS B HZ3  1 
ATOM   6081  N N    . ILE B 1 8   ? -0.605  31.956  -74.608 1.00 39.38  ? 569  ILE B N    1 
ATOM   6082  C CA   . ILE B 1 8   ? 0.490   30.995  -74.635 1.00 34.52  ? 569  ILE B CA   1 
ATOM   6083  C C    . ILE B 1 8   ? 1.661   31.612  -75.386 1.00 37.75  ? 569  ILE B C    1 
ATOM   6084  O O    . ILE B 1 8   ? 1.510   32.078  -76.521 1.00 41.00  ? 569  ILE B O    1 
ATOM   6085  C CB   . ILE B 1 8   ? 0.041   29.678  -75.290 1.00 36.29  ? 569  ILE B CB   1 
ATOM   6086  C CG1  . ILE B 1 8   ? -0.982  28.977  -74.395 1.00 30.52  ? 569  ILE B CG1  1 
ATOM   6087  C CG2  . ILE B 1 8   ? 1.235   28.760  -75.544 1.00 31.14  ? 569  ILE B CG2  1 
ATOM   6088  C CD1  . ILE B 1 8   ? -1.689  27.814  -75.052 1.00 38.09  ? 569  ILE B CD1  1 
ATOM   6089  H H    . ILE B 1 8   ? -1.151  31.873  -75.267 1.00 47.26  ? 569  ILE B H    1 
ATOM   6090  H HA   . ILE B 1 8   ? 0.774   30.805  -73.728 1.00 41.43  ? 569  ILE B HA   1 
ATOM   6091  H HB   . ILE B 1 8   ? -0.379  29.882  -76.141 1.00 43.55  ? 569  ILE B HB   1 
ATOM   6092  H HG12 . ILE B 1 8   ? -0.527  28.639  -73.607 1.00 36.62  ? 569  ILE B HG12 1 
ATOM   6093  H HG13 . ILE B 1 8   ? -1.658  29.621  -74.131 1.00 36.62  ? 569  ILE B HG13 1 
ATOM   6094  H HG21 . ILE B 1 8   ? 0.921   27.940  -75.956 1.00 37.37  ? 569  ILE B HG21 1 
ATOM   6095  H HG22 . ILE B 1 8   ? 1.859   29.210  -76.135 1.00 37.37  ? 569  ILE B HG22 1 
ATOM   6096  H HG23 . ILE B 1 8   ? 1.666   28.561  -74.698 1.00 37.37  ? 569  ILE B HG23 1 
ATOM   6097  H HD11 . ILE B 1 8   ? -2.316  27.428  -74.421 1.00 45.71  ? 569  ILE B HD11 1 
ATOM   6098  H HD12 . ILE B 1 8   ? -2.162  28.134  -75.836 1.00 45.71  ? 569  ILE B HD12 1 
ATOM   6099  H HD13 . ILE B 1 8   ? -1.030  27.151  -75.311 1.00 45.71  ? 569  ILE B HD13 1 
ATOM   6100  N N    . SER B 1 9   ? 2.825   31.622  -74.746 1.00 36.58  ? 570  SER B N    1 
ATOM   6101  C CA   . SER B 1 9   ? 4.068   32.043  -75.372 1.00 36.29  ? 570  SER B CA   1 
ATOM   6102  C C    . SER B 1 9   ? 5.112   30.964  -75.134 1.00 41.04  ? 570  SER B C    1 
ATOM   6103  O O    . SER B 1 9   ? 5.232   30.442  -74.021 1.00 41.06  ? 570  SER B O    1 
ATOM   6104  C CB   . SER B 1 9   ? 4.562   33.383  -74.815 1.00 38.21  ? 570  SER B CB   1 
ATOM   6105  O OG   . SER B 1 9   ? 4.912   33.265  -73.448 1.00 27.41  ? 570  SER B OG   1 
ATOM   6106  H H    . SER B 1 9   ? 2.920   31.383  -73.926 1.00 43.89  ? 570  SER B H    1 
ATOM   6107  H HA   . SER B 1 9   ? 3.934   32.137  -76.329 1.00 43.54  ? 570  SER B HA   1 
ATOM   6108  H HB2  . SER B 1 9   ? 5.343   33.664  -75.318 1.00 45.85  ? 570  SER B HB2  1 
ATOM   6109  H HB3  . SER B 1 9   ? 3.856   34.041  -74.905 1.00 45.85  ? 570  SER B HB3  1 
ATOM   6110  H HG   . SER B 1 9   ? 5.181   34.005  -73.156 1.00 32.89  ? 570  SER B HG   1 
ATOM   6111  N N    . PHE B 1 10  ? 5.858   30.625  -76.183 1.00 40.47  ? 571  PHE B N    1 
ATOM   6112  C CA   . PHE B 1 10  ? 6.886   29.604  -76.073 1.00 41.72  ? 571  PHE B CA   1 
ATOM   6113  C C    . PHE B 1 10  ? 8.025   29.934  -77.022 1.00 43.19  ? 571  PHE B C    1 
ATOM   6114  O O    . PHE B 1 10  ? 7.880   30.730  -77.953 1.00 38.54  ? 571  PHE B O    1 
ATOM   6115  C CB   . PHE B 1 10  ? 6.328   28.202  -76.364 1.00 41.10  ? 571  PHE B CB   1 
ATOM   6116  C CG   . PHE B 1 10  ? 6.002   27.961  -77.814 1.00 32.38  ? 571  PHE B CG   1 
ATOM   6117  C CD1  . PHE B 1 10  ? 6.986   27.557  -78.703 1.00 36.22  ? 571  PHE B CD1  1 
ATOM   6118  C CD2  . PHE B 1 10  ? 4.709   28.120  -78.283 1.00 31.02  ? 571  PHE B CD2  1 
ATOM   6119  C CE1  . PHE B 1 10  ? 6.688   27.331  -80.033 1.00 34.32  ? 571  PHE B CE1  1 
ATOM   6120  C CE2  . PHE B 1 10  ? 4.406   27.894  -79.613 1.00 33.58  ? 571  PHE B CE2  1 
ATOM   6121  C CZ   . PHE B 1 10  ? 5.397   27.498  -80.489 1.00 33.41  ? 571  PHE B CZ   1 
ATOM   6122  H H    . PHE B 1 10  ? 5.787   30.973  -76.966 1.00 48.56  ? 571  PHE B H    1 
ATOM   6123  H HA   . PHE B 1 10  ? 7.238   29.605  -75.169 1.00 50.06  ? 571  PHE B HA   1 
ATOM   6124  H HB2  . PHE B 1 10  ? 6.986   27.543  -76.095 1.00 49.32  ? 571  PHE B HB2  1 
ATOM   6125  H HB3  . PHE B 1 10  ? 5.513   28.079  -75.853 1.00 49.32  ? 571  PHE B HB3  1 
ATOM   6126  H HD1  . PHE B 1 10  ? 7.858   27.444  -78.402 1.00 43.46  ? 571  PHE B HD1  1 
ATOM   6127  H HD2  . PHE B 1 10  ? 4.038   28.388  -77.697 1.00 37.23  ? 571  PHE B HD2  1 
ATOM   6128  H HE1  . PHE B 1 10  ? 7.358   27.063  -80.621 1.00 41.18  ? 571  PHE B HE1  1 
ATOM   6129  H HE2  . PHE B 1 10  ? 3.534   28.008  -79.917 1.00 40.30  ? 571  PHE B HE2  1 
ATOM   6130  H HZ   . PHE B 1 10  ? 5.195   27.345  -81.383 1.00 40.09  ? 571  PHE B HZ   1 
ATOM   6131  N N    . CYS B 1 11  ? 9.162   29.294  -76.768 1.00 46.97  ? 572  CYS B N    1 
ATOM   6132  C CA   . CYS B 1 11  ? 10.362  29.436  -77.575 1.00 50.88  ? 572  CYS B CA   1 
ATOM   6133  C C    . CYS B 1 11  ? 10.535  28.174  -78.407 1.00 53.51  ? 572  CYS B C    1 
ATOM   6134  O O    . CYS B 1 11  ? 10.557  27.076  -77.831 1.00 51.76  ? 572  CYS B O    1 
ATOM   6135  C CB   . CYS B 1 11  ? 11.572  29.654  -76.674 1.00 52.80  ? 572  CYS B CB   1 
ATOM   6136  S SG   . CYS B 1 11  ? 13.031  30.317  -77.494 1.00 71.18  ? 572  CYS B SG   1 
ATOM   6137  H H    . CYS B 1 11  ? 9.263   28.753  -76.108 1.00 56.36  ? 572  CYS B H    1 
ATOM   6138  H HA   . CYS B 1 11  ? 10.272  30.196  -78.171 1.00 61.06  ? 572  CYS B HA   1 
ATOM   6139  H HB2  . CYS B 1 11  ? 11.324  30.276  -75.972 1.00 63.36  ? 572  CYS B HB2  1 
ATOM   6140  H HB3  . CYS B 1 11  ? 11.820  28.803  -76.280 1.00 63.36  ? 572  CYS B HB3  1 
ATOM   6141  H HG   . CYS B 1 11  ? 12.759  31.383  -77.974 1.00 85.42  ? 572  CYS B HG   1 
ATOM   6142  N N    . PRO B 1 12  ? 10.649  28.252  -79.737 1.00 51.45  ? 573  PRO B N    1 
ATOM   6143  C CA   . PRO B 1 12  ? 10.745  27.013  -80.527 1.00 55.37  ? 573  PRO B CA   1 
ATOM   6144  C C    . PRO B 1 12  ? 11.984  26.186  -80.222 1.00 60.66  ? 573  PRO B C    1 
ATOM   6145  O O    . PRO B 1 12  ? 11.950  24.961  -80.396 1.00 61.78  ? 573  PRO B O    1 
ATOM   6146  C CB   . PRO B 1 12  ? 10.744  27.529  -81.973 1.00 58.23  ? 573  PRO B CB   1 
ATOM   6147  C CG   . PRO B 1 12  ? 11.325  28.899  -81.867 1.00 57.02  ? 573  PRO B CG   1 
ATOM   6148  C CD   . PRO B 1 12  ? 10.743  29.444  -80.596 1.00 52.86  ? 573  PRO B CD   1 
ATOM   6149  H HA   . PRO B 1 12  ? 9.957   26.466  -80.385 1.00 66.44  ? 573  PRO B HA   1 
ATOM   6150  H HB2  . PRO B 1 12  ? 11.300  26.959  -82.527 1.00 69.88  ? 573  PRO B HB2  1 
ATOM   6151  H HB3  . PRO B 1 12  ? 9.836   27.563  -82.311 1.00 69.88  ? 573  PRO B HB3  1 
ATOM   6152  H HG2  . PRO B 1 12  ? 12.292  28.844  -81.810 1.00 68.43  ? 573  PRO B HG2  1 
ATOM   6153  H HG3  . PRO B 1 12  ? 11.052  29.433  -82.630 1.00 68.43  ? 573  PRO B HG3  1 
ATOM   6154  H HD2  . PRO B 1 12  ? 11.340  30.099  -80.202 1.00 63.43  ? 573  PRO B HD2  1 
ATOM   6155  H HD3  . PRO B 1 12  ? 9.862   29.815  -80.758 1.00 63.43  ? 573  PRO B HD3  1 
ATOM   6156  N N    . LYS B 1 13  ? 13.082  26.810  -79.783 1.00 60.98  ? 574  LYS B N    1 
ATOM   6157  C CA   . LYS B 1 13  ? 14.264  26.029  -79.430 1.00 62.99  ? 574  LYS B CA   1 
ATOM   6158  C C    . LYS B 1 13  ? 14.027  25.184  -78.187 1.00 61.97  ? 574  LYS B C    1 
ATOM   6159  O O    . LYS B 1 13  ? 14.593  24.092  -78.069 1.00 60.07  ? 574  LYS B O    1 
ATOM   6160  C CB   . LYS B 1 13  ? 15.477  26.934  -79.204 1.00 69.91  ? 574  LYS B CB   1 
ATOM   6161  C CG   . LYS B 1 13  ? 15.374  27.832  -77.989 1.00 64.94  ? 574  LYS B CG   1 
ATOM   6162  C CD   . LYS B 1 13  ? 16.652  28.623  -77.762 1.00 65.61  ? 574  LYS B CD   1 
ATOM   6163  H H    . LYS B 1 13  ? 13.165  27.660  -79.683 1.00 73.17  ? 574  LYS B H    1 
ATOM   6164  H HA   . LYS B 1 13  ? 14.473  25.428  -80.162 1.00 75.59  ? 574  LYS B HA   1 
ATOM   6165  H HB2  . LYS B 1 13  ? 16.263  26.377  -79.093 1.00 83.89  ? 574  LYS B HB2  1 
ATOM   6166  H HB3  . LYS B 1 13  ? 15.587  27.503  -79.982 1.00 83.89  ? 574  LYS B HB3  1 
ATOM   6167  H HG2  . LYS B 1 13  ? 14.647  28.462  -78.117 1.00 77.92  ? 574  LYS B HG2  1 
ATOM   6168  H HG3  . LYS B 1 13  ? 15.211  27.288  -77.203 1.00 77.92  ? 574  LYS B HG3  1 
ATOM   6169  N N    . ASP B 1 14  ? 13.192  25.650  -77.259 1.00 67.89  ? 575  ASP B N    1 
ATOM   6170  C CA   . ASP B 1 14  ? 12.884  24.849  -76.082 1.00 56.49  ? 575  ASP B CA   1 
ATOM   6171  C C    . ASP B 1 14  ? 11.884  23.791  -76.520 1.00 50.45  ? 575  ASP B C    1 
ATOM   6172  O O    . ASP B 1 14  ? 10.733  24.105  -76.831 1.00 56.58  ? 575  ASP B O    1 
ATOM   6173  C CB   . ASP B 1 14  ? 12.310  25.715  -74.962 1.00 48.79  ? 575  ASP B CB   1 
ATOM   6174  C CG   . ASP B 1 14  ? 13.198  26.897  -74.614 1.00 55.48  ? 575  ASP B CG   1 
ATOM   6175  O OD1  . ASP B 1 14  ? 14.429  26.793  -74.780 1.00 56.43  ? 575  ASP B OD1  1 
ATOM   6176  O OD2  . ASP B 1 14  ? 12.660  27.932  -74.165 1.00 47.38  ? 575  ASP B OD2  1 
ATOM   6177  H H    . ASP B 1 14  ? 12.799  26.415  -77.287 1.00 81.47  ? 575  ASP B H    1 
ATOM   6178  H HA   . ASP B 1 14  ? 13.687  24.410  -75.761 1.00 67.79  ? 575  ASP B HA   1 
ATOM   6179  H HB2  . ASP B 1 14  ? 11.448  26.060  -75.240 1.00 58.54  ? 575  ASP B HB2  1 
ATOM   6180  H HB3  . ASP B 1 14  ? 12.209  25.172  -74.164 1.00 58.54  ? 575  ASP B HB3  1 
ATOM   6181  N N    . VAL B 1 15  ? 12.310  22.533  -76.501 1.00 51.28  ? 576  VAL B N    1 
ATOM   6182  C CA   . VAL B 1 15  ? 11.495  21.413  -76.948 1.00 46.70  ? 576  VAL B CA   1 
ATOM   6183  C C    . VAL B 1 15  ? 11.657  20.313  -75.918 1.00 39.56  ? 576  VAL B C    1 
ATOM   6184  O O    . VAL B 1 15  ? 12.767  19.805  -75.717 1.00 36.88  ? 576  VAL B O    1 
ATOM   6185  C CB   . VAL B 1 15  ? 11.901  20.909  -78.345 1.00 42.93  ? 576  VAL B CB   1 
ATOM   6186  C CG1  . VAL B 1 15  ? 11.054  19.704  -78.750 1.00 46.01  ? 576  VAL B CG1  1 
ATOM   6187  C CG2  . VAL B 1 15  ? 11.768  22.016  -79.377 1.00 49.80  ? 576  VAL B CG2  1 
ATOM   6188  H H    . VAL B 1 15  ? 13.090  22.299  -76.226 1.00 61.54  ? 576  VAL B H    1 
ATOM   6189  H HA   . VAL B 1 15  ? 10.562  21.678  -76.973 1.00 56.04  ? 576  VAL B HA   1 
ATOM   6190  H HB   . VAL B 1 15  ? 12.829  20.629  -78.322 1.00 51.52  ? 576  VAL B HB   1 
ATOM   6191  H HG11 . VAL B 1 15  ? 11.330  19.407  -79.632 1.00 55.21  ? 576  VAL B HG11 1 
ATOM   6192  H HG12 . VAL B 1 15  ? 11.188  18.993  -78.104 1.00 55.21  ? 576  VAL B HG12 1 
ATOM   6193  H HG13 . VAL B 1 15  ? 10.120  19.966  -78.766 1.00 55.21  ? 576  VAL B HG13 1 
ATOM   6194  H HG21 . VAL B 1 15  ? 12.029  21.671  -80.245 1.00 59.76  ? 576  VAL B HG21 1 
ATOM   6195  H HG22 . VAL B 1 15  ? 10.845  22.313  -79.404 1.00 59.76  ? 576  VAL B HG22 1 
ATOM   6196  H HG23 . VAL B 1 15  ? 12.346  22.753  -79.126 1.00 59.76  ? 576  VAL B HG23 1 
ATOM   6197  N N    . LEU B 1 16  ? 10.559  19.947  -75.268 1.00 39.75  ? 577  LEU B N    1 
ATOM   6198  C CA   . LEU B 1 16  ? 10.605  18.848  -74.319 1.00 39.66  ? 577  LEU B CA   1 
ATOM   6199  C C    . LEU B 1 16  ? 10.662  17.507  -75.036 1.00 39.60  ? 577  LEU B C    1 
ATOM   6200  O O    . LEU B 1 16  ? 11.324  16.581  -74.556 1.00 43.22  ? 577  LEU B O    1 
ATOM   6201  C CB   . LEU B 1 16  ? 9.401   18.940  -73.380 1.00 33.26  ? 577  LEU B CB   1 
ATOM   6202  C CG   . LEU B 1 16  ? 9.322   20.287  -72.653 1.00 34.01  ? 577  LEU B CG   1 
ATOM   6203  C CD1  . LEU B 1 16  ? 8.021   20.427  -71.882 1.00 35.65  ? 577  LEU B CD1  1 
ATOM   6204  C CD2  . LEU B 1 16  ? 10.515  20.472  -71.722 1.00 32.97  ? 577  LEU B CD2  1 
ATOM   6205  H H    . LEU B 1 16  ? 9.786   20.314  -75.357 1.00 47.70  ? 577  LEU B H    1 
ATOM   6206  H HA   . LEU B 1 16  ? 11.408  18.932  -73.781 1.00 47.59  ? 577  LEU B HA   1 
ATOM   6207  H HB2  . LEU B 1 16  ? 8.588   18.829  -73.897 1.00 39.92  ? 577  LEU B HB2  1 
ATOM   6208  H HB3  . LEU B 1 16  ? 9.467   18.240  -72.712 1.00 39.92  ? 577  LEU B HB3  1 
ATOM   6209  H HG   . LEU B 1 16  ? 9.350   20.998  -73.312 1.00 40.81  ? 577  LEU B HG   1 
ATOM   6210  H HD11 . LEU B 1 16  ? 8.009   21.289  -71.437 1.00 42.78  ? 577  LEU B HD11 1 
ATOM   6211  H HD12 . LEU B 1 16  ? 7.278   20.364  -72.503 1.00 42.78  ? 577  LEU B HD12 1 
ATOM   6212  H HD13 . LEU B 1 16  ? 7.965   19.715  -71.226 1.00 42.78  ? 577  LEU B HD13 1 
ATOM   6213  H HD21 . LEU B 1 16  ? 10.438  21.331  -71.277 1.00 39.56  ? 577  LEU B HD21 1 
ATOM   6214  H HD22 . LEU B 1 16  ? 10.518  19.758  -71.066 1.00 39.56  ? 577  LEU B HD22 1 
ATOM   6215  H HD23 . LEU B 1 16  ? 11.331  20.443  -72.246 1.00 39.56  ? 577  LEU B HD23 1 
ATOM   6216  N N    . GLY B 1 17  ? 10.022  17.399  -76.193 1.00 33.96  ? 578  GLY B N    1 
ATOM   6217  C CA   . GLY B 1 17  ? 10.083  16.179  -76.972 1.00 34.00  ? 578  GLY B CA   1 
ATOM   6218  C C    . GLY B 1 17  ? 9.149   16.253  -78.155 1.00 39.67  ? 578  GLY B C    1 
ATOM   6219  O O    . GLY B 1 17  ? 8.284   17.130  -78.250 1.00 41.44  ? 578  GLY B O    1 
ATOM   6220  H H    . GLY B 1 17  ? 9.546   18.022  -76.548 1.00 40.76  ? 578  GLY B H    1 
ATOM   6221  H HA2  . GLY B 1 17  ? 10.987  16.040  -77.295 1.00 40.80  ? 578  GLY B HA2  1 
ATOM   6222  H HA3  . GLY B 1 17  ? 9.829   15.423  -76.419 1.00 40.80  ? 578  GLY B HA3  1 
ATOM   6223  N N    . HIS B 1 18  ? 9.343   15.307  -79.070 1.00 44.30  ? 579  HIS B N    1 
ATOM   6224  C CA   . HIS B 1 18  ? 8.515   15.180  -80.261 1.00 47.96  ? 579  HIS B CA   1 
ATOM   6225  C C    . HIS B 1 18  ? 7.517   14.049  -80.066 1.00 46.62  ? 579  HIS B C    1 
ATOM   6226  O O    . HIS B 1 18  ? 7.886   12.953  -79.631 1.00 45.06  ? 579  HIS B O    1 
ATOM   6227  C CB   . HIS B 1 18  ? 9.367   14.919  -81.504 1.00 48.72  ? 579  HIS B CB   1 
ATOM   6228  C CG   . HIS B 1 18  ? 10.285  16.048  -81.854 1.00 48.22  ? 579  HIS B CG   1 
ATOM   6229  N ND1  . HIS B 1 18  ? 9.985   16.975  -82.829 1.00 47.73  ? 579  HIS B ND1  1 
ATOM   6230  C CD2  . HIS B 1 18  ? 11.495  16.400  -81.359 1.00 51.18  ? 579  HIS B CD2  1 
ATOM   6231  C CE1  . HIS B 1 18  ? 10.972  17.849  -82.920 1.00 51.63  ? 579  HIS B CE1  1 
ATOM   6232  N NE2  . HIS B 1 18  ? 11.900  17.523  -82.039 1.00 52.81  ? 579  HIS B NE2  1 
ATOM   6233  H H    . HIS B 1 18  ? 9.964   14.714  -79.020 1.00 53.17  ? 579  HIS B H    1 
ATOM   6234  H HA   . HIS B 1 18  ? 8.020   16.004  -80.397 1.00 57.55  ? 579  HIS B HA   1 
ATOM   6235  H HB2  . HIS B 1 18  ? 9.912   14.131  -81.350 1.00 58.46  ? 579  HIS B HB2  1 
ATOM   6236  H HB3  . HIS B 1 18  ? 8.779   14.770  -82.261 1.00 58.46  ? 579  HIS B HB3  1 
ATOM   6237  H HD2  . HIS B 1 18  ? 11.964  15.964  -80.685 1.00 61.42  ? 579  HIS B HD2  1 
ATOM   6238  H HE1  . HIS B 1 18  ? 11.006  18.572  -83.505 1.00 61.96  ? 579  HIS B HE1  1 
ATOM   6239  H HE2  . HIS B 1 18  ? 12.638  17.945  -81.911 1.00 63.37  ? 579  HIS B HE2  1 
ATOM   6240  N N    . GLY B 1 19  ? 6.257   14.324  -80.381 1.00 49.44  ? 580  GLY B N    1 
ATOM   6241  C CA   . GLY B 1 19  ? 5.209   13.327  -80.359 1.00 49.68  ? 580  GLY B CA   1 
ATOM   6242  C C    . GLY B 1 19  ? 5.121   12.604  -81.686 1.00 56.06  ? 580  GLY B C    1 
ATOM   6243  O O    . GLY B 1 19  ? 6.137   12.369  -82.347 1.00 70.22  ? 580  GLY B O    1 
ATOM   6244  H H    . GLY B 1 19  ? 5.983   15.105  -80.617 1.00 59.33  ? 580  GLY B H    1 
ATOM   6245  H HA2  . GLY B 1 19  ? 5.389   12.678  -79.662 1.00 59.62  ? 580  GLY B HA2  1 
ATOM   6246  H HA3  . GLY B 1 19  ? 4.356   13.752  -80.178 1.00 59.62  ? 580  GLY B HA3  1 
ATOM   6247  N N    . ALA B 1 20  ? 3.905   12.243  -82.073 1.00 54.47  ? 581  ALA B N    1 
ATOM   6248  C CA   . ALA B 1 20  ? 3.617   11.586  -83.336 1.00 59.51  ? 581  ALA B CA   1 
ATOM   6249  C C    . ALA B 1 20  ? 2.718   12.497  -84.160 1.00 61.19  ? 581  ALA B C    1 
ATOM   6250  O O    . ALA B 1 20  ? 2.203   13.504  -83.665 1.00 61.85  ? 581  ALA B O    1 
ATOM   6251  C CB   . ALA B 1 20  ? 2.952   10.221  -83.119 1.00 62.43  ? 581  ALA B CB   1 
ATOM   6252  H H    . ALA B 1 20  ? 3.201   12.375  -81.597 1.00 65.36  ? 581  ALA B H    1 
ATOM   6253  H HA   . ALA B 1 20  ? 4.444   11.449  -83.824 1.00 71.41  ? 581  ALA B HA   1 
ATOM   6254  H HB1  . ALA B 1 20  ? 2.776   9.815   -83.983 1.00 74.92  ? 581  ALA B HB1  1 
ATOM   6255  H HB2  . ALA B 1 20  ? 3.550   9.657   -82.604 1.00 74.92  ? 581  ALA B HB2  1 
ATOM   6256  H HB3  . ALA B 1 20  ? 2.120   10.349  -82.638 1.00 74.92  ? 581  ALA B HB3  1 
ATOM   6257  N N    . GLU B 1 21  ? 2.603   12.175  -85.451 1.00 65.98  ? 582  GLU B N    1 
ATOM   6258  C CA   . GLU B 1 21  ? 1.754   12.912  -86.394 1.00 65.26  ? 582  GLU B CA   1 
ATOM   6259  C C    . GLU B 1 21  ? 2.006   14.418  -86.310 1.00 65.99  ? 582  GLU B C    1 
ATOM   6260  O O    . GLU B 1 21  ? 1.088   15.236  -86.400 1.00 66.00  ? 582  GLU B O    1 
ATOM   6261  C CB   . GLU B 1 21  ? 0.264   12.576  -86.193 1.00 70.32  ? 582  GLU B CB   1 
ATOM   6262  C CG   . GLU B 1 21  ? -0.174  12.188  -84.779 1.00 81.86  ? 582  GLU B CG   1 
ATOM   6263  C CD   . GLU B 1 21  ? -1.675  12.033  -84.650 1.00 100.64 ? 582  GLU B CD   1 
ATOM   6264  O OE1  . GLU B 1 21  ? -2.277  11.257  -85.421 1.00 102.34 ? 582  GLU B OE1  1 
ATOM   6265  O OE2  . GLU B 1 21  ? -2.250  12.696  -83.765 1.00 95.49  ? 582  GLU B OE2  1 
ATOM   6266  H H    . GLU B 1 21  ? 3.019   11.515  -85.814 1.00 79.17  ? 582  GLU B H    1 
ATOM   6267  H HA   . GLU B 1 21  ? 1.990   12.633  -87.292 1.00 78.31  ? 582  GLU B HA   1 
ATOM   6268  H HB2  . GLU B 1 21  ? -0.258  13.353  -86.451 1.00 84.38  ? 582  GLU B HB2  1 
ATOM   6269  H HB3  . GLU B 1 21  ? 0.040   11.834  -86.776 1.00 84.38  ? 582  GLU B HB3  1 
ATOM   6270  H HG2  . GLU B 1 21  ? 0.236   11.341  -84.543 1.00 98.24  ? 582  GLU B HG2  1 
ATOM   6271  H HG3  . GLU B 1 21  ? 0.111   12.878  -84.160 1.00 98.24  ? 582  GLU B HG3  1 
ATOM   6272  N N    . GLY B 1 22  ? 3.275   14.786  -86.149 1.00 61.90  ? 583  GLY B N    1 
ATOM   6273  C CA   . GLY B 1 22  ? 3.667   16.180  -86.129 1.00 57.03  ? 583  GLY B CA   1 
ATOM   6274  C C    . GLY B 1 22  ? 3.508   16.874  -84.797 1.00 56.89  ? 583  GLY B C    1 
ATOM   6275  O O    . GLY B 1 22  ? 3.735   18.087  -84.721 1.00 62.47  ? 583  GLY B O    1 
ATOM   6276  H H    . GLY B 1 22  ? 3.930   14.238  -86.050 1.00 74.28  ? 583  GLY B H    1 
ATOM   6277  H HA2  . GLY B 1 22  ? 4.598   16.247  -86.390 1.00 68.44  ? 583  GLY B HA2  1 
ATOM   6278  H HA3  . GLY B 1 22  ? 3.137   16.664  -86.782 1.00 68.44  ? 583  GLY B HA3  1 
ATOM   6279  N N    . THR B 1 23  ? 3.128   16.153  -83.746 1.00 53.44  ? 584  THR B N    1 
ATOM   6280  C CA   . THR B 1 23  ? 2.978   16.768  -82.435 1.00 51.04  ? 584  THR B CA   1 
ATOM   6281  C C    . THR B 1 23  ? 4.345   17.113  -81.859 1.00 47.65  ? 584  THR B C    1 
ATOM   6282  O O    . THR B 1 23  ? 5.256   16.279  -81.849 1.00 50.09  ? 584  THR B O    1 
ATOM   6283  C CB   . THR B 1 23  ? 2.229   15.830  -81.489 1.00 48.68  ? 584  THR B CB   1 
ATOM   6284  O OG1  . THR B 1 23  ? 0.939   15.527  -82.034 1.00 54.32  ? 584  THR B OG1  1 
ATOM   6285  C CG2  . THR B 1 23  ? 2.056   16.468  -80.111 1.00 47.92  ? 584  THR B CG2  1 
ATOM   6286  H H    . THR B 1 23  ? 2.952   15.312  -83.767 1.00 64.12  ? 584  THR B H    1 
ATOM   6287  H HA   . THR B 1 23  ? 2.467   17.588  -82.521 1.00 61.25  ? 584  THR B HA   1 
ATOM   6288  H HB   . THR B 1 23  ? 2.734   15.008  -81.384 1.00 58.41  ? 584  THR B HB   1 
ATOM   6289  H HG1  . THR B 1 23  ? 1.023   15.153  -82.782 1.00 65.19  ? 584  THR B HG1  1 
ATOM   6290  H HG21 . THR B 1 23  ? 1.580   15.862  -79.523 1.00 57.51  ? 584  THR B HG21 1 
ATOM   6291  H HG22 . THR B 1 23  ? 2.925   16.664  -79.726 1.00 57.51  ? 584  THR B HG22 1 
ATOM   6292  H HG23 . THR B 1 23  ? 1.552   17.293  -80.189 1.00 57.51  ? 584  THR B HG23 1 
ATOM   6293  N N    . ILE B 1 24  ? 4.486   18.351  -81.385 1.00 42.76  ? 585  ILE B N    1 
ATOM   6294  C CA   . ILE B 1 24  ? 5.679   18.798  -80.678 1.00 40.75  ? 585  ILE B CA   1 
ATOM   6295  C C    . ILE B 1 24  ? 5.241   19.427  -79.365 1.00 42.14  ? 585  ILE B C    1 
ATOM   6296  O O    . ILE B 1 24  ? 4.180   20.053  -79.274 1.00 40.78  ? 585  ILE B O    1 
ATOM   6297  C CB   . ILE B 1 24  ? 6.519   19.808  -81.494 1.00 44.86  ? 585  ILE B CB   1 
ATOM   6298  C CG1  . ILE B 1 24  ? 6.513   19.437  -82.979 1.00 51.04  ? 585  ILE B CG1  1 
ATOM   6299  C CG2  . ILE B 1 24  ? 7.936   19.875  -80.926 1.00 45.42  ? 585  ILE B CG2  1 
ATOM   6300  C CD1  . ILE B 1 24  ? 7.369   20.339  -83.851 1.00 49.73  ? 585  ILE B CD1  1 
ATOM   6301  H H    . ILE B 1 24  ? 3.887   18.963  -81.465 1.00 51.31  ? 585  ILE B H    1 
ATOM   6302  H HA   . ILE B 1 24  ? 6.237   18.031  -80.477 1.00 48.90  ? 585  ILE B HA   1 
ATOM   6303  H HB   . ILE B 1 24  ? 6.114   20.684  -81.399 1.00 53.83  ? 585  ILE B HB   1 
ATOM   6304  H HG12 . ILE B 1 24  ? 6.847   18.531  -83.075 1.00 61.24  ? 585  ILE B HG12 1 
ATOM   6305  H HG13 . ILE B 1 24  ? 5.602   19.486  -83.308 1.00 61.24  ? 585  ILE B HG13 1 
ATOM   6306  H HG21 . ILE B 1 24  ? 8.454   20.510  -81.445 1.00 54.50  ? 585  ILE B HG21 1 
ATOM   6307  H HG22 . ILE B 1 24  ? 7.892   20.160  -80.000 1.00 54.50  ? 585  ILE B HG22 1 
ATOM   6308  H HG23 . ILE B 1 24  ? 8.340   18.994  -80.982 1.00 54.50  ? 585  ILE B HG23 1 
ATOM   6309  H HD11 . ILE B 1 24  ? 7.309   20.037  -84.771 1.00 59.68  ? 585  ILE B HD11 1 
ATOM   6310  H HD12 . ILE B 1 24  ? 7.041   21.249  -83.780 1.00 59.68  ? 585  ILE B HD12 1 
ATOM   6311  H HD13 . ILE B 1 24  ? 8.288   20.293  -83.546 1.00 59.68  ? 585  ILE B HD13 1 
ATOM   6312  N N    . VAL B 1 25  ? 6.072   19.251  -78.342 1.00 36.94  ? 586  VAL B N    1 
ATOM   6313  C CA   . VAL B 1 25  ? 5.831   19.806  -77.017 1.00 33.44  ? 586  VAL B CA   1 
ATOM   6314  C C    . VAL B 1 25  ? 6.987   20.734  -76.681 1.00 32.50  ? 586  VAL B C    1 
ATOM   6315  O O    . VAL B 1 25  ? 8.156   20.344  -76.791 1.00 31.95  ? 586  VAL B O    1 
ATOM   6316  C CB   . VAL B 1 25  ? 5.686   18.701  -75.956 1.00 34.85  ? 586  VAL B CB   1 
ATOM   6317  C CG1  . VAL B 1 25  ? 5.238   19.295  -74.625 1.00 29.86  ? 586  VAL B CG1  1 
ATOM   6318  C CG2  . VAL B 1 25  ? 4.695   17.657  -76.427 1.00 34.11  ? 586  VAL B CG2  1 
ATOM   6319  H H    . VAL B 1 25  ? 6.803   18.800  -78.394 1.00 44.32  ? 586  VAL B H    1 
ATOM   6320  H HA   . VAL B 1 25  ? 5.013   20.327  -77.029 1.00 40.13  ? 586  VAL B HA   1 
ATOM   6321  H HB   . VAL B 1 25  ? 6.545   18.268  -75.823 1.00 41.82  ? 586  VAL B HB   1 
ATOM   6322  H HG11 . VAL B 1 25  ? 5.154   18.581  -73.973 1.00 35.83  ? 586  VAL B HG11 1 
ATOM   6323  H HG12 . VAL B 1 25  ? 5.900   19.938  -74.327 1.00 35.83  ? 586  VAL B HG12 1 
ATOM   6324  H HG13 . VAL B 1 25  ? 4.381   19.733  -74.748 1.00 35.83  ? 586  VAL B HG13 1 
ATOM   6325  H HG21 . VAL B 1 25  ? 4.616   16.968  -75.748 1.00 40.94  ? 586  VAL B HG21 1 
ATOM   6326  H HG22 . VAL B 1 25  ? 3.835   18.081  -76.571 1.00 40.94  ? 586  VAL B HG22 1 
ATOM   6327  H HG23 . VAL B 1 25  ? 5.016   17.269  -77.256 1.00 40.94  ? 586  VAL B HG23 1 
ATOM   6328  N N    . TYR B 1 26  ? 6.657   21.954  -76.271 1.00 31.29  ? 587  TYR B N    1 
ATOM   6329  C CA   . TYR B 1 26  ? 7.632   22.972  -75.921 1.00 34.59  ? 587  TYR B CA   1 
ATOM   6330  C C    . TYR B 1 26  ? 7.468   23.345  -74.457 1.00 30.96  ? 587  TYR B C    1 
ATOM   6331  O O    . TYR B 1 26  ? 6.422   23.111  -73.845 1.00 31.55  ? 587  TYR B O    1 
ATOM   6332  C CB   . TYR B 1 26  ? 7.470   24.242  -76.773 1.00 37.66  ? 587  TYR B CB   1 
ATOM   6333  C CG   . TYR B 1 26  ? 7.457   24.029  -78.269 1.00 30.66  ? 587  TYR B CG   1 
ATOM   6334  C CD1  . TYR B 1 26  ? 6.276   23.741  -78.937 1.00 29.77  ? 587  TYR B CD1  1 
ATOM   6335  C CD2  . TYR B 1 26  ? 8.620   24.149  -79.018 1.00 39.37  ? 587  TYR B CD2  1 
ATOM   6336  C CE1  . TYR B 1 26  ? 6.258   23.559  -80.306 1.00 42.02  ? 587  TYR B CE1  1 
ATOM   6337  C CE2  . TYR B 1 26  ? 8.612   23.969  -80.385 1.00 41.31  ? 587  TYR B CE2  1 
ATOM   6338  C CZ   . TYR B 1 26  ? 7.430   23.675  -81.024 1.00 40.97  ? 587  TYR B CZ   1 
ATOM   6339  O OH   . TYR B 1 26  ? 7.422   23.497  -82.386 1.00 52.84  ? 587  TYR B OH   1 
ATOM   6340  H H    . TYR B 1 26  ? 5.844   22.222  -76.186 1.00 37.54  ? 587  TYR B H    1 
ATOM   6341  H HA   . TYR B 1 26  ? 8.527   22.623  -76.053 1.00 41.51  ? 587  TYR B HA   1 
ATOM   6342  H HB2  . TYR B 1 26  ? 6.632   24.667  -76.533 1.00 45.19  ? 587  TYR B HB2  1 
ATOM   6343  H HB3  . TYR B 1 26  ? 8.206   24.841  -76.572 1.00 45.19  ? 587  TYR B HB3  1 
ATOM   6344  H HD1  . TYR B 1 26  ? 5.485   23.661  -78.455 1.00 35.72  ? 587  TYR B HD1  1 
ATOM   6345  H HD2  . TYR B 1 26  ? 9.421   24.347  -78.588 1.00 47.24  ? 587  TYR B HD2  1 
ATOM   6346  H HE1  . TYR B 1 26  ? 5.461   23.360  -80.741 1.00 50.42  ? 587  TYR B HE1  1 
ATOM   6347  H HE2  . TYR B 1 26  ? 9.401   24.047  -80.871 1.00 49.58  ? 587  TYR B HE2  1 
ATOM   6348  H HH   . TYR B 1 26  ? 8.198   23.596  -82.694 1.00 63.41  ? 587  TYR B HH   1 
ATOM   6349  N N    . ARG B 1 27  ? 8.528   23.922  -73.900 1.00 32.04  ? 588  ARG B N    1 
ATOM   6350  C CA   . ARG B 1 27  ? 8.454   24.611  -72.621 1.00 29.71  ? 588  ARG B CA   1 
ATOM   6351  C C    . ARG B 1 27  ? 8.075   26.062  -72.887 1.00 36.27  ? 588  ARG B C    1 
ATOM   6352  O O    . ARG B 1 27  ? 8.677   26.719  -73.743 1.00 37.66  ? 588  ARG B O    1 
ATOM   6353  C CB   . ARG B 1 27  ? 9.787   24.528  -71.879 1.00 35.94  ? 588  ARG B CB   1 
ATOM   6354  C CG   . ARG B 1 27  ? 9.761   25.172  -70.506 1.00 33.07  ? 588  ARG B CG   1 
ATOM   6355  C CD   . ARG B 1 27  ? 11.039  24.887  -69.737 1.00 33.01  ? 588  ARG B CD   1 
ATOM   6356  N NE   . ARG B 1 27  ? 11.065  25.572  -68.449 1.00 48.86  ? 588  ARG B NE   1 
ATOM   6357  C CZ   . ARG B 1 27  ? 12.029  25.431  -67.545 1.00 54.67  ? 588  ARG B CZ   1 
ATOM   6358  N NH1  . ARG B 1 27  ? 13.056  24.623  -67.778 1.00 58.03  ? 588  ARG B NH1  1 
ATOM   6359  N NH2  . ARG B 1 27  ? 11.963  26.099  -66.402 1.00 52.80  ? 588  ARG B NH2  1 
ATOM   6360  H H    . ARG B 1 27  ? 9.313   23.927  -74.251 1.00 38.45  ? 588  ARG B H    1 
ATOM   6361  H HA   . ARG B 1 27  ? 7.766   24.206  -72.071 1.00 35.65  ? 588  ARG B HA   1 
ATOM   6362  H HB2  . ARG B 1 27  ? 10.024  23.595  -71.765 1.00 43.13  ? 588  ARG B HB2  1 
ATOM   6363  H HB3  . ARG B 1 27  ? 10.466  24.978  -72.405 1.00 43.13  ? 588  ARG B HB3  1 
ATOM   6364  H HG2  . ARG B 1 27  ? 9.673   26.133  -70.604 1.00 39.68  ? 588  ARG B HG2  1 
ATOM   6365  H HG3  . ARG B 1 27  ? 9.015   24.816  -69.998 1.00 39.68  ? 588  ARG B HG3  1 
ATOM   6366  H HD2  . ARG B 1 27  ? 11.107  23.933  -69.574 1.00 39.61  ? 588  ARG B HD2  1 
ATOM   6367  H HD3  . ARG B 1 27  ? 11.799  25.192  -70.258 1.00 39.61  ? 588  ARG B HD3  1 
ATOM   6368  H HE   . ARG B 1 27  ? 10.414  26.103  -68.263 1.00 58.64  ? 588  ARG B HE   1 
ATOM   6369  H HH11 . ARG B 1 27  ? 13.101  24.188  -68.518 1.00 69.64  ? 588  ARG B HH11 1 
ATOM   6370  H HH12 . ARG B 1 27  ? 13.676  24.535  -67.189 1.00 69.64  ? 588  ARG B HH12 1 
ATOM   6371  H HH21 . ARG B 1 27  ? 11.299  26.623  -66.247 1.00 63.36  ? 588  ARG B HH21 1 
ATOM   6372  H HH22 . ARG B 1 27  ? 12.585  26.008  -65.815 1.00 63.36  ? 588  ARG B HH22 1 
ATOM   6373  N N    . GLY B 1 28  ? 7.074   26.556  -72.164 1.00 32.36  ? 589  GLY B N    1 
ATOM   6374  C CA   . GLY B 1 28  ? 6.525   27.863  -72.455 1.00 34.81  ? 589  GLY B CA   1 
ATOM   6375  C C    . GLY B 1 28  ? 5.841   28.505  -71.267 1.00 30.67  ? 589  GLY B C    1 
ATOM   6376  O O    . GLY B 1 28  ? 5.909   27.995  -70.145 1.00 30.23  ? 589  GLY B O    1 
ATOM   6377  H H    . GLY B 1 28  ? 6.701   26.152  -71.503 1.00 38.83  ? 589  GLY B H    1 
ATOM   6378  H HA2  . GLY B 1 28  ? 7.238   28.451  -72.750 1.00 41.77  ? 589  GLY B HA2  1 
ATOM   6379  H HA3  . GLY B 1 28  ? 5.877   27.785  -73.173 1.00 41.77  ? 589  GLY B HA3  1 
ATOM   6380  N N    . MET B 1 29  ? 5.186   29.635  -71.512 1.00 29.22  ? 590  MET B N    1 
ATOM   6381  C CA   . MET B 1 29  ? 4.533   30.423  -70.478 1.00 30.54  ? 590  MET B CA   1 
ATOM   6382  C C    . MET B 1 29  ? 3.045   30.533  -70.769 1.00 25.44  ? 590  MET B C    1 
ATOM   6383  O O    . MET B 1 29  ? 2.640   30.714  -71.920 1.00 33.80  ? 590  MET B O    1 
ATOM   6384  C CB   . MET B 1 29  ? 5.133   31.826  -70.399 1.00 35.11  ? 590  MET B CB   1 
ATOM   6385  C CG   . MET B 1 29  ? 6.608   31.859  -70.057 1.00 39.16  ? 590  MET B CG   1 
ATOM   6386  S SD   . MET B 1 29  ? 6.913   31.468  -68.327 1.00 56.99  ? 590  MET B SD   1 
ATOM   6387  C CE   . MET B 1 29  ? 6.192   32.897  -67.520 1.00 64.56  ? 590  MET B CE   1 
ATOM   6388  H H    . MET B 1 29  ? 5.105   29.976  -72.297 1.00 35.06  ? 590  MET B H    1 
ATOM   6389  H HA   . MET B 1 29  ? 4.660   29.990  -69.619 1.00 36.64  ? 590  MET B HA   1 
ATOM   6390  H HB2  . MET B 1 29  ? 5.020   32.260  -71.260 1.00 42.13  ? 590  MET B HB2  1 
ATOM   6391  H HB3  . MET B 1 29  ? 4.661   32.327  -69.716 1.00 42.13  ? 590  MET B HB3  1 
ATOM   6392  H HG2  . MET B 1 29  ? 7.076   31.206  -70.601 1.00 46.99  ? 590  MET B HG2  1 
ATOM   6393  H HG3  . MET B 1 29  ? 6.955   32.748  -70.231 1.00 46.99  ? 590  MET B HG3  1 
ATOM   6394  H HE1  . MET B 1 29  ? 6.295   32.803  -66.560 1.00 77.47  ? 590  MET B HE1  1 
ATOM   6395  H HE2  . MET B 1 29  ? 6.650   33.696  -67.825 1.00 77.47  ? 590  MET B HE2  1 
ATOM   6396  H HE3  . MET B 1 29  ? 5.251   32.947  -67.749 1.00 77.47  ? 590  MET B HE3  1 
ATOM   6397  N N    . PHE B 1 30  ? 2.235   30.398  -69.722 1.00 28.53  ? 591  PHE B N    1 
ATOM   6398  C CA   . PHE B 1 30  ? 0.820   30.746  -69.782 1.00 32.33  ? 591  PHE B CA   1 
ATOM   6399  C C    . PHE B 1 30  ? 0.445   31.436  -68.481 1.00 33.13  ? 591  PHE B C    1 
ATOM   6400  O O    . PHE B 1 30  ? 0.585   30.844  -67.407 1.00 33.39  ? 591  PHE B O    1 
ATOM   6401  C CB   . PHE B 1 30  ? -0.056  29.512  -70.002 1.00 36.55  ? 591  PHE B CB   1 
ATOM   6402  C CG   . PHE B 1 30  ? -1.495  29.725  -69.635 1.00 34.95  ? 591  PHE B CG   1 
ATOM   6403  C CD1  . PHE B 1 30  ? -2.321  30.488  -70.441 1.00 33.04  ? 591  PHE B CD1  1 
ATOM   6404  C CD2  . PHE B 1 30  ? -2.020  29.168  -68.481 1.00 33.53  ? 591  PHE B CD2  1 
ATOM   6405  C CE1  . PHE B 1 30  ? -3.645  30.691  -70.104 1.00 33.92  ? 591  PHE B CE1  1 
ATOM   6406  C CE2  . PHE B 1 30  ? -3.344  29.368  -68.140 1.00 34.44  ? 591  PHE B CE2  1 
ATOM   6407  C CZ   . PHE B 1 30  ? -4.157  30.129  -68.952 1.00 34.17  ? 591  PHE B CZ   1 
ATOM   6408  H H    . PHE B 1 30  ? 2.486   30.103  -68.955 1.00 34.24  ? 591  PHE B H    1 
ATOM   6409  H HA   . PHE B 1 30  ? 0.669   31.365  -70.513 1.00 38.80  ? 591  PHE B HA   1 
ATOM   6410  H HB2  . PHE B 1 30  ? -0.021  29.266  -70.940 1.00 43.86  ? 591  PHE B HB2  1 
ATOM   6411  H HB3  . PHE B 1 30  ? 0.285   28.784  -69.459 1.00 43.86  ? 591  PHE B HB3  1 
ATOM   6412  H HD1  . PHE B 1 30  ? -1.981  30.869  -71.218 1.00 39.65  ? 591  PHE B HD1  1 
ATOM   6413  H HD2  . PHE B 1 30  ? -1.476  28.654  -67.929 1.00 40.24  ? 591  PHE B HD2  1 
ATOM   6414  H HE1  . PHE B 1 30  ? -4.191  31.205  -70.654 1.00 40.71  ? 591  PHE B HE1  1 
ATOM   6415  H HE2  . PHE B 1 30  ? -3.686  28.988  -67.363 1.00 41.33  ? 591  PHE B HE2  1 
ATOM   6416  H HZ   . PHE B 1 30  ? -5.049  30.264  -68.725 1.00 41.00  ? 591  PHE B HZ   1 
ATOM   6417  N N    . ASP B 1 31  ? -0.050  32.668  -68.581 1.00 33.65  ? 592  ASP B N    1 
ATOM   6418  C CA   . ASP B 1 31  ? -0.508  33.432  -67.421 1.00 37.21  ? 592  ASP B CA   1 
ATOM   6419  C C    . ASP B 1 31  ? 0.579   33.506  -66.349 1.00 34.32  ? 592  ASP B C    1 
ATOM   6420  O O    . ASP B 1 31  ? 0.364   33.174  -65.182 1.00 37.56  ? 592  ASP B O    1 
ATOM   6421  C CB   . ASP B 1 31  ? -1.800  32.833  -66.859 1.00 37.90  ? 592  ASP B CB   1 
ATOM   6422  C CG   . ASP B 1 31  ? -2.442  33.710  -65.798 1.00 37.20  ? 592  ASP B CG   1 
ATOM   6423  O OD1  . ASP B 1 31  ? -2.143  34.922  -65.755 1.00 51.61  ? 592  ASP B OD1  1 
ATOM   6424  O OD2  . ASP B 1 31  ? -3.251  33.184  -65.006 1.00 40.74  ? 592  ASP B OD2  1 
ATOM   6425  H H    . ASP B 1 31  ? -0.132  33.092  -69.325 1.00 40.38  ? 592  ASP B H    1 
ATOM   6426  H HA   . ASP B 1 31  ? -0.704  34.339  -67.705 1.00 44.65  ? 592  ASP B HA   1 
ATOM   6427  H HB2  . ASP B 1 31  ? -2.438  32.722  -67.582 1.00 45.47  ? 592  ASP B HB2  1 
ATOM   6428  H HB3  . ASP B 1 31  ? -1.601  31.973  -66.458 1.00 45.47  ? 592  ASP B HB3  1 
ATOM   6429  N N    . ASN B 1 32  ? 1.770   33.940  -66.766 1.00 36.11  ? 593  ASN B N    1 
ATOM   6430  C CA   . ASN B 1 32  ? 2.905   34.133  -65.859 1.00 44.10  ? 593  ASN B CA   1 
ATOM   6431  C C    . ASN B 1 32  ? 3.230   32.853  -65.090 1.00 40.57  ? 593  ASN B C    1 
ATOM   6432  O O    . ASN B 1 32  ? 3.630   32.892  -63.925 1.00 45.44  ? 593  ASN B O    1 
ATOM   6433  C CB   . ASN B 1 32  ? 2.651   35.296  -64.894 1.00 48.20  ? 593  ASN B CB   1 
ATOM   6434  C CG   . ASN B 1 32  ? 2.599   36.639  -65.597 1.00 52.97  ? 593  ASN B CG   1 
ATOM   6435  O OD1  . ASN B 1 32  ? 3.634   37.202  -65.957 1.00 63.02  ? 593  ASN B OD1  1 
ATOM   6436  N ND2  . ASN B 1 32  ? 1.393   37.168  -65.782 1.00 57.70  ? 593  ASN B ND2  1 
ATOM   6437  H H    . ASN B 1 32  ? 1.949   34.134  -67.585 1.00 43.33  ? 593  ASN B H    1 
ATOM   6438  H HA   . ASN B 1 32  ? 3.685   34.360  -66.389 1.00 52.92  ? 593  ASN B HA   1 
ATOM   6439  H HB2  . ASN B 1 32  ? 1.800   35.158  -64.449 1.00 57.84  ? 593  ASN B HB2  1 
ATOM   6440  H HB3  . ASN B 1 32  ? 3.366   35.327  -64.240 1.00 57.84  ? 593  ASN B HB3  1 
ATOM   6441  H HD21 . ASN B 1 32  ? 1.313   37.928  -66.177 1.00 69.24  ? 593  ASN B HD21 1 
ATOM   6442  H HD22 . ASN B 1 32  ? 0.694   36.750  -65.508 1.00 69.24  ? 593  ASN B HD22 1 
ATOM   6443  N N    . ARG B 1 33  ? 3.058   31.709  -65.750 1.00 40.37  ? 594  ARG B N    1 
ATOM   6444  C CA   . ARG B 1 33  ? 3.327   30.403  -65.166 1.00 39.91  ? 594  ARG B CA   1 
ATOM   6445  C C    . ARG B 1 33  ? 4.127   29.571  -66.154 1.00 33.13  ? 594  ARG B C    1 
ATOM   6446  O O    . ARG B 1 33  ? 3.813   29.543  -67.347 1.00 32.32  ? 594  ARG B O    1 
ATOM   6447  C CB   . ARG B 1 33  ? 2.022   29.674  -64.815 1.00 42.75  ? 594  ARG B CB   1 
ATOM   6448  C CG   . ARG B 1 33  ? 2.203   28.362  -64.066 1.00 50.22  ? 594  ARG B CG   1 
ATOM   6449  C CD   . ARG B 1 33  ? 1.011   27.437  -64.299 1.00 54.11  ? 594  ARG B CD   1 
ATOM   6450  N NE   . ARG B 1 33  ? -0.251  28.010  -63.832 1.00 56.79  ? 594  ARG B NE   1 
ATOM   6451  C CZ   . ARG B 1 33  ? -0.903  27.642  -62.730 1.00 61.28  ? 594  ARG B CZ   1 
ATOM   6452  N NH1  . ARG B 1 33  ? -0.432  26.683  -61.944 1.00 56.45  ? 594  ARG B NH1  1 
ATOM   6453  N NH2  . ARG B 1 33  ? -2.044  28.238  -62.411 1.00 54.76  ? 594  ARG B NH2  1 
ATOM   6454  H H    . ARG B 1 33  ? 2.778   31.666  -66.562 1.00 48.44  ? 594  ARG B H    1 
ATOM   6455  H HA   . ARG B 1 33  ? 3.850   30.510  -64.356 1.00 47.90  ? 594  ARG B HA   1 
ATOM   6456  H HB2  . ARG B 1 33  ? 1.483   30.257  -64.258 1.00 51.30  ? 594  ARG B HB2  1 
ATOM   6457  H HB3  . ARG B 1 33  ? 1.547   29.478  -65.638 1.00 51.30  ? 594  ARG B HB3  1 
ATOM   6458  H HG2  . ARG B 1 33  ? 3.003   27.916  -64.384 1.00 60.26  ? 594  ARG B HG2  1 
ATOM   6459  H HG3  . ARG B 1 33  ? 2.270   28.540  -63.115 1.00 60.26  ? 594  ARG B HG3  1 
ATOM   6460  H HD2  . ARG B 1 33  ? 0.928   27.262  -65.249 1.00 64.93  ? 594  ARG B HD2  1 
ATOM   6461  H HD3  . ARG B 1 33  ? 1.158   26.606  -63.820 1.00 64.93  ? 594  ARG B HD3  1 
ATOM   6462  H HE   . ARG B 1 33  ? -0.602  28.635  -64.308 1.00 68.15  ? 594  ARG B HE   1 
ATOM   6463  H HH11 . ARG B 1 33  ? 0.307   26.289  -62.141 1.00 67.74  ? 594  ARG B HH11 1 
ATOM   6464  H HH12 . ARG B 1 33  ? -0.864  26.456  -61.236 1.00 67.74  ? 594  ARG B HH12 1 
ATOM   6465  H HH21 . ARG B 1 33  ? -2.359  28.860  -62.914 1.00 65.71  ? 594  ARG B HH21 1 
ATOM   6466  H HH22 . ARG B 1 33  ? -2.469  28.003  -61.701 1.00 65.71  ? 594  ARG B HH22 1 
ATOM   6467  N N    . ASP B 1 34  ? 5.161   28.897  -65.658 1.00 38.96  ? 595  ASP B N    1 
ATOM   6468  C CA   . ASP B 1 34  ? 5.872   27.924  -66.474 1.00 39.27  ? 595  ASP B CA   1 
ATOM   6469  C C    . ASP B 1 34  ? 4.936   26.770  -66.804 1.00 31.12  ? 595  ASP B C    1 
ATOM   6470  O O    . ASP B 1 34  ? 4.268   26.230  -65.917 1.00 40.86  ? 595  ASP B O    1 
ATOM   6471  C CB   . ASP B 1 34  ? 7.112   27.412  -65.745 1.00 38.91  ? 595  ASP B CB   1 
ATOM   6472  C CG   . ASP B 1 34  ? 8.151   28.494  -65.534 1.00 51.05  ? 595  ASP B CG   1 
ATOM   6473  O OD1  . ASP B 1 34  ? 8.059   29.218  -64.520 1.00 66.90  ? 595  ASP B OD1  1 
ATOM   6474  O OD2  . ASP B 1 34  ? 9.063   28.621  -66.378 1.00 47.58  ? 595  ASP B OD2  1 
ATOM   6475  H H    . ASP B 1 34  ? 5.467   28.985  -64.859 1.00 46.76  ? 595  ASP B H    1 
ATOM   6476  H HA   . ASP B 1 34  ? 6.152   28.340  -67.305 1.00 47.12  ? 595  ASP B HA   1 
ATOM   6477  H HB2  . ASP B 1 34  ? 6.850   27.073  -64.875 1.00 46.69  ? 595  ASP B HB2  1 
ATOM   6478  H HB3  . ASP B 1 34  ? 7.518   26.704  -66.269 1.00 46.69  ? 595  ASP B HB3  1 
ATOM   6479  N N    . VAL B 1 35  ? 4.873   26.399  -68.083 1.00 21.44  ? 596  VAL B N    1 
ATOM   6480  C CA   . VAL B 1 35  ? 3.976   25.345  -68.543 1.00 25.77  ? 596  VAL B CA   1 
ATOM   6481  C C    . VAL B 1 35  ? 4.619   24.630  -69.723 1.00 28.82  ? 596  VAL B C    1 
ATOM   6482  O O    . VAL B 1 35  ? 5.561   25.127  -70.346 1.00 31.73  ? 596  VAL B O    1 
ATOM   6483  C CB   . VAL B 1 35  ? 2.586   25.891  -68.960 1.00 29.45  ? 596  VAL B CB   1 
ATOM   6484  C CG1  . VAL B 1 35  ? 1.867   26.525  -67.777 1.00 30.15  ? 596  VAL B CG1  1 
ATOM   6485  C CG2  . VAL B 1 35  ? 2.720   26.887  -70.105 1.00 28.55  ? 596  VAL B CG2  1 
ATOM   6486  H H    . VAL B 1 35  ? 5.346   26.750  -68.710 1.00 25.73  ? 596  VAL B H    1 
ATOM   6487  H HA   . VAL B 1 35  ? 3.848   24.701  -67.830 1.00 30.93  ? 596  VAL B HA   1 
ATOM   6488  H HB   . VAL B 1 35  ? 2.042   25.152  -69.274 1.00 35.34  ? 596  VAL B HB   1 
ATOM   6489  H HG11 . VAL B 1 35  ? 1.004   26.855  -68.072 1.00 36.18  ? 596  VAL B HG11 1 
ATOM   6490  H HG12 . VAL B 1 35  ? 1.747   25.855  -67.086 1.00 36.18  ? 596  VAL B HG12 1 
ATOM   6491  H HG13 . VAL B 1 35  ? 2.403   27.258  -67.438 1.00 36.18  ? 596  VAL B HG13 1 
ATOM   6492  H HG21 . VAL B 1 35  ? 1.838   27.212  -70.345 1.00 34.26  ? 596  VAL B HG21 1 
ATOM   6493  H HG22 . VAL B 1 35  ? 3.278   27.626  -69.817 1.00 34.26  ? 596  VAL B HG22 1 
ATOM   6494  H HG23 . VAL B 1 35  ? 3.127   26.441  -70.864 1.00 34.26  ? 596  VAL B HG23 1 
ATOM   6495  N N    . ALA B 1 36  ? 4.107   23.439  -70.012 1.00 26.11  ? 597  ALA B N    1 
ATOM   6496  C CA   . ALA B 1 36  ? 4.377   22.760  -71.268 1.00 26.48  ? 597  ALA B CA   1 
ATOM   6497  C C    . ALA B 1 36  ? 3.327   23.173  -72.289 1.00 26.49  ? 597  ALA B C    1 
ATOM   6498  O O    . ALA B 1 36  ? 2.157   23.368  -71.947 1.00 25.45  ? 597  ALA B O    1 
ATOM   6499  C CB   . ALA B 1 36  ? 4.363   21.243  -71.087 1.00 28.59  ? 597  ALA B CB   1 
ATOM   6500  H H    . ALA B 1 36  ? 3.590   22.997  -69.486 1.00 31.34  ? 597  ALA B H    1 
ATOM   6501  H HA   . ALA B 1 36  ? 5.250   23.023  -71.599 1.00 31.77  ? 597  ALA B HA   1 
ATOM   6502  H HB1  . ALA B 1 36  ? 4.546   20.821  -71.942 1.00 34.30  ? 597  ALA B HB1  1 
ATOM   6503  H HB2  . ALA B 1 36  ? 5.045   20.995  -70.443 1.00 34.30  ? 597  ALA B HB2  1 
ATOM   6504  H HB3  . ALA B 1 36  ? 3.489   20.971  -70.765 1.00 34.30  ? 597  ALA B HB3  1 
ATOM   6505  N N    . VAL B 1 37  ? 3.753   23.315  -73.541 1.00 29.68  ? 598  VAL B N    1 
ATOM   6506  C CA   . VAL B 1 37  ? 2.876   23.720  -74.635 1.00 28.58  ? 598  VAL B CA   1 
ATOM   6507  C C    . VAL B 1 37  ? 2.900   22.615  -75.681 1.00 29.67  ? 598  VAL B C    1 
ATOM   6508  O O    . VAL B 1 37  ? 3.944   22.356  -76.294 1.00 27.31  ? 598  VAL B O    1 
ATOM   6509  C CB   . VAL B 1 37  ? 3.305   25.063  -75.246 1.00 25.90  ? 598  VAL B CB   1 
ATOM   6510  C CG1  . VAL B 1 37  ? 2.363   25.460  -76.373 1.00 27.05  ? 598  VAL B CG1  1 
ATOM   6511  C CG2  . VAL B 1 37  ? 3.339   26.143  -74.177 1.00 25.52  ? 598  VAL B CG2  1 
ATOM   6512  H H    . VAL B 1 37  ? 4.565   23.178  -73.787 1.00 35.61  ? 598  VAL B H    1 
ATOM   6513  H HA   . VAL B 1 37  ? 1.968   23.810  -74.305 1.00 34.30  ? 598  VAL B HA   1 
ATOM   6514  H HB   . VAL B 1 37  ? 4.198   24.975  -75.615 1.00 31.08  ? 598  VAL B HB   1 
ATOM   6515  H HG11 . VAL B 1 37  ? 2.653   26.309  -76.743 1.00 32.46  ? 598  VAL B HG11 1 
ATOM   6516  H HG12 . VAL B 1 37  ? 2.386   24.775  -77.059 1.00 32.46  ? 598  VAL B HG12 1 
ATOM   6517  H HG13 . VAL B 1 37  ? 1.464   25.543  -76.018 1.00 32.46  ? 598  VAL B HG13 1 
ATOM   6518  H HG21 . VAL B 1 37  ? 3.612   26.980  -74.583 1.00 30.63  ? 598  VAL B HG21 1 
ATOM   6519  H HG22 . VAL B 1 37  ? 2.453   26.234  -73.793 1.00 30.63  ? 598  VAL B HG22 1 
ATOM   6520  H HG23 . VAL B 1 37  ? 3.973   25.886  -73.490 1.00 30.63  ? 598  VAL B HG23 1 
ATOM   6521  N N    . LYS B 1 38  ? 1.751   21.975  -75.889 1.00 31.39  ? 599  LYS B N    1 
ATOM   6522  C CA   . LYS B 1 38  ? 1.612   20.875  -76.837 1.00 36.72  ? 599  LYS B CA   1 
ATOM   6523  C C    . LYS B 1 38  ? 0.988   21.413  -78.119 1.00 33.75  ? 599  LYS B C    1 
ATOM   6524  O O    . LYS B 1 38  ? -0.178  21.821  -78.125 1.00 36.76  ? 599  LYS B O    1 
ATOM   6525  C CB   . LYS B 1 38  ? 0.756   19.757  -76.245 1.00 38.97  ? 599  LYS B CB   1 
ATOM   6526  C CG   . LYS B 1 38  ? 0.650   18.523  -77.127 1.00 38.36  ? 599  LYS B CG   1 
ATOM   6527  C CD   . LYS B 1 38  ? -0.370  17.539  -76.577 1.00 39.46  ? 599  LYS B CD   1 
ATOM   6528  C CE   . LYS B 1 38  ? -0.399  16.253  -77.388 1.00 41.70  ? 599  LYS B CE   1 
ATOM   6529  N NZ   . LYS B 1 38  ? -1.460  15.317  -76.923 1.00 43.42  ? 599  LYS B NZ   1 
ATOM   6530  H H    . LYS B 1 38  ? 1.019   22.167  -75.480 1.00 37.66  ? 599  LYS B H    1 
ATOM   6531  H HA   . LYS B 1 38  ? 2.488   20.515  -77.047 1.00 44.07  ? 599  LYS B HA   1 
ATOM   6532  H HB2  . LYS B 1 38  ? 1.143   19.483  -75.399 1.00 46.77  ? 599  LYS B HB2  1 
ATOM   6533  H HB3  . LYS B 1 38  ? -0.141  20.096  -76.101 1.00 46.77  ? 599  LYS B HB3  1 
ATOM   6534  H HG2  . LYS B 1 38  ? 0.369   18.788  -78.017 1.00 46.03  ? 599  LYS B HG2  1 
ATOM   6535  H HG3  . LYS B 1 38  ? 1.512   18.080  -77.164 1.00 46.03  ? 599  LYS B HG3  1 
ATOM   6536  H HD2  . LYS B 1 38  ? -0.139  17.316  -75.662 1.00 47.35  ? 599  LYS B HD2  1 
ATOM   6537  H HD3  . LYS B 1 38  ? -1.253  17.940  -76.612 1.00 47.35  ? 599  LYS B HD3  1 
ATOM   6538  H HE2  . LYS B 1 38  ? -0.572  16.467  -78.318 1.00 50.04  ? 599  LYS B HE2  1 
ATOM   6539  H HE3  . LYS B 1 38  ? 0.457   15.804  -77.303 1.00 50.04  ? 599  LYS B HE3  1 
ATOM   6540  H HZ1  . LYS B 1 38  ? -1.450  14.577  -77.417 1.00 52.10  ? 599  LYS B HZ1  1 
ATOM   6541  H HZ2  . LYS B 1 38  ? -1.322  15.099  -76.071 1.00 52.10  ? 599  LYS B HZ2  1 
ATOM   6542  H HZ3  . LYS B 1 38  ? -2.259  15.703  -76.996 1.00 52.10  ? 599  LYS B HZ3  1 
ATOM   6543  N N    . ARG B 1 39  ? 1.763   21.410  -79.199 1.00 39.25  ? 600  ARG B N    1 
ATOM   6544  C CA   . ARG B 1 39  ? 1.289   21.836  -80.510 1.00 41.31  ? 600  ARG B CA   1 
ATOM   6545  C C    . ARG B 1 39  ? 0.849   20.607  -81.295 1.00 44.24  ? 600  ARG B C    1 
ATOM   6546  O O    . ARG B 1 39  ? 1.675   19.748  -81.622 1.00 43.51  ? 600  ARG B O    1 
ATOM   6547  C CB   . ARG B 1 39  ? 2.378   22.592  -81.270 1.00 43.77  ? 600  ARG B CB   1 
ATOM   6548  C CG   . ARG B 1 39  ? 1.866   23.327  -82.499 1.00 47.83  ? 600  ARG B CG   1 
ATOM   6549  C CD   . ARG B 1 39  ? 2.988   24.041  -83.235 1.00 49.91  ? 600  ARG B CD   1 
ATOM   6550  N NE   . ARG B 1 39  ? 3.864   23.108  -83.937 1.00 55.55  ? 600  ARG B NE   1 
ATOM   6551  C CZ   . ARG B 1 39  ? 4.817   23.472  -84.790 1.00 62.04  ? 600  ARG B CZ   1 
ATOM   6552  N NH1  . ARG B 1 39  ? 5.023   24.756  -85.058 1.00 74.79  ? 600  ARG B NH1  1 
ATOM   6553  N NH2  . ARG B 1 39  ? 5.564   22.550  -85.381 1.00 64.48  ? 600  ARG B NH2  1 
ATOM   6554  H H    . ARG B 1 39  ? 2.586   21.160  -79.197 1.00 47.11  ? 600  ARG B H    1 
ATOM   6555  H HA   . ARG B 1 39  ? 0.524   22.423  -80.403 1.00 49.58  ? 600  ARG B HA   1 
ATOM   6556  H HB2  . ARG B 1 39  ? 2.776   23.248  -80.676 1.00 52.52  ? 600  ARG B HB2  1 
ATOM   6557  H HB3  . ARG B 1 39  ? 3.053   21.959  -81.561 1.00 52.52  ? 600  ARG B HB3  1 
ATOM   6558  H HG2  . ARG B 1 39  ? 1.462   22.689  -83.108 1.00 57.39  ? 600  ARG B HG2  1 
ATOM   6559  H HG3  . ARG B 1 39  ? 1.212   23.990  -82.226 1.00 57.39  ? 600  ARG B HG3  1 
ATOM   6560  H HD2  . ARG B 1 39  ? 2.604   24.646  -83.889 1.00 59.89  ? 600  ARG B HD2  1 
ATOM   6561  H HD3  . ARG B 1 39  ? 3.523   24.536  -82.596 1.00 59.89  ? 600  ARG B HD3  1 
ATOM   6562  H HE   . ARG B 1 39  ? 3.758   22.268  -83.788 1.00 66.66  ? 600  ARG B HE   1 
ATOM   6563  H HH11 . ARG B 1 39  ? 4.540   25.357  -84.678 1.00 89.75  ? 600  ARG B HH11 1 
ATOM   6564  H HH12 . ARG B 1 39  ? 5.640   24.986  -85.611 1.00 89.75  ? 600  ARG B HH12 1 
ATOM   6565  H HH21 . ARG B 1 39  ? 5.434   21.717  -85.210 1.00 77.38  ? 600  ARG B HH21 1 
ATOM   6566  H HH22 . ARG B 1 39  ? 6.180   22.785  -85.933 1.00 77.38  ? 600  ARG B HH22 1 
ATOM   6567  N N    . ILE B 1 40  ? -0.445  20.529  -81.599 1.00 45.79  ? 601  ILE B N    1 
ATOM   6568  C CA   . ILE B 1 40  ? -1.021  19.391  -82.305 1.00 51.39  ? 601  ILE B CA   1 
ATOM   6569  C C    . ILE B 1 40  ? -1.597  19.867  -83.629 1.00 60.00  ? 601  ILE B C    1 
ATOM   6570  O O    . ILE B 1 40  ? -2.042  21.012  -83.763 1.00 55.84  ? 601  ILE B O    1 
ATOM   6571  C CB   . ILE B 1 40  ? -2.116  18.683  -81.474 1.00 50.85  ? 601  ILE B CB   1 
ATOM   6572  C CG1  . ILE B 1 40  ? -3.238  19.662  -81.106 1.00 56.69  ? 601  ILE B CG1  1 
ATOM   6573  C CG2  . ILE B 1 40  ? -1.515  18.075  -80.223 1.00 45.79  ? 601  ILE B CG2  1 
ATOM   6574  C CD1  . ILE B 1 40  ? -4.475  18.993  -80.544 1.00 54.75  ? 601  ILE B CD1  1 
ATOM   6575  H H    . ILE B 1 40  ? -1.020  21.137  -81.402 1.00 54.95  ? 601  ILE B H    1 
ATOM   6576  H HA   . ILE B 1 40  ? -0.321  18.747  -82.493 1.00 61.67  ? 601  ILE B HA   1 
ATOM   6577  H HB   . ILE B 1 40  ? -2.495  17.969  -82.010 1.00 61.02  ? 601  ILE B HB   1 
ATOM   6578  H HG12 . ILE B 1 40  ? -2.906  20.280  -80.437 1.00 68.03  ? 601  ILE B HG12 1 
ATOM   6579  H HG13 . ILE B 1 40  ? -3.501  20.149  -81.903 1.00 68.03  ? 601  ILE B HG13 1 
ATOM   6580  H HG21 . ILE B 1 40  ? -2.217  17.636  -79.717 1.00 54.95  ? 601  ILE B HG21 1 
ATOM   6581  H HG22 . ILE B 1 40  ? -0.839  17.429  -80.480 1.00 54.95  ? 601  ILE B HG22 1 
ATOM   6582  H HG23 . ILE B 1 40  ? -1.114  18.780  -79.691 1.00 54.95  ? 601  ILE B HG23 1 
ATOM   6583  H HD11 . ILE B 1 40  ? -5.135  19.673  -80.338 1.00 65.69  ? 601  ILE B HD11 1 
ATOM   6584  H HD12 . ILE B 1 40  ? -4.829  18.378  -81.206 1.00 65.69  ? 601  ILE B HD12 1 
ATOM   6585  H HD13 . ILE B 1 40  ? -4.234  18.510  -79.739 1.00 65.69  ? 601  ILE B HD13 1 
ATOM   6586  N N    . LEU B 1 41  ? -1.577  18.972  -84.617 1.00 68.45  ? 602  LEU B N    1 
ATOM   6587  C CA   . LEU B 1 41  ? -2.330  19.170  -85.846 1.00 61.87  ? 602  LEU B CA   1 
ATOM   6588  C C    . LEU B 1 41  ? -3.714  18.569  -85.639 1.00 62.07  ? 602  LEU B C    1 
ATOM   6589  O O    . LEU B 1 41  ? -3.835  17.336  -85.573 1.00 61.26  ? 602  LEU B O    1 
ATOM   6590  C CB   . LEU B 1 41  ? -1.628  18.507  -87.022 1.00 58.48  ? 602  LEU B CB   1 
ATOM   6591  H H    . LEU B 1 41  ? -1.131  18.237  -84.595 1.00 82.14  ? 602  LEU B H    1 
ATOM   6592  H HA   . LEU B 1 41  ? -2.422  20.118  -86.028 1.00 74.25  ? 602  LEU B HA   1 
ATOM   6593  N N    . PRO B 1 42  ? -4.780  19.378  -85.529 1.00 61.37  ? 603  PRO B N    1 
ATOM   6594  C CA   . PRO B 1 42  ? -6.105  18.813  -85.247 1.00 61.24  ? 603  PRO B CA   1 
ATOM   6595  C C    . PRO B 1 42  ? -6.668  18.009  -86.413 1.00 63.95  ? 603  PRO B C    1 
ATOM   6596  O O    . PRO B 1 42  ? -7.566  17.196  -86.189 1.00 62.91  ? 603  PRO B O    1 
ATOM   6597  C CB   . PRO B 1 42  ? -6.962  20.053  -84.975 1.00 57.28  ? 603  PRO B CB   1 
ATOM   6598  C CG   . PRO B 1 42  ? -6.285  21.147  -85.709 1.00 56.20  ? 603  PRO B CG   1 
ATOM   6599  C CD   . PRO B 1 42  ? -4.822  20.848  -85.631 1.00 57.01  ? 603  PRO B CD   1 
ATOM   6600  H HA   . PRO B 1 42  ? -6.076  18.258  -84.452 1.00 73.49  ? 603  PRO B HA   1 
ATOM   6601  H HB2  . PRO B 1 42  ? -7.859  19.913  -85.316 1.00 68.74  ? 603  PRO B HB2  1 
ATOM   6602  H HB3  . PRO B 1 42  ? -6.980  20.237  -84.022 1.00 68.74  ? 603  PRO B HB3  1 
ATOM   6603  H HG2  . PRO B 1 42  ? -6.583  21.151  -86.632 1.00 67.44  ? 603  PRO B HG2  1 
ATOM   6604  H HG3  . PRO B 1 42  ? -6.483  21.995  -85.282 1.00 67.44  ? 603  PRO B HG3  1 
ATOM   6605  H HD2  . PRO B 1 42  ? -4.372  21.143  -86.438 1.00 68.41  ? 603  PRO B HD2  1 
ATOM   6606  H HD3  . PRO B 1 42  ? -4.436  21.253  -84.839 1.00 68.41  ? 603  PRO B HD3  1 
ATOM   6607  N N    . ASP B 1 49  ? -9.736  16.921  -80.879 1.00 67.66  ? 610  ASP B N    1 
ATOM   6608  C CA   . ASP B 1 49  ? -10.252 17.562  -79.675 1.00 59.17  ? 610  ASP B CA   1 
ATOM   6609  C C    . ASP B 1 49  ? -10.681 16.523  -78.643 1.00 59.70  ? 610  ASP B C    1 
ATOM   6610  O O    . ASP B 1 49  ? -10.897 16.848  -77.474 1.00 54.76  ? 610  ASP B O    1 
ATOM   6611  C CB   . ASP B 1 49  ? -11.426 18.483  -80.023 1.00 62.53  ? 610  ASP B CB   1 
ATOM   6612  C CG   . ASP B 1 49  ? -12.682 17.720  -80.409 1.00 71.34  ? 610  ASP B CG   1 
ATOM   6613  O OD1  . ASP B 1 49  ? -12.572 16.560  -80.858 1.00 86.61  ? 610  ASP B OD1  1 
ATOM   6614  O OD2  . ASP B 1 49  ? -13.786 18.290  -80.269 1.00 68.21  ? 610  ASP B OD2  1 
ATOM   6615  H HA   . ASP B 1 49  ? -9.552  18.104  -79.281 1.00 71.01  ? 610  ASP B HA   1 
ATOM   6616  H HB2  . ASP B 1 49  ? -11.635 19.033  -79.252 1.00 75.04  ? 610  ASP B HB2  1 
ATOM   6617  H HB3  . ASP B 1 49  ? -11.174 19.045  -80.772 1.00 75.04  ? 610  ASP B HB3  1 
ATOM   6618  N N    . ARG B 1 50  ? -10.811 15.269  -79.086 1.00 67.82  ? 611  ARG B N    1 
ATOM   6619  C CA   . ARG B 1 50  ? -11.188 14.194  -78.173 1.00 56.80  ? 611  ARG B CA   1 
ATOM   6620  C C    . ARG B 1 50  ? -10.155 14.031  -77.066 1.00 47.91  ? 611  ARG B C    1 
ATOM   6621  O O    . ARG B 1 50  ? -10.500 13.979  -75.879 1.00 48.23  ? 611  ARG B O    1 
ATOM   6622  C CB   . ARG B 1 50  ? -11.364 12.883  -78.947 1.00 61.92  ? 611  ARG B CB   1 
ATOM   6623  C CG   . ARG B 1 50  ? -10.053 12.209  -79.363 1.00 74.87  ? 611  ARG B CG   1 
ATOM   6624  C CD   . ARG B 1 50  ? -10.275 10.928  -80.139 1.00 84.64  ? 611  ARG B CD   1 
ATOM   6625  N NE   . ARG B 1 50  ? -9.026  10.196  -80.330 1.00 89.85  ? 611  ARG B NE   1 
ATOM   6626  H H    . ARG B 1 50  ? -10.687 15.020  -79.899 1.00 81.39  ? 611  ARG B H    1 
ATOM   6627  H HA   . ARG B 1 50  ? -12.038 14.415  -77.760 1.00 68.17  ? 611  ARG B HA   1 
ATOM   6628  H HB2  . ARG B 1 50  ? -11.853 12.257  -78.390 1.00 74.30  ? 611  ARG B HB2  1 
ATOM   6629  H HB3  . ARG B 1 50  ? -11.870 13.065  -79.755 1.00 74.30  ? 611  ARG B HB3  1 
ATOM   6630  H HG2  . ARG B 1 50  ? -9.549  12.818  -79.925 1.00 89.84  ? 611  ARG B HG2  1 
ATOM   6631  H HG3  . ARG B 1 50  ? -9.542  11.993  -78.567 1.00 89.84  ? 611  ARG B HG3  1 
ATOM   6632  H HD2  . ARG B 1 50  ? -10.889 10.359  -79.649 1.00 101.57 ? 611  ARG B HD2  1 
ATOM   6633  H HD3  . ARG B 1 50  ? -10.639 11.142  -81.012 1.00 101.57 ? 611  ARG B HD3  1 
ATOM   6634  H HE   . ARG B 1 50  ? -8.317  10.502  -79.951 1.00 107.83 ? 611  ARG B HE   1 
ATOM   6635  N N    . GLU B 1 51  ? -8.873  13.958  -77.436 1.00 46.61  ? 612  GLU B N    1 
ATOM   6636  C CA   . GLU B 1 51  ? -7.828  13.746  -76.443 1.00 45.83  ? 612  GLU B CA   1 
ATOM   6637  C C    . GLU B 1 51  ? -7.726  14.925  -75.487 1.00 48.08  ? 612  GLU B C    1 
ATOM   6638  O O    . GLU B 1 51  ? -7.282  14.761  -74.345 1.00 39.47  ? 612  GLU B O    1 
ATOM   6639  C CB   . GLU B 1 51  ? -6.487  13.507  -77.138 1.00 39.01  ? 612  GLU B CB   1 
ATOM   6640  H H    . GLU B 1 51  ? -8.590  14.027  -78.245 1.00 55.94  ? 612  GLU B H    1 
ATOM   6641  H HA   . GLU B 1 51  ? -8.042  12.956  -75.923 1.00 55.00  ? 612  GLU B HA   1 
ATOM   6642  N N    . VAL B 1 52  ? -8.135  16.115  -75.929 1.00 46.58  ? 613  VAL B N    1 
ATOM   6643  C CA   . VAL B 1 52  ? -8.134  17.271  -75.041 1.00 38.16  ? 613  VAL B CA   1 
ATOM   6644  C C    . VAL B 1 52  ? -9.269  17.157  -74.031 1.00 41.40  ? 613  VAL B C    1 
ATOM   6645  O O    . VAL B 1 52  ? -9.062  17.314  -72.822 1.00 47.47  ? 613  VAL B O    1 
ATOM   6646  C CB   . VAL B 1 52  ? -8.230  18.574  -75.857 1.00 45.60  ? 613  VAL B CB   1 
ATOM   6647  C CG1  . VAL B 1 52  ? -8.194  19.787  -74.934 1.00 43.11  ? 613  VAL B CG1  1 
ATOM   6648  C CG2  . VAL B 1 52  ? -7.098  18.642  -76.867 1.00 39.84  ? 613  VAL B CG2  1 
ATOM   6649  H H    . VAL B 1 52  ? -8.414  16.275  -76.727 1.00 55.89  ? 613  VAL B H    1 
ATOM   6650  H HA   . VAL B 1 52  ? -7.298  17.289  -74.549 1.00 45.79  ? 613  VAL B HA   1 
ATOM   6651  H HB   . VAL B 1 52  ? -9.070  18.586  -76.342 1.00 54.72  ? 613  VAL B HB   1 
ATOM   6652  H HG11 . VAL B 1 52  ? -8.256  20.593  -75.470 1.00 51.73  ? 613  VAL B HG11 1 
ATOM   6653  H HG12 . VAL B 1 52  ? -8.944  19.738  -74.320 1.00 51.73  ? 613  VAL B HG12 1 
ATOM   6654  H HG13 . VAL B 1 52  ? -7.360  19.782  -74.438 1.00 51.73  ? 613  VAL B HG13 1 
ATOM   6655  H HG21 . VAL B 1 52  ? -7.175  19.467  -77.371 1.00 47.81  ? 613  VAL B HG21 1 
ATOM   6656  H HG22 . VAL B 1 52  ? -6.252  18.620  -76.395 1.00 47.81  ? 613  VAL B HG22 1 
ATOM   6657  H HG23 . VAL B 1 52  ? -7.164  17.881  -77.466 1.00 47.81  ? 613  VAL B HG23 1 
ATOM   6658  N N    . GLN B 1 53  ? -10.483 16.869  -74.508 1.00 41.67  ? 614  GLN B N    1 
ATOM   6659  C CA   . GLN B 1 53  ? -11.622 16.761  -73.602 1.00 45.46  ? 614  GLN B CA   1 
ATOM   6660  C C    . GLN B 1 53  ? -11.451 15.608  -72.623 1.00 45.42  ? 614  GLN B C    1 
ATOM   6661  O O    . GLN B 1 53  ? -11.896 15.700  -71.473 1.00 48.64  ? 614  GLN B O    1 
ATOM   6662  C CB   . GLN B 1 53  ? -12.920 16.596  -74.395 1.00 47.98  ? 614  GLN B CB   1 
ATOM   6663  C CG   . GLN B 1 53  ? -13.804 17.838  -74.413 1.00 68.50  ? 614  GLN B CG   1 
ATOM   6664  C CD   . GLN B 1 53  ? -14.194 18.302  -73.022 1.00 89.03  ? 614  GLN B CD   1 
ATOM   6665  O OE1  . GLN B 1 53  ? -13.698 19.317  -72.533 1.00 99.23  ? 614  GLN B OE1  1 
ATOM   6666  N NE2  . GLN B 1 53  ? -15.087 17.559  -72.377 1.00 89.48  ? 614  GLN B NE2  1 
ATOM   6667  H H    . GLN B 1 53  ? -10.669 16.734  -75.337 1.00 50.00  ? 614  GLN B H    1 
ATOM   6668  H HA   . GLN B 1 53  ? -11.691 17.580  -73.087 1.00 54.56  ? 614  GLN B HA   1 
ATOM   6669  H HB2  . GLN B 1 53  ? -12.697 16.379  -75.314 1.00 57.58  ? 614  GLN B HB2  1 
ATOM   6670  H HB3  . GLN B 1 53  ? -13.434 15.873  -74.004 1.00 57.58  ? 614  GLN B HB3  1 
ATOM   6671  H HG2  . GLN B 1 53  ? -13.324 18.561  -74.847 1.00 82.19  ? 614  GLN B HG2  1 
ATOM   6672  H HG3  . GLN B 1 53  ? -14.618 17.640  -74.903 1.00 82.19  ? 614  GLN B HG3  1 
ATOM   6673  H HE21 . GLN B 1 53  ? -15.413 16.856  -72.751 1.00 107.38 ? 614  GLN B HE21 1 
ATOM   6674  H HE22 . GLN B 1 53  ? -15.340 17.781  -71.585 1.00 107.38 ? 614  GLN B HE22 1 
ATOM   6675  N N    . LEU B 1 54  ? -10.815 14.517  -73.055 1.00 44.74  ? 615  LEU B N    1 
ATOM   6676  C CA   . LEU B 1 54  ? -10.514 13.422  -72.137 1.00 45.11  ? 615  LEU B CA   1 
ATOM   6677  C C    . LEU B 1 54  ? -9.519  13.866  -71.073 1.00 39.57  ? 615  LEU B C    1 
ATOM   6678  O O    . LEU B 1 54  ? -9.690  13.573  -69.883 1.00 40.15  ? 615  LEU B O    1 
ATOM   6679  C CB   . LEU B 1 54  ? -9.975  12.219  -72.913 1.00 42.88  ? 615  LEU B CB   1 
ATOM   6680  C CG   . LEU B 1 54  ? -10.952 11.484  -73.833 1.00 38.80  ? 615  LEU B CG   1 
ATOM   6681  C CD1  . LEU B 1 54  ? -10.273 10.280  -74.467 1.00 40.09  ? 615  LEU B CD1  1 
ATOM   6682  C CD2  . LEU B 1 54  ? -12.208 11.054  -73.093 1.00 39.12  ? 615  LEU B CD2  1 
ATOM   6683  H H    . LEU B 1 54  ? -10.552 14.388  -73.863 1.00 53.69  ? 615  LEU B H    1 
ATOM   6684  H HA   . LEU B 1 54  ? -11.331 13.150  -71.690 1.00 54.13  ? 615  LEU B HA   1 
ATOM   6685  H HB2  . LEU B 1 54  ? -9.238  12.523  -73.465 1.00 51.46  ? 615  LEU B HB2  1 
ATOM   6686  H HB3  . LEU B 1 54  ? -9.645  11.571  -72.271 1.00 51.46  ? 615  LEU B HB3  1 
ATOM   6687  H HG   . LEU B 1 54  ? -11.219 12.083  -74.547 1.00 46.56  ? 615  LEU B HG   1 
ATOM   6688  H HD11 . LEU B 1 54  ? -10.908 9.828   -75.045 1.00 48.11  ? 615  LEU B HD11 1 
ATOM   6689  H HD12 . LEU B 1 54  ? -9.511  10.584  -74.984 1.00 48.11  ? 615  LEU B HD12 1 
ATOM   6690  H HD13 . LEU B 1 54  ? -9.978  9.679   -73.765 1.00 48.11  ? 615  LEU B HD13 1 
ATOM   6691  H HD21 . LEU B 1 54  ? -12.796 10.594  -73.711 1.00 46.94  ? 615  LEU B HD21 1 
ATOM   6692  H HD22 . LEU B 1 54  ? -11.959 10.459  -72.368 1.00 46.94  ? 615  LEU B HD22 1 
ATOM   6693  H HD23 . LEU B 1 54  ? -12.650 11.841  -72.738 1.00 46.94  ? 615  LEU B HD23 1 
ATOM   6694  N N    . LEU B 1 55  ? -8.464  14.574  -71.485 1.00 39.36  ? 616  LEU B N    1 
ATOM   6695  C CA   . LEU B 1 55  ? -7.515  15.117  -70.517 1.00 46.20  ? 616  LEU B CA   1 
ATOM   6696  C C    . LEU B 1 55  ? -8.201  16.087  -69.564 1.00 46.23  ? 616  LEU B C    1 
ATOM   6697  O O    . LEU B 1 55  ? -7.970  16.044  -68.350 1.00 44.38  ? 616  LEU B O    1 
ATOM   6698  C CB   . LEU B 1 55  ? -6.360  15.810  -71.240 1.00 40.43  ? 616  LEU B CB   1 
ATOM   6699  C CG   . LEU B 1 55  ? -5.462  16.709  -70.375 1.00 46.20  ? 616  LEU B CG   1 
ATOM   6700  C CD1  . LEU B 1 55  ? -4.772  15.906  -69.282 1.00 40.64  ? 616  LEU B CD1  1 
ATOM   6701  C CD2  . LEU B 1 55  ? -4.439  17.437  -71.233 1.00 42.98  ? 616  LEU B CD2  1 
ATOM   6702  H H    . LEU B 1 55  ? -8.279  14.750  -72.306 1.00 47.24  ? 616  LEU B H    1 
ATOM   6703  H HA   . LEU B 1 55  ? -7.148  14.389  -69.992 1.00 55.44  ? 616  LEU B HA   1 
ATOM   6704  H HB2  . LEU B 1 55  ? -5.792  15.128  -71.632 1.00 48.52  ? 616  LEU B HB2  1 
ATOM   6705  H HB3  . LEU B 1 55  ? -6.730  16.365  -71.945 1.00 48.52  ? 616  LEU B HB3  1 
ATOM   6706  H HG   . LEU B 1 55  ? -6.016  17.379  -69.945 1.00 55.44  ? 616  LEU B HG   1 
ATOM   6707  H HD11 . LEU B 1 55  ? -4.216  16.502  -68.757 1.00 48.77  ? 616  LEU B HD11 1 
ATOM   6708  H HD12 . LEU B 1 55  ? -5.447  15.499  -68.717 1.00 48.77  ? 616  LEU B HD12 1 
ATOM   6709  H HD13 . LEU B 1 55  ? -4.226  15.219  -69.693 1.00 48.77  ? 616  LEU B HD13 1 
ATOM   6710  H HD21 . LEU B 1 55  ? -3.889  17.995  -70.661 1.00 51.57  ? 616  LEU B HD21 1 
ATOM   6711  H HD22 . LEU B 1 55  ? -3.887  16.782  -71.688 1.00 51.57  ? 616  LEU B HD22 1 
ATOM   6712  H HD23 . LEU B 1 55  ? -4.905  17.986  -71.882 1.00 51.57  ? 616  LEU B HD23 1 
ATOM   6713  N N    . ARG B 1 56  ? -9.047  16.971  -70.100 1.00 42.61  ? 617  ARG B N    1 
ATOM   6714  C CA   . ARG B 1 56  ? -9.731  17.950  -69.262 1.00 43.85  ? 617  ARG B CA   1 
ATOM   6715  C C    . ARG B 1 56  ? -10.590 17.273  -68.203 1.00 41.61  ? 617  ARG B C    1 
ATOM   6716  O O    . ARG B 1 56  ? -10.663 17.739  -67.060 1.00 42.91  ? 617  ARG B O    1 
ATOM   6717  C CB   . ARG B 1 56  ? -10.594 18.865  -70.126 1.00 46.26  ? 617  ARG B CB   1 
ATOM   6718  C CG   . ARG B 1 56  ? -9.801  19.867  -70.944 1.00 50.58  ? 617  ARG B CG   1 
ATOM   6719  C CD   . ARG B 1 56  ? -10.686 20.765  -71.799 1.00 54.64  ? 617  ARG B CD   1 
ATOM   6720  N NE   . ARG B 1 56  ? -11.815 21.315  -71.053 1.00 59.21  ? 617  ARG B NE   1 
ATOM   6721  C CZ   . ARG B 1 56  ? -12.495 22.404  -71.404 1.00 67.32  ? 617  ARG B CZ   1 
ATOM   6722  N NH1  . ARG B 1 56  ? -12.163 23.088  -72.491 1.00 58.38  ? 617  ARG B NH1  1 
ATOM   6723  N NH2  . ARG B 1 56  ? -13.507 22.814  -70.654 1.00 81.04  ? 617  ARG B NH2  1 
ATOM   6724  H H    . ARG B 1 56  ? -9.237  17.023  -70.937 1.00 51.13  ? 617  ARG B H    1 
ATOM   6725  H HA   . ARG B 1 56  ? -9.070  18.497  -68.809 1.00 52.62  ? 617  ARG B HA   1 
ATOM   6726  H HB2  . ARG B 1 56  ? -11.106 18.319  -70.743 1.00 55.51  ? 617  ARG B HB2  1 
ATOM   6727  H HB3  . ARG B 1 56  ? -11.195 19.362  -69.550 1.00 55.51  ? 617  ARG B HB3  1 
ATOM   6728  H HG2  . ARG B 1 56  ? -9.293  20.433  -70.342 1.00 60.69  ? 617  ARG B HG2  1 
ATOM   6729  H HG3  . ARG B 1 56  ? -9.200  19.387  -71.535 1.00 60.69  ? 617  ARG B HG3  1 
ATOM   6730  H HD2  . ARG B 1 56  ? -10.157 21.506  -72.133 1.00 65.56  ? 617  ARG B HD2  1 
ATOM   6731  H HD3  . ARG B 1 56  ? -11.039 20.248  -72.540 1.00 65.56  ? 617  ARG B HD3  1 
ATOM   6732  H HE   . ARG B 1 56  ? -12.058 20.906  -70.337 1.00 71.05  ? 617  ARG B HE   1 
ATOM   6733  H HH11 . ARG B 1 56  ? -11.507 22.825  -72.981 1.00 70.05  ? 617  ARG B HH11 1 
ATOM   6734  H HH12 . ARG B 1 56  ? -12.607 23.791  -72.709 1.00 70.05  ? 617  ARG B HH12 1 
ATOM   6735  H HH21 . ARG B 1 56  ? -13.724 22.375  -69.947 1.00 97.25  ? 617  ARG B HH21 1 
ATOM   6736  H HH22 . ARG B 1 56  ? -13.947 23.519  -70.874 1.00 97.25  ? 617  ARG B HH22 1 
ATOM   6737  N N    . GLU B 1 57  ? -11.248 16.171  -68.565 1.00 44.67  ? 618  GLU B N    1 
ATOM   6738  C CA   . GLU B 1 57  ? -12.200 15.545  -67.654 1.00 48.92  ? 618  GLU B CA   1 
ATOM   6739  C C    . GLU B 1 57  ? -11.506 14.829  -66.501 1.00 39.70  ? 618  GLU B C    1 
ATOM   6740  O O    . GLU B 1 57  ? -12.047 14.786  -65.391 1.00 39.98  ? 618  GLU B O    1 
ATOM   6741  C CB   . GLU B 1 57  ? -13.093 14.573  -68.428 1.00 52.74  ? 618  GLU B CB   1 
ATOM   6742  C CG   . GLU B 1 57  ? -14.157 13.887  -67.578 1.00 76.30  ? 618  GLU B CG   1 
ATOM   6743  C CD   . GLU B 1 57  ? -15.087 13.003  -68.393 1.00 80.76  ? 618  GLU B CD   1 
ATOM   6744  O OE1  . GLU B 1 57  ? -15.146 13.171  -69.630 1.00 80.35  ? 618  GLU B OE1  1 
ATOM   6745  O OE2  . GLU B 1 57  ? -15.759 12.137  -67.793 1.00 63.56  ? 618  GLU B OE2  1 
ATOM   6746  H H    . GLU B 1 57  ? -11.162 15.772  -69.322 1.00 53.60  ? 618  GLU B H    1 
ATOM   6747  H HA   . GLU B 1 57  ? -12.769 16.234  -67.276 1.00 58.70  ? 618  GLU B HA   1 
ATOM   6748  H HB2  . GLU B 1 57  ? -13.547 15.061  -69.132 1.00 63.29  ? 618  GLU B HB2  1 
ATOM   6749  H HB3  . GLU B 1 57  ? -12.535 13.881  -68.817 1.00 63.29  ? 618  GLU B HB3  1 
ATOM   6750  H HG2  . GLU B 1 57  ? -13.720 13.330  -66.914 1.00 91.56  ? 618  GLU B HG2  1 
ATOM   6751  H HG3  . GLU B 1 57  ? -14.696 14.564  -67.140 1.00 91.56  ? 618  GLU B HG3  1 
ATOM   6752  N N    . SER B 1 58  ? -10.328 14.254  -66.739 1.00 35.44  ? 619  SER B N    1 
ATOM   6753  C CA   . SER B 1 58  ? -9.646  13.431  -65.748 1.00 41.65  ? 619  SER B CA   1 
ATOM   6754  C C    . SER B 1 58  ? -8.548  14.160  -64.976 1.00 40.21  ? 619  SER B C    1 
ATOM   6755  O O    . SER B 1 58  ? -7.890  13.533  -64.140 1.00 37.46  ? 619  SER B O    1 
ATOM   6756  C CB   . SER B 1 58  ? -9.052  12.193  -66.426 1.00 43.88  ? 619  SER B CB   1 
ATOM   6757  O OG   . SER B 1 58  ? -8.110  12.557  -67.415 1.00 44.50  ? 619  SER B OG   1 
ATOM   6758  H H    . SER B 1 58  ? -9.898  14.328  -67.481 1.00 42.53  ? 619  SER B H    1 
ATOM   6759  H HA   . SER B 1 58  ? -10.301 13.124  -65.102 1.00 49.98  ? 619  SER B HA   1 
ATOM   6760  H HB2  . SER B 1 58  ? -8.610  11.649  -65.756 1.00 52.65  ? 619  SER B HB2  1 
ATOM   6761  H HB3  . SER B 1 58  ? -9.768  11.689  -66.843 1.00 52.65  ? 619  SER B HB3  1 
ATOM   6762  H HG   . SER B 1 58  ? -8.479  13.029  -68.004 1.00 53.39  ? 619  SER B HG   1 
ATOM   6763  N N    . ASP B 1 59  ? -8.325  15.454  -65.220 1.00 38.50  ? 620  ASP B N    1 
ATOM   6764  C CA   . ASP B 1 59  ? -7.142  16.112  -64.670 1.00 31.02  ? 620  ASP B CA   1 
ATOM   6765  C C    . ASP B 1 59  ? -7.282  16.501  -63.201 1.00 36.70  ? 620  ASP B C    1 
ATOM   6766  O O    . ASP B 1 59  ? -6.286  16.903  -62.589 1.00 32.30  ? 620  ASP B O    1 
ATOM   6767  C CB   . ASP B 1 59  ? -6.795  17.361  -65.487 1.00 38.46  ? 620  ASP B CB   1 
ATOM   6768  C CG   . ASP B 1 59  ? -7.618  18.574  -65.091 1.00 41.37  ? 620  ASP B CG   1 
ATOM   6769  O OD1  . ASP B 1 59  ? -8.788  18.410  -64.683 1.00 44.46  ? 620  ASP B OD1  1 
ATOM   6770  O OD2  . ASP B 1 59  ? -7.089  19.700  -65.191 1.00 42.69  ? 620  ASP B OD2  1 
ATOM   6771  H H    . ASP B 1 59  ? -8.834  15.963  -65.692 1.00 46.20  ? 620  ASP B H    1 
ATOM   6772  H HA   . ASP B 1 59  ? -6.392  15.500  -64.738 1.00 37.22  ? 620  ASP B HA   1 
ATOM   6773  H HB2  . ASP B 1 59  ? -5.859  17.577  -65.351 1.00 46.15  ? 620  ASP B HB2  1 
ATOM   6774  H HB3  . ASP B 1 59  ? -6.960  17.180  -66.426 1.00 46.15  ? 620  ASP B HB3  1 
ATOM   6775  N N    . GLU B 1 60  ? -8.480  16.403  -62.620 1.00 33.14  ? 621  GLU B N    1 
ATOM   6776  C CA   . GLU B 1 60  ? -8.668  16.741  -61.214 1.00 32.35  ? 621  GLU B CA   1 
ATOM   6777  C C    . GLU B 1 60  ? -7.929  15.798  -60.272 1.00 34.56  ? 621  GLU B C    1 
ATOM   6778  O O    . GLU B 1 60  ? -7.856  16.083  -59.073 1.00 37.82  ? 621  GLU B O    1 
ATOM   6779  C CB   . GLU B 1 60  ? -10.159 16.739  -60.875 1.00 39.44  ? 621  GLU B CB   1 
ATOM   6780  H H    . GLU B 1 60  ? -9.196  16.144  -63.020 1.00 39.76  ? 621  GLU B H    1 
ATOM   6781  H HA   . GLU B 1 60  ? -8.330  17.638  -61.060 1.00 38.82  ? 621  GLU B HA   1 
ATOM   6782  N N    . HIS B 1 61  ? -7.392  14.690  -60.777 1.00 28.65  ? 622  HIS B N    1 
ATOM   6783  C CA   . HIS B 1 61  ? -6.630  13.756  -59.960 1.00 25.04  ? 622  HIS B CA   1 
ATOM   6784  C C    . HIS B 1 61  ? -5.198  14.264  -59.787 1.00 26.54  ? 622  HIS B C    1 
ATOM   6785  O O    . HIS B 1 61  ? -4.614  14.803  -60.731 1.00 24.64  ? 622  HIS B O    1 
ATOM   6786  C CB   . HIS B 1 61  ? -6.615  12.375  -60.610 1.00 27.45  ? 622  HIS B CB   1 
ATOM   6787  C CG   . HIS B 1 61  ? -6.176  11.280  -59.689 1.00 24.68  ? 622  HIS B CG   1 
ATOM   6788  N ND1  . HIS B 1 61  ? -4.863  10.880  -59.579 1.00 24.51  ? 622  HIS B ND1  1 
ATOM   6789  C CD2  . HIS B 1 61  ? -6.879  10.503  -58.833 1.00 17.37  ? 622  HIS B CD2  1 
ATOM   6790  C CE1  . HIS B 1 61  ? -4.775  9.904   -58.694 1.00 18.58  ? 622  HIS B CE1  1 
ATOM   6791  N NE2  . HIS B 1 61  ? -5.985  9.655   -58.228 1.00 19.21  ? 622  HIS B NE2  1 
ATOM   6792  H H    . HIS B 1 61  ? -7.458  14.455  -61.602 1.00 34.38  ? 622  HIS B H    1 
ATOM   6793  H HA   . HIS B 1 61  ? -7.040  13.681  -59.084 1.00 30.05  ? 622  HIS B HA   1 
ATOM   6794  H HB2  . HIS B 1 61  ? -7.510  12.164  -60.916 1.00 32.94  ? 622  HIS B HB2  1 
ATOM   6795  H HB3  . HIS B 1 61  ? -6.004  12.390  -61.363 1.00 32.94  ? 622  HIS B HB3  1 
ATOM   6796  H HD2  . HIS B 1 61  ? -7.797  10.536  -58.684 1.00 20.85  ? 622  HIS B HD2  1 
ATOM   6797  H HE1  . HIS B 1 61  ? -3.994  9.465   -58.444 1.00 22.29  ? 622  HIS B HE1  1 
ATOM   6798  H HE2  . HIS B 1 61  ? -6.181  9.059   -57.640 1.00 23.06  ? 622  HIS B HE2  1 
ATOM   6799  N N    . PRO B 1 62  ? -4.607  14.116  -58.596 1.00 22.69  ? 623  PRO B N    1 
ATOM   6800  C CA   . PRO B 1 62  ? -3.238  14.626  -58.405 1.00 24.62  ? 623  PRO B CA   1 
ATOM   6801  C C    . PRO B 1 62  ? -2.206  13.946  -59.288 1.00 23.86  ? 623  PRO B C    1 
ATOM   6802  O O    . PRO B 1 62  ? -1.175  14.554  -59.599 1.00 30.63  ? 623  PRO B O    1 
ATOM   6803  C CB   . PRO B 1 62  ? -2.965  14.367  -56.914 1.00 18.78  ? 623  PRO B CB   1 
ATOM   6804  C CG   . PRO B 1 62  ? -3.962  13.329  -56.504 1.00 20.59  ? 623  PRO B CG   1 
ATOM   6805  C CD   . PRO B 1 62  ? -5.171  13.571  -57.349 1.00 23.44  ? 623  PRO B CD   1 
ATOM   6806  H HA   . PRO B 1 62  ? -3.213  15.582  -58.569 1.00 29.55  ? 623  PRO B HA   1 
ATOM   6807  H HB2  . PRO B 1 62  ? -2.060  14.036  -56.801 1.00 22.53  ? 623  PRO B HB2  1 
ATOM   6808  H HB3  . PRO B 1 62  ? -3.097  15.186  -56.411 1.00 22.53  ? 623  PRO B HB3  1 
ATOM   6809  H HG2  . PRO B 1 62  ? -3.599  12.445  -56.672 1.00 24.71  ? 623  PRO B HG2  1 
ATOM   6810  H HG3  . PRO B 1 62  ? -4.175  13.437  -55.564 1.00 24.71  ? 623  PRO B HG3  1 
ATOM   6811  H HD2  . PRO B 1 62  ? -5.634  12.737  -57.523 1.00 28.12  ? 623  PRO B HD2  1 
ATOM   6812  H HD3  . PRO B 1 62  ? -5.753  14.222  -56.928 1.00 28.12  ? 623  PRO B HD3  1 
ATOM   6813  N N    . ASN B 1 63  ? -2.444  12.701  -59.688 1.00 21.96  ? 624  ASN B N    1 
ATOM   6814  C CA   . ASN B 1 63  ? -1.519  11.929  -60.506 1.00 26.40  ? 624  ASN B CA   1 
ATOM   6815  C C    . ASN B 1 63  ? -1.859  11.974  -61.992 1.00 29.20  ? 624  ASN B C    1 
ATOM   6816  O O    . ASN B 1 63  ? -1.268  11.225  -62.775 1.00 28.58  ? 624  ASN B O    1 
ATOM   6817  C CB   . ASN B 1 63  ? -1.470  10.490  -60.003 1.00 27.21  ? 624  ASN B CB   1 
ATOM   6818  C CG   . ASN B 1 63  ? -1.094  10.411  -58.536 1.00 26.90  ? 624  ASN B CG   1 
ATOM   6819  O OD1  . ASN B 1 63  ? -1.832  9.861   -57.721 1.00 37.68  ? 624  ASN B OD1  1 
ATOM   6820  N ND2  . ASN B 1 63  ? 0.055   10.984  -58.189 1.00 22.69  ? 624  ASN B ND2  1 
ATOM   6821  H H    . ASN B 1 63  ? -3.161  12.269  -59.491 1.00 26.35  ? 624  ASN B H    1 
ATOM   6822  H HA   . ASN B 1 63  ? -0.631  12.305  -60.401 1.00 31.68  ? 624  ASN B HA   1 
ATOM   6823  H HB2  . ASN B 1 63  ? -2.344  10.084  -60.112 1.00 32.65  ? 624  ASN B HB2  1 
ATOM   6824  H HB3  . ASN B 1 63  ? -0.807  9.997   -60.511 1.00 32.65  ? 624  ASN B HB3  1 
ATOM   6825  H HD21 . ASN B 1 63  ? 0.314   10.967  -57.369 1.00 27.23  ? 624  ASN B HD21 1 
ATOM   6826  H HD22 . ASN B 1 63  ? 0.540   11.371  -58.785 1.00 27.23  ? 624  ASN B HD22 1 
ATOM   6827  N N    . VAL B 1 64  ? -2.837  12.785  -62.388 1.00 30.10  ? 625  VAL B N    1 
ATOM   6828  C CA   . VAL B 1 64  ? -3.094  13.101  -63.789 1.00 30.41  ? 625  VAL B CA   1 
ATOM   6829  C C    . VAL B 1 64  ? -2.616  14.523  -64.036 1.00 28.98  ? 625  VAL B C    1 
ATOM   6830  O O    . VAL B 1 64  ? -2.823  15.413  -63.201 1.00 31.14  ? 625  VAL B O    1 
ATOM   6831  C CB   . VAL B 1 64  ? -4.587  12.948  -64.144 1.00 28.28  ? 625  VAL B CB   1 
ATOM   6832  C CG1  . VAL B 1 64  ? -4.855  13.417  -65.570 1.00 27.25  ? 625  VAL B CG1  1 
ATOM   6833  C CG2  . VAL B 1 64  ? -5.016  11.502  -63.971 1.00 26.86  ? 625  VAL B CG2  1 
ATOM   6834  H H    . VAL B 1 64  ? -3.380  13.174  -61.846 1.00 36.12  ? 625  VAL B H    1 
ATOM   6835  H HA   . VAL B 1 64  ? -2.582  12.502  -64.354 1.00 36.50  ? 625  VAL B HA   1 
ATOM   6836  H HB   . VAL B 1 64  ? -5.115  13.494  -63.541 1.00 33.93  ? 625  VAL B HB   1 
ATOM   6837  H HG11 . VAL B 1 64  ? -5.799  13.309  -65.765 1.00 32.70  ? 625  VAL B HG11 1 
ATOM   6838  H HG12 . VAL B 1 64  ? -4.605  14.351  -65.648 1.00 32.70  ? 625  VAL B HG12 1 
ATOM   6839  H HG13 . VAL B 1 64  ? -4.327  12.881  -66.183 1.00 32.70  ? 625  VAL B HG13 1 
ATOM   6840  H HG21 . VAL B 1 64  ? -5.956  11.423  -64.199 1.00 32.23  ? 625  VAL B HG21 1 
ATOM   6841  H HG22 . VAL B 1 64  ? -4.485  10.943  -64.560 1.00 32.23  ? 625  VAL B HG22 1 
ATOM   6842  H HG23 . VAL B 1 64  ? -4.876  11.239  -63.048 1.00 32.23  ? 625  VAL B HG23 1 
ATOM   6843  N N    . ILE B 1 65  ? -1.971  14.737  -65.183 1.00 29.61  ? 626  ILE B N    1 
ATOM   6844  C CA   . ILE B 1 65  ? -1.367  16.033  -65.469 1.00 33.82  ? 626  ILE B CA   1 
ATOM   6845  C C    . ILE B 1 65  ? -2.457  17.090  -65.600 1.00 26.09  ? 626  ILE B C    1 
ATOM   6846  O O    . ILE B 1 65  ? -3.551  16.828  -66.118 1.00 24.09  ? 626  ILE B O    1 
ATOM   6847  C CB   . ILE B 1 65  ? -0.496  15.950  -66.736 1.00 31.85  ? 626  ILE B CB   1 
ATOM   6848  C CG1  . ILE B 1 65  ? 0.664   16.943  -66.657 1.00 34.83  ? 626  ILE B CG1  1 
ATOM   6849  C CG2  . ILE B 1 65  ? -1.324  16.163  -68.006 1.00 31.38  ? 626  ILE B CG2  1 
ATOM   6850  C CD1  . ILE B 1 65  ? 1.762   16.658  -67.653 1.00 40.73  ? 626  ILE B CD1  1 
ATOM   6851  H H    . ILE B 1 65  ? -1.871  14.153  -65.806 1.00 35.53  ? 626  ILE B H    1 
ATOM   6852  H HA   . ILE B 1 65  ? -0.794  16.285  -64.727 1.00 40.59  ? 626  ILE B HA   1 
ATOM   6853  H HB   . ILE B 1 65  ? -0.118  15.057  -66.776 1.00 38.23  ? 626  ILE B HB   1 
ATOM   6854  H HG12 . ILE B 1 65  ? 0.326   17.835  -66.833 1.00 41.79  ? 626  ILE B HG12 1 
ATOM   6855  H HG13 . ILE B 1 65  ? 1.050   16.906  -65.768 1.00 41.79  ? 626  ILE B HG13 1 
ATOM   6856  H HG21 . ILE B 1 65  ? -0.739  16.102  -68.777 1.00 37.65  ? 626  ILE B HG21 1 
ATOM   6857  H HG22 . ILE B 1 65  ? -2.008  15.477  -68.055 1.00 37.65  ? 626  ILE B HG22 1 
ATOM   6858  H HG23 . ILE B 1 65  ? -1.735  17.040  -67.971 1.00 37.65  ? 626  ILE B HG23 1 
ATOM   6859  H HD11 . ILE B 1 65  ? 2.462   17.321  -67.550 1.00 48.88  ? 626  ILE B HD11 1 
ATOM   6860  H HD12 . ILE B 1 65  ? 2.118   15.771  -67.484 1.00 48.88  ? 626  ILE B HD12 1 
ATOM   6861  H HD13 . ILE B 1 65  ? 1.394   16.701  -68.550 1.00 48.88  ? 626  ILE B HD13 1 
ATOM   6862  N N    . ARG B 1 66  ? -2.158  18.294  -65.125 1.00 26.15  ? 627  ARG B N    1 
ATOM   6863  C CA   . ARG B 1 66  ? -3.139  19.367  -65.054 1.00 31.99  ? 627  ARG B CA   1 
ATOM   6864  C C    . ARG B 1 66  ? -3.210  20.121  -66.376 1.00 27.02  ? 627  ARG B C    1 
ATOM   6865  O O    . ARG B 1 66  ? -2.187  20.388  -67.014 1.00 20.76  ? 627  ARG B O    1 
ATOM   6866  C CB   . ARG B 1 66  ? -2.789  20.327  -63.917 1.00 30.09  ? 627  ARG B CB   1 
ATOM   6867  C CG   . ARG B 1 66  ? -3.836  21.391  -63.654 1.00 46.35  ? 627  ARG B CG   1 
ATOM   6868  C CD   . ARG B 1 66  ? -3.428  22.274  -62.487 1.00 53.24  ? 627  ARG B CD   1 
ATOM   6869  N NE   . ARG B 1 66  ? -4.364  23.373  -62.273 1.00 71.76  ? 627  ARG B NE   1 
ATOM   6870  C CZ   . ARG B 1 66  ? -4.205  24.324  -61.358 1.00 69.08  ? 627  ARG B CZ   1 
ATOM   6871  N NH1  . ARG B 1 66  ? -3.142  24.316  -60.563 1.00 66.93  ? 627  ARG B NH1  1 
ATOM   6872  N NH2  . ARG B 1 66  ? -5.109  25.286  -61.236 1.00 58.02  ? 627  ARG B NH2  1 
ATOM   6873  H H    . ARG B 1 66  ? -1.380  18.517  -64.834 1.00 31.38  ? 627  ARG B H    1 
ATOM   6874  H HA   . ARG B 1 66  ? -4.013  18.988  -64.873 1.00 38.39  ? 627  ARG B HA   1 
ATOM   6875  H HB2  . ARG B 1 66  ? -2.678  19.815  -63.101 1.00 36.11  ? 627  ARG B HB2  1 
ATOM   6876  H HB3  . ARG B 1 66  ? -1.959  20.778  -64.136 1.00 36.11  ? 627  ARG B HB3  1 
ATOM   6877  H HG2  . ARG B 1 66  ? -3.933  21.949  -64.441 1.00 55.62  ? 627  ARG B HG2  1 
ATOM   6878  H HG3  . ARG B 1 66  ? -4.679  20.966  -63.435 1.00 55.62  ? 627  ARG B HG3  1 
ATOM   6879  H HD2  . ARG B 1 66  ? -3.401  21.739  -61.678 1.00 63.88  ? 627  ARG B HD2  1 
ATOM   6880  H HD3  . ARG B 1 66  ? -2.553  22.653  -62.666 1.00 63.88  ? 627  ARG B HD3  1 
ATOM   6881  H HE   . ARG B 1 66  ? -5.064  23.409  -62.772 1.00 86.11  ? 627  ARG B HE   1 
ATOM   6882  H HH11 . ARG B 1 66  ? -2.553  23.694  -60.639 1.00 80.31  ? 627  ARG B HH11 1 
ATOM   6883  H HH12 . ARG B 1 66  ? -3.042  24.932  -59.972 1.00 80.31  ? 627  ARG B HH12 1 
ATOM   6884  H HH21 . ARG B 1 66  ? -5.799  25.295  -61.750 1.00 69.63  ? 627  ARG B HH21 1 
ATOM   6885  H HH22 . ARG B 1 66  ? -5.005  25.901  -60.644 1.00 69.63  ? 627  ARG B HH22 1 
ATOM   6886  N N    . TYR B 1 67  ? -4.430  20.461  -66.779 1.00 28.10  ? 628  TYR B N    1 
ATOM   6887  C CA   . TYR B 1 67  ? -4.696  21.179  -68.017 1.00 32.49  ? 628  TYR B CA   1 
ATOM   6888  C C    . TYR B 1 67  ? -5.054  22.626  -67.704 1.00 33.31  ? 628  TYR B C    1 
ATOM   6889  O O    . TYR B 1 67  ? -5.812  22.898  -66.766 1.00 30.95  ? 628  TYR B O    1 
ATOM   6890  C CB   . TYR B 1 67  ? -5.830  20.506  -68.794 1.00 30.04  ? 628  TYR B CB   1 
ATOM   6891  C CG   . TYR B 1 67  ? -6.498  21.396  -69.815 1.00 36.55  ? 628  TYR B CG   1 
ATOM   6892  C CD1  . TYR B 1 67  ? -6.034  21.458  -71.120 1.00 38.02  ? 628  TYR B CD1  1 
ATOM   6893  C CD2  . TYR B 1 67  ? -7.598  22.173  -69.472 1.00 34.90  ? 628  TYR B CD2  1 
ATOM   6894  C CE1  . TYR B 1 67  ? -6.646  22.269  -72.056 1.00 37.01  ? 628  TYR B CE1  1 
ATOM   6895  C CE2  . TYR B 1 67  ? -8.216  22.984  -70.400 1.00 40.54  ? 628  TYR B CE2  1 
ATOM   6896  C CZ   . TYR B 1 67  ? -7.739  23.031  -71.690 1.00 39.18  ? 628  TYR B CZ   1 
ATOM   6897  O OH   . TYR B 1 67  ? -8.366  23.847  -72.602 1.00 33.62  ? 628  TYR B OH   1 
ATOM   6898  H H    . TYR B 1 67  ? -5.144  20.279  -66.335 1.00 33.72  ? 628  TYR B H    1 
ATOM   6899  H HA   . TYR B 1 67  ? -3.900  21.173  -68.571 1.00 38.98  ? 628  TYR B HA   1 
ATOM   6900  H HB2  . TYR B 1 67  ? -5.472  19.737  -69.264 1.00 36.05  ? 628  TYR B HB2  1 
ATOM   6901  H HB3  . TYR B 1 67  ? -6.510  20.218  -68.165 1.00 36.05  ? 628  TYR B HB3  1 
ATOM   6902  H HD1  . TYR B 1 67  ? -5.299  20.945  -71.369 1.00 45.62  ? 628  TYR B HD1  1 
ATOM   6903  H HD2  . TYR B 1 67  ? -7.924  22.143  -68.602 1.00 41.88  ? 628  TYR B HD2  1 
ATOM   6904  H HE1  . TYR B 1 67  ? -6.324  22.301  -72.928 1.00 44.41  ? 628  TYR B HE1  1 
ATOM   6905  H HE2  . TYR B 1 67  ? -8.951  23.499  -70.154 1.00 48.65  ? 628  TYR B HE2  1 
ATOM   6906  H HH   . TYR B 1 67  ? -9.009  24.245  -72.237 1.00 40.34  ? 628  TYR B HH   1 
ATOM   6907  N N    . PHE B 1 68  ? -4.507  23.550  -68.495 1.00 30.32  ? 629  PHE B N    1 
ATOM   6908  C CA   . PHE B 1 68  ? -4.690  24.980  -68.278 1.00 33.33  ? 629  PHE B CA   1 
ATOM   6909  C C    . PHE B 1 68  ? -5.544  25.632  -69.358 1.00 32.98  ? 629  PHE B C    1 
ATOM   6910  O O    . PHE B 1 68  ? -6.637  26.126  -69.063 1.00 33.07  ? 629  PHE B O    1 
ATOM   6911  C CB   . PHE B 1 68  ? -3.323  25.673  -68.195 1.00 33.66  ? 629  PHE B CB   1 
ATOM   6912  C CG   . PHE B 1 68  ? -2.507  25.263  -67.006 1.00 36.76  ? 629  PHE B CG   1 
ATOM   6913  C CD1  . PHE B 1 68  ? -2.962  25.504  -65.721 1.00 41.60  ? 629  PHE B CD1  1 
ATOM   6914  C CD2  . PHE B 1 68  ? -1.280  24.647  -67.172 1.00 36.22  ? 629  PHE B CD2  1 
ATOM   6915  C CE1  . PHE B 1 68  ? -2.211  25.129  -64.627 1.00 40.39  ? 629  PHE B CE1  1 
ATOM   6916  C CE2  . PHE B 1 68  ? -0.526  24.272  -66.080 1.00 36.25  ? 629  PHE B CE2  1 
ATOM   6917  C CZ   . PHE B 1 68  ? -0.991  24.514  -64.807 1.00 37.98  ? 629  PHE B CZ   1 
ATOM   6918  H H    . PHE B 1 68  ? -4.016  23.367  -69.177 1.00 36.39  ? 629  PHE B H    1 
ATOM   6919  H HA   . PHE B 1 68  ? -5.139  25.111  -67.428 1.00 40.00  ? 629  PHE B HA   1 
ATOM   6920  H HB2  . PHE B 1 68  ? -2.814  25.457  -68.992 1.00 40.39  ? 629  PHE B HB2  1 
ATOM   6921  H HB3  . PHE B 1 68  ? -3.461  26.632  -68.143 1.00 40.39  ? 629  PHE B HB3  1 
ATOM   6922  H HD1  . PHE B 1 68  ? -3.785  25.918  -65.595 1.00 49.92  ? 629  PHE B HD1  1 
ATOM   6923  H HD2  . PHE B 1 68  ? -0.961  24.482  -68.030 1.00 43.47  ? 629  PHE B HD2  1 
ATOM   6924  H HE1  . PHE B 1 68  ? -2.527  25.294  -63.768 1.00 48.47  ? 629  PHE B HE1  1 
ATOM   6925  H HE2  . PHE B 1 68  ? 0.297   23.857  -66.204 1.00 43.50  ? 629  PHE B HE2  1 
ATOM   6926  H HZ   . PHE B 1 68  ? -0.484  24.261  -64.069 1.00 45.58  ? 629  PHE B HZ   1 
ATOM   6927  N N    . CYS B 1 69  ? -5.070  25.665  -70.603 1.00 28.72  ? 630  CYS B N    1 
ATOM   6928  C CA   . CYS B 1 69  ? -5.750  26.414  -71.649 1.00 31.86  ? 630  CYS B CA   1 
ATOM   6929  C C    . CYS B 1 69  ? -5.441  25.802  -73.008 1.00 33.06  ? 630  CYS B C    1 
ATOM   6930  O O    . CYS B 1 69  ? -4.411  25.147  -73.191 1.00 31.39  ? 630  CYS B O    1 
ATOM   6931  C CB   . CYS B 1 69  ? -5.329  27.889  -71.631 1.00 25.39  ? 630  CYS B CB   1 
ATOM   6932  S SG   . CYS B 1 69  ? -6.454  28.996  -72.497 1.00 38.97  ? 630  CYS B SG   1 
ATOM   6933  H H    . CYS B 1 69  ? -4.357  25.262  -70.864 1.00 34.46  ? 630  CYS B H    1 
ATOM   6934  H HA   . CYS B 1 69  ? -6.708  26.368  -71.505 1.00 38.23  ? 630  CYS B HA   1 
ATOM   6935  H HB2  . CYS B 1 69  ? -5.276  28.186  -70.709 1.00 30.47  ? 630  CYS B HB2  1 
ATOM   6936  H HB3  . CYS B 1 69  ? -4.457  27.969  -72.050 1.00 30.47  ? 630  CYS B HB3  1 
ATOM   6937  H HG   . CYS B 1 69  ? -7.538  28.930  -71.986 1.00 46.76  ? 630  CYS B HG   1 
ATOM   6938  N N    . THR B 1 70  ? -6.352  26.017  -73.953 1.00 36.05  ? 631  THR B N    1 
ATOM   6939  C CA   . THR B 1 70  ? -6.113  25.747  -75.364 1.00 40.96  ? 631  THR B CA   1 
ATOM   6940  C C    . THR B 1 70  ? -6.143  27.054  -76.144 1.00 42.93  ? 631  THR B C    1 
ATOM   6941  O O    . THR B 1 70  ? -6.940  27.949  -75.844 1.00 40.17  ? 631  THR B O    1 
ATOM   6942  C CB   . THR B 1 70  ? -7.153  24.790  -75.953 1.00 41.56  ? 631  THR B CB   1 
ATOM   6943  O OG1  . THR B 1 70  ? -8.469  25.219  -75.582 1.00 61.54  ? 631  THR B OG1  1 
ATOM   6944  C CG2  . THR B 1 70  ? -6.924  23.375  -75.463 1.00 41.16  ? 631  THR B CG2  1 
ATOM   6945  H H    . THR B 1 70  ? -7.138  26.328  -73.795 1.00 43.26  ? 631  THR B H    1 
ATOM   6946  H HA   . THR B 1 70  ? -5.235  25.348  -75.470 1.00 49.15  ? 631  THR B HA   1 
ATOM   6947  H HB   . THR B 1 70  ? -7.078  24.792  -76.920 1.00 49.88  ? 631  THR B HB   1 
ATOM   6948  H HG1  . THR B 1 70  ? -9.043  24.696  -75.904 1.00 73.85  ? 631  THR B HG1  1 
ATOM   6949  H HG21 . THR B 1 70  ? -7.590  22.780  -75.844 1.00 49.39  ? 631  THR B HG21 1 
ATOM   6950  H HG22 . THR B 1 70  ? -6.042  23.071  -75.728 1.00 49.39  ? 631  THR B HG22 1 
ATOM   6951  H HG23 . THR B 1 70  ? -6.991  23.344  -74.496 1.00 49.39  ? 631  THR B HG23 1 
ATOM   6952  N N    . GLU B 1 71  ? -5.273  27.154  -77.146 1.00 44.44  ? 632  GLU B N    1 
ATOM   6953  C CA   . GLU B 1 71  ? -5.232  28.292  -78.049 1.00 46.46  ? 632  GLU B CA   1 
ATOM   6954  C C    . GLU B 1 71  ? -5.151  27.775  -79.477 1.00 49.62  ? 632  GLU B C    1 
ATOM   6955  O O    . GLU B 1 71  ? -4.648  26.676  -79.725 1.00 39.52  ? 632  GLU B O    1 
ATOM   6956  C CB   . GLU B 1 71  ? -4.040  29.206  -77.752 1.00 43.54  ? 632  GLU B CB   1 
ATOM   6957  C CG   . GLU B 1 71  ? -4.331  30.679  -77.953 1.00 59.18  ? 632  GLU B CG   1 
ATOM   6958  C CD   . GLU B 1 71  ? -5.124  31.265  -76.807 1.00 48.37  ? 632  GLU B CD   1 
ATOM   6959  O OE1  . GLU B 1 71  ? -4.529  31.515  -75.738 1.00 48.05  ? 632  GLU B OE1  1 
ATOM   6960  O OE2  . GLU B 1 71  ? -6.344  31.468  -76.976 1.00 55.10  ? 632  GLU B OE2  1 
ATOM   6961  H H    . GLU B 1 71  ? -4.682  26.556  -77.324 1.00 53.32  ? 632  GLU B H    1 
ATOM   6962  H HA   . GLU B 1 71  ? -6.047  28.810  -77.955 1.00 55.75  ? 632  GLU B HA   1 
ATOM   6963  H HB2  . GLU B 1 71  ? -3.773  29.080  -76.828 1.00 52.24  ? 632  GLU B HB2  1 
ATOM   6964  H HB3  . GLU B 1 71  ? -3.308  28.965  -78.341 1.00 52.24  ? 632  GLU B HB3  1 
ATOM   6965  H HG2  . GLU B 1 71  ? -3.492  31.163  -78.018 1.00 71.01  ? 632  GLU B HG2  1 
ATOM   6966  H HG3  . GLU B 1 71  ? -4.846  30.794  -78.767 1.00 71.01  ? 632  GLU B HG3  1 
ATOM   6967  N N    . LYS B 1 72  ? -5.654  28.575  -80.414 1.00 55.83  ? 633  LYS B N    1 
ATOM   6968  C CA   . LYS B 1 72  ? -5.747  28.174  -81.810 1.00 46.92  ? 633  LYS B CA   1 
ATOM   6969  C C    . LYS B 1 72  ? -5.208  29.274  -82.709 1.00 47.23  ? 633  LYS B C    1 
ATOM   6970  O O    . LYS B 1 72  ? -5.461  30.460  -82.479 1.00 41.59  ? 633  LYS B O    1 
ATOM   6971  C CB   . LYS B 1 72  ? -7.198  27.852  -82.199 1.00 41.52  ? 633  LYS B CB   1 
ATOM   6972  H H    . LYS B 1 72  ? -5.952  29.367  -80.261 1.00 67.00  ? 633  LYS B H    1 
ATOM   6973  H HA   . LYS B 1 72  ? -5.211  27.377  -81.950 1.00 56.30  ? 633  LYS B HA   1 
ATOM   6974  N N    . ASP B 1 73  ? -4.441  28.868  -83.718 1.00 52.19  ? 634  ASP B N    1 
ATOM   6975  C CA   . ASP B 1 73  ? -4.031  29.752  -84.801 1.00 57.26  ? 634  ASP B CA   1 
ATOM   6976  C C    . ASP B 1 73  ? -4.300  29.039  -86.118 1.00 55.52  ? 634  ASP B C    1 
ATOM   6977  O O    . ASP B 1 73  ? -4.960  27.995  -86.128 1.00 56.38  ? 634  ASP B O    1 
ATOM   6978  C CB   . ASP B 1 73  ? -2.562  30.172  -84.655 1.00 50.79  ? 634  ASP B CB   1 
ATOM   6979  C CG   . ASP B 1 73  ? -1.580  29.084  -85.066 1.00 45.55  ? 634  ASP B CG   1 
ATOM   6980  O OD1  . ASP B 1 73  ? -1.960  27.896  -85.127 1.00 53.93  ? 634  ASP B OD1  1 
ATOM   6981  O OD2  . ASP B 1 73  ? -0.405  29.428  -85.315 1.00 49.70  ? 634  ASP B OD2  1 
ATOM   6982  H H    . ASP B 1 73  ? -4.140  28.066  -83.797 1.00 62.62  ? 634  ASP B H    1 
ATOM   6983  H HA   . ASP B 1 73  ? -4.576  30.555  -84.777 1.00 68.72  ? 634  ASP B HA   1 
ATOM   6984  H HB2  . ASP B 1 73  ? -2.400  30.947  -85.215 1.00 60.95  ? 634  ASP B HB2  1 
ATOM   6985  H HB3  . ASP B 1 73  ? -2.389  30.394  -83.727 1.00 60.95  ? 634  ASP B HB3  1 
ATOM   6986  N N    . ARG B 1 74  ? -3.819  29.600  -87.228 1.00 62.61  ? 635  ARG B N    1 
ATOM   6987  C CA   . ARG B 1 74  ? -4.096  29.060  -88.556 1.00 58.07  ? 635  ARG B CA   1 
ATOM   6988  C C    . ARG B 1 74  ? -3.913  27.546  -88.618 1.00 63.82  ? 635  ARG B C    1 
ATOM   6989  O O    . ARG B 1 74  ? -4.882  26.811  -88.833 1.00 68.01  ? 635  ARG B O    1 
ATOM   6990  C CB   . ARG B 1 74  ? -3.196  29.737  -89.594 1.00 55.42  ? 635  ARG B CB   1 
ATOM   6991  H H    . ARG B 1 74  ? -3.324  30.303  -87.237 1.00 75.13  ? 635  ARG B H    1 
ATOM   6992  H HA   . ARG B 1 74  ? -5.017  29.258  -88.787 1.00 69.68  ? 635  ARG B HA   1 
ATOM   6993  N N    . GLN B 1 75  ? -2.680  27.070  -88.436 1.00 61.10  ? 636  GLN B N    1 
ATOM   6994  C CA   . GLN B 1 75  ? -2.386  25.654  -88.635 1.00 58.76  ? 636  GLN B CA   1 
ATOM   6995  C C    . GLN B 1 75  ? -2.740  24.797  -87.420 1.00 64.86  ? 636  GLN B C    1 
ATOM   6996  O O    . GLN B 1 75  ? -3.322  23.717  -87.575 1.00 67.87  ? 636  GLN B O    1 
ATOM   6997  C CB   . GLN B 1 75  ? -0.908  25.478  -88.984 1.00 61.38  ? 636  GLN B CB   1 
ATOM   6998  H H    . GLN B 1 75  ? -2.002  27.544  -88.198 1.00 73.32  ? 636  GLN B H    1 
ATOM   6999  H HA   . GLN B 1 75  ? -2.908  25.331  -89.386 1.00 70.51  ? 636  GLN B HA   1 
ATOM   7000  N N    . PHE B 1 76  ? -2.413  25.256  -86.212 1.00 64.99  ? 637  PHE B N    1 
ATOM   7001  C CA   . PHE B 1 76  ? -2.297  24.380  -85.054 1.00 60.23  ? 637  PHE B CA   1 
ATOM   7002  C C    . PHE B 1 76  ? -3.236  24.781  -83.923 1.00 56.54  ? 637  PHE B C    1 
ATOM   7003  O O    . PHE B 1 76  ? -3.734  25.909  -83.856 1.00 60.46  ? 637  PHE B O    1 
ATOM   7004  C CB   . PHE B 1 76  ? -0.863  24.379  -84.506 1.00 59.11  ? 637  PHE B CB   1 
ATOM   7005  C CG   . PHE B 1 76  ? 0.177   23.986  -85.512 1.00 64.23  ? 637  PHE B CG   1 
ATOM   7006  C CD1  . PHE B 1 76  ? 0.407   22.652  -85.805 1.00 58.72  ? 637  PHE B CD1  1 
ATOM   7007  C CD2  . PHE B 1 76  ? 0.938   24.949  -86.151 1.00 61.44  ? 637  PHE B CD2  1 
ATOM   7008  C CE1  . PHE B 1 76  ? 1.369   22.289  -86.725 1.00 60.44  ? 637  PHE B CE1  1 
ATOM   7009  C CE2  . PHE B 1 76  ? 1.901   24.592  -87.071 1.00 57.23  ? 637  PHE B CE2  1 
ATOM   7010  C CZ   . PHE B 1 76  ? 2.117   23.259  -87.358 1.00 59.48  ? 637  PHE B CZ   1 
ATOM   7011  H H    . PHE B 1 76  ? -2.251  26.083  -86.039 1.00 77.99  ? 637  PHE B H    1 
ATOM   7012  H HA   . PHE B 1 76  ? -2.518  23.474  -85.321 1.00 72.27  ? 637  PHE B HA   1 
ATOM   7013  H HB2  . PHE B 1 76  ? -0.649  25.272  -84.193 1.00 70.93  ? 637  PHE B HB2  1 
ATOM   7014  H HB3  . PHE B 1 76  ? -0.813  23.752  -83.767 1.00 70.93  ? 637  PHE B HB3  1 
ATOM   7015  H HD1  . PHE B 1 76  ? -0.096  21.995  -85.381 1.00 70.46  ? 637  PHE B HD1  1 
ATOM   7016  H HD2  . PHE B 1 76  ? 0.796   25.849  -85.960 1.00 73.73  ? 637  PHE B HD2  1 
ATOM   7017  H HE1  . PHE B 1 76  ? 1.513   21.390  -86.917 1.00 72.52  ? 637  PHE B HE1  1 
ATOM   7018  H HE2  . PHE B 1 76  ? 2.404   25.248  -87.497 1.00 68.67  ? 637  PHE B HE2  1 
ATOM   7019  H HZ   . PHE B 1 76  ? 2.766   23.016  -87.979 1.00 71.38  ? 637  PHE B HZ   1 
ATOM   7020  N N    . GLN B 1 77  ? -3.466  23.816  -83.035 1.00 51.05  ? 638  GLN B N    1 
ATOM   7021  C CA   . GLN B 1 77  ? -3.975  24.056  -81.692 1.00 45.06  ? 638  GLN B CA   1 
ATOM   7022  C C    . GLN B 1 77  ? -2.818  23.956  -80.706 1.00 35.92  ? 638  GLN B C    1 
ATOM   7023  O O    . GLN B 1 77  ? -1.918  23.128  -80.874 1.00 41.86  ? 638  GLN B O    1 
ATOM   7024  C CB   . GLN B 1 77  ? -5.058  23.044  -81.313 1.00 47.65  ? 638  GLN B CB   1 
ATOM   7025  C CG   . GLN B 1 77  ? -6.444  23.358  -81.849 1.00 58.02  ? 638  GLN B CG   1 
ATOM   7026  C CD   . GLN B 1 77  ? -7.465  22.300  -81.472 1.00 62.66  ? 638  GLN B CD   1 
ATOM   7027  O OE1  . GLN B 1 77  ? -7.287  21.567  -80.498 1.00 68.21  ? 638  GLN B OE1  1 
ATOM   7028  N NE2  . GLN B 1 77  ? -8.541  22.211  -82.246 1.00 75.30  ? 638  GLN B NE2  1 
ATOM   7029  H H    . GLN B 1 77  ? -3.329  22.983  -83.197 1.00 61.26  ? 638  GLN B H    1 
ATOM   7030  H HA   . GLN B 1 77  ? -4.351  24.949  -81.640 1.00 54.07  ? 638  GLN B HA   1 
ATOM   7031  H HB2  . GLN B 1 77  ? -4.802  22.174  -81.657 1.00 57.18  ? 638  GLN B HB2  1 
ATOM   7032  H HB3  . GLN B 1 77  ? -5.121  23.007  -80.346 1.00 57.18  ? 638  GLN B HB3  1 
ATOM   7033  H HG2  . GLN B 1 77  ? -6.741  24.207  -81.484 1.00 69.63  ? 638  GLN B HG2  1 
ATOM   7034  H HG3  . GLN B 1 77  ? -6.406  23.408  -82.817 1.00 69.63  ? 638  GLN B HG3  1 
ATOM   7035  H HE21 . GLN B 1 77  ? -8.630  22.738  -82.920 1.00 90.36  ? 638  GLN B HE21 1 
ATOM   7036  H HE22 . GLN B 1 77  ? -9.148  21.627  -82.073 1.00 90.36  ? 638  GLN B HE22 1 
ATOM   7037  N N    . TYR B 1 78  ? -2.848  24.799  -79.678 1.00 41.52  ? 639  TYR B N    1 
ATOM   7038  C CA   . TYR B 1 78  ? -1.810  24.847  -78.654 1.00 40.76  ? 639  TYR B CA   1 
ATOM   7039  C C    . TYR B 1 78  ? -2.456  24.567  -77.306 1.00 35.55  ? 639  TYR B C    1 
ATOM   7040  O O    . TYR B 1 78  ? -3.373  25.285  -76.898 1.00 35.63  ? 639  TYR B O    1 
ATOM   7041  C CB   . TYR B 1 78  ? -1.108  26.207  -78.648 1.00 35.81  ? 639  TYR B CB   1 
ATOM   7042  C CG   . TYR B 1 78  ? -0.415  26.545  -79.951 1.00 33.42  ? 639  TYR B CG   1 
ATOM   7043  C CD1  . TYR B 1 78  ? -1.129  27.050  -81.030 1.00 43.67  ? 639  TYR B CD1  1 
ATOM   7044  C CD2  . TYR B 1 78  ? 0.953   26.363  -80.101 1.00 32.90  ? 639  TYR B CD2  1 
ATOM   7045  C CE1  . TYR B 1 78  ? -0.502  27.362  -82.221 1.00 39.21  ? 639  TYR B CE1  1 
ATOM   7046  C CE2  . TYR B 1 78  ? 1.590   26.672  -81.289 1.00 37.11  ? 639  TYR B CE2  1 
ATOM   7047  C CZ   . TYR B 1 78  ? 0.858   27.171  -82.346 1.00 40.01  ? 639  TYR B CZ   1 
ATOM   7048  O OH   . TYR B 1 78  ? 1.487   27.480  -83.531 1.00 38.64  ? 639  TYR B OH   1 
ATOM   7049  H H    . TYR B 1 78  ? -3.479  25.369  -79.548 1.00 49.83  ? 639  TYR B H    1 
ATOM   7050  H HA   . TYR B 1 78  ? -1.148  24.159  -78.829 1.00 48.91  ? 639  TYR B HA   1 
ATOM   7051  H HB2  . TYR B 1 78  ? -1.767  26.898  -78.474 1.00 42.97  ? 639  TYR B HB2  1 
ATOM   7052  H HB3  . TYR B 1 78  ? -0.437  26.209  -77.946 1.00 42.97  ? 639  TYR B HB3  1 
ATOM   7053  H HD1  . TYR B 1 78  ? -2.047  27.180  -80.949 1.00 52.41  ? 639  TYR B HD1  1 
ATOM   7054  H HD2  . TYR B 1 78  ? 1.450   26.027  -79.391 1.00 39.48  ? 639  TYR B HD2  1 
ATOM   7055  H HE1  . TYR B 1 78  ? -0.995  27.699  -82.935 1.00 47.05  ? 639  TYR B HE1  1 
ATOM   7056  H HE2  . TYR B 1 78  ? 2.507   26.544  -81.375 1.00 44.54  ? 639  TYR B HE2  1 
ATOM   7057  H HH   . TYR B 1 78  ? 0.928   27.773  -84.086 1.00 46.36  ? 639  TYR B HH   1 
ATOM   7058  N N    . ILE B 1 79  ? -1.976  23.534  -76.619 1.00 33.37  ? 640  ILE B N    1 
ATOM   7059  C CA   . ILE B 1 79  ? -2.572  23.061  -75.372 1.00 37.63  ? 640  ILE B CA   1 
ATOM   7060  C C    . ILE B 1 79  ? -1.579  23.334  -74.250 1.00 34.67  ? 640  ILE B C    1 
ATOM   7061  O O    . ILE B 1 79  ? -0.510  22.714  -74.188 1.00 32.39  ? 640  ILE B O    1 
ATOM   7062  C CB   . ILE B 1 79  ? -2.925  21.567  -75.436 1.00 38.76  ? 640  ILE B CB   1 
ATOM   7063  C CG1  . ILE B 1 79  ? -3.686  21.241  -76.726 1.00 40.42  ? 640  ILE B CG1  1 
ATOM   7064  C CG2  . ILE B 1 79  ? -3.754  21.173  -74.223 1.00 39.34  ? 640  ILE B CG2  1 
ATOM   7065  C CD1  . ILE B 1 79  ? -3.754  19.770  -77.025 1.00 43.44  ? 640  ILE B CD1  1 
ATOM   7066  H H    . ILE B 1 79  ? -1.288  23.079  -76.862 1.00 40.05  ? 640  ILE B H    1 
ATOM   7067  H HA   . ILE B 1 79  ? -3.384  23.560  -75.193 1.00 45.16  ? 640  ILE B HA   1 
ATOM   7068  H HB   . ILE B 1 79  ? -2.101  21.055  -75.427 1.00 46.51  ? 640  ILE B HB   1 
ATOM   7069  H HG12 . ILE B 1 79  ? -4.595  21.571  -76.645 1.00 48.51  ? 640  ILE B HG12 1 
ATOM   7070  H HG13 . ILE B 1 79  ? -3.243  21.676  -77.470 1.00 48.51  ? 640  ILE B HG13 1 
ATOM   7071  H HG21 . ILE B 1 79  ? -3.967  20.228  -74.280 1.00 47.21  ? 640  ILE B HG21 1 
ATOM   7072  H HG22 . ILE B 1 79  ? -3.239  21.348  -73.419 1.00 47.21  ? 640  ILE B HG22 1 
ATOM   7073  H HG23 . ILE B 1 79  ? -4.570  21.696  -74.214 1.00 47.21  ? 640  ILE B HG23 1 
ATOM   7074  H HD11 . ILE B 1 79  ? -4.247  19.639  -77.850 1.00 52.12  ? 640  ILE B HD11 1 
ATOM   7075  H HD12 . ILE B 1 79  ? -2.852  19.426  -77.119 1.00 52.12  ? 640  ILE B HD12 1 
ATOM   7076  H HD13 . ILE B 1 79  ? -4.205  19.320  -76.293 1.00 52.12  ? 640  ILE B HD13 1 
ATOM   7077  N N    . ALA B 1 80  ? -1.931  24.258  -73.359 1.00 30.16  ? 641  ALA B N    1 
ATOM   7078  C CA   . ALA B 1 80  ? -1.111  24.538  -72.189 1.00 30.31  ? 641  ALA B CA   1 
ATOM   7079  C C    . ALA B 1 80  ? -1.434  23.545  -71.082 1.00 28.06  ? 641  ALA B C    1 
ATOM   7080  O O    . ALA B 1 80  ? -2.594  23.405  -70.679 1.00 26.85  ? 641  ALA B O    1 
ATOM   7081  C CB   . ALA B 1 80  ? -1.340  25.967  -71.700 1.00 30.20  ? 641  ALA B CB   1 
ATOM   7082  H H    . ALA B 1 80  ? -2.644  24.737  -73.412 1.00 36.19  ? 641  ALA B H    1 
ATOM   7083  H HA   . ALA B 1 80  ? -0.175  24.441  -72.423 1.00 36.37  ? 641  ALA B HA   1 
ATOM   7084  H HB1  . ALA B 1 80  ? -0.783  26.127  -70.922 1.00 36.24  ? 641  ALA B HB1  1 
ATOM   7085  H HB2  . ALA B 1 80  ? -1.103  26.585  -72.409 1.00 36.24  ? 641  ALA B HB2  1 
ATOM   7086  H HB3  . ALA B 1 80  ? -2.275  26.075  -71.465 1.00 36.24  ? 641  ALA B HB3  1 
ATOM   7087  N N    . ILE B 1 81  ? -0.404  22.854  -70.594 1.00 26.86  ? 642  ILE B N    1 
ATOM   7088  C CA   . ILE B 1 81  ? -0.548  21.820  -69.577 1.00 28.24  ? 642  ILE B CA   1 
ATOM   7089  C C    . ILE B 1 81  ? 0.616   21.936  -68.601 1.00 32.22  ? 642  ILE B C    1 
ATOM   7090  O O    . ILE B 1 81  ? 1.596   22.643  -68.845 1.00 29.07  ? 642  ILE B O    1 
ATOM   7091  C CB   . ILE B 1 81  ? -0.606  20.405  -70.193 1.00 25.52  ? 642  ILE B CB   1 
ATOM   7092  C CG1  . ILE B 1 81  ? 0.632   20.154  -71.060 1.00 29.33  ? 642  ILE B CG1  1 
ATOM   7093  C CG2  . ILE B 1 81  ? -1.890  20.249  -70.995 1.00 32.76  ? 642  ILE B CG2  1 
ATOM   7094  C CD1  . ILE B 1 81  ? 0.612   18.845  -71.838 1.00 44.95  ? 642  ILE B CD1  1 
ATOM   7095  H H    . ILE B 1 81  ? 0.410   22.973  -70.845 1.00 32.23  ? 642  ILE B H    1 
ATOM   7096  H HA   . ILE B 1 81  ? -1.371  21.969  -69.086 1.00 33.89  ? 642  ILE B HA   1 
ATOM   7097  H HB   . ILE B 1 81  ? -0.613  19.756  -69.472 1.00 30.62  ? 642  ILE B HB   1 
ATOM   7098  H HG12 . ILE B 1 81  ? 0.711   20.876  -71.703 1.00 35.19  ? 642  ILE B HG12 1 
ATOM   7099  H HG13 . ILE B 1 81  ? 1.414   20.142  -70.487 1.00 35.19  ? 642  ILE B HG13 1 
ATOM   7100  H HG21 . ILE B 1 81  ? -1.916  19.358  -71.377 1.00 39.32  ? 642  ILE B HG21 1 
ATOM   7101  H HG22 . ILE B 1 81  ? -2.648  20.379  -70.404 1.00 39.32  ? 642  ILE B HG22 1 
ATOM   7102  H HG23 . ILE B 1 81  ? -1.903  20.913  -71.702 1.00 39.32  ? 642  ILE B HG23 1 
ATOM   7103  H HD11 . ILE B 1 81  ? 1.430   18.773  -72.355 1.00 53.94  ? 642  ILE B HD11 1 
ATOM   7104  H HD12 . ILE B 1 81  ? 0.550   18.107  -71.212 1.00 53.94  ? 642  ILE B HD12 1 
ATOM   7105  H HD13 . ILE B 1 81  ? -0.155  18.842  -72.431 1.00 53.94  ? 642  ILE B HD13 1 
ATOM   7106  N N    . GLU B 1 82  ? 0.490   21.231  -67.478 1.00 29.19  ? 643  GLU B N    1 
ATOM   7107  C CA   . GLU B 1 82  ? 1.471   21.335  -66.407 1.00 29.54  ? 643  GLU B CA   1 
ATOM   7108  C C    . GLU B 1 82  ? 2.849   20.898  -66.887 1.00 24.94  ? 643  GLU B C    1 
ATOM   7109  O O    . GLU B 1 82  ? 3.001   19.842  -67.508 1.00 28.57  ? 643  GLU B O    1 
ATOM   7110  C CB   . GLU B 1 82  ? 1.031   20.489  -65.214 1.00 35.38  ? 643  GLU B CB   1 
ATOM   7111  C CG   . GLU B 1 82  ? 2.004   20.503  -64.044 1.00 43.35  ? 643  GLU B CG   1 
ATOM   7112  C CD   . GLU B 1 82  ? 1.479   19.745  -62.840 1.00 40.09  ? 643  GLU B CD   1 
ATOM   7113  O OE1  . GLU B 1 82  ? 0.312   19.300  -62.874 1.00 35.39  ? 643  GLU B OE1  1 
ATOM   7114  O OE2  . GLU B 1 82  ? 2.238   19.585  -61.860 1.00 52.02  ? 643  GLU B OE2  1 
ATOM   7115  H H    . GLU B 1 82  ? -0.155  20.686  -67.315 1.00 35.03  ? 643  GLU B H    1 
ATOM   7116  H HA   . GLU B 1 82  ? 1.530   22.259  -66.118 1.00 35.45  ? 643  GLU B HA   1 
ATOM   7117  H HB2  . GLU B 1 82  ? 0.179   20.823  -64.893 1.00 42.46  ? 643  GLU B HB2  1 
ATOM   7118  H HB3  . GLU B 1 82  ? 0.933   19.568  -65.504 1.00 42.46  ? 643  GLU B HB3  1 
ATOM   7119  H HG2  . GLU B 1 82  ? 2.837   20.090  -64.320 1.00 52.02  ? 643  GLU B HG2  1 
ATOM   7120  H HG3  . GLU B 1 82  ? 2.162   21.422  -63.775 1.00 52.02  ? 643  GLU B HG3  1 
ATOM   7121  N N    . LEU B 1 83  ? 3.850   21.724  -66.601 1.00 25.10  ? 644  LEU B N    1 
ATOM   7122  C CA   . LEU B 1 83  ? 5.233   21.384  -66.894 1.00 30.18  ? 644  LEU B CA   1 
ATOM   7123  C C    . LEU B 1 83  ? 5.774   20.465  -65.808 1.00 30.67  ? 644  LEU B C    1 
ATOM   7124  O O    . LEU B 1 83  ? 5.525   20.677  -64.618 1.00 28.04  ? 644  LEU B O    1 
ATOM   7125  C CB   . LEU B 1 83  ? 6.089   22.649  -66.981 1.00 27.00  ? 644  LEU B CB   1 
ATOM   7126  C CG   . LEU B 1 83  ? 7.588   22.447  -67.211 1.00 31.84  ? 644  LEU B CG   1 
ATOM   7127  C CD1  . LEU B 1 83  ? 7.855   21.884  -68.593 1.00 32.25  ? 644  LEU B CD1  1 
ATOM   7128  C CD2  . LEU B 1 83  ? 8.340   23.756  -66.998 1.00 35.45  ? 644  LEU B CD2  1 
ATOM   7129  H H    . LEU B 1 83  ? 3.751   22.495  -66.233 1.00 30.12  ? 644  LEU B H    1 
ATOM   7130  H HA   . LEU B 1 83  ? 5.281   20.920  -67.744 1.00 36.21  ? 644  LEU B HA   1 
ATOM   7131  H HB2  . LEU B 1 83  ? 5.756   23.190  -67.714 1.00 32.40  ? 644  LEU B HB2  1 
ATOM   7132  H HB3  . LEU B 1 83  ? 5.989   23.140  -66.150 1.00 32.40  ? 644  LEU B HB3  1 
ATOM   7133  H HG   . LEU B 1 83  ? 7.920   21.807  -66.563 1.00 38.21  ? 644  LEU B HG   1 
ATOM   7134  H HD11 . LEU B 1 83  ? 8.812   21.768  -68.707 1.00 38.71  ? 644  LEU B HD11 1 
ATOM   7135  H HD12 . LEU B 1 83  ? 7.406   21.029  -68.677 1.00 38.71  ? 644  LEU B HD12 1 
ATOM   7136  H HD13 . LEU B 1 83  ? 7.515   22.504  -69.257 1.00 38.71  ? 644  LEU B HD13 1 
ATOM   7137  H HD21 . LEU B 1 83  ? 9.286   23.605  -67.149 1.00 42.54  ? 644  LEU B HD21 1 
ATOM   7138  H HD22 . LEU B 1 83  ? 8.006   24.417  -67.624 1.00 42.54  ? 644  LEU B HD22 1 
ATOM   7139  H HD23 . LEU B 1 83  ? 8.194   24.058  -66.087 1.00 42.54  ? 644  LEU B HD23 1 
ATOM   7140  N N    . CYS B 1 84  ? 6.517   19.443  -66.222 1.00 34.04  ? 645  CYS B N    1 
ATOM   7141  C CA   . CYS B 1 84  ? 7.121   18.495  -65.300 1.00 34.56  ? 645  CYS B CA   1 
ATOM   7142  C C    . CYS B 1 84  ? 8.639   18.539  -65.433 1.00 36.05  ? 645  CYS B C    1 
ATOM   7143  O O    . CYS B 1 84  ? 9.193   19.212  -66.306 1.00 42.80  ? 645  CYS B O    1 
ATOM   7144  C CB   . CYS B 1 84  ? 6.600   17.075  -65.563 1.00 33.62  ? 645  CYS B CB   1 
ATOM   7145  S SG   . CYS B 1 84  ? 4.827   16.880  -65.265 1.00 37.13  ? 645  CYS B SG   1 
ATOM   7146  H H    . CYS B 1 84  ? 6.688   19.278  -67.049 1.00 40.85  ? 645  CYS B H    1 
ATOM   7147  H HA   . CYS B 1 84  ? 6.889   18.740  -64.391 1.00 41.47  ? 645  CYS B HA   1 
ATOM   7148  H HB2  . CYS B 1 84  ? 6.772   16.847  -66.490 1.00 40.35  ? 645  CYS B HB2  1 
ATOM   7149  H HB3  . CYS B 1 84  ? 7.069   16.457  -64.981 1.00 40.35  ? 645  CYS B HB3  1 
ATOM   7150  H HG   . CYS B 1 84  ? 4.514   15.745  -65.496 1.00 44.55  ? 645  CYS B HG   1 
ATOM   7151  N N    . ALA B 1 85  ? 9.310   17.801  -64.546 1.00 37.25  ? 646  ALA B N    1 
ATOM   7152  C CA   . ALA B 1 85  ? 10.768  17.798  -64.516 1.00 39.13  ? 646  ALA B CA   1 
ATOM   7153  C C    . ALA B 1 85  ? 11.358  16.834  -65.538 1.00 42.03  ? 646  ALA B C    1 
ATOM   7154  O O    . ALA B 1 85  ? 12.331  17.171  -66.223 1.00 57.38  ? 646  ALA B O    1 
ATOM   7155  C CB   . ALA B 1 85  ? 11.262  17.447  -63.113 1.00 35.06  ? 646  ALA B CB   1 
ATOM   7156  H H    . ALA B 1 85  ? 8.943   17.297  -63.953 1.00 44.70  ? 646  ALA B H    1 
ATOM   7157  H HA   . ALA B 1 85  ? 11.087  18.689  -64.730 1.00 46.95  ? 646  ALA B HA   1 
ATOM   7158  H HB1  . ALA B 1 85  ? 12.232  17.450  -63.110 1.00 42.07  ? 646  ALA B HB1  1 
ATOM   7159  H HB2  . ALA B 1 85  ? 10.928  18.107  -62.486 1.00 42.07  ? 646  ALA B HB2  1 
ATOM   7160  H HB3  . ALA B 1 85  ? 10.933  16.567  -62.874 1.00 42.07  ? 646  ALA B HB3  1 
ATOM   7161  N N    . ALA B 1 86  ? 10.794  15.636  -65.650 1.00 37.79  ? 647  ALA B N    1 
ATOM   7162  C CA   . ALA B 1 86  ? 11.392  14.577  -66.451 1.00 38.48  ? 647  ALA B CA   1 
ATOM   7163  C C    . ALA B 1 86  ? 10.339  13.502  -66.702 1.00 37.47  ? 647  ALA B C    1 
ATOM   7164  O O    . ALA B 1 86  ? 9.155   13.684  -66.400 1.00 37.59  ? 647  ALA B O    1 
ATOM   7165  C CB   . ALA B 1 86  ? 12.634  14.015  -65.751 1.00 40.12  ? 647  ALA B CB   1 
ATOM   7166  H H    . ALA B 1 86  ? 10.057  15.411  -65.268 1.00 45.35  ? 647  ALA B H    1 
ATOM   7167  H HA   . ALA B 1 86  ? 11.666  14.940  -67.308 1.00 46.18  ? 647  ALA B HA   1 
ATOM   7168  H HB1  . ALA B 1 86  ? 13.015  13.313  -66.301 1.00 48.15  ? 647  ALA B HB1  1 
ATOM   7169  H HB2  . ALA B 1 86  ? 13.279  14.730  -65.632 1.00 48.15  ? 647  ALA B HB2  1 
ATOM   7170  H HB3  . ALA B 1 86  ? 12.374  13.656  -64.888 1.00 48.15  ? 647  ALA B HB3  1 
ATOM   7171  N N    . THR B 1 87  ? 10.778  12.378  -67.262 1.00 37.32  ? 648  THR B N    1 
ATOM   7172  C CA   . THR B 1 87  ? 9.941   11.213  -67.504 1.00 45.19  ? 648  THR B CA   1 
ATOM   7173  C C    . THR B 1 87  ? 10.401  10.070  -66.609 1.00 42.93  ? 648  THR B C    1 
ATOM   7174  O O    . THR B 1 87  ? 11.541  10.039  -66.138 1.00 41.10  ? 648  THR B O    1 
ATOM   7175  C CB   . THR B 1 87  ? 9.999   10.768  -68.973 1.00 42.59  ? 648  THR B CB   1 
ATOM   7176  O OG1  . THR B 1 87  ? 11.228  10.074  -69.221 1.00 42.55  ? 648  THR B OG1  1 
ATOM   7177  C CG2  . THR B 1 87  ? 9.884   11.956  -69.918 1.00 35.94  ? 648  THR B CG2  1 
ATOM   7178  H H    . THR B 1 87  ? 11.590  12.266  -67.520 1.00 44.78  ? 648  THR B H    1 
ATOM   7179  H HA   . THR B 1 87  ? 9.021   11.425  -67.283 1.00 54.23  ? 648  THR B HA   1 
ATOM   7180  H HB   . THR B 1 87  ? 9.257   10.170  -69.151 1.00 51.10  ? 648  THR B HB   1 
ATOM   7181  H HG1  . THR B 1 87  ? 11.262  9.830   -70.024 1.00 51.06  ? 648  THR B HG1  1 
ATOM   7182  H HG21 . THR B 1 87  ? 9.923   11.652  -70.839 1.00 43.13  ? 648  THR B HG21 1 
ATOM   7183  H HG22 . THR B 1 87  ? 9.042   12.415  -69.773 1.00 43.13  ? 648  THR B HG22 1 
ATOM   7184  H HG23 . THR B 1 87  ? 10.612  12.577  -69.761 1.00 43.13  ? 648  THR B HG23 1 
ATOM   7185  N N    . LEU B 1 88  ? 9.484   9.134   -66.356 1.00 40.68  ? 649  LEU B N    1 
ATOM   7186  C CA   . LEU B 1 88  ? 9.819   7.981   -65.529 1.00 40.68  ? 649  LEU B CA   1 
ATOM   7187  C C    . LEU B 1 88  ? 10.983  7.193   -66.113 1.00 44.50  ? 649  LEU B C    1 
ATOM   7188  O O    . LEU B 1 88  ? 11.786  6.626   -65.362 1.00 51.01  ? 649  LEU B O    1 
ATOM   7189  C CB   . LEU B 1 88  ? 8.596   7.078   -65.367 1.00 39.54  ? 649  LEU B CB   1 
ATOM   7190  C CG   . LEU B 1 88  ? 8.809   5.813   -64.531 1.00 38.85  ? 649  LEU B CG   1 
ATOM   7191  C CD1  . LEU B 1 88  ? 9.210   6.166   -63.108 1.00 42.62  ? 649  LEU B CD1  1 
ATOM   7192  C CD2  . LEU B 1 88  ? 7.557   4.955   -64.537 1.00 38.42  ? 649  LEU B CD2  1 
ATOM   7193  H H    . LEU B 1 88  ? 8.675   9.145   -66.647 1.00 48.82  ? 649  LEU B H    1 
ATOM   7194  H HA   . LEU B 1 88  ? 10.081  8.292   -64.648 1.00 48.81  ? 649  LEU B HA   1 
ATOM   7195  H HB2  . LEU B 1 88  ? 7.891   7.591   -64.942 1.00 47.45  ? 649  LEU B HB2  1 
ATOM   7196  H HB3  . LEU B 1 88  ? 8.305   6.797   -66.248 1.00 47.45  ? 649  LEU B HB3  1 
ATOM   7197  H HG   . LEU B 1 88  ? 9.528   5.294   -64.923 1.00 46.62  ? 649  LEU B HG   1 
ATOM   7198  H HD11 . LEU B 1 88  ? 9.337   5.346   -62.604 1.00 51.15  ? 649  LEU B HD11 1 
ATOM   7199  H HD12 . LEU B 1 88  ? 10.037  6.673   -63.130 1.00 51.15  ? 649  LEU B HD12 1 
ATOM   7200  H HD13 . LEU B 1 88  ? 8.506   6.697   -62.704 1.00 51.15  ? 649  LEU B HD13 1 
ATOM   7201  H HD21 . LEU B 1 88  ? 7.716   4.161   -64.002 1.00 46.10  ? 649  LEU B HD21 1 
ATOM   7202  H HD22 . LEU B 1 88  ? 6.822   5.465   -64.163 1.00 46.10  ? 649  LEU B HD22 1 
ATOM   7203  H HD23 . LEU B 1 88  ? 7.353   4.702   -65.451 1.00 46.10  ? 649  LEU B HD23 1 
ATOM   7204  N N    . GLN B 1 89  ? 11.095  7.147   -67.443 1.00 47.26  ? 650  GLN B N    1 
ATOM   7205  C CA   . GLN B 1 89  ? 12.194  6.426   -68.079 1.00 49.93  ? 650  GLN B CA   1 
ATOM   7206  C C    . GLN B 1 89  ? 13.541  6.988   -67.641 1.00 54.73  ? 650  GLN B C    1 
ATOM   7207  O O    . GLN B 1 89  ? 14.396  6.262   -67.122 1.00 64.78  ? 650  GLN B O    1 
ATOM   7208  C CB   . GLN B 1 89  ? 12.049  6.492   -69.601 1.00 48.94  ? 650  GLN B CB   1 
ATOM   7209  C CG   . GLN B 1 89  ? 13.237  5.930   -70.389 1.00 63.28  ? 650  GLN B CG   1 
ATOM   7210  C CD   . GLN B 1 89  ? 13.839  6.934   -71.359 1.00 77.71  ? 650  GLN B CD   1 
ATOM   7211  O OE1  . GLN B 1 89  ? 13.158  7.846   -71.830 1.00 83.09  ? 650  GLN B OE1  1 
ATOM   7212  N NE2  . GLN B 1 89  ? 15.122  6.769   -71.660 1.00 73.78  ? 650  GLN B NE2  1 
ATOM   7213  H H    . GLN B 1 89  ? 10.551  7.524   -67.993 1.00 56.71  ? 650  GLN B H    1 
ATOM   7214  H HA   . GLN B 1 89  ? 12.156  5.494   -67.814 1.00 59.92  ? 650  GLN B HA   1 
ATOM   7215  H HB2  . GLN B 1 89  ? 11.262  5.987   -69.859 1.00 58.73  ? 650  GLN B HB2  1 
ATOM   7216  H HB3  . GLN B 1 89  ? 11.939  7.420   -69.861 1.00 58.73  ? 650  GLN B HB3  1 
ATOM   7217  H HG2  . GLN B 1 89  ? 13.931  5.664   -69.766 1.00 75.94  ? 650  GLN B HG2  1 
ATOM   7218  H HG3  . GLN B 1 89  ? 12.940  5.161   -70.901 1.00 75.94  ? 650  GLN B HG3  1 
ATOM   7219  H HE21 . GLN B 1 89  ? 15.566  6.121   -71.311 1.00 88.54  ? 650  GLN B HE21 1 
ATOM   7220  H HE22 . GLN B 1 89  ? 15.509  7.312   -72.204 1.00 88.54  ? 650  GLN B HE22 1 
ATOM   7221  N N    . GLU B 1 90  ? 13.751  8.289   -67.848 1.00 53.47  ? 651  GLU B N    1 
ATOM   7222  C CA   . GLU B 1 90  ? 15.018  8.902   -67.472 1.00 55.44  ? 651  GLU B CA   1 
ATOM   7223  C C    . GLU B 1 90  ? 15.200  8.997   -65.962 1.00 53.84  ? 651  GLU B C    1 
ATOM   7224  O O    . GLU B 1 90  ? 16.321  9.252   -65.509 1.00 55.58  ? 651  GLU B O    1 
ATOM   7225  C CB   . GLU B 1 90  ? 15.138  10.288  -68.111 1.00 57.82  ? 651  GLU B CB   1 
ATOM   7226  C CG   . GLU B 1 90  ? 14.006  11.243  -67.788 1.00 54.52  ? 651  GLU B CG   1 
ATOM   7227  C CD   . GLU B 1 90  ? 14.007  12.461  -68.691 1.00 55.30  ? 651  GLU B CD   1 
ATOM   7228  O OE1  . GLU B 1 90  ? 12.945  13.101  -68.833 1.00 57.54  ? 651  GLU B OE1  1 
ATOM   7229  O OE2  . GLU B 1 90  ? 15.072  12.778  -69.264 1.00 55.84  ? 651  GLU B OE2  1 
ATOM   7230  H H    . GLU B 1 90  ? 13.182  8.829   -68.200 1.00 64.16  ? 651  GLU B H    1 
ATOM   7231  H HA   . GLU B 1 90  ? 15.740  8.355   -67.820 1.00 66.53  ? 651  GLU B HA   1 
ATOM   7232  H HB2  . GLU B 1 90  ? 15.963  10.697  -67.805 1.00 69.39  ? 651  GLU B HB2  1 
ATOM   7233  H HB3  . GLU B 1 90  ? 15.166  10.182  -69.074 1.00 69.39  ? 651  GLU B HB3  1 
ATOM   7234  H HG2  . GLU B 1 90  ? 13.159  10.783  -67.902 1.00 65.42  ? 651  GLU B HG2  1 
ATOM   7235  H HG3  . GLU B 1 90  ? 14.098  11.547  -66.871 1.00 65.42  ? 651  GLU B HG3  1 
ATOM   7236  N N    . TYR B 1 91  ? 14.136  8.798   -65.177 1.00 51.22  ? 652  TYR B N    1 
ATOM   7237  C CA   . TYR B 1 91  ? 14.294  8.696   -63.729 1.00 54.76  ? 652  TYR B CA   1 
ATOM   7238  C C    . TYR B 1 91  ? 14.985  7.397   -63.333 1.00 58.83  ? 652  TYR B C    1 
ATOM   7239  O O    . TYR B 1 91  ? 15.709  7.364   -62.331 1.00 60.48  ? 652  TYR B O    1 
ATOM   7240  C CB   . TYR B 1 91  ? 12.932  8.797   -63.037 1.00 51.16  ? 652  TYR B CB   1 
ATOM   7241  C CG   . TYR B 1 91  ? 12.926  8.284   -61.609 1.00 50.01  ? 652  TYR B CG   1 
ATOM   7242  C CD1  . TYR B 1 91  ? 13.224  9.124   -60.545 1.00 50.61  ? 652  TYR B CD1  1 
ATOM   7243  C CD2  . TYR B 1 91  ? 12.620  6.957   -61.327 1.00 53.73  ? 652  TYR B CD2  1 
ATOM   7244  C CE1  . TYR B 1 91  ? 13.221  8.658   -59.242 1.00 53.62  ? 652  TYR B CE1  1 
ATOM   7245  C CE2  . TYR B 1 91  ? 12.615  6.483   -60.029 1.00 53.36  ? 652  TYR B CE2  1 
ATOM   7246  C CZ   . TYR B 1 91  ? 12.915  7.337   -58.990 1.00 58.34  ? 652  TYR B CZ   1 
ATOM   7247  O OH   . TYR B 1 91  ? 12.910  6.868   -57.696 1.00 69.41  ? 652  TYR B OH   1 
ATOM   7248  H H    . TYR B 1 91  ? 13.327  8.720   -65.456 1.00 61.46  ? 652  TYR B H    1 
ATOM   7249  H HA   . TYR B 1 91  ? 14.843  9.434   -63.419 1.00 65.71  ? 652  TYR B HA   1 
ATOM   7250  H HB2  . TYR B 1 91  ? 12.660  9.728   -63.018 1.00 61.40  ? 652  TYR B HB2  1 
ATOM   7251  H HB3  . TYR B 1 91  ? 12.286  8.278   -63.541 1.00 61.40  ? 652  TYR B HB3  1 
ATOM   7252  H HD1  . TYR B 1 91  ? 13.431  10.015  -60.711 1.00 60.73  ? 652  TYR B HD1  1 
ATOM   7253  H HD2  . TYR B 1 91  ? 12.418  6.377   -62.025 1.00 64.47  ? 652  TYR B HD2  1 
ATOM   7254  H HE1  . TYR B 1 91  ? 13.423  9.233   -58.540 1.00 64.34  ? 652  TYR B HE1  1 
ATOM   7255  H HE2  . TYR B 1 91  ? 12.409  5.593   -59.857 1.00 64.03  ? 652  TYR B HE2  1 
ATOM   7256  H HH   . TYR B 1 91  ? 12.709  6.052   -57.687 1.00 83.29  ? 652  TYR B HH   1 
ATOM   7257  N N    . VAL B 1 92  ? 14.775  6.324   -64.099 1.00 57.34  ? 653  VAL B N    1 
ATOM   7258  C CA   . VAL B 1 92  ? 15.351  5.026   -63.775 1.00 60.70  ? 653  VAL B CA   1 
ATOM   7259  C C    . VAL B 1 92  ? 16.874  5.057   -63.783 1.00 67.34  ? 653  VAL B C    1 
ATOM   7260  O O    . VAL B 1 92  ? 17.510  4.151   -63.236 1.00 70.00  ? 653  VAL B O    1 
ATOM   7261  C CB   . VAL B 1 92  ? 14.776  3.965   -64.743 1.00 52.48  ? 653  VAL B CB   1 
ATOM   7262  C CG1  . VAL B 1 92  ? 15.509  2.629   -64.650 1.00 60.30  ? 653  VAL B CG1  1 
ATOM   7263  C CG2  . VAL B 1 92  ? 13.300  3.760   -64.437 1.00 49.15  ? 653  VAL B CG2  1 
ATOM   7264  H H    . VAL B 1 92  ? 14.299  6.326   -64.816 1.00 68.81  ? 653  VAL B H    1 
ATOM   7265  H HA   . VAL B 1 92  ? 15.071  4.782   -62.879 1.00 72.84  ? 653  VAL B HA   1 
ATOM   7266  H HB   . VAL B 1 92  ? 14.853  4.290   -65.654 1.00 62.98  ? 653  VAL B HB   1 
ATOM   7267  H HG11 . VAL B 1 92  ? 15.108  2.006   -65.275 1.00 72.36  ? 653  VAL B HG11 1 
ATOM   7268  H HG12 . VAL B 1 92  ? 16.443  2.766   -64.870 1.00 72.36  ? 653  VAL B HG12 1 
ATOM   7269  H HG13 . VAL B 1 92  ? 15.429  2.289   -63.745 1.00 72.36  ? 653  VAL B HG13 1 
ATOM   7270  H HG21 . VAL B 1 92  ? 12.941  3.095   -65.045 1.00 58.98  ? 653  VAL B HG21 1 
ATOM   7271  H HG22 . VAL B 1 92  ? 13.208  3.456   -63.521 1.00 58.98  ? 653  VAL B HG22 1 
ATOM   7272  H HG23 . VAL B 1 92  ? 12.834  4.603   -64.555 1.00 58.98  ? 653  VAL B HG23 1 
ATOM   7273  N N    . GLU B 1 93  ? 17.476  6.096   -64.360 1.00 75.88  ? 654  GLU B N    1 
ATOM   7274  C CA   . GLU B 1 93  ? 18.876  6.419   -64.105 1.00 74.93  ? 654  GLU B CA   1 
ATOM   7275  C C    . GLU B 1 93  ? 18.892  7.424   -62.959 1.00 76.39  ? 654  GLU B C    1 
ATOM   7276  O O    . GLU B 1 93  ? 18.468  8.573   -63.125 1.00 75.70  ? 654  GLU B O    1 
ATOM   7277  C CB   . GLU B 1 93  ? 19.558  6.977   -65.352 1.00 67.05  ? 654  GLU B CB   1 
ATOM   7278  C CG   . GLU B 1 93  ? 19.714  5.963   -66.483 1.00 66.47  ? 654  GLU B CG   1 
ATOM   7279  C CD   . GLU B 1 93  ? 18.410  5.670   -67.201 1.00 66.53  ? 654  GLU B CD   1 
ATOM   7280  O OE1  . GLU B 1 93  ? 17.350  6.132   -66.728 1.00 71.36  ? 654  GLU B OE1  1 
ATOM   7281  O OE2  . GLU B 1 93  ? 18.443  4.978   -68.240 1.00 78.58  ? 654  GLU B OE2  1 
ATOM   7282  H H    . GLU B 1 93  ? 17.090  6.633   -64.910 1.00 91.06  ? 654  GLU B H    1 
ATOM   7283  H HA   . GLU B 1 93  ? 19.349  5.621   -63.823 1.00 89.92  ? 654  GLU B HA   1 
ATOM   7284  H HB2  . GLU B 1 93  ? 19.032  7.718   -65.690 1.00 80.46  ? 654  GLU B HB2  1 
ATOM   7285  H HB3  . GLU B 1 93  ? 20.445  7.287   -65.109 1.00 80.46  ? 654  GLU B HB3  1 
ATOM   7286  H HG2  . GLU B 1 93  ? 20.342  6.312   -67.134 1.00 79.76  ? 654  GLU B HG2  1 
ATOM   7287  H HG3  . GLU B 1 93  ? 20.047  5.129   -66.115 1.00 79.76  ? 654  GLU B HG3  1 
ATOM   7288  N N    . GLN B 1 94  ? 19.376  6.986   -61.800 1.00 83.17  ? 655  GLN B N    1 
ATOM   7289  C CA   . GLN B 1 94  ? 19.249  7.741   -60.557 1.00 80.98  ? 655  GLN B CA   1 
ATOM   7290  C C    . GLN B 1 94  ? 19.804  9.158   -60.669 1.00 80.14  ? 655  GLN B C    1 
ATOM   7291  O O    . GLN B 1 94  ? 19.054  10.133  -60.597 1.00 78.42  ? 655  GLN B O    1 
ATOM   7292  C CB   . GLN B 1 94  ? 19.956  6.994   -59.425 1.00 78.85  ? 655  GLN B CB   1 
ATOM   7293  C CG   . GLN B 1 94  ? 19.783  7.624   -58.053 1.00 82.10  ? 655  GLN B CG   1 
ATOM   7294  C CD   . GLN B 1 94  ? 20.349  6.760   -56.941 1.00 95.31  ? 655  GLN B CD   1 
ATOM   7295  O OE1  . GLN B 1 94  ? 20.498  5.548   -57.094 1.00 80.99  ? 655  GLN B OE1  1 
ATOM   7296  N NE2  . GLN B 1 94  ? 20.672  7.384   -55.813 1.00 108.26 ? 655  GLN B NE2  1 
ATOM   7297  H H    . GLN B 1 94  ? 19.792  6.239   -61.707 1.00 99.81  ? 655  GLN B H    1 
ATOM   7298  H HA   . GLN B 1 94  ? 18.309  7.808   -60.327 1.00 97.18  ? 655  GLN B HA   1 
ATOM   7299  H HB2  . GLN B 1 94  ? 19.604  6.091   -59.381 1.00 94.62  ? 655  GLN B HB2  1 
ATOM   7300  H HB3  . GLN B 1 94  ? 20.906  6.965   -59.618 1.00 94.62  ? 655  GLN B HB3  1 
ATOM   7301  H HG2  . GLN B 1 94  ? 20.244  8.477   -58.036 1.00 98.52  ? 655  GLN B HG2  1 
ATOM   7302  H HG3  . GLN B 1 94  ? 18.837  7.753   -57.881 1.00 98.52  ? 655  GLN B HG3  1 
ATOM   7303  H HE21 . GLN B 1 94  ? 20.556  8.233   -55.743 1.00 129.91 ? 655  GLN B HE21 1 
ATOM   7304  H HE22 . GLN B 1 94  ? 20.997  6.939   -55.153 1.00 129.91 ? 655  GLN B HE22 1 
ATOM   7305  N N    . GLU B 1 103 ? 10.542  7.786   -54.187 1.00 46.47  ? 664  GLU B N    1 
ATOM   7306  C CA   . GLU B 1 103 ? 10.740  6.360   -53.948 1.00 51.82  ? 664  GLU B CA   1 
ATOM   7307  C C    . GLU B 1 103 ? 9.945   5.509   -54.953 1.00 46.31  ? 664  GLU B C    1 
ATOM   7308  O O    . GLU B 1 103 ? 8.762   5.764   -55.172 1.00 42.97  ? 664  GLU B O    1 
ATOM   7309  C CB   . GLU B 1 103 ? 10.342  6.026   -52.510 1.00 54.15  ? 664  GLU B CB   1 
ATOM   7310  C CG   . GLU B 1 103 ? 10.814  4.666   -52.019 1.00 57.83  ? 664  GLU B CG   1 
ATOM   7311  C CD   . GLU B 1 103 ? 10.542  4.470   -50.541 1.00 69.46  ? 664  GLU B CD   1 
ATOM   7312  O OE1  . GLU B 1 103 ? 9.980   5.393   -49.911 1.00 86.13  ? 664  GLU B OE1  1 
ATOM   7313  O OE2  . GLU B 1 103 ? 10.891  3.399   -50.005 1.00 80.66  ? 664  GLU B OE2  1 
ATOM   7314  H HA   . GLU B 1 103 ? 11.681  6.149   -54.055 1.00 62.18  ? 664  GLU B HA   1 
ATOM   7315  H HB2  . GLU B 1 103 ? 10.718  6.698   -51.920 1.00 64.98  ? 664  GLU B HB2  1 
ATOM   7316  H HB3  . GLU B 1 103 ? 9.374   6.041   -52.445 1.00 64.98  ? 664  GLU B HB3  1 
ATOM   7317  H HG2  . GLU B 1 103 ? 10.347  3.971   -52.507 1.00 69.40  ? 664  GLU B HG2  1 
ATOM   7318  H HG3  . GLU B 1 103 ? 11.771  4.591   -52.163 1.00 69.40  ? 664  GLU B HG3  1 
ATOM   7319  N N    . PRO B 1 104 ? 10.590  4.490   -55.545 1.00 42.63  ? 665  PRO B N    1 
ATOM   7320  C CA   . PRO B 1 104 ? 9.986   3.821   -56.718 1.00 46.38  ? 665  PRO B CA   1 
ATOM   7321  C C    . PRO B 1 104 ? 8.592   3.254   -56.487 1.00 41.37  ? 665  PRO B C    1 
ATOM   7322  O O    . PRO B 1 104 ? 7.741   3.362   -57.379 1.00 43.59  ? 665  PRO B O    1 
ATOM   7323  C CB   . PRO B 1 104 ? 11.001  2.711   -57.053 1.00 46.36  ? 665  PRO B CB   1 
ATOM   7324  C CG   . PRO B 1 104 ? 11.883  2.586   -55.851 1.00 48.56  ? 665  PRO B CG   1 
ATOM   7325  C CD   . PRO B 1 104 ? 11.922  3.944   -55.239 1.00 46.06  ? 665  PRO B CD   1 
ATOM   7326  H HA   . PRO B 1 104 ? 9.947   4.441   -57.463 1.00 55.65  ? 665  PRO B HA   1 
ATOM   7327  H HB2  . PRO B 1 104 ? 10.529  1.879   -57.218 1.00 55.64  ? 665  PRO B HB2  1 
ATOM   7328  H HB3  . PRO B 1 104 ? 11.519  2.970   -57.831 1.00 55.64  ? 665  PRO B HB3  1 
ATOM   7329  H HG2  . PRO B 1 104 ? 11.501  1.943   -55.232 1.00 58.27  ? 665  PRO B HG2  1 
ATOM   7330  H HG3  . PRO B 1 104 ? 12.771  2.309   -56.127 1.00 58.27  ? 665  PRO B HG3  1 
ATOM   7331  H HD2  . PRO B 1 104 ? 12.050  3.880   -54.280 1.00 55.27  ? 665  PRO B HD2  1 
ATOM   7332  H HD3  . PRO B 1 104 ? 12.613  4.483   -55.656 1.00 55.27  ? 665  PRO B HD3  1 
ATOM   7333  N N    . ILE B 1 105 ? 8.324   2.646   -55.331 1.00 40.03  ? 666  ILE B N    1 
ATOM   7334  C CA   . ILE B 1 105 ? 7.023   2.012   -55.131 1.00 39.12  ? 666  ILE B CA   1 
ATOM   7335  C C    . ILE B 1 105 ? 5.924   3.066   -55.066 1.00 35.26  ? 666  ILE B C    1 
ATOM   7336  O O    . ILE B 1 105 ? 4.808   2.847   -55.552 1.00 36.76  ? 666  ILE B O    1 
ATOM   7337  C CB   . ILE B 1 105 ? 7.037   1.127   -53.870 1.00 46.07  ? 666  ILE B CB   1 
ATOM   7338  C CG1  . ILE B 1 105 ? 8.201   0.133   -53.945 1.00 50.84  ? 666  ILE B CG1  1 
ATOM   7339  C CG2  . ILE B 1 105 ? 5.693   0.404   -53.722 1.00 45.40  ? 666  ILE B CG2  1 
ATOM   7340  C CD1  . ILE B 1 105 ? 8.226   -0.917  -52.844 1.00 67.28  ? 666  ILE B CD1  1 
ATOM   7341  H H    . ILE B 1 105 ? 8.864   2.588   -54.664 1.00 48.04  ? 666  ILE B H    1 
ATOM   7342  H HA   . ILE B 1 105 ? 6.836   1.439   -55.891 1.00 46.94  ? 666  ILE B HA   1 
ATOM   7343  H HB   . ILE B 1 105 ? 7.167   1.696   -53.095 1.00 55.29  ? 666  ILE B HB   1 
ATOM   7344  H HG12 . ILE B 1 105 ? 8.153   -0.334  -54.794 1.00 61.01  ? 666  ILE B HG12 1 
ATOM   7345  H HG13 . ILE B 1 105 ? 9.033   0.629   -53.894 1.00 61.01  ? 666  ILE B HG13 1 
ATOM   7346  H HG21 . ILE B 1 105 ? 5.718   -0.149  -52.925 1.00 54.48  ? 666  ILE B HG21 1 
ATOM   7347  H HG22 . ILE B 1 105 ? 4.987   1.064   -53.645 1.00 54.48  ? 666  ILE B HG22 1 
ATOM   7348  H HG23 . ILE B 1 105 ? 5.545   -0.150  -54.504 1.00 54.48  ? 666  ILE B HG23 1 
ATOM   7349  H HD11 . ILE B 1 105 ? 8.993   -1.495  -52.976 1.00 80.74  ? 666  ILE B HD11 1 
ATOM   7350  H HD12 . ILE B 1 105 ? 8.291   -0.472  -51.985 1.00 80.74  ? 666  ILE B HD12 1 
ATOM   7351  H HD13 . ILE B 1 105 ? 7.408   -1.438  -52.886 1.00 80.74  ? 666  ILE B HD13 1 
ATOM   7352  N N    . THR B 1 106 ? 6.216   4.224   -54.470 1.00 36.86  ? 667  THR B N    1 
ATOM   7353  C CA   . THR B 1 106 ? 5.222   5.290   -54.415 1.00 38.14  ? 667  THR B CA   1 
ATOM   7354  C C    . THR B 1 106 ? 4.910   5.815   -55.811 1.00 33.14  ? 667  THR B C    1 
ATOM   7355  O O    . THR B 1 106 ? 3.758   6.149   -56.113 1.00 32.05  ? 667  THR B O    1 
ATOM   7356  C CB   . THR B 1 106 ? 5.712   6.422   -53.513 1.00 38.89  ? 667  THR B CB   1 
ATOM   7357  O OG1  . THR B 1 106 ? 6.324   5.871   -52.340 1.00 48.26  ? 667  THR B OG1  1 
ATOM   7358  C CG2  . THR B 1 106 ? 4.551   7.321   -53.101 1.00 38.73  ? 667  THR B CG2  1 
ATOM   7359  H H    . THR B 1 106 ? 6.968   4.412   -54.097 1.00 44.23  ? 667  THR B H    1 
ATOM   7360  H HA   . THR B 1 106 ? 4.402   4.938   -54.037 1.00 45.77  ? 667  THR B HA   1 
ATOM   7361  H HB   . THR B 1 106 ? 6.360   6.960   -53.993 1.00 46.67  ? 667  THR B HB   1 
ATOM   7362  H HG1  . THR B 1 106 ? 6.595   6.489   -51.840 1.00 57.92  ? 667  THR B HG1  1 
ATOM   7363  H HG21 . THR B 1 106 ? 4.872   8.036   -52.529 1.00 46.48  ? 667  THR B HG21 1 
ATOM   7364  H HG22 . THR B 1 106 ? 4.137   7.709   -53.889 1.00 46.48  ? 667  THR B HG22 1 
ATOM   7365  H HG23 . THR B 1 106 ? 3.887   6.805   -52.619 1.00 46.48  ? 667  THR B HG23 1 
ATOM   7366  N N    . LEU B 1 107 ? 5.923   5.892   -56.679 1.00 28.96  ? 668  LEU B N    1 
ATOM   7367  C CA   . LEU B 1 107 ? 5.682   6.307   -58.058 1.00 33.80  ? 668  LEU B CA   1 
ATOM   7368  C C    . LEU B 1 107 ? 4.742   5.337   -58.762 1.00 32.55  ? 668  LEU B C    1 
ATOM   7369  O O    . LEU B 1 107 ? 3.838   5.756   -59.495 1.00 28.14  ? 668  LEU B O    1 
ATOM   7370  C CB   . LEU B 1 107 ? 7.005   6.411   -58.819 1.00 37.01  ? 668  LEU B CB   1 
ATOM   7371  C CG   . LEU B 1 107 ? 7.996   7.488   -58.369 1.00 36.89  ? 668  LEU B CG   1 
ATOM   7372  C CD1  . LEU B 1 107 ? 9.272   7.394   -59.189 1.00 40.83  ? 668  LEU B CD1  1 
ATOM   7373  C CD2  . LEU B 1 107 ? 7.397   8.885   -58.482 1.00 36.34  ? 668  LEU B CD2  1 
ATOM   7374  H H    . LEU B 1 107 ? 6.744   5.712   -56.497 1.00 34.76  ? 668  LEU B H    1 
ATOM   7375  H HA   . LEU B 1 107 ? 5.265   7.183   -58.057 1.00 40.57  ? 668  LEU B HA   1 
ATOM   7376  H HB2  . LEU B 1 107 ? 7.461   5.558   -58.746 1.00 44.41  ? 668  LEU B HB2  1 
ATOM   7377  H HB3  . LEU B 1 107 ? 6.802   6.584   -59.751 1.00 44.41  ? 668  LEU B HB3  1 
ATOM   7378  H HG   . LEU B 1 107 ? 8.226   7.336   -57.439 1.00 44.26  ? 668  LEU B HG   1 
ATOM   7379  H HD11 . LEU B 1 107 ? 9.889   8.082   -58.892 1.00 49.00  ? 668  LEU B HD11 1 
ATOM   7380  H HD12 . LEU B 1 107 ? 9.666   6.517   -59.059 1.00 49.00  ? 668  LEU B HD12 1 
ATOM   7381  H HD13 . LEU B 1 107 ? 9.056   7.524   -60.125 1.00 49.00  ? 668  LEU B HD13 1 
ATOM   7382  H HD21 . LEU B 1 107 ? 8.055   9.534   -58.188 1.00 43.61  ? 668  LEU B HD21 1 
ATOM   7383  H HD22 . LEU B 1 107 ? 7.158   9.051   -59.407 1.00 43.61  ? 668  LEU B HD22 1 
ATOM   7384  H HD23 . LEU B 1 107 ? 6.608   8.936   -57.921 1.00 43.61  ? 668  LEU B HD23 1 
ATOM   7385  N N    . LEU B 1 108 ? 4.940   4.034   -58.551 1.00 33.73  ? 669  LEU B N    1 
ATOM   7386  C CA   . LEU B 1 108 ? 4.066   3.042   -59.167 1.00 31.43  ? 669  LEU B CA   1 
ATOM   7387  C C    . LEU B 1 108 ? 2.660   3.116   -58.589 1.00 29.41  ? 669  LEU B C    1 
ATOM   7388  O O    . LEU B 1 108 ? 1.672   3.012   -59.326 1.00 30.92  ? 669  LEU B O    1 
ATOM   7389  C CB   . LEU B 1 108 ? 4.655   1.646   -58.979 1.00 31.21  ? 669  LEU B CB   1 
ATOM   7390  C CG   . LEU B 1 108 ? 6.055   1.456   -59.567 1.00 35.54  ? 669  LEU B CG   1 
ATOM   7391  C CD1  . LEU B 1 108 ? 6.626   0.101   -59.181 1.00 36.52  ? 669  LEU B CD1  1 
ATOM   7392  C CD2  . LEU B 1 108 ? 6.033   1.617   -61.075 1.00 33.15  ? 669  LEU B CD2  1 
ATOM   7393  H H    . LEU B 1 108 ? 5.565   3.705   -58.060 1.00 40.48  ? 669  LEU B H    1 
ATOM   7394  H HA   . LEU B 1 108 ? 4.009   3.219   -60.119 1.00 37.72  ? 669  LEU B HA   1 
ATOM   7395  H HB2  . LEU B 1 108 ? 4.708   1.457   -58.029 1.00 37.45  ? 669  LEU B HB2  1 
ATOM   7396  H HB3  . LEU B 1 108 ? 4.068   1.002   -59.406 1.00 37.45  ? 669  LEU B HB3  1 
ATOM   7397  H HG   . LEU B 1 108 ? 6.641   2.139   -59.204 1.00 42.64  ? 669  LEU B HG   1 
ATOM   7398  H HD11 . LEU B 1 108 ? 7.511   0.011   -59.567 1.00 43.82  ? 669  LEU B HD11 1 
ATOM   7399  H HD12 . LEU B 1 108 ? 6.678   0.045   -58.214 1.00 43.82  ? 669  LEU B HD12 1 
ATOM   7400  H HD13 . LEU B 1 108 ? 6.043   -0.595  -59.522 1.00 43.82  ? 669  LEU B HD13 1 
ATOM   7401  H HD21 . LEU B 1 108 ? 6.932   1.492   -61.419 1.00 39.78  ? 669  LEU B HD21 1 
ATOM   7402  H HD22 . LEU B 1 108 ? 5.438   0.952   -61.455 1.00 39.78  ? 669  LEU B HD22 1 
ATOM   7403  H HD23 . LEU B 1 108 ? 5.716   2.508   -61.293 1.00 39.78  ? 669  LEU B HD23 1 
ATOM   7404  N N    . GLN B 1 109 ? 2.550   3.297   -57.272 1.00 28.60  ? 670  GLN B N    1 
ATOM   7405  C CA   . GLN B 1 109 ? 1.240   3.462   -56.652 1.00 30.25  ? 670  GLN B CA   1 
ATOM   7406  C C    . GLN B 1 109 ? 0.540   4.706   -57.183 1.00 28.66  ? 670  GLN B C    1 
ATOM   7407  O O    . GLN B 1 109 ? -0.672  4.691   -57.428 1.00 27.31  ? 670  GLN B O    1 
ATOM   7408  C CB   . GLN B 1 109 ? 1.397   3.541   -55.134 1.00 35.39  ? 670  GLN B CB   1 
ATOM   7409  C CG   . GLN B 1 109 ? 0.092   3.638   -54.367 1.00 40.54  ? 670  GLN B CG   1 
ATOM   7410  C CD   . GLN B 1 109 ? 0.318   3.865   -52.889 1.00 52.47  ? 670  GLN B CD   1 
ATOM   7411  O OE1  . GLN B 1 109 ? 1.317   4.461   -52.486 1.00 63.61  ? 670  GLN B OE1  1 
ATOM   7412  N NE2  . GLN B 1 109 ? -0.607  3.384   -52.069 1.00 61.90  ? 670  GLN B NE2  1 
ATOM   7413  H H    . GLN B 1 109 ? 3.211   3.328   -56.723 1.00 34.32  ? 670  GLN B H    1 
ATOM   7414  H HA   . GLN B 1 109 ? 0.689   2.692   -56.861 1.00 36.29  ? 670  GLN B HA   1 
ATOM   7415  H HB2  . GLN B 1 109 ? 1.858   2.745   -54.829 1.00 42.47  ? 670  GLN B HB2  1 
ATOM   7416  H HB3  . GLN B 1 109 ? 1.923   4.326   -54.918 1.00 42.47  ? 670  GLN B HB3  1 
ATOM   7417  H HG2  . GLN B 1 109 ? -0.425  4.383   -54.712 1.00 48.65  ? 670  GLN B HG2  1 
ATOM   7418  H HG3  . GLN B 1 109 ? -0.402  2.811   -54.474 1.00 48.65  ? 670  GLN B HG3  1 
ATOM   7419  H HE21 . GLN B 1 109 ? -1.290  2.969   -52.387 1.00 74.28  ? 670  GLN B HE21 1 
ATOM   7420  H HE22 . GLN B 1 109 ? -0.524  3.488   -51.219 1.00 74.28  ? 670  GLN B HE22 1 
ATOM   7421  N N    . GLN B 1 110 ? 1.290   5.794   -57.363 1.00 27.31  ? 671  GLN B N    1 
ATOM   7422  C CA   . GLN B 1 110 ? 0.711   7.020   -57.899 1.00 29.42  ? 671  GLN B CA   1 
ATOM   7423  C C    . GLN B 1 110 ? 0.283   6.841   -59.349 1.00 23.54  ? 671  GLN B C    1 
ATOM   7424  O O    . GLN B 1 110 ? -0.793  7.304   -59.745 1.00 22.10  ? 671  GLN B O    1 
ATOM   7425  C CB   . GLN B 1 110 ? 1.717   8.160   -57.775 1.00 29.58  ? 671  GLN B CB   1 
ATOM   7426  C CG   . GLN B 1 110 ? 1.892   8.671   -56.349 1.00 26.21  ? 671  GLN B CG   1 
ATOM   7427  C CD   . GLN B 1 110 ? 3.134   9.524   -56.174 1.00 31.77  ? 671  GLN B CD   1 
ATOM   7428  O OE1  . GLN B 1 110 ? 4.027   9.523   -57.020 1.00 33.67  ? 671  GLN B OE1  1 
ATOM   7429  N NE2  . GLN B 1 110 ? 3.196   10.257  -55.069 1.00 32.77  ? 671  GLN B NE2  1 
ATOM   7430  H H    . GLN B 1 110 ? 2.130   5.846   -57.183 1.00 32.77  ? 671  GLN B H    1 
ATOM   7431  H HA   . GLN B 1 110 ? -0.074  7.253   -57.380 1.00 35.31  ? 671  GLN B HA   1 
ATOM   7432  H HB2  . GLN B 1 110 ? 2.582   7.851   -58.087 1.00 35.50  ? 671  GLN B HB2  1 
ATOM   7433  H HB3  . GLN B 1 110 ? 1.417   8.903   -58.322 1.00 35.50  ? 671  GLN B HB3  1 
ATOM   7434  H HG2  . GLN B 1 110 ? 1.122   9.211   -56.111 1.00 31.45  ? 671  GLN B HG2  1 
ATOM   7435  H HG3  . GLN B 1 110 ? 1.963   7.913   -55.749 1.00 31.45  ? 671  GLN B HG3  1 
ATOM   7436  H HE21 . GLN B 1 110 ? 2.552   10.232  -54.499 1.00 39.32  ? 671  GLN B HE21 1 
ATOM   7437  H HE22 . GLN B 1 110 ? 3.880   10.758  -54.923 1.00 39.32  ? 671  GLN B HE22 1 
ATOM   7438  N N    . THR B 1 111 ? 1.116   6.181   -60.157 1.00 22.03  ? 672  THR B N    1 
ATOM   7439  C CA   . THR B 1 111 ? 0.737   5.898   -61.537 1.00 23.95  ? 672  THR B CA   1 
ATOM   7440  C C    . THR B 1 111 ? -0.531  5.057   -61.590 1.00 25.19  ? 672  THR B C    1 
ATOM   7441  O O    . THR B 1 111 ? -1.407  5.290   -62.431 1.00 24.20  ? 672  THR B O    1 
ATOM   7442  C CB   . THR B 1 111 ? 1.882   5.186   -62.261 1.00 19.78  ? 672  THR B CB   1 
ATOM   7443  O OG1  . THR B 1 111 ? 3.090   5.944   -62.112 1.00 24.11  ? 672  THR B OG1  1 
ATOM   7444  C CG2  . THR B 1 111 ? 1.567   5.015   -63.747 1.00 24.40  ? 672  THR B CG2  1 
ATOM   7445  H H    . THR B 1 111 ? 1.894   5.892   -59.933 1.00 26.44  ? 672  THR B H    1 
ATOM   7446  H HA   . THR B 1 111 ? 0.563   6.735   -61.997 1.00 28.74  ? 672  THR B HA   1 
ATOM   7447  H HB   . THR B 1 111 ? 2.007   4.306   -61.873 1.00 23.74  ? 672  THR B HB   1 
ATOM   7448  H HG1  . THR B 1 111 ? 3.284   6.020   -61.299 1.00 28.93  ? 672  THR B HG1  1 
ATOM   7449  H HG21 . THR B 1 111 ? 2.301   4.563   -64.192 1.00 29.28  ? 672  THR B HG21 1 
ATOM   7450  H HG22 . THR B 1 111 ? 0.760   4.488   -63.856 1.00 29.28  ? 672  THR B HG22 1 
ATOM   7451  H HG23 . THR B 1 111 ? 1.435   5.883   -64.160 1.00 29.28  ? 672  THR B HG23 1 
ATOM   7452  N N    . THR B 1 112 ? -0.653  4.084   -60.685 1.00 21.73  ? 673  THR B N    1 
ATOM   7453  C CA   . THR B 1 112 ? -1.815  3.203   -60.693 1.00 21.83  ? 673  THR B CA   1 
ATOM   7454  C C    . THR B 1 112 ? -3.065  3.941   -60.236 1.00 22.65  ? 673  THR B C    1 
ATOM   7455  O O    . THR B 1 112 ? -4.153  3.730   -60.786 1.00 23.32  ? 673  THR B O    1 
ATOM   7456  C CB   . THR B 1 112 ? -1.547  1.989   -59.802 1.00 28.19  ? 673  THR B CB   1 
ATOM   7457  O OG1  . THR B 1 112 ? -0.324  1.362   -60.207 1.00 21.08  ? 673  THR B OG1  1 
ATOM   7458  C CG2  . THR B 1 112 ? -2.688  0.981   -59.891 1.00 24.70  ? 673  THR B CG2  1 
ATOM   7459  H H    . THR B 1 112 ? -0.083  3.917   -60.064 1.00 26.08  ? 673  THR B H    1 
ATOM   7460  H HA   . THR B 1 112 ? -1.966  2.886   -61.597 1.00 26.19  ? 673  THR B HA   1 
ATOM   7461  H HB   . THR B 1 112 ? -1.468  2.279   -58.879 1.00 33.82  ? 673  THR B HB   1 
ATOM   7462  H HG1  . THR B 1 112 ? 0.314   1.904   -60.136 1.00 25.30  ? 673  THR B HG1  1 
ATOM   7463  H HG21 . THR B 1 112 ? -2.502  0.219   -59.321 1.00 29.64  ? 673  THR B HG21 1 
ATOM   7464  H HG22 . THR B 1 112 ? -3.518  1.394   -59.605 1.00 29.64  ? 673  THR B HG22 1 
ATOM   7465  H HG23 . THR B 1 112 ? -2.787  0.674   -60.806 1.00 29.64  ? 673  THR B HG23 1 
ATOM   7466  N N    . SER B 1 113 ? -2.931  4.813   -59.234 1.00 23.34  ? 674  SER B N    1 
ATOM   7467  C CA   . SER B 1 113 ? -4.079  5.583   -58.770 1.00 27.64  ? 674  SER B CA   1 
ATOM   7468  C C    . SER B 1 113 ? -4.598  6.502   -59.868 1.00 23.61  ? 674  SER B C    1 
ATOM   7469  O O    . SER B 1 113 ? -5.813  6.641   -60.051 1.00 26.75  ? 674  SER B O    1 
ATOM   7470  C CB   . SER B 1 113 ? -3.698  6.387   -57.528 1.00 24.26  ? 674  SER B CB   1 
ATOM   7471  O OG   . SER B 1 113 ? -4.807  7.121   -57.043 1.00 47.95  ? 674  SER B OG   1 
ATOM   7472  H H    . SER B 1 113 ? -2.198  4.972   -58.814 1.00 28.01  ? 674  SER B H    1 
ATOM   7473  H HA   . SER B 1 113 ? -4.792  4.973   -58.526 1.00 33.17  ? 674  SER B HA   1 
ATOM   7474  H HB2  . SER B 1 113 ? -3.398  5.776   -56.837 1.00 29.11  ? 674  SER B HB2  1 
ATOM   7475  H HB3  . SER B 1 113 ? -2.987  7.004   -57.757 1.00 29.11  ? 674  SER B HB3  1 
ATOM   7476  H HG   . SER B 1 113 ? -4.585  7.558   -56.361 1.00 57.54  ? 674  SER B HG   1 
ATOM   7477  N N    . GLY B 1 114 ? -3.691  7.134   -60.613 1.00 22.99  ? 675  GLY B N    1 
ATOM   7478  C CA   . GLY B 1 114 ? -4.114  7.942   -61.744 1.00 28.31  ? 675  GLY B CA   1 
ATOM   7479  C C    . GLY B 1 114 ? -4.733  7.106   -62.848 1.00 26.66  ? 675  GLY B C    1 
ATOM   7480  O O    . GLY B 1 114 ? -5.693  7.531   -63.497 1.00 25.52  ? 675  GLY B O    1 
ATOM   7481  H H    . GLY B 1 114 ? -2.841  7.110   -60.485 1.00 27.59  ? 675  GLY B H    1 
ATOM   7482  H HA2  . GLY B 1 114 ? -4.768  8.595   -61.449 1.00 33.97  ? 675  GLY B HA2  1 
ATOM   7483  H HA3  . GLY B 1 114 ? -3.349  8.415   -62.108 1.00 33.97  ? 675  GLY B HA3  1 
ATOM   7484  N N    . LEU B 1 115 ? -4.194  5.906   -63.076 1.00 22.90  ? 676  LEU B N    1 
ATOM   7485  C CA   . LEU B 1 115 ? -4.789  5.008   -64.060 1.00 22.47  ? 676  LEU B CA   1 
ATOM   7486  C C    . LEU B 1 115 ? -6.162  4.533   -63.604 1.00 25.75  ? 676  LEU B C    1 
ATOM   7487  O O    . LEU B 1 115 ? -7.096  4.446   -64.411 1.00 26.72  ? 676  LEU B O    1 
ATOM   7488  C CB   . LEU B 1 115 ? -3.866  3.817   -64.313 1.00 24.55  ? 676  LEU B CB   1 
ATOM   7489  C CG   . LEU B 1 115 ? -4.305  2.869   -65.434 1.00 29.18  ? 676  LEU B CG   1 
ATOM   7490  C CD1  . LEU B 1 115 ? -4.276  3.574   -66.788 1.00 25.97  ? 676  LEU B CD1  1 
ATOM   7491  C CD2  . LEU B 1 115 ? -3.435  1.623   -65.454 1.00 29.87  ? 676  LEU B CD2  1 
ATOM   7492  H H    . LEU B 1 115 ? -3.497  5.594   -62.681 1.00 27.48  ? 676  LEU B H    1 
ATOM   7493  H HA   . LEU B 1 115 ? -4.900  5.485   -64.897 1.00 26.96  ? 676  LEU B HA   1 
ATOM   7494  H HB2  . LEU B 1 115 ? -2.986  4.154   -64.546 1.00 29.46  ? 676  LEU B HB2  1 
ATOM   7495  H HB3  . LEU B 1 115 ? -3.807  3.295   -63.497 1.00 29.46  ? 676  LEU B HB3  1 
ATOM   7496  H HG   . LEU B 1 115 ? -5.219  2.590   -65.266 1.00 35.01  ? 676  LEU B HG   1 
ATOM   7497  H HD11 . LEU B 1 115 ? -4.558  2.950   -67.474 1.00 31.17  ? 676  LEU B HD11 1 
ATOM   7498  H HD12 . LEU B 1 115 ? -4.879  4.333   -66.762 1.00 31.17  ? 676  LEU B HD12 1 
ATOM   7499  H HD13 . LEU B 1 115 ? -3.371  3.875   -66.966 1.00 31.17  ? 676  LEU B HD13 1 
ATOM   7500  H HD21 . LEU B 1 115 ? -3.734  1.041   -66.170 1.00 35.84  ? 676  LEU B HD21 1 
ATOM   7501  H HD22 . LEU B 1 115 ? -2.513  1.884   -65.602 1.00 35.84  ? 676  LEU B HD22 1 
ATOM   7502  H HD23 . LEU B 1 115 ? -3.518  1.167   -64.601 1.00 35.84  ? 676  LEU B HD23 1 
ATOM   7503  N N    . ALA B 1 116 ? -6.304  4.217   -62.313 1.00 24.06  ? 677  ALA B N    1 
ATOM   7504  C CA   . ALA B 1 116 ? -7.608  3.837   -61.784 1.00 24.97  ? 677  ALA B CA   1 
ATOM   7505  C C    . ALA B 1 116 ? -8.604  4.981   -61.905 1.00 23.71  ? 677  ALA B C    1 
ATOM   7506  O O    . ALA B 1 116 ? -9.801  4.748   -62.114 1.00 26.01  ? 677  ALA B O    1 
ATOM   7507  C CB   . ALA B 1 116 ? -7.479  3.398   -60.327 1.00 20.47  ? 677  ALA B CB   1 
ATOM   7508  H H    . ALA B 1 116 ? -5.668  4.216   -61.734 1.00 28.87  ? 677  ALA B H    1 
ATOM   7509  H HA   . ALA B 1 116 ? -7.950  3.087   -62.295 1.00 29.96  ? 677  ALA B HA   1 
ATOM   7510  H HB1  . ALA B 1 116 ? -8.355  3.149   -59.993 1.00 24.57  ? 677  ALA B HB1  1 
ATOM   7511  H HB2  . ALA B 1 116 ? -6.879  2.637   -60.279 1.00 24.57  ? 677  ALA B HB2  1 
ATOM   7512  H HB3  . ALA B 1 116 ? -7.123  4.134   -59.806 1.00 24.57  ? 677  ALA B HB3  1 
ATOM   7513  N N    . HIS B 1 117 ? -8.132  6.222   -61.773 1.00 27.27  ? 678  HIS B N    1 
ATOM   7514  C CA   . HIS B 1 117 ? -9.003  7.371   -61.993 1.00 25.90  ? 678  HIS B CA   1 
ATOM   7515  C C    . HIS B 1 117 ? -9.495  7.412   -63.434 1.00 22.91  ? 678  HIS B C    1 
ATOM   7516  O O    . HIS B 1 117 ? -10.679 7.665   -63.686 1.00 23.52  ? 678  HIS B O    1 
ATOM   7517  C CB   . HIS B 1 117 ? -8.266  8.662   -61.637 1.00 23.31  ? 678  HIS B CB   1 
ATOM   7518  C CG   . HIS B 1 117 ? -9.096  9.897   -61.796 1.00 23.13  ? 678  HIS B CG   1 
ATOM   7519  N ND1  . HIS B 1 117 ? -9.991  10.319  -60.837 1.00 30.69  ? 678  HIS B ND1  1 
ATOM   7520  C CD2  . HIS B 1 117 ? -9.163  10.806  -62.798 1.00 29.41  ? 678  HIS B CD2  1 
ATOM   7521  C CE1  . HIS B 1 117 ? -10.574 11.433  -61.241 1.00 30.00  ? 678  HIS B CE1  1 
ATOM   7522  N NE2  . HIS B 1 117 ? -10.090 11.750  -62.427 1.00 30.43  ? 678  HIS B NE2  1 
ATOM   7523  H H    . HIS B 1 117 ? -7.322  6.421   -61.561 1.00 32.73  ? 678  HIS B H    1 
ATOM   7524  H HA   . HIS B 1 117 ? -9.777  7.297   -61.412 1.00 31.08  ? 678  HIS B HA   1 
ATOM   7525  H HB2  . HIS B 1 117 ? -7.981  8.613   -60.711 1.00 27.98  ? 678  HIS B HB2  1 
ATOM   7526  H HB3  . HIS B 1 117 ? -7.492  8.748   -62.215 1.00 27.98  ? 678  HIS B HB3  1 
ATOM   7527  H HD2  . HIS B 1 117 ? -8.673  10.794  -63.588 1.00 35.29  ? 678  HIS B HD2  1 
ATOM   7528  H HE1  . HIS B 1 117 ? -11.218 11.912  -60.770 1.00 36.00  ? 678  HIS B HE1  1 
ATOM   7529  H HE2  . HIS B 1 117 ? -10.319 12.436  -62.893 1.00 36.52  ? 678  HIS B HE2  1 
ATOM   7530  N N    . LEU B 1 118 ? -8.602  7.160   -64.394 1.00 20.21  ? 679  LEU B N    1 
ATOM   7531  C CA   . LEU B 1 118 ? -9.013  7.114   -65.795 1.00 26.67  ? 679  LEU B CA   1 
ATOM   7532  C C    . LEU B 1 118 ? -10.049 6.021   -66.026 1.00 27.26  ? 679  LEU B C    1 
ATOM   7533  O O    . LEU B 1 118 ? -11.091 6.260   -66.647 1.00 27.44  ? 679  LEU B O    1 
ATOM   7534  C CB   . LEU B 1 118 ? -7.797  6.890   -66.699 1.00 26.48  ? 679  LEU B CB   1 
ATOM   7535  C CG   . LEU B 1 118 ? -6.720  7.977   -66.800 1.00 27.48  ? 679  LEU B CG   1 
ATOM   7536  C CD1  . LEU B 1 118 ? -5.902  7.783   -68.076 1.00 33.28  ? 679  LEU B CD1  1 
ATOM   7537  C CD2  . LEU B 1 118 ? -7.311  9.376   -66.757 1.00 35.11  ? 679  LEU B CD2  1 
ATOM   7538  H H    . LEU B 1 118 ? -7.765  7.014   -64.261 1.00 24.25  ? 679  LEU B H    1 
ATOM   7539  H HA   . LEU B 1 118 ? -9.414  7.964   -66.035 1.00 32.00  ? 679  LEU B HA   1 
ATOM   7540  H HB2  . LEU B 1 118 ? -7.350  6.085   -66.395 1.00 31.78  ? 679  LEU B HB2  1 
ATOM   7541  H HB3  . LEU B 1 118 ? -8.126  6.743   -67.600 1.00 31.78  ? 679  LEU B HB3  1 
ATOM   7542  H HG   . LEU B 1 118 ? -6.116  7.888   -66.046 1.00 32.98  ? 679  LEU B HG   1 
ATOM   7543  H HD11 . LEU B 1 118 ? -5.226  8.476   -68.125 1.00 39.94  ? 679  LEU B HD11 1 
ATOM   7544  H HD12 . LEU B 1 118 ? -5.481  6.910   -68.050 1.00 39.94  ? 679  LEU B HD12 1 
ATOM   7545  H HD13 . LEU B 1 118 ? -6.495  7.842   -68.841 1.00 39.94  ? 679  LEU B HD13 1 
ATOM   7546  H HD21 . LEU B 1 118 ? -6.592  10.024  -66.824 1.00 42.13  ? 679  LEU B HD21 1 
ATOM   7547  H HD22 . LEU B 1 118 ? -7.923  9.482   -67.502 1.00 42.13  ? 679  LEU B HD22 1 
ATOM   7548  H HD23 . LEU B 1 118 ? -7.785  9.492   -65.919 1.00 42.13  ? 679  LEU B HD23 1 
ATOM   7549  N N    . HIS B 1 119 ? -9.780  4.809   -65.529 1.00 23.69  ? 680  HIS B N    1 
ATOM   7550  C CA   . HIS B 1 119 ? -10.697 3.697   -65.760 1.00 26.50  ? 680  HIS B CA   1 
ATOM   7551  C C    . HIS B 1 119 ? -12.061 3.950   -65.130 1.00 26.78  ? 680  HIS B C    1 
ATOM   7552  O O    . HIS B 1 119 ? -13.083 3.516   -65.674 1.00 30.82  ? 680  HIS B O    1 
ATOM   7553  C CB   . HIS B 1 119 ? -10.097 2.397   -65.223 1.00 28.80  ? 680  HIS B CB   1 
ATOM   7554  C CG   . HIS B 1 119 ? -8.895  1.926   -65.982 1.00 27.38  ? 680  HIS B CG   1 
ATOM   7555  N ND1  . HIS B 1 119 ? -8.217  0.771   -65.657 1.00 31.68  ? 680  HIS B ND1  1 
ATOM   7556  C CD2  . HIS B 1 119 ? -8.253  2.450   -67.053 1.00 29.71  ? 680  HIS B CD2  1 
ATOM   7557  C CE1  . HIS B 1 119 ? -7.208  0.604   -66.494 1.00 29.59  ? 680  HIS B CE1  1 
ATOM   7558  N NE2  . HIS B 1 119 ? -7.208  1.609   -67.351 1.00 33.73  ? 680  HIS B NE2  1 
ATOM   7559  H H    . HIS B 1 119 ? -9.085  4.610   -65.063 1.00 28.43  ? 680  HIS B H    1 
ATOM   7560  H HA   . HIS B 1 119 ? -10.826 3.592   -66.716 1.00 31.80  ? 680  HIS B HA   1 
ATOM   7561  H HB2  . HIS B 1 119 ? -9.830  2.534   -64.300 1.00 34.56  ? 680  HIS B HB2  1 
ATOM   7562  H HB3  . HIS B 1 119 ? -10.769 1.700   -65.270 1.00 34.56  ? 680  HIS B HB3  1 
ATOM   7563  H HD2  . HIS B 1 119 ? -8.477  3.232   -67.502 1.00 35.65  ? 680  HIS B HD2  1 
ATOM   7564  H HE1  . HIS B 1 119 ? -6.601  -0.100  -66.481 1.00 35.51  ? 680  HIS B HE1  1 
ATOM   7565  H HE2  . HIS B 1 119 ? -6.644  1.720   -67.991 1.00 40.47  ? 680  HIS B HE2  1 
ATOM   7566  N N    . SER B 1 120 ? -12.105 4.649   -63.993 1.00 24.56  ? 681  SER B N    1 
ATOM   7567  C CA   . SER B 1 120 ? -13.384 4.963   -63.369 1.00 30.07  ? 681  SER B CA   1 
ATOM   7568  C C    . SER B 1 120 ? -14.215 5.917   -64.217 1.00 31.02  ? 681  SER B C    1 
ATOM   7569  O O    . SER B 1 120 ? -15.441 5.959   -64.063 1.00 33.58  ? 681  SER B O    1 
ATOM   7570  C CB   . SER B 1 120 ? -13.160 5.562   -61.980 1.00 30.57  ? 681  SER B CB   1 
ATOM   7571  O OG   . SER B 1 120 ? -12.476 6.797   -62.068 1.00 32.54  ? 681  SER B OG   1 
ATOM   7572  H H    . SER B 1 120 ? -11.417 4.948   -63.572 1.00 29.47  ? 681  SER B H    1 
ATOM   7573  H HA   . SER B 1 120 ? -13.890 4.142   -63.261 1.00 36.09  ? 681  SER B HA   1 
ATOM   7574  H HB2  . SER B 1 120 ? -14.020 5.707   -61.556 1.00 36.68  ? 681  SER B HB2  1 
ATOM   7575  H HB3  . SER B 1 120 ? -12.629 4.945   -61.452 1.00 36.68  ? 681  SER B HB3  1 
ATOM   7576  H HG   . SER B 1 120 ? -11.729 6.687   -62.435 1.00 39.05  ? 681  SER B HG   1 
ATOM   7577  N N    . LEU B 1 121 ? -13.574 6.678   -65.100 1.00 27.97  ? 682  LEU B N    1 
ATOM   7578  C CA   . LEU B 1 121 ? -14.249 7.561   -66.041 1.00 32.00  ? 682  LEU B CA   1 
ATOM   7579  C C    . LEU B 1 121 ? -14.523 6.881   -67.378 1.00 39.70  ? 682  LEU B C    1 
ATOM   7580  O O    . LEU B 1 121 ? -14.929 7.555   -68.331 1.00 37.76  ? 682  LEU B O    1 
ATOM   7581  C CB   . LEU B 1 121 ? -13.418 8.829   -66.253 1.00 33.36  ? 682  LEU B CB   1 
ATOM   7582  C CG   . LEU B 1 121 ? -13.089 9.599   -64.969 1.00 37.43  ? 682  LEU B CG   1 
ATOM   7583  C CD1  . LEU B 1 121 ? -12.208 10.802  -65.264 1.00 38.15  ? 682  LEU B CD1  1 
ATOM   7584  C CD2  . LEU B 1 121 ? -14.352 10.031  -64.234 1.00 35.50  ? 682  LEU B CD2  1 
ATOM   7585  H H    . LEU B 1 121 ? -12.718 6.699   -65.173 1.00 33.56  ? 682  LEU B H    1 
ATOM   7586  H HA   . LEU B 1 121 ? -15.102 7.825   -65.664 1.00 38.40  ? 682  LEU B HA   1 
ATOM   7587  H HB2  . LEU B 1 121 ? -12.579 8.584   -66.672 1.00 40.03  ? 682  LEU B HB2  1 
ATOM   7588  H HB3  . LEU B 1 121 ? -13.911 9.428   -66.836 1.00 40.03  ? 682  LEU B HB3  1 
ATOM   7589  H HG   . LEU B 1 121 ? -12.593 9.013   -64.377 1.00 44.91  ? 682  LEU B HG   1 
ATOM   7590  H HD11 . LEU B 1 121 ? -12.019 11.266  -64.432 1.00 45.78  ? 682  LEU B HD11 1 
ATOM   7591  H HD12 . LEU B 1 121 ? -11.381 10.497  -65.668 1.00 45.78  ? 682  LEU B HD12 1 
ATOM   7592  H HD13 . LEU B 1 121 ? -12.676 11.394  -65.873 1.00 45.78  ? 682  LEU B HD13 1 
ATOM   7593  H HD21 . LEU B 1 121 ? -14.101 10.513  -63.431 1.00 42.60  ? 682  LEU B HD21 1 
ATOM   7594  H HD22 . LEU B 1 121 ? -14.875 10.605  -64.815 1.00 42.60  ? 682  LEU B HD22 1 
ATOM   7595  H HD23 . LEU B 1 121 ? -14.866 9.242   -64.000 1.00 42.60  ? 682  LEU B HD23 1 
ATOM   7596  N N    . ASN B 1 122 ? -14.279 5.571   -67.469 1.00 36.35  ? 683  ASN B N    1 
ATOM   7597  C CA   . ASN B 1 122 ? -14.443 4.795   -68.697 1.00 37.73  ? 683  ASN B CA   1 
ATOM   7598  C C    . ASN B 1 122 ? -13.445 5.212   -69.771 1.00 36.05  ? 683  ASN B C    1 
ATOM   7599  O O    . ASN B 1 122 ? -13.750 5.155   -70.965 1.00 35.91  ? 683  ASN B O    1 
ATOM   7600  C CB   . ASN B 1 122 ? -15.876 4.885   -69.239 1.00 46.98  ? 683  ASN B CB   1 
ATOM   7601  C CG   . ASN B 1 122 ? -16.907 4.369   -68.254 1.00 43.12  ? 683  ASN B CG   1 
ATOM   7602  O OD1  . ASN B 1 122 ? -16.635 4.247   -67.061 1.00 49.83  ? 683  ASN B OD1  1 
ATOM   7603  N ND2  . ASN B 1 122 ? -18.098 4.057   -68.753 1.00 57.34  ? 683  ASN B ND2  1 
ATOM   7604  H H    . ASN B 1 122 ? -14.007 5.096   -66.806 1.00 43.62  ? 683  ASN B H    1 
ATOM   7605  H HA   . ASN B 1 122 ? -14.272 3.863   -68.491 1.00 45.28  ? 683  ASN B HA   1 
ATOM   7606  H HB2  . ASN B 1 122 ? -16.083 5.812   -69.433 1.00 56.37  ? 683  ASN B HB2  1 
ATOM   7607  H HB3  . ASN B 1 122 ? -15.941 4.354   -70.048 1.00 56.37  ? 683  ASN B HB3  1 
ATOM   7608  H HD21 . ASN B 1 122 ? -18.717 3.760   -68.235 1.00 68.81  ? 683  ASN B HD21 1 
ATOM   7609  H HD22 . ASN B 1 122 ? -18.250 4.153   -69.594 1.00 68.81  ? 683  ASN B HD22 1 
ATOM   7610  N N    . ILE B 1 123 ? -12.245 5.614   -69.358 1.00 33.48  ? 684  ILE B N    1 
ATOM   7611  C CA   . ILE B 1 123 ? -11.186 6.035   -70.268 1.00 34.86  ? 684  ILE B CA   1 
ATOM   7612  C C    . ILE B 1 123 ? -10.071 4.999   -70.207 1.00 33.82  ? 684  ILE B C    1 
ATOM   7613  O O    . ILE B 1 123 ? -9.552  4.696   -69.125 1.00 27.27  ? 684  ILE B O    1 
ATOM   7614  C CB   . ILE B 1 123 ? -10.657 7.435   -69.915 1.00 31.16  ? 684  ILE B CB   1 
ATOM   7615  C CG1  . ILE B 1 123 ? -11.799 8.458   -69.966 1.00 37.51  ? 684  ILE B CG1  1 
ATOM   7616  C CG2  . ILE B 1 123 ? -9.535  7.830   -70.871 1.00 30.94  ? 684  ILE B CG2  1 
ATOM   7617  C CD1  . ILE B 1 123 ? -11.404 9.856   -69.545 1.00 38.75  ? 684  ILE B CD1  1 
ATOM   7618  H H    . ILE B 1 123 ? -12.016 5.651   -68.530 1.00 40.18  ? 684  ILE B H    1 
ATOM   7619  H HA   . ILE B 1 123 ? -11.531 6.060   -71.174 1.00 41.83  ? 684  ILE B HA   1 
ATOM   7620  H HB   . ILE B 1 123 ? -10.302 7.413   -69.012 1.00 37.39  ? 684  ILE B HB   1 
ATOM   7621  H HG12 . ILE B 1 123 ? -12.131 8.507   -70.876 1.00 45.02  ? 684  ILE B HG12 1 
ATOM   7622  H HG13 . ILE B 1 123 ? -12.508 8.162   -69.374 1.00 45.02  ? 684  ILE B HG13 1 
ATOM   7623  H HG21 . ILE B 1 123 ? -9.215  8.714   -70.633 1.00 37.13  ? 684  ILE B HG21 1 
ATOM   7624  H HG22 . ILE B 1 123 ? -8.814  7.185   -70.796 1.00 37.13  ? 684  ILE B HG22 1 
ATOM   7625  H HG23 . ILE B 1 123 ? -9.881  7.836   -71.778 1.00 37.13  ? 684  ILE B HG23 1 
ATOM   7626  H HD11 . ILE B 1 123 ? -12.180 10.435  -69.607 1.00 46.50  ? 684  ILE B HD11 1 
ATOM   7627  H HD12 . ILE B 1 123 ? -11.081 9.831   -68.631 1.00 46.50  ? 684  ILE B HD12 1 
ATOM   7628  H HD13 . ILE B 1 123 ? -10.704 10.177  -70.135 1.00 46.50  ? 684  ILE B HD13 1 
ATOM   7629  N N    . VAL B 1 124 ? -9.711  4.451   -71.366 1.00 27.83  ? 685  VAL B N    1 
ATOM   7630  C CA   . VAL B 1 124 ? -8.574  3.545   -71.505 1.00 27.74  ? 685  VAL B CA   1 
ATOM   7631  C C    . VAL B 1 124 ? -7.418  4.325   -72.117 1.00 27.02  ? 685  VAL B C    1 
ATOM   7632  O O    . VAL B 1 124 ? -7.576  4.956   -73.169 1.00 34.69  ? 685  VAL B O    1 
ATOM   7633  C CB   . VAL B 1 124 ? -8.932  2.328   -72.376 1.00 39.72  ? 685  VAL B CB   1 
ATOM   7634  C CG1  . VAL B 1 124 ? -7.831  1.279   -72.302 1.00 31.49  ? 685  VAL B CG1  1 
ATOM   7635  C CG2  . VAL B 1 124 ? -10.259 1.722   -71.940 1.00 40.60  ? 685  VAL B CG2  1 
ATOM   7636  H H    . VAL B 1 124 ? -10.124 4.593   -72.107 1.00 33.39  ? 685  VAL B H    1 
ATOM   7637  H HA   . VAL B 1 124 ? -8.303  3.228   -70.629 1.00 33.28  ? 685  VAL B HA   1 
ATOM   7638  H HB   . VAL B 1 124 ? -9.018  2.611   -73.300 1.00 47.66  ? 685  VAL B HB   1 
ATOM   7639  H HG11 . VAL B 1 124 ? -8.077  0.523   -72.857 1.00 37.78  ? 685  VAL B HG11 1 
ATOM   7640  H HG12 . VAL B 1 124 ? -7.002  1.669   -72.622 1.00 37.78  ? 685  VAL B HG12 1 
ATOM   7641  H HG13 . VAL B 1 124 ? -7.728  0.994   -71.380 1.00 37.78  ? 685  VAL B HG13 1 
ATOM   7642  H HG21 . VAL B 1 124 ? -10.458 0.959   -72.504 1.00 48.73  ? 685  VAL B HG21 1 
ATOM   7643  H HG22 . VAL B 1 124 ? -10.187 1.440   -71.014 1.00 48.73  ? 685  VAL B HG22 1 
ATOM   7644  H HG23 . VAL B 1 124 ? -10.955 2.391   -72.028 1.00 48.73  ? 685  VAL B HG23 1 
ATOM   7645  N N    . HIS B 1 125 ? -6.252  4.274   -71.468 1.00 23.84  ? 686  HIS B N    1 
ATOM   7646  C CA   . HIS B 1 125 ? -5.108  5.049   -71.944 1.00 32.24  ? 686  HIS B CA   1 
ATOM   7647  C C    . HIS B 1 125 ? -4.555  4.470   -73.243 1.00 29.55  ? 686  HIS B C    1 
ATOM   7648  O O    . HIS B 1 125 ? -4.221  5.213   -74.172 1.00 24.73  ? 686  HIS B O    1 
ATOM   7649  C CB   . HIS B 1 125 ? -4.024  5.098   -70.865 1.00 33.39  ? 686  HIS B CB   1 
ATOM   7650  C CG   . HIS B 1 125 ? -3.053  6.224   -71.039 1.00 36.01  ? 686  HIS B CG   1 
ATOM   7651  N ND1  . HIS B 1 125 ? -1.821  6.060   -71.633 1.00 35.61  ? 686  HIS B ND1  1 
ATOM   7652  C CD2  . HIS B 1 125 ? -3.135  7.532   -70.698 1.00 42.52  ? 686  HIS B CD2  1 
ATOM   7653  C CE1  . HIS B 1 125 ? -1.185  7.218   -71.649 1.00 40.80  ? 686  HIS B CE1  1 
ATOM   7654  N NE2  . HIS B 1 125 ? -1.960  8.127   -71.089 1.00 61.28  ? 686  HIS B NE2  1 
ATOM   7655  H H    . HIS B 1 125 ? -6.101  3.807   -70.762 1.00 28.61  ? 686  HIS B H    1 
ATOM   7656  H HA   . HIS B 1 125 ? -5.395  5.958   -72.120 1.00 38.68  ? 686  HIS B HA   1 
ATOM   7657  H HB2  . HIS B 1 125 ? -4.448  5.203   -69.999 1.00 40.07  ? 686  HIS B HB2  1 
ATOM   7658  H HB3  . HIS B 1 125 ? -3.523  4.267   -70.887 1.00 40.07  ? 686  HIS B HB3  1 
ATOM   7659  H HD1  . HIS B 1 125 ? -1.513  5.319   -71.944 1.00 42.73  ? 686  HIS B HD1  1 
ATOM   7660  H HD2  . HIS B 1 125 ? -3.852  7.949   -70.278 1.00 51.02  ? 686  HIS B HD2  1 
ATOM   7661  H HE1  . HIS B 1 125 ? -0.336  7.368   -71.997 1.00 48.96  ? 686  HIS B HE1  1 
ATOM   7662  H HE2  . HIS B 1 125 ? -1.762  8.958   -70.985 1.00 73.53  ? 686  HIS B HE2  1 
ATOM   7663  N N    . ARG B 1 126 ? -4.413  3.145   -73.301 1.00 32.83  ? 687  ARG B N    1 
ATOM   7664  C CA   . ARG B 1 126 ? -4.098  2.383   -74.508 1.00 30.31  ? 687  ARG B CA   1 
ATOM   7665  C C    . ARG B 1 126 ? -2.642  2.515   -74.945 1.00 32.33  ? 687  ARG B C    1 
ATOM   7666  O O    . ARG B 1 126 ? -2.172  1.701   -75.745 1.00 39.50  ? 687  ARG B O    1 
ATOM   7667  C CB   . ARG B 1 126 ? -5.027  2.769   -75.670 1.00 33.65  ? 687  ARG B CB   1 
ATOM   7668  C CG   . ARG B 1 126 ? -6.254  1.884   -75.762 1.00 38.48  ? 687  ARG B CG   1 
ATOM   7669  C CD   . ARG B 1 126 ? -7.381  2.528   -76.547 1.00 45.78  ? 687  ARG B CD   1 
ATOM   7670  N NE   . ARG B 1 126 ? -6.935  3.176   -77.780 1.00 47.35  ? 687  ARG B NE   1 
ATOM   7671  C CZ   . ARG B 1 126 ? -7.713  3.376   -78.841 1.00 51.42  ? 687  ARG B CZ   1 
ATOM   7672  N NH1  . ARG B 1 126 ? -8.972  2.965   -78.832 1.00 50.77  ? 687  ARG B NH1  1 
ATOM   7673  N NH2  . ARG B 1 126 ? -7.231  3.978   -79.918 1.00 54.39  ? 687  ARG B NH2  1 
ATOM   7674  H H    . ARG B 1 126 ? -4.501  2.639   -72.610 1.00 39.39  ? 687  ARG B H    1 
ATOM   7675  H HA   . ARG B 1 126 ? -4.253  1.444   -74.319 1.00 36.37  ? 687  ARG B HA   1 
ATOM   7676  H HB2  . ARG B 1 126 ? -5.326  3.683   -75.544 1.00 40.38  ? 687  ARG B HB2  1 
ATOM   7677  H HB3  . ARG B 1 126 ? -4.538  2.691   -76.504 1.00 40.38  ? 687  ARG B HB3  1 
ATOM   7678  H HG2  . ARG B 1 126 ? -6.013  1.056   -76.207 1.00 46.17  ? 687  ARG B HG2  1 
ATOM   7679  H HG3  . ARG B 1 126 ? -6.578  1.698   -74.867 1.00 46.17  ? 687  ARG B HG3  1 
ATOM   7680  H HD2  . ARG B 1 126 ? -8.027  1.845   -76.786 1.00 54.94  ? 687  ARG B HD2  1 
ATOM   7681  H HD3  . ARG B 1 126 ? -7.804  3.202   -75.992 1.00 54.94  ? 687  ARG B HD3  1 
ATOM   7682  H HE   . ARG B 1 126 ? -6.133  3.484   -77.805 1.00 56.82  ? 687  ARG B HE   1 
ATOM   7683  H HH11 . ARG B 1 126 ? -9.293  2.575   -78.136 1.00 60.93  ? 687  ARG B HH11 1 
ATOM   7684  H HH12 . ARG B 1 126 ? -9.471  3.094   -79.521 1.00 60.93  ? 687  ARG B HH12 1 
ATOM   7685  H HH21 . ARG B 1 126 ? -6.413  4.244   -79.933 1.00 65.27  ? 687  ARG B HH21 1 
ATOM   7686  H HH22 . ARG B 1 126 ? -7.735  4.101   -80.604 1.00 65.27  ? 687  ARG B HH22 1 
ATOM   7687  N N    . ASP B 1 127 ? -1.911  3.512   -74.445 1.00 34.77  ? 688  ASP B N    1 
ATOM   7688  C CA   . ASP B 1 127 ? -0.462  3.564   -74.630 1.00 39.03  ? 688  ASP B CA   1 
ATOM   7689  C C    . ASP B 1 127 ? 0.165   3.946   -73.298 1.00 34.29  ? 688  ASP B C    1 
ATOM   7690  O O    . ASP B 1 127 ? 0.040   5.093   -72.870 1.00 45.88  ? 688  ASP B O    1 
ATOM   7691  C CB   . ASP B 1 127 ? -0.086  4.565   -75.723 1.00 45.00  ? 688  ASP B CB   1 
ATOM   7692  C CG   . ASP B 1 127 ? 1.412   4.671   -75.934 1.00 45.87  ? 688  ASP B CG   1 
ATOM   7693  O OD1  . ASP B 1 127 ? 2.116   3.657   -75.756 1.00 53.59  ? 688  ASP B OD1  1 
ATOM   7694  O OD2  . ASP B 1 127 ? 1.884   5.774   -76.287 1.00 46.64  ? 688  ASP B OD2  1 
ATOM   7695  H H    . ASP B 1 127 ? -2.231  4.171   -73.995 1.00 41.73  ? 688  ASP B H    1 
ATOM   7696  H HA   . ASP B 1 127 ? -0.134  2.688   -74.887 1.00 46.83  ? 688  ASP B HA   1 
ATOM   7697  H HB2  . ASP B 1 127 ? -0.488  4.284   -76.560 1.00 54.00  ? 688  ASP B HB2  1 
ATOM   7698  H HB3  . ASP B 1 127 ? -0.417  5.442   -75.475 1.00 54.00  ? 688  ASP B HB3  1 
ATOM   7699  N N    . LEU B 1 128 ? 0.886   3.020   -72.674 1.00 45.03  ? 689  LEU B N    1 
ATOM   7700  C CA   . LEU B 1 128 ? 1.432   3.253   -71.345 1.00 36.38  ? 689  LEU B CA   1 
ATOM   7701  C C    . LEU B 1 128 ? 2.852   2.718   -71.300 1.00 34.17  ? 689  LEU B C    1 
ATOM   7702  O O    . LEU B 1 128 ? 3.125   1.618   -71.789 1.00 33.67  ? 689  LEU B O    1 
ATOM   7703  C CB   . LEU B 1 128 ? 0.560   2.592   -70.265 1.00 36.30  ? 689  LEU B CB   1 
ATOM   7704  C CG   . LEU B 1 128 ? 0.805   2.967   -68.800 1.00 37.77  ? 689  LEU B CG   1 
ATOM   7705  C CD1  . LEU B 1 128 ? 0.624   4.457   -68.561 1.00 36.86  ? 689  LEU B CD1  1 
ATOM   7706  C CD2  . LEU B 1 128 ? -0.136  2.176   -67.902 1.00 36.10  ? 689  LEU B CD2  1 
ATOM   7707  H H    . LEU B 1 128 ? 1.073   2.247   -73.001 1.00 54.03  ? 689  LEU B H    1 
ATOM   7708  H HA   . LEU B 1 128 ? 1.460   4.207   -71.172 1.00 43.66  ? 689  LEU B HA   1 
ATOM   7709  H HB2  . LEU B 1 128 ? -0.365  2.807   -70.459 1.00 43.56  ? 689  LEU B HB2  1 
ATOM   7710  H HB3  . LEU B 1 128 ? 0.682   1.632   -70.333 1.00 43.56  ? 689  LEU B HB3  1 
ATOM   7711  H HG   . LEU B 1 128 ? 1.715   2.733   -68.561 1.00 45.33  ? 689  LEU B HG   1 
ATOM   7712  H HD11 . LEU B 1 128 ? 0.788   4.649   -67.624 1.00 44.24  ? 689  LEU B HD11 1 
ATOM   7713  H HD12 . LEU B 1 128 ? 1.255   4.944   -69.114 1.00 44.24  ? 689  LEU B HD12 1 
ATOM   7714  H HD13 . LEU B 1 128 ? -0.284  4.707   -68.796 1.00 44.24  ? 689  LEU B HD13 1 
ATOM   7715  H HD21 . LEU B 1 128 ? 0.028   2.422   -66.978 1.00 43.32  ? 689  LEU B HD21 1 
ATOM   7716  H HD22 . LEU B 1 128 ? -1.052  2.385   -68.143 1.00 43.32  ? 689  LEU B HD22 1 
ATOM   7717  H HD23 . LEU B 1 128 ? 0.031   1.229   -68.027 1.00 43.32  ? 689  LEU B HD23 1 
ATOM   7718  N N    . LYS B 1 129 ? 3.748   3.494   -70.705 1.00 31.90  ? 690  LYS B N    1 
ATOM   7719  C CA   . LYS B 1 129 ? 5.168   3.195   -70.786 1.00 36.92  ? 690  LYS B CA   1 
ATOM   7720  C C    . LYS B 1 129 ? 5.956   4.190   -69.947 1.00 36.60  ? 690  LYS B C    1 
ATOM   7721  O O    . LYS B 1 129 ? 5.441   5.264   -69.610 1.00 35.94  ? 690  LYS B O    1 
ATOM   7722  C CB   . LYS B 1 129 ? 5.644   3.241   -72.240 1.00 40.98  ? 690  LYS B CB   1 
ATOM   7723  C CG   . LYS B 1 129 ? 5.298   4.541   -72.952 1.00 42.23  ? 690  LYS B CG   1 
ATOM   7724  C CD   . LYS B 1 129 ? 5.763   4.535   -74.398 1.00 47.05  ? 690  LYS B CD   1 
ATOM   7725  C CE   . LYS B 1 129 ? 5.362   5.815   -75.118 1.00 46.41  ? 690  LYS B CE   1 
ATOM   7726  N NZ   . LYS B 1 129 ? 5.859   5.847   -76.522 1.00 51.85  ? 690  LYS B NZ   1 
ATOM   7727  H H    . LYS B 1 129 ? 3.560   4.199   -70.249 1.00 38.28  ? 690  LYS B H    1 
ATOM   7728  H HA   . LYS B 1 129 ? 5.331   2.304   -70.439 1.00 44.31  ? 690  LYS B HA   1 
ATOM   7729  H HB2  . LYS B 1 129 ? 6.609   3.140   -72.257 1.00 49.17  ? 690  LYS B HB2  1 
ATOM   7730  H HB3  . LYS B 1 129 ? 5.228   2.514   -72.729 1.00 49.17  ? 690  LYS B HB3  1 
ATOM   7731  H HG2  . LYS B 1 129 ? 4.336   4.663   -72.943 1.00 50.68  ? 690  LYS B HG2  1 
ATOM   7732  H HG3  . LYS B 1 129 ? 5.733   5.279   -72.497 1.00 50.68  ? 690  LYS B HG3  1 
ATOM   7733  H HD2  . LYS B 1 129 ? 6.729   4.462   -74.424 1.00 56.46  ? 690  LYS B HD2  1 
ATOM   7734  H HD3  . LYS B 1 129 ? 5.356   3.786   -74.862 1.00 56.46  ? 690  LYS B HD3  1 
ATOM   7735  H HE2  . LYS B 1 129 ? 4.394   5.879   -75.138 1.00 55.69  ? 690  LYS B HE2  1 
ATOM   7736  H HE3  . LYS B 1 129 ? 5.737   6.576   -74.647 1.00 55.69  ? 690  LYS B HE3  1 
ATOM   7737  H HZ1  . LYS B 1 129 ? 5.610   6.606   -76.916 1.00 62.22  ? 690  LYS B HZ1  1 
ATOM   7738  H HZ2  . LYS B 1 129 ? 6.747   5.795   -76.532 1.00 62.22  ? 690  LYS B HZ2  1 
ATOM   7739  H HZ3  . LYS B 1 129 ? 5.524   5.161   -76.979 1.00 62.22  ? 690  LYS B HZ3  1 
ATOM   7740  N N    . PRO B 1 130 ? 7.200   3.869   -69.587 1.00 34.09  ? 691  PRO B N    1 
ATOM   7741  C CA   . PRO B 1 130 ? 7.998   4.815   -68.794 1.00 39.48  ? 691  PRO B CA   1 
ATOM   7742  C C    . PRO B 1 130 ? 8.143   6.176   -69.448 1.00 39.05  ? 691  PRO B C    1 
ATOM   7743  O O    . PRO B 1 130 ? 8.245   7.189   -68.745 1.00 41.30  ? 691  PRO B O    1 
ATOM   7744  C CB   . PRO B 1 130 ? 9.353   4.103   -68.669 1.00 44.26  ? 691  PRO B CB   1 
ATOM   7745  C CG   . PRO B 1 130 ? 9.051   2.663   -68.858 1.00 39.07  ? 691  PRO B CG   1 
ATOM   7746  C CD   . PRO B 1 130 ? 7.923   2.611   -69.841 1.00 35.18  ? 691  PRO B CD   1 
ATOM   7747  H HA   . PRO B 1 130 ? 7.611   4.924   -67.911 1.00 47.38  ? 691  PRO B HA   1 
ATOM   7748  H HB2  . PRO B 1 130 ? 9.954   4.421   -69.361 1.00 53.11  ? 691  PRO B HB2  1 
ATOM   7749  H HB3  . PRO B 1 130 ? 9.726   4.263   -67.789 1.00 53.11  ? 691  PRO B HB3  1 
ATOM   7750  H HG2  . PRO B 1 130 ? 9.833   2.210   -69.211 1.00 46.88  ? 691  PRO B HG2  1 
ATOM   7751  H HG3  . PRO B 1 130 ? 8.784   2.273   -68.011 1.00 46.88  ? 691  PRO B HG3  1 
ATOM   7752  H HD2  . PRO B 1 130 ? 8.265   2.594   -70.749 1.00 42.22  ? 691  PRO B HD2  1 
ATOM   7753  H HD3  . PRO B 1 130 ? 7.351   1.849   -69.661 1.00 42.22  ? 691  PRO B HD3  1 
ATOM   7754  N N    . HIS B 1 131 ? 8.154   6.234   -70.779 1.00 45.41  ? 692  HIS B N    1 
ATOM   7755  C CA   . HIS B 1 131 ? 8.335   7.507   -71.466 1.00 41.22  ? 692  HIS B CA   1 
ATOM   7756  C C    . HIS B 1 131 ? 7.103   8.400   -71.361 1.00 39.16  ? 692  HIS B C    1 
ATOM   7757  O O    . HIS B 1 131 ? 7.232   9.625   -71.457 1.00 33.27  ? 692  HIS B O    1 
ATOM   7758  C CB   . HIS B 1 131 ? 8.680   7.266   -72.938 1.00 44.83  ? 692  HIS B CB   1 
ATOM   7759  C CG   . HIS B 1 131 ? 9.652   6.145   -73.161 1.00 47.76  ? 692  HIS B CG   1 
ATOM   7760  N ND1  . HIS B 1 131 ? 9.259   4.830   -73.295 1.00 47.72  ? 692  HIS B ND1  1 
ATOM   7761  C CD2  . HIS B 1 131 ? 11.001  6.146   -73.277 1.00 51.89  ? 692  HIS B CD2  1 
ATOM   7762  C CE1  . HIS B 1 131 ? 10.323  4.070   -73.483 1.00 45.82  ? 692  HIS B CE1  1 
ATOM   7763  N NE2  . HIS B 1 131 ? 11.393  4.844   -73.476 1.00 51.23  ? 692  HIS B NE2  1 
ATOM   7764  H H    . HIS B 1 131 ? 8.058   5.557   -71.301 1.00 54.49  ? 692  HIS B H    1 
ATOM   7765  H HA   . HIS B 1 131 ? 9.079   7.978   -71.060 1.00 49.47  ? 692  HIS B HA   1 
ATOM   7766  H HB2  . HIS B 1 131 ? 7.866   7.051   -73.418 1.00 53.80  ? 692  HIS B HB2  1 
ATOM   7767  H HB3  . HIS B 1 131 ? 9.073   8.074   -73.303 1.00 53.80  ? 692  HIS B HB3  1 
ATOM   7768  H HD2  . HIS B 1 131 ? 11.559  6.889   -73.231 1.00 62.27  ? 692  HIS B HD2  1 
ATOM   7769  H HE1  . HIS B 1 131 ? 10.320  3.147   -73.600 1.00 54.99  ? 692  HIS B HE1  1 
ATOM   7770  H HE2  . HIS B 1 131 ? 12.204  4.576   -73.579 1.00 61.47  ? 692  HIS B HE2  1 
ATOM   7771  N N    . ASN B 1 132 ? 5.920   7.820   -71.156 1.00 45.96  ? 693  ASN B N    1 
ATOM   7772  C CA   . ASN B 1 132 ? 4.682   8.582   -71.035 1.00 43.07  ? 693  ASN B CA   1 
ATOM   7773  C C    . ASN B 1 132 ? 4.368   8.997   -69.604 1.00 38.98  ? 693  ASN B C    1 
ATOM   7774  O O    . ASN B 1 132 ? 3.448   9.796   -69.397 1.00 40.25  ? 693  ASN B O    1 
ATOM   7775  C CB   . ASN B 1 132 ? 3.507   7.768   -71.586 1.00 48.29  ? 693  ASN B CB   1 
ATOM   7776  C CG   . ASN B 1 132 ? 3.295   7.973   -73.073 1.00 53.32  ? 693  ASN B CG   1 
ATOM   7777  O OD1  . ASN B 1 132 ? 4.093   8.623   -73.748 1.00 66.14  ? 693  ASN B OD1  1 
ATOM   7778  N ND2  . ASN B 1 132 ? 2.211   7.408   -73.593 1.00 61.88  ? 693  ASN B ND2  1 
ATOM   7779  H H    . ASN B 1 132 ? 5.809   6.970   -71.084 1.00 55.16  ? 693  ASN B H    1 
ATOM   7780  H HA   . ASN B 1 132 ? 4.760   9.389   -71.567 1.00 51.68  ? 693  ASN B HA   1 
ATOM   7781  H HB2  . ASN B 1 132 ? 3.677   6.825   -71.435 1.00 57.94  ? 693  ASN B HB2  1 
ATOM   7782  H HB3  . ASN B 1 132 ? 2.695   8.036   -71.128 1.00 57.94  ? 693  ASN B HB3  1 
ATOM   7783  H HD21 . ASN B 1 132 ? 2.042   7.492   -74.432 1.00 74.26  ? 693  ASN B HD21 1 
ATOM   7784  H HD22 . ASN B 1 132 ? 1.678   6.957   -73.090 1.00 74.26  ? 693  ASN B HD22 1 
ATOM   7785  N N    . ILE B 1 133 ? 5.099   8.476   -68.624 1.00 32.03  ? 694  ILE B N    1 
ATOM   7786  C CA   . ILE B 1 133 ? 4.863   8.770   -67.215 1.00 32.72  ? 694  ILE B CA   1 
ATOM   7787  C C    . ILE B 1 133 ? 5.862   9.838   -66.793 1.00 29.95  ? 694  ILE B C    1 
ATOM   7788  O O    . ILE B 1 133 ? 7.078   9.636   -66.895 1.00 34.61  ? 694  ILE B O    1 
ATOM   7789  C CB   . ILE B 1 133 ? 4.993   7.503   -66.354 1.00 34.96  ? 694  ILE B CB   1 
ATOM   7790  C CG1  . ILE B 1 133 ? 3.980   6.448   -66.816 1.00 32.80  ? 694  ILE B CG1  1 
ATOM   7791  C CG2  . ILE B 1 133 ? 4.777   7.831   -64.882 1.00 26.03  ? 694  ILE B CG2  1 
ATOM   7792  C CD1  . ILE B 1 133 ? 4.221   5.074   -66.252 1.00 39.41  ? 694  ILE B CD1  1 
ATOM   7793  H H    . ILE B 1 133 ? 5.754   7.936   -68.754 1.00 38.43  ? 694  ILE B H    1 
ATOM   7794  H HA   . ILE B 1 133 ? 3.967   9.126   -67.104 1.00 39.27  ? 694  ILE B HA   1 
ATOM   7795  H HB   . ILE B 1 133 ? 5.887   7.143   -66.464 1.00 41.95  ? 694  ILE B HB   1 
ATOM   7796  H HG12 . ILE B 1 133 ? 3.092   6.728   -66.543 1.00 39.36  ? 694  ILE B HG12 1 
ATOM   7797  H HG13 . ILE B 1 133 ? 4.019   6.382   -67.783 1.00 39.36  ? 694  ILE B HG13 1 
ATOM   7798  H HG21 . ILE B 1 133 ? 4.864   7.017   -64.361 1.00 31.24  ? 694  ILE B HG21 1 
ATOM   7799  H HG22 . ILE B 1 133 ? 5.445   8.477   -64.601 1.00 31.24  ? 694  ILE B HG22 1 
ATOM   7800  H HG23 . ILE B 1 133 ? 3.888   8.203   -64.769 1.00 31.24  ? 694  ILE B HG23 1 
ATOM   7801  H HD11 . ILE B 1 133 ? 3.542   4.470   -66.591 1.00 47.29  ? 694  ILE B HD11 1 
ATOM   7802  H HD12 . ILE B 1 133 ? 5.101   4.771   -66.526 1.00 47.29  ? 694  ILE B HD12 1 
ATOM   7803  H HD13 . ILE B 1 133 ? 4.173   5.118   -65.284 1.00 47.29  ? 694  ILE B HD13 1 
ATOM   7804  N N    . LEU B 1 134 ? 5.352   10.973  -66.326 1.00 25.27  ? 695  LEU B N    1 
ATOM   7805  C CA   . LEU B 1 134 ? 6.171   12.143  -66.043 1.00 35.47  ? 695  LEU B CA   1 
ATOM   7806  C C    . LEU B 1 134 ? 6.379   12.313  -64.544 1.00 35.63  ? 695  LEU B C    1 
ATOM   7807  O O    . LEU B 1 134 ? 5.475   12.057  -63.743 1.00 30.84  ? 695  LEU B O    1 
ATOM   7808  C CB   . LEU B 1 134 ? 5.526   13.403  -66.624 1.00 32.50  ? 695  LEU B CB   1 
ATOM   7809  C CG   . LEU B 1 134 ? 5.334   13.388  -68.144 1.00 33.34  ? 695  LEU B CG   1 
ATOM   7810  C CD1  . LEU B 1 134 ? 4.737   14.694  -68.630 1.00 28.11  ? 695  LEU B CD1  1 
ATOM   7811  C CD2  . LEU B 1 134 ? 6.644   13.111  -68.872 1.00 35.52  ? 695  LEU B CD2  1 
ATOM   7812  H H    . LEU B 1 134 ? 4.516   11.090  -66.162 1.00 30.32  ? 695  LEU B H    1 
ATOM   7813  H HA   . LEU B 1 134 ? 7.040   12.030  -66.457 1.00 42.56  ? 695  LEU B HA   1 
ATOM   7814  H HB2  . LEU B 1 134 ? 4.651   13.517  -66.220 1.00 39.00  ? 695  LEU B HB2  1 
ATOM   7815  H HB3  . LEU B 1 134 ? 6.086   14.165  -66.407 1.00 39.00  ? 695  LEU B HB3  1 
ATOM   7816  H HG   . LEU B 1 134 ? 4.714   12.678  -68.372 1.00 40.00  ? 695  LEU B HG   1 
ATOM   7817  H HD11 . LEU B 1 134 ? 4.629   14.652  -69.593 1.00 33.73  ? 695  LEU B HD11 1 
ATOM   7818  H HD12 . LEU B 1 134 ? 3.875   14.824  -68.205 1.00 33.73  ? 695  LEU B HD12 1 
ATOM   7819  H HD13 . LEU B 1 134 ? 5.336   15.421  -68.395 1.00 33.73  ? 695  LEU B HD13 1 
ATOM   7820  H HD21 . LEU B 1 134 ? 6.480   13.110  -69.828 1.00 42.63  ? 695  LEU B HD21 1 
ATOM   7821  H HD22 . LEU B 1 134 ? 7.283   13.805  -68.646 1.00 42.63  ? 695  LEU B HD22 1 
ATOM   7822  H HD23 . LEU B 1 134 ? 6.983   12.246  -68.593 1.00 42.63  ? 695  LEU B HD23 1 
ATOM   7823  N N    . ILE B 1 135 ? 7.580   12.749  -64.179 1.00 32.64  ? 696  ILE B N    1 
ATOM   7824  C CA   . ILE B 1 135 ? 7.924   13.048  -62.794 1.00 36.20  ? 696  ILE B CA   1 
ATOM   7825  C C    . ILE B 1 135 ? 7.687   14.535  -62.570 1.00 35.94  ? 696  ILE B C    1 
ATOM   7826  O O    . ILE B 1 135 ? 8.354   15.378  -63.180 1.00 36.78  ? 696  ILE B O    1 
ATOM   7827  C CB   . ILE B 1 135 ? 9.381   12.668  -62.487 1.00 36.73  ? 696  ILE B CB   1 
ATOM   7828  C CG1  . ILE B 1 135 ? 9.656   11.210  -62.883 1.00 35.32  ? 696  ILE B CG1  1 
ATOM   7829  C CG2  . ILE B 1 135 ? 9.695   12.900  -61.015 1.00 31.15  ? 696  ILE B CG2  1 
ATOM   7830  C CD1  . ILE B 1 135 ? 8.775   10.188  -62.185 1.00 34.91  ? 696  ILE B CD1  1 
ATOM   7831  H H    . ILE B 1 135 ? 8.228   12.882  -64.729 1.00 39.16  ? 696  ILE B H    1 
ATOM   7832  H HA   . ILE B 1 135 ? 7.342   12.549  -62.199 1.00 43.43  ? 696  ILE B HA   1 
ATOM   7833  H HB   . ILE B 1 135 ? 9.960   13.239  -63.015 1.00 44.07  ? 696  ILE B HB   1 
ATOM   7834  H HG12 . ILE B 1 135 ? 9.514   11.116  -63.838 1.00 42.38  ? 696  ILE B HG12 1 
ATOM   7835  H HG13 . ILE B 1 135 ? 10.578  10.999  -62.668 1.00 42.38  ? 696  ILE B HG13 1 
ATOM   7836  H HG21 . ILE B 1 135 ? 10.618  12.654  -60.847 1.00 37.38  ? 696  ILE B HG21 1 
ATOM   7837  H HG22 . ILE B 1 135 ? 9.560   13.838  -60.808 1.00 37.38  ? 696  ILE B HG22 1 
ATOM   7838  H HG23 . ILE B 1 135 ? 9.102   12.353  -60.476 1.00 37.38  ? 696  ILE B HG23 1 
ATOM   7839  H HD11 . ILE B 1 135 ? 9.016   9.300   -62.493 1.00 41.89  ? 696  ILE B HD11 1 
ATOM   7840  H HD12 . ILE B 1 135 ? 8.913   10.255  -61.227 1.00 41.89  ? 696  ILE B HD12 1 
ATOM   7841  H HD13 . ILE B 1 135 ? 7.847   10.372  -62.400 1.00 41.89  ? 696  ILE B HD13 1 
ATOM   7842  N N    . SER B 1 136 ? 6.742   14.858  -61.694 1.00 36.89  ? 697  SER B N    1 
ATOM   7843  C CA   . SER B 1 136 ? 6.353   16.242  -61.482 1.00 32.78  ? 697  SER B CA   1 
ATOM   7844  C C    . SER B 1 136 ? 7.493   17.036  -60.855 1.00 32.83  ? 697  SER B C    1 
ATOM   7845  O O    . SER B 1 136 ? 8.438   16.483  -60.288 1.00 32.12  ? 697  SER B O    1 
ATOM   7846  C CB   . SER B 1 136 ? 5.126   16.326  -60.575 1.00 33.17  ? 697  SER B CB   1 
ATOM   7847  O OG   . SER B 1 136 ? 5.513   16.341  -59.212 1.00 36.00  ? 697  SER B OG   1 
ATOM   7848  H H    . SER B 1 136 ? 6.311   14.292  -61.210 1.00 44.26  ? 697  SER B H    1 
ATOM   7849  H HA   . SER B 1 136 ? 6.131   16.647  -62.335 1.00 39.33  ? 697  SER B HA   1 
ATOM   7850  H HB2  . SER B 1 136 ? 4.640   17.141  -60.776 1.00 39.81  ? 697  SER B HB2  1 
ATOM   7851  H HB3  . SER B 1 136 ? 4.561   15.554  -60.735 1.00 39.81  ? 697  SER B HB3  1 
ATOM   7852  H HG   . SER B 1 136 ? 4.834   16.388  -58.721 1.00 43.20  ? 697  SER B HG   1 
ATOM   7853  N N    . MET B 1 137 ? 7.400   18.352  -60.984 1.00 38.65  ? 698  MET B N    1 
ATOM   7854  C CA   . MET B 1 137 ? 8.297   19.228  -60.255 1.00 41.47  ? 698  MET B CA   1 
ATOM   7855  C C    . MET B 1 137 ? 7.836   19.342  -58.803 1.00 40.32  ? 698  MET B C    1 
ATOM   7856  O O    . MET B 1 137 ? 6.648   19.180  -58.508 1.00 39.73  ? 698  MET B O    1 
ATOM   7857  C CB   . MET B 1 137 ? 8.334   20.610  -60.896 1.00 45.15  ? 698  MET B CB   1 
ATOM   7858  C CG   . MET B 1 137 ? 9.671   20.957  -61.530 1.00 46.09  ? 698  MET B CG   1 
ATOM   7859  S SD   . MET B 1 137 ? 9.574   22.396  -62.602 1.00 68.19  ? 698  MET B SD   1 
ATOM   7860  C CE   . MET B 1 137 ? 8.594   21.739  -63.946 1.00 62.37  ? 698  MET B CE   1 
ATOM   7861  H H    . MET B 1 137 ? 6.831   18.758  -61.485 1.00 46.38  ? 698  MET B H    1 
ATOM   7862  H HA   . MET B 1 137 ? 9.193   18.859  -60.278 1.00 49.76  ? 698  MET B HA   1 
ATOM   7863  H HB2  . MET B 1 137 ? 7.658   20.650  -61.590 1.00 54.18  ? 698  MET B HB2  1 
ATOM   7864  H HB3  . MET B 1 137 ? 8.147   21.275  -60.216 1.00 54.18  ? 698  MET B HB3  1 
ATOM   7865  H HG2  . MET B 1 137 ? 10.313  21.148  -60.828 1.00 55.30  ? 698  MET B HG2  1 
ATOM   7866  H HG3  . MET B 1 137 ? 9.973   20.205  -62.062 1.00 55.30  ? 698  MET B HG3  1 
ATOM   7867  H HE1  . MET B 1 137 ? 8.465   22.433  -64.611 1.00 74.84  ? 698  MET B HE1  1 
ATOM   7868  H HE2  . MET B 1 137 ? 9.063   20.986  -64.339 1.00 74.84  ? 698  MET B HE2  1 
ATOM   7869  H HE3  . MET B 1 137 ? 7.736   21.449  -63.598 1.00 74.84  ? 698  MET B HE3  1 
ATOM   7870  N N    . PRO B 1 138 ? 8.753   19.614  -57.876 1.00 42.96  ? 699  PRO B N    1 
ATOM   7871  C CA   . PRO B 1 138 ? 8.364   19.686  -56.461 1.00 50.03  ? 699  PRO B CA   1 
ATOM   7872  C C    . PRO B 1 138 ? 7.351   20.795  -56.216 1.00 52.54  ? 699  PRO B C    1 
ATOM   7873  O O    . PRO B 1 138 ? 7.500   21.917  -56.707 1.00 49.75  ? 699  PRO B O    1 
ATOM   7874  C CB   . PRO B 1 138 ? 9.691   19.956  -55.741 1.00 47.15  ? 699  PRO B CB   1 
ATOM   7875  C CG   . PRO B 1 138 ? 10.579  20.555  -56.781 1.00 40.09  ? 699  PRO B CG   1 
ATOM   7876  C CD   . PRO B 1 138 ? 10.183  19.906  -58.071 1.00 39.45  ? 699  PRO B CD   1 
ATOM   7877  H HA   . PRO B 1 138 ? 7.999   18.838  -56.164 1.00 60.03  ? 699  PRO B HA   1 
ATOM   7878  H HB2  . PRO B 1 138 ? 9.546   20.579  -55.012 1.00 56.58  ? 699  PRO B HB2  1 
ATOM   7879  H HB3  . PRO B 1 138 ? 10.061  19.122  -55.412 1.00 56.58  ? 699  PRO B HB3  1 
ATOM   7880  H HG2  . PRO B 1 138 ? 10.433  21.513  -56.821 1.00 48.11  ? 699  PRO B HG2  1 
ATOM   7881  H HG3  . PRO B 1 138 ? 11.506  20.359  -56.570 1.00 48.11  ? 699  PRO B HG3  1 
ATOM   7882  H HD2  . PRO B 1 138 ? 10.306  20.521  -58.811 1.00 47.34  ? 699  PRO B HD2  1 
ATOM   7883  H HD3  . PRO B 1 138 ? 10.681  19.084  -58.204 1.00 47.34  ? 699  PRO B HD3  1 
ATOM   7884  N N    . ASN B 1 139 ? 6.313   20.469  -55.449 1.00 53.78  ? 700  ASN B N    1 
ATOM   7885  C CA   . ASN B 1 139 ? 5.289   21.440  -55.087 1.00 59.57  ? 700  ASN B CA   1 
ATOM   7886  C C    . ASN B 1 139 ? 5.793   22.274  -53.910 1.00 62.02  ? 700  ASN B C    1 
ATOM   7887  O O    . ASN B 1 139 ? 6.971   22.227  -53.544 1.00 62.23  ? 700  ASN B O    1 
ATOM   7888  C CB   . ASN B 1 139 ? 3.963   20.736  -54.797 1.00 71.41  ? 700  ASN B CB   1 
ATOM   7889  C CG   . ASN B 1 139 ? 4.074   19.673  -53.710 1.00 56.97  ? 700  ASN B CG   1 
ATOM   7890  O OD1  . ASN B 1 139 ? 5.035   19.644  -52.940 1.00 48.35  ? 700  ASN B OD1  1 
ATOM   7891  N ND2  . ASN B 1 139 ? 3.079   18.794  -53.646 1.00 45.97  ? 700  ASN B ND2  1 
ATOM   7892  H H    . ASN B 1 139 ? 6.179   19.684  -55.124 1.00 64.54  ? 700  ASN B H    1 
ATOM   7893  H HA   . ASN B 1 139 ? 5.148   22.040  -55.837 1.00 71.49  ? 700  ASN B HA   1 
ATOM   7894  H HB2  . ASN B 1 139 ? 3.314   21.396  -54.504 1.00 85.69  ? 700  ASN B HB2  1 
ATOM   7895  H HB3  . ASN B 1 139 ? 3.651   20.304  -55.607 1.00 85.69  ? 700  ASN B HB3  1 
ATOM   7896  H HD21 . ASN B 1 139 ? 3.092   18.173  -53.051 1.00 55.17  ? 700  ASN B HD21 1 
ATOM   7897  H HD22 . ASN B 1 139 ? 2.422   18.846  -54.199 1.00 55.17  ? 700  ASN B HD22 1 
ATOM   7898  N N    . ALA B 1 140 ? 4.899   23.065  -53.310 1.00 63.34  ? 701  ALA B N    1 
ATOM   7899  C CA   . ALA B 1 140 ? 5.305   23.980  -52.247 1.00 70.29  ? 701  ALA B CA   1 
ATOM   7900  C C    . ALA B 1 140 ? 5.973   23.250  -51.087 1.00 64.94  ? 701  ALA B C    1 
ATOM   7901  O O    . ALA B 1 140 ? 6.844   23.818  -50.418 1.00 64.66  ? 701  ALA B O    1 
ATOM   7902  C CB   . ALA B 1 140 ? 4.095   24.769  -51.747 1.00 75.93  ? 701  ALA B CB   1 
ATOM   7903  H H    . ALA B 1 140 ? 4.060   23.090  -53.499 1.00 76.01  ? 701  ALA B H    1 
ATOM   7904  H HA   . ALA B 1 140 ? 5.945   24.613  -52.606 1.00 84.35  ? 701  ALA B HA   1 
ATOM   7905  H HB1  . ALA B 1 140 ? 4.380   25.371  -51.043 1.00 91.12  ? 701  ALA B HB1  1 
ATOM   7906  H HB2  . ALA B 1 140 ? 3.723   25.276  -52.486 1.00 91.12  ? 701  ALA B HB2  1 
ATOM   7907  H HB3  . ALA B 1 140 ? 3.433   24.148  -51.405 1.00 91.12  ? 701  ALA B HB3  1 
ATOM   7908  N N    . HIS B 1 141 ? 5.588   22.000  -50.836 1.00 63.80  ? 702  HIS B N    1 
ATOM   7909  C CA   . HIS B 1 141 ? 6.167   21.210  -49.756 1.00 65.77  ? 702  HIS B CA   1 
ATOM   7910  C C    . HIS B 1 141 ? 7.371   20.389  -50.199 1.00 63.90  ? 702  HIS B C    1 
ATOM   7911  O O    . HIS B 1 141 ? 7.924   19.641  -49.386 1.00 56.52  ? 702  HIS B O    1 
ATOM   7912  C CB   . HIS B 1 141 ? 5.111   20.275  -49.161 1.00 64.06  ? 702  HIS B CB   1 
ATOM   7913  C CG   . HIS B 1 141 ? 3.918   20.988  -48.605 1.00 63.47  ? 702  HIS B CG   1 
ATOM   7914  N ND1  . HIS B 1 141 ? 3.988   21.801  -47.494 1.00 55.29  ? 702  HIS B ND1  1 
ATOM   7915  C CD2  . HIS B 1 141 ? 2.624   21.007  -49.004 1.00 61.46  ? 702  HIS B CD2  1 
ATOM   7916  C CE1  . HIS B 1 141 ? 2.789   22.293  -47.236 1.00 53.83  ? 702  HIS B CE1  1 
ATOM   7917  N NE2  . HIS B 1 141 ? 1.944   21.826  -48.137 1.00 58.58  ? 702  HIS B NE2  1 
ATOM   7918  H H    . HIS B 1 141 ? 4.985   21.583  -51.284 1.00 76.56  ? 702  HIS B H    1 
ATOM   7919  H HA   . HIS B 1 141 ? 6.462   21.811  -49.054 1.00 78.92  ? 702  HIS B HA   1 
ATOM   7920  H HB2  . HIS B 1 141 ? 4.799   19.673  -49.854 1.00 76.87  ? 702  HIS B HB2  1 
ATOM   7921  H HB3  . HIS B 1 141 ? 5.514   19.766  -48.440 1.00 76.87  ? 702  HIS B HB3  1 
ATOM   7922  H HD2  . HIS B 1 141 ? 2.264   20.552  -49.731 1.00 73.76  ? 702  HIS B HD2  1 
ATOM   7923  H HE1  . HIS B 1 141 ? 2.577   22.869  -46.537 1.00 64.60  ? 702  HIS B HE1  1 
ATOM   7924  H HE2  . HIS B 1 141 ? 1.104   22.006  -48.174 1.00 70.30  ? 702  HIS B HE2  1 
ATOM   7925  N N    . GLY B 1 142 ? 7.789   20.506  -51.458 1.00 61.21  ? 703  GLY B N    1 
ATOM   7926  C CA   . GLY B 1 142 ? 8.897   19.716  -51.954 1.00 56.03  ? 703  GLY B CA   1 
ATOM   7927  C C    . GLY B 1 142 ? 8.545   18.290  -52.302 1.00 50.68  ? 703  GLY B C    1 
ATOM   7928  O O    . GLY B 1 142 ? 9.448   17.461  -52.457 1.00 45.63  ? 703  GLY B O    1 
ATOM   7929  H H    . GLY B 1 142 ? 7.444   21.037  -52.039 1.00 73.45  ? 703  GLY B H    1 
ATOM   7930  H HA2  . GLY B 1 142 ? 9.255   20.139  -52.751 1.00 67.23  ? 703  GLY B HA2  1 
ATOM   7931  H HA3  . GLY B 1 142 ? 9.598   19.697  -51.283 1.00 67.23  ? 703  GLY B HA3  1 
ATOM   7932  N N    . LYS B 1 143 ? 7.258   17.975  -52.430 1.00 46.66  ? 704  LYS B N    1 
ATOM   7933  C CA   . LYS B 1 143 ? 6.813   16.628  -52.757 1.00 48.09  ? 704  LYS B CA   1 
ATOM   7934  C C    . LYS B 1 143 ? 6.788   16.429  -54.268 1.00 46.30  ? 704  LYS B C    1 
ATOM   7935  O O    . LYS B 1 143 ? 6.361   17.311  -55.018 1.00 45.68  ? 704  LYS B O    1 
ATOM   7936  C CB   . LYS B 1 143 ? 5.424   16.365  -52.173 1.00 46.94  ? 704  LYS B CB   1 
ATOM   7937  H H    . LYS B 1 143 ? 6.614   18.536  -52.330 1.00 56.00  ? 704  LYS B H    1 
ATOM   7938  H HA   . LYS B 1 143 ? 7.431   15.985  -52.375 1.00 57.71  ? 704  LYS B HA   1 
ATOM   7939  N N    . ILE B 1 144 ? 7.243   15.255  -54.703 1.00 43.61  ? 705  ILE B N    1 
ATOM   7940  C CA   . ILE B 1 144 ? 7.339   14.901  -56.114 1.00 38.23  ? 705  ILE B CA   1 
ATOM   7941  C C    . ILE B 1 144 ? 6.488   13.662  -56.355 1.00 40.81  ? 705  ILE B C    1 
ATOM   7942  O O    . ILE B 1 144 ? 6.510   12.719  -55.556 1.00 50.10  ? 705  ILE B O    1 
ATOM   7943  C CB   . ILE B 1 144 ? 8.808   14.662  -56.527 1.00 38.55  ? 705  ILE B CB   1 
ATOM   7944  C CG1  . ILE B 1 144 ? 9.583   15.981  -56.445 1.00 46.72  ? 705  ILE B CG1  1 
ATOM   7945  C CG2  . ILE B 1 144 ? 8.894   14.081  -57.938 1.00 38.28  ? 705  ILE B CG2  1 
ATOM   7946  C CD1  . ILE B 1 144 ? 11.084  15.840  -56.593 1.00 46.38  ? 705  ILE B CD1  1 
ATOM   7947  H H    . ILE B 1 144 ? 7.511   14.628  -54.179 1.00 52.33  ? 705  ILE B H    1 
ATOM   7948  H HA   . ILE B 1 144 ? 6.984   15.625  -56.653 1.00 45.87  ? 705  ILE B HA   1 
ATOM   7949  H HB   . ILE B 1 144 ? 9.205   14.030  -55.907 1.00 46.26  ? 705  ILE B HB   1 
ATOM   7950  H HG12 . ILE B 1 144 ? 9.272   16.568  -57.152 1.00 56.06  ? 705  ILE B HG12 1 
ATOM   7951  H HG13 . ILE B 1 144 ? 9.410   16.389  -55.582 1.00 56.06  ? 705  ILE B HG13 1 
ATOM   7952  H HG21 . ILE B 1 144 ? 9.827   13.943  -58.166 1.00 45.94  ? 705  ILE B HG21 1 
ATOM   7953  H HG22 . ILE B 1 144 ? 8.419   13.235  -57.960 1.00 45.94  ? 705  ILE B HG22 1 
ATOM   7954  H HG23 . ILE B 1 144 ? 8.489   14.704  -58.561 1.00 45.94  ? 705  ILE B HG23 1 
ATOM   7955  H HD11 . ILE B 1 144 ? 11.491  16.718  -56.529 1.00 55.66  ? 705  ILE B HD11 1 
ATOM   7956  H HD12 . ILE B 1 144 ? 11.418  15.267  -55.886 1.00 55.66  ? 705  ILE B HD12 1 
ATOM   7957  H HD13 . ILE B 1 144 ? 11.280  15.447  -57.458 1.00 55.66  ? 705  ILE B HD13 1 
ATOM   7958  N N    . LYS B 1 145 ? 5.738   13.668  -57.457 1.00 36.44  ? 706  LYS B N    1 
ATOM   7959  C CA   . LYS B 1 145 ? 4.768   12.623  -57.747 1.00 37.18  ? 706  LYS B CA   1 
ATOM   7960  C C    . LYS B 1 145 ? 4.836   12.234  -59.216 1.00 34.69  ? 706  LYS B C    1 
ATOM   7961  O O    . LYS B 1 145 ? 5.177   13.048  -60.078 1.00 35.24  ? 706  LYS B O    1 
ATOM   7962  C CB   . LYS B 1 145 ? 3.343   13.079  -57.401 1.00 38.60  ? 706  LYS B CB   1 
ATOM   7963  C CG   . LYS B 1 145 ? 2.969   14.423  -58.010 1.00 40.29  ? 706  LYS B CG   1 
ATOM   7964  C CD   . LYS B 1 145 ? 1.523   14.793  -57.726 1.00 38.06  ? 706  LYS B CD   1 
ATOM   7965  C CE   . LYS B 1 145 ? 1.189   16.169  -58.285 1.00 36.53  ? 706  LYS B CE   1 
ATOM   7966  N NZ   . LYS B 1 145 ? -0.257  16.509  -58.157 1.00 35.17  ? 706  LYS B NZ   1 
ATOM   7967  H H    . LYS B 1 145 ? 5.777   14.279  -58.061 1.00 43.73  ? 706  LYS B H    1 
ATOM   7968  H HA   . LYS B 1 145 ? 4.974   11.838  -57.214 1.00 44.61  ? 706  LYS B HA   1 
ATOM   7969  H HB2  . LYS B 1 145 ? 2.714   12.418  -57.730 1.00 46.32  ? 706  LYS B HB2  1 
ATOM   7970  H HB3  . LYS B 1 145 ? 3.265   13.158  -56.438 1.00 46.32  ? 706  LYS B HB3  1 
ATOM   7971  H HG2  . LYS B 1 145 ? 3.537   15.113  -57.634 1.00 48.34  ? 706  LYS B HG2  1 
ATOM   7972  H HG3  . LYS B 1 145 ? 3.087   14.380  -58.972 1.00 48.34  ? 706  LYS B HG3  1 
ATOM   7973  H HD2  . LYS B 1 145 ? 0.936   14.143  -58.144 1.00 45.67  ? 706  LYS B HD2  1 
ATOM   7974  H HD3  . LYS B 1 145 ? 1.378   14.809  -56.767 1.00 45.67  ? 706  LYS B HD3  1 
ATOM   7975  H HE2  . LYS B 1 145 ? 1.698   16.838  -57.802 1.00 43.83  ? 706  LYS B HE2  1 
ATOM   7976  H HE3  . LYS B 1 145 ? 1.420   16.192  -59.227 1.00 43.83  ? 706  LYS B HE3  1 
ATOM   7977  H HZ1  . LYS B 1 145 ? -0.410  17.319  -58.494 1.00 42.20  ? 706  LYS B HZ1  1 
ATOM   7978  H HZ2  . LYS B 1 145 ? -0.750  15.914  -58.598 1.00 42.20  ? 706  LYS B HZ2  1 
ATOM   7979  H HZ3  . LYS B 1 145 ? -0.496  16.504  -57.299 1.00 42.20  ? 706  LYS B HZ3  1 
ATOM   7980  N N    . ALA B 1 146 ? 4.505   10.975  -59.489 1.00 33.47  ? 707  ALA B N    1 
ATOM   7981  C CA   . ALA B 1 146 ? 4.388   10.495  -60.858 1.00 29.54  ? 707  ALA B CA   1 
ATOM   7982  C C    . ALA B 1 146 ? 3.037   10.911  -61.423 1.00 26.83  ? 707  ALA B C    1 
ATOM   7983  O O    . ALA B 1 146 ? 2.040   10.970  -60.697 1.00 25.23  ? 707  ALA B O    1 
ATOM   7984  C CB   . ALA B 1 146 ? 4.534   8.974   -60.914 1.00 24.71  ? 707  ALA B CB   1 
ATOM   7985  H H    . ALA B 1 146 ? 4.341   10.376  -58.894 1.00 40.16  ? 707  ALA B H    1 
ATOM   7986  H HA   . ALA B 1 146 ? 5.086   10.892  -61.402 1.00 35.45  ? 707  ALA B HA   1 
ATOM   7987  H HB1  . ALA B 1 146 ? 4.452   8.683   -61.835 1.00 29.65  ? 707  ALA B HB1  1 
ATOM   7988  H HB2  . ALA B 1 146 ? 5.404   8.728   -60.565 1.00 29.65  ? 707  ALA B HB2  1 
ATOM   7989  H HB3  . ALA B 1 146 ? 3.835   8.570   -60.376 1.00 29.65  ? 707  ALA B HB3  1 
ATOM   7990  N N    . MET B 1 147 ? 3.006   11.207  -62.721 1.00 28.90  ? 708  MET B N    1 
ATOM   7991  C CA   . MET B 1 147 ? 1.792   11.708  -63.347 1.00 31.50  ? 708  MET B CA   1 
ATOM   7992  C C    . MET B 1 147 ? 1.629   11.128  -64.744 1.00 30.54  ? 708  MET B C    1 
ATOM   7993  O O    . MET B 1 147 ? 2.605   10.891  -65.461 1.00 30.54  ? 708  MET B O    1 
ATOM   7994  C CB   . MET B 1 147 ? 1.787   13.241  -63.407 1.00 36.34  ? 708  MET B CB   1 
ATOM   7995  C CG   . MET B 1 147 ? 1.633   13.884  -62.044 1.00 32.66  ? 708  MET B CG   1 
ATOM   7996  S SD   . MET B 1 147 ? 1.035   15.577  -62.136 1.00 50.63  ? 708  MET B SD   1 
ATOM   7997  C CE   . MET B 1 147 ? 2.380   16.339  -63.035 1.00 60.37  ? 708  MET B CE   1 
ATOM   7998  H H    . MET B 1 147 ? 3.673   11.127  -63.257 1.00 34.68  ? 708  MET B H    1 
ATOM   7999  H HA   . MET B 1 147 ? 1.033   11.434  -62.809 1.00 37.80  ? 708  MET B HA   1 
ATOM   8000  H HB2  . MET B 1 147 ? 2.625   13.545  -63.788 1.00 43.61  ? 708  MET B HB2  1 
ATOM   8001  H HB3  . MET B 1 147 ? 1.046   13.533  -63.960 1.00 43.61  ? 708  MET B HB3  1 
ATOM   8002  H HG2  . MET B 1 147 ? 0.998   13.369  -61.522 1.00 39.19  ? 708  MET B HG2  1 
ATOM   8003  H HG3  . MET B 1 147 ? 2.496   13.894  -61.601 1.00 39.19  ? 708  MET B HG3  1 
ATOM   8004  H HE1  . MET B 1 147 ? 3.198   16.236  -62.525 1.00 72.44  ? 708  MET B HE1  1 
ATOM   8005  H HE2  . MET B 1 147 ? 2.470   15.903  -63.897 1.00 72.44  ? 708  MET B HE2  1 
ATOM   8006  H HE3  . MET B 1 147 ? 2.183   17.280  -63.158 1.00 72.44  ? 708  MET B HE3  1 
ATOM   8007  N N    . ILE B 1 148 ? 0.370   10.912  -65.117 1.00 31.61  ? 709  ILE B N    1 
ATOM   8008  C CA   . ILE B 1 148 ? 0.003   10.347  -66.410 1.00 31.82  ? 709  ILE B CA   1 
ATOM   8009  C C    . ILE B 1 148 ? -0.238  11.486  -67.391 1.00 29.01  ? 709  ILE B C    1 
ATOM   8010  O O    . ILE B 1 148 ? -0.911  12.471  -67.063 1.00 29.75  ? 709  ILE B O    1 
ATOM   8011  C CB   . ILE B 1 148 ? -1.244  9.457   -66.275 1.00 29.80  ? 709  ILE B CB   1 
ATOM   8012  C CG1  . ILE B 1 148 ? -0.888  8.194   -65.486 1.00 29.90  ? 709  ILE B CG1  1 
ATOM   8013  C CG2  . ILE B 1 148 ? -1.823  9.098   -67.648 1.00 34.12  ? 709  ILE B CG2  1 
ATOM   8014  C CD1  . ILE B 1 148 ? -2.063  7.291   -65.175 1.00 28.14  ? 709  ILE B CD1  1 
ATOM   8015  H H    . ILE B 1 148 ? -0.309  11.091  -64.620 1.00 37.94  ? 709  ILE B H    1 
ATOM   8016  H HA   . ILE B 1 148 ? 0.734   9.804   -66.744 1.00 38.18  ? 709  ILE B HA   1 
ATOM   8017  H HB   . ILE B 1 148 ? -1.918  9.948   -65.778 1.00 35.76  ? 709  ILE B HB   1 
ATOM   8018  H HG12 . ILE B 1 148 ? -0.248  7.678   -66.000 1.00 35.88  ? 709  ILE B HG12 1 
ATOM   8019  H HG13 . ILE B 1 148 ? -0.490  8.459   -64.641 1.00 35.88  ? 709  ILE B HG13 1 
ATOM   8020  H HG21 . ILE B 1 148 ? -2.606  8.538   -67.524 1.00 40.94  ? 709  ILE B HG21 1 
ATOM   8021  H HG22 . ILE B 1 148 ? -2.070  9.914   -68.109 1.00 40.94  ? 709  ILE B HG22 1 
ATOM   8022  H HG23 . ILE B 1 148 ? -1.151  8.619   -68.158 1.00 40.94  ? 709  ILE B HG23 1 
ATOM   8023  H HD11 . ILE B 1 148 ? -1.747  6.522   -64.677 1.00 33.77  ? 709  ILE B HD11 1 
ATOM   8024  H HD12 . ILE B 1 148 ? -2.710  7.785   -64.647 1.00 33.77  ? 709  ILE B HD12 1 
ATOM   8025  H HD13 . ILE B 1 148 ? -2.467  7.003   -66.009 1.00 33.77  ? 709  ILE B HD13 1 
ATOM   8026  N N    . SER B 1 149 ? 0.302   11.348  -68.600 1.00 36.44  ? 710  SER B N    1 
ATOM   8027  C CA   . SER B 1 149 ? 0.150   12.349  -69.649 1.00 38.81  ? 710  SER B CA   1 
ATOM   8028  C C    . SER B 1 149 ? -0.041  11.623  -70.977 1.00 39.25  ? 710  SER B C    1 
ATOM   8029  O O    . SER B 1 149 ? -0.164  10.396  -71.027 1.00 42.27  ? 710  SER B O    1 
ATOM   8030  C CB   . SER B 1 149 ? 1.361   13.289  -69.678 1.00 38.08  ? 710  SER B CB   1 
ATOM   8031  O OG   . SER B 1 149 ? 2.547   12.573  -69.977 1.00 38.40  ? 710  SER B OG   1 
ATOM   8032  H H    . SER B 1 149 ? 0.770   10.668  -68.839 1.00 43.72  ? 710  SER B H    1 
ATOM   8033  H HA   . SER B 1 149 ? -0.643  12.879  -69.474 1.00 46.58  ? 710  SER B HA   1 
ATOM   8034  H HB2  . SER B 1 149 ? 1.220   13.965  -70.359 1.00 45.70  ? 710  SER B HB2  1 
ATOM   8035  H HB3  . SER B 1 149 ? 1.457   13.709  -68.809 1.00 45.70  ? 710  SER B HB3  1 
ATOM   8036  H HG   . SER B 1 149 ? 2.680   11.983  -69.395 1.00 46.08  ? 710  SER B HG   1 
ATOM   8037  N N    . ASP B 1 150 ? -0.055  12.396  -72.064 1.00 44.26  ? 711  ASP B N    1 
ATOM   8038  C CA   . ASP B 1 150 ? -0.168  11.874  -73.426 1.00 43.84  ? 711  ASP B CA   1 
ATOM   8039  C C    . ASP B 1 150 ? -1.466  11.076  -73.599 1.00 41.31  ? 711  ASP B C    1 
ATOM   8040  O O    . ASP B 1 150 ? -1.484  9.846   -73.688 1.00 42.40  ? 711  ASP B O    1 
ATOM   8041  C CB   . ASP B 1 150 ? 1.064   11.036  -73.788 1.00 44.19  ? 711  ASP B CB   1 
ATOM   8042  C CG   . ASP B 1 150 ? 1.341   11.025  -75.282 1.00 44.25  ? 711  ASP B CG   1 
ATOM   8043  O OD1  . ASP B 1 150 ? 0.433   11.380  -76.064 1.00 34.93  ? 711  ASP B OD1  1 
ATOM   8044  O OD2  . ASP B 1 150 ? 2.470   10.662  -75.675 1.00 45.32  ? 711  ASP B OD2  1 
ATOM   8045  H H    . ASP B 1 150 ? 0.001   13.254  -72.035 1.00 53.11  ? 711  ASP B H    1 
ATOM   8046  H HA   . ASP B 1 150 ? -0.203  12.623  -74.041 1.00 52.61  ? 711  ASP B HA   1 
ATOM   8047  H HB2  . ASP B 1 150 ? 1.841   11.405  -73.340 1.00 53.03  ? 711  ASP B HB2  1 
ATOM   8048  H HB3  . ASP B 1 150 ? 0.919   10.120  -73.502 1.00 53.03  ? 711  ASP B HB3  1 
ATOM   8049  N N    . PHE B 1 151 ? -2.561  11.831  -73.639 1.00 37.86  ? 712  PHE B N    1 
ATOM   8050  C CA   . PHE B 1 151 ? -3.901  11.289  -73.822 1.00 35.41  ? 712  PHE B CA   1 
ATOM   8051  C C    . PHE B 1 151 ? -4.261  11.082  -75.292 1.00 38.31  ? 712  PHE B C    1 
ATOM   8052  O O    . PHE B 1 151 ? -5.409  10.738  -75.591 1.00 33.00  ? 712  PHE B O    1 
ATOM   8053  C CB   . PHE B 1 151 ? -4.932  12.210  -73.159 1.00 33.60  ? 712  PHE B CB   1 
ATOM   8054  C CG   . PHE B 1 151 ? -4.935  12.135  -71.657 1.00 36.52  ? 712  PHE B CG   1 
ATOM   8055  C CD1  . PHE B 1 151 ? -3.815  12.496  -70.926 1.00 38.56  ? 712  PHE B CD1  1 
ATOM   8056  C CD2  . PHE B 1 151 ? -6.064  11.707  -70.975 1.00 41.45  ? 712  PHE B CD2  1 
ATOM   8057  C CE1  . PHE B 1 151 ? -3.820  12.423  -69.545 1.00 40.02  ? 712  PHE B CE1  1 
ATOM   8058  C CE2  . PHE B 1 151 ? -6.072  11.630  -69.597 1.00 39.04  ? 712  PHE B CE2  1 
ATOM   8059  C CZ   . PHE B 1 151 ? -4.951  11.990  -68.881 1.00 34.32  ? 712  PHE B CZ   1 
ATOM   8060  H H    . PHE B 1 151 ? -2.550  12.687  -73.559 1.00 45.43  ? 712  PHE B H    1 
ATOM   8061  H HA   . PHE B 1 151 ? -3.950  10.426  -73.383 1.00 42.49  ? 712  PHE B HA   1 
ATOM   8062  H HB2  . PHE B 1 151 ? -4.738  13.127  -73.409 1.00 40.32  ? 712  PHE B HB2  1 
ATOM   8063  H HB3  . PHE B 1 151 ? -5.817  11.964  -73.470 1.00 40.32  ? 712  PHE B HB3  1 
ATOM   8064  H HD1  . PHE B 1 151 ? -3.050  12.786  -71.369 1.00 46.27  ? 712  PHE B HD1  1 
ATOM   8065  H HD2  . PHE B 1 151 ? -6.822  11.461  -71.453 1.00 49.74  ? 712  PHE B HD2  1 
ATOM   8066  H HE1  . PHE B 1 151 ? -3.062  12.666  -69.064 1.00 48.03  ? 712  PHE B HE1  1 
ATOM   8067  H HE2  . PHE B 1 151 ? -6.836  11.341  -69.151 1.00 46.85  ? 712  PHE B HE2  1 
ATOM   8068  H HZ   . PHE B 1 151 ? -4.956  11.943  -67.952 1.00 41.19  ? 712  PHE B HZ   1 
ATOM   8069  N N    . GLY B 1 152 ? -3.312  11.300  -76.208 1.00 35.58  ? 713  GLY B N    1 
ATOM   8070  C CA   . GLY B 1 152 ? -3.625  11.253  -77.630 1.00 45.58  ? 713  GLY B CA   1 
ATOM   8071  C C    . GLY B 1 152 ? -4.310  9.971   -78.065 1.00 42.30  ? 713  GLY B C    1 
ATOM   8072  O O    . GLY B 1 152 ? -5.215  9.995   -78.903 1.00 44.46  ? 713  GLY B O    1 
ATOM   8073  H H    . GLY B 1 152 ? -2.489  11.474  -76.029 1.00 42.70  ? 713  GLY B H    1 
ATOM   8074  H HA2  . GLY B 1 152 ? -4.205  11.997  -77.853 1.00 54.70  ? 713  GLY B HA2  1 
ATOM   8075  H HA3  . GLY B 1 152 ? -2.804  11.345  -78.139 1.00 54.70  ? 713  GLY B HA3  1 
ATOM   8076  N N    . LEU B 1 153 ? -3.894  8.837   -77.507 1.00 42.06  ? 714  LEU B N    1 
ATOM   8077  C CA   . LEU B 1 153 ? -4.439  7.539   -77.885 1.00 44.22  ? 714  LEU B CA   1 
ATOM   8078  C C    . LEU B 1 153 ? -5.589  7.086   -76.994 1.00 40.92  ? 714  LEU B C    1 
ATOM   8079  O O    . LEU B 1 153 ? -6.070  5.960   -77.157 1.00 41.42  ? 714  LEU B O    1 
ATOM   8080  C CB   . LEU B 1 153 ? -3.329  6.482   -77.871 1.00 34.13  ? 714  LEU B CB   1 
ATOM   8081  C CG   . LEU B 1 153 ? -2.277  6.668   -78.967 1.00 42.15  ? 714  LEU B CG   1 
ATOM   8082  C CD1  . LEU B 1 153 ? -1.055  5.808   -78.704 1.00 39.91  ? 714  LEU B CD1  1 
ATOM   8083  C CD2  . LEU B 1 153 ? -2.862  6.353   -80.336 1.00 42.76  ? 714  LEU B CD2  1 
ATOM   8084  H H    . LEU B 1 153 ? -3.287  8.794   -76.899 1.00 50.48  ? 714  LEU B H    1 
ATOM   8085  H HA   . LEU B 1 153 ? -4.777  7.598   -78.792 1.00 53.06  ? 714  LEU B HA   1 
ATOM   8086  H HB2  . LEU B 1 153 ? -2.874  6.518   -77.015 1.00 40.96  ? 714  LEU B HB2  1 
ATOM   8087  H HB3  . LEU B 1 153 ? -3.730  5.607   -77.992 1.00 40.96  ? 714  LEU B HB3  1 
ATOM   8088  H HG   . LEU B 1 153 ? -1.992  7.596   -78.972 1.00 50.58  ? 714  LEU B HG   1 
ATOM   8089  H HD11 . LEU B 1 153 ? -0.410  5.950   -79.415 1.00 47.90  ? 714  LEU B HD11 1 
ATOM   8090  H HD12 . LEU B 1 153 ? -0.669  6.061   -77.851 1.00 47.90  ? 714  LEU B HD12 1 
ATOM   8091  H HD13 . LEU B 1 153 ? -1.324  4.876   -78.682 1.00 47.90  ? 714  LEU B HD13 1 
ATOM   8092  H HD21 . LEU B 1 153 ? -2.175  6.480   -81.009 1.00 51.31  ? 714  LEU B HD21 1 
ATOM   8093  H HD22 . LEU B 1 153 ? -3.168  5.433   -80.344 1.00 51.31  ? 714  LEU B HD22 1 
ATOM   8094  H HD23 . LEU B 1 153 ? -3.606  6.951   -80.506 1.00 51.31  ? 714  LEU B HD23 1 
ATOM   8095  N N    . CYS B 1 154 ? -6.040  7.924   -76.068 1.00 36.30  ? 715  CYS B N    1 
ATOM   8096  C CA   . CYS B 1 154 ? -7.084  7.525   -75.138 1.00 38.23  ? 715  CYS B CA   1 
ATOM   8097  C C    . CYS B 1 154 ? -8.426  7.371   -75.846 1.00 33.84  ? 715  CYS B C    1 
ATOM   8098  O O    . CYS B 1 154 ? -8.704  8.028   -76.853 1.00 34.82  ? 715  CYS B O    1 
ATOM   8099  C CB   . CYS B 1 154 ? -7.210  8.550   -74.011 1.00 36.08  ? 715  CYS B CB   1 
ATOM   8100  S SG   . CYS B 1 154 ? -5.830  8.549   -72.850 1.00 43.63  ? 715  CYS B SG   1 
ATOM   8101  H H    . CYS B 1 154 ? -5.757  8.729   -75.959 1.00 43.56  ? 715  CYS B H    1 
ATOM   8102  H HA   . CYS B 1 154 ? -6.850  6.670   -74.744 1.00 45.87  ? 715  CYS B HA   1 
ATOM   8103  H HB2  . CYS B 1 154 ? -7.265  9.436   -74.401 1.00 43.30  ? 715  CYS B HB2  1 
ATOM   8104  H HB3  . CYS B 1 154 ? -8.018  8.362   -73.509 1.00 43.30  ? 715  CYS B HB3  1 
ATOM   8105  H HG   . CYS B 1 154 ? -6.026  9.383   -72.011 1.00 52.36  ? 715  CYS B HG   1 
ATOM   8106  N N    . LYS B 1 155 ? -9.263  6.488   -75.299 1.00 34.02  ? 716  LYS B N    1 
ATOM   8107  C CA   . LYS B 1 155 ? -10.607 6.240   -75.802 1.00 40.20  ? 716  LYS B CA   1 
ATOM   8108  C C    . LYS B 1 155 ? -11.587 6.218   -74.639 1.00 39.11  ? 716  LYS B C    1 
ATOM   8109  O O    . LYS B 1 155 ? -11.273 5.703   -73.562 1.00 36.87  ? 716  LYS B O    1 
ATOM   8110  C CB   . LYS B 1 155 ? -10.693 4.911   -76.566 1.00 38.18  ? 716  LYS B CB   1 
ATOM   8111  C CG   . LYS B 1 155 ? -12.061 4.656   -77.182 1.00 45.67  ? 716  LYS B CG   1 
ATOM   8112  C CD   . LYS B 1 155 ? -12.153 3.277   -77.812 1.00 52.56  ? 716  LYS B CD   1 
ATOM   8113  C CE   . LYS B 1 155 ? -13.435 3.119   -78.610 1.00 59.44  ? 716  LYS B CE   1 
ATOM   8114  N NZ   . LYS B 1 155 ? -13.469 4.026   -79.789 1.00 49.35  ? 716  LYS B NZ   1 
ATOM   8115  H H    . LYS B 1 155 ? -9.063  6.007   -74.615 1.00 40.82  ? 716  LYS B H    1 
ATOM   8116  H HA   . LYS B 1 155 ? -10.862 6.956   -76.404 1.00 48.24  ? 716  LYS B HA   1 
ATOM   8117  H HB2  . LYS B 1 155 ? -10.040 4.918   -77.283 1.00 45.81  ? 716  LYS B HB2  1 
ATOM   8118  H HB3  . LYS B 1 155 ? -10.503 4.184   -75.953 1.00 45.81  ? 716  LYS B HB3  1 
ATOM   8119  H HG2  . LYS B 1 155 ? -12.739 4.718   -76.491 1.00 54.81  ? 716  LYS B HG2  1 
ATOM   8120  H HG3  . LYS B 1 155 ? -12.227 5.316   -77.874 1.00 54.81  ? 716  LYS B HG3  1 
ATOM   8121  H HD2  . LYS B 1 155 ? -11.402 3.148   -78.413 1.00 63.07  ? 716  LYS B HD2  1 
ATOM   8122  H HD3  . LYS B 1 155 ? -12.144 2.604   -77.114 1.00 63.07  ? 716  LYS B HD3  1 
ATOM   8123  H HE2  . LYS B 1 155 ? -13.503 2.206   -78.929 1.00 71.32  ? 716  LYS B HE2  1 
ATOM   8124  H HE3  . LYS B 1 155 ? -14.193 3.332   -78.043 1.00 71.32  ? 716  LYS B HE3  1 
ATOM   8125  H HZ1  . LYS B 1 155 ? -14.229 3.914   -80.238 1.00 59.22  ? 716  LYS B HZ1  1 
ATOM   8126  H HZ2  . LYS B 1 155 ? -13.413 4.873   -79.522 1.00 59.22  ? 716  LYS B HZ2  1 
ATOM   8127  H HZ3  . LYS B 1 155 ? -12.784 3.847   -80.329 1.00 59.22  ? 716  LYS B HZ3  1 
ATOM   8128  N N    . LYS B 1 156 ? -12.776 6.773   -74.867 1.00 44.70  ? 717  LYS B N    1 
ATOM   8129  C CA   . LYS B 1 156 ? -13.855 6.795   -73.884 1.00 42.77  ? 717  LYS B CA   1 
ATOM   8130  C C    . LYS B 1 156 ? -14.896 5.763   -74.301 1.00 45.85  ? 717  LYS B C    1 
ATOM   8131  O O    . LYS B 1 156 ? -15.535 5.906   -75.349 1.00 58.07  ? 717  LYS B O    1 
ATOM   8132  C CB   . LYS B 1 156 ? -14.468 8.190   -73.782 1.00 44.05  ? 717  LYS B CB   1 
ATOM   8133  C CG   . LYS B 1 156 ? -15.739 8.279   -72.937 1.00 49.63  ? 717  LYS B CG   1 
ATOM   8134  C CD   . LYS B 1 156 ? -15.428 8.323   -71.450 1.00 52.59  ? 717  LYS B CD   1 
ATOM   8135  C CE   . LYS B 1 156 ? -15.346 9.754   -70.938 1.00 57.73  ? 717  LYS B CE   1 
ATOM   8136  N NZ   . LYS B 1 156 ? -16.649 10.471  -71.049 1.00 59.69  ? 717  LYS B NZ   1 
ATOM   8137  H H    . LYS B 1 156 ? -12.986 7.155   -75.609 1.00 53.64  ? 717  LYS B H    1 
ATOM   8138  H HA   . LYS B 1 156 ? -13.506 6.547   -73.014 1.00 51.32  ? 717  LYS B HA   1 
ATOM   8139  H HB2  . LYS B 1 156 ? -13.812 8.786   -73.387 1.00 52.86  ? 717  LYS B HB2  1 
ATOM   8140  H HB3  . LYS B 1 156 ? -14.689 8.496   -74.675 1.00 52.86  ? 717  LYS B HB3  1 
ATOM   8141  H HG2  . LYS B 1 156 ? -16.220 9.089   -73.170 1.00 59.56  ? 717  LYS B HG2  1 
ATOM   8142  H HG3  . LYS B 1 156 ? -16.291 7.500   -73.109 1.00 59.56  ? 717  LYS B HG3  1 
ATOM   8143  H HD2  . LYS B 1 156 ? -16.131 7.866   -70.962 1.00 63.11  ? 717  LYS B HD2  1 
ATOM   8144  H HD3  . LYS B 1 156 ? -14.573 7.893   -71.289 1.00 63.11  ? 717  LYS B HD3  1 
ATOM   8145  H HE2  . LYS B 1 156 ? -15.087 9.743   -70.004 1.00 69.28  ? 717  LYS B HE2  1 
ATOM   8146  H HE3  . LYS B 1 156 ? -14.689 10.240  -71.461 1.00 69.28  ? 717  LYS B HE3  1 
ATOM   8147  H HZ1  . LYS B 1 156 ? -16.565 11.302  -70.742 1.00 71.63  ? 717  LYS B HZ1  1 
ATOM   8148  H HZ2  . LYS B 1 156 ? -16.907 10.501  -71.900 1.00 71.63  ? 717  LYS B HZ2  1 
ATOM   8149  H HZ3  . LYS B 1 156 ? -17.270 10.047  -70.573 1.00 71.63  ? 717  LYS B HZ3  1 
ATOM   8150  N N    . LEU B 1 157 ? -15.068 4.731   -73.482 1.00 43.39  ? 718  LEU B N    1 
ATOM   8151  C CA   . LEU B 1 157 ? -16.067 3.711   -73.767 1.00 54.43  ? 718  LEU B CA   1 
ATOM   8152  C C    . LEU B 1 157 ? -17.466 4.248   -73.492 1.00 58.48  ? 718  LEU B C    1 
ATOM   8153  O O    . LEU B 1 157 ? -17.684 5.013   -72.548 1.00 63.84  ? 718  LEU B O    1 
ATOM   8154  C CB   . LEU B 1 157 ? -15.805 2.462   -72.926 1.00 59.86  ? 718  LEU B CB   1 
ATOM   8155  C CG   . LEU B 1 157 ? -14.740 1.501   -73.465 1.00 58.12  ? 718  LEU B CG   1 
ATOM   8156  C CD1  . LEU B 1 157 ? -13.440 2.222   -73.797 1.00 53.17  ? 718  LEU B CD1  1 
ATOM   8157  C CD2  . LEU B 1 157 ? -14.484 0.392   -72.462 1.00 58.50  ? 718  LEU B CD2  1 
ATOM   8158  H H    . LEU B 1 157 ? -14.621 4.599   -72.759 1.00 52.07  ? 718  LEU B H    1 
ATOM   8159  H HA   . LEU B 1 157 ? -16.015 3.464   -74.703 1.00 65.32  ? 718  LEU B HA   1 
ATOM   8160  H HB2  . LEU B 1 157 ? -15.520 2.742   -72.043 1.00 71.83  ? 718  LEU B HB2  1 
ATOM   8161  H HB3  . LEU B 1 157 ? -16.634 1.963   -72.854 1.00 71.83  ? 718  LEU B HB3  1 
ATOM   8162  H HG   . LEU B 1 157 ? -15.071 1.093   -74.281 1.00 69.75  ? 718  LEU B HG   1 
ATOM   8163  H HD11 . LEU B 1 157 ? -12.799 1.576   -74.133 1.00 63.80  ? 718  LEU B HD11 1 
ATOM   8164  H HD12 . LEU B 1 157 ? -13.617 2.896   -74.471 1.00 63.80  ? 718  LEU B HD12 1 
ATOM   8165  H HD13 . LEU B 1 157 ? -13.098 2.640   -72.992 1.00 63.80  ? 718  LEU B HD13 1 
ATOM   8166  H HD21 . LEU B 1 157 ? -13.808 -0.206  -72.819 1.00 70.20  ? 718  LEU B HD21 1 
ATOM   8167  H HD22 . LEU B 1 157 ? -14.173 0.785   -71.631 1.00 70.20  ? 718  LEU B HD22 1 
ATOM   8168  H HD23 . LEU B 1 157 ? -15.310 -0.093  -72.311 1.00 70.20  ? 718  LEU B HD23 1 
ATOM   8169  N N    . ALA B 1 158 ? -18.417 3.842   -74.328 1.00 73.87  ? 719  ALA B N    1 
ATOM   8170  C CA   . ALA B 1 158 ? -19.796 4.300   -74.207 1.00 74.36  ? 719  ALA B CA   1 
ATOM   8171  C C    . ALA B 1 158 ? -20.553 3.477   -73.170 1.00 72.65  ? 719  ALA B C    1 
ATOM   8172  O O    . ALA B 1 158 ? -19.978 2.614   -72.508 1.00 73.99  ? 719  ALA B O    1 
ATOM   8173  C CB   . ALA B 1 158 ? -20.496 4.226   -75.553 1.00 77.56  ? 719  ALA B CB   1 
ATOM   8174  H H    . ALA B 1 158 ? -18.287 3.297   -74.980 1.00 88.64  ? 719  ALA B H    1 
ATOM   8175  H HA   . ALA B 1 158 ? -19.799 5.225   -73.917 1.00 89.24  ? 719  ALA B HA   1 
ATOM   8176  H HB1  . ALA B 1 158 ? -21.410 4.534   -75.450 1.00 93.07  ? 719  ALA B HB1  1 
ATOM   8177  H HB2  . ALA B 1 158 ? -20.025 4.791   -76.185 1.00 93.07  ? 719  ALA B HB2  1 
ATOM   8178  H HB3  . ALA B 1 158 ? -20.489 3.306   -75.862 1.00 93.07  ? 719  ALA B HB3  1 
ATOM   8179  N N    . ARG B 1 161 ? -20.659 -0.590  -72.009 1.00 76.02  ? 722  ARG B N    1 
ATOM   8180  C CA   . ARG B 1 161 ? -19.636 -1.347  -72.721 1.00 73.95  ? 722  ARG B CA   1 
ATOM   8181  C C    . ARG B 1 161 ? -18.338 -1.412  -71.925 1.00 70.02  ? 722  ARG B C    1 
ATOM   8182  O O    . ARG B 1 161 ? -17.753 -0.383  -71.585 1.00 68.28  ? 722  ARG B O    1 
ATOM   8183  C CB   . ARG B 1 161 ? -19.373 -0.731  -74.093 1.00 67.80  ? 722  ARG B CB   1 
ATOM   8184  C CG   . ARG B 1 161 ? -19.946 -1.536  -75.245 1.00 72.28  ? 722  ARG B CG   1 
ATOM   8185  C CD   . ARG B 1 161 ? -19.464 -1.013  -76.586 1.00 70.33  ? 722  ARG B CD   1 
ATOM   8186  N NE   . ARG B 1 161 ? -19.033 -2.093  -77.470 1.00 66.56  ? 722  ARG B NE   1 
ATOM   8187  C CZ   . ARG B 1 161 ? -18.496 -1.911  -78.672 1.00 69.48  ? 722  ARG B CZ   1 
ATOM   8188  N NH1  . ARG B 1 161 ? -18.318 -0.686  -79.149 1.00 71.58  ? 722  ARG B NH1  1 
ATOM   8189  N NH2  . ARG B 1 161 ? -18.133 -2.958  -79.402 1.00 81.12  ? 722  ARG B NH2  1 
ATOM   8190  H H    . ARG B 1 161 ? -21.442 -0.944  -72.041 1.00 91.22  ? 722  ARG B H    1 
ATOM   8191  H HA   . ARG B 1 161 ? -19.951 -2.255  -72.855 1.00 88.74  ? 722  ARG B HA   1 
ATOM   8192  H HB2  . ARG B 1 161 ? -19.773 0.153   -74.121 1.00 81.36  ? 722  ARG B HB2  1 
ATOM   8193  H HB3  . ARG B 1 161 ? -18.415 -0.662  -74.227 1.00 81.36  ? 722  ARG B HB3  1 
ATOM   8194  H HG2  . ARG B 1 161 ? -19.664 -2.460  -75.160 1.00 86.74  ? 722  ARG B HG2  1 
ATOM   8195  H HG3  . ARG B 1 161 ? -20.914 -1.478  -75.225 1.00 86.74  ? 722  ARG B HG3  1 
ATOM   8196  H HD2  . ARG B 1 161 ? -20.189 -0.537  -77.021 1.00 84.40  ? 722  ARG B HD2  1 
ATOM   8197  H HD3  . ARG B 1 161 ? -18.711 -0.418  -76.444 1.00 84.40  ? 722  ARG B HD3  1 
ATOM   8198  H HE   . ARG B 1 161 ? -19.133 -2.902  -77.193 1.00 79.87  ? 722  ARG B HE   1 
ATOM   8199  H HH11 . ARG B 1 161 ? -18.551 -0.004  -78.680 1.00 85.90  ? 722  ARG B HH11 1 
ATOM   8200  H HH12 . ARG B 1 161 ? -17.970 -0.574  -79.928 1.00 85.90  ? 722  ARG B HH12 1 
ATOM   8201  H HH21 . ARG B 1 161 ? -18.246 -3.754  -79.098 1.00 97.35  ? 722  ARG B HH21 1 
ATOM   8202  H HH22 . ARG B 1 161 ? -17.786 -2.840  -80.180 1.00 97.35  ? 722  ARG B HH22 1 
ATOM   8203  N N    . HIS B 1 162 ? -17.900 -2.632  -71.632 1.00 69.21  ? 723  HIS B N    1 
ATOM   8204  C CA   . HIS B 1 162 ? -16.671 -2.866  -70.879 1.00 70.81  ? 723  HIS B CA   1 
ATOM   8205  C C    . HIS B 1 162 ? -15.481 -3.094  -71.806 1.00 60.95  ? 723  HIS B C    1 
ATOM   8206  O O    . HIS B 1 162 ? -14.390 -3.440  -71.357 1.00 53.63  ? 723  HIS B O    1 
ATOM   8207  C CB   . HIS B 1 162 ? -16.843 -4.067  -69.944 1.00 74.93  ? 723  HIS B CB   1 
ATOM   8208  H H    . HIS B 1 162 ? -18.305 -3.354  -71.862 1.00 83.05  ? 723  HIS B H    1 
ATOM   8209  H HA   . HIS B 1 162 ? -16.481 -2.086  -70.334 1.00 84.97  ? 723  HIS B HA   1 
HETATM 8210  N N    . SEP B 1 163 ? -15.709 -2.911  -73.101 1.00 64.52  ? 724  SEP B N    1 
HETATM 8211  C CA   . SEP B 1 163 ? -14.757 -3.313  -74.126 1.00 61.83  ? 724  SEP B CA   1 
HETATM 8212  C CB   . SEP B 1 163 ? -15.135 -4.710  -74.604 1.00 69.02  ? 724  SEP B CB   1 
HETATM 8213  O OG   . SEP B 1 163 ? -16.548 -4.872  -74.505 1.00 84.14  ? 724  SEP B OG   1 
HETATM 8214  C C    . SEP B 1 163 ? -14.784 -2.349  -75.304 1.00 60.31  ? 724  SEP B C    1 
HETATM 8215  O O    . SEP B 1 163 ? -15.722 -1.565  -75.452 1.00 62.94  ? 724  SEP B O    1 
HETATM 8216  P P    . SEP B 1 163 ? -17.201 -5.868  -75.593 1.00 78.10  ? 724  SEP B P    1 
HETATM 8217  O O1P  . SEP B 1 163 ? -16.578 -5.573  -77.042 1.00 59.56  ? 724  SEP B O1P  1 
HETATM 8218  O O2P  . SEP B 1 163 ? -18.794 -5.630  -75.686 1.00 78.52  ? 724  SEP B O2P  1 
HETATM 8219  O O3P  . SEP B 1 163 ? -16.929 -7.397  -75.165 1.00 78.92  ? 724  SEP B O3P  1 
HETATM 8220  H HA   . SEP B 1 163 ? -13.851 -3.337  -73.753 1.00 74.19  ? 724  SEP B HA   1 
HETATM 8221  H HB2  . SEP B 1 163 ? -14.696 -5.370  -74.045 1.00 82.82  ? 724  SEP B HB2  1 
HETATM 8222  H HB3  . SEP B 1 163 ? -14.863 -4.817  -75.529 1.00 82.82  ? 724  SEP B HB3  1 
ATOM   8223  N N    . PHE B 1 164 ? -13.753 -2.418  -76.142 1.00 54.71  ? 725  PHE B N    1 
ATOM   8224  C CA   . PHE B 1 164 ? -13.686 -1.609  -77.357 1.00 52.87  ? 725  PHE B CA   1 
ATOM   8225  C C    . PHE B 1 164 ? -13.110 -2.422  -78.511 1.00 57.05  ? 725  PHE B C    1 
ATOM   8226  O O    . PHE B 1 164 ? -12.358 -3.371  -78.298 1.00 50.52  ? 725  PHE B O    1 
ATOM   8227  C CB   . PHE B 1 164 ? -12.844 -0.353  -77.122 1.00 48.18  ? 725  PHE B CB   1 
ATOM   8228  C CG   . PHE B 1 164 ? -11.403 -0.634  -76.792 1.00 50.87  ? 725  PHE B CG   1 
ATOM   8229  C CD1  . PHE B 1 164 ? -11.016 -0.916  -75.491 1.00 43.89  ? 725  PHE B CD1  1 
ATOM   8230  C CD2  . PHE B 1 164 ? -10.433 -0.603  -77.781 1.00 46.12  ? 725  PHE B CD2  1 
ATOM   8231  C CE1  . PHE B 1 164 ? -9.690  -1.168  -75.186 1.00 35.35  ? 725  PHE B CE1  1 
ATOM   8232  C CE2  . PHE B 1 164 ? -9.108  -0.854  -77.481 1.00 49.20  ? 725  PHE B CE2  1 
ATOM   8233  C CZ   . PHE B 1 164 ? -8.736  -1.136  -76.182 1.00 43.55  ? 725  PHE B CZ   1 
ATOM   8234  H H    . PHE B 1 164 ? -13.073 -2.931  -76.028 1.00 65.65  ? 725  PHE B H    1 
ATOM   8235  H HA   . PHE B 1 164 ? -14.582 -1.330  -77.602 1.00 63.44  ? 725  PHE B HA   1 
ATOM   8236  H HB2  . PHE B 1 164 ? -12.863 0.189   -77.926 1.00 57.81  ? 725  PHE B HB2  1 
ATOM   8237  H HB3  . PHE B 1 164 ? -13.226 0.144   -76.382 1.00 57.81  ? 725  PHE B HB3  1 
ATOM   8238  H HD1  . PHE B 1 164 ? -11.655 -0.938  -74.816 1.00 52.67  ? 725  PHE B HD1  1 
ATOM   8239  H HD2  . PHE B 1 164 ? -10.678 -0.413  -78.658 1.00 55.35  ? 725  PHE B HD2  1 
ATOM   8240  H HE1  . PHE B 1 164 ? -9.441  -1.358  -74.310 1.00 42.42  ? 725  PHE B HE1  1 
ATOM   8241  H HE2  . PHE B 1 164 ? -8.467  -0.832  -78.154 1.00 59.04  ? 725  PHE B HE2  1 
ATOM   8242  H HZ   . PHE B 1 164 ? -7.845  -1.306  -75.979 1.00 52.26  ? 725  PHE B HZ   1 
HETATM 8243  N N    . SEP B 1 165 ? -13.466 -2.041  -79.735 1.00 59.86  ? 726  SEP B N    1 
HETATM 8244  C CA   . SEP B 1 165 ? -13.036 -2.771  -80.922 1.00 50.70  ? 726  SEP B CA   1 
HETATM 8245  C CB   . SEP B 1 165 ? -13.990 -2.504  -82.084 1.00 50.93  ? 726  SEP B CB   1 
HETATM 8246  O OG   . SEP B 1 165 ? -15.318 -2.322  -81.625 1.00 54.14  ? 726  SEP B OG   1 
HETATM 8247  C C    . SEP B 1 165 ? -11.624 -2.371  -81.329 1.00 49.48  ? 726  SEP B C    1 
HETATM 8248  O O    . SEP B 1 165 ? -11.100 -1.349  -80.883 1.00 50.73  ? 726  SEP B O    1 
HETATM 8249  P P    . SEP B 1 165 ? -16.158 -1.454  -82.691 1.00 67.22  ? 726  SEP B P    1 
HETATM 8250  O O1P  . SEP B 1 165 ? -16.209 -2.236  -84.097 1.00 74.53  ? 726  SEP B O1P  1 
HETATM 8251  O O2P  . SEP B 1 165 ? -17.656 -1.237  -82.140 1.00 71.23  ? 726  SEP B O2P  1 
HETATM 8252  O O3P  . SEP B 1 165 ? -15.457 -0.017  -82.898 1.00 54.14  ? 726  SEP B O3P  1 
HETATM 8253  H H    . SEP B 1 165 ? -13.959 -1.358  -79.905 1.00 71.83  ? 726  SEP B H    1 
HETATM 8254  H HA   . SEP B 1 165 ? -13.042 -3.733  -80.732 1.00 60.84  ? 726  SEP B HA   1 
HETATM 8255  H HB2  . SEP B 1 165 ? -13.968 -3.262  -82.690 1.00 61.12  ? 726  SEP B HB2  1 
HETATM 8256  H HB3  . SEP B 1 165 ? -13.704 -1.702  -82.548 1.00 61.12  ? 726  SEP B HB3  1 
ATOM   8257  N N    . ARG B 1 166 ? -11.025 -3.181  -82.195 1.00 50.26  ? 727  ARG B N    1 
ATOM   8258  C CA   . ARG B 1 166 ? -9.690  -2.921  -82.722 1.00 46.23  ? 727  ARG B CA   1 
ATOM   8259  C C    . ARG B 1 166 ? -9.762  -2.079  -83.996 1.00 40.75  ? 727  ARG B C    1 
ATOM   8260  O O    . ARG B 1 166 ? -8.750  -1.861  -84.663 1.00 42.73  ? 727  ARG B O    1 
ATOM   8261  C CB   . ARG B 1 166 ? -8.961  -4.240  -82.984 1.00 45.63  ? 727  ARG B CB   1 
ATOM   8262  C CG   . ARG B 1 166 ? -8.231  -4.777  -81.762 1.00 57.55  ? 727  ARG B CG   1 
ATOM   8263  C CD   . ARG B 1 166 ? -8.125  -6.294  -81.770 1.00 58.18  ? 727  ARG B CD   1 
ATOM   8264  N NE   . ARG B 1 166 ? -9.394  -6.932  -81.420 1.00 59.49  ? 727  ARG B NE   1 
ATOM   8265  C CZ   . ARG B 1 166 ? -9.530  -7.956  -80.580 1.00 64.23  ? 727  ARG B CZ   1 
ATOM   8266  N NH1  . ARG B 1 166 ? -8.477  -8.490  -79.976 1.00 67.45  ? 727  ARG B NH1  1 
ATOM   8267  N NH2  . ARG B 1 166 ? -10.735 -8.450  -80.339 1.00 69.01  ? 727  ARG B NH2  1 
ATOM   8268  H H    . ARG B 1 166 ? -11.380 -3.903  -82.500 1.00 60.31  ? 727  ARG B H    1 
ATOM   8269  H HA   . ARG B 1 166 ? -9.182  -2.424  -82.062 1.00 55.48  ? 727  ARG B HA   1 
ATOM   8270  H HB2  . ARG B 1 166 ? -9.608  -4.907  -83.261 1.00 54.76  ? 727  ARG B HB2  1 
ATOM   8271  H HB3  . ARG B 1 166 ? -8.306  -4.103  -83.686 1.00 54.76  ? 727  ARG B HB3  1 
ATOM   8272  H HG2  . ARG B 1 166 ? -7.332  -4.413  -81.745 1.00 69.06  ? 727  ARG B HG2  1 
ATOM   8273  H HG3  . ARG B 1 166 ? -8.713  -4.513  -80.963 1.00 69.06  ? 727  ARG B HG3  1 
ATOM   8274  H HD2  . ARG B 1 166 ? -7.872  -6.592  -82.657 1.00 69.81  ? 727  ARG B HD2  1 
ATOM   8275  H HD3  . ARG B 1 166 ? -7.459  -6.570  -81.121 1.00 69.81  ? 727  ARG B HD3  1 
ATOM   8276  H HE   . ARG B 1 166 ? -10.108 -6.621  -81.785 1.00 71.38  ? 727  ARG B HE   1 
ATOM   8277  H HH11 . ARG B 1 166 ? -7.690  -8.176  -80.126 1.00 80.94  ? 727  ARG B HH11 1 
ATOM   8278  H HH12 . ARG B 1 166 ? -8.580  -9.151  -79.436 1.00 80.94  ? 727  ARG B HH12 1 
ATOM   8279  H HH21 . ARG B 1 166 ? -11.425 -8.111  -80.725 1.00 82.82  ? 727  ARG B HH21 1 
ATOM   8280  H HH22 . ARG B 1 166 ? -10.828 -9.112  -79.797 1.00 82.82  ? 727  ARG B HH22 1 
ATOM   8281  N N    . ARG B 1 167 ? -10.964 -1.609  -84.322 1.00 36.57  ? 728  ARG B N    1 
ATOM   8282  C CA   . ARG B 1 167 ? -11.216 -0.877  -85.560 1.00 46.24  ? 728  ARG B CA   1 
ATOM   8283  C C    . ARG B 1 167 ? -10.252 0.288   -85.795 1.00 48.92  ? 728  ARG B C    1 
ATOM   8284  O O    . ARG B 1 167 ? -9.926  0.601   -86.937 1.00 46.14  ? 728  ARG B O    1 
ATOM   8285  C CB   . ARG B 1 167 ? -12.652 -0.347  -85.564 1.00 52.33  ? 728  ARG B CB   1 
ATOM   8286  H H    . ARG B 1 167 ? -11.664 -1.705  -83.832 1.00 43.88  ? 728  ARG B H    1 
ATOM   8287  H HA   . ARG B 1 167 ? -11.125 -1.489  -86.307 1.00 55.49  ? 728  ARG B HA   1 
HETATM 8288  N N    . SEP B 1 168 ? -9.783  0.914   -84.721 1.00 41.29  ? 729  SEP B N    1 
HETATM 8289  C CA   . SEP B 1 168 ? -8.925  2.093   -84.839 1.00 37.48  ? 729  SEP B CA   1 
HETATM 8290  C CB   . SEP B 1 168 ? -9.027  2.947   -83.574 1.00 40.06  ? 729  SEP B CB   1 
HETATM 8291  O OG   . SEP B 1 168 ? -10.341 3.456   -83.415 1.00 46.83  ? 729  SEP B OG   1 
HETATM 8292  C C    . SEP B 1 168 ? -7.461  1.743   -85.100 1.00 41.44  ? 729  SEP B C    1 
HETATM 8293  O O    . SEP B 1 168 ? -6.599  2.623   -85.097 1.00 44.56  ? 729  SEP B O    1 
HETATM 8294  P P    . SEP B 1 168 ? -10.558 3.990   -81.915 1.00 38.71  ? 729  SEP B P    1 
HETATM 8295  O O1P  . SEP B 1 168 ? -12.040 4.604   -81.771 1.00 45.38  ? 729  SEP B O1P  1 
HETATM 8296  O O2P  . SEP B 1 168 ? -9.475  5.138   -81.595 1.00 38.99  ? 729  SEP B O2P  1 
HETATM 8297  O O3P  . SEP B 1 168 ? -10.385 2.760   -80.893 1.00 50.38  ? 729  SEP B O3P  1 
HETATM 8298  H H    . SEP B 1 168 ? -9.946  0.678   -83.910 1.00 49.55  ? 729  SEP B H    1 
HETATM 8299  H HA   . SEP B 1 168 ? -9.240  2.635   -85.592 1.00 44.97  ? 729  SEP B HA   1 
HETATM 8300  H HB2  . SEP B 1 168 ? -8.407  3.690   -83.643 1.00 48.07  ? 729  SEP B HB2  1 
HETATM 8301  H HB3  . SEP B 1 168 ? -8.805  2.400   -82.805 1.00 48.07  ? 729  SEP B HB3  1 
ATOM   8302  N N    . GLY B 1 169 ? -7.184  0.465   -85.333 1.00 49.05  ? 730  GLY B N    1 
ATOM   8303  C CA   . GLY B 1 169 ? -5.827  0.004   -85.548 1.00 49.41  ? 730  GLY B CA   1 
ATOM   8304  C C    . GLY B 1 169 ? -5.224  -0.484  -84.244 1.00 51.85  ? 730  GLY B C    1 
ATOM   8305  O O    . GLY B 1 169 ? -5.954  -0.775  -83.296 1.00 51.03  ? 730  GLY B O    1 
ATOM   8306  H H    . GLY B 1 169 ? -7.775  -0.159  -85.371 1.00 58.86  ? 730  GLY B H    1 
ATOM   8307  H HA2  . GLY B 1 169 ? -5.822  -0.724  -86.188 1.00 59.29  ? 730  GLY B HA2  1 
ATOM   8308  H HA3  . GLY B 1 169 ? -5.283  0.730   -85.893 1.00 59.29  ? 730  GLY B HA3  1 
ATOM   8309  N N    . VAL B 1 170 ? -3.898  -0.577  -84.192 1.00 53.91  ? 731  VAL B N    1 
ATOM   8310  C CA   . VAL B 1 170 ? -3.203  -0.975  -82.971 1.00 48.24  ? 731  VAL B CA   1 
ATOM   8311  C C    . VAL B 1 170 ? -2.559  0.264   -82.360 1.00 44.71  ? 731  VAL B C    1 
ATOM   8312  O O    . VAL B 1 170 ? -1.517  0.721   -82.850 1.00 44.31  ? 731  VAL B O    1 
ATOM   8313  C CB   . VAL B 1 170 ? -2.148  -2.054  -83.261 1.00 43.78  ? 731  VAL B CB   1 
ATOM   8314  H H    . VAL B 1 170 ? -3.374  -0.413  -84.854 1.00 64.69  ? 731  VAL B H    1 
ATOM   8315  H HA   . VAL B 1 170 ? -3.843  -1.334  -82.337 1.00 57.89  ? 731  VAL B HA   1 
ATOM   8316  N N    . PRO B 1 171 ? -3.129  0.833   -81.302 1.00 45.13  ? 732  PRO B N    1 
ATOM   8317  C CA   . PRO B 1 171 ? -2.444  1.901   -80.571 1.00 46.77  ? 732  PRO B CA   1 
ATOM   8318  C C    . PRO B 1 171 ? -1.375  1.340   -79.646 1.00 43.70  ? 732  PRO B C    1 
ATOM   8319  O O    . PRO B 1 171 ? -1.336  0.145   -79.347 1.00 52.40  ? 732  PRO B O    1 
ATOM   8320  C CB   . PRO B 1 171 ? -3.576  2.563   -79.780 1.00 44.66  ? 732  PRO B CB   1 
ATOM   8321  C CG   . PRO B 1 171 ? -4.504  1.444   -79.503 1.00 49.49  ? 732  PRO B CG   1 
ATOM   8322  C CD   . PRO B 1 171 ? -4.459  0.559   -80.731 1.00 49.11  ? 732  PRO B CD   1 
ATOM   8323  H HA   . PRO B 1 171 ? -2.050  2.542   -81.183 1.00 56.12  ? 732  PRO B HA   1 
ATOM   8324  H HB2  . PRO B 1 171 ? -3.228  2.939   -78.956 1.00 53.59  ? 732  PRO B HB2  1 
ATOM   8325  H HB3  . PRO B 1 171 ? -4.004  3.245   -80.321 1.00 53.59  ? 732  PRO B HB3  1 
ATOM   8326  H HG2  . PRO B 1 171 ? -4.202  0.957   -78.720 1.00 59.38  ? 732  PRO B HG2  1 
ATOM   8327  H HG3  . PRO B 1 171 ? -5.400  1.790   -79.365 1.00 59.38  ? 732  PRO B HG3  1 
ATOM   8328  H HD2  . PRO B 1 171 ? -4.533  -0.375  -80.479 1.00 58.93  ? 732  PRO B HD2  1 
ATOM   8329  H HD3  . PRO B 1 171 ? -5.155  0.814   -81.358 1.00 58.93  ? 732  PRO B HD3  1 
ATOM   8330  N N    . GLY B 1 172 ? -0.502  2.230   -79.196 1.00 39.90  ? 733  GLY B N    1 
ATOM   8331  C CA   . GLY B 1 172 ? 0.538   1.888   -78.247 1.00 42.07  ? 733  GLY B CA   1 
ATOM   8332  C C    . GLY B 1 172 ? 1.908   1.841   -78.900 1.00 38.59  ? 733  GLY B C    1 
ATOM   8333  O O    . GLY B 1 172 ? 2.070   2.022   -80.108 1.00 46.53  ? 733  GLY B O    1 
ATOM   8334  H H    . GLY B 1 172 ? -0.495  3.057   -79.433 1.00 47.88  ? 733  GLY B H    1 
ATOM   8335  H HA2  . GLY B 1 172 ? 0.557   2.547   -77.535 1.00 50.48  ? 733  GLY B HA2  1 
ATOM   8336  H HA3  . GLY B 1 172 ? 0.351   1.019   -77.859 1.00 50.48  ? 733  GLY B HA3  1 
ATOM   8337  N N    . THR B 1 173 ? 2.900   1.586   -78.053 1.00 35.33  ? 734  THR B N    1 
ATOM   8338  C CA   . THR B 1 173 ? 4.303   1.594   -78.437 1.00 35.95  ? 734  THR B CA   1 
ATOM   8339  C C    . THR B 1 173 ? 4.852   0.174   -78.392 1.00 41.18  ? 734  THR B C    1 
ATOM   8340  O O    . THR B 1 173 ? 4.538   -0.592  -77.475 1.00 40.20  ? 734  THR B O    1 
ATOM   8341  C CB   . THR B 1 173 ? 5.115   2.500   -77.507 1.00 43.14  ? 734  THR B CB   1 
ATOM   8342  O OG1  . THR B 1 173 ? 4.466   3.774   -77.393 1.00 44.41  ? 734  THR B OG1  1 
ATOM   8343  C CG2  . THR B 1 173 ? 6.525   2.699   -78.043 1.00 36.54  ? 734  THR B CG2  1 
ATOM   8344  H H    . THR B 1 173 ? 2.778   1.400   -77.222 1.00 42.40  ? 734  THR B H    1 
ATOM   8345  H HA   . THR B 1 173 ? 4.389   1.928   -79.343 1.00 43.14  ? 734  THR B HA   1 
ATOM   8346  H HB   . THR B 1 173 ? 5.176   2.091   -76.630 1.00 51.77  ? 734  THR B HB   1 
ATOM   8347  H HG1  . THR B 1 173 ? 3.694   3.676   -77.078 1.00 53.30  ? 734  THR B HG1  1 
ATOM   8348  H HG21 . THR B 1 173 ? 7.028   3.274   -77.447 1.00 43.84  ? 734  THR B HG21 1 
ATOM   8349  H HG22 . THR B 1 173 ? 6.976   1.843   -78.112 1.00 43.84  ? 734  THR B HG22 1 
ATOM   8350  H HG23 . THR B 1 173 ? 6.490   3.108   -78.922 1.00 43.84  ? 734  THR B HG23 1 
ATOM   8351  N N    . GLU B 1 174 ? 5.680   -0.161  -79.381 1.00 38.18  ? 735  GLU B N    1 
ATOM   8352  C CA   . GLU B 1 174 ? 6.182   -1.520  -79.540 1.00 46.42  ? 735  GLU B CA   1 
ATOM   8353  C C    . GLU B 1 174 ? 6.818   -2.028  -78.252 1.00 41.09  ? 735  GLU B C    1 
ATOM   8354  O O    . GLU B 1 174 ? 7.644   -1.347  -77.638 1.00 39.58  ? 735  GLU B O    1 
ATOM   8355  C CB   . GLU B 1 174 ? 7.202   -1.562  -80.678 1.00 49.51  ? 735  GLU B CB   1 
ATOM   8356  C CG   . GLU B 1 174 ? 7.578   -2.965  -81.128 1.00 60.47  ? 735  GLU B CG   1 
ATOM   8357  C CD   . GLU B 1 174 ? 8.765   -2.976  -82.070 1.00 68.00  ? 735  GLU B CD   1 
ATOM   8358  O OE1  . GLU B 1 174 ? 9.665   -2.125  -81.910 1.00 78.03  ? 735  GLU B OE1  1 
ATOM   8359  O OE2  . GLU B 1 174 ? 8.797   -3.836  -82.975 1.00 74.53  ? 735  GLU B OE2  1 
ATOM   8360  H H    . GLU B 1 174 ? 5.966   0.388   -79.977 1.00 45.81  ? 735  GLU B H    1 
ATOM   8361  H HA   . GLU B 1 174 ? 5.446   -2.109  -79.769 1.00 55.70  ? 735  GLU B HA   1 
ATOM   8362  H HB2  . GLU B 1 174 ? 6.832   -1.096  -81.444 1.00 59.41  ? 735  GLU B HB2  1 
ATOM   8363  H HB3  . GLU B 1 174 ? 8.013   -1.118  -80.386 1.00 59.41  ? 735  GLU B HB3  1 
ATOM   8364  H HG2  . GLU B 1 174 ? 7.807   -3.496  -80.349 1.00 72.57  ? 735  GLU B HG2  1 
ATOM   8365  H HG3  . GLU B 1 174 ? 6.823   -3.362  -81.591 1.00 72.57  ? 735  GLU B HG3  1 
ATOM   8366  N N    . GLY B 1 175 ? 6.423   -3.235  -77.850 1.00 38.68  ? 736  GLY B N    1 
ATOM   8367  C CA   . GLY B 1 175 ? 6.910   -3.853  -76.639 1.00 46.04  ? 736  GLY B CA   1 
ATOM   8368  C C    . GLY B 1 175 ? 6.085   -3.565  -75.403 1.00 36.62  ? 736  GLY B C    1 
ATOM   8369  O O    . GLY B 1 175 ? 6.213   -4.287  -74.410 1.00 46.37  ? 736  GLY B O    1 
ATOM   8370  H H    . GLY B 1 175 ? 5.857   -3.721  -78.279 1.00 46.42  ? 736  GLY B H    1 
ATOM   8371  H HA2  . GLY B 1 175 ? 6.935   -4.815  -76.765 1.00 55.25  ? 736  GLY B HA2  1 
ATOM   8372  H HA3  . GLY B 1 175 ? 7.815   -3.548  -76.473 1.00 55.25  ? 736  GLY B HA3  1 
ATOM   8373  N N    . TRP B 1 176 ? 5.292   -2.497  -75.411 1.00 32.34  ? 737  TRP B N    1 
ATOM   8374  C CA   . TRP B 1 176 ? 4.374   -2.189  -74.322 1.00 34.91  ? 737  TRP B CA   1 
ATOM   8375  C C    . TRP B 1 176 ? 2.926   -2.565  -74.623 1.00 33.13  ? 737  TRP B C    1 
ATOM   8376  O O    . TRP B 1 176 ? 2.052   -2.312  -73.788 1.00 30.88  ? 737  TRP B O    1 
ATOM   8377  C CB   . TRP B 1 176 ? 4.494   -0.705  -73.971 1.00 30.02  ? 737  TRP B CB   1 
ATOM   8378  C CG   . TRP B 1 176 ? 5.929   -0.346  -73.748 1.00 31.31  ? 737  TRP B CG   1 
ATOM   8379  C CD1  . TRP B 1 176 ? 6.803   0.147   -74.672 1.00 35.83  ? 737  TRP B CD1  1 
ATOM   8380  C CD2  . TRP B 1 176 ? 6.674   -0.499  -72.534 1.00 35.32  ? 737  TRP B CD2  1 
ATOM   8381  N NE1  . TRP B 1 176 ? 8.041   0.326   -74.106 1.00 39.70  ? 737  TRP B NE1  1 
ATOM   8382  C CE2  . TRP B 1 176 ? 7.989   -0.063  -72.793 1.00 38.69  ? 737  TRP B CE2  1 
ATOM   8383  C CE3  . TRP B 1 176 ? 6.355   -0.954  -71.250 1.00 31.68  ? 737  TRP B CE3  1 
ATOM   8384  C CZ2  . TRP B 1 176 ? 8.982   -0.066  -71.816 1.00 37.68  ? 737  TRP B CZ2  1 
ATOM   8385  C CZ3  . TRP B 1 176 ? 7.342   -0.954  -70.283 1.00 31.54  ? 737  TRP B CZ3  1 
ATOM   8386  C CH2  . TRP B 1 176 ? 8.639   -0.514  -70.571 1.00 37.35  ? 737  TRP B CH2  1 
ATOM   8387  H H    . TRP B 1 176 ? 5.268   -1.924  -76.051 1.00 38.81  ? 737  TRP B H    1 
ATOM   8388  H HA   . TRP B 1 176 ? 4.647   -2.694  -73.540 1.00 41.89  ? 737  TRP B HA   1 
ATOM   8389  H HB2  . TRP B 1 176 ? 4.152   -0.169  -74.704 1.00 36.03  ? 737  TRP B HB2  1 
ATOM   8390  H HB3  . TRP B 1 176 ? 4.000   -0.523  -73.156 1.00 36.03  ? 737  TRP B HB3  1 
ATOM   8391  H HD1  . TRP B 1 176 ? 6.591   0.336   -75.558 1.00 43.00  ? 737  TRP B HD1  1 
ATOM   8392  H HE1  . TRP B 1 176 ? 8.736   0.633   -74.509 1.00 47.64  ? 737  TRP B HE1  1 
ATOM   8393  H HE3  . TRP B 1 176 ? 5.495   -1.247  -71.051 1.00 38.01  ? 737  TRP B HE3  1 
ATOM   8394  H HZ2  . TRP B 1 176 ? 9.844   0.228   -72.004 1.00 45.21  ? 737  TRP B HZ2  1 
ATOM   8395  H HZ3  . TRP B 1 176 ? 7.141   -1.254  -69.426 1.00 37.85  ? 737  TRP B HZ3  1 
ATOM   8396  H HH2  . TRP B 1 176 ? 9.283   -0.526  -69.899 1.00 44.82  ? 737  TRP B HH2  1 
ATOM   8397  N N    . ILE B 1 177 ? 2.649   -3.160  -75.784 1.00 36.45  ? 738  ILE B N    1 
ATOM   8398  C CA   . ILE B 1 177 ? 1.281   -3.438  -76.212 1.00 36.42  ? 738  ILE B CA   1 
ATOM   8399  C C    . ILE B 1 177 ? 0.859   -4.802  -75.687 1.00 37.17  ? 738  ILE B C    1 
ATOM   8400  O O    . ILE B 1 177 ? 1.640   -5.760  -75.703 1.00 41.96  ? 738  ILE B O    1 
ATOM   8401  C CB   . ILE B 1 177 ? 1.162   -3.374  -77.749 1.00 35.36  ? 738  ILE B CB   1 
ATOM   8402  C CG1  . ILE B 1 177 ? 1.770   -2.070  -78.274 1.00 41.99  ? 738  ILE B CG1  1 
ATOM   8403  C CG2  . ILE B 1 177 ? -0.299  -3.498  -78.170 1.00 33.03  ? 738  ILE B CG2  1 
ATOM   8404  C CD1  . ILE B 1 177 ? 1.819   -1.961  -79.784 1.00 40.95  ? 738  ILE B CD1  1 
ATOM   8405  H H    . ILE B 1 177 ? 3.246   -3.416  -76.347 1.00 43.74  ? 738  ILE B H    1 
ATOM   8406  H HA   . ILE B 1 177 ? 0.686   -2.771  -75.834 1.00 43.70  ? 738  ILE B HA   1 
ATOM   8407  H HB   . ILE B 1 177 ? 1.656   -4.118  -78.127 1.00 42.44  ? 738  ILE B HB   1 
ATOM   8408  H HG12 . ILE B 1 177 ? 1.243   -1.327  -77.942 1.00 50.38  ? 738  ILE B HG12 1 
ATOM   8409  H HG13 . ILE B 1 177 ? 2.680   -1.998  -77.944 1.00 50.38  ? 738  ILE B HG13 1 
ATOM   8410  H HG21 . ILE B 1 177 ? -0.353  -3.456  -79.137 1.00 39.63  ? 738  ILE B HG21 1 
ATOM   8411  H HG22 . ILE B 1 177 ? -0.646  -4.348  -77.855 1.00 39.63  ? 738  ILE B HG22 1 
ATOM   8412  H HG23 . ILE B 1 177 ? -0.803  -2.768  -77.777 1.00 39.63  ? 738  ILE B HG23 1 
ATOM   8413  H HD11 . ILE B 1 177 ? 2.217   -1.110  -80.026 1.00 49.14  ? 738  ILE B HD11 1 
ATOM   8414  H HD12 . ILE B 1 177 ? 2.356   -2.689  -80.136 1.00 49.14  ? 738  ILE B HD12 1 
ATOM   8415  H HD13 . ILE B 1 177 ? 0.916   -2.016  -80.134 1.00 49.14  ? 738  ILE B HD13 1 
ATOM   8416  N N    . ALA B 1 178 ? -0.385  -4.892  -75.224 1.00 38.10  ? 739  ALA B N    1 
ATOM   8417  C CA   . ALA B 1 178 ? -0.900  -6.153  -74.719 1.00 41.06  ? 739  ALA B CA   1 
ATOM   8418  C C    . ALA B 1 178 ? -1.071  -7.151  -75.865 1.00 43.28  ? 739  ALA B C    1 
ATOM   8419  O O    . ALA B 1 178 ? -1.256  -6.756  -77.019 1.00 41.45  ? 739  ALA B O    1 
ATOM   8420  C CB   . ALA B 1 178 ? -2.233  -5.941  -74.008 1.00 36.07  ? 739  ALA B CB   1 
ATOM   8421  H H    . ALA B 1 178 ? -0.945  -4.241  -75.193 1.00 45.72  ? 739  ALA B H    1 
ATOM   8422  H HA   . ALA B 1 178 ? -0.270  -6.525  -74.082 1.00 49.27  ? 739  ALA B HA   1 
ATOM   8423  H HB1  . ALA B 1 178 ? -2.555  -6.795  -73.681 1.00 43.29  ? 739  ALA B HB1  1 
ATOM   8424  H HB2  . ALA B 1 178 ? -2.101  -5.330  -73.266 1.00 43.29  ? 739  ALA B HB2  1 
ATOM   8425  H HB3  . ALA B 1 178 ? -2.869  -5.565  -74.637 1.00 43.29  ? 739  ALA B HB3  1 
ATOM   8426  N N    . PRO B 1 179 ? -1.004  -8.457  -75.574 1.00 44.75  ? 740  PRO B N    1 
ATOM   8427  C CA   . PRO B 1 179 ? -1.097  -9.443  -76.666 1.00 49.41  ? 740  PRO B CA   1 
ATOM   8428  C C    . PRO B 1 179 ? -2.433  -9.436  -77.387 1.00 44.52  ? 740  PRO B C    1 
ATOM   8429  O O    . PRO B 1 179 ? -2.460  -9.531  -78.620 1.00 51.05  ? 740  PRO B O    1 
ATOM   8430  C CB   . PRO B 1 179 ? -0.849  -10.782 -75.953 1.00 45.79  ? 740  PRO B CB   1 
ATOM   8431  C CG   . PRO B 1 179 ? -0.175  -10.425 -74.670 1.00 48.30  ? 740  PRO B CG   1 
ATOM   8432  C CD   . PRO B 1 179 ? -0.735  -9.100  -74.278 1.00 44.66  ? 740  PRO B CD   1 
ATOM   8433  H HA   . PRO B 1 179 ? -0.389  -9.292  -77.311 1.00 59.29  ? 740  PRO B HA   1 
ATOM   8434  H HB2  . PRO B 1 179 ? -1.695  -11.224 -75.785 1.00 54.94  ? 740  PRO B HB2  1 
ATOM   8435  H HB3  . PRO B 1 179 ? -0.273  -11.340 -76.499 1.00 54.94  ? 740  PRO B HB3  1 
ATOM   8436  H HG2  . PRO B 1 179 ? -0.378  -11.095 -73.998 1.00 57.96  ? 740  PRO B HG2  1 
ATOM   8437  H HG3  . PRO B 1 179 ? 0.783   -10.363 -74.811 1.00 57.96  ? 740  PRO B HG3  1 
ATOM   8438  H HD2  . PRO B 1 179 ? -1.559  -9.215  -73.778 1.00 53.59  ? 740  PRO B HD2  1 
ATOM   8439  H HD3  . PRO B 1 179 ? -0.081  -8.591  -73.775 1.00 53.59  ? 740  PRO B HD3  1 
ATOM   8440  N N    . GLU B 1 180 ? -3.548  -9.329  -76.659 1.00 46.04  ? 741  GLU B N    1 
ATOM   8441  C CA   . GLU B 1 180 ? -4.853  -9.347  -77.311 1.00 45.72  ? 741  GLU B CA   1 
ATOM   8442  C C    . GLU B 1 180 ? -5.043  -8.159  -78.244 1.00 51.79  ? 741  GLU B C    1 
ATOM   8443  O O    . GLU B 1 180 ? -5.911  -8.207  -79.123 1.00 55.48  ? 741  GLU B O    1 
ATOM   8444  C CB   . GLU B 1 180 ? -5.974  -9.382  -76.266 1.00 43.01  ? 741  GLU B CB   1 
ATOM   8445  C CG   . GLU B 1 180 ? -6.136  -8.115  -75.429 1.00 43.67  ? 741  GLU B CG   1 
ATOM   8446  C CD   . GLU B 1 180 ? -5.194  -8.059  -74.241 1.00 37.82  ? 741  GLU B CD   1 
ATOM   8447  O OE1  . GLU B 1 180 ? -4.148  -8.737  -74.270 1.00 35.54  ? 741  GLU B OE1  1 
ATOM   8448  O OE2  . GLU B 1 180 ? -5.507  -7.335  -73.273 1.00 37.61  ? 741  GLU B OE2  1 
ATOM   8449  H H    . GLU B 1 180 ? -3.573  -9.246  -75.804 1.00 55.25  ? 741  GLU B H    1 
ATOM   8450  H HA   . GLU B 1 180 ? -4.922  -10.155 -77.844 1.00 54.87  ? 741  GLU B HA   1 
ATOM   8451  H HB2  . GLU B 1 180 ? -6.815  -9.538  -76.724 1.00 51.61  ? 741  GLU B HB2  1 
ATOM   8452  H HB3  . GLU B 1 180 ? -5.799  -10.114 -75.653 1.00 51.61  ? 741  GLU B HB3  1 
ATOM   8453  H HG2  . GLU B 1 180 ? -5.957  -7.343  -75.989 1.00 52.41  ? 741  GLU B HG2  1 
ATOM   8454  H HG3  . GLU B 1 180 ? -7.045  -8.075  -75.091 1.00 52.41  ? 741  GLU B HG3  1 
ATOM   8455  N N    . MET B 1 181 ? -4.252  -7.097  -78.077 1.00 55.82  ? 742  MET B N    1 
ATOM   8456  C CA   . MET B 1 181 ? -4.328  -5.962  -78.989 1.00 58.19  ? 742  MET B CA   1 
ATOM   8457  C C    . MET B 1 181 ? -3.658  -6.284  -80.317 1.00 61.81  ? 742  MET B C    1 
ATOM   8458  O O    . MET B 1 181 ? -4.220  -6.028  -81.388 1.00 68.26  ? 742  MET B O    1 
ATOM   8459  C CB   . MET B 1 181 ? -3.678  -4.735  -78.347 1.00 56.38  ? 742  MET B CB   1 
ATOM   8460  C CG   . MET B 1 181 ? -4.520  -4.065  -77.277 1.00 66.40  ? 742  MET B CG   1 
ATOM   8461  S SD   . MET B 1 181 ? -6.107  -3.475  -77.892 1.00 75.91  ? 742  MET B SD   1 
ATOM   8462  C CE   . MET B 1 181 ? -5.601  -2.411  -79.235 1.00 62.85  ? 742  MET B CE   1 
ATOM   8463  H H    . MET B 1 181 ? -3.670  -7.013  -77.449 1.00 66.98  ? 742  MET B H    1 
ATOM   8464  H HA   . MET B 1 181 ? -5.261  -5.752  -79.152 1.00 69.83  ? 742  MET B HA   1 
ATOM   8465  H HB2  . MET B 1 181 ? -2.842  -5.007  -77.936 1.00 67.65  ? 742  MET B HB2  1 
ATOM   8466  H HB3  . MET B 1 181 ? -3.503  -4.079  -79.039 1.00 67.65  ? 742  MET B HB3  1 
ATOM   8467  H HG2  . MET B 1 181 ? -4.693  -4.702  -76.567 1.00 79.68  ? 742  MET B HG2  1 
ATOM   8468  H HG3  . MET B 1 181 ? -4.034  -3.302  -76.926 1.00 79.68  ? 742  MET B HG3  1 
ATOM   8469  H HE1  . MET B 1 181 ? -6.390  -2.029  -79.650 1.00 75.42  ? 742  MET B HE1  1 
ATOM   8470  H HE2  . MET B 1 181 ? -5.037  -1.705  -78.882 1.00 75.42  ? 742  MET B HE2  1 
ATOM   8471  H HE3  . MET B 1 181 ? -5.107  -2.936  -79.884 1.00 75.42  ? 742  MET B HE3  1 
ATOM   8472  N N    . LEU B 1 182 ? -2.453  -6.854  -80.265 1.00 61.25  ? 743  LEU B N    1 
ATOM   8473  C CA   . LEU B 1 182 ? -1.701  -7.139  -81.480 1.00 62.38  ? 743  LEU B CA   1 
ATOM   8474  C C    . LEU B 1 182 ? -2.313  -8.275  -82.293 1.00 65.37  ? 743  LEU B C    1 
ATOM   8475  O O    . LEU B 1 182 ? -2.073  -8.348  -83.503 1.00 86.19  ? 743  LEU B O    1 
ATOM   8476  C CB   . LEU B 1 182 ? -0.251  -7.476  -81.127 1.00 53.06  ? 743  LEU B CB   1 
ATOM   8477  H H    . LEU B 1 182 ? -2.052  -7.082  -79.539 1.00 73.50  ? 743  LEU B H    1 
ATOM   8478  H HA   . LEU B 1 182 ? -1.694  -6.346  -82.037 1.00 74.85  ? 743  LEU B HA   1 
ATOM   8479  N N    . SER B 1 183 ? -3.082  -9.158  -81.660 1.00 65.23  ? 744  SER B N    1 
ATOM   8480  C CA   . SER B 1 183 ? -3.767  -10.247 -82.359 1.00 66.93  ? 744  SER B CA   1 
ATOM   8481  C C    . SER B 1 183 ? -5.285  -10.120 -82.243 1.00 72.76  ? 744  SER B C    1 
ATOM   8482  O O    . SER B 1 183 ? -6.024  -10.664 -83.067 1.00 74.36  ? 744  SER B O    1 
ATOM   8483  C CB   . SER B 1 183 ? -3.331  -11.597 -81.807 1.00 62.79  ? 744  SER B CB   1 
ATOM   8484  O OG   . SER B 1 183 ? -3.936  -11.841 -80.551 1.00 69.23  ? 744  SER B OG   1 
ATOM   8485  H H    . SER B 1 183 ? -3.226  -9.148  -80.813 1.00 78.28  ? 744  SER B H    1 
ATOM   8486  H HA   . SER B 1 183 ? -3.533  -10.216 -83.300 1.00 80.32  ? 744  SER B HA   1 
ATOM   8487  H HB2  . SER B 1 183 ? -3.597  -12.294 -82.427 1.00 75.34  ? 744  SER B HB2  1 
ATOM   8488  H HB3  . SER B 1 183 ? -2.367  -11.599 -81.699 1.00 75.34  ? 744  SER B HB3  1 
ATOM   8489  H HG   . SER B 1 183 ? -3.714  -11.244 -80.005 1.00 83.08  ? 744  SER B HG   1 
ATOM   8490  N N    . CYS B 1 186 ? -9.545  -12.501 -82.211 1.00 85.86  ? 747  CYS B N    1 
ATOM   8491  C CA   . CYS B 1 186 ? -9.102  -12.916 -80.885 1.00 89.41  ? 747  CYS B CA   1 
ATOM   8492  C C    . CYS B 1 186 ? -10.245 -13.572 -80.103 1.00 101.04 ? 747  CYS B C    1 
ATOM   8493  O O    . CYS B 1 186 ? -10.017 -14.274 -79.117 1.00 101.78 ? 747  CYS B O    1 
ATOM   8494  C CB   . CYS B 1 186 ? -8.542  -11.711 -80.120 1.00 91.30  ? 747  CYS B CB   1 
ATOM   8495  S SG   . CYS B 1 186 ? -8.121  -12.016 -78.387 1.00 90.19  ? 747  CYS B SG   1 
ATOM   8496  H H    . CYS B 1 186 ? -10.145 -11.884 -82.202 1.00 103.03 ? 747  CYS B H    1 
ATOM   8497  H HA   . CYS B 1 186 ? -8.390  -13.568 -80.979 1.00 107.29 ? 747  CYS B HA   1 
ATOM   8498  H HB2  . CYS B 1 186 ? -7.735  -11.411 -80.567 1.00 109.56 ? 747  CYS B HB2  1 
ATOM   8499  H HB3  . CYS B 1 186 ? -9.204  -11.002 -80.138 1.00 109.56 ? 747  CYS B HB3  1 
ATOM   8500  H HG   . CYS B 1 186 ? -9.108  -12.367 -77.801 1.00 108.23 ? 747  CYS B HG   1 
ATOM   8501  N N    . LYS B 1 187 ? -11.474 -13.355 -80.573 1.00 96.77  ? 748  LYS B N    1 
ATOM   8502  C CA   . LYS B 1 187 ? -12.695 -13.819 -79.916 1.00 100.04 ? 748  LYS B CA   1 
ATOM   8503  C C    . LYS B 1 187 ? -12.899 -13.171 -78.550 1.00 95.57  ? 748  LYS B C    1 
ATOM   8504  O O    . LYS B 1 187 ? -13.641 -13.696 -77.713 1.00 95.14  ? 748  LYS B O    1 
ATOM   8505  C CB   . LYS B 1 187 ? -12.703 -15.347 -79.775 1.00 102.45 ? 748  LYS B CB   1 
ATOM   8506  H H    . LYS B 1 187 ? -11.630 -12.924 -81.301 1.00 116.13 ? 748  LYS B H    1 
ATOM   8507  H HA   . LYS B 1 187 ? -13.453 -13.574 -80.469 1.00 120.05 ? 748  LYS B HA   1 
ATOM   8508  N N    . GLU B 1 188 ? -12.238 -12.042 -78.305 1.00 87.87  ? 749  GLU B N    1 
ATOM   8509  C CA   . GLU B 1 188 ? -12.606 -11.141 -77.223 1.00 80.58  ? 749  GLU B CA   1 
ATOM   8510  C C    . GLU B 1 188 ? -12.137 -9.740  -77.582 1.00 69.14  ? 749  GLU B C    1 
ATOM   8511  O O    . GLU B 1 188 ? -11.037 -9.572  -78.113 1.00 70.60  ? 749  GLU B O    1 
ATOM   8512  C CB   . GLU B 1 188 ? -11.992 -11.580 -75.890 1.00 71.63  ? 749  GLU B CB   1 
ATOM   8513  H H    . GLU B 1 188 ? -11.561 -11.773 -78.763 1.00 105.45 ? 749  GLU B H    1 
ATOM   8514  H HA   . GLU B 1 188 ? -13.571 -11.127 -77.127 1.00 96.69  ? 749  GLU B HA   1 
ATOM   8515  N N    . ASN B 1 189 ? -12.948 -8.741  -77.264 1.00 58.45  ? 750  ASN B N    1 
ATOM   8516  C CA   . ASN B 1 189 ? -12.496 -7.379  -77.509 1.00 62.63  ? 750  ASN B CA   1 
ATOM   8517  C C    . ASN B 1 189 ? -11.559 -6.934  -76.387 1.00 58.78  ? 750  ASN B C    1 
ATOM   8518  O O    . ASN B 1 189 ? -11.748 -7.323  -75.231 1.00 56.50  ? 750  ASN B O    1 
ATOM   8519  C CB   . ASN B 1 189 ? -13.679 -6.416  -77.607 1.00 62.92  ? 750  ASN B CB   1 
ATOM   8520  C CG   . ASN B 1 189 ? -14.252 -6.323  -79.013 1.00 60.50  ? 750  ASN B CG   1 
ATOM   8521  O OD1  . ASN B 1 189 ? -13.651 -6.790  -79.983 1.00 56.28  ? 750  ASN B OD1  1 
ATOM   8522  N ND2  . ASN B 1 189 ? -15.414 -5.695  -79.130 1.00 60.15  ? 750  ASN B ND2  1 
ATOM   8523  H H    . ASN B 1 189 ? -13.732 -8.817  -76.919 1.00 70.14  ? 750  ASN B H    1 
ATOM   8524  H HA   . ASN B 1 189 ? -12.007 -7.348  -78.346 1.00 75.15  ? 750  ASN B HA   1 
ATOM   8525  H HB2  . ASN B 1 189 ? -14.385 -6.723  -77.016 1.00 75.50  ? 750  ASN B HB2  1 
ATOM   8526  H HB3  . ASN B 1 189 ? -13.387 -5.530  -77.343 1.00 75.50  ? 750  ASN B HB3  1 
ATOM   8527  H HD21 . ASN B 1 189 ? -15.783 -5.613  -79.903 1.00 72.18  ? 750  ASN B HD21 1 
ATOM   8528  H HD22 . ASN B 1 189 ? -15.799 -5.369  -78.433 1.00 72.18  ? 750  ASN B HD22 1 
ATOM   8529  N N    . PRO B 1 190 ? -10.536 -6.135  -76.695 1.00 59.19  ? 751  PRO B N    1 
ATOM   8530  C CA   . PRO B 1 190 ? -9.694  -5.585  -75.628 1.00 53.43  ? 751  PRO B CA   1 
ATOM   8531  C C    . PRO B 1 190 ? -10.505 -4.690  -74.705 1.00 52.26  ? 751  PRO B C    1 
ATOM   8532  O O    . PRO B 1 190 ? -11.571 -4.182  -75.062 1.00 54.57  ? 751  PRO B O    1 
ATOM   8533  C CB   . PRO B 1 190 ? -8.626  -4.790  -76.388 1.00 55.44  ? 751  PRO B CB   1 
ATOM   8534  C CG   . PRO B 1 190 ? -9.269  -4.463  -77.694 1.00 56.03  ? 751  PRO B CG   1 
ATOM   8535  C CD   . PRO B 1 190 ? -10.124 -5.641  -78.020 1.00 57.32  ? 751  PRO B CD   1 
ATOM   8536  H HA   . PRO B 1 190 ? -9.275  -6.296  -75.118 1.00 64.12  ? 751  PRO B HA   1 
ATOM   8537  H HB2  . PRO B 1 190 ? -8.406  -3.982  -75.899 1.00 66.52  ? 751  PRO B HB2  1 
ATOM   8538  H HB3  . PRO B 1 190 ? -7.837  -5.340  -76.520 1.00 66.52  ? 751  PRO B HB3  1 
ATOM   8539  H HG2  . PRO B 1 190 ? -9.810  -3.663  -77.599 1.00 67.23  ? 751  PRO B HG2  1 
ATOM   8540  H HG3  . PRO B 1 190 ? -8.587  -4.337  -78.371 1.00 67.23  ? 751  PRO B HG3  1 
ATOM   8541  H HD2  . PRO B 1 190 ? -10.898 -5.366  -78.535 1.00 68.78  ? 751  PRO B HD2  1 
ATOM   8542  H HD3  . PRO B 1 190 ? -9.607  -6.316  -78.486 1.00 68.78  ? 751  PRO B HD3  1 
ATOM   8543  N N    . THR B 1 191 ? -9.987  -4.502  -73.495 1.00 50.08  ? 752  THR B N    1 
ATOM   8544  C CA   . THR B 1 191 ? -10.686 -3.744  -72.466 1.00 45.95  ? 752  THR B CA   1 
ATOM   8545  C C    . THR B 1 191 ? -9.647  -3.024  -71.614 1.00 38.68  ? 752  THR B C    1 
ATOM   8546  O O    . THR B 1 191 ? -8.473  -2.929  -71.986 1.00 36.02  ? 752  THR B O    1 
ATOM   8547  C CB   . THR B 1 191 ? -11.596 -4.660  -71.635 1.00 48.69  ? 752  THR B CB   1 
ATOM   8548  O OG1  . THR B 1 191 ? -12.322 -3.874  -70.683 1.00 56.86  ? 752  THR B OG1  1 
ATOM   8549  C CG2  . THR B 1 191 ? -10.787 -5.716  -70.904 1.00 43.84  ? 752  THR B CG2  1 
ATOM   8550  H H    . THR B 1 191 ? -9.223  -4.808  -73.244 1.00 60.10  ? 752  THR B H    1 
ATOM   8551  H HA   . THR B 1 191 ? -11.243 -3.073  -72.891 1.00 55.14  ? 752  THR B HA   1 
ATOM   8552  H HB   . THR B 1 191 ? -12.222 -5.109  -72.224 1.00 58.42  ? 752  THR B HB   1 
ATOM   8553  H HG1  . THR B 1 191 ? -12.793 -3.303  -71.080 1.00 68.23  ? 752  THR B HG1  1 
ATOM   8554  H HG21 . THR B 1 191 ? -11.377 -6.285  -70.385 1.00 52.61  ? 752  THR B HG21 1 
ATOM   8555  H HG22 . THR B 1 191 ? -10.303 -6.263  -71.542 1.00 52.61  ? 752  THR B HG22 1 
ATOM   8556  H HG23 . THR B 1 191 ? -10.152 -5.292  -70.306 1.00 52.61  ? 752  THR B HG23 1 
ATOM   8557  N N    . TYR B 1 192 ? -10.095 -2.493  -70.472 1.00 39.30  ? 753  TYR B N    1 
ATOM   8558  C CA   . TYR B 1 192 ? -9.219  -1.720  -69.597 1.00 30.74  ? 753  TYR B CA   1 
ATOM   8559  C C    . TYR B 1 192 ? -7.942  -2.474  -69.246 1.00 32.48  ? 753  TYR B C    1 
ATOM   8560  O O    . TYR B 1 192 ? -6.910  -1.851  -68.972 1.00 27.35  ? 753  TYR B O    1 
ATOM   8561  C CB   . TYR B 1 192 ? -9.965  -1.345  -68.314 1.00 36.09  ? 753  TYR B CB   1 
ATOM   8562  C CG   . TYR B 1 192 ? -11.243 -0.565  -68.544 1.00 39.88  ? 753  TYR B CG   1 
ATOM   8563  C CD1  . TYR B 1 192 ? -11.221 0.816   -68.678 1.00 37.15  ? 753  TYR B CD1  1 
ATOM   8564  C CD2  . TYR B 1 192 ? -12.471 -1.209  -68.616 1.00 42.03  ? 753  TYR B CD2  1 
ATOM   8565  C CE1  . TYR B 1 192 ? -12.385 1.534   -68.889 1.00 37.99  ? 753  TYR B CE1  1 
ATOM   8566  C CE2  . TYR B 1 192 ? -13.641 -0.501  -68.824 1.00 45.12  ? 753  TYR B CE2  1 
ATOM   8567  C CZ   . TYR B 1 192 ? -13.592 0.870   -68.959 1.00 45.60  ? 753  TYR B CZ   1 
ATOM   8568  O OH   . TYR B 1 192 ? -14.758 1.571   -69.167 1.00 41.20  ? 753  TYR B OH   1 
ATOM   8569  H H    . TYR B 1 192 ? -10.902 -2.567  -70.185 1.00 47.17  ? 753  TYR B H    1 
ATOM   8570  H HA   . TYR B 1 192 ? -8.967  -0.899  -70.048 1.00 36.89  ? 753  TYR B HA   1 
ATOM   8571  H HB2  . TYR B 1 192 ? -10.198 -2.159  -67.841 1.00 43.31  ? 753  TYR B HB2  1 
ATOM   8572  H HB3  . TYR B 1 192 ? -9.382  -0.801  -67.763 1.00 43.31  ? 753  TYR B HB3  1 
ATOM   8573  H HD1  . TYR B 1 192 ? -10.409 1.267   -68.633 1.00 44.58  ? 753  TYR B HD1  1 
ATOM   8574  H HD2  . TYR B 1 192 ? -12.508 -2.134  -68.527 1.00 50.43  ? 753  TYR B HD2  1 
ATOM   8575  H HE1  . TYR B 1 192 ? -12.354 2.459   -68.979 1.00 45.58  ? 753  TYR B HE1  1 
ATOM   8576  H HE2  . TYR B 1 192 ? -14.455 -0.947  -68.873 1.00 54.15  ? 753  TYR B HE2  1 
ATOM   8577  H HH   . TYR B 1 192 ? -15.411 1.043   -69.187 1.00 49.44  ? 753  TYR B HH   1 
ATOM   8578  N N    . THR B 1 193 ? -7.984  -3.809  -69.253 1.00 35.92  ? 754  THR B N    1 
ATOM   8579  C CA   . THR B 1 193 ? -6.829  -4.603  -68.848 1.00 35.17  ? 754  THR B CA   1 
ATOM   8580  C C    . THR B 1 193 ? -5.646  -4.474  -69.802 1.00 31.82  ? 754  THR B C    1 
ATOM   8581  O O    . THR B 1 193 ? -4.566  -4.983  -69.483 1.00 31.74  ? 754  THR B O    1 
ATOM   8582  C CB   . THR B 1 193 ? -7.214  -6.079  -68.711 1.00 39.92  ? 754  THR B CB   1 
ATOM   8583  O OG1  . THR B 1 193 ? -7.973  -6.494  -69.853 1.00 36.57  ? 754  THR B OG1  1 
ATOM   8584  C CG2  . THR B 1 193 ? -8.033  -6.299  -67.446 1.00 34.58  ? 754  THR B CG2  1 
ATOM   8585  H H    . THR B 1 193 ? -8.669  -4.274  -69.487 1.00 43.10  ? 754  THR B H    1 
ATOM   8586  H HA   . THR B 1 193 ? -6.535  -4.295  -67.977 1.00 42.20  ? 754  THR B HA   1 
ATOM   8587  H HB   . THR B 1 193 ? -6.408  -6.616  -68.649 1.00 47.91  ? 754  THR B HB   1 
ATOM   8588  H HG1  . THR B 1 193 ? -8.185  -7.303  -69.778 1.00 43.88  ? 754  THR B HG1  1 
ATOM   8589  H HG21 . THR B 1 193 ? -8.273  -7.235  -67.365 1.00 41.50  ? 754  THR B HG21 1 
ATOM   8590  H HG22 . THR B 1 193 ? -7.517  -6.038  -66.667 1.00 41.50  ? 754  THR B HG22 1 
ATOM   8591  H HG23 . THR B 1 193 ? -8.844  -5.767  -67.479 1.00 41.50  ? 754  THR B HG23 1 
ATOM   8592  N N    . VAL B 1 194 ? -5.817  -3.831  -70.960 1.00 27.44  ? 755  VAL B N    1 
ATOM   8593  C CA   . VAL B 1 194 ? -4.662  -3.521  -71.801 1.00 26.80  ? 755  VAL B CA   1 
ATOM   8594  C C    . VAL B 1 194 ? -3.686  -2.634  -71.037 1.00 32.84  ? 755  VAL B C    1 
ATOM   8595  O O    . VAL B 1 194 ? -2.466  -2.837  -71.089 1.00 30.81  ? 755  VAL B O    1 
ATOM   8596  C CB   . VAL B 1 194 ? -5.112  -2.857  -73.117 1.00 36.31  ? 755  VAL B CB   1 
ATOM   8597  C CG1  . VAL B 1 194 ? -3.902  -2.410  -73.940 1.00 43.41  ? 755  VAL B CG1  1 
ATOM   8598  C CG2  . VAL B 1 194 ? -5.973  -3.810  -73.929 1.00 39.52  ? 755  VAL B CG2  1 
ATOM   8599  H H    . VAL B 1 194 ? -6.573  -3.569  -71.275 1.00 32.93  ? 755  VAL B H    1 
ATOM   8600  H HA   . VAL B 1 194 ? -4.204  -4.346  -72.023 1.00 32.15  ? 755  VAL B HA   1 
ATOM   8601  H HB   . VAL B 1 194 ? -5.643  -2.072  -72.911 1.00 43.58  ? 755  VAL B HB   1 
ATOM   8602  H HG11 . VAL B 1 194 ? -4.215  -1.998  -74.761 1.00 52.09  ? 755  VAL B HG11 1 
ATOM   8603  H HG12 . VAL B 1 194 ? -3.388  -1.771  -73.423 1.00 52.09  ? 755  VAL B HG12 1 
ATOM   8604  H HG13 . VAL B 1 194 ? -3.357  -3.185  -74.146 1.00 52.09  ? 755  VAL B HG13 1 
ATOM   8605  H HG21 . VAL B 1 194 ? -6.242  -3.369  -74.750 1.00 47.43  ? 755  VAL B HG21 1 
ATOM   8606  H HG22 . VAL B 1 194 ? -5.456  -4.605  -74.134 1.00 47.43  ? 755  VAL B HG22 1 
ATOM   8607  H HG23 . VAL B 1 194 ? -6.756  -4.048  -73.409 1.00 47.43  ? 755  VAL B HG23 1 
ATOM   8608  N N    . ASP B 1 195 ? -4.209  -1.636  -70.319 1.00 27.67  ? 756  ASP B N    1 
ATOM   8609  C CA   . ASP B 1 195 ? -3.354  -0.760  -69.527 1.00 26.54  ? 756  ASP B CA   1 
ATOM   8610  C C    . ASP B 1 195 ? -2.732  -1.496  -68.347 1.00 32.37  ? 756  ASP B C    1 
ATOM   8611  O O    . ASP B 1 195 ? -1.634  -1.137  -67.904 1.00 29.21  ? 756  ASP B O    1 
ATOM   8612  C CB   . ASP B 1 195 ? -4.155  0.442   -69.029 1.00 28.96  ? 756  ASP B CB   1 
ATOM   8613  C CG   . ASP B 1 195 ? -4.617  1.347   -70.157 1.00 36.16  ? 756  ASP B CG   1 
ATOM   8614  O OD1  . ASP B 1 195 ? -3.918  1.423   -71.192 1.00 34.39  ? 756  ASP B OD1  1 
ATOM   8615  O OD2  . ASP B 1 195 ? -5.679  1.988   -70.007 1.00 33.82  ? 756  ASP B OD2  1 
ATOM   8616  H H    . ASP B 1 195 ? -5.047  -1.449  -70.276 1.00 33.20  ? 756  ASP B H    1 
ATOM   8617  H HA   . ASP B 1 195 ? -2.635  -0.430  -70.087 1.00 31.84  ? 756  ASP B HA   1 
ATOM   8618  H HB2  . ASP B 1 195 ? -4.941  0.125   -68.558 1.00 34.76  ? 756  ASP B HB2  1 
ATOM   8619  H HB3  . ASP B 1 195 ? -3.599  0.967   -68.432 1.00 34.76  ? 756  ASP B HB3  1 
ATOM   8620  N N    . ILE B 1 196 ? -3.414  -2.514  -67.819 1.00 27.16  ? 757  ILE B N    1 
ATOM   8621  C CA   . ILE B 1 196 ? -2.841  -3.296  -66.728 1.00 30.21  ? 757  ILE B CA   1 
ATOM   8622  C C    . ILE B 1 196 ? -1.615  -4.061  -67.212 1.00 31.31  ? 757  ILE B C    1 
ATOM   8623  O O    . ILE B 1 196 ? -0.595  -4.126  -66.515 1.00 27.91  ? 757  ILE B O    1 
ATOM   8624  C CB   . ILE B 1 196 ? -3.901  -4.243  -66.133 1.00 30.63  ? 757  ILE B CB   1 
ATOM   8625  C CG1  . ILE B 1 196 ? -5.098  -3.445  -65.599 1.00 26.51  ? 757  ILE B CG1  1 
ATOM   8626  C CG2  . ILE B 1 196 ? -3.295  -5.115  -65.036 1.00 35.12  ? 757  ILE B CG2  1 
ATOM   8627  C CD1  . ILE B 1 196 ? -4.763  -2.454  -64.487 1.00 23.21  ? 757  ILE B CD1  1 
ATOM   8628  H H    . ILE B 1 196 ? -4.196  -2.768  -68.071 1.00 32.59  ? 757  ILE B H    1 
ATOM   8629  H HA   . ILE B 1 196 ? -2.556  -2.691  -66.025 1.00 36.26  ? 757  ILE B HA   1 
ATOM   8630  H HB   . ILE B 1 196 ? -4.218  -4.825  -66.842 1.00 36.76  ? 757  ILE B HB   1 
ATOM   8631  H HG12 . ILE B 1 196 ? -5.487  -2.942  -66.332 1.00 31.81  ? 757  ILE B HG12 1 
ATOM   8632  H HG13 . ILE B 1 196 ? -5.753  -4.068  -65.248 1.00 31.81  ? 757  ILE B HG13 1 
ATOM   8633  H HG21 . ILE B 1 196 ? -3.983  -5.700  -64.681 1.00 42.14  ? 757  ILE B HG21 1 
ATOM   8634  H HG22 . ILE B 1 196 ? -2.575  -5.644  -65.415 1.00 42.14  ? 757  ILE B HG22 1 
ATOM   8635  H HG23 . ILE B 1 196 ? -2.951  -4.543  -64.332 1.00 42.14  ? 757  ILE B HG23 1 
ATOM   8636  H HD11 . ILE B 1 196 ? -5.575  -1.999  -64.214 1.00 27.86  ? 757  ILE B HD11 1 
ATOM   8637  H HD12 . ILE B 1 196 ? -4.386  -2.938  -63.735 1.00 27.86  ? 757  ILE B HD12 1 
ATOM   8638  H HD13 . ILE B 1 196 ? -4.119  -1.810  -64.822 1.00 27.86  ? 757  ILE B HD13 1 
ATOM   8639  N N    . PHE B 1 197 ? -1.693  -4.655  -68.406 1.00 27.85  ? 758  PHE B N    1 
ATOM   8640  C CA   . PHE B 1 197 ? -0.532  -5.343  -68.961 1.00 28.94  ? 758  PHE B CA   1 
ATOM   8641  C C    . PHE B 1 197 ? 0.635   -4.381  -69.127 1.00 31.18  ? 758  PHE B C    1 
ATOM   8642  O O    . PHE B 1 197 ? 1.753   -4.657  -68.676 1.00 26.29  ? 758  PHE B O    1 
ATOM   8643  C CB   . PHE B 1 197 ? -0.886  -5.986  -70.302 1.00 29.81  ? 758  PHE B CB   1 
ATOM   8644  C CG   . PHE B 1 197 ? 0.272   -6.680  -70.960 1.00 33.56  ? 758  PHE B CG   1 
ATOM   8645  C CD1  . PHE B 1 197 ? 1.142   -5.980  -71.780 1.00 32.92  ? 758  PHE B CD1  1 
ATOM   8646  C CD2  . PHE B 1 197 ? 0.497   -8.031  -70.752 1.00 39.43  ? 758  PHE B CD2  1 
ATOM   8647  C CE1  . PHE B 1 197 ? 2.210   -6.612  -72.380 1.00 35.95  ? 758  PHE B CE1  1 
ATOM   8648  C CE2  . PHE B 1 197 ? 1.564   -8.669  -71.350 1.00 37.39  ? 758  PHE B CE2  1 
ATOM   8649  C CZ   . PHE B 1 197 ? 2.422   -7.959  -72.165 1.00 38.34  ? 758  PHE B CZ   1 
ATOM   8650  H H    . PHE B 1 197 ? -2.394  -4.673  -68.903 1.00 33.42  ? 758  PHE B H    1 
ATOM   8651  H HA   . PHE B 1 197 ? -0.259  -6.046  -68.352 1.00 34.73  ? 758  PHE B HA   1 
ATOM   8652  H HB2  . PHE B 1 197 ? -1.585  -6.644  -70.159 1.00 35.77  ? 758  PHE B HB2  1 
ATOM   8653  H HB3  . PHE B 1 197 ? -1.202  -5.297  -70.907 1.00 35.77  ? 758  PHE B HB3  1 
ATOM   8654  H HD1  . PHE B 1 197 ? 1.004   -5.072  -71.926 1.00 39.50  ? 758  PHE B HD1  1 
ATOM   8655  H HD2  . PHE B 1 197 ? -0.078  -8.513  -70.202 1.00 47.31  ? 758  PHE B HD2  1 
ATOM   8656  H HE1  . PHE B 1 197 ? 2.787   -6.132  -72.929 1.00 43.14  ? 758  PHE B HE1  1 
ATOM   8657  H HE2  . PHE B 1 197 ? 1.705   -9.577  -71.204 1.00 44.87  ? 758  PHE B HE2  1 
ATOM   8658  H HZ   . PHE B 1 197 ? 3.141   -8.388  -72.570 1.00 46.01  ? 758  PHE B HZ   1 
ATOM   8659  N N    . SER B 1 198 ? 0.389   -3.240  -69.777 1.00 28.72  ? 759  SER B N    1 
ATOM   8660  C CA   . SER B 1 198 ? 1.436   -2.239  -69.941 1.00 30.76  ? 759  SER B CA   1 
ATOM   8661  C C    . SER B 1 198 ? 1.968   -1.786  -68.588 1.00 27.74  ? 759  SER B C    1 
ATOM   8662  O O    . SER B 1 198 ? 3.183   -1.655  -68.402 1.00 26.48  ? 759  SER B O    1 
ATOM   8663  C CB   . SER B 1 198 ? 0.899   -1.050  -70.736 1.00 36.24  ? 759  SER B CB   1 
ATOM   8664  O OG   . SER B 1 198 ? 0.270   -1.479  -71.932 1.00 41.49  ? 759  SER B OG   1 
ATOM   8665  H H    . SER B 1 198 ? -0.367  -3.027  -70.128 1.00 34.46  ? 759  SER B H    1 
ATOM   8666  H HA   . SER B 1 198 ? 2.172   -2.628  -70.439 1.00 36.91  ? 759  SER B HA   1 
ATOM   8667  H HB2  . SER B 1 198 ? 0.252   -0.574  -70.193 1.00 43.49  ? 759  SER B HB2  1 
ATOM   8668  H HB3  . SER B 1 198 ? 1.637   -0.462  -70.962 1.00 43.49  ? 759  SER B HB3  1 
ATOM   8669  H HG   . SER B 1 198 ? 0.820   -1.893  -72.413 1.00 49.79  ? 759  SER B HG   1 
ATOM   8670  N N    . ALA B 1 199 ? 1.070   -1.566  -67.624 1.00 32.42  ? 760  ALA B N    1 
ATOM   8671  C CA   . ALA B 1 199 ? 1.494   -1.145  -66.293 1.00 29.86  ? 760  ALA B CA   1 
ATOM   8672  C C    . ALA B 1 199 ? 2.360   -2.208  -65.631 1.00 31.58  ? 760  ALA B C    1 
ATOM   8673  O O    . ALA B 1 199 ? 3.331   -1.885  -64.938 1.00 31.82  ? 760  ALA B O    1 
ATOM   8674  C CB   . ALA B 1 199 ? 0.274   -0.834  -65.428 1.00 27.44  ? 760  ALA B CB   1 
ATOM   8675  H H    . ALA B 1 199 ? 0.219   -1.653  -67.716 1.00 38.90  ? 760  ALA B H    1 
ATOM   8676  H HA   . ALA B 1 199 ? 2.021   -0.334  -66.371 1.00 35.83  ? 760  ALA B HA   1 
ATOM   8677  H HB1  . ALA B 1 199 ? 0.573   -0.556  -64.548 1.00 32.93  ? 760  ALA B HB1  1 
ATOM   8678  H HB2  . ALA B 1 199 ? -0.235  -0.121  -65.845 1.00 32.93  ? 760  ALA B HB2  1 
ATOM   8679  H HB3  . ALA B 1 199 ? -0.273  -1.632  -65.355 1.00 32.93  ? 760  ALA B HB3  1 
ATOM   8680  N N    . GLY B 1 200 ? 2.024   -3.483  -65.832 1.00 30.58  ? 761  GLY B N    1 
ATOM   8681  C CA   . GLY B 1 200 ? 2.848   -4.547  -65.284 1.00 29.03  ? 761  GLY B CA   1 
ATOM   8682  C C    . GLY B 1 200 ? 4.272   -4.501  -65.803 1.00 32.72  ? 761  GLY B C    1 
ATOM   8683  O O    . GLY B 1 200 ? 5.231   -4.658  -65.042 1.00 26.69  ? 761  GLY B O    1 
ATOM   8684  H H    . GLY B 1 200 ? 1.335   -3.750  -66.274 1.00 36.70  ? 761  GLY B H    1 
ATOM   8685  H HA2  . GLY B 1 200 ? 2.872   -4.473  -64.317 1.00 34.84  ? 761  GLY B HA2  1 
ATOM   8686  H HA3  . GLY B 1 200 ? 2.464   -5.407  -65.517 1.00 34.84  ? 761  GLY B HA3  1 
ATOM   8687  N N    . CYS B 1 201 ? 4.430   -4.291  -67.113 1.00 30.49  ? 762  CYS B N    1 
ATOM   8688  C CA   . CYS B 1 201 ? 5.763   -4.120  -67.677 1.00 33.37  ? 762  CYS B CA   1 
ATOM   8689  C C    . CYS B 1 201 ? 6.457   -2.892  -67.102 1.00 34.93  ? 762  CYS B C    1 
ATOM   8690  O O    . CYS B 1 201 ? 7.680   -2.898  -66.924 1.00 34.39  ? 762  CYS B O    1 
ATOM   8691  C CB   . CYS B 1 201 ? 5.676   -4.021  -69.198 1.00 37.70  ? 762  CYS B CB   1 
ATOM   8692  S SG   . CYS B 1 201 ? 5.055   -5.518  -70.008 1.00 31.21  ? 762  CYS B SG   1 
ATOM   8693  H H    . CYS B 1 201 ? 3.789   -4.244  -67.686 1.00 36.59  ? 762  CYS B H    1 
ATOM   8694  H HA   . CYS B 1 201 ? 6.301   -4.897  -67.457 1.00 40.04  ? 762  CYS B HA   1 
ATOM   8695  H HB2  . CYS B 1 201 ? 5.080   -3.291  -69.428 1.00 45.25  ? 762  CYS B HB2  1 
ATOM   8696  H HB3  . CYS B 1 201 ? 6.563   -3.842  -69.549 1.00 45.25  ? 762  CYS B HB3  1 
ATOM   8697  H HG   . CYS B 1 201 ? 5.025   -5.337  -71.194 1.00 37.46  ? 762  CYS B HG   1 
ATOM   8698  N N    . VAL B 1 202 ? 5.699   -1.832  -66.806 1.00 31.06  ? 763  VAL B N    1 
ATOM   8699  C CA   . VAL B 1 202 ? 6.289   -0.645  -66.194 1.00 33.85  ? 763  VAL B CA   1 
ATOM   8700  C C    . VAL B 1 202 ? 6.694   -0.935  -64.755 1.00 31.34  ? 763  VAL B C    1 
ATOM   8701  O O    . VAL B 1 202 ? 7.744   -0.478  -64.288 1.00 31.52  ? 763  VAL B O    1 
ATOM   8702  C CB   . VAL B 1 202 ? 5.310   0.542   -66.278 1.00 34.56  ? 763  VAL B CB   1 
ATOM   8703  C CG1  . VAL B 1 202 ? 5.813   1.729   -65.451 1.00 27.31  ? 763  VAL B CG1  1 
ATOM   8704  C CG2  . VAL B 1 202 ? 5.111   0.959   -67.727 1.00 29.13  ? 763  VAL B CG2  1 
ATOM   8705  H H    . VAL B 1 202 ? 4.852   -1.778  -66.949 1.00 37.27  ? 763  VAL B H    1 
ATOM   8706  H HA   . VAL B 1 202 ? 7.090   -0.404  -66.686 1.00 40.62  ? 763  VAL B HA   1 
ATOM   8707  H HB   . VAL B 1 202 ? 4.450   0.270   -65.922 1.00 41.47  ? 763  VAL B HB   1 
ATOM   8708  H HG11 . VAL B 1 202 ? 5.176   2.457   -65.525 1.00 32.77  ? 763  VAL B HG11 1 
ATOM   8709  H HG12 . VAL B 1 202 ? 5.897   1.455   -64.525 1.00 32.77  ? 763  VAL B HG12 1 
ATOM   8710  H HG13 . VAL B 1 202 ? 6.676   2.008   -65.794 1.00 32.77  ? 763  VAL B HG13 1 
ATOM   8711  H HG21 . VAL B 1 202 ? 4.493   1.706   -67.758 1.00 34.95  ? 763  VAL B HG21 1 
ATOM   8712  H HG22 . VAL B 1 202 ? 5.967   1.221   -68.100 1.00 34.95  ? 763  VAL B HG22 1 
ATOM   8713  H HG23 . VAL B 1 202 ? 4.749   0.208   -68.224 1.00 34.95  ? 763  VAL B HG23 1 
ATOM   8714  N N    . PHE B 1 203 ? 5.864   -1.683  -64.025 1.00 29.57  ? 764  PHE B N    1 
ATOM   8715  C CA   . PHE B 1 203 ? 6.211   -2.070  -62.661 1.00 30.41  ? 764  PHE B CA   1 
ATOM   8716  C C    . PHE B 1 203 ? 7.551   -2.794  -62.623 1.00 32.41  ? 764  PHE B C    1 
ATOM   8717  O O    . PHE B 1 203 ? 8.436   -2.445  -61.833 1.00 35.10  ? 764  PHE B O    1 
ATOM   8718  C CB   . PHE B 1 203 ? 5.112   -2.952  -62.071 1.00 30.70  ? 764  PHE B CB   1 
ATOM   8719  C CG   . PHE B 1 203 ? 4.001   -2.184  -61.416 1.00 30.48  ? 764  PHE B CG   1 
ATOM   8720  C CD1  . PHE B 1 203 ? 3.445   -1.077  -62.032 1.00 31.53  ? 764  PHE B CD1  1 
ATOM   8721  C CD2  . PHE B 1 203 ? 3.504   -2.579  -60.185 1.00 31.59  ? 764  PHE B CD2  1 
ATOM   8722  C CE1  . PHE B 1 203 ? 2.420   -0.376  -61.430 1.00 27.89  ? 764  PHE B CE1  1 
ATOM   8723  C CE2  . PHE B 1 203 ? 2.478   -1.883  -59.579 1.00 34.94  ? 764  PHE B CE2  1 
ATOM   8724  C CZ   . PHE B 1 203 ? 1.935   -0.781  -60.202 1.00 35.69  ? 764  PHE B CZ   1 
ATOM   8725  H H    . PHE B 1 203 ? 5.101   -1.975  -64.294 1.00 35.48  ? 764  PHE B H    1 
ATOM   8726  H HA   . PHE B 1 203 ? 6.284   -1.273  -62.113 1.00 36.49  ? 764  PHE B HA   1 
ATOM   8727  H HB2  . PHE B 1 203 ? 4.724   -3.485  -62.783 1.00 36.84  ? 764  PHE B HB2  1 
ATOM   8728  H HB3  . PHE B 1 203 ? 5.505   -3.534  -61.402 1.00 36.84  ? 764  PHE B HB3  1 
ATOM   8729  H HD1  . PHE B 1 203 ? 3.767   -0.801  -62.860 1.00 37.84  ? 764  PHE B HD1  1 
ATOM   8730  H HD2  . PHE B 1 203 ? 3.867   -3.323  -59.761 1.00 37.91  ? 764  PHE B HD2  1 
ATOM   8731  H HE1  . PHE B 1 203 ? 2.054   0.368   -61.853 1.00 33.46  ? 764  PHE B HE1  1 
ATOM   8732  H HE2  . PHE B 1 203 ? 2.155   -2.157  -58.752 1.00 41.92  ? 764  PHE B HE2  1 
ATOM   8733  H HZ   . PHE B 1 203 ? 1.245   -0.309  -59.795 1.00 42.83  ? 764  PHE B HZ   1 
ATOM   8734  N N    . TYR B 1 204 ? 7.719   -3.808  -63.474 1.00 32.59  ? 765  TYR B N    1 
ATOM   8735  C CA   . TYR B 1 204 ? 8.987   -4.526  -63.509 1.00 38.58  ? 765  TYR B CA   1 
ATOM   8736  C C    . TYR B 1 204 ? 10.115  -3.626  -63.994 1.00 39.22  ? 765  TYR B C    1 
ATOM   8737  O O    . TYR B 1 204 ? 11.250  -3.737  -63.518 1.00 41.68  ? 765  TYR B O    1 
ATOM   8738  C CB   . TYR B 1 204 ? 8.875   -5.762  -64.399 1.00 41.92  ? 765  TYR B CB   1 
ATOM   8739  C CG   . TYR B 1 204 ? 10.112  -6.629  -64.370 1.00 45.53  ? 765  TYR B CG   1 
ATOM   8740  C CD1  . TYR B 1 204 ? 10.313  -7.548  -63.350 1.00 43.77  ? 765  TYR B CD1  1 
ATOM   8741  C CD2  . TYR B 1 204 ? 11.083  -6.523  -65.357 1.00 44.89  ? 765  TYR B CD2  1 
ATOM   8742  C CE1  . TYR B 1 204 ? 11.442  -8.343  -63.316 1.00 49.57  ? 765  TYR B CE1  1 
ATOM   8743  C CE2  . TYR B 1 204 ? 12.216  -7.314  -65.333 1.00 44.91  ? 765  TYR B CE2  1 
ATOM   8744  C CZ   . TYR B 1 204 ? 12.391  -8.222  -64.309 1.00 50.99  ? 765  TYR B CZ   1 
ATOM   8745  O OH   . TYR B 1 204 ? 13.518  -9.010  -64.282 1.00 55.52  ? 765  TYR B OH   1 
ATOM   8746  H H    . TYR B 1 204 ? 7.126   -4.093  -64.028 1.00 39.11  ? 765  TYR B H    1 
ATOM   8747  H HA   . TYR B 1 204 ? 9.206   -4.823  -62.612 1.00 46.30  ? 765  TYR B HA   1 
ATOM   8748  H HB2  . TYR B 1 204 ? 8.127   -6.300  -64.098 1.00 50.30  ? 765  TYR B HB2  1 
ATOM   8749  H HB3  . TYR B 1 204 ? 8.731   -5.477  -65.315 1.00 50.30  ? 765  TYR B HB3  1 
ATOM   8750  H HD1  . TYR B 1 204 ? 9.675   -7.632  -62.679 1.00 52.52  ? 765  TYR B HD1  1 
ATOM   8751  H HD2  . TYR B 1 204 ? 10.967  -5.912  -66.049 1.00 53.87  ? 765  TYR B HD2  1 
ATOM   8752  H HE1  . TYR B 1 204 ? 11.562  -8.956  -62.627 1.00 59.49  ? 765  TYR B HE1  1 
ATOM   8753  H HE2  . TYR B 1 204 ? 12.857  -7.234  -66.001 1.00 53.89  ? 765  TYR B HE2  1 
ATOM   8754  H HH   . TYR B 1 204 ? 14.007  -8.834  -64.942 1.00 66.62  ? 765  TYR B HH   1 
ATOM   8755  N N    . TYR B 1 205 ? 9.820   -2.725  -64.935 1.00 43.65  ? 766  TYR B N    1 
ATOM   8756  C CA   . TYR B 1 205 ? 10.844  -1.822  -65.452 1.00 40.66  ? 766  TYR B CA   1 
ATOM   8757  C C    . TYR B 1 205 ? 11.439  -0.969  -64.340 1.00 39.32  ? 766  TYR B C    1 
ATOM   8758  O O    . TYR B 1 205 ? 12.649  -0.712  -64.323 1.00 46.22  ? 766  TYR B O    1 
ATOM   8759  C CB   . TYR B 1 205 ? 10.253  -0.944  -66.556 1.00 43.33  ? 766  TYR B CB   1 
ATOM   8760  C CG   . TYR B 1 205 ? 11.233  0.020   -67.190 1.00 44.57  ? 766  TYR B CG   1 
ATOM   8761  C CD1  . TYR B 1 205 ? 12.082  -0.390  -68.209 1.00 51.00  ? 766  TYR B CD1  1 
ATOM   8762  C CD2  . TYR B 1 205 ? 11.298  1.342   -66.778 1.00 46.47  ? 766  TYR B CD2  1 
ATOM   8763  C CE1  . TYR B 1 205 ? 12.976  0.491   -68.794 1.00 51.16  ? 766  TYR B CE1  1 
ATOM   8764  C CE2  . TYR B 1 205 ? 12.184  2.230   -67.358 1.00 54.83  ? 766  TYR B CE2  1 
ATOM   8765  C CZ   . TYR B 1 205 ? 13.022  1.799   -68.363 1.00 56.78  ? 766  TYR B CZ   1 
ATOM   8766  O OH   . TYR B 1 205 ? 13.905  2.686   -68.936 1.00 66.44  ? 766  TYR B OH   1 
ATOM   8767  H H    . TYR B 1 205 ? 9.042   -2.619  -65.286 1.00 52.38  ? 766  TYR B H    1 
ATOM   8768  H HA   . TYR B 1 205 ? 11.561  -2.348  -65.840 1.00 48.80  ? 766  TYR B HA   1 
ATOM   8769  H HB2  . TYR B 1 205 ? 9.910   -1.518  -67.258 1.00 52.00  ? 766  TYR B HB2  1 
ATOM   8770  H HB3  . TYR B 1 205 ? 9.528   -0.420  -66.180 1.00 52.00  ? 766  TYR B HB3  1 
ATOM   8771  H HD1  . TYR B 1 205 ? 12.054  -1.272  -68.501 1.00 61.20  ? 766  TYR B HD1  1 
ATOM   8772  H HD2  . TYR B 1 205 ? 10.735  1.638   -66.099 1.00 55.76  ? 766  TYR B HD2  1 
ATOM   8773  H HE1  . TYR B 1 205 ? 13.541  0.202   -69.474 1.00 61.39  ? 766  TYR B HE1  1 
ATOM   8774  H HE2  . TYR B 1 205 ? 12.218  3.113   -67.068 1.00 65.79  ? 766  TYR B HE2  1 
ATOM   8775  H HH   . TYR B 1 205 ? 13.825  3.442   -68.579 1.00 79.73  ? 766  TYR B HH   1 
ATOM   8776  N N    . VAL B 1 206 ? 10.607  -0.528  -63.397 1.00 40.08  ? 767  VAL B N    1 
ATOM   8777  C CA   . VAL B 1 206 ? 11.096  0.284   -62.287 1.00 39.68  ? 767  VAL B CA   1 
ATOM   8778  C C    . VAL B 1 206 ? 11.814  -0.583  -61.259 1.00 42.74  ? 767  VAL B C    1 
ATOM   8779  O O    . VAL B 1 206 ? 12.906  -0.240  -60.793 1.00 44.54  ? 767  VAL B O    1 
ATOM   8780  C CB   . VAL B 1 206 ? 9.927   1.064   -61.655 1.00 36.87  ? 767  VAL B CB   1 
ATOM   8781  C CG1  . VAL B 1 206 ? 10.373  1.790   -60.392 1.00 42.68  ? 767  VAL B CG1  1 
ATOM   8782  C CG2  . VAL B 1 206 ? 9.353   2.050   -62.663 1.00 35.88  ? 767  VAL B CG2  1 
ATOM   8783  H H    . VAL B 1 206 ? 9.762   -0.685  -63.378 1.00 48.10  ? 767  VAL B H    1 
ATOM   8784  H HA   . VAL B 1 206 ? 11.734  0.930   -62.628 1.00 47.62  ? 767  VAL B HA   1 
ATOM   8785  H HB   . VAL B 1 206 ? 9.225   0.440   -61.411 1.00 44.24  ? 767  VAL B HB   1 
ATOM   8786  H HG11 . VAL B 1 206 ? 9.617   2.270   -60.020 1.00 51.22  ? 767  VAL B HG11 1 
ATOM   8787  H HG12 . VAL B 1 206 ? 10.699  1.138   -59.752 1.00 51.22  ? 767  VAL B HG12 1 
ATOM   8788  H HG13 . VAL B 1 206 ? 11.081  2.413   -60.620 1.00 51.22  ? 767  VAL B HG13 1 
ATOM   8789  H HG21 . VAL B 1 206 ? 8.620   2.532   -62.251 1.00 43.05  ? 767  VAL B HG21 1 
ATOM   8790  H HG22 . VAL B 1 206 ? 10.050  2.671   -62.929 1.00 43.05  ? 767  VAL B HG22 1 
ATOM   8791  H HG23 . VAL B 1 206 ? 9.034   1.560   -63.437 1.00 43.05  ? 767  VAL B HG23 1 
ATOM   8792  N N    . ILE B 1 207 ? 11.213  -1.718  -60.890 1.00 41.62  ? 768  ILE B N    1 
ATOM   8793  C CA   . ILE B 1 207 ? 11.809  -2.583  -59.872 1.00 49.87  ? 768  ILE B CA   1 
ATOM   8794  C C    . ILE B 1 207 ? 13.136  -3.144  -60.363 1.00 48.13  ? 768  ILE B C    1 
ATOM   8795  O O    . ILE B 1 207 ? 14.110  -3.231  -59.605 1.00 47.11  ? 768  ILE B O    1 
ATOM   8796  C CB   . ILE B 1 207 ? 10.835  -3.713  -59.490 1.00 48.19  ? 768  ILE B CB   1 
ATOM   8797  C CG1  . ILE B 1 207 ? 9.533   -3.139  -58.932 1.00 44.40  ? 768  ILE B CG1  1 
ATOM   8798  C CG2  . ILE B 1 207 ? 11.464  -4.642  -58.456 1.00 53.91  ? 768  ILE B CG2  1 
ATOM   8799  C CD1  . ILE B 1 207 ? 8.389   -4.111  -59.006 1.00 51.53  ? 768  ILE B CD1  1 
ATOM   8800  H H    . ILE B 1 207 ? 10.469  -2.006  -61.211 1.00 49.95  ? 768  ILE B H    1 
ATOM   8801  H HA   . ILE B 1 207 ? 11.984  -2.057  -59.075 1.00 59.84  ? 768  ILE B HA   1 
ATOM   8802  H HB   . ILE B 1 207 ? 10.631  -4.228  -60.286 1.00 57.83  ? 768  ILE B HB   1 
ATOM   8803  H HG12 . ILE B 1 207 ? 9.666   -2.902  -58.001 1.00 53.29  ? 768  ILE B HG12 1 
ATOM   8804  H HG13 . ILE B 1 207 ? 9.290   -2.351  -59.444 1.00 53.29  ? 768  ILE B HG13 1 
ATOM   8805  H HG21 . ILE B 1 207 ? 10.831  -5.342  -58.235 1.00 64.69  ? 768  ILE B HG21 1 
ATOM   8806  H HG22 . ILE B 1 207 ? 12.270  -5.030  -58.830 1.00 64.69  ? 768  ILE B HG22 1 
ATOM   8807  H HG23 . ILE B 1 207 ? 11.681  -4.128  -57.662 1.00 64.69  ? 768  ILE B HG23 1 
ATOM   8808  H HD11 . ILE B 1 207 ? 7.594   -3.692  -58.639 1.00 61.83  ? 768  ILE B HD11 1 
ATOM   8809  H HD12 . ILE B 1 207 ? 8.238   -4.352  -59.933 1.00 61.83  ? 768  ILE B HD12 1 
ATOM   8810  H HD13 . ILE B 1 207 ? 8.613   -4.902  -58.491 1.00 61.83  ? 768  ILE B HD13 1 
ATOM   8811  N N    . SER B 1 208 ? 13.198  -3.525  -61.636 1.00 46.54  ? 769  SER B N    1 
ATOM   8812  C CA   . SER B 1 208 ? 14.404  -4.109  -62.206 1.00 48.68  ? 769  SER B CA   1 
ATOM   8813  C C    . SER B 1 208 ? 15.437  -3.064  -62.597 1.00 51.99  ? 769  SER B C    1 
ATOM   8814  O O    . SER B 1 208 ? 16.521  -3.434  -63.062 1.00 58.90  ? 769  SER B O    1 
ATOM   8815  C CB   . SER B 1 208 ? 14.052  -4.952  -63.434 1.00 46.15  ? 769  SER B CB   1 
ATOM   8816  O OG   . SER B 1 208 ? 13.450  -4.166  -64.450 1.00 50.20  ? 769  SER B OG   1 
ATOM   8817  H H    . SER B 1 208 ? 12.547  -3.455  -62.194 1.00 55.84  ? 769  SER B H    1 
ATOM   8818  H HA   . SER B 1 208 ? 14.809  -4.696  -61.548 1.00 58.42  ? 769  SER B HA   1 
ATOM   8819  H HB2  . SER B 1 208 ? 14.864  -5.349  -63.785 1.00 55.38  ? 769  SER B HB2  1 
ATOM   8820  H HB3  . SER B 1 208 ? 13.432  -5.649  -63.168 1.00 55.38  ? 769  SER B HB3  1 
ATOM   8821  H HG   . SER B 1 208 ? 12.743  -3.817  -64.161 1.00 60.24  ? 769  SER B HG   1 
ATOM   8822  N N    . GLU B 1 209 ? 15.131  -1.778  -62.419 1.00 51.65  ? 770  GLU B N    1 
ATOM   8823  C CA   . GLU B 1 209 ? 16.043  -0.691  -62.773 1.00 54.53  ? 770  GLU B CA   1 
ATOM   8824  C C    . GLU B 1 209 ? 16.433  -0.756  -64.250 1.00 54.81  ? 770  GLU B C    1 
ATOM   8825  O O    . GLU B 1 209 ? 17.612  -0.793  -64.607 1.00 56.43  ? 770  GLU B O    1 
ATOM   8826  C CB   . GLU B 1 209 ? 17.281  -0.699  -61.872 1.00 56.76  ? 770  GLU B CB   1 
ATOM   8827  C CG   . GLU B 1 209 ? 16.962  -0.532  -60.389 1.00 59.07  ? 770  GLU B CG   1 
ATOM   8828  C CD   . GLU B 1 209 ? 18.202  -0.329  -59.538 1.00 74.12  ? 770  GLU B CD   1 
ATOM   8829  O OE1  . GLU B 1 209 ? 19.107  0.419   -59.966 1.00 83.11  ? 770  GLU B OE1  1 
ATOM   8830  O OE2  . GLU B 1 209 ? 18.273  -0.918  -58.438 1.00 69.51  ? 770  GLU B OE2  1 
ATOM   8831  H H    . GLU B 1 209 ? 14.385  -1.506  -62.089 1.00 61.98  ? 770  GLU B H    1 
ATOM   8832  H HA   . GLU B 1 209 ? 15.585  0.152   -62.630 1.00 65.43  ? 770  GLU B HA   1 
ATOM   8833  H HB2  . GLU B 1 209 ? 17.743  -1.544  -61.983 1.00 68.11  ? 770  GLU B HB2  1 
ATOM   8834  H HB3  . GLU B 1 209 ? 17.863  0.031   -62.135 1.00 68.11  ? 770  GLU B HB3  1 
ATOM   8835  H HG2  . GLU B 1 209 ? 16.390  0.243   -60.275 1.00 70.88  ? 770  GLU B HG2  1 
ATOM   8836  H HG3  . GLU B 1 209 ? 16.508  -1.328  -60.073 1.00 70.88  ? 770  GLU B HG3  1 
ATOM   8837  N N    . GLY B 1 210 ? 15.415  -0.776  -65.114 1.00 55.83  ? 771  GLY B N    1 
ATOM   8838  C CA   . GLY B 1 210 ? 15.581  -0.613  -66.545 1.00 61.94  ? 771  GLY B CA   1 
ATOM   8839  C C    . GLY B 1 210 ? 15.351  -1.863  -67.371 1.00 53.26  ? 771  GLY B C    1 
ATOM   8840  O O    . GLY B 1 210 ? 15.181  -1.752  -68.593 1.00 56.48  ? 771  GLY B O    1 
ATOM   8841  H H    . GLY B 1 210 ? 14.596  -0.888  -64.879 1.00 66.99  ? 771  GLY B H    1 
ATOM   8842  H HA2  . GLY B 1 210 ? 14.962  0.067   -66.856 1.00 74.33  ? 771  GLY B HA2  1 
ATOM   8843  H HA3  . GLY B 1 210 ? 16.482  -0.301  -66.722 1.00 74.33  ? 771  GLY B HA3  1 
ATOM   8844  N N    . SER B 1 211 ? 15.332  -3.042  -66.756 1.00 53.44  ? 772  SER B N    1 
ATOM   8845  C CA   . SER B 1 211 ? 15.087  -4.267  -67.503 1.00 51.97  ? 772  SER B CA   1 
ATOM   8846  C C    . SER B 1 211 ? 13.598  -4.446  -67.772 1.00 46.62  ? 772  SER B C    1 
ATOM   8847  O O    . SER B 1 211 ? 12.748  -3.944  -67.033 1.00 47.45  ? 772  SER B O    1 
ATOM   8848  C CB   . SER B 1 211 ? 15.629  -5.480  -66.749 1.00 53.56  ? 772  SER B CB   1 
ATOM   8849  O OG   . SER B 1 211 ? 17.045  -5.476  -66.727 1.00 62.06  ? 772  SER B OG   1 
ATOM   8850  H H    . SER B 1 211 ? 15.457  -3.157  -65.913 1.00 64.12  ? 772  SER B H    1 
ATOM   8851  H HA   . SER B 1 211 ? 15.544  -4.215  -68.358 1.00 62.37  ? 772  SER B HA   1 
ATOM   8852  H HB2  . SER B 1 211 ? 15.299  -5.457  -65.837 1.00 64.28  ? 772  SER B HB2  1 
ATOM   8853  H HB3  . SER B 1 211 ? 15.323  -6.288  -67.190 1.00 64.28  ? 772  SER B HB3  1 
ATOM   8854  H HG   . SER B 1 211 ? 17.327  -6.148  -66.309 1.00 74.47  ? 772  SER B HG   1 
ATOM   8855  N N    . HIS B 1 212 ? 13.288  -5.189  -68.836 1.00 46.54  ? 773  HIS B N    1 
ATOM   8856  C CA   . HIS B 1 212 ? 11.920  -5.428  -69.270 1.00 47.33  ? 773  HIS B CA   1 
ATOM   8857  C C    . HIS B 1 212 ? 11.582  -6.911  -69.133 1.00 45.51  ? 773  HIS B C    1 
ATOM   8858  O O    . HIS B 1 212 ? 12.458  -7.764  -69.311 1.00 46.97  ? 773  HIS B O    1 
ATOM   8859  C CB   . HIS B 1 212 ? 11.740  -4.987  -70.730 1.00 51.29  ? 773  HIS B CB   1 
ATOM   8860  C CG   . HIS B 1 212 ? 10.311  -4.882  -71.168 1.00 50.56  ? 773  HIS B CG   1 
ATOM   8861  N ND1  . HIS B 1 212 ? 9.622   -5.938  -71.724 1.00 43.10  ? 773  HIS B ND1  1 
ATOM   8862  C CD2  . HIS B 1 212 ? 9.446   -3.841  -71.143 1.00 52.24  ? 773  HIS B CD2  1 
ATOM   8863  C CE1  . HIS B 1 212 ? 8.391   -5.554  -72.013 1.00 43.76  ? 773  HIS B CE1  1 
ATOM   8864  N NE2  . HIS B 1 212 ? 8.259   -4.286  -71.672 1.00 46.09  ? 773  HIS B NE2  1 
ATOM   8865  H H    . HIS B 1 212 ? 13.874  -5.574  -69.333 1.00 55.85  ? 773  HIS B H    1 
ATOM   8866  H HA   . HIS B 1 212 ? 11.309  -4.918  -68.715 1.00 56.80  ? 773  HIS B HA   1 
ATOM   8867  H HB2  . HIS B 1 212 ? 12.149  -4.115  -70.845 1.00 61.55  ? 773  HIS B HB2  1 
ATOM   8868  H HB3  . HIS B 1 212 ? 12.179  -5.633  -71.306 1.00 61.55  ? 773  HIS B HB3  1 
ATOM   8869  H HD2  . HIS B 1 212 ? 9.621   -2.985  -70.823 1.00 62.69  ? 773  HIS B HD2  1 
ATOM   8870  H HE1  . HIS B 1 212 ? 7.731   -6.087  -72.396 1.00 52.51  ? 773  HIS B HE1  1 
ATOM   8871  H HE2  . HIS B 1 212 ? 7.546   -3.815  -71.765 1.00 55.31  ? 773  HIS B HE2  1 
ATOM   8872  N N    . PRO B 1 213 ? 10.331  -7.256  -68.794 1.00 45.17  ? 774  PRO B N    1 
ATOM   8873  C CA   . PRO B 1 213 ? 9.977   -8.683  -68.670 1.00 48.81  ? 774  PRO B CA   1 
ATOM   8874  C C    . PRO B 1 213 ? 10.355  -9.505  -69.887 1.00 49.15  ? 774  PRO B C    1 
ATOM   8875  O O    . PRO B 1 213 ? 10.855  -10.629 -69.754 1.00 49.09  ? 774  PRO B O    1 
ATOM   8876  C CB   . PRO B 1 213 ? 8.454   -8.652  -68.472 1.00 47.78  ? 774  PRO B CB   1 
ATOM   8877  C CG   . PRO B 1 213 ? 8.140   -7.302  -67.952 1.00 44.76  ? 774  PRO B CG   1 
ATOM   8878  C CD   . PRO B 1 213 ? 9.247   -6.368  -68.334 1.00 39.93  ? 774  PRO B CD   1 
ATOM   8879  H HA   . PRO B 1 213 ? 10.394  -9.065  -67.883 1.00 58.58  ? 774  PRO B HA   1 
ATOM   8880  H HB2  . PRO B 1 213 ? 8.013   -8.801  -69.323 1.00 57.33  ? 774  PRO B HB2  1 
ATOM   8881  H HB3  . PRO B 1 213 ? 8.197   -9.333  -67.831 1.00 57.33  ? 774  PRO B HB3  1 
ATOM   8882  H HG2  . PRO B 1 213 ? 7.304   -7.001  -68.340 1.00 53.71  ? 774  PRO B HG2  1 
ATOM   8883  H HG3  . PRO B 1 213 ? 8.062   -7.346  -66.986 1.00 53.71  ? 774  PRO B HG3  1 
ATOM   8884  H HD2  . PRO B 1 213 ? 8.961   -5.785  -69.055 1.00 47.92  ? 774  PRO B HD2  1 
ATOM   8885  H HD3  . PRO B 1 213 ? 9.537   -5.857  -67.562 1.00 47.92  ? 774  PRO B HD3  1 
ATOM   8886  N N    . PHE B 1 214 ? 10.124  -8.963  -71.076 1.00 49.72  ? 775  PHE B N    1 
ATOM   8887  C CA   . PHE B 1 214 ? 10.391  -9.643  -72.331 1.00 49.06  ? 775  PHE B CA   1 
ATOM   8888  C C    . PHE B 1 214 ? 11.752  -9.292  -72.912 1.00 55.30  ? 775  PHE B C    1 
ATOM   8889  O O    . PHE B 1 214 ? 12.068  -9.721  -74.024 1.00 63.13  ? 775  PHE B O    1 
ATOM   8890  C CB   . PHE B 1 214 ? 9.272   -9.326  -73.324 1.00 48.31  ? 775  PHE B CB   1 
ATOM   8891  C CG   . PHE B 1 214 ? 7.897   -9.619  -72.780 1.00 47.56  ? 775  PHE B CG   1 
ATOM   8892  C CD1  . PHE B 1 214 ? 7.263   -10.815 -73.062 1.00 50.44  ? 775  PHE B CD1  1 
ATOM   8893  C CD2  . PHE B 1 214 ? 7.254   -8.708  -71.959 1.00 47.29  ? 775  PHE B CD2  1 
ATOM   8894  C CE1  . PHE B 1 214 ? 6.009   -11.090 -72.546 1.00 47.32  ? 775  PHE B CE1  1 
ATOM   8895  C CE2  . PHE B 1 214 ? 6.001   -8.977  -71.443 1.00 45.16  ? 775  PHE B CE2  1 
ATOM   8896  C CZ   . PHE B 1 214 ? 5.378   -10.169 -71.738 1.00 49.52  ? 775  PHE B CZ   1 
ATOM   8897  H H    . PHE B 1 214 ? 9.802   -8.173  -71.181 1.00 59.66  ? 775  PHE B H    1 
ATOM   8898  H HA   . PHE B 1 214 ? 10.379  -10.600 -72.173 1.00 58.88  ? 775  PHE B HA   1 
ATOM   8899  H HB2  . PHE B 1 214 ? 9.310   -8.383  -73.549 1.00 57.97  ? 775  PHE B HB2  1 
ATOM   8900  H HB3  . PHE B 1 214 ? 9.398   -9.862  -74.122 1.00 57.97  ? 775  PHE B HB3  1 
ATOM   8901  H HD1  . PHE B 1 214 ? 7.684   -11.441 -73.606 1.00 60.53  ? 775  PHE B HD1  1 
ATOM   8902  H HD2  . PHE B 1 214 ? 7.670   -7.901  -71.756 1.00 56.75  ? 775  PHE B HD2  1 
ATOM   8903  H HE1  . PHE B 1 214 ? 5.590   -11.896 -72.748 1.00 56.78  ? 775  PHE B HE1  1 
ATOM   8904  H HE2  . PHE B 1 214 ? 5.578   -8.353  -70.898 1.00 54.20  ? 775  PHE B HE2  1 
ATOM   8905  H HZ   . PHE B 1 214 ? 4.534   -10.352 -71.393 1.00 59.43  ? 775  PHE B HZ   1 
ATOM   8906  N N    . GLY B 1 215 ? 12.563  -8.526  -72.193 1.00 72.03  ? 776  GLY B N    1 
ATOM   8907  C CA   . GLY B 1 215 ? 13.949  -8.382  -72.584 1.00 64.86  ? 776  GLY B CA   1 
ATOM   8908  C C    . GLY B 1 215 ? 14.220  -7.314  -73.619 1.00 63.55  ? 776  GLY B C    1 
ATOM   8909  O O    . GLY B 1 215 ? 13.609  -6.240  -73.598 1.00 52.27  ? 776  GLY B O    1 
ATOM   8910  N N    . LYS B 1 216 ? 15.161  -7.607  -74.516 1.00 66.04  ? 777  LYS B N    1 
ATOM   8911  C CA   . LYS B 1 216 ? 15.648  -6.629  -75.480 1.00 65.53  ? 777  LYS B CA   1 
ATOM   8912  C C    . LYS B 1 216 ? 14.515  -6.085  -76.344 1.00 59.55  ? 777  LYS B C    1 
ATOM   8913  O O    . LYS B 1 216 ? 13.567  -6.795  -76.687 1.00 59.37  ? 777  LYS B O    1 
ATOM   8914  C CB   . LYS B 1 216 ? 16.718  -7.261  -76.369 1.00 73.22  ? 777  LYS B CB   1 
ATOM   8915  H H    . LYS B 1 216 ? 15.536  -8.377  -74.585 1.00 79.25  ? 777  LYS B H    1 
ATOM   8916  H HA   . LYS B 1 216 ? 16.050  -5.885  -75.005 1.00 78.63  ? 777  LYS B HA   1 
ATOM   8917  N N    . SER B 1 217 ? 14.644  -4.807  -76.716 1.00 62.17  ? 778  SER B N    1 
ATOM   8918  C CA   . SER B 1 217 ? 13.579  -4.118  -77.441 1.00 65.09  ? 778  SER B CA   1 
ATOM   8919  C C    . SER B 1 217 ? 13.279  -4.790  -78.776 1.00 67.96  ? 778  SER B C    1 
ATOM   8920  O O    . SER B 1 217 ? 12.123  -4.826  -79.214 1.00 66.44  ? 778  SER B O    1 
ATOM   8921  C CB   . SER B 1 217 ? 13.969  -2.656  -77.664 1.00 61.49  ? 778  SER B CB   1 
ATOM   8922  O OG   . SER B 1 217 ? 14.648  -2.129  -76.537 1.00 63.82  ? 778  SER B OG   1 
ATOM   8923  H H    . SER B 1 217 ? 15.336  -4.321  -76.559 1.00 74.60  ? 778  SER B H    1 
ATOM   8924  H HA   . SER B 1 217 ? 12.770  -4.135  -76.907 1.00 78.10  ? 778  SER B HA   1 
ATOM   8925  H HB2  . SER B 1 217 ? 14.553  -2.601  -78.437 1.00 73.79  ? 778  SER B HB2  1 
ATOM   8926  H HB3  . SER B 1 217 ? 13.165  -2.137  -77.819 1.00 73.79  ? 778  SER B HB3  1 
ATOM   8927  H HG   . SER B 1 217 ? 14.855  -1.327  -76.676 1.00 76.59  ? 778  SER B HG   1 
ATOM   8928  N N    . LEU B 1 218 ? 14.308  -5.320  -79.442 1.00 65.66  ? 779  LEU B N    1 
ATOM   8929  C CA   . LEU B 1 218 ? 14.131  -5.883  -80.778 1.00 67.08  ? 779  LEU B CA   1 
ATOM   8930  C C    . LEU B 1 218 ? 13.116  -7.021  -80.768 1.00 62.25  ? 779  LEU B C    1 
ATOM   8931  O O    . LEU B 1 218 ? 12.111  -6.985  -81.488 1.00 62.57  ? 779  LEU B O    1 
ATOM   8932  C CB   . LEU B 1 218 ? 15.478  -6.366  -81.318 1.00 65.43  ? 779  LEU B CB   1 
ATOM   8933  H H    . LEU B 1 218 ? 15.113  -5.365  -79.143 1.00 78.79  ? 779  LEU B H    1 
ATOM   8934  H HA   . LEU B 1 218 ? 13.800  -5.191  -81.372 1.00 80.50  ? 779  LEU B HA   1 
ATOM   8935  N N    . GLN B 1 219 ? 13.362  -8.040  -79.948 1.00 66.34  ? 780  GLN B N    1 
ATOM   8936  C CA   . GLN B 1 219 ? 12.489  -9.201  -79.849 1.00 65.00  ? 780  GLN B CA   1 
ATOM   8937  C C    . GLN B 1 219 ? 11.399  -9.032  -78.800 1.00 56.04  ? 780  GLN B C    1 
ATOM   8938  O O    . GLN B 1 219 ? 10.645  -9.979  -78.555 1.00 53.75  ? 780  GLN B O    1 
ATOM   8939  C CB   . GLN B 1 219 ? 13.315  -10.453 -79.530 1.00 59.68  ? 780  GLN B CB   1 
ATOM   8940  H H    . GLN B 1 219 ? 14.046  -8.080  -79.428 1.00 79.61  ? 780  GLN B H    1 
ATOM   8941  H HA   . GLN B 1 219 ? 12.056  -9.341  -80.706 1.00 78.00  ? 780  GLN B HA   1 
ATOM   8942  N N    . ARG B 1 220 ? 11.304  -7.853  -78.179 1.00 53.51  ? 781  ARG B N    1 
ATOM   8943  C CA   . ARG B 1 220 ? 10.359  -7.641  -77.088 1.00 53.08  ? 781  ARG B CA   1 
ATOM   8944  C C    . ARG B 1 220 ? 8.932   -7.957  -77.522 1.00 46.29  ? 781  ARG B C    1 
ATOM   8945  O O    . ARG B 1 220 ? 8.258   -8.802  -76.921 1.00 44.28  ? 781  ARG B O    1 
ATOM   8946  C CB   . ARG B 1 220 ? 10.462  -6.197  -76.593 1.00 52.32  ? 781  ARG B CB   1 
ATOM   8947  C CG   . ARG B 1 220 ? 9.624   -5.877  -75.371 1.00 45.83  ? 781  ARG B CG   1 
ATOM   8948  C CD   . ARG B 1 220 ? 9.974   -4.496  -74.845 1.00 46.44  ? 781  ARG B CD   1 
ATOM   8949  N NE   . ARG B 1 220 ? 11.363  -4.425  -74.404 1.00 46.71  ? 781  ARG B NE   1 
ATOM   8950  C CZ   . ARG B 1 220 ? 11.939  -3.338  -73.902 1.00 48.53  ? 781  ARG B CZ   1 
ATOM   8951  N NH1  . ARG B 1 220 ? 11.247  -2.215  -73.768 1.00 49.37  ? 781  ARG B NH1  1 
ATOM   8952  N NH2  . ARG B 1 220 ? 13.212  -3.375  -73.533 1.00 51.23  ? 781  ARG B NH2  1 
ATOM   8953  H H    . ARG B 1 220 ? 11.778  -7.162  -78.374 1.00 64.21  ? 781  ARG B H    1 
ATOM   8954  H HA   . ARG B 1 220 ? 10.587  -8.230  -76.351 1.00 63.69  ? 781  ARG B HA   1 
ATOM   8955  H HB2  . ARG B 1 220 ? 11.388  -6.013  -76.370 1.00 62.79  ? 781  ARG B HB2  1 
ATOM   8956  H HB3  . ARG B 1 220 ? 10.176  -5.605  -77.307 1.00 62.79  ? 781  ARG B HB3  1 
ATOM   8957  H HG2  . ARG B 1 220 ? 8.684   -5.887  -75.611 1.00 55.00  ? 781  ARG B HG2  1 
ATOM   8958  H HG3  . ARG B 1 220 ? 9.805   -6.527  -74.675 1.00 55.00  ? 781  ARG B HG3  1 
ATOM   8959  H HD2  . ARG B 1 220 ? 9.846   -3.843  -75.551 1.00 55.73  ? 781  ARG B HD2  1 
ATOM   8960  H HD3  . ARG B 1 220 ? 9.404   -4.288  -74.089 1.00 55.73  ? 781  ARG B HD3  1 
ATOM   8961  H HE   . ARG B 1 220 ? 11.842  -5.136  -74.473 1.00 56.05  ? 781  ARG B HE   1 
ATOM   8962  H HH11 . ARG B 1 220 ? 10.422  -2.187  -74.008 1.00 59.25  ? 781  ARG B HH11 1 
ATOM   8963  H HH12 . ARG B 1 220 ? 11.624  -1.514  -73.442 1.00 59.25  ? 781  ARG B HH12 1 
ATOM   8964  H HH21 . ARG B 1 220 ? 13.664  -4.102  -73.617 1.00 61.48  ? 781  ARG B HH21 1 
ATOM   8965  H HH22 . ARG B 1 220 ? 13.586  -2.672  -73.206 1.00 61.48  ? 781  ARG B HH22 1 
ATOM   8966  N N    . GLN B 1 221 ? 8.457   -7.292  -78.577 1.00 50.07  ? 782  GLN B N    1 
ATOM   8967  C CA   . GLN B 1 221 ? 7.065   -7.451  -78.982 1.00 47.45  ? 782  GLN B CA   1 
ATOM   8968  C C    . GLN B 1 221 ? 6.780   -8.860  -79.486 1.00 50.19  ? 782  GLN B C    1 
ATOM   8969  O O    . GLN B 1 221 ? 5.649   -9.343  -79.362 1.00 50.38  ? 782  GLN B O    1 
ATOM   8970  C CB   . GLN B 1 221 ? 6.708   -6.425  -80.057 1.00 47.83  ? 782  GLN B CB   1 
ATOM   8971  C CG   . GLN B 1 221 ? 5.218   -6.337  -80.356 1.00 47.58  ? 782  GLN B CG   1 
ATOM   8972  C CD   . GLN B 1 221 ? 4.396   -5.967  -79.133 1.00 52.60  ? 782  GLN B CD   1 
ATOM   8973  O OE1  . GLN B 1 221 ? 4.707   -5.007  -78.430 1.00 42.83  ? 782  GLN B OE1  1 
ATOM   8974  N NE2  . GLN B 1 221 ? 3.346   -6.737  -78.869 1.00 47.75  ? 782  GLN B NE2  1 
ATOM   8975  H H    . GLN B 1 221 ? 8.914   -6.752  -79.067 1.00 60.08  ? 782  GLN B H    1 
ATOM   8976  H HA   . GLN B 1 221 ? 6.495   -7.289  -78.214 1.00 56.94  ? 782  GLN B HA   1 
ATOM   8977  H HB2  . GLN B 1 221 ? 7.003   -5.549  -79.762 1.00 57.40  ? 782  GLN B HB2  1 
ATOM   8978  H HB3  . GLN B 1 221 ? 7.162   -6.665  -80.880 1.00 57.40  ? 782  GLN B HB3  1 
ATOM   8979  H HG2  . GLN B 1 221 ? 5.071   -5.659  -81.034 1.00 57.10  ? 782  GLN B HG2  1 
ATOM   8980  H HG3  . GLN B 1 221 ? 4.908   -7.199  -80.676 1.00 57.10  ? 782  GLN B HG3  1 
ATOM   8981  H HE21 . GLN B 1 221 ? 3.163   -7.404  -79.379 1.00 57.30  ? 782  GLN B HE21 1 
ATOM   8982  H HE22 . GLN B 1 221 ? 2.850   -6.567  -78.187 1.00 57.30  ? 782  GLN B HE22 1 
ATOM   8983  N N    . ALA B 1 222 ? 7.779   -9.529  -80.062 1.00 49.63  ? 783  ALA B N    1 
ATOM   8984  C CA   . ALA B 1 222 ? 7.590   -10.913 -80.478 1.00 53.54  ? 783  ALA B CA   1 
ATOM   8985  C C    . ALA B 1 222 ? 7.398   -11.818 -79.268 1.00 52.18  ? 783  ALA B C    1 
ATOM   8986  O O    . ALA B 1 222 ? 6.465   -12.628 -79.228 1.00 52.34  ? 783  ALA B O    1 
ATOM   8987  C CB   . ALA B 1 222 ? 8.781   -11.377 -81.316 1.00 50.27  ? 783  ALA B CB   1 
ATOM   8988  H H    . ALA B 1 222 ? 8.561   -9.208  -80.221 1.00 59.56  ? 783  ALA B H    1 
ATOM   8989  H HA   . ALA B 1 222 ? 6.794   -10.973 -81.027 1.00 64.24  ? 783  ALA B HA   1 
ATOM   8990  H HB1  . ALA B 1 222 ? 8.639   -12.298 -81.583 1.00 60.32  ? 783  ALA B HB1  1 
ATOM   8991  H HB2  . ALA B 1 222 ? 8.852   -10.811 -82.102 1.00 60.32  ? 783  ALA B HB2  1 
ATOM   8992  H HB3  . ALA B 1 222 ? 9.588   -11.307 -80.783 1.00 60.32  ? 783  ALA B HB3  1 
ATOM   8993  N N    . ASN B 1 223 ? 8.265   -11.680 -78.262 1.00 51.53  ? 784  ASN B N    1 
ATOM   8994  C CA   . ASN B 1 223 ? 8.145   -12.494 -77.057 1.00 52.07  ? 784  ASN B CA   1 
ATOM   8995  C C    . ASN B 1 223 ? 6.828   -12.243 -76.333 1.00 47.43  ? 784  ASN B C    1 
ATOM   8996  O O    . ASN B 1 223 ? 6.319   -13.139 -75.650 1.00 48.40  ? 784  ASN B O    1 
ATOM   8997  C CB   . ASN B 1 223 ? 9.328   -12.224 -76.127 1.00 51.31  ? 784  ASN B CB   1 
ATOM   8998  C CG   . ASN B 1 223 ? 10.636  -12.758 -76.676 1.00 51.81  ? 784  ASN B CG   1 
ATOM   8999  O OD1  . ASN B 1 223 ? 10.656  -13.729 -77.432 1.00 53.91  ? 784  ASN B OD1  1 
ATOM   9000  N ND2  . ASN B 1 223 ? 11.740  -12.127 -76.292 1.00 51.21  ? 784  ASN B ND2  1 
ATOM   9001  H H    . ASN B 1 223 ? 8.924   -11.127 -78.254 1.00 61.84  ? 784  ASN B H    1 
ATOM   9002  H HA   . ASN B 1 223 ? 8.173   -13.430 -77.308 1.00 62.48  ? 784  ASN B HA   1 
ATOM   9003  H HB2  . ASN B 1 223 ? 9.422   -11.267 -76.004 1.00 61.57  ? 784  ASN B HB2  1 
ATOM   9004  H HB3  . ASN B 1 223 ? 9.163   -12.654 -75.273 1.00 61.57  ? 784  ASN B HB3  1 
ATOM   9005  H HD21 . ASN B 1 223 ? 12.508  -12.391 -76.576 1.00 61.45  ? 784  ASN B HD21 1 
ATOM   9006  H HD22 . ASN B 1 223 ? 11.688  -11.454 -75.759 1.00 61.45  ? 784  ASN B HD22 1 
ATOM   9007  N N    . ILE B 1 224 ? 6.264   -11.039 -76.461 1.00 48.72  ? 785  ILE B N    1 
ATOM   9008  C CA   . ILE B 1 224 ? 4.934   -10.782 -75.910 1.00 50.92  ? 785  ILE B CA   1 
ATOM   9009  C C    . ILE B 1 224 ? 3.899   -11.646 -76.618 1.00 51.45  ? 785  ILE B C    1 
ATOM   9010  O O    . ILE B 1 224 ? 3.073   -12.308 -75.979 1.00 47.40  ? 785  ILE B O    1 
ATOM   9011  C CB   . ILE B 1 224 ? 4.586   -9.285  -76.016 1.00 48.16  ? 785  ILE B CB   1 
ATOM   9012  C CG1  . ILE B 1 224 ? 5.458   -8.479  -75.055 1.00 46.44  ? 785  ILE B CG1  1 
ATOM   9013  C CG2  . ILE B 1 224 ? 3.107   -9.049  -75.696 1.00 44.43  ? 785  ILE B CG2  1 
ATOM   9014  C CD1  . ILE B 1 224 ? 5.267   -6.993  -75.133 1.00 42.07  ? 785  ILE B CD1  1 
ATOM   9015  H H    . ILE B 1 224 ? 6.625   -10.366 -76.855 1.00 58.46  ? 785  ILE B H    1 
ATOM   9016  H HA   . ILE B 1 224 ? 4.931   -11.023 -74.970 1.00 61.10  ? 785  ILE B HA   1 
ATOM   9017  H HB   . ILE B 1 224 ? 4.761   -8.987  -76.922 1.00 57.80  ? 785  ILE B HB   1 
ATOM   9018  H HG12 . ILE B 1 224 ? 5.255   -8.754  -74.147 1.00 55.73  ? 785  ILE B HG12 1 
ATOM   9019  H HG13 . ILE B 1 224 ? 6.390   -8.665  -75.252 1.00 55.73  ? 785  ILE B HG13 1 
ATOM   9020  H HG21 . ILE B 1 224 ? 2.915   -8.101  -75.770 1.00 53.32  ? 785  ILE B HG21 1 
ATOM   9021  H HG22 . ILE B 1 224 ? 2.564   -9.547  -76.328 1.00 53.32  ? 785  ILE B HG22 1 
ATOM   9022  H HG23 . ILE B 1 224 ? 2.927   -9.354  -74.793 1.00 53.32  ? 785  ILE B HG23 1 
ATOM   9023  H HD11 . ILE B 1 224 ? 5.857   -6.565  -74.493 1.00 50.48  ? 785  ILE B HD11 1 
ATOM   9024  H HD12 . ILE B 1 224 ? 5.480   -6.694  -76.031 1.00 50.48  ? 785  ILE B HD12 1 
ATOM   9025  H HD13 . ILE B 1 224 ? 4.343   -6.782  -74.924 1.00 50.48  ? 785  ILE B HD13 1 
ATOM   9026  N N    . LEU B 1 225 ? 3.922   -11.641 -77.954 1.00 58.65  ? 786  LEU B N    1 
ATOM   9027  C CA   . LEU B 1 225 ? 2.985   -12.459 -78.717 1.00 54.31  ? 786  LEU B CA   1 
ATOM   9028  C C    . LEU B 1 225 ? 3.173   -13.940 -78.420 1.00 53.78  ? 786  LEU B C    1 
ATOM   9029  O O    . LEU B 1 225 ? 2.197   -14.699 -78.406 1.00 54.90  ? 786  LEU B O    1 
ATOM   9030  C CB   . LEU B 1 225 ? 3.153   -12.189 -80.213 1.00 49.65  ? 786  LEU B CB   1 
ATOM   9031  H H    . LEU B 1 225 ? 4.464   -11.178 -78.434 1.00 70.38  ? 786  LEU B H    1 
ATOM   9032  H HA   . LEU B 1 225 ? 2.080   -12.217 -78.468 1.00 65.17  ? 786  LEU B HA   1 
ATOM   9033  N N    . LEU B 1 226 ? 4.415   -14.369 -78.184 1.00 56.06  ? 787  LEU B N    1 
ATOM   9034  C CA   . LEU B 1 226 ? 4.653   -15.748 -77.774 1.00 54.12  ? 787  LEU B CA   1 
ATOM   9035  C C    . LEU B 1 226 ? 4.182   -15.996 -76.348 1.00 53.10  ? 787  LEU B C    1 
ATOM   9036  O O    . LEU B 1 226 ? 3.829   -17.129 -76.001 1.00 61.01  ? 787  LEU B O    1 
ATOM   9037  C CB   . LEU B 1 226 ? 6.140   -16.088 -77.880 1.00 51.88  ? 787  LEU B CB   1 
ATOM   9038  C CG   . LEU B 1 226 ? 6.846   -15.933 -79.228 1.00 55.82  ? 787  LEU B CG   1 
ATOM   9039  C CD1  . LEU B 1 226 ? 8.305   -16.339 -79.082 1.00 53.15  ? 787  LEU B CD1  1 
ATOM   9040  C CD2  . LEU B 1 226 ? 6.163   -16.748 -80.314 1.00 57.61  ? 787  LEU B CD2  1 
ATOM   9041  H H    . LEU B 1 226 ? 5.124   -13.888 -78.252 1.00 67.28  ? 787  LEU B H    1 
ATOM   9042  H HA   . LEU B 1 226 ? 4.164   -16.344 -78.362 1.00 64.95  ? 787  LEU B HA   1 
ATOM   9043  H HB2  . LEU B 1 226 ? 6.615   -15.523 -77.251 1.00 62.25  ? 787  LEU B HB2  1 
ATOM   9044  H HB3  . LEU B 1 226 ? 6.249   -17.014 -77.614 1.00 62.25  ? 787  LEU B HB3  1 
ATOM   9045  H HG   . LEU B 1 226 ? 6.819   -15.000 -79.493 1.00 66.98  ? 787  LEU B HG   1 
ATOM   9046  H HD11 . LEU B 1 226 ? 8.747   -16.239 -79.940 1.00 63.78  ? 787  LEU B HD11 1 
ATOM   9047  H HD12 . LEU B 1 226 ? 8.727   -15.766 -78.423 1.00 63.78  ? 787  LEU B HD12 1 
ATOM   9048  H HD13 . LEU B 1 226 ? 8.348   -17.264 -78.793 1.00 63.78  ? 787  LEU B HD13 1 
ATOM   9049  H HD21 . LEU B 1 226 ? 6.640   -16.622 -81.149 1.00 69.13  ? 787  LEU B HD21 1 
ATOM   9050  H HD22 . LEU B 1 226 ? 6.178   -17.684 -80.062 1.00 69.13  ? 787  LEU B HD22 1 
ATOM   9051  H HD23 . LEU B 1 226 ? 5.247   -16.444 -80.407 1.00 69.13  ? 787  LEU B HD23 1 
ATOM   9052  N N    . GLY B 1 227 ? 4.166   -14.957 -75.516 1.00 51.70  ? 788  GLY B N    1 
ATOM   9053  C CA   . GLY B 1 227 ? 3.943   -15.132 -74.097 1.00 48.73  ? 788  GLY B CA   1 
ATOM   9054  C C    . GLY B 1 227 ? 5.185   -15.512 -73.327 1.00 44.96  ? 788  GLY B C    1 
ATOM   9055  O O    . GLY B 1 227 ? 5.075   -16.020 -72.208 1.00 41.19  ? 788  GLY B O    1 
ATOM   9056  H H    . GLY B 1 227 ? 4.284   -14.140 -75.756 1.00 62.03  ? 788  GLY B H    1 
ATOM   9057  H HA2  . GLY B 1 227 ? 3.597   -14.306 -73.724 1.00 58.47  ? 788  GLY B HA2  1 
ATOM   9058  H HA3  . GLY B 1 227 ? 3.280   -15.827 -73.962 1.00 58.47  ? 788  GLY B HA3  1 
ATOM   9059  N N    . ALA B 1 228 ? 6.367   -15.276 -73.894 1.00 49.04  ? 789  ALA B N    1 
ATOM   9060  C CA   . ALA B 1 228 ? 7.629   -15.663 -73.272 1.00 49.59  ? 789  ALA B CA   1 
ATOM   9061  C C    . ALA B 1 228 ? 8.163   -14.477 -72.477 1.00 47.49  ? 789  ALA B C    1 
ATOM   9062  O O    . ALA B 1 228 ? 8.606   -13.481 -73.057 1.00 48.04  ? 789  ALA B O    1 
ATOM   9063  C CB   . ALA B 1 228 ? 8.633   -16.111 -74.331 1.00 44.60  ? 789  ALA B CB   1 
ATOM   9064  H H    . ALA B 1 228 ? 6.465   -14.886 -74.655 1.00 58.85  ? 789  ALA B H    1 
ATOM   9065  H HA   . ALA B 1 228 ? 7.476   -16.400 -72.660 1.00 59.51  ? 789  ALA B HA   1 
ATOM   9066  H HB1  . ALA B 1 228 ? 9.461   -16.363 -73.893 1.00 53.52  ? 789  ALA B HB1  1 
ATOM   9067  H HB2  . ALA B 1 228 ? 8.268   -16.871 -74.810 1.00 53.52  ? 789  ALA B HB2  1 
ATOM   9068  H HB3  . ALA B 1 228 ? 8.792   -15.378 -74.945 1.00 53.52  ? 789  ALA B HB3  1 
ATOM   9069  N N    . CYS B 1 229 ? 8.141   -14.595 -71.153 1.00 48.68  ? 790  CYS B N    1 
ATOM   9070  C CA   . CYS B 1 229 ? 8.598   -13.543 -70.259 1.00 51.77  ? 790  CYS B CA   1 
ATOM   9071  C C    . CYS B 1 229 ? 9.490   -14.145 -69.186 1.00 53.89  ? 790  CYS B C    1 
ATOM   9072  O O    . CYS B 1 229 ? 9.351   -15.316 -68.824 1.00 56.93  ? 790  CYS B O    1 
ATOM   9073  C CB   . CYS B 1 229 ? 7.421   -12.808 -69.606 1.00 49.65  ? 790  CYS B CB   1 
ATOM   9074  S SG   . CYS B 1 229 ? 6.231   -13.895 -68.794 1.00 56.09  ? 790  CYS B SG   1 
ATOM   9075  H H    . CYS B 1 229 ? 7.858   -15.295 -70.740 1.00 58.42  ? 790  CYS B H    1 
ATOM   9076  H HA   . CYS B 1 229 ? 9.118   -12.898 -70.763 1.00 62.13  ? 790  CYS B HA   1 
ATOM   9077  H HB2  . CYS B 1 229 ? 7.768   -12.198 -68.936 1.00 59.58  ? 790  CYS B HB2  1 
ATOM   9078  H HB3  . CYS B 1 229 ? 6.947   -12.309 -70.289 1.00 59.58  ? 790  CYS B HB3  1 
ATOM   9079  H HG   . CYS B 1 229 ? 5.354   -13.228 -68.317 1.00 67.31  ? 790  CYS B HG   1 
ATOM   9080  N N    . SER B 1 230 ? 10.417  -13.331 -68.688 1.00 56.83  ? 791  SER B N    1 
ATOM   9081  C CA   . SER B 1 230 ? 11.368  -13.762 -67.675 1.00 53.44  ? 791  SER B CA   1 
ATOM   9082  C C    . SER B 1 230 ? 11.584  -12.633 -66.683 1.00 54.70  ? 791  SER B C    1 
ATOM   9083  O O    . SER B 1 230 ? 11.810  -11.488 -67.085 1.00 51.64  ? 791  SER B O    1 
ATOM   9084  C CB   . SER B 1 230 ? 12.703  -14.169 -68.310 1.00 56.09  ? 791  SER B CB   1 
ATOM   9085  O OG   . SER B 1 230 ? 13.756  -14.116 -67.364 1.00 58.25  ? 791  SER B OG   1 
ATOM   9086  H H    . SER B 1 230 ? 10.514  -12.510 -68.927 1.00 68.19  ? 791  SER B H    1 
ATOM   9087  H HA   . SER B 1 230 ? 11.008  -14.526 -67.198 1.00 64.13  ? 791  SER B HA   1 
ATOM   9088  H HB2  . SER B 1 230 ? 12.627  -15.076 -68.646 1.00 67.30  ? 791  SER B HB2  1 
ATOM   9089  H HB3  . SER B 1 230 ? 12.903  -13.562 -69.039 1.00 67.30  ? 791  SER B HB3  1 
ATOM   9090  H HG   . SER B 1 230 ? 13.597  -14.638 -66.726 1.00 69.90  ? 791  SER B HG   1 
ATOM   9091  N N    . LEU B 1 231 ? 11.507  -12.957 -65.395 1.00 54.70  ? 792  LEU B N    1 
ATOM   9092  C CA   . LEU B 1 231 ? 11.891  -12.040 -64.328 1.00 53.04  ? 792  LEU B CA   1 
ATOM   9093  C C    . LEU B 1 231 ? 13.124  -12.650 -63.670 1.00 58.89  ? 792  LEU B C    1 
ATOM   9094  O O    . LEU B 1 231 ? 13.020  -13.613 -62.904 1.00 62.33  ? 792  LEU B O    1 
ATOM   9095  C CB   . LEU B 1 231 ? 10.747  -11.851 -63.334 1.00 52.41  ? 792  LEU B CB   1 
ATOM   9096  C CG   . LEU B 1 231 ? 9.334   -11.813 -63.929 1.00 50.62  ? 792  LEU B CG   1 
ATOM   9097  C CD1  . LEU B 1 231 ? 8.295   -11.766 -62.821 1.00 47.07  ? 792  LEU B CD1  1 
ATOM   9098  C CD2  . LEU B 1 231 ? 9.152   -10.639 -64.878 1.00 50.28  ? 792  LEU B CD2  1 
ATOM   9099  H H    . LEU B 1 231 ? 11.228  -13.719 -65.109 1.00 65.64  ? 792  LEU B H    1 
ATOM   9100  H HA   . LEU B 1 231 ? 12.128  -11.178 -64.703 1.00 63.65  ? 792  LEU B HA   1 
ATOM   9101  H HB2  . LEU B 1 231 ? 10.772  -12.582 -62.697 1.00 62.90  ? 792  LEU B HB2  1 
ATOM   9102  H HB3  . LEU B 1 231 ? 10.885  -11.012 -62.866 1.00 62.90  ? 792  LEU B HB3  1 
ATOM   9103  H HG   . LEU B 1 231 ? 9.189   -12.627 -64.436 1.00 60.74  ? 792  LEU B HG   1 
ATOM   9104  H HD11 . LEU B 1 231 ? 7.411   -11.743 -63.219 1.00 56.48  ? 792  LEU B HD11 1 
ATOM   9105  H HD12 . LEU B 1 231 ? 8.389   -12.557 -62.268 1.00 56.48  ? 792  LEU B HD12 1 
ATOM   9106  H HD13 . LEU B 1 231 ? 8.439   -10.969 -62.287 1.00 56.48  ? 792  LEU B HD13 1 
ATOM   9107  H HD21 . LEU B 1 231 ? 8.248   -10.655 -65.229 1.00 60.33  ? 792  LEU B HD21 1 
ATOM   9108  H HD22 . LEU B 1 231 ? 9.304   -9.814  -64.392 1.00 60.33  ? 792  LEU B HD22 1 
ATOM   9109  H HD23 . LEU B 1 231 ? 9.791   -10.718 -65.604 1.00 60.33  ? 792  LEU B HD23 1 
ATOM   9110  N N    . ASP B 1 232 ? 14.293  -12.086 -63.974 1.00 61.07  ? 793  ASP B N    1 
ATOM   9111  C CA   . ASP B 1 232 ? 15.550  -12.551 -63.406 1.00 62.19  ? 793  ASP B CA   1 
ATOM   9112  C C    . ASP B 1 232 ? 15.986  -11.754 -62.185 1.00 57.86  ? 793  ASP B C    1 
ATOM   9113  O O    . ASP B 1 232 ? 16.910  -12.181 -61.484 1.00 52.46  ? 793  ASP B O    1 
ATOM   9114  C CB   . ASP B 1 232 ? 16.655  -12.496 -64.468 1.00 74.04  ? 793  ASP B CB   1 
ATOM   9115  C CG   . ASP B 1 232 ? 16.286  -13.251 -65.732 1.00 64.94  ? 793  ASP B CG   1 
ATOM   9116  O OD1  . ASP B 1 232 ? 15.535  -14.244 -65.635 1.00 66.57  ? 793  ASP B OD1  1 
ATOM   9117  O OD2  . ASP B 1 232 ? 16.745  -12.850 -66.822 1.00 75.90  ? 793  ASP B OD2  1 
ATOM   9118  H H    . ASP B 1 232 ? 14.381  -11.423 -64.515 1.00 73.29  ? 793  ASP B H    1 
ATOM   9119  H HA   . ASP B 1 232 ? 15.446  -13.476 -63.133 1.00 74.63  ? 793  ASP B HA   1 
ATOM   9120  H HB2  . ASP B 1 232 ? 16.818  -11.570 -64.708 1.00 88.85  ? 793  ASP B HB2  1 
ATOM   9121  H HB3  . ASP B 1 232 ? 17.463  -12.893 -64.106 1.00 88.85  ? 793  ASP B HB3  1 
ATOM   9122  N N    . CYS B 1 233 ? 15.345  -10.620 -61.915 1.00 52.90  ? 794  CYS B N    1 
ATOM   9123  C CA   . CYS B 1 233 ? 15.722  -9.753  -60.811 1.00 58.50  ? 794  CYS B CA   1 
ATOM   9124  C C    . CYS B 1 233 ? 14.929  -10.028 -59.542 1.00 47.81  ? 794  CYS B C    1 
ATOM   9125  O O    . CYS B 1 233 ? 15.265  -9.478  -58.488 1.00 52.77  ? 794  CYS B O    1 
ATOM   9126  C CB   . CYS B 1 233 ? 15.543  -8.294  -61.232 1.00 53.55  ? 794  CYS B CB   1 
ATOM   9127  S SG   . CYS B 1 233 ? 16.164  -7.993  -62.904 1.00 71.76  ? 794  CYS B SG   1 
ATOM   9128  H H    . CYS B 1 233 ? 14.675  -10.329 -62.369 1.00 63.49  ? 794  CYS B H    1 
ATOM   9129  H HA   . CYS B 1 233 ? 16.661  -9.891  -60.610 1.00 70.20  ? 794  CYS B HA   1 
ATOM   9130  H HB2  . CYS B 1 233 ? 14.599  -8.071  -61.215 1.00 64.26  ? 794  CYS B HB2  1 
ATOM   9131  H HB3  . CYS B 1 233 ? 16.032  -7.723  -60.620 1.00 64.26  ? 794  CYS B HB3  1 
ATOM   9132  H HG   . CYS B 1 233 ? 15.998  -6.837  -63.180 1.00 86.11  ? 794  CYS B HG   1 
ATOM   9133  N N    . LEU B 1 234 ? 13.897  -10.864 -59.618 1.00 46.47  ? 795  LEU B N    1 
ATOM   9134  C CA   . LEU B 1 234 ? 13.068  -11.204 -58.469 1.00 49.58  ? 795  LEU B CA   1 
ATOM   9135  C C    . LEU B 1 234 ? 13.525  -12.553 -57.928 1.00 46.44  ? 795  LEU B C    1 
ATOM   9136  O O    . LEU B 1 234 ? 13.383  -13.581 -58.597 1.00 33.43  ? 795  LEU B O    1 
ATOM   9137  C CB   . LEU B 1 234 ? 11.593  -11.231 -58.862 1.00 41.38  ? 795  LEU B CB   1 
ATOM   9138  C CG   . LEU B 1 234 ? 11.078  -9.948  -59.521 1.00 40.91  ? 795  LEU B CG   1 
ATOM   9139  C CD1  . LEU B 1 234 ? 9.575   -10.022 -59.727 1.00 42.87  ? 795  LEU B CD1  1 
ATOM   9140  C CD2  . LEU B 1 234 ? 11.444  -8.709  -58.708 1.00 44.56  ? 795  LEU B CD2  1 
ATOM   9141  H H    . LEU B 1 234 ? 13.653  -11.255 -60.344 1.00 55.76  ? 795  LEU B H    1 
ATOM   9142  H HA   . LEU B 1 234 ? 13.189  -10.538 -57.775 1.00 59.49  ? 795  LEU B HA   1 
ATOM   9143  H HB2  . LEU B 1 234 ? 11.453  -11.958 -59.488 1.00 49.66  ? 795  LEU B HB2  1 
ATOM   9144  H HB3  . LEU B 1 234 ? 11.064  -11.382 -58.063 1.00 49.66  ? 795  LEU B HB3  1 
ATOM   9145  H HG   . LEU B 1 234 ? 11.491  -9.860  -60.394 1.00 49.10  ? 795  LEU B HG   1 
ATOM   9146  H HD11 . LEU B 1 234 ? 9.273   -9.201  -60.145 1.00 51.45  ? 795  LEU B HD11 1 
ATOM   9147  H HD12 . LEU B 1 234 ? 9.372   -10.779 -60.299 1.00 51.45  ? 795  LEU B HD12 1 
ATOM   9148  H HD13 . LEU B 1 234 ? 9.144   -10.133 -58.865 1.00 51.45  ? 795  LEU B HD13 1 
ATOM   9149  H HD21 . LEU B 1 234 ? 11.100  -7.922  -59.160 1.00 53.47  ? 795  LEU B HD21 1 
ATOM   9150  H HD22 . LEU B 1 234 ? 11.049  -8.783  -57.826 1.00 53.47  ? 795  LEU B HD22 1 
ATOM   9151  H HD23 . LEU B 1 234 ? 12.410  -8.653  -58.636 1.00 53.47  ? 795  LEU B HD23 1 
ATOM   9152  N N    . HIS B 1 235 ? 14.073  -12.542 -56.718 1.00 49.15  ? 796  HIS B N    1 
ATOM   9153  C CA   . HIS B 1 235 ? 14.561  -13.766 -56.110 1.00 51.91  ? 796  HIS B CA   1 
ATOM   9154  C C    . HIS B 1 235 ? 13.380  -14.633 -55.679 1.00 55.85  ? 796  HIS B C    1 
ATOM   9155  O O    . HIS B 1 235 ? 12.402  -14.118 -55.126 1.00 56.48  ? 796  HIS B O    1 
ATOM   9156  C CB   . HIS B 1 235 ? 15.440  -13.442 -54.903 1.00 53.52  ? 796  HIS B CB   1 
ATOM   9157  C CG   . HIS B 1 235 ? 16.456  -14.495 -54.592 1.00 62.96  ? 796  HIS B CG   1 
ATOM   9158  N ND1  . HIS B 1 235 ? 16.126  -15.701 -54.013 1.00 65.10  ? 796  HIS B ND1  1 
ATOM   9159  C CD2  . HIS B 1 235 ? 17.797  -14.522 -54.778 1.00 64.95  ? 796  HIS B CD2  1 
ATOM   9160  C CE1  . HIS B 1 235 ? 17.219  -16.427 -53.858 1.00 65.55  ? 796  HIS B CE1  1 
ATOM   9161  N NE2  . HIS B 1 235 ? 18.247  -15.734 -54.315 1.00 76.40  ? 796  HIS B NE2  1 
ATOM   9162  H H    . HIS B 1 235 ? 14.172  -11.839 -56.232 1.00 58.98  ? 796  HIS B H    1 
ATOM   9163  H HA   . HIS B 1 235 ? 15.091  -14.262 -56.754 1.00 62.29  ? 796  HIS B HA   1 
ATOM   9164  H HB2  . HIS B 1 235 ? 15.915  -12.614 -55.076 1.00 64.23  ? 796  HIS B HB2  1 
ATOM   9165  H HB3  . HIS B 1 235 ? 14.873  -13.338 -54.123 1.00 64.23  ? 796  HIS B HB3  1 
ATOM   9166  H HD2  . HIS B 1 235 ? 18.316  -13.847 -55.152 1.00 77.94  ? 796  HIS B HD2  1 
ATOM   9167  H HE1  . HIS B 1 235 ? 17.259  -17.280 -53.490 1.00 78.66  ? 796  HIS B HE1  1 
ATOM   9168  H HE2  . HIS B 1 235 ? 19.065  -15.999 -54.320 1.00 91.68  ? 796  HIS B HE2  1 
ATOM   9169  N N    . PRO B 1 236 ? 13.427  -15.947 -55.923 1.00 57.90  ? 797  PRO B N    1 
ATOM   9170  C CA   . PRO B 1 236 ? 12.313  -16.795 -55.470 1.00 59.28  ? 797  PRO B CA   1 
ATOM   9171  C C    . PRO B 1 236 ? 12.172  -16.845 -53.959 1.00 57.43  ? 797  PRO B C    1 
ATOM   9172  O O    . PRO B 1 236 ? 11.048  -16.970 -53.460 1.00 55.66  ? 797  PRO B O    1 
ATOM   9173  C CB   . PRO B 1 236 ? 12.657  -18.177 -56.049 1.00 55.24  ? 797  PRO B CB   1 
ATOM   9174  C CG   . PRO B 1 236 ? 13.653  -17.917 -57.130 1.00 60.16  ? 797  PRO B CG   1 
ATOM   9175  C CD   . PRO B 1 236 ? 14.420  -16.714 -56.695 1.00 57.23  ? 797  PRO B CD   1 
ATOM   9176  H HA   . PRO B 1 236 ? 11.479  -16.487 -55.857 1.00 71.14  ? 797  PRO B HA   1 
ATOM   9177  H HB2  . PRO B 1 236 ? 13.042  -18.735 -55.356 1.00 66.29  ? 797  PRO B HB2  1 
ATOM   9178  H HB3  . PRO B 1 236 ? 11.856  -18.587 -56.413 1.00 66.29  ? 797  PRO B HB3  1 
ATOM   9179  H HG2  . PRO B 1 236 ? 14.242  -18.683 -57.221 1.00 72.19  ? 797  PRO B HG2  1 
ATOM   9180  H HG3  . PRO B 1 236 ? 13.189  -17.743 -57.964 1.00 72.19  ? 797  PRO B HG3  1 
ATOM   9181  H HD2  . PRO B 1 236 ? 15.163  -16.973 -56.129 1.00 68.68  ? 797  PRO B HD2  1 
ATOM   9182  H HD3  . PRO B 1 236 ? 14.717  -16.205 -57.465 1.00 68.68  ? 797  PRO B HD3  1 
ATOM   9183  N N    . GLU B 1 237 ? 13.278  -16.770 -53.219 1.00 56.52  ? 798  GLU B N    1 
ATOM   9184  C CA   . GLU B 1 237 ? 13.277  -16.922 -51.770 1.00 65.21  ? 798  GLU B CA   1 
ATOM   9185  C C    . GLU B 1 237 ? 13.294  -15.595 -51.010 1.00 58.74  ? 798  GLU B C    1 
ATOM   9186  O O    . GLU B 1 237 ? 13.433  -15.606 -49.783 1.00 58.76  ? 798  GLU B O    1 
ATOM   9187  C CB   . GLU B 1 237 ? 14.463  -17.792 -51.341 1.00 64.50  ? 798  GLU B CB   1 
ATOM   9188  C CG   . GLU B 1 237 ? 14.144  -18.757 -50.201 1.00 79.05  ? 798  GLU B CG   1 
ATOM   9189  C CD   . GLU B 1 237 ? 12.998  -19.702 -50.530 1.00 80.31  ? 798  GLU B CD   1 
ATOM   9190  O OE1  . GLU B 1 237 ? 12.715  -19.908 -51.730 1.00 71.87  ? 798  GLU B OE1  1 
ATOM   9191  O OE2  . GLU B 1 237 ? 12.376  -20.232 -49.586 1.00 79.77  ? 798  GLU B OE2  1 
ATOM   9192  H H    . GLU B 1 237 ? 14.060  -16.626 -53.546 1.00 67.82  ? 798  GLU B H    1 
ATOM   9193  H HA   . GLU B 1 237 ? 12.468  -17.391 -51.514 1.00 78.25  ? 798  GLU B HA   1 
ATOM   9194  H HB2  . GLU B 1 237 ? 14.756  -18.318 -52.102 1.00 77.40  ? 798  GLU B HB2  1 
ATOM   9195  H HB3  . GLU B 1 237 ? 15.184  -17.213 -51.046 1.00 77.40  ? 798  GLU B HB3  1 
ATOM   9196  H HG2  . GLU B 1 237 ? 14.930  -19.294 -50.013 1.00 94.86  ? 798  GLU B HG2  1 
ATOM   9197  H HG3  . GLU B 1 237 ? 13.896  -18.246 -49.415 1.00 94.86  ? 798  GLU B HG3  1 
ATOM   9198  N N    . LYS B 1 238 ? 13.194  -14.459 -51.697 1.00 58.24  ? 799  LYS B N    1 
ATOM   9199  C CA   . LYS B 1 238 ? 13.182  -13.156 -51.039 1.00 52.52  ? 799  LYS B CA   1 
ATOM   9200  C C    . LYS B 1 238 ? 11.752  -12.636 -50.955 1.00 49.13  ? 799  LYS B C    1 
ATOM   9201  O O    . LYS B 1 238 ? 11.042  -12.592 -51.964 1.00 50.21  ? 799  LYS B O    1 
ATOM   9202  C CB   . LYS B 1 238 ? 14.070  -12.158 -51.781 1.00 56.16  ? 799  LYS B CB   1 
ATOM   9203  C CG   . LYS B 1 238 ? 14.354  -10.887 -50.986 1.00 61.00  ? 799  LYS B CG   1 
ATOM   9204  C CD   . LYS B 1 238 ? 15.357  -9.977  -51.687 1.00 69.50  ? 799  LYS B CD   1 
ATOM   9205  C CE   . LYS B 1 238 ? 16.768  -10.562 -51.706 1.00 76.75  ? 799  LYS B CE   1 
ATOM   9206  N NZ   . LYS B 1 238 ? 17.457  -10.454 -50.390 1.00 85.17  ? 799  LYS B NZ   1 
ATOM   9207  H H    . LYS B 1 238 ? 13.131  -14.417 -52.553 1.00 69.89  ? 799  LYS B H    1 
ATOM   9208  H HA   . LYS B 1 238 ? 13.523  -13.252 -50.137 1.00 63.03  ? 799  LYS B HA   1 
ATOM   9209  H HB2  . LYS B 1 238 ? 14.920  -12.581 -51.979 1.00 67.39  ? 799  LYS B HB2  1 
ATOM   9210  H HB3  . LYS B 1 238 ? 13.630  -11.900 -52.606 1.00 67.39  ? 799  LYS B HB3  1 
ATOM   9211  H HG2  . LYS B 1 238 ? 13.527  -10.393 -50.872 1.00 73.20  ? 799  LYS B HG2  1 
ATOM   9212  H HG3  . LYS B 1 238 ? 14.719  -11.129 -50.121 1.00 73.20  ? 799  LYS B HG3  1 
ATOM   9213  H HD2  . LYS B 1 238 ? 15.075  -9.843  -52.605 1.00 83.40  ? 799  LYS B HD2  1 
ATOM   9214  H HD3  . LYS B 1 238 ? 15.391  -9.127  -51.221 1.00 83.40  ? 799  LYS B HD3  1 
ATOM   9215  H HE2  . LYS B 1 238 ? 16.717  -11.502 -51.940 1.00 92.10  ? 799  LYS B HE2  1 
ATOM   9216  H HE3  . LYS B 1 238 ? 17.299  -10.085 -52.362 1.00 92.10  ? 799  LYS B HE3  1 
ATOM   9217  H HZ1  . LYS B 1 238 ? 18.273  -10.805 -50.444 1.00 102.20 ? 799  LYS B HZ1  1 
ATOM   9218  H HZ2  . LYS B 1 238 ? 17.525  -9.599  -50.152 1.00 102.20 ? 799  LYS B HZ2  1 
ATOM   9219  H HZ3  . LYS B 1 238 ? 16.995  -10.891 -49.767 1.00 102.20 ? 799  LYS B HZ3  1 
ATOM   9220  N N    . HIS B 1 239 ? 11.346  -12.224 -49.750 1.00 48.83  ? 800  HIS B N    1 
ATOM   9221  C CA   . HIS B 1 239 ? 9.949   -11.874 -49.501 1.00 47.12  ? 800  HIS B CA   1 
ATOM   9222  C C    . HIS B 1 239 ? 9.493   -10.722 -50.388 1.00 48.44  ? 800  HIS B C    1 
ATOM   9223  O O    . HIS B 1 239 ? 8.411   -10.776 -50.984 1.00 45.13  ? 800  HIS B O    1 
ATOM   9224  C CB   . HIS B 1 239 ? 9.756   -11.518 -48.026 1.00 43.36  ? 800  HIS B CB   1 
ATOM   9225  C CG   . HIS B 1 239 ? 8.456   -10.836 -47.734 1.00 45.80  ? 800  HIS B CG   1 
ATOM   9226  N ND1  . HIS B 1 239 ? 8.381   -9.524  -47.320 1.00 43.02  ? 800  HIS B ND1  1 
ATOM   9227  C CD2  . HIS B 1 239 ? 7.179   -11.284 -47.798 1.00 44.32  ? 800  HIS B CD2  1 
ATOM   9228  C CE1  . HIS B 1 239 ? 7.115   -9.192  -47.140 1.00 43.64  ? 800  HIS B CE1  1 
ATOM   9229  N NE2  . HIS B 1 239 ? 6.366   -10.243 -47.423 1.00 42.98  ? 800  HIS B NE2  1 
ATOM   9230  H H    . HIS B 1 239 ? 11.858  -12.140 -49.065 1.00 58.60  ? 800  HIS B H    1 
ATOM   9231  H HA   . HIS B 1 239 ? 9.391   -12.643 -49.699 1.00 56.55  ? 800  HIS B HA   1 
ATOM   9232  H HB2  . HIS B 1 239 ? 9.788   -12.333 -47.501 1.00 52.03  ? 800  HIS B HB2  1 
ATOM   9233  H HB3  . HIS B 1 239 ? 10.472  -10.923 -47.753 1.00 52.03  ? 800  HIS B HB3  1 
ATOM   9234  H HD1  . HIS B 1 239 ? 9.054   -9.002  -47.197 1.00 51.63  ? 800  HIS B HD1  1 
ATOM   9235  H HD2  . HIS B 1 239 ? 6.905   -12.137 -48.048 1.00 53.19  ? 800  HIS B HD2  1 
ATOM   9236  H HE1  . HIS B 1 239 ? 6.804   -8.361  -46.861 1.00 52.36  ? 800  HIS B HE1  1 
ATOM   9237  N N    . GLU B 1 240 ? 10.299  -9.663  -50.477 1.00 46.24  ? 801  GLU B N    1 
ATOM   9238  C CA   . GLU B 1 240 ? 9.912   -8.510  -51.285 1.00 50.82  ? 801  GLU B CA   1 
ATOM   9239  C C    . GLU B 1 240 ? 9.753   -8.900  -52.747 1.00 45.10  ? 801  GLU B C    1 
ATOM   9240  O O    . GLU B 1 240 ? 8.841   -8.420  -53.432 1.00 39.47  ? 801  GLU B O    1 
ATOM   9241  C CB   . GLU B 1 240 ? 10.942  -7.389  -51.144 1.00 52.17  ? 801  GLU B CB   1 
ATOM   9242  C CG   . GLU B 1 240 ? 11.025  -6.772  -49.751 1.00 62.88  ? 801  GLU B CG   1 
ATOM   9243  C CD   . GLU B 1 240 ? 11.739  -7.655  -48.741 1.00 71.58  ? 801  GLU B CD   1 
ATOM   9244  O OE1  . GLU B 1 240 ? 12.287  -8.704  -49.141 1.00 63.60  ? 801  GLU B OE1  1 
ATOM   9245  O OE2  . GLU B 1 240 ? 11.751  -7.298  -47.544 1.00 71.38  ? 801  GLU B OE2  1 
ATOM   9246  H H    . GLU B 1 240 ? 11.062  -9.588  -50.087 1.00 55.49  ? 801  GLU B H    1 
ATOM   9247  H HA   . GLU B 1 240 ? 9.058   -8.175  -50.969 1.00 60.98  ? 801  GLU B HA   1 
ATOM   9248  H HB2  . GLU B 1 240 ? 11.819  -7.744  -51.360 1.00 62.60  ? 801  GLU B HB2  1 
ATOM   9249  H HB3  . GLU B 1 240 ? 10.716  -6.680  -51.766 1.00 62.60  ? 801  GLU B HB3  1 
ATOM   9250  H HG2  . GLU B 1 240 ? 11.508  -5.933  -49.807 1.00 75.46  ? 801  GLU B HG2  1 
ATOM   9251  H HG3  . GLU B 1 240 ? 10.126  -6.613  -49.424 1.00 75.46  ? 801  GLU B HG3  1 
ATOM   9252  N N    . ASP B 1 241 ? 10.625  -9.779  -53.240 1.00 45.61  ? 802  ASP B N    1 
ATOM   9253  C CA   . ASP B 1 241 ? 10.563  -10.204 -54.631 1.00 42.35  ? 802  ASP B CA   1 
ATOM   9254  C C    . ASP B 1 241 ? 9.440   -11.204 -54.880 1.00 45.89  ? 802  ASP B C    1 
ATOM   9255  O O    . ASP B 1 241 ? 8.922   -11.273 -56.000 1.00 48.29  ? 802  ASP B O    1 
ATOM   9256  C CB   . ASP B 1 241 ? 11.906  -10.806 -55.046 1.00 43.01  ? 802  ASP B CB   1 
ATOM   9257  C CG   . ASP B 1 241 ? 13.063  -9.848  -54.832 1.00 40.34  ? 802  ASP B CG   1 
ATOM   9258  O OD1  . ASP B 1 241 ? 12.875  -8.843  -54.115 1.00 43.34  ? 802  ASP B OD1  1 
ATOM   9259  O OD2  . ASP B 1 241 ? 14.159  -10.101 -55.376 1.00 39.91  ? 802  ASP B OD2  1 
ATOM   9260  H H    . ASP B 1 241 ? 11.260  -10.142 -52.787 1.00 54.73  ? 802  ASP B H    1 
ATOM   9261  H HA   . ASP B 1 241 ? 10.400  -9.428  -55.189 1.00 50.82  ? 802  ASP B HA   1 
ATOM   9262  H HB2  . ASP B 1 241 ? 12.073  -11.602 -54.517 1.00 51.61  ? 802  ASP B HB2  1 
ATOM   9263  H HB3  . ASP B 1 241 ? 11.874  -11.033 -55.988 1.00 51.61  ? 802  ASP B HB3  1 
ATOM   9264  N N    . VAL B 1 242 ? 9.051   -11.982 -53.866 1.00 42.62  ? 803  VAL B N    1 
ATOM   9265  C CA   . VAL B 1 242 ? 7.939   -12.913 -54.037 1.00 42.04  ? 803  VAL B CA   1 
ATOM   9266  C C    . VAL B 1 242 ? 6.630   -12.151 -54.199 1.00 36.27  ? 803  VAL B C    1 
ATOM   9267  O O    . VAL B 1 242 ? 5.814   -12.470 -55.071 1.00 29.82  ? 803  VAL B O    1 
ATOM   9268  C CB   . VAL B 1 242 ? 7.881   -13.899 -52.853 1.00 44.75  ? 803  VAL B CB   1 
ATOM   9269  C CG1  . VAL B 1 242 ? 6.549   -14.644 -52.818 1.00 37.78  ? 803  VAL B CG1  1 
ATOM   9270  C CG2  . VAL B 1 242 ? 9.026   -14.895 -52.936 1.00 46.14  ? 803  VAL B CG2  1 
ATOM   9271  H H    . VAL B 1 242 ? 9.408   -11.988 -53.084 1.00 51.15  ? 803  VAL B H    1 
ATOM   9272  H HA   . VAL B 1 242 ? 8.084   -13.429 -54.846 1.00 50.45  ? 803  VAL B HA   1 
ATOM   9273  H HB   . VAL B 1 242 ? 7.971   -13.404 -52.024 1.00 53.70  ? 803  VAL B HB   1 
ATOM   9274  H HG11 . VAL B 1 242 ? 6.549   -15.253 -52.062 1.00 45.34  ? 803  VAL B HG11 1 
ATOM   9275  H HG12 . VAL B 1 242 ? 5.830   -14.001 -52.725 1.00 45.34  ? 803  VAL B HG12 1 
ATOM   9276  H HG13 . VAL B 1 242 ? 6.444   -15.142 -53.644 1.00 45.34  ? 803  VAL B HG13 1 
ATOM   9277  H HG21 . VAL B 1 242 ? 8.969   -15.503 -52.182 1.00 55.36  ? 803  VAL B HG21 1 
ATOM   9278  H HG22 . VAL B 1 242 ? 8.954   -15.389 -53.767 1.00 55.36  ? 803  VAL B HG22 1 
ATOM   9279  H HG23 . VAL B 1 242 ? 9.867   -14.412 -52.909 1.00 55.36  ? 803  VAL B HG23 1 
ATOM   9280  N N    . ILE B 1 243 ? 6.410   -11.134 -53.362 1.00 39.01  ? 804  ILE B N    1 
ATOM   9281  C CA   . ILE B 1 243 ? 5.195   -10.328 -53.461 1.00 42.25  ? 804  ILE B CA   1 
ATOM   9282  C C    . ILE B 1 243 ? 5.158   -9.592  -54.794 1.00 35.53  ? 804  ILE B C    1 
ATOM   9283  O O    . ILE B 1 243 ? 4.132   -9.573  -55.486 1.00 32.76  ? 804  ILE B O    1 
ATOM   9284  C CB   . ILE B 1 243 ? 5.107   -9.351  -52.271 1.00 40.52  ? 804  ILE B CB   1 
ATOM   9285  C CG1  . ILE B 1 243 ? 4.701   -10.095 -50.993 1.00 35.11  ? 804  ILE B CG1  1 
ATOM   9286  C CG2  . ILE B 1 243 ? 4.134   -8.202  -52.556 1.00 37.88  ? 804  ILE B CG2  1 
ATOM   9287  C CD1  . ILE B 1 243 ? 3.299   -10.696 -51.020 1.00 37.29  ? 804  ILE B CD1  1 
ATOM   9288  H H    . ILE B 1 243 ? 6.945   -10.894 -52.733 1.00 46.81  ? 804  ILE B H    1 
ATOM   9289  H HA   . ILE B 1 243 ? 4.423   -10.915 -53.422 1.00 50.70  ? 804  ILE B HA   1 
ATOM   9290  H HB   . ILE B 1 243 ? 5.988   -8.970  -52.129 1.00 48.63  ? 804  ILE B HB   1 
ATOM   9291  H HG12 . ILE B 1 243 ? 5.328   -10.820 -50.845 1.00 42.14  ? 804  ILE B HG12 1 
ATOM   9292  H HG13 . ILE B 1 243 ? 4.739   -9.474  -50.249 1.00 42.14  ? 804  ILE B HG13 1 
ATOM   9293  H HG21 . ILE B 1 243 ? 4.108   -7.613  -51.786 1.00 45.46  ? 804  ILE B HG21 1 
ATOM   9294  H HG22 . ILE B 1 243 ? 4.442   -7.715  -53.336 1.00 45.46  ? 804  ILE B HG22 1 
ATOM   9295  H HG23 . ILE B 1 243 ? 3.252   -8.570  -52.722 1.00 45.46  ? 804  ILE B HG23 1 
ATOM   9296  H HD11 . ILE B 1 243 ? 3.131   -11.143 -50.176 1.00 44.74  ? 804  ILE B HD11 1 
ATOM   9297  H HD12 . ILE B 1 243 ? 2.653   -9.984  -51.152 1.00 44.74  ? 804  ILE B HD12 1 
ATOM   9298  H HD13 . ILE B 1 243 ? 3.243   -11.333 -51.750 1.00 44.74  ? 804  ILE B HD13 1 
ATOM   9299  N N    . ALA B 1 244 ? 6.276   -8.968  -55.171 1.00 36.95  ? 805  ALA B N    1 
ATOM   9300  C CA   . ALA B 1 244 ? 6.325   -8.235  -56.431 1.00 40.90  ? 805  ALA B CA   1 
ATOM   9301  C C    . ALA B 1 244 ? 6.099   -9.165  -57.616 1.00 36.31  ? 805  ALA B C    1 
ATOM   9302  O O    . ALA B 1 244 ? 5.446   -8.787  -58.597 1.00 30.69  ? 805  ALA B O    1 
ATOM   9303  C CB   . ALA B 1 244 ? 7.663   -7.511  -56.563 1.00 43.39  ? 805  ALA B CB   1 
ATOM   9304  H H    . ALA B 1 244 ? 7.009   -8.955  -54.720 1.00 44.34  ? 805  ALA B H    1 
ATOM   9305  H HA   . ALA B 1 244 ? 5.621   -7.568  -56.436 1.00 49.08  ? 805  ALA B HA   1 
ATOM   9306  H HB1  . ALA B 1 244 ? 7.680   -7.029  -57.405 1.00 52.07  ? 805  ALA B HB1  1 
ATOM   9307  H HB2  . ALA B 1 244 ? 7.760   -6.890  -55.824 1.00 52.07  ? 805  ALA B HB2  1 
ATOM   9308  H HB3  . ALA B 1 244 ? 8.379   -8.165  -56.541 1.00 52.07  ? 805  ALA B HB3  1 
ATOM   9309  N N    . ARG B 1 245 ? 6.626   -10.388 -57.542 1.00 38.57  ? 806  ARG B N    1 
ATOM   9310  C CA   . ARG B 1 245 ? 6.432   -11.344 -58.627 1.00 36.55  ? 806  ARG B CA   1 
ATOM   9311  C C    . ARG B 1 245 ? 4.980   -11.796 -58.712 1.00 34.89  ? 806  ARG B C    1 
ATOM   9312  O O    . ARG B 1 245 ? 4.424   -11.914 -59.811 1.00 33.83  ? 806  ARG B O    1 
ATOM   9313  C CB   . ARG B 1 245 ? 7.353   -12.548 -58.436 1.00 41.08  ? 806  ARG B CB   1 
ATOM   9314  C CG   . ARG B 1 245 ? 7.230   -13.579 -59.542 1.00 40.96  ? 806  ARG B CG   1 
ATOM   9315  C CD   . ARG B 1 245 ? 8.133   -14.774 -59.323 1.00 36.34  ? 806  ARG B CD   1 
ATOM   9316  N NE   . ARG B 1 245 ? 8.714   -15.231 -60.582 1.00 45.19  ? 806  ARG B NE   1 
ATOM   9317  C CZ   . ARG B 1 245 ? 9.994   -15.116 -60.926 1.00 38.13  ? 806  ARG B CZ   1 
ATOM   9318  N NH1  . ARG B 1 245 ? 10.877  -14.569 -60.104 1.00 31.26  ? 806  ARG B NH1  1 
ATOM   9319  N NH2  . ARG B 1 245 ? 10.394  -15.566 -62.107 1.00 39.37  ? 806  ARG B NH2  1 
ATOM   9320  H H    . ARG B 1 245 ? 7.094   -10.684 -56.884 1.00 46.29  ? 806  ARG B H    1 
ATOM   9321  H HA   . ARG B 1 245 ? 6.664   -10.919 -59.468 1.00 43.87  ? 806  ARG B HA   1 
ATOM   9322  H HB2  . ARG B 1 245 ? 8.272   -12.241 -58.416 1.00 49.30  ? 806  ARG B HB2  1 
ATOM   9323  H HB3  . ARG B 1 245 ? 7.132   -12.983 -57.598 1.00 49.30  ? 806  ARG B HB3  1 
ATOM   9324  H HG2  . ARG B 1 245 ? 6.315   -13.897 -59.579 1.00 49.16  ? 806  ARG B HG2  1 
ATOM   9325  H HG3  . ARG B 1 245 ? 7.475   -13.168 -60.386 1.00 49.16  ? 806  ARG B HG3  1 
ATOM   9326  H HD2  . ARG B 1 245 ? 8.856   -14.527 -58.726 1.00 43.61  ? 806  ARG B HD2  1 
ATOM   9327  H HD3  . ARG B 1 245 ? 7.616   -15.502 -58.944 1.00 43.61  ? 806  ARG B HD3  1 
ATOM   9328  H HE   . ARG B 1 245 ? 8.185   -15.604 -61.148 1.00 54.22  ? 806  ARG B HE   1 
ATOM   9329  H HH11 . ARG B 1 245 ? 10.625  -14.274 -59.336 1.00 37.51  ? 806  ARG B HH11 1 
ATOM   9330  H HH12 . ARG B 1 245 ? 11.702  -14.505 -60.340 1.00 37.51  ? 806  ARG B HH12 1 
ATOM   9331  H HH21 . ARG B 1 245 ? 9.827   -15.926 -62.644 1.00 47.24  ? 806  ARG B HH21 1 
ATOM   9332  H HH22 . ARG B 1 245 ? 11.221  -15.501 -62.334 1.00 47.24  ? 806  ARG B HH22 1 
ATOM   9333  N N    . GLU B 1 246 ? 4.353   -12.061 -57.564 1.00 35.15  ? 807  GLU B N    1 
ATOM   9334  C CA   . GLU B 1 246 ? 2.967   -12.518 -57.556 1.00 39.51  ? 807  GLU B CA   1 
ATOM   9335  C C    . GLU B 1 246 ? 2.050   -11.502 -58.226 1.00 35.51  ? 807  GLU B C    1 
ATOM   9336  O O    . GLU B 1 246 ? 1.133   -11.875 -58.968 1.00 28.91  ? 807  GLU B O    1 
ATOM   9337  C CB   . GLU B 1 246 ? 2.525   -12.788 -56.116 1.00 43.23  ? 807  GLU B CB   1 
ATOM   9338  C CG   . GLU B 1 246 ? 1.313   -13.710 -55.977 1.00 45.32  ? 807  GLU B CG   1 
ATOM   9339  C CD   . GLU B 1 246 ? -0.020  -12.975 -55.971 1.00 55.50  ? 807  GLU B CD   1 
ATOM   9340  O OE1  . GLU B 1 246 ? -0.063  -11.795 -55.563 1.00 41.76  ? 807  GLU B OE1  1 
ATOM   9341  O OE2  . GLU B 1 246 ? -1.033  -13.584 -56.371 1.00 50.71  ? 807  GLU B OE2  1 
ATOM   9342  H H    . GLU B 1 246 ? 4.707   -11.985 -56.784 1.00 42.18  ? 807  GLU B H    1 
ATOM   9343  H HA   . GLU B 1 246 ? 2.905   -13.350 -58.050 1.00 47.42  ? 807  GLU B HA   1 
ATOM   9344  H HB2  . GLU B 1 246 ? 3.263   -13.200 -55.639 1.00 51.87  ? 807  GLU B HB2  1 
ATOM   9345  H HB3  . GLU B 1 246 ? 2.300   -11.942 -55.698 1.00 51.87  ? 807  GLU B HB3  1 
ATOM   9346  H HG2  . GLU B 1 246 ? 1.305   -14.331 -56.722 1.00 54.39  ? 807  GLU B HG2  1 
ATOM   9347  H HG3  . GLU B 1 246 ? 1.385   -14.198 -55.142 1.00 54.39  ? 807  GLU B HG3  1 
ATOM   9348  N N    . LEU B 1 247 ? 2.287   -10.210 -57.983 1.00 35.36  ? 808  LEU B N    1 
ATOM   9349  C CA   . LEU B 1 247 ? 1.465   -9.171  -58.597 1.00 33.16  ? 808  LEU B CA   1 
ATOM   9350  C C    . LEU B 1 247 ? 1.784   -9.015  -60.079 1.00 28.28  ? 808  LEU B C    1 
ATOM   9351  O O    . LEU B 1 247 ? 0.881   -9.039  -60.925 1.00 23.98  ? 808  LEU B O    1 
ATOM   9352  C CB   . LEU B 1 247 ? 1.672   -7.844  -57.865 1.00 31.84  ? 808  LEU B CB   1 
ATOM   9353  C CG   . LEU B 1 247 ? 1.035   -6.594  -58.474 1.00 27.94  ? 808  LEU B CG   1 
ATOM   9354  C CD1  . LEU B 1 247 ? -0.480  -6.725  -58.550 1.00 32.21  ? 808  LEU B CD1  1 
ATOM   9355  C CD2  . LEU B 1 247 ? 1.432   -5.353  -57.686 1.00 32.98  ? 808  LEU B CD2  1 
ATOM   9356  H H    . LEU B 1 247 ? 2.912   -9.914  -57.472 1.00 42.44  ? 808  LEU B H    1 
ATOM   9357  H HA   . LEU B 1 247 ? 0.530   -9.417  -58.515 1.00 39.79  ? 808  LEU B HA   1 
ATOM   9358  H HB2  . LEU B 1 247 ? 1.313   -7.938  -56.968 1.00 38.21  ? 808  LEU B HB2  1 
ATOM   9359  H HB3  . LEU B 1 247 ? 2.626   -7.678  -57.809 1.00 38.21  ? 808  LEU B HB3  1 
ATOM   9360  H HG   . LEU B 1 247 ? 1.366   -6.486  -59.379 1.00 33.52  ? 808  LEU B HG   1 
ATOM   9361  H HD11 . LEU B 1 247 ? -0.847  -5.917  -58.940 1.00 38.65  ? 808  LEU B HD11 1 
ATOM   9362  H HD12 . LEU B 1 247 ? -0.703  -7.491  -59.103 1.00 38.65  ? 808  LEU B HD12 1 
ATOM   9363  H HD13 . LEU B 1 247 ? -0.831  -6.851  -57.655 1.00 38.65  ? 808  LEU B HD13 1 
ATOM   9364  H HD21 . LEU B 1 247 ? 1.016   -4.576  -58.091 1.00 39.57  ? 808  LEU B HD21 1 
ATOM   9365  H HD22 . LEU B 1 247 ? 1.128   -5.451  -56.769 1.00 39.57  ? 808  LEU B HD22 1 
ATOM   9366  H HD23 . LEU B 1 247 ? 2.397   -5.262  -57.707 1.00 39.57  ? 808  LEU B HD23 1 
ATOM   9367  N N    . ILE B 1 248 ? 3.068   -8.862  -60.413 1.00 29.19  ? 809  ILE B N    1 
ATOM   9368  C CA   . ILE B 1 248 ? 3.456   -8.551  -61.788 1.00 32.66  ? 809  ILE B CA   1 
ATOM   9369  C C    . ILE B 1 248 ? 3.043   -9.678  -62.727 1.00 37.10  ? 809  ILE B C    1 
ATOM   9370  O O    . ILE B 1 248 ? 2.461   -9.437  -63.790 1.00 35.32  ? 809  ILE B O    1 
ATOM   9371  C CB   . ILE B 1 248 ? 4.969   -8.275  -61.866 1.00 32.70  ? 809  ILE B CB   1 
ATOM   9372  C CG1  . ILE B 1 248 ? 5.287   -6.952  -61.166 1.00 34.29  ? 809  ILE B CG1  1 
ATOM   9373  C CG2  . ILE B 1 248 ? 5.445   -8.222  -63.318 1.00 33.44  ? 809  ILE B CG2  1 
ATOM   9374  C CD1  . ILE B 1 248 ? 6.763   -6.649  -61.040 1.00 33.87  ? 809  ILE B CD1  1 
ATOM   9375  H H    . ILE B 1 248 ? 3.727   -8.933  -59.865 1.00 35.03  ? 809  ILE B H    1 
ATOM   9376  H HA   . ILE B 1 248 ? 2.993   -7.747  -62.069 1.00 39.20  ? 809  ILE B HA   1 
ATOM   9377  H HB   . ILE B 1 248 ? 5.440   -8.990  -61.409 1.00 39.25  ? 809  ILE B HB   1 
ATOM   9378  H HG12 . ILE B 1 248 ? 4.880   -6.229  -61.669 1.00 41.15  ? 809  ILE B HG12 1 
ATOM   9379  H HG13 . ILE B 1 248 ? 4.914   -6.977  -60.270 1.00 41.15  ? 809  ILE B HG13 1 
ATOM   9380  H HG21 . ILE B 1 248 ? 6.398   -8.047  -63.331 1.00 40.13  ? 809  ILE B HG21 1 
ATOM   9381  H HG22 . ILE B 1 248 ? 5.258   -9.074  -63.742 1.00 40.13  ? 809  ILE B HG22 1 
ATOM   9382  H HG23 . ILE B 1 248 ? 4.971   -7.512  -63.779 1.00 40.13  ? 809  ILE B HG23 1 
ATOM   9383  H HD11 . ILE B 1 248 ? 6.873   -5.798  -60.587 1.00 40.64  ? 809  ILE B HD11 1 
ATOM   9384  H HD12 . ILE B 1 248 ? 7.186   -7.355  -60.526 1.00 40.64  ? 809  ILE B HD12 1 
ATOM   9385  H HD13 . ILE B 1 248 ? 7.152   -6.606  -61.927 1.00 40.64  ? 809  ILE B HD13 1 
ATOM   9386  N N    . GLU B 1 249 ? 3.339   -10.925 -62.347 1.00 34.84  ? 810  GLU B N    1 
ATOM   9387  C CA   . GLU B 1 249 ? 3.047   -12.056 -63.223 1.00 37.31  ? 810  GLU B CA   1 
ATOM   9388  C C    . GLU B 1 249 ? 1.573   -12.095 -63.607 1.00 35.86  ? 810  GLU B C    1 
ATOM   9389  O O    . GLU B 1 249 ? 1.225   -12.474 -64.732 1.00 34.59  ? 810  GLU B O    1 
ATOM   9390  C CB   . GLU B 1 249 ? 3.452   -13.365 -62.547 1.00 44.50  ? 810  GLU B CB   1 
ATOM   9391  C CG   . GLU B 1 249 ? 4.949   -13.599 -62.486 1.00 50.80  ? 810  GLU B CG   1 
ATOM   9392  C CD   . GLU B 1 249 ? 5.298   -14.919 -61.830 1.00 53.89  ? 810  GLU B CD   1 
ATOM   9393  O OE1  . GLU B 1 249 ? 4.545   -15.349 -60.930 1.00 52.83  ? 810  GLU B OE1  1 
ATOM   9394  O OE2  . GLU B 1 249 ? 6.316   -15.531 -62.219 1.00 41.04  ? 810  GLU B OE2  1 
ATOM   9395  H H    . GLU B 1 249 ? 3.704   -11.137 -61.598 1.00 41.80  ? 810  GLU B H    1 
ATOM   9396  H HA   . GLU B 1 249 ? 3.565   -11.966 -64.038 1.00 44.78  ? 810  GLU B HA   1 
ATOM   9397  H HB2  . GLU B 1 249 ? 3.117   -13.361 -61.637 1.00 53.40  ? 810  GLU B HB2  1 
ATOM   9398  H HB3  . GLU B 1 249 ? 3.058   -14.103 -63.038 1.00 53.40  ? 810  GLU B HB3  1 
ATOM   9399  H HG2  . GLU B 1 249 ? 5.306   -13.607 -63.388 1.00 60.97  ? 810  GLU B HG2  1 
ATOM   9400  H HG3  . GLU B 1 249 ? 5.361   -12.888 -61.971 1.00 60.97  ? 810  GLU B HG3  1 
ATOM   9401  N N    . LYS B 1 250 ? 0.691   -11.707 -62.684 1.00 33.43  ? 811  LYS B N    1 
ATOM   9402  C CA   . LYS B 1 250 ? -0.736  -11.683 -62.983 1.00 38.18  ? 811  LYS B CA   1 
ATOM   9403  C C    . LYS B 1 250 ? -1.118  -10.473 -63.826 1.00 40.41  ? 811  LYS B C    1 
ATOM   9404  O O    . LYS B 1 250 ? -2.062  -10.554 -64.621 1.00 41.30  ? 811  LYS B O    1 
ATOM   9405  C CB   . LYS B 1 250 ? -1.545  -11.696 -61.684 1.00 39.60  ? 811  LYS B CB   1 
ATOM   9406  C CG   . LYS B 1 250 ? -3.037  -11.927 -61.878 1.00 47.98  ? 811  LYS B CG   1 
ATOM   9407  C CD   . LYS B 1 250 ? -3.804  -11.736 -60.573 1.00 46.87  ? 811  LYS B CD   1 
ATOM   9408  C CE   . LYS B 1 250 ? -5.309  -11.733 -60.800 1.00 50.52  ? 811  LYS B CE   1 
ATOM   9409  N NZ   . LYS B 1 250 ? -6.066  -11.213 -59.630 1.00 56.19  ? 811  LYS B NZ   1 
ATOM   9410  H H    . LYS B 1 250 ? 0.892   -11.456 -61.887 1.00 40.11  ? 811  LYS B H    1 
ATOM   9411  H HA   . LYS B 1 250 ? -0.965  -12.481 -63.485 1.00 45.81  ? 811  LYS B HA   1 
ATOM   9412  H HB2  . LYS B 1 250 ? -1.208  -12.407 -61.115 1.00 47.52  ? 811  LYS B HB2  1 
ATOM   9413  H HB3  . LYS B 1 250 ? -1.434  -10.841 -61.240 1.00 47.52  ? 811  LYS B HB3  1 
ATOM   9414  H HG2  . LYS B 1 250 ? -3.378  -11.291 -62.527 1.00 57.57  ? 811  LYS B HG2  1 
ATOM   9415  H HG3  . LYS B 1 250 ? -3.184  -12.834 -62.187 1.00 57.57  ? 811  LYS B HG3  1 
ATOM   9416  H HD2  . LYS B 1 250 ? -3.590  -12.463 -59.967 1.00 56.25  ? 811  LYS B HD2  1 
ATOM   9417  H HD3  . LYS B 1 250 ? -3.555  -10.886 -60.177 1.00 56.25  ? 811  LYS B HD3  1 
ATOM   9418  H HE2  . LYS B 1 250 ? -5.513  -11.171 -61.563 1.00 60.62  ? 811  LYS B HE2  1 
ATOM   9419  H HE3  . LYS B 1 250 ? -5.605  -12.642 -60.968 1.00 60.62  ? 811  LYS B HE3  1 
ATOM   9420  H HZ1  . LYS B 1 250 ? -6.939  -11.227 -59.801 1.00 67.43  ? 811  LYS B HZ1  1 
ATOM   9421  H HZ2  . LYS B 1 250 ? -5.904  -11.716 -58.914 1.00 67.43  ? 811  LYS B HZ2  1 
ATOM   9422  H HZ3  . LYS B 1 250 ? -5.819  -10.375 -59.456 1.00 67.43  ? 811  LYS B HZ3  1 
ATOM   9423  N N    . MET B 1 251 ? -0.400  -9.356  -63.678 1.00 33.46  ? 812  MET B N    1 
ATOM   9424  C CA   . MET B 1 251 ? -0.718  -8.164  -64.459 1.00 42.15  ? 812  MET B CA   1 
ATOM   9425  C C    . MET B 1 251 ? -0.347  -8.351  -65.924 1.00 36.26  ? 812  MET B C    1 
ATOM   9426  O O    . MET B 1 251 ? -1.062  -7.881  -66.815 1.00 35.56  ? 812  MET B O    1 
ATOM   9427  C CB   . MET B 1 251 ? 0.004   -6.947  -63.879 1.00 34.82  ? 812  MET B CB   1 
ATOM   9428  C CG   . MET B 1 251 ? -0.596  -6.425  -62.586 1.00 36.25  ? 812  MET B CG   1 
ATOM   9429  S SD   . MET B 1 251 ? 0.114   -4.847  -62.079 1.00 39.33  ? 812  MET B SD   1 
ATOM   9430  C CE   . MET B 1 251 ? 1.842   -5.283  -61.919 1.00 32.16  ? 812  MET B CE   1 
ATOM   9431  H H    . MET B 1 251 ? 0.265   -9.266  -63.140 1.00 40.16  ? 812  MET B H    1 
ATOM   9432  H HA   . MET B 1 251 ? -1.671  -7.998  -64.398 1.00 50.58  ? 812  MET B HA   1 
ATOM   9433  H HB2  . MET B 1 251 ? 0.926   -7.188  -63.700 1.00 41.78  ? 812  MET B HB2  1 
ATOM   9434  H HB3  . MET B 1 251 ? -0.027  -6.228  -64.530 1.00 41.78  ? 812  MET B HB3  1 
ATOM   9435  H HG2  . MET B 1 251 ? -1.550  -6.299  -62.708 1.00 43.50  ? 812  MET B HG2  1 
ATOM   9436  H HG3  . MET B 1 251 ? -0.433  -7.069  -61.879 1.00 43.50  ? 812  MET B HG3  1 
ATOM   9437  H HE1  . MET B 1 251 ? 1.931   -5.982  -61.252 1.00 38.60  ? 812  MET B HE1  1 
ATOM   9438  H HE2  . MET B 1 251 ? 2.169   -5.599  -62.776 1.00 38.60  ? 812  MET B HE2  1 
ATOM   9439  H HE3  . MET B 1 251 ? 2.341   -4.498  -61.644 1.00 38.60  ? 812  MET B HE3  1 
ATOM   9440  N N    . ILE B 1 252 ? 0.773   -9.019  -66.197 1.00 39.51  ? 813  ILE B N    1 
ATOM   9441  C CA   . ILE B 1 252 ? 1.219   -9.261  -67.566 1.00 37.62  ? 813  ILE B CA   1 
ATOM   9442  C C    . ILE B 1 252 ? 0.726   -10.603 -68.108 1.00 34.68  ? 813  ILE B C    1 
ATOM   9443  O O    . ILE B 1 252 ? 1.160   -11.023 -69.185 1.00 37.96  ? 813  ILE B O    1 
ATOM   9444  C CB   . ILE B 1 252 ? 2.750   -9.147  -67.681 1.00 36.96  ? 813  ILE B CB   1 
ATOM   9445  C CG1  . ILE B 1 252 ? 3.448   -10.266 -66.900 1.00 30.63  ? 813  ILE B CG1  1 
ATOM   9446  C CG2  . ILE B 1 252 ? 3.200   -7.763  -67.204 1.00 31.87  ? 813  ILE B CG2  1 
ATOM   9447  C CD1  . ILE B 1 252 ? 4.959   -10.248 -67.008 1.00 32.06  ? 813  ILE B CD1  1 
ATOM   9448  H H    . ILE B 1 252 ? 1.298   -9.345  -65.599 1.00 47.41  ? 813  ILE B H    1 
ATOM   9449  H HA   . ILE B 1 252 ? 0.840   -8.570  -68.131 1.00 45.15  ? 813  ILE B HA   1 
ATOM   9450  H HB   . ILE B 1 252 ? 2.990   -9.237  -68.616 1.00 44.35  ? 813  ILE B HB   1 
ATOM   9451  H HG12 . ILE B 1 252 ? 3.218   -10.182 -65.962 1.00 36.76  ? 813  ILE B HG12 1 
ATOM   9452  H HG13 . ILE B 1 252 ? 3.138   -11.121 -67.238 1.00 36.76  ? 813  ILE B HG13 1 
ATOM   9453  H HG21 . ILE B 1 252 ? 4.165   -7.702  -67.280 1.00 38.25  ? 813  ILE B HG21 1 
ATOM   9454  H HG22 . ILE B 1 252 ? 2.781   -7.087  -67.758 1.00 38.25  ? 813  ILE B HG22 1 
ATOM   9455  H HG23 . ILE B 1 252 ? 2.933   -7.646  -66.279 1.00 38.25  ? 813  ILE B HG23 1 
ATOM   9456  H HD11 . ILE B 1 252 ? 5.321   -10.983 -66.490 1.00 38.47  ? 813  ILE B HD11 1 
ATOM   9457  H HD12 . ILE B 1 252 ? 5.210   -10.345 -67.940 1.00 38.47  ? 813  ILE B HD12 1 
ATOM   9458  H HD13 . ILE B 1 252 ? 5.290   -9.404  -66.662 1.00 38.47  ? 813  ILE B HD13 1 
ATOM   9459  N N    . ALA B 1 253 ? -0.153  -11.290 -67.382 1.00 37.55  ? 814  ALA B N    1 
ATOM   9460  C CA   . ALA B 1 253 ? -0.641  -12.599 -67.803 1.00 37.63  ? 814  ALA B CA   1 
ATOM   9461  C C    . ALA B 1 253 ? -1.207  -12.552 -69.216 1.00 42.54  ? 814  ALA B C    1 
ATOM   9462  O O    . ALA B 1 253 ? -1.822  -11.565 -69.626 1.00 39.39  ? 814  ALA B O    1 
ATOM   9463  C CB   . ALA B 1 253 ? -1.714  -13.089 -66.832 1.00 32.55  ? 814  ALA B CB   1 
ATOM   9464  H H    . ALA B 1 253 ? -0.484  -11.017 -66.636 1.00 45.06  ? 814  ALA B H    1 
ATOM   9465  H HA   . ALA B 1 253 ? 0.093   -13.233 -67.790 1.00 45.15  ? 814  ALA B HA   1 
ATOM   9466  H HB1  . ALA B 1 253 ? -2.029  -13.959 -67.123 1.00 39.06  ? 814  ALA B HB1  1 
ATOM   9467  H HB2  . ALA B 1 253 ? -1.329  -13.156 -65.944 1.00 39.06  ? 814  ALA B HB2  1 
ATOM   9468  H HB3  . ALA B 1 253 ? -2.448  -12.455 -66.828 1.00 39.06  ? 814  ALA B HB3  1 
ATOM   9469  N N    . MET B 1 254 ? -0.982  -13.637 -69.962 1.00 41.38  ? 815  MET B N    1 
ATOM   9470  C CA   . MET B 1 254 ? -1.433  -13.707 -71.348 1.00 39.04  ? 815  MET B CA   1 
ATOM   9471  C C    . MET B 1 254 ? -2.949  -13.581 -71.443 1.00 41.36  ? 815  MET B C    1 
ATOM   9472  O O    . MET B 1 254 ? -3.472  -12.826 -72.272 1.00 41.94  ? 815  MET B O    1 
ATOM   9473  C CB   . MET B 1 254 ? -0.959  -15.019 -71.973 1.00 37.73  ? 815  MET B CB   1 
ATOM   9474  C CG   . MET B 1 254 ? 0.373   -14.916 -72.697 1.00 45.59  ? 815  MET B CG   1 
ATOM   9475  S SD   . MET B 1 254 ? 0.282   -13.913 -74.193 1.00 77.96  ? 815  MET B SD   1 
ATOM   9476  C CE   . MET B 1 254 ? -0.883  -14.856 -75.175 1.00 61.07  ? 815  MET B CE   1 
ATOM   9477  H H    . MET B 1 254 ? -0.572  -14.341 -69.688 1.00 49.66  ? 815  MET B H    1 
ATOM   9478  H HA   . MET B 1 254 ? -1.028  -12.979 -71.845 1.00 46.85  ? 815  MET B HA   1 
ATOM   9479  H HB2  . MET B 1 254 ? -0.863  -15.682 -71.271 1.00 45.27  ? 815  MET B HB2  1 
ATOM   9480  H HB3  . MET B 1 254 ? -1.622  -15.316 -72.615 1.00 45.27  ? 815  MET B HB3  1 
ATOM   9481  H HG2  . MET B 1 254 ? 1.024   -14.510 -72.103 1.00 54.71  ? 815  MET B HG2  1 
ATOM   9482  H HG3  . MET B 1 254 ? 0.664   -15.806 -72.949 1.00 54.71  ? 815  MET B HG3  1 
ATOM   9483  H HE1  . MET B 1 254 ? -1.017  -14.406 -76.024 1.00 73.28  ? 815  MET B HE1  1 
ATOM   9484  H HE2  . MET B 1 254 ? -0.524  -15.744 -75.324 1.00 73.28  ? 815  MET B HE2  1 
ATOM   9485  H HE3  . MET B 1 254 ? -1.724  -14.915 -74.695 1.00 73.28  ? 815  MET B HE3  1 
ATOM   9486  N N    . ASP B 1 255 ? -3.672  -14.310 -70.602 1.00 44.47  ? 816  ASP B N    1 
ATOM   9487  C CA   . ASP B 1 255 ? -5.128  -14.245 -70.606 1.00 46.39  ? 816  ASP B CA   1 
ATOM   9488  C C    . ASP B 1 255 ? -5.579  -12.952 -69.937 1.00 44.85  ? 816  ASP B C    1 
ATOM   9489  O O    . ASP B 1 255 ? -5.319  -12.764 -68.743 1.00 41.29  ? 816  ASP B O    1 
ATOM   9490  C CB   . ASP B 1 255 ? -5.715  -15.446 -69.879 1.00 45.37  ? 816  ASP B CB   1 
ATOM   9491  C CG   . ASP B 1 255 ? -7.233  -15.447 -69.877 1.00 49.22  ? 816  ASP B CG   1 
ATOM   9492  O OD1  . ASP B 1 255 ? -7.835  -14.806 -70.764 1.00 48.46  ? 816  ASP B OD1  1 
ATOM   9493  O OD2  . ASP B 1 255 ? -7.825  -16.096 -68.990 1.00 52.27  ? 816  ASP B OD2  1 
ATOM   9494  H H    . ASP B 1 255 ? -3.343  -14.850 -70.019 1.00 53.36  ? 816  ASP B H    1 
ATOM   9495  H HA   . ASP B 1 255 ? -5.451  -14.249 -71.521 1.00 55.67  ? 816  ASP B HA   1 
ATOM   9496  H HB2  . ASP B 1 255 ? -5.415  -16.258 -70.318 1.00 54.44  ? 816  ASP B HB2  1 
ATOM   9497  H HB3  . ASP B 1 255 ? -5.414  -15.436 -68.957 1.00 54.44  ? 816  ASP B HB3  1 
ATOM   9498  N N    . PRO B 1 256 ? -6.249  -12.042 -70.652 1.00 47.65  ? 817  PRO B N    1 
ATOM   9499  C CA   . PRO B 1 256 ? -6.605  -10.757 -70.029 1.00 42.05  ? 817  PRO B CA   1 
ATOM   9500  C C    . PRO B 1 256 ? -7.596  -10.884 -68.885 1.00 42.01  ? 817  PRO B C    1 
ATOM   9501  O O    . PRO B 1 256 ? -7.501  -10.120 -67.917 1.00 34.11  ? 817  PRO B O    1 
ATOM   9502  C CB   . PRO B 1 256 ? -7.189  -9.951  -71.198 1.00 37.99  ? 817  PRO B CB   1 
ATOM   9503  C CG   . PRO B 1 256 ? -7.668  -10.979 -72.163 1.00 40.46  ? 817  PRO B CG   1 
ATOM   9504  C CD   . PRO B 1 256 ? -6.692  -12.111 -72.056 1.00 42.94  ? 817  PRO B CD   1 
ATOM   9505  H HA   . PRO B 1 256 ? -5.805  -10.312 -69.707 1.00 50.46  ? 817  PRO B HA   1 
ATOM   9506  H HB2  . PRO B 1 256 ? -7.926  -9.403  -70.884 1.00 45.59  ? 817  PRO B HB2  1 
ATOM   9507  H HB3  . PRO B 1 256 ? -6.496  -9.401  -71.597 1.00 45.59  ? 817  PRO B HB3  1 
ATOM   9508  H HG2  . PRO B 1 256 ? -8.559  -11.271 -71.912 1.00 48.55  ? 817  PRO B HG2  1 
ATOM   9509  H HG3  . PRO B 1 256 ? -7.668  -10.610 -73.060 1.00 48.55  ? 817  PRO B HG3  1 
ATOM   9510  H HD2  . PRO B 1 256 ? -7.133  -12.957 -72.232 1.00 51.53  ? 817  PRO B HD2  1 
ATOM   9511  H HD3  . PRO B 1 256 ? -5.942  -11.969 -72.655 1.00 51.53  ? 817  PRO B HD3  1 
ATOM   9512  N N    . GLN B 1 257 ? -8.544  -11.820 -68.959 1.00 44.90  ? 818  GLN B N    1 
ATOM   9513  C CA   . GLN B 1 257 ? -9.534  -11.958 -67.897 1.00 55.22  ? 818  GLN B CA   1 
ATOM   9514  C C    . GLN B 1 257 ? -8.930  -12.421 -66.577 1.00 46.56  ? 818  GLN B C    1 
ATOM   9515  O O    . GLN B 1 257 ? -9.630  -12.401 -65.558 1.00 51.80  ? 818  GLN B O    1 
ATOM   9516  C CB   . GLN B 1 257 ? -10.639 -12.924 -68.329 1.00 57.24  ? 818  GLN B CB   1 
ATOM   9517  C CG   . GLN B 1 257 ? -11.745 -12.266 -69.142 1.00 65.55  ? 818  GLN B CG   1 
ATOM   9518  C CD   . GLN B 1 257 ? -13.001 -13.113 -69.215 1.00 79.57  ? 818  GLN B CD   1 
ATOM   9519  O OE1  . GLN B 1 257 ? -12.935 -14.341 -69.257 1.00 80.24  ? 818  GLN B OE1  1 
ATOM   9520  N NE2  . GLN B 1 257 ? -14.156 -12.457 -69.220 1.00 81.86  ? 818  GLN B NE2  1 
ATOM   9521  H H    . GLN B 1 257 ? -8.633  -12.379 -69.606 1.00 53.89  ? 818  GLN B H    1 
ATOM   9522  H HA   . GLN B 1 257 ? -9.945  -11.093 -67.744 1.00 66.27  ? 818  GLN B HA   1 
ATOM   9523  H HB2  . GLN B 1 257 ? -10.247 -13.624 -68.874 1.00 68.68  ? 818  GLN B HB2  1 
ATOM   9524  H HB3  . GLN B 1 257 ? -11.044 -13.312 -67.537 1.00 68.68  ? 818  GLN B HB3  1 
ATOM   9525  H HG2  . GLN B 1 257 ? -11.978 -11.418 -68.731 1.00 78.66  ? 818  GLN B HG2  1 
ATOM   9526  H HG3  . GLN B 1 257 ? -11.428 -12.120 -70.047 1.00 78.66  ? 818  GLN B HG3  1 
ATOM   9527  H HE21 . GLN B 1 257 ? -14.163 -11.597 -69.182 1.00 98.24  ? 818  GLN B HE21 1 
ATOM   9528  H HE22 . GLN B 1 257 ? -14.897 -12.891 -69.260 1.00 98.24  ? 818  GLN B HE22 1 
ATOM   9529  N N    . LYS B 1 258 ? -7.662  -12.830 -66.566 1.00 41.27  ? 819  LYS B N    1 
ATOM   9530  C CA   . LYS B 1 258 ? -6.963  -13.185 -65.339 1.00 48.41  ? 819  LYS B CA   1 
ATOM   9531  C C    . LYS B 1 258 ? -6.154  -12.030 -64.761 1.00 40.47  ? 819  LYS B C    1 
ATOM   9532  O O    . LYS B 1 258 ? -5.470  -12.219 -63.751 1.00 44.62  ? 819  LYS B O    1 
ATOM   9533  C CB   . LYS B 1 258 ? -6.043  -14.387 -65.582 1.00 50.35  ? 819  LYS B CB   1 
ATOM   9534  C CG   . LYS B 1 258 ? -6.765  -15.721 -65.539 1.00 52.79  ? 819  LYS B CG   1 
ATOM   9535  C CD   . LYS B 1 258 ? -5.793  -16.887 -65.438 1.00 66.71  ? 819  LYS B CD   1 
ATOM   9536  C CE   . LYS B 1 258 ? -5.083  -17.152 -66.755 1.00 74.47  ? 819  LYS B CE   1 
ATOM   9537  N NZ   . LYS B 1 258 ? -6.016  -17.676 -67.792 1.00 84.32  ? 819  LYS B NZ   1 
ATOM   9538  H H    . LYS B 1 258 ? -7.179  -12.910 -67.272 1.00 49.52  ? 819  LYS B H    1 
ATOM   9539  H HA   . LYS B 1 258 ? -7.619  -13.445 -64.673 1.00 58.09  ? 819  LYS B HA   1 
ATOM   9540  H HB2  . LYS B 1 258 ? -5.635  -14.297 -66.457 1.00 60.42  ? 819  LYS B HB2  1 
ATOM   9541  H HB3  . LYS B 1 258 ? -5.356  -14.399 -64.897 1.00 60.42  ? 819  LYS B HB3  1 
ATOM   9542  H HG2  . LYS B 1 258 ? -7.348  -15.744 -64.764 1.00 63.35  ? 819  LYS B HG2  1 
ATOM   9543  H HG3  . LYS B 1 258 ? -7.284  -15.829 -66.352 1.00 63.35  ? 819  LYS B HG3  1 
ATOM   9544  H HD2  . LYS B 1 258 ? -5.121  -16.684 -64.768 1.00 80.06  ? 819  LYS B HD2  1 
ATOM   9545  H HD3  . LYS B 1 258 ? -6.280  -17.688 -65.191 1.00 80.06  ? 819  LYS B HD3  1 
ATOM   9546  H HE2  . LYS B 1 258 ? -4.699  -16.324 -67.083 1.00 89.37  ? 819  LYS B HE2  1 
ATOM   9547  H HE3  . LYS B 1 258 ? -4.385  -17.811 -66.614 1.00 89.37  ? 819  LYS B HE3  1 
ATOM   9548  H HZ1  . LYS B 1 258 ? -5.576  -17.822 -68.551 1.00 101.19 ? 819  LYS B HZ1  1 
ATOM   9549  H HZ2  . LYS B 1 258 ? -6.379  -18.441 -67.516 1.00 101.19 ? 819  LYS B HZ2  1 
ATOM   9550  H HZ3  . LYS B 1 258 ? -6.665  -17.086 -67.943 1.00 101.19 ? 819  LYS B HZ3  1 
ATOM   9551  N N    . ARG B 1 259 ? -6.208  -10.819 -65.390 1.00 42.08  ? 820  ARG B N    1 
ATOM   9552  C CA   . ARG B 1 259 ? -5.460  -9.674  -64.888 1.00 41.28  ? 820  ARG B CA   1 
ATOM   9553  C C    . ARG B 1 259 ? -6.302  -8.894  -63.883 1.00 34.35  ? 820  ARG B C    1 
ATOM   9554  O O    . ARG B 1 259 ? -7.524  -8.804  -64.036 1.00 33.68  ? 820  ARG B O    1 
ATOM   9555  C CB   . ARG B 1 259 ? -5.052  -8.748  -66.026 1.00 39.07  ? 820  ARG B CB   1 
ATOM   9556  C CG   . ARG B 1 259 ? -4.230  -9.427  -67.100 1.00 40.07  ? 820  ARG B CG   1 
ATOM   9557  C CD   . ARG B 1 259 ? -3.896  -8.463  -68.214 1.00 36.71  ? 820  ARG B CD   1 
ATOM   9558  N NE   . ARG B 1 259 ? -3.307  -9.146  -69.360 1.00 41.03  ? 820  ARG B NE   1 
ATOM   9559  C CZ   . ARG B 1 259 ? -3.452  -8.759  -70.623 1.00 40.45  ? 820  ARG B CZ   1 
ATOM   9560  N NH1  . ARG B 1 259 ? -4.170  -7.685  -70.925 1.00 38.02  ? 820  ARG B NH1  1 
ATOM   9561  N NH2  . ARG B 1 259 ? -2.878  -9.453  -71.593 1.00 39.20  ? 820  ARG B NH2  1 
ATOM   9562  H H    . ARG B 1 259 ? -6.670  -10.657 -66.098 1.00 50.50  ? 820  ARG B H    1 
ATOM   9563  H HA   . ARG B 1 259 ? -4.656  -9.984  -64.441 1.00 49.54  ? 820  ARG B HA   1 
ATOM   9564  H HB2  . ARG B 1 259 ? -5.853  -8.395  -66.444 1.00 46.89  ? 820  ARG B HB2  1 
ATOM   9565  H HB3  . ARG B 1 259 ? -4.523  -8.021  -65.663 1.00 46.89  ? 820  ARG B HB3  1 
ATOM   9566  H HG2  . ARG B 1 259 ? -3.400  -9.749  -66.715 1.00 48.09  ? 820  ARG B HG2  1 
ATOM   9567  H HG3  . ARG B 1 259 ? -4.737  -10.164 -67.475 1.00 48.09  ? 820  ARG B HG3  1 
ATOM   9568  H HD2  . ARG B 1 259 ? -4.707  -8.021  -68.508 1.00 44.05  ? 820  ARG B HD2  1 
ATOM   9569  H HD3  . ARG B 1 259 ? -3.257  -7.809  -67.889 1.00 44.05  ? 820  ARG B HD3  1 
ATOM   9570  H HE   . ARG B 1 259 ? -2.834  -9.847  -69.208 1.00 49.24  ? 820  ARG B HE   1 
ATOM   9571  H HH11 . ARG B 1 259 ? -4.547  -7.230  -70.300 1.00 45.63  ? 820  ARG B HH11 1 
ATOM   9572  H HH12 . ARG B 1 259 ? -4.257  -7.443  -71.746 1.00 45.63  ? 820  ARG B HH12 1 
ATOM   9573  H HH21 . ARG B 1 259 ? -2.411  -10.150 -71.405 1.00 47.04  ? 820  ARG B HH21 1 
ATOM   9574  H HH22 . ARG B 1 259 ? -2.969  -9.204  -72.411 1.00 47.04  ? 820  ARG B HH22 1 
ATOM   9575  N N    . PRO B 1 260 ? -5.684  -8.321  -62.853 1.00 31.25  ? 821  PRO B N    1 
ATOM   9576  C CA   . PRO B 1 260 ? -6.441  -7.503  -61.904 1.00 33.38  ? 821  PRO B CA   1 
ATOM   9577  C C    . PRO B 1 260 ? -6.735  -6.120  -62.462 1.00 34.63  ? 821  PRO B C    1 
ATOM   9578  O O    . PRO B 1 260 ? -6.007  -5.593  -63.305 1.00 24.33  ? 821  PRO B O    1 
ATOM   9579  C CB   . PRO B 1 260 ? -5.503  -7.421  -60.694 1.00 32.14  ? 821  PRO B CB   1 
ATOM   9580  C CG   . PRO B 1 260 ? -4.145  -7.474  -61.301 1.00 30.70  ? 821  PRO B CG   1 
ATOM   9581  C CD   . PRO B 1 260 ? -4.255  -8.383  -62.499 1.00 31.91  ? 821  PRO B CD   1 
ATOM   9582  H HA   . PRO B 1 260 ? -7.268  -7.941  -61.651 1.00 40.06  ? 821  PRO B HA   1 
ATOM   9583  H HB2  . PRO B 1 260 ? -5.641  -6.584  -60.224 1.00 38.56  ? 821  PRO B HB2  1 
ATOM   9584  H HB3  . PRO B 1 260 ? -5.652  -8.179  -60.108 1.00 38.56  ? 821  PRO B HB3  1 
ATOM   9585  H HG2  . PRO B 1 260 ? -3.877  -6.583  -61.574 1.00 36.84  ? 821  PRO B HG2  1 
ATOM   9586  H HG3  . PRO B 1 260 ? -3.516  -7.836  -60.657 1.00 36.84  ? 821  PRO B HG3  1 
ATOM   9587  H HD2  . PRO B 1 260 ? -3.712  -8.046  -63.228 1.00 38.29  ? 821  PRO B HD2  1 
ATOM   9588  H HD3  . PRO B 1 260 ? -4.006  -9.289  -62.259 1.00 38.29  ? 821  PRO B HD3  1 
ATOM   9589  N N    . SER B 1 261 ? -7.829  -5.535  -61.980 1.00 34.64  ? 822  SER B N    1 
ATOM   9590  C CA   . SER B 1 261 ? -8.121  -4.143  -62.279 1.00 27.62  ? 822  SER B CA   1 
ATOM   9591  C C    . SER B 1 261 ? -7.185  -3.235  -61.487 1.00 28.58  ? 822  SER B C    1 
ATOM   9592  O O    . SER B 1 261 ? -6.563  -3.648  -60.505 1.00 32.66  ? 822  SER B O    1 
ATOM   9593  C CB   . SER B 1 261 ? -9.573  -3.808  -61.948 1.00 21.15  ? 822  SER B CB   1 
ATOM   9594  O OG   . SER B 1 261 ? -9.737  -3.597  -60.558 1.00 35.85  ? 822  SER B OG   1 
ATOM   9595  H H    . SER B 1 261 ? -8.412  -5.922  -61.481 1.00 41.57  ? 822  SER B H    1 
ATOM   9596  H HA   . SER B 1 261 ? -7.977  -3.980  -63.225 1.00 33.15  ? 822  SER B HA   1 
ATOM   9597  H HB2  . SER B 1 261 ? -9.827  -3.000  -62.422 1.00 25.38  ? 822  SER B HB2  1 
ATOM   9598  H HB3  . SER B 1 261 ? -10.138 -4.546  -62.224 1.00 25.38  ? 822  SER B HB3  1 
ATOM   9599  H HG   . SER B 1 261 ? -9.520  -4.290  -60.135 1.00 43.02  ? 822  SER B HG   1 
ATOM   9600  N N    . ALA B 1 262 ? -7.075  -1.984  -61.940 1.00 28.47  ? 823  ALA B N    1 
ATOM   9601  C CA   . ALA B 1 262 ? -6.206  -1.026  -61.264 1.00 27.09  ? 823  ALA B CA   1 
ATOM   9602  C C    . ALA B 1 262 ? -6.519  -0.944  -59.775 1.00 30.58  ? 823  ALA B C    1 
ATOM   9603  O O    . ALA B 1 262 ? -5.609  -0.830  -58.946 1.00 29.53  ? 823  ALA B O    1 
ATOM   9604  C CB   . ALA B 1 262 ? -6.340  0.351   -61.913 1.00 24.13  ? 823  ALA B CB   1 
ATOM   9605  H H    . ALA B 1 262 ? -7.488  -1.671  -62.626 1.00 34.16  ? 823  ALA B H    1 
ATOM   9606  H HA   . ALA B 1 262 ? -5.285  -1.314  -61.361 1.00 32.51  ? 823  ALA B HA   1 
ATOM   9607  H HB1  . ALA B 1 262 ? -5.757  0.975   -61.453 1.00 28.96  ? 823  ALA B HB1  1 
ATOM   9608  H HB2  . ALA B 1 262 ? -6.085  0.286   -62.847 1.00 28.96  ? 823  ALA B HB2  1 
ATOM   9609  H HB3  . ALA B 1 262 ? -7.262  0.645   -61.841 1.00 28.96  ? 823  ALA B HB3  1 
ATOM   9610  N N    . LYS B 1 263 ? -7.803  -1.010  -59.416 1.00 31.43  ? 824  LYS B N    1 
ATOM   9611  C CA   . LYS B 1 263 ? -8.175  -0.979  -58.004 1.00 28.87  ? 824  LYS B CA   1 
ATOM   9612  C C    . LYS B 1 263 ? -7.675  -2.220  -57.276 1.00 35.68  ? 824  LYS B C    1 
ATOM   9613  O O    . LYS B 1 263 ? -7.220  -2.131  -56.129 1.00 36.65  ? 824  LYS B O    1 
ATOM   9614  C CB   . LYS B 1 263 ? -9.691  -0.841  -57.862 1.00 34.82  ? 824  LYS B CB   1 
ATOM   9615  C CG   . LYS B 1 263 ? -10.214 0.533   -58.265 1.00 32.08  ? 824  LYS B CG   1 
ATOM   9616  C CD   . LYS B 1 263 ? -11.713 0.672   -58.033 1.00 39.15  ? 824  LYS B CD   1 
ATOM   9617  C CE   . LYS B 1 263 ? -12.214 2.050   -58.446 1.00 50.13  ? 824  LYS B CE   1 
ATOM   9618  N NZ   . LYS B 1 263 ? -13.683 2.207   -58.247 1.00 52.18  ? 824  LYS B NZ   1 
ATOM   9619  H H    . LYS B 1 263 ? -8.466  -1.072  -59.960 1.00 37.71  ? 824  LYS B H    1 
ATOM   9620  H HA   . LYS B 1 263 ? -7.764  -0.205  -57.589 1.00 34.65  ? 824  LYS B HA   1 
ATOM   9621  H HB2  . LYS B 1 263 ? -10.121 -1.501  -58.427 1.00 41.78  ? 824  LYS B HB2  1 
ATOM   9622  H HB3  . LYS B 1 263 ? -9.934  -0.992  -56.935 1.00 41.78  ? 824  LYS B HB3  1 
ATOM   9623  H HG2  . LYS B 1 263 ? -9.763  1.211   -57.738 1.00 38.49  ? 824  LYS B HG2  1 
ATOM   9624  H HG3  . LYS B 1 263 ? -10.040 0.674   -59.208 1.00 38.49  ? 824  LYS B HG3  1 
ATOM   9625  H HD2  . LYS B 1 263 ? -12.182 0.006   -58.561 1.00 46.98  ? 824  LYS B HD2  1 
ATOM   9626  H HD3  . LYS B 1 263 ? -11.904 0.548   -57.090 1.00 46.98  ? 824  LYS B HD3  1 
ATOM   9627  H HE2  . LYS B 1 263 ? -11.764 2.724   -57.912 1.00 60.15  ? 824  LYS B HE2  1 
ATOM   9628  H HE3  . LYS B 1 263 ? -12.021 2.189   -59.387 1.00 60.15  ? 824  LYS B HE3  1 
ATOM   9629  H HZ1  . LYS B 1 263 ? -13.938 3.021   -58.499 1.00 62.62  ? 824  LYS B HZ1  1 
ATOM   9630  H HZ2  . LYS B 1 263 ? -14.121 1.603   -58.733 1.00 62.62  ? 824  LYS B HZ2  1 
ATOM   9631  H HZ3  . LYS B 1 263 ? -13.887 2.091   -57.389 1.00 62.62  ? 824  LYS B HZ3  1 
ATOM   9632  N N    . HIS B 1 264 ? -7.759  -3.390  -57.919 1.00 32.77  ? 825  HIS B N    1 
ATOM   9633  C CA   . HIS B 1 264 ? -7.167  -4.592  -57.341 1.00 32.61  ? 825  HIS B CA   1 
ATOM   9634  C C    . HIS B 1 264 ? -5.674  -4.403  -57.101 1.00 29.51  ? 825  HIS B C    1 
ATOM   9635  O O    . HIS B 1 264 ? -5.152  -4.795  -56.050 1.00 30.51  ? 825  HIS B O    1 
ATOM   9636  C CB   . HIS B 1 264 ? -7.401  -5.798  -58.254 1.00 37.10  ? 825  HIS B CB   1 
ATOM   9637  C CG   . HIS B 1 264 ? -8.717  -6.483  -58.045 1.00 36.30  ? 825  HIS B CG   1 
ATOM   9638  N ND1  . HIS B 1 264 ? -9.811  -6.258  -58.854 1.00 41.29  ? 825  HIS B ND1  1 
ATOM   9639  C CD2  . HIS B 1 264 ? -9.109  -7.400  -57.130 1.00 35.32  ? 825  HIS B CD2  1 
ATOM   9640  C CE1  . HIS B 1 264 ? -10.822 -7.001  -58.441 1.00 45.25  ? 825  HIS B CE1  1 
ATOM   9641  N NE2  . HIS B 1 264 ? -10.423 -7.703  -57.395 1.00 49.76  ? 825  HIS B NE2  1 
ATOM   9642  H H    . HIS B 1 264 ? -8.146  -3.509  -58.678 1.00 39.33  ? 825  HIS B H    1 
ATOM   9643  H HA   . HIS B 1 264 ? -7.589  -4.774  -56.486 1.00 39.13  ? 825  HIS B HA   1 
ATOM   9644  H HB2  . HIS B 1 264 ? -7.367  -5.501  -59.177 1.00 44.52  ? 825  HIS B HB2  1 
ATOM   9645  H HB3  . HIS B 1 264 ? -6.701  -6.450  -58.094 1.00 44.52  ? 825  HIS B HB3  1 
ATOM   9646  H HD2  . HIS B 1 264 ? -8.588  -7.755  -56.446 1.00 42.39  ? 825  HIS B HD2  1 
ATOM   9647  H HE1  . HIS B 1 264 ? -11.670 -7.025  -58.820 1.00 54.30  ? 825  HIS B HE1  1 
ATOM   9648  H HE2  . HIS B 1 264 ? -10.906 -8.259  -56.953 1.00 59.71  ? 825  HIS B HE2  1 
ATOM   9649  N N    . VAL B 1 265 ? -4.974  -3.795  -58.062 1.00 26.64  ? 826  VAL B N    1 
ATOM   9650  C CA   . VAL B 1 265 ? -3.532  -3.596  -57.929 1.00 28.27  ? 826  VAL B CA   1 
ATOM   9651  C C    . VAL B 1 265 ? -3.230  -2.688  -56.744 1.00 28.31  ? 826  VAL B C    1 
ATOM   9652  O O    . VAL B 1 265 ? -2.225  -2.869  -56.046 1.00 26.26  ? 826  VAL B O    1 
ATOM   9653  C CB   . VAL B 1 265 ? -2.953  -3.028  -59.241 1.00 28.27  ? 826  VAL B CB   1 
ATOM   9654  C CG1  . VAL B 1 265 ? -1.462  -2.735  -59.096 1.00 31.29  ? 826  VAL B CG1  1 
ATOM   9655  C CG2  . VAL B 1 265 ? -3.194  -3.998  -60.395 1.00 29.14  ? 826  VAL B CG2  1 
ATOM   9656  H H    . VAL B 1 265 ? -5.308  -3.492  -58.794 1.00 31.97  ? 826  VAL B H    1 
ATOM   9657  H HA   . VAL B 1 265 ? -3.110  -4.454  -57.764 1.00 33.92  ? 826  VAL B HA   1 
ATOM   9658  H HB   . VAL B 1 265 ? -3.403  -2.195  -59.450 1.00 33.92  ? 826  VAL B HB   1 
ATOM   9659  H HG11 . VAL B 1 265 ? -1.128  -2.380  -59.935 1.00 37.55  ? 826  VAL B HG11 1 
ATOM   9660  H HG12 . VAL B 1 265 ? -1.336  -2.085  -58.387 1.00 37.55  ? 826  VAL B HG12 1 
ATOM   9661  H HG13 . VAL B 1 265 ? -0.999  -3.558  -58.877 1.00 37.55  ? 826  VAL B HG13 1 
ATOM   9662  H HG21 . VAL B 1 265 ? -2.823  -3.620  -61.207 1.00 34.97  ? 826  VAL B HG21 1 
ATOM   9663  H HG22 . VAL B 1 265 ? -2.761  -4.842  -60.193 1.00 34.97  ? 826  VAL B HG22 1 
ATOM   9664  H HG23 . VAL B 1 265 ? -4.149  -4.133  -60.499 1.00 34.97  ? 826  VAL B HG23 1 
ATOM   9665  N N    . LEU B 1 266 ? -4.094  -1.699  -56.498 1.00 31.58  ? 827  LEU B N    1 
ATOM   9666  C CA   . LEU B 1 266 ? -3.864  -0.771  -55.394 1.00 31.79  ? 827  LEU B CA   1 
ATOM   9667  C C    . LEU B 1 266 ? -3.957  -1.467  -54.043 1.00 29.19  ? 827  LEU B C    1 
ATOM   9668  O O    . LEU B 1 266 ? -3.247  -1.087  -53.105 1.00 28.84  ? 827  LEU B O    1 
ATOM   9669  C CB   . LEU B 1 266 ? -4.864  0.384   -55.463 1.00 31.34  ? 827  LEU B CB   1 
ATOM   9670  C CG   . LEU B 1 266 ? -4.631  1.411   -56.574 1.00 27.07  ? 827  LEU B CG   1 
ATOM   9671  C CD1  . LEU B 1 266 ? -5.832  2.337   -56.711 1.00 25.23  ? 827  LEU B CD1  1 
ATOM   9672  C CD2  . LEU B 1 266 ? -3.367  2.218   -56.315 1.00 23.54  ? 827  LEU B CD2  1 
ATOM   9673  H H    . LEU B 1 266 ? -4.810  -1.548  -56.949 1.00 37.90  ? 827  LEU B H    1 
ATOM   9674  H HA   . LEU B 1 266 ? -2.972  -0.400  -55.478 1.00 38.15  ? 827  LEU B HA   1 
ATOM   9675  H HB2  . LEU B 1 266 ? -5.750  0.013   -55.593 1.00 37.61  ? 827  LEU B HB2  1 
ATOM   9676  H HB3  . LEU B 1 266 ? -4.836  0.862   -54.619 1.00 37.61  ? 827  LEU B HB3  1 
ATOM   9677  H HG   . LEU B 1 266 ? -4.519  0.942   -57.415 1.00 32.48  ? 827  LEU B HG   1 
ATOM   9678  H HD11 . LEU B 1 266 ? -5.658  2.976   -57.420 1.00 30.28  ? 827  LEU B HD11 1 
ATOM   9679  H HD12 . LEU B 1 266 ? -6.616  1.808   -56.926 1.00 30.28  ? 827  LEU B HD12 1 
ATOM   9680  H HD13 . LEU B 1 266 ? -5.968  2.804   -55.871 1.00 30.28  ? 827  LEU B HD13 1 
ATOM   9681  H HD21 . LEU B 1 266 ? -3.248  2.858   -57.035 1.00 28.25  ? 827  LEU B HD21 1 
ATOM   9682  H HD22 . LEU B 1 266 ? -3.458  2.684   -55.469 1.00 28.25  ? 827  LEU B HD22 1 
ATOM   9683  H HD23 . LEU B 1 266 ? -2.609  1.614   -56.280 1.00 28.25  ? 827  LEU B HD23 1 
ATOM   9684  N N    . LYS B 1 267 ? -4.814  -2.481  -53.923 1.00 33.35  ? 828  LYS B N    1 
ATOM   9685  C CA   . LYS B 1 267 ? -4.966  -3.221  -52.678 1.00 32.51  ? 828  LYS B CA   1 
ATOM   9686  C C    . LYS B 1 267 ? -3.873  -4.259  -52.458 1.00 30.61  ? 828  LYS B C    1 
ATOM   9687  O O    . LYS B 1 267 ? -3.825  -4.856  -51.379 1.00 35.71  ? 828  LYS B O    1 
ATOM   9688  C CB   . LYS B 1 267 ? -6.322  -3.929  -52.651 1.00 36.33  ? 828  LYS B CB   1 
ATOM   9689  C CG   . LYS B 1 267 ? -7.526  -3.008  -52.615 1.00 40.55  ? 828  LYS B CG   1 
ATOM   9690  C CD   . LYS B 1 267 ? -7.775  -2.448  -51.227 1.00 45.23  ? 828  LYS B CD   1 
ATOM   9691  C CE   . LYS B 1 267 ? -9.087  -1.681  -51.181 1.00 41.59  ? 828  LYS B CE   1 
ATOM   9692  N NZ   . LYS B 1 267 ? -9.344  -1.065  -49.849 1.00 43.32  ? 828  LYS B NZ   1 
ATOM   9693  H H    . LYS B 1 267 ? -5.323  -2.760  -54.558 1.00 40.02  ? 828  LYS B H    1 
ATOM   9694  H HA   . LYS B 1 267 ? -4.939  -2.597  -51.936 1.00 39.02  ? 828  LYS B HA   1 
ATOM   9695  H HB2  . LYS B 1 267 ? -6.399  -4.479  -53.446 1.00 43.59  ? 828  LYS B HB2  1 
ATOM   9696  H HB3  . LYS B 1 267 ? -6.361  -4.491  -51.861 1.00 43.59  ? 828  LYS B HB3  1 
ATOM   9697  H HG2  . LYS B 1 267 ? -7.375  -2.264  -53.218 1.00 48.66  ? 828  LYS B HG2  1 
ATOM   9698  H HG3  . LYS B 1 267 ? -8.314  -3.504  -52.887 1.00 48.66  ? 828  LYS B HG3  1 
ATOM   9699  H HD2  . LYS B 1 267 ? -7.825  -3.177  -50.589 1.00 54.28  ? 828  LYS B HD2  1 
ATOM   9700  H HD3  . LYS B 1 267 ? -7.057  -1.841  -50.990 1.00 54.28  ? 828  LYS B HD3  1 
ATOM   9701  H HE2  . LYS B 1 267 ? -9.061  -0.970  -51.841 1.00 49.90  ? 828  LYS B HE2  1 
ATOM   9702  H HE3  . LYS B 1 267 ? -9.817  -2.289  -51.377 1.00 49.90  ? 828  LYS B HE3  1 
ATOM   9703  H HZ1  . LYS B 1 267 ? -10.118 -0.626  -49.861 1.00 51.98  ? 828  LYS B HZ1  1 
ATOM   9704  H HZ2  . LYS B 1 267 ? -9.380  -1.697  -49.223 1.00 51.98  ? 828  LYS B HZ2  1 
ATOM   9705  H HZ3  . LYS B 1 267 ? -8.692  -0.495  -49.646 1.00 51.98  ? 828  LYS B HZ3  1 
ATOM   9706  N N    . HIS B 1 268 ? -3.003  -4.493  -53.437 1.00 30.35  ? 829  HIS B N    1 
ATOM   9707  C CA   . HIS B 1 268 ? -2.091  -5.622  -53.353 1.00 35.90  ? 829  HIS B CA   1 
ATOM   9708  C C    . HIS B 1 268 ? -1.048  -5.396  -52.257 1.00 34.67  ? 829  HIS B C    1 
ATOM   9709  O O    . HIS B 1 268 ? -0.651  -4.257  -51.994 1.00 33.43  ? 829  HIS B O    1 
ATOM   9710  C CB   . HIS B 1 268 ? -1.392  -5.852  -54.691 1.00 31.58  ? 829  HIS B CB   1 
ATOM   9711  C CG   . HIS B 1 268 ? -0.678  -7.166  -54.776 1.00 32.73  ? 829  HIS B CG   1 
ATOM   9712  N ND1  . HIS B 1 268 ? 0.633   -7.329  -54.384 1.00 35.54  ? 829  HIS B ND1  1 
ATOM   9713  C CD2  . HIS B 1 268 ? -1.103  -8.385  -55.180 1.00 31.32  ? 829  HIS B CD2  1 
ATOM   9714  C CE1  . HIS B 1 268 ? 0.988   -8.590  -54.549 1.00 34.45  ? 829  HIS B CE1  1 
ATOM   9715  N NE2  . HIS B 1 268 ? -0.046  -9.251  -55.038 1.00 35.08  ? 829  HIS B NE2  1 
ATOM   9716  H H    . HIS B 1 268 ? -2.923  -4.019  -54.150 1.00 36.42  ? 829  HIS B H    1 
ATOM   9717  H HA   . HIS B 1 268 ? -2.593  -6.422  -53.132 1.00 43.08  ? 829  HIS B HA   1 
ATOM   9718  H HB2  . HIS B 1 268 ? -2.054  -5.828  -55.399 1.00 37.90  ? 829  HIS B HB2  1 
ATOM   9719  H HB3  . HIS B 1 268 ? -0.738  -5.149  -54.828 1.00 37.90  ? 829  HIS B HB3  1 
ATOM   9720  H HD2  . HIS B 1 268 ? -1.949  -8.596  -55.502 1.00 37.59  ? 829  HIS B HD2  1 
ATOM   9721  H HE1  . HIS B 1 268 ? 1.826   -8.949  -54.364 1.00 41.34  ? 829  HIS B HE1  1 
ATOM   9722  H HE2  . HIS B 1 268 ? -0.057  -10.089 -55.231 1.00 42.10  ? 829  HIS B HE2  1 
ATOM   9723  N N    . PRO B 1 269 ? -0.584  -6.469  -51.604 1.00 34.51  ? 830  PRO B N    1 
ATOM   9724  C CA   . PRO B 1 269 ? 0.449   -6.309  -50.564 1.00 34.34  ? 830  PRO B CA   1 
ATOM   9725  C C    . PRO B 1 269 ? 1.735   -5.672  -51.051 1.00 33.61  ? 830  PRO B C    1 
ATOM   9726  O O    . PRO B 1 269 ? 2.564   -5.288  -50.217 1.00 31.51  ? 830  PRO B O    1 
ATOM   9727  C CB   . PRO B 1 269 ? 0.685   -7.747  -50.068 1.00 36.57  ? 830  PRO B CB   1 
ATOM   9728  C CG   . PRO B 1 269 ? 0.004   -8.634  -51.055 1.00 35.22  ? 830  PRO B CG   1 
ATOM   9729  C CD   . PRO B 1 269 ? -1.128  -7.836  -51.595 1.00 36.91  ? 830  PRO B CD   1 
ATOM   9730  H HA   . PRO B 1 269 ? 0.097   -5.780  -49.831 1.00 41.21  ? 830  PRO B HA   1 
ATOM   9731  H HB2  . PRO B 1 269 ? 1.637   -7.930  -50.045 1.00 43.89  ? 830  PRO B HB2  1 
ATOM   9732  H HB3  . PRO B 1 269 ? 0.295   -7.855  -49.187 1.00 43.89  ? 830  PRO B HB3  1 
ATOM   9733  H HG2  . PRO B 1 269 ? 0.624   -8.870  -51.763 1.00 42.27  ? 830  PRO B HG2  1 
ATOM   9734  H HG3  . PRO B 1 269 ? -0.322  -9.430  -50.606 1.00 42.27  ? 830  PRO B HG3  1 
ATOM   9735  H HD2  . PRO B 1 269 ? -1.346  -8.122  -52.496 1.00 44.30  ? 830  PRO B HD2  1 
ATOM   9736  H HD3  . PRO B 1 269 ? -1.896  -7.893  -51.005 1.00 44.30  ? 830  PRO B HD3  1 
ATOM   9737  N N    . PHE B 1 270 ? 1.935   -5.566  -52.362 1.00 35.92  ? 831  PHE B N    1 
ATOM   9738  C CA   . PHE B 1 270 ? 3.120   -4.904  -52.891 1.00 34.94  ? 831  PHE B CA   1 
ATOM   9739  C C    . PHE B 1 270 ? 3.239   -3.477  -52.368 1.00 32.29  ? 831  PHE B C    1 
ATOM   9740  O O    . PHE B 1 270 ? 4.352   -2.954  -52.241 1.00 29.26  ? 831  PHE B O    1 
ATOM   9741  C CB   . PHE B 1 270 ? 3.066   -4.928  -54.420 1.00 33.98  ? 831  PHE B CB   1 
ATOM   9742  C CG   . PHE B 1 270 ? 4.253   -4.304  -55.087 1.00 42.41  ? 831  PHE B CG   1 
ATOM   9743  C CD1  . PHE B 1 270 ? 5.512   -4.864  -54.957 1.00 44.42  ? 831  PHE B CD1  1 
ATOM   9744  C CD2  . PHE B 1 270 ? 4.104   -3.173  -55.871 1.00 41.33  ? 831  PHE B CD2  1 
ATOM   9745  C CE1  . PHE B 1 270 ? 6.604   -4.293  -55.582 1.00 43.16  ? 831  PHE B CE1  1 
ATOM   9746  C CE2  . PHE B 1 270 ? 5.192   -2.599  -56.499 1.00 41.87  ? 831  PHE B CE2  1 
ATOM   9747  C CZ   . PHE B 1 270 ? 6.443   -3.160  -56.353 1.00 39.61  ? 831  PHE B CZ   1 
ATOM   9748  H H    . PHE B 1 270 ? 1.401   -5.868  -52.964 1.00 43.10  ? 831  PHE B H    1 
ATOM   9749  H HA   . PHE B 1 270 ? 3.908   -5.394  -52.610 1.00 41.93  ? 831  PHE B HA   1 
ATOM   9750  H HB2  . PHE B 1 270 ? 3.013   -5.851  -54.714 1.00 40.77  ? 831  PHE B HB2  1 
ATOM   9751  H HB3  . PHE B 1 270 ? 2.276   -4.446  -54.711 1.00 40.77  ? 831  PHE B HB3  1 
ATOM   9752  H HD1  . PHE B 1 270 ? 5.626   -5.626  -54.437 1.00 53.30  ? 831  PHE B HD1  1 
ATOM   9753  H HD2  . PHE B 1 270 ? 3.262   -2.790  -55.971 1.00 49.59  ? 831  PHE B HD2  1 
ATOM   9754  H HE1  . PHE B 1 270 ? 7.448   -4.673  -55.484 1.00 51.79  ? 831  PHE B HE1  1 
ATOM   9755  H HE2  . PHE B 1 270 ? 5.081   -1.835  -57.018 1.00 50.25  ? 831  PHE B HE2  1 
ATOM   9756  H HZ   . PHE B 1 270 ? 7.177   -2.775  -56.775 1.00 47.53  ? 831  PHE B HZ   1 
ATOM   9757  N N    . PHE B 1 271 ? 2.111   -2.833  -52.065 1.00 26.87  ? 832  PHE B N    1 
ATOM   9758  C CA   . PHE B 1 271 ? 2.093   -1.466  -51.558 1.00 32.73  ? 832  PHE B CA   1 
ATOM   9759  C C    . PHE B 1 271 ? 1.934   -1.370  -50.043 1.00 30.39  ? 832  PHE B C    1 
ATOM   9760  O O    . PHE B 1 271 ? 1.925   -0.256  -49.512 1.00 26.09  ? 832  PHE B O    1 
ATOM   9761  C CB   . PHE B 1 271 ? 0.974   -0.672  -52.240 1.00 32.52  ? 832  PHE B CB   1 
ATOM   9762  C CG   . PHE B 1 271 ? 1.137   -0.557  -53.727 1.00 33.79  ? 832  PHE B CG   1 
ATOM   9763  C CD1  . PHE B 1 271 ? 2.263   0.041   -54.269 1.00 34.52  ? 832  PHE B CD1  1 
ATOM   9764  C CD2  . PHE B 1 271 ? 0.163   -1.038  -54.584 1.00 32.02  ? 832  PHE B CD2  1 
ATOM   9765  C CE1  . PHE B 1 271 ? 2.417   0.151   -55.636 1.00 31.10  ? 832  PHE B CE1  1 
ATOM   9766  C CE2  . PHE B 1 271 ? 0.311   -0.929  -55.952 1.00 38.67  ? 832  PHE B CE2  1 
ATOM   9767  C CZ   . PHE B 1 271 ? 1.439   -0.334  -56.478 1.00 33.50  ? 832  PHE B CZ   1 
ATOM   9768  H H    . PHE B 1 271 ? 1.327   -3.177  -52.148 1.00 32.24  ? 832  PHE B H    1 
ATOM   9769  H HA   . PHE B 1 271 ? 2.935   -1.043  -51.789 1.00 39.27  ? 832  PHE B HA   1 
ATOM   9770  H HB2  . PHE B 1 271 ? 0.128   -1.113  -52.068 1.00 39.03  ? 832  PHE B HB2  1 
ATOM   9771  H HB3  . PHE B 1 271 ? 0.959   0.225   -51.873 1.00 39.03  ? 832  PHE B HB3  1 
ATOM   9772  H HD1  . PHE B 1 271 ? 2.925   0.369   -53.705 1.00 41.43  ? 832  PHE B HD1  1 
ATOM   9773  H HD2  . PHE B 1 271 ? -0.599  -1.440  -54.234 1.00 38.42  ? 832  PHE B HD2  1 
ATOM   9774  H HE1  . PHE B 1 271 ? 3.177   0.553   -55.988 1.00 37.32  ? 832  PHE B HE1  1 
ATOM   9775  H HE2  . PHE B 1 271 ? -0.349  -1.257  -56.519 1.00 46.41  ? 832  PHE B HE2  1 
ATOM   9776  H HZ   . PHE B 1 271 ? 1.540   -0.260  -57.400 1.00 40.20  ? 832  PHE B HZ   1 
ATOM   9777  N N    . TRP B 1 272 ? 1.808   -2.490  -49.332 1.00 33.94  ? 833  TRP B N    1 
ATOM   9778  C CA   . TRP B 1 272 ? 1.550   -2.442  -47.897 1.00 31.12  ? 833  TRP B CA   1 
ATOM   9779  C C    . TRP B 1 272 ? 2.800   -2.050  -47.122 1.00 33.48  ? 833  TRP B C    1 
ATOM   9780  O O    . TRP B 1 272 ? 3.907   -2.509  -47.420 1.00 31.77  ? 833  TRP B O    1 
ATOM   9781  C CB   . TRP B 1 272 ? 1.060   -3.794  -47.382 1.00 35.71  ? 833  TRP B CB   1 
ATOM   9782  C CG   . TRP B 1 272 ? -0.275  -4.211  -47.887 1.00 36.13  ? 833  TRP B CG   1 
ATOM   9783  C CD1  . TRP B 1 272 ? -1.087  -3.525  -48.741 1.00 33.31  ? 833  TRP B CD1  1 
ATOM   9784  C CD2  . TRP B 1 272 ? -0.956  -5.432  -47.577 1.00 36.31  ? 833  TRP B CD2  1 
ATOM   9785  N NE1  . TRP B 1 272 ? -2.233  -4.244  -48.983 1.00 34.50  ? 833  TRP B NE1  1 
ATOM   9786  C CE2  . TRP B 1 272 ? -2.175  -5.419  -48.281 1.00 37.83  ? 833  TRP B CE2  1 
ATOM   9787  C CE3  . TRP B 1 272 ? -0.649  -6.538  -46.780 1.00 38.30  ? 833  TRP B CE3  1 
ATOM   9788  C CZ2  . TRP B 1 272 ? -3.089  -6.465  -48.205 1.00 34.53  ? 833  TRP B CZ2  1 
ATOM   9789  C CZ3  . TRP B 1 272 ? -1.557  -7.574  -46.705 1.00 35.75  ? 833  TRP B CZ3  1 
ATOM   9790  C CH2  . TRP B 1 272 ? -2.762  -7.531  -47.414 1.00 36.32  ? 833  TRP B CH2  1 
ATOM   9791  H H    . TRP B 1 272 ? 1.868   -3.284  -49.656 1.00 40.73  ? 833  TRP B H    1 
ATOM   9792  H HA   . TRP B 1 272 ? 0.862   -1.782  -47.718 1.00 37.35  ? 833  TRP B HA   1 
ATOM   9793  H HB2  . TRP B 1 272 ? 1.699   -4.475  -47.646 1.00 42.85  ? 833  TRP B HB2  1 
ATOM   9794  H HB3  . TRP B 1 272 ? 1.008   -3.755  -46.414 1.00 42.85  ? 833  TRP B HB3  1 
ATOM   9795  H HD1  . TRP B 1 272 ? -0.893  -2.692  -49.107 1.00 39.97  ? 833  TRP B HD1  1 
ATOM   9796  H HE1  . TRP B 1 272 ? -2.882  -3.996  -49.490 1.00 41.40  ? 833  TRP B HE1  1 
ATOM   9797  H HE3  . TRP B 1 272 ? 0.152   -6.574  -46.307 1.00 45.96  ? 833  TRP B HE3  1 
ATOM   9798  H HZ2  . TRP B 1 272 ? -3.893  -6.439  -48.673 1.00 41.44  ? 833  TRP B HZ2  1 
ATOM   9799  H HZ3  . TRP B 1 272 ? -1.365  -8.314  -46.176 1.00 42.90  ? 833  TRP B HZ3  1 
ATOM   9800  H HH2  . TRP B 1 272 ? -3.356  -8.243  -47.343 1.00 43.59  ? 833  TRP B HH2  1 
ATOM   9801  N N    . SER B 1 273 ? 2.611   -1.211  -46.106 1.00 34.45  ? 834  SER B N    1 
ATOM   9802  C CA   . SER B 1 273 ? 3.663   -0.964  -45.136 1.00 39.57  ? 834  SER B CA   1 
ATOM   9803  C C    . SER B 1 273 ? 3.805   -2.178  -44.222 1.00 43.01  ? 834  SER B C    1 
ATOM   9804  O O    . SER B 1 273 ? 3.054   -3.153  -44.311 1.00 42.80  ? 834  SER B O    1 
ATOM   9805  C CB   . SER B 1 273 ? 3.354   0.291   -44.326 1.00 29.16  ? 834  SER B CB   1 
ATOM   9806  O OG   . SER B 1 273 ? 2.154   0.130   -43.589 1.00 29.96  ? 834  SER B OG   1 
ATOM   9807  H H    . SER B 1 273 ? 1.884   -0.776  -45.960 1.00 41.34  ? 834  SER B H    1 
ATOM   9808  H HA   . SER B 1 273 ? 4.504   -0.829  -45.600 1.00 47.49  ? 834  SER B HA   1 
ATOM   9809  H HB2  . SER B 1 273 ? 4.084   0.456   -43.709 1.00 34.99  ? 834  SER B HB2  1 
ATOM   9810  H HB3  . SER B 1 273 ? 3.255   1.042   -44.932 1.00 34.99  ? 834  SER B HB3  1 
ATOM   9811  H HG   . SER B 1 273 ? 1.993   0.826   -43.147 1.00 35.95  ? 834  SER B HG   1 
ATOM   9812  N N    . LEU B 1 274 ? 4.774   -2.110  -43.308 1.00 48.44  ? 835  LEU B N    1 
ATOM   9813  C CA   . LEU B 1 274 ? 5.020   -3.241  -42.421 1.00 40.90  ? 835  LEU B CA   1 
ATOM   9814  C C    . LEU B 1 274 ? 3.934   -3.371  -41.361 1.00 43.04  ? 835  LEU B C    1 
ATOM   9815  O O    . LEU B 1 274 ? 3.626   -4.488  -40.930 1.00 45.86  ? 835  LEU B O    1 
ATOM   9816  C CB   . LEU B 1 274 ? 6.399   -3.104  -41.779 1.00 41.23  ? 835  LEU B CB   1 
ATOM   9817  C CG   . LEU B 1 274 ? 7.552   -2.934  -42.777 1.00 39.09  ? 835  LEU B CG   1 
ATOM   9818  C CD1  . LEU B 1 274 ? 8.892   -2.892  -42.058 1.00 35.88  ? 835  LEU B CD1  1 
ATOM   9819  C CD2  . LEU B 1 274 ? 7.556   -4.030  -43.837 1.00 42.03  ? 835  LEU B CD2  1 
ATOM   9820  H H    . LEU B 1 274 ? 5.292   -1.435  -43.185 1.00 58.12  ? 835  LEU B H    1 
ATOM   9821  H HA   . LEU B 1 274 ? 5.018   -4.056  -42.947 1.00 49.08  ? 835  LEU B HA   1 
ATOM   9822  H HB2  . LEU B 1 274 ? 6.396   -2.327  -41.199 1.00 49.48  ? 835  LEU B HB2  1 
ATOM   9823  H HB3  . LEU B 1 274 ? 6.579   -3.901  -41.257 1.00 49.48  ? 835  LEU B HB3  1 
ATOM   9824  H HG   . LEU B 1 274 ? 7.440   -2.086  -43.235 1.00 46.91  ? 835  LEU B HG   1 
ATOM   9825  H HD11 . LEU B 1 274 ? 9.598   -2.784  -42.714 1.00 43.05  ? 835  LEU B HD11 1 
ATOM   9826  H HD12 . LEU B 1 274 ? 8.895   -2.143  -41.441 1.00 43.05  ? 835  LEU B HD12 1 
ATOM   9827  H HD13 . LEU B 1 274 ? 9.015   -3.722  -41.572 1.00 43.05  ? 835  LEU B HD13 1 
ATOM   9828  H HD21 . LEU B 1 274 ? 8.299   -3.881  -44.442 1.00 50.43  ? 835  LEU B HD21 1 
ATOM   9829  H HD22 . LEU B 1 274 ? 7.652   -4.891  -43.400 1.00 50.43  ? 835  LEU B HD22 1 
ATOM   9830  H HD23 . LEU B 1 274 ? 6.719   -3.999  -44.326 1.00 50.43  ? 835  LEU B HD23 1 
ATOM   9831  N N    . GLU B 1 275 ? 3.337   -2.255  -40.932 1.00 41.12  ? 836  GLU B N    1 
ATOM   9832  C CA   . GLU B 1 275 ? 2.187   -2.337  -40.039 1.00 43.77  ? 836  GLU B CA   1 
ATOM   9833  C C    . GLU B 1 275 ? 1.034   -3.078  -40.699 1.00 37.76  ? 836  GLU B C    1 
ATOM   9834  O O    . GLU B 1 275 ? 0.389   -3.927  -40.073 1.00 37.21  ? 836  GLU B O    1 
ATOM   9835  C CB   . GLU B 1 275 ? 1.727   -0.940  -39.628 1.00 44.29  ? 836  GLU B CB   1 
ATOM   9836  C CG   . GLU B 1 275 ? 2.765   -0.103  -38.923 1.00 52.37  ? 836  GLU B CG   1 
ATOM   9837  C CD   . GLU B 1 275 ? 2.151   1.112   -38.256 1.00 58.98  ? 836  GLU B CD   1 
ATOM   9838  O OE1  . GLU B 1 275 ? 0.915   1.281   -38.346 1.00 62.39  ? 836  GLU B OE1  1 
ATOM   9839  O OE2  . GLU B 1 275 ? 2.896   1.897   -37.639 1.00 68.34  ? 836  GLU B OE2  1 
ATOM   9840  H H    . GLU B 1 275 ? 3.576   -1.455  -41.141 1.00 49.35  ? 836  GLU B H    1 
ATOM   9841  H HA   . GLU B 1 275 ? 2.439   -2.821  -39.237 1.00 52.52  ? 836  GLU B HA   1 
ATOM   9842  H HB2  . GLU B 1 275 ? 1.455   -0.459  -40.426 1.00 53.14  ? 836  GLU B HB2  1 
ATOM   9843  H HB3  . GLU B 1 275 ? 0.968   -1.030  -39.030 1.00 53.14  ? 836  GLU B HB3  1 
ATOM   9844  H HG2  . GLU B 1 275 ? 3.196   -0.638  -38.240 1.00 62.84  ? 836  GLU B HG2  1 
ATOM   9845  H HG3  . GLU B 1 275 ? 3.419   0.206   -39.570 1.00 62.84  ? 836  GLU B HG3  1 
ATOM   9846  N N    . LYS B 1 276 ? 0.759   -2.765  -41.967 1.00 41.63  ? 837  LYS B N    1 
ATOM   9847  C CA   . LYS B 1 276 ? -0.381  -3.358  -42.657 1.00 38.44  ? 837  LYS B CA   1 
ATOM   9848  C C    . LYS B 1 276 ? -0.180  -4.852  -42.872 1.00 37.30  ? 837  LYS B C    1 
ATOM   9849  O O    . LYS B 1 276 ? -1.133  -5.633  -42.766 1.00 33.35  ? 837  LYS B O    1 
ATOM   9850  C CB   . LYS B 1 276 ? -0.598  -2.640  -43.988 1.00 36.35  ? 837  LYS B CB   1 
ATOM   9851  C CG   . LYS B 1 276 ? -1.940  -2.905  -44.640 1.00 37.47  ? 837  LYS B CG   1 
ATOM   9852  C CD   . LYS B 1 276 ? -2.163  -1.962  -45.815 1.00 43.23  ? 837  LYS B CD   1 
ATOM   9853  C CE   . LYS B 1 276 ? -3.460  -2.267  -46.545 1.00 45.83  ? 837  LYS B CE   1 
ATOM   9854  N NZ   . LYS B 1 276 ? -4.645  -2.141  -45.655 1.00 55.90  ? 837  LYS B NZ   1 
ATOM   9855  H H    . LYS B 1 276 ? 1.216   -2.215  -42.445 1.00 49.96  ? 837  LYS B H    1 
ATOM   9856  H HA   . LYS B 1 276 ? -1.176  -3.236  -42.116 1.00 46.13  ? 837  LYS B HA   1 
ATOM   9857  H HB2  . LYS B 1 276 ? -0.529  -1.684  -43.839 1.00 43.63  ? 837  LYS B HB2  1 
ATOM   9858  H HB3  . LYS B 1 276 ? 0.091   -2.924  -44.609 1.00 43.63  ? 837  LYS B HB3  1 
ATOM   9859  H HG2  . LYS B 1 276 ? -1.964  -3.817  -44.970 1.00 44.96  ? 837  LYS B HG2  1 
ATOM   9860  H HG3  . LYS B 1 276 ? -2.648  -2.760  -43.993 1.00 44.96  ? 837  LYS B HG3  1 
ATOM   9861  H HD2  . LYS B 1 276 ? -2.206  -1.050  -45.489 1.00 51.88  ? 837  LYS B HD2  1 
ATOM   9862  H HD3  . LYS B 1 276 ? -1.432  -2.058  -46.445 1.00 51.88  ? 837  LYS B HD3  1 
ATOM   9863  H HE2  . LYS B 1 276 ? -3.566  -1.642  -47.280 1.00 54.99  ? 837  LYS B HE2  1 
ATOM   9864  H HE3  . LYS B 1 276 ? -3.430  -3.176  -46.882 1.00 54.99  ? 837  LYS B HE3  1 
ATOM   9865  H HZ1  . LYS B 1 276 ? -5.388  -2.325  -46.110 1.00 67.08  ? 837  LYS B HZ1  1 
ATOM   9866  H HZ2  . LYS B 1 276 ? -4.576  -2.709  -44.974 1.00 67.08  ? 837  LYS B HZ2  1 
ATOM   9867  H HZ3  . LYS B 1 276 ? -4.699  -1.312  -45.336 1.00 67.08  ? 837  LYS B HZ3  1 
ATOM   9868  N N    . GLN B 1 277 ? 1.052   -5.270  -43.173 1.00 39.30  ? 838  GLN B N    1 
ATOM   9869  C CA   . GLN B 1 277 ? 1.342   -6.694  -43.301 1.00 38.35  ? 838  GLN B CA   1 
ATOM   9870  C C    . GLN B 1 277 ? 1.106   -7.414  -41.981 1.00 39.37  ? 838  GLN B C    1 
ATOM   9871  O O    . GLN B 1 277 ? 0.451   -8.462  -41.939 1.00 33.52  ? 838  GLN B O    1 
ATOM   9872  C CB   . GLN B 1 277 ? 2.785   -6.901  -43.761 1.00 39.09  ? 838  GLN B CB   1 
ATOM   9873  C CG   . GLN B 1 277 ? 3.105   -6.337  -45.134 1.00 37.03  ? 838  GLN B CG   1 
ATOM   9874  C CD   . GLN B 1 277 ? 4.576   -6.469  -45.474 1.00 39.87  ? 838  GLN B CD   1 
ATOM   9875  O OE1  . GLN B 1 277 ? 5.283   -7.298  -44.900 1.00 42.25  ? 838  GLN B OE1  1 
ATOM   9876  N NE2  . GLN B 1 277 ? 5.047   -5.647  -46.403 1.00 38.22  ? 838  GLN B NE2  1 
ATOM   9877  H H    . GLN B 1 277 ? 1.727   -4.754  -43.306 1.00 47.16  ? 838  GLN B H    1 
ATOM   9878  H HA   . GLN B 1 277 ? 0.753   -7.081  -43.967 1.00 46.02  ? 838  GLN B HA   1 
ATOM   9879  H HB2  . GLN B 1 277 ? 3.377   -6.473  -43.123 1.00 46.90  ? 838  GLN B HB2  1 
ATOM   9880  H HB3  . GLN B 1 277 ? 2.967   -7.853  -43.786 1.00 46.90  ? 838  GLN B HB3  1 
ATOM   9881  H HG2  . GLN B 1 277 ? 2.596   -6.820  -45.803 1.00 44.43  ? 838  GLN B HG2  1 
ATOM   9882  H HG3  . GLN B 1 277 ? 2.874   -5.395  -45.153 1.00 44.43  ? 838  GLN B HG3  1 
ATOM   9883  H HE21 . GLN B 1 277 ? 4.524   -5.077  -46.778 1.00 45.86  ? 838  GLN B HE21 1 
ATOM   9884  H HE22 . GLN B 1 277 ? 5.876   -5.684  -46.629 1.00 45.86  ? 838  GLN B HE22 1 
ATOM   9885  N N    . LEU B 1 278 ? 1.639   -6.864  -40.888 1.00 44.19  ? 839  LEU B N    1 
ATOM   9886  C CA   . LEU B 1 278 ? 1.461   -7.488  -39.582 1.00 38.20  ? 839  LEU B CA   1 
ATOM   9887  C C    . LEU B 1 278 ? -0.001  -7.468  -39.158 1.00 35.04  ? 839  LEU B C    1 
ATOM   9888  O O    . LEU B 1 278 ? -0.500  -8.442  -38.583 1.00 32.45  ? 839  LEU B O    1 
ATOM   9889  C CB   . LEU B 1 278 ? 2.326   -6.778  -38.542 1.00 39.69  ? 839  LEU B CB   1 
ATOM   9890  C CG   . LEU B 1 278 ? 2.411   -7.444  -37.167 1.00 44.19  ? 839  LEU B CG   1 
ATOM   9891  C CD1  . LEU B 1 278 ? 3.040   -8.828  -37.270 1.00 41.32  ? 839  LEU B CD1  1 
ATOM   9892  C CD2  . LEU B 1 278 ? 3.193   -6.570  -36.202 1.00 45.86  ? 839  LEU B CD2  1 
ATOM   9893  H H    . LEU B 1 278 ? 2.103   -6.140  -40.878 1.00 53.03  ? 839  LEU B H    1 
ATOM   9894  H HA   . LEU B 1 278 ? 1.747   -8.413  -39.630 1.00 45.84  ? 839  LEU B HA   1 
ATOM   9895  H HB2  . LEU B 1 278 ? 3.230   -6.717  -38.889 1.00 47.63  ? 839  LEU B HB2  1 
ATOM   9896  H HB3  . LEU B 1 278 ? 1.972   -5.885  -38.409 1.00 47.63  ? 839  LEU B HB3  1 
ATOM   9897  H HG   . LEU B 1 278 ? 1.514   -7.550  -36.814 1.00 53.03  ? 839  LEU B HG   1 
ATOM   9898  H HD11 . LEU B 1 278 ? 3.080   -9.222  -36.385 1.00 49.58  ? 839  LEU B HD11 1 
ATOM   9899  H HD12 . LEU B 1 278 ? 2.496   -9.379  -37.854 1.00 49.58  ? 839  LEU B HD12 1 
ATOM   9900  H HD13 . LEU B 1 278 ? 3.935   -8.741  -37.634 1.00 49.58  ? 839  LEU B HD13 1 
ATOM   9901  H HD21 . LEU B 1 278 ? 3.233   -7.011  -35.339 1.00 55.03  ? 839  LEU B HD21 1 
ATOM   9902  H HD22 . LEU B 1 278 ? 4.089   -6.439  -36.549 1.00 55.03  ? 839  LEU B HD22 1 
ATOM   9903  H HD23 . LEU B 1 278 ? 2.742   -5.715  -36.116 1.00 55.03  ? 839  LEU B HD23 1 
ATOM   9904  N N    . GLN B 1 279 ? -0.704  -6.366  -39.431 1.00 34.27  ? 840  GLN B N    1 
ATOM   9905  C CA   . GLN B 1 279 ? -2.125  -6.301  -39.110 1.00 35.94  ? 840  GLN B CA   1 
ATOM   9906  C C    . GLN B 1 279 ? -2.916  -7.309  -39.934 1.00 39.02  ? 840  GLN B C    1 
ATOM   9907  O O    . GLN B 1 279 ? -3.868  -7.918  -39.431 1.00 37.68  ? 840  GLN B O    1 
ATOM   9908  C CB   . GLN B 1 279 ? -2.649  -4.884  -39.339 1.00 30.55  ? 840  GLN B CB   1 
ATOM   9909  C CG   . GLN B 1 279 ? -4.084  -4.673  -38.885 1.00 33.08  ? 840  GLN B CG   1 
ATOM   9910  C CD   . GLN B 1 279 ? -4.264  -4.876  -37.393 1.00 42.02  ? 840  GLN B CD   1 
ATOM   9911  O OE1  . GLN B 1 279 ? -3.333  -4.680  -36.611 1.00 38.52  ? 840  GLN B OE1  1 
ATOM   9912  N NE2  . GLN B 1 279 ? -5.464  -5.280  -36.991 1.00 41.11  ? 840  GLN B NE2  1 
ATOM   9913  H H    . GLN B 1 279 ? -0.385  -5.655  -39.795 1.00 41.13  ? 840  GLN B H    1 
ATOM   9914  H HA   . GLN B 1 279 ? -2.247  -6.518  -38.173 1.00 43.12  ? 840  GLN B HA   1 
ATOM   9915  H HB2  . GLN B 1 279 ? -2.089  -4.262  -38.848 1.00 36.66  ? 840  GLN B HB2  1 
ATOM   9916  H HB3  . GLN B 1 279 ? -2.606  -4.685  -40.287 1.00 36.66  ? 840  GLN B HB3  1 
ATOM   9917  H HG2  . GLN B 1 279 ? -4.353  -3.765  -39.098 1.00 39.70  ? 840  GLN B HG2  1 
ATOM   9918  H HG3  . GLN B 1 279 ? -4.658  -5.306  -39.345 1.00 39.70  ? 840  GLN B HG3  1 
ATOM   9919  H HE21 . GLN B 1 279 ? -6.088  -5.412  -37.568 1.00 49.33  ? 840  GLN B HE21 1 
ATOM   9920  H HE22 . GLN B 1 279 ? -5.616  -5.410  -36.155 1.00 49.33  ? 840  GLN B HE22 1 
ATOM   9921  N N    . PHE B 1 280 ? -2.535  -7.502  -41.200 1.00 40.09  ? 841  PHE B N    1 
ATOM   9922  C CA   . PHE B 1 280 ? -3.152  -8.548  -42.011 1.00 32.80  ? 841  PHE B CA   1 
ATOM   9923  C C    . PHE B 1 280 ? -2.941  -9.917  -41.376 1.00 34.68  ? 841  PHE B C    1 
ATOM   9924  O O    . PHE B 1 280 ? -3.881  -10.710 -41.255 1.00 32.55  ? 841  PHE B O    1 
ATOM   9925  C CB   . PHE B 1 280 ? -2.585  -8.521  -43.432 1.00 34.16  ? 841  PHE B CB   1 
ATOM   9926  C CG   . PHE B 1 280 ? -3.099  -9.630  -44.305 1.00 31.44  ? 841  PHE B CG   1 
ATOM   9927  C CD1  . PHE B 1 280 ? -4.431  -9.676  -44.681 1.00 29.83  ? 841  PHE B CD1  1 
ATOM   9928  C CD2  . PHE B 1 280 ? -2.248  -10.629 -44.751 1.00 30.30  ? 841  PHE B CD2  1 
ATOM   9929  C CE1  . PHE B 1 280 ? -4.906  -10.697 -45.482 1.00 32.19  ? 841  PHE B CE1  1 
ATOM   9930  C CE2  . PHE B 1 280 ? -2.718  -11.653 -45.552 1.00 32.07  ? 841  PHE B CE2  1 
ATOM   9931  C CZ   . PHE B 1 280 ? -4.049  -11.686 -45.917 1.00 31.29  ? 841  PHE B CZ   1 
ATOM   9932  H H    . PHE B 1 280 ? -1.929  -7.045  -41.606 1.00 48.11  ? 841  PHE B H    1 
ATOM   9933  H HA   . PHE B 1 280 ? -4.107  -8.385  -42.064 1.00 39.36  ? 841  PHE B HA   1 
ATOM   9934  H HB2  . PHE B 1 280 ? -2.826  -7.679  -43.849 1.00 40.99  ? 841  PHE B HB2  1 
ATOM   9935  H HB3  . PHE B 1 280 ? -1.620  -8.602  -43.385 1.00 40.99  ? 841  PHE B HB3  1 
ATOM   9936  H HD1  . PHE B 1 280 ? -5.014  -9.012  -44.389 1.00 35.79  ? 841  PHE B HD1  1 
ATOM   9937  H HD2  . PHE B 1 280 ? -1.351  -10.612 -44.506 1.00 36.36  ? 841  PHE B HD2  1 
ATOM   9938  H HE1  . PHE B 1 280 ? -5.803  -10.718 -45.728 1.00 38.62  ? 841  PHE B HE1  1 
ATOM   9939  H HE2  . PHE B 1 280 ? -2.139  -12.318 -45.845 1.00 38.49  ? 841  PHE B HE2  1 
ATOM   9940  H HZ   . PHE B 1 280 ? -4.366  -12.373 -46.458 1.00 37.55  ? 841  PHE B HZ   1 
ATOM   9941  N N    . PHE B 1 281 ? -1.706  -10.207 -40.955 1.00 34.20  ? 842  PHE B N    1 
ATOM   9942  C CA   . PHE B 1 281 ? -1.423  -11.472 -40.284 1.00 33.63  ? 842  PHE B CA   1 
ATOM   9943  C C    . PHE B 1 281 ? -2.234  -11.615 -39.002 1.00 34.42  ? 842  PHE B C    1 
ATOM   9944  O O    . PHE B 1 281 ? -2.688  -12.716 -38.666 1.00 33.82  ? 842  PHE B O    1 
ATOM   9945  C CB   . PHE B 1 281 ? 0.075   -11.582 -39.982 1.00 34.42  ? 842  PHE B CB   1 
ATOM   9946  C CG   . PHE B 1 281 ? 0.922   -11.961 -41.171 1.00 29.70  ? 842  PHE B CG   1 
ATOM   9947  C CD1  . PHE B 1 281 ? 0.459   -12.857 -42.122 1.00 24.31  ? 842  PHE B CD1  1 
ATOM   9948  C CD2  . PHE B 1 281 ? 2.191   -11.427 -41.329 1.00 28.26  ? 842  PHE B CD2  1 
ATOM   9949  C CE1  . PHE B 1 281 ? 1.240   -13.208 -43.207 1.00 30.62  ? 842  PHE B CE1  1 
ATOM   9950  C CE2  . PHE B 1 281 ? 2.979   -11.775 -42.413 1.00 30.67  ? 842  PHE B CE2  1 
ATOM   9951  C CZ   . PHE B 1 281 ? 2.501   -12.667 -43.353 1.00 31.19  ? 842  PHE B CZ   1 
ATOM   9952  H H    . PHE B 1 281 ? -1.024  -9.691  -41.045 1.00 41.04  ? 842  PHE B H    1 
ATOM   9953  H HA   . PHE B 1 281 ? -1.664  -12.203 -40.874 1.00 40.36  ? 842  PHE B HA   1 
ATOM   9954  H HB2  . PHE B 1 281 ? 0.390   -10.723 -39.657 1.00 41.30  ? 842  PHE B HB2  1 
ATOM   9955  H HB3  . PHE B 1 281 ? 0.205   -12.258 -39.299 1.00 41.30  ? 842  PHE B HB3  1 
ATOM   9956  H HD1  . PHE B 1 281 ? -0.389  -13.226 -42.030 1.00 29.17  ? 842  PHE B HD1  1 
ATOM   9957  H HD2  . PHE B 1 281 ? 2.518   -10.827 -40.699 1.00 33.91  ? 842  PHE B HD2  1 
ATOM   9958  H HE1  . PHE B 1 281 ? 0.916   -13.809 -43.838 1.00 36.75  ? 842  PHE B HE1  1 
ATOM   9959  H HE2  . PHE B 1 281 ? 3.828   -11.408 -42.509 1.00 36.81  ? 842  PHE B HE2  1 
ATOM   9960  H HZ   . PHE B 1 281 ? 3.027   -12.902 -44.083 1.00 37.43  ? 842  PHE B HZ   1 
ATOM   9961  N N    . GLN B 1 282 ? -2.422  -10.516 -38.267 1.00 36.05  ? 843  GLN B N    1 
ATOM   9962  C CA   . GLN B 1 282 ? -3.231  -10.572 -37.053 1.00 41.06  ? 843  GLN B CA   1 
ATOM   9963  C C    . GLN B 1 282 ? -4.680  -10.911 -37.377 1.00 41.41  ? 843  GLN B C    1 
ATOM   9964  O O    . GLN B 1 282 ? -5.264  -11.826 -36.785 1.00 40.37  ? 843  GLN B O    1 
ATOM   9965  C CB   . GLN B 1 282 ? -3.151  -9.244  -36.298 1.00 43.04  ? 843  GLN B CB   1 
ATOM   9966  C CG   . GLN B 1 282 ? -4.207  -9.102  -35.199 1.00 50.55  ? 843  GLN B CG   1 
ATOM   9967  C CD   . GLN B 1 282 ? -4.112  -7.795  -34.439 1.00 48.22  ? 843  GLN B CD   1 
ATOM   9968  O OE1  . GLN B 1 282 ? -3.061  -7.161  -34.398 1.00 48.90  ? 843  GLN B OE1  1 
ATOM   9969  N NE2  . GLN B 1 282 ? -5.220  -7.384  -33.834 1.00 64.08  ? 843  GLN B NE2  1 
ATOM   9970  H H    . GLN B 1 282 ? -2.098  -9.740  -38.448 1.00 43.26  ? 843  GLN B H    1 
ATOM   9971  H HA   . GLN B 1 282 ? -2.883  -11.268 -36.474 1.00 49.27  ? 843  GLN B HA   1 
ATOM   9972  H HB2  . GLN B 1 282 ? -2.278  -9.171  -35.883 1.00 51.65  ? 843  GLN B HB2  1 
ATOM   9973  H HB3  . GLN B 1 282 ? -3.278  -8.517  -36.928 1.00 51.65  ? 843  GLN B HB3  1 
ATOM   9974  H HG2  . GLN B 1 282 ? -5.088  -9.149  -35.602 1.00 60.66  ? 843  GLN B HG2  1 
ATOM   9975  H HG3  . GLN B 1 282 ? -4.096  -9.825  -34.562 1.00 60.66  ? 843  GLN B HG3  1 
ATOM   9976  H HE21 . GLN B 1 282 ? -5.938  -7.854  -33.887 1.00 76.89  ? 843  GLN B HE21 1 
ATOM   9977  H HE22 . GLN B 1 282 ? -5.219  -6.648  -33.390 1.00 76.89  ? 843  GLN B HE22 1 
ATOM   9978  N N    . ASP B 1 283 ? -5.282  -10.173 -38.312 1.00 38.11  ? 844  ASP B N    1 
ATOM   9979  C CA   . ASP B 1 283 ? -6.689  -10.386 -38.631 1.00 39.31  ? 844  ASP B CA   1 
ATOM   9980  C C    . ASP B 1 283 ? -6.923  -11.750 -39.267 1.00 42.35  ? 844  ASP B C    1 
ATOM   9981  O O    . ASP B 1 283 ? -7.978  -12.358 -39.049 1.00 47.47  ? 844  ASP B O    1 
ATOM   9982  C CB   . ASP B 1 283 ? -7.189  -9.274  -39.550 1.00 47.78  ? 844  ASP B CB   1 
ATOM   9983  C CG   . ASP B 1 283 ? -7.186  -7.918  -38.873 1.00 51.70  ? 844  ASP B CG   1 
ATOM   9984  O OD1  . ASP B 1 283 ? -7.776  -7.799  -37.777 1.00 49.81  ? 844  ASP B OD1  1 
ATOM   9985  O OD2  . ASP B 1 283 ? -6.585  -6.976  -39.428 1.00 46.55  ? 844  ASP B OD2  1 
ATOM   9986  H H    . ASP B 1 283 ? -4.902  -9.551  -38.769 1.00 45.73  ? 844  ASP B H    1 
ATOM   9987  H HA   . ASP B 1 283 ? -7.205  -10.349 -37.811 1.00 47.17  ? 844  ASP B HA   1 
ATOM   9988  H HB2  . ASP B 1 283 ? -6.613  -9.223  -40.329 1.00 57.33  ? 844  ASP B HB2  1 
ATOM   9989  H HB3  . ASP B 1 283 ? -8.099  -9.473  -39.822 1.00 57.33  ? 844  ASP B HB3  1 
ATOM   9990  N N    . VAL B 1 284 ? -5.965  -12.244 -40.053 1.00 39.34  ? 845  VAL B N    1 
ATOM   9991  C CA   . VAL B 1 284 ? -6.064  -13.603 -40.578 1.00 43.89  ? 845  VAL B CA   1 
ATOM   9992  C C    . VAL B 1 284 ? -6.068  -14.604 -39.431 1.00 40.20  ? 845  VAL B C    1 
ATOM   9993  O O    . VAL B 1 284 ? -6.956  -15.458 -39.331 1.00 42.86  ? 845  VAL B O    1 
ATOM   9994  C CB   . VAL B 1 284 ? -4.917  -13.882 -41.567 1.00 40.45  ? 845  VAL B CB   1 
ATOM   9995  C CG1  . VAL B 1 284 ? -4.794  -15.377 -41.864 1.00 41.32  ? 845  VAL B CG1  1 
ATOM   9996  C CG2  . VAL B 1 284 ? -5.133  -13.109 -42.859 1.00 40.54  ? 845  VAL B CG2  1 
ATOM   9997  H H    . VAL B 1 284 ? -5.257  -11.818 -40.293 1.00 47.21  ? 845  VAL B H    1 
ATOM   9998  H HA   . VAL B 1 284 ? -6.902  -13.695 -41.058 1.00 52.66  ? 845  VAL B HA   1 
ATOM   9999  H HB   . VAL B 1 284 ? -4.081  -13.584 -41.175 1.00 48.54  ? 845  VAL B HB   1 
ATOM   10000 H HG11 . VAL B 1 284 ? -4.065  -15.516 -42.488 1.00 49.58  ? 845  VAL B HG11 1 
ATOM   10001 H HG12 . VAL B 1 284 ? -4.616  -15.849 -41.036 1.00 49.58  ? 845  VAL B HG12 1 
ATOM   10002 H HG13 . VAL B 1 284 ? -5.626  -15.690 -42.252 1.00 49.58  ? 845  VAL B HG13 1 
ATOM   10003 H HG21 . VAL B 1 284 ? -4.401  -13.299 -43.466 1.00 48.64  ? 845  VAL B HG21 1 
ATOM   10004 H HG22 . VAL B 1 284 ? -5.973  -13.387 -43.256 1.00 48.64  ? 845  VAL B HG22 1 
ATOM   10005 H HG23 . VAL B 1 284 ? -5.159  -12.160 -42.658 1.00 48.64  ? 845  VAL B HG23 1 
ATOM   10006 N N    . SER B 1 285 ? -5.074  -14.508 -38.545 1.00 36.37  ? 846  SER B N    1 
ATOM   10007 C CA   . SER B 1 285 ? -4.990  -15.423 -37.411 1.00 38.72  ? 846  SER B CA   1 
ATOM   10008 C C    . SER B 1 285 ? -6.233  -15.334 -36.535 1.00 42.39  ? 846  SER B C    1 
ATOM   10009 O O    . SER B 1 285 ? -6.781  -16.360 -36.115 1.00 45.88  ? 846  SER B O    1 
ATOM   10010 C CB   . SER B 1 285 ? -3.732  -15.123 -36.595 1.00 35.22  ? 846  SER B CB   1 
ATOM   10011 O OG   . SER B 1 285 ? -3.589  -16.029 -35.516 1.00 39.78  ? 846  SER B OG   1 
ATOM   10012 H H    . SER B 1 285 ? -4.442  -13.925 -38.580 1.00 43.65  ? 846  SER B H    1 
ATOM   10013 H HA   . SER B 1 285 ? -4.922  -16.332 -37.743 1.00 46.46  ? 846  SER B HA   1 
ATOM   10014 H HB2  . SER B 1 285 ? -2.956  -15.199 -37.173 1.00 42.26  ? 846  SER B HB2  1 
ATOM   10015 H HB3  . SER B 1 285 ? -3.793  -14.222 -36.242 1.00 42.26  ? 846  SER B HB3  1 
ATOM   10016 H HG   . SER B 1 285 ? -4.254  -15.974 -35.005 1.00 47.74  ? 846  SER B HG   1 
ATOM   10017 N N    . ASP B 1 286 ? -6.695  -14.114 -36.246 1.00 42.39  ? 847  ASP B N    1 
ATOM   10018 C CA   . ASP B 1 286 ? -7.918  -13.950 -35.468 1.00 42.37  ? 847  ASP B CA   1 
ATOM   10019 C C    . ASP B 1 286 ? -9.131  -14.498 -36.206 1.00 48.15  ? 847  ASP B C    1 
ATOM   10020 O O    . ASP B 1 286 ? -10.106 -14.918 -35.571 1.00 49.44  ? 847  ASP B O    1 
ATOM   10021 C CB   . ASP B 1 286 ? -8.133  -12.476 -35.132 1.00 48.67  ? 847  ASP B CB   1 
ATOM   10022 C CG   . ASP B 1 286 ? -7.270  -12.012 -33.981 1.00 49.83  ? 847  ASP B CG   1 
ATOM   10023 O OD1  . ASP B 1 286 ? -6.289  -12.714 -33.653 1.00 53.51  ? 847  ASP B OD1  1 
ATOM   10024 O OD2  . ASP B 1 286 ? -7.568  -10.946 -33.402 1.00 60.58  ? 847  ASP B OD2  1 
ATOM   10025 H H    . ASP B 1 286 ? -6.321  -13.377 -36.486 1.00 50.87  ? 847  ASP B H    1 
ATOM   10026 H HA   . ASP B 1 286 ? -7.830  -14.438 -34.634 1.00 50.85  ? 847  ASP B HA   1 
ATOM   10027 H HB2  . ASP B 1 286 ? -7.912  -11.939 -35.909 1.00 58.40  ? 847  ASP B HB2  1 
ATOM   10028 H HB3  . ASP B 1 286 ? -9.062  -12.339 -34.886 1.00 58.40  ? 847  ASP B HB3  1 
ATOM   10029 N N    . ARG B 1 287 ? -9.093  -14.502 -37.538 1.00 52.28  ? 848  ARG B N    1 
ATOM   10030 C CA   . ARG B 1 287 ? -10.232 -14.976 -38.316 1.00 52.63  ? 848  ARG B CA   1 
ATOM   10031 C C    . ARG B 1 287 ? -10.293 -16.499 -38.359 1.00 48.34  ? 848  ARG B C    1 
ATOM   10032 O O    . ARG B 1 287 ? -11.371 -17.081 -38.204 1.00 53.40  ? 848  ARG B O    1 
ATOM   10033 C CB   . ARG B 1 287 ? -10.163 -14.409 -39.735 1.00 51.33  ? 848  ARG B CB   1 
ATOM   10034 C CG   . ARG B 1 287 ? -11.237 -14.930 -40.677 1.00 52.73  ? 848  ARG B CG   1 
ATOM   10035 C CD   . ARG B 1 287 ? -12.633 -14.563 -40.202 1.00 50.19  ? 848  ARG B CD   1 
ATOM   10036 N NE   . ARG B 1 287 ? -13.660 -15.017 -41.135 1.00 54.67  ? 848  ARG B NE   1 
ATOM   10037 C CZ   . ARG B 1 287 ? -14.186 -16.239 -41.146 1.00 65.03  ? 848  ARG B CZ   1 
ATOM   10038 N NH1  . ARG B 1 287 ? -13.786 -17.151 -40.269 1.00 59.97  ? 848  ARG B NH1  1 
ATOM   10039 N NH2  . ARG B 1 287 ? -15.114 -16.552 -42.039 1.00 61.34  ? 848  ARG B NH2  1 
ATOM   10040 H H    . ARG B 1 287 ? -8.425  -14.237 -38.011 1.00 62.73  ? 848  ARG B H    1 
ATOM   10041 H HA   . ARG B 1 287 ? -11.049 -14.656 -37.905 1.00 63.15  ? 848  ARG B HA   1 
ATOM   10042 H HB2  . ARG B 1 287 ? -10.256 -13.445 -39.688 1.00 61.59  ? 848  ARG B HB2  1 
ATOM   10043 H HB3  . ARG B 1 287 ? -9.301  -14.635 -40.117 1.00 61.59  ? 848  ARG B HB3  1 
ATOM   10044 H HG2  . ARG B 1 287 ? -11.105 -14.543 -41.557 1.00 63.28  ? 848  ARG B HG2  1 
ATOM   10045 H HG3  . ARG B 1 287 ? -11.178 -15.897 -40.725 1.00 63.28  ? 848  ARG B HG3  1 
ATOM   10046 H HD2  . ARG B 1 287 ? -12.798 -14.982 -39.342 1.00 60.23  ? 848  ARG B HD2  1 
ATOM   10047 H HD3  . ARG B 1 287 ? -12.699 -13.599 -40.123 1.00 60.23  ? 848  ARG B HD3  1 
ATOM   10048 H HE   . ARG B 1 287 ? -13.946 -14.454 -41.720 1.00 65.60  ? 848  ARG B HE   1 
ATOM   10049 H HH11 . ARG B 1 287 ? -13.184 -16.955 -39.688 1.00 71.96  ? 848  ARG B HH11 1 
ATOM   10050 H HH12 . ARG B 1 287 ? -14.131 -17.939 -40.282 1.00 71.96  ? 848  ARG B HH12 1 
ATOM   10051 H HH21 . ARG B 1 287 ? -15.377 -15.965 -42.610 1.00 73.60  ? 848  ARG B HH21 1 
ATOM   10052 H HH22 . ARG B 1 287 ? -15.455 -17.342 -42.046 1.00 73.60  ? 848  ARG B HH22 1 
ATOM   10053 N N    . ILE B 1 288 ? -9.152  -17.158 -38.568 1.00 50.31  ? 849  ILE B N    1 
ATOM   10054 C CA   . ILE B 1 288 ? -9.161  -18.605 -38.766 1.00 50.66  ? 849  ILE B CA   1 
ATOM   10055 C C    . ILE B 1 288 ? -9.285  -19.346 -37.439 1.00 57.86  ? 849  ILE B C    1 
ATOM   10056 O O    . ILE B 1 288 ? -9.884  -20.426 -37.386 1.00 62.76  ? 849  ILE B O    1 
ATOM   10057 C CB   . ILE B 1 288 ? -7.909  -19.049 -39.545 1.00 46.68  ? 849  ILE B CB   1 
ATOM   10058 C CG1  . ILE B 1 288 ? -6.631  -18.679 -38.783 1.00 42.96  ? 849  ILE B CG1  1 
ATOM   10059 C CG2  . ILE B 1 288 ? -7.935  -18.445 -40.945 1.00 51.19  ? 849  ILE B CG2  1 
ATOM   10060 C CD1  . ILE B 1 288 ? -5.344  -19.017 -39.514 1.00 40.23  ? 849  ILE B CD1  1 
ATOM   10061 H H    . ILE B 1 288 ? -8.372  -16.797 -38.599 1.00 60.37  ? 849  ILE B H    1 
ATOM   10062 H HA   . ILE B 1 288 ? -9.935  -18.837 -39.303 1.00 60.79  ? 849  ILE B HA   1 
ATOM   10063 H HB   . ILE B 1 288 ? -7.937  -20.014 -39.634 1.00 56.02  ? 849  ILE B HB   1 
ATOM   10064 H HG12 . ILE B 1 288 ? -6.633  -17.724 -38.617 1.00 51.56  ? 849  ILE B HG12 1 
ATOM   10065 H HG13 . ILE B 1 288 ? -6.624  -19.157 -37.939 1.00 51.56  ? 849  ILE B HG13 1 
ATOM   10066 H HG21 . ILE B 1 288 ? -7.143  -18.731 -41.427 1.00 61.42  ? 849  ILE B HG21 1 
ATOM   10067 H HG22 . ILE B 1 288 ? -8.732  -18.753 -41.406 1.00 61.42  ? 849  ILE B HG22 1 
ATOM   10068 H HG23 . ILE B 1 288 ? -7.948  -17.478 -40.872 1.00 61.42  ? 849  ILE B HG23 1 
ATOM   10069 H HD11 . ILE B 1 288 ? -4.590  -18.752 -38.965 1.00 48.28  ? 849  ILE B HD11 1 
ATOM   10070 H HD12 . ILE B 1 288 ? -5.315  -19.972 -39.677 1.00 48.28  ? 849  ILE B HD12 1 
ATOM   10071 H HD13 . ILE B 1 288 ? -5.325  -18.536 -40.357 1.00 48.28  ? 849  ILE B HD13 1 
ATOM   10072 N N    . GLU B 1 289 ? -8.734  -18.798 -36.359 1.00 57.70  ? 850  GLU B N    1 
ATOM   10073 C CA   . GLU B 1 289 ? -8.886  -19.404 -35.039 1.00 64.45  ? 850  GLU B CA   1 
ATOM   10074 C C    . GLU B 1 289 ? -10.104 -18.815 -34.325 1.00 68.29  ? 850  GLU B C    1 
ATOM   10075 O O    . GLU B 1 289 ? -10.244 -17.596 -34.299 1.00 68.89  ? 850  GLU B O    1 
ATOM   10076 C CB   . GLU B 1 289 ? -7.636  -19.189 -34.184 1.00 67.41  ? 850  GLU B CB   1 
ATOM   10077 C CG   . GLU B 1 289 ? -7.722  -19.831 -32.800 1.00 65.64  ? 850  GLU B CG   1 
ATOM   10078 C CD   . GLU B 1 289 ? -6.507  -19.553 -31.940 1.00 66.23  ? 850  GLU B CD   1 
ATOM   10079 O OE1  . GLU B 1 289 ? -5.718  -18.654 -32.295 1.00 63.51  ? 850  GLU B OE1  1 
ATOM   10080 O OE2  . GLU B 1 289 ? -6.341  -20.238 -30.907 1.00 64.23  ? 850  GLU B OE2  1 
ATOM   10081 H H    . GLU B 1 289 ? -8.268  -18.075 -36.364 1.00 69.23  ? 850  GLU B H    1 
ATOM   10082 H HA   . GLU B 1 289 ? -9.025  -20.358 -35.139 1.00 77.34  ? 850  GLU B HA   1 
ATOM   10083 H HB2  . GLU B 1 289 ? -6.873  -19.574 -34.643 1.00 80.89  ? 850  GLU B HB2  1 
ATOM   10084 H HB3  . GLU B 1 289 ? -7.500  -18.236 -34.062 1.00 80.89  ? 850  GLU B HB3  1 
ATOM   10085 H HG2  . GLU B 1 289 ? -8.501  -19.481 -32.339 1.00 78.76  ? 850  GLU B HG2  1 
ATOM   10086 H HG3  . GLU B 1 289 ? -7.802  -20.792 -32.903 1.00 78.76  ? 850  GLU B HG3  1 
ATOM   10087 N N    . LYS B 1 290 ? -10.997 -19.624 -33.748 1.00 68.97  ? 851  LYS B N    1 
ATOM   10088 C CA   . LYS B 1 290 ? -10.982 -21.084 -33.795 1.00 62.08  ? 851  LYS B CA   1 
ATOM   10089 C C    . LYS B 1 290 ? -12.033 -21.577 -34.778 1.00 68.94  ? 851  LYS B C    1 
ATOM   10090 O O    . LYS B 1 290 ? -13.230 -21.460 -34.515 1.00 71.25  ? 851  LYS B O    1 
ATOM   10091 C CB   . LYS B 1 290 ? -11.241 -21.670 -32.405 1.00 70.20  ? 851  LYS B CB   1 
ATOM   10092 H H    . LYS B 1 290 ? -11.663 -19.324 -33.295 1.00 82.77  ? 851  LYS B H    1 
ATOM   10093 H HA   . LYS B 1 290 ? -10.113 -21.388 -34.099 1.00 74.49  ? 851  LYS B HA   1 
ATOM   10094 N N    . GLU B 1 291 ? -11.586 -22.123 -35.908 1.00 67.30  ? 852  GLU B N    1 
ATOM   10095 C CA   . GLU B 1 291 ? -12.479 -22.654 -36.927 1.00 65.96  ? 852  GLU B CA   1 
ATOM   10096 C C    . GLU B 1 291 ? -12.037 -24.064 -37.289 1.00 70.45  ? 852  GLU B C    1 
ATOM   10097 O O    . GLU B 1 291 ? -10.900 -24.466 -37.031 1.00 70.40  ? 852  GLU B O    1 
ATOM   10098 C CB   . GLU B 1 291 ? -12.505 -21.766 -38.178 1.00 67.91  ? 852  GLU B CB   1 
ATOM   10099 C CG   . GLU B 1 291 ? -13.809 -21.841 -38.957 1.00 71.43  ? 852  GLU B CG   1 
ATOM   10100 C CD   . GLU B 1 291 ? -13.792 -20.993 -40.212 1.00 63.49  ? 852  GLU B CD   1 
ATOM   10101 O OE1  . GLU B 1 291 ? -12.692 -20.743 -40.747 1.00 63.27  ? 852  GLU B OE1  1 
ATOM   10102 O OE2  . GLU B 1 291 ? -14.880 -20.572 -40.661 1.00 74.12  ? 852  GLU B OE2  1 
ATOM   10103 H H    . GLU B 1 291 ? -10.753 -22.196 -36.109 1.00 80.76  ? 852  GLU B H    1 
ATOM   10104 H HA   . GLU B 1 291 ? -13.380 -22.701 -36.569 1.00 79.16  ? 852  GLU B HA   1 
ATOM   10105 H HB2  . GLU B 1 291 ? -12.373 -20.843 -37.909 1.00 81.49  ? 852  GLU B HB2  1 
ATOM   10106 H HB3  . GLU B 1 291 ? -11.789 -22.041 -38.771 1.00 81.49  ? 852  GLU B HB3  1 
ATOM   10107 H HG2  . GLU B 1 291 ? -13.968 -22.761 -39.219 1.00 85.71  ? 852  GLU B HG2  1 
ATOM   10108 H HG3  . GLU B 1 291 ? -14.533 -21.527 -38.393 1.00 85.71  ? 852  GLU B HG3  1 
ATOM   10109 N N    . SER B 1 292 ? -12.958 -24.812 -37.893 1.00 70.83  ? 853  SER B N    1 
ATOM   10110 C CA   . SER B 1 292 ? -12.703 -26.213 -38.203 1.00 74.81  ? 853  SER B CA   1 
ATOM   10111 C C    . SER B 1 292 ? -11.492 -26.346 -39.119 1.00 75.28  ? 853  SER B C    1 
ATOM   10112 O O    . SER B 1 292 ? -11.413 -25.697 -40.165 1.00 75.66  ? 853  SER B O    1 
ATOM   10113 C CB   . SER B 1 292 ? -13.934 -26.838 -38.857 1.00 86.56  ? 853  SER B CB   1 
ATOM   10114 O OG   . SER B 1 292 ? -14.075 -26.409 -40.200 1.00 90.77  ? 853  SER B OG   1 
ATOM   10115 H H    . SER B 1 292 ? -13.735 -24.533 -38.133 1.00 84.99  ? 853  SER B H    1 
ATOM   10116 H HA   . SER B 1 292 ? -12.517 -26.694 -37.382 1.00 89.78  ? 853  SER B HA   1 
ATOM   10117 H HB2  . SER B 1 292 ? -13.842 -27.804 -38.844 1.00 103.87 ? 853  SER B HB2  1 
ATOM   10118 H HB3  . SER B 1 292 ? -14.723 -26.575 -38.358 1.00 103.87 ? 853  SER B HB3  1 
ATOM   10119 H HG   . SER B 1 292 ? -14.157 -25.573 -40.227 1.00 108.92 ? 853  SER B HG   1 
ATOM   10120 N N    . LEU B 1 293 ? -10.544 -27.193 -38.714 1.00 73.88  ? 854  LEU B N    1 
ATOM   10121 C CA   . LEU B 1 293 ? -9.310  -27.372 -39.469 1.00 74.38  ? 854  LEU B CA   1 
ATOM   10122 C C    . LEU B 1 293 ? -9.514  -28.158 -40.756 1.00 72.07  ? 854  LEU B C    1 
ATOM   10123 O O    . LEU B 1 293 ? -8.625  -28.146 -41.614 1.00 67.72  ? 854  LEU B O    1 
ATOM   10124 C CB   . LEU B 1 293 ? -8.267  -28.061 -38.588 1.00 71.68  ? 854  LEU B CB   1 
ATOM   10125 C CG   . LEU B 1 293 ? -8.013  -27.371 -37.244 1.00 72.30  ? 854  LEU B CG   1 
ATOM   10126 C CD1  . LEU B 1 293 ? -6.950  -28.115 -36.450 1.00 76.56  ? 854  LEU B CD1  1 
ATOM   10127 C CD2  . LEU B 1 293 ? -7.615  -25.911 -37.432 1.00 69.04  ? 854  LEU B CD2  1 
ATOM   10128 H H    . LEU B 1 293 ? -10.594 -27.675 -38.004 1.00 88.65  ? 854  LEU B H    1 
ATOM   10129 H HA   . LEU B 1 293 ? -8.963  -26.498 -39.709 1.00 89.26  ? 854  LEU B HA   1 
ATOM   10130 H HB2  . LEU B 1 293 ? -8.567  -28.965 -38.402 1.00 86.01  ? 854  LEU B HB2  1 
ATOM   10131 H HB3  . LEU B 1 293 ? -7.425  -28.089 -39.068 1.00 86.01  ? 854  LEU B HB3  1 
ATOM   10132 H HG   . LEU B 1 293 ? -8.833  -27.389 -36.726 1.00 86.76  ? 854  LEU B HG   1 
ATOM   10133 H HD11 . LEU B 1 293 ? -6.810  -27.658 -35.606 1.00 91.87  ? 854  LEU B HD11 1 
ATOM   10134 H HD12 . LEU B 1 293 ? -7.254  -29.022 -36.289 1.00 91.87  ? 854  LEU B HD12 1 
ATOM   10135 H HD13 . LEU B 1 293 ? -6.126  -28.128 -36.962 1.00 91.87  ? 854  LEU B HD13 1 
ATOM   10136 H HD21 . LEU B 1 293 ? -7.464  -25.510 -36.562 1.00 82.85  ? 854  LEU B HD21 1 
ATOM   10137 H HD22 . LEU B 1 293 ? -6.803  -25.871 -37.961 1.00 82.85  ? 854  LEU B HD22 1 
ATOM   10138 H HD23 . LEU B 1 293 ? -8.333  -25.445 -37.890 1.00 82.85  ? 854  LEU B HD23 1 
ATOM   10139 N N    . ASP B 1 294 ? -10.648 -28.838 -40.909 1.00 75.16  ? 855  ASP B N    1 
ATOM   10140 C CA   . ASP B 1 294 ? -11.024 -29.470 -42.166 1.00 81.01  ? 855  ASP B CA   1 
ATOM   10141 C C    . ASP B 1 294 ? -11.939 -28.591 -43.008 1.00 74.92  ? 855  ASP B C    1 
ATOM   10142 O O    . ASP B 1 294 ? -12.310 -28.988 -44.117 1.00 78.54  ? 855  ASP B O    1 
ATOM   10143 C CB   . ASP B 1 294 ? -11.704 -30.822 -41.905 1.00 88.83  ? 855  ASP B CB   1 
ATOM   10144 C CG   . ASP B 1 294 ? -12.740 -30.755 -40.800 1.00 91.31  ? 855  ASP B CG   1 
ATOM   10145 O OD1  . ASP B 1 294 ? -13.079 -29.634 -40.369 1.00 84.13  ? 855  ASP B OD1  1 
ATOM   10146 O OD2  . ASP B 1 294 ? -13.216 -31.824 -40.364 1.00 95.68  ? 855  ASP B OD2  1 
ATOM   10147 H H    . ASP B 1 294 ? -11.228 -28.949 -40.283 1.00 90.20  ? 855  ASP B H    1 
ATOM   10148 H HA   . ASP B 1 294 ? -10.220 -29.638 -42.682 1.00 97.21  ? 855  ASP B HA   1 
ATOM   10149 H HB2  . ASP B 1 294 ? -12.149 -31.113 -42.716 1.00 106.60 ? 855  ASP B HB2  1 
ATOM   10150 H HB3  . ASP B 1 294 ? -11.030 -31.469 -41.646 1.00 106.60 ? 855  ASP B HB3  1 
ATOM   10151 N N    . GLY B 1 295 ? -12.304 -27.409 -42.514 1.00 71.36  ? 856  GLY B N    1 
ATOM   10152 C CA   . GLY B 1 295 ? -13.199 -26.528 -43.225 1.00 69.29  ? 856  GLY B CA   1 
ATOM   10153 C C    . GLY B 1 295 ? -12.556 -25.911 -44.450 1.00 62.06  ? 856  GLY B C    1 
ATOM   10154 O O    . GLY B 1 295 ? -11.349 -26.040 -44.679 1.00 60.93  ? 856  GLY B O    1 
ATOM   10155 H H    . GLY B 1 295 ? -12.039 -27.099 -41.757 1.00 85.63  ? 856  GLY B H    1 
ATOM   10156 H HA2  . GLY B 1 295 ? -13.984 -27.023 -43.507 1.00 83.15  ? 856  GLY B HA2  1 
ATOM   10157 H HA3  . GLY B 1 295 ? -13.483 -25.812 -42.635 1.00 83.15  ? 856  GLY B HA3  1 
ATOM   10158 N N    . PRO B 1 296 ? -13.359 -25.224 -45.268 1.00 60.49  ? 857  PRO B N    1 
ATOM   10159 C CA   . PRO B 1 296 ? -12.810 -24.643 -46.507 1.00 61.61  ? 857  PRO B CA   1 
ATOM   10160 C C    . PRO B 1 296 ? -11.701 -23.632 -46.270 1.00 57.20  ? 857  PRO B C    1 
ATOM   10161 O O    . PRO B 1 296 ? -10.685 -23.660 -46.978 1.00 53.90  ? 857  PRO B O    1 
ATOM   10162 C CB   . PRO B 1 296 ? -14.039 -23.993 -47.160 1.00 60.05  ? 857  PRO B CB   1 
ATOM   10163 C CG   . PRO B 1 296 ? -15.215 -24.688 -46.562 1.00 61.99  ? 857  PRO B CG   1 
ATOM   10164 C CD   . PRO B 1 296 ? -14.816 -25.034 -45.163 1.00 60.86  ? 857  PRO B CD   1 
ATOM   10165 H HA   . PRO B 1 296 ? -12.478 -25.347 -47.086 1.00 73.93  ? 857  PRO B HA   1 
ATOM   10166 H HB2  . PRO B 1 296 ? -14.057 -23.046 -46.951 1.00 72.06  ? 857  PRO B HB2  1 
ATOM   10167 H HB3  . PRO B 1 296 ? -14.010 -24.131 -48.120 1.00 72.06  ? 857  PRO B HB3  1 
ATOM   10168 H HG2  . PRO B 1 296 ? -15.979 -24.092 -46.561 1.00 74.38  ? 857  PRO B HG2  1 
ATOM   10169 H HG3  . PRO B 1 296 ? -15.409 -25.492 -47.069 1.00 74.38  ? 857  PRO B HG3  1 
ATOM   10170 H HD2  . PRO B 1 296 ? -15.019 -24.300 -44.562 1.00 73.03  ? 857  PRO B HD2  1 
ATOM   10171 H HD3  . PRO B 1 296 ? -15.246 -25.856 -44.881 1.00 73.03  ? 857  PRO B HD3  1 
ATOM   10172 N N    . ILE B 1 297 ? -11.865 -22.736 -45.296 1.00 50.91  ? 858  ILE B N    1 
ATOM   10173 C CA   . ILE B 1 297 ? -10.888 -21.669 -45.086 1.00 50.28  ? 858  ILE B CA   1 
ATOM   10174 C C    . ILE B 1 297 ? -9.552  -22.250 -44.636 1.00 49.11  ? 858  ILE B C    1 
ATOM   10175 O O    . ILE B 1 297 ? -8.509  -22.006 -45.253 1.00 44.19  ? 858  ILE B O    1 
ATOM   10176 C CB   . ILE B 1 297 ? -11.422 -20.645 -44.068 1.00 54.90  ? 858  ILE B CB   1 
ATOM   10177 C CG1  . ILE B 1 297 ? -12.660 -19.942 -44.628 1.00 53.35  ? 858  ILE B CG1  1 
ATOM   10178 C CG2  . ILE B 1 297 ? -10.351 -19.611 -43.730 1.00 48.39  ? 858  ILE B CG2  1 
ATOM   10179 C CD1  . ILE B 1 297 ? -13.446 -19.166 -43.592 1.00 49.92  ? 858  ILE B CD1  1 
ATOM   10180 H H    . ILE B 1 297 ? -12.527 -22.725 -44.747 1.00 61.10  ? 858  ILE B H    1 
ATOM   10181 H HA   . ILE B 1 297 ? -10.743 -21.206 -45.926 1.00 60.34  ? 858  ILE B HA   1 
ATOM   10182 H HB   . ILE B 1 297 ? -11.670 -21.113 -43.256 1.00 65.87  ? 858  ILE B HB   1 
ATOM   10183 H HG12 . ILE B 1 297 ? -12.380 -19.317 -45.315 1.00 64.02  ? 858  ILE B HG12 1 
ATOM   10184 H HG13 . ILE B 1 297 ? -13.251 -20.608 -45.010 1.00 64.02  ? 858  ILE B HG13 1 
ATOM   10185 H HG21 . ILE B 1 297 ? -10.713 -18.980 -43.088 1.00 58.06  ? 858  ILE B HG21 1 
ATOM   10186 H HG22 . ILE B 1 297 ? -9.583  -20.065 -43.350 1.00 58.06  ? 858  ILE B HG22 1 
ATOM   10187 H HG23 . ILE B 1 297 ? -10.093 -19.147 -44.542 1.00 58.06  ? 858  ILE B HG23 1 
ATOM   10188 H HD11 . ILE B 1 297 ? -14.211 -18.752 -44.022 1.00 59.90  ? 858  ILE B HD11 1 
ATOM   10189 H HD12 . ILE B 1 297 ? -13.746 -19.778 -42.901 1.00 59.90  ? 858  ILE B HD12 1 
ATOM   10190 H HD13 . ILE B 1 297 ? -12.874 -18.485 -43.207 1.00 59.90  ? 858  ILE B HD13 1 
ATOM   10191 N N    . VAL B 1 298 ? -9.564  -23.026 -43.550 1.00 55.00  ? 859  VAL B N    1 
ATOM   10192 C CA   . VAL B 1 298 ? -8.310  -23.503 -42.977 1.00 55.04  ? 859  VAL B CA   1 
ATOM   10193 C C    . VAL B 1 298 ? -7.663  -24.539 -43.888 1.00 53.61  ? 859  VAL B C    1 
ATOM   10194 O O    . VAL B 1 298 ? -6.433  -24.674 -43.909 1.00 50.44  ? 859  VAL B O    1 
ATOM   10195 C CB   . VAL B 1 298 ? -8.545  -24.064 -41.561 1.00 60.01  ? 859  VAL B CB   1 
ATOM   10196 C CG1  . VAL B 1 298 ? -7.215  -24.353 -40.879 1.00 60.98  ? 859  VAL B CG1  1 
ATOM   10197 C CG2  . VAL B 1 298 ? -9.358  -23.086 -40.720 1.00 58.34  ? 859  VAL B CG2  1 
ATOM   10198 H H    . VAL B 1 298 ? -10.272 -23.285 -43.136 1.00 66.01  ? 859  VAL B H    1 
ATOM   10199 H HA   . VAL B 1 298 ? -7.698  -22.754 -42.899 1.00 66.05  ? 859  VAL B HA   1 
ATOM   10200 H HB   . VAL B 1 298 ? -9.041  -24.895 -41.625 1.00 72.02  ? 859  VAL B HB   1 
ATOM   10201 H HG11 . VAL B 1 298 ? -7.386  -24.705 -39.991 1.00 73.17  ? 859  VAL B HG11 1 
ATOM   10202 H HG12 . VAL B 1 298 ? -6.726  -25.005 -41.405 1.00 73.17  ? 859  VAL B HG12 1 
ATOM   10203 H HG13 . VAL B 1 298 ? -6.707  -23.529 -40.816 1.00 73.17  ? 859  VAL B HG13 1 
ATOM   10204 H HG21 . VAL B 1 298 ? -9.491  -23.464 -39.837 1.00 70.01  ? 859  VAL B HG21 1 
ATOM   10205 H HG22 . VAL B 1 298 ? -8.873  -22.249 -40.652 1.00 70.01  ? 859  VAL B HG22 1 
ATOM   10206 H HG23 . VAL B 1 298 ? -10.216 -22.937 -41.149 1.00 70.01  ? 859  VAL B HG23 1 
ATOM   10207 N N    . LYS B 1 299 ? -8.464  -25.280 -44.657 1.00 59.92  ? 860  LYS B N    1 
ATOM   10208 C CA   . LYS B 1 299 ? -7.898  -26.233 -45.606 1.00 56.26  ? 860  LYS B CA   1 
ATOM   10209 C C    . LYS B 1 299 ? -7.221  -25.515 -46.766 1.00 54.20  ? 860  LYS B C    1 
ATOM   10210 O O    . LYS B 1 299 ? -6.161  -25.947 -47.236 1.00 48.58  ? 860  LYS B O    1 
ATOM   10211 C CB   . LYS B 1 299 ? -8.988  -27.174 -46.120 1.00 58.11  ? 860  LYS B CB   1 
ATOM   10212 H H    . LYS B 1 299 ? -9.324  -25.249 -44.648 1.00 71.90  ? 860  LYS B H    1 
ATOM   10213 H HA   . LYS B 1 299 ? -7.228  -26.769 -45.153 1.00 67.51  ? 860  LYS B HA   1 
ATOM   10214 N N    . GLN B 1 300 ? -7.815  -24.416 -47.239 1.00 56.58  ? 861  GLN B N    1 
ATOM   10215 C CA   . GLN B 1 300 ? -7.198  -23.635 -48.307 1.00 48.22  ? 861  GLN B CA   1 
ATOM   10216 C C    . GLN B 1 300 ? -5.889  -23.009 -47.841 1.00 44.89  ? 861  GLN B C    1 
ATOM   10217 O O    . GLN B 1 300 ? -4.932  -22.906 -48.619 1.00 42.57  ? 861  GLN B O    1 
ATOM   10218 C CB   . GLN B 1 300 ? -8.169  -22.557 -48.791 1.00 51.39  ? 861  GLN B CB   1 
ATOM   10219 C CG   . GLN B 1 300 ? -7.663  -21.712 -49.956 1.00 56.15  ? 861  GLN B CG   1 
ATOM   10220 C CD   . GLN B 1 300 ? -7.828  -22.402 -51.294 1.00 68.05  ? 861  GLN B CD   1 
ATOM   10221 O OE1  . GLN B 1 300 ? -6.876  -22.952 -51.847 1.00 75.51  ? 861  GLN B OE1  1 
ATOM   10222 N NE2  . GLN B 1 300 ? -9.045  -22.373 -51.826 1.00 67.89  ? 861  GLN B NE2  1 
ATOM   10223 H H    . GLN B 1 300 ? -8.568  -24.107 -46.961 1.00 67.90  ? 861  GLN B H    1 
ATOM   10224 H HA   . GLN B 1 300 ? -7.002  -24.221 -49.055 1.00 57.86  ? 861  GLN B HA   1 
ATOM   10225 H HB2  . GLN B 1 300 ? -8.990  -22.987 -49.077 1.00 61.67  ? 861  GLN B HB2  1 
ATOM   10226 H HB3  . GLN B 1 300 ? -8.356  -21.956 -48.054 1.00 61.67  ? 861  GLN B HB3  1 
ATOM   10227 H HG2  . GLN B 1 300 ? -8.162  -20.881 -49.984 1.00 67.38  ? 861  GLN B HG2  1 
ATOM   10228 H HG3  . GLN B 1 300 ? -6.719  -21.529 -49.827 1.00 67.38  ? 861  GLN B HG3  1 
ATOM   10229 H HE21 . GLN B 1 300 ? -9.686  -21.977 -51.411 1.00 81.47  ? 861  GLN B HE21 1 
ATOM   10230 H HE22 . GLN B 1 300 ? -9.192  -22.750 -52.584 1.00 81.47  ? 861  GLN B HE22 1 
ATOM   10231 N N    . LEU B 1 301 ? -5.827  -22.586 -46.576 1.00 45.48  ? 862  LEU B N    1 
ATOM   10232 C CA   . LEU B 1 301 ? -4.611  -21.969 -46.059 1.00 43.11  ? 862  LEU B CA   1 
ATOM   10233 C C    . LEU B 1 301 ? -3.485  -22.983 -45.897 1.00 42.38  ? 862  LEU B C    1 
ATOM   10234 O O    . LEU B 1 301 ? -2.313  -22.641 -46.089 1.00 42.70  ? 862  LEU B O    1 
ATOM   10235 C CB   . LEU B 1 301 ? -4.898  -21.285 -44.722 1.00 40.11  ? 862  LEU B CB   1 
ATOM   10236 C CG   . LEU B 1 301 ? -3.711  -20.591 -44.046 1.00 39.24  ? 862  LEU B CG   1 
ATOM   10237 C CD1  . LEU B 1 301 ? -3.137  -19.501 -44.936 1.00 36.07  ? 862  LEU B CD1  1 
ATOM   10238 C CD2  . LEU B 1 301 ? -4.127  -20.016 -42.701 1.00 43.42  ? 862  LEU B CD2  1 
ATOM   10239 H H    . LEU B 1 301 ? -6.469  -22.645 -46.006 1.00 54.57  ? 862  LEU B H    1 
ATOM   10240 H HA   . LEU B 1 301 ? -4.313  -21.289 -46.684 1.00 51.74  ? 862  LEU B HA   1 
ATOM   10241 H HB2  . LEU B 1 301 ? -5.582  -20.613 -44.865 1.00 48.14  ? 862  LEU B HB2  1 
ATOM   10242 H HB3  . LEU B 1 301 ? -5.230  -21.955 -44.104 1.00 48.14  ? 862  LEU B HB3  1 
ATOM   10243 H HG   . LEU B 1 301 ? -3.013  -21.246 -43.888 1.00 47.09  ? 862  LEU B HG   1 
ATOM   10244 H HD11 . LEU B 1 301 ? -2.390  -19.083 -44.480 1.00 43.28  ? 862  LEU B HD11 1 
ATOM   10245 H HD12 . LEU B 1 301 ? -2.836  -19.900 -45.768 1.00 43.28  ? 862  LEU B HD12 1 
ATOM   10246 H HD13 . LEU B 1 301 ? -3.826  -18.843 -45.115 1.00 43.28  ? 862  LEU B HD13 1 
ATOM   10247 H HD21 . LEU B 1 301 ? -3.361  -19.583 -42.293 1.00 52.11  ? 862  LEU B HD21 1 
ATOM   10248 H HD22 . LEU B 1 301 ? -4.838  -19.371 -42.840 1.00 52.11  ? 862  LEU B HD22 1 
ATOM   10249 H HD23 . LEU B 1 301 ? -4.441  -20.737 -42.133 1.00 52.11  ? 862  LEU B HD23 1 
ATOM   10250 N N    . GLU B 1 302 ? -3.812  -24.224 -45.540 1.00 43.50  ? 863  GLU B N    1 
ATOM   10251 C CA   . GLU B 1 302 ? -2.809  -25.261 -45.331 1.00 44.96  ? 863  GLU B CA   1 
ATOM   10252 C C    . GLU B 1 302 ? -2.468  -26.039 -46.595 1.00 44.02  ? 863  GLU B C    1 
ATOM   10253 O O    . GLU B 1 302 ? -1.507  -26.816 -46.577 1.00 56.07  ? 863  GLU B O    1 
ATOM   10254 C CB   . GLU B 1 302 ? -3.287  -26.248 -44.261 1.00 44.23  ? 863  GLU B CB   1 
ATOM   10255 C CG   . GLU B 1 302 ? -3.444  -25.647 -42.875 1.00 37.83  ? 863  GLU B CG   1 
ATOM   10256 C CD   . GLU B 1 302 ? -2.123  -25.237 -42.246 1.00 39.68  ? 863  GLU B CD   1 
ATOM   10257 O OE1  . GLU B 1 302 ? -1.058  -25.551 -42.818 1.00 34.22  ? 863  GLU B OE1  1 
ATOM   10258 O OE2  . GLU B 1 302 ? -2.153  -24.600 -41.172 1.00 36.36  ? 863  GLU B OE2  1 
ATOM   10259 H H    . GLU B 1 302 ? -4.620  -24.492 -45.413 1.00 52.20  ? 863  GLU B H    1 
ATOM   10260 H HA   . GLU B 1 302 ? -1.993  -24.846 -45.009 1.00 53.96  ? 863  GLU B HA   1 
ATOM   10261 H HB2  . GLU B 1 302 ? -4.150  -26.600 -44.528 1.00 53.07  ? 863  GLU B HB2  1 
ATOM   10262 H HB3  . GLU B 1 302 ? -2.644  -26.971 -44.197 1.00 53.07  ? 863  GLU B HB3  1 
ATOM   10263 H HG2  . GLU B 1 302 ? -4.003  -24.856 -42.936 1.00 45.40  ? 863  GLU B HG2  1 
ATOM   10264 H HG3  . GLU B 1 302 ? -3.861  -26.302 -42.294 1.00 45.40  ? 863  GLU B HG3  1 
ATOM   10265 N N    . ARG B 1 303 ? -3.222  -25.848 -47.678 1.00 45.84  ? 864  ARG B N    1 
ATOM   10266 C CA   . ARG B 1 303 ? -3.107  -26.677 -48.874 1.00 52.99  ? 864  ARG B CA   1 
ATOM   10267 C C    . ARG B 1 303 ? -1.660  -26.826 -49.336 1.00 54.51  ? 864  ARG B C    1 
ATOM   10268 O O    . ARG B 1 303 ? -1.108  -27.931 -49.305 1.00 80.48  ? 864  ARG B O    1 
ATOM   10269 C CB   . ARG B 1 303 ? -3.975  -26.093 -49.991 1.00 56.02  ? 864  ARG B CB   1 
ATOM   10270 C CG   . ARG B 1 303 ? -4.205  -27.038 -51.158 1.00 57.95  ? 864  ARG B CG   1 
ATOM   10271 C CD   . ARG B 1 303 ? -5.495  -26.717 -51.908 1.00 73.88  ? 864  ARG B CD   1 
ATOM   10272 N NE   . ARG B 1 303 ? -6.603  -27.575 -51.486 1.00 79.28  ? 864  ARG B NE   1 
ATOM   10273 C CZ   . ARG B 1 303 ? -7.727  -27.162 -50.901 1.00 75.05  ? 864  ARG B CZ   1 
ATOM   10274 N NH1  . ARG B 1 303 ? -7.941  -25.879 -50.652 1.00 68.48  ? 864  ARG B NH1  1 
ATOM   10275 N NH2  . ARG B 1 303 ? -8.656  -28.048 -50.568 1.00 77.20  ? 864  ARG B NH2  1 
ATOM   10276 H H    . ARG B 1 303 ? -3.818  -25.231 -47.744 1.00 55.01  ? 864  ARG B H    1 
ATOM   10277 H HA   . ARG B 1 303 ? -3.444  -27.564 -48.671 1.00 63.59  ? 864  ARG B HA   1 
ATOM   10278 H HB2  . ARG B 1 303 ? -4.843  -25.862 -49.622 1.00 67.22  ? 864  ARG B HB2  1 
ATOM   10279 H HB3  . ARG B 1 303 ? -3.544  -25.296 -50.336 1.00 67.22  ? 864  ARG B HB3  1 
ATOM   10280 H HG2  . ARG B 1 303 ? -3.465  -26.959 -51.781 1.00 69.54  ? 864  ARG B HG2  1 
ATOM   10281 H HG3  . ARG B 1 303 ? -4.266  -27.947 -50.825 1.00 69.54  ? 864  ARG B HG3  1 
ATOM   10282 H HD2  . ARG B 1 303 ? -5.743  -25.796 -51.736 1.00 88.65  ? 864  ARG B HD2  1 
ATOM   10283 H HD3  . ARG B 1 303 ? -5.352  -26.853 -52.858 1.00 88.65  ? 864  ARG B HD3  1 
ATOM   10284 H HE   . ARG B 1 303 ? -6.522  -28.420 -51.627 1.00 95.14  ? 864  ARG B HE   1 
ATOM   10285 H HH11 . ARG B 1 303 ? -7.347  -25.294 -50.864 1.00 82.17  ? 864  ARG B HH11 1 
ATOM   10286 H HH12 . ARG B 1 303 ? -8.673  -25.630 -50.275 1.00 82.17  ? 864  ARG B HH12 1 
ATOM   10287 H HH21 . ARG B 1 303 ? -8.529  -28.884 -50.726 1.00 92.63  ? 864  ARG B HH21 1 
ATOM   10288 H HH22 . ARG B 1 303 ? -9.384  -27.787 -50.192 1.00 92.63  ? 864  ARG B HH22 1 
ATOM   10289 N N    . GLY B 1 304 ? -1.038  -25.729 -49.760 1.00 49.94  ? 865  GLY B N    1 
ATOM   10290 C CA   . GLY B 1 304 ? 0.357   -25.744 -50.163 1.00 47.18  ? 865  GLY B CA   1 
ATOM   10291 C C    . GLY B 1 304 ? 1.282   -25.290 -49.052 1.00 50.70  ? 865  GLY B C    1 
ATOM   10292 O O    . GLY B 1 304 ? 2.408   -24.852 -49.308 1.00 45.86  ? 865  GLY B O    1 
ATOM   10293 H H    . GLY B 1 304 ? -1.410  -24.956 -49.822 1.00 59.93  ? 865  GLY B H    1 
ATOM   10294 H HA2  . GLY B 1 304 ? 0.608   -26.644 -50.424 1.00 56.62  ? 865  GLY B HA2  1 
ATOM   10295 H HA3  . GLY B 1 304 ? 0.479   -25.157 -50.925 1.00 56.62  ? 865  GLY B HA3  1 
ATOM   10296 N N    . GLY B 1 305 ? 0.813   -25.397 -47.807 1.00 53.33  ? 866  GLY B N    1 
ATOM   10297 C CA   . GLY B 1 305 ? 1.494   -24.776 -46.683 1.00 47.68  ? 866  GLY B CA   1 
ATOM   10298 C C    . GLY B 1 305 ? 2.809   -25.420 -46.294 1.00 46.49  ? 866  GLY B C    1 
ATOM   10299 O O    . GLY B 1 305 ? 3.632   -24.766 -45.643 1.00 49.67  ? 866  GLY B O    1 
ATOM   10300 H H    . GLY B 1 305 ? 0.100   -25.827 -47.592 1.00 64.00  ? 866  GLY B H    1 
ATOM   10301 H HA2  . GLY B 1 305 ? 1.668   -23.846 -46.897 1.00 57.21  ? 866  GLY B HA2  1 
ATOM   10302 H HA3  . GLY B 1 305 ? 0.909   -24.801 -45.909 1.00 57.21  ? 866  GLY B HA3  1 
ATOM   10303 N N    . ARG B 1 306 ? 3.027   -26.683 -46.669 1.00 46.11  ? 867  ARG B N    1 
ATOM   10304 C CA   . ARG B 1 306 ? 4.245   -27.381 -46.263 1.00 47.83  ? 867  ARG B CA   1 
ATOM   10305 C C    . ARG B 1 306 ? 5.492   -26.664 -46.773 1.00 44.48  ? 867  ARG B C    1 
ATOM   10306 O O    . ARG B 1 306 ? 6.449   -26.445 -46.021 1.00 48.51  ? 867  ARG B O    1 
ATOM   10307 C CB   . ARG B 1 306 ? 4.210   -28.825 -46.766 1.00 44.29  ? 867  ARG B CB   1 
ATOM   10308 H H    . ARG B 1 306 ? 2.492   -27.152 -47.152 1.00 55.33  ? 867  ARG B H    1 
ATOM   10309 H HA   . ARG B 1 306 ? 4.288   -27.403 -45.294 1.00 57.40  ? 867  ARG B HA   1 
ATOM   10310 N N    . ALA B 1 307 ? 5.497   -26.289 -48.054 1.00 48.07  ? 868  ALA B N    1 
ATOM   10311 C CA   . ALA B 1 307 ? 6.661   -25.621 -48.630 1.00 48.05  ? 868  ALA B CA   1 
ATOM   10312 C C    . ALA B 1 307 ? 6.815   -24.202 -48.092 1.00 48.84  ? 868  ALA B C    1 
ATOM   10313 O O    . ALA B 1 307 ? 7.940   -23.722 -47.909 1.00 44.63  ? 868  ALA B O    1 
ATOM   10314 C CB   . ALA B 1 307 ? 6.552   -25.606 -50.153 1.00 39.02  ? 868  ALA B CB   1 
ATOM   10315 H H    . ALA B 1 307 ? 4.846   -26.409 -48.603 1.00 57.69  ? 868  ALA B H    1 
ATOM   10316 H HA   . ALA B 1 307 ? 7.459   -26.119 -48.392 1.00 57.66  ? 868  ALA B HA   1 
ATOM   10317 H HB1  . ALA B 1 307 ? 7.331   -25.160 -50.521 1.00 46.83  ? 868  ALA B HB1  1 
ATOM   10318 H HB2  . ALA B 1 307 ? 6.512   -26.521 -50.475 1.00 46.83  ? 868  ALA B HB2  1 
ATOM   10319 H HB3  . ALA B 1 307 ? 5.747   -25.129 -50.407 1.00 46.83  ? 868  ALA B HB3  1 
ATOM   10320 N N    . VAL B 1 308 ? 5.699   -23.512 -47.848 1.00 50.80  ? 869  VAL B N    1 
ATOM   10321 C CA   . VAL B 1 308 ? 5.760   -22.175 -47.260 1.00 49.07  ? 869  VAL B CA   1 
ATOM   10322 C C    . VAL B 1 308 ? 6.449   -22.227 -45.904 1.00 50.50  ? 869  VAL B C    1 
ATOM   10323 O O    . VAL B 1 308 ? 7.258   -21.355 -45.563 1.00 50.39  ? 869  VAL B O    1 
ATOM   10324 C CB   . VAL B 1 308 ? 4.342   -21.582 -47.148 1.00 44.26  ? 869  VAL B CB   1 
ATOM   10325 C CG1  . VAL B 1 308 ? 4.348   -20.293 -46.329 1.00 47.21  ? 869  VAL B CG1  1 
ATOM   10326 C CG2  . VAL B 1 308 ? 3.761   -21.333 -48.528 1.00 44.78  ? 869  VAL B CG2  1 
ATOM   10327 H H    . VAL B 1 308 ? 4.903   -23.792 -48.012 1.00 60.96  ? 869  VAL B H    1 
ATOM   10328 H HA   . VAL B 1 308 ? 6.282   -21.598 -47.840 1.00 58.89  ? 869  VAL B HA   1 
ATOM   10329 H HB   . VAL B 1 308 ? 3.770   -22.220 -46.694 1.00 53.11  ? 869  VAL B HB   1 
ATOM   10330 H HG11 . VAL B 1 308 ? 3.443   -19.948 -46.278 1.00 56.66  ? 869  VAL B HG11 1 
ATOM   10331 H HG12 . VAL B 1 308 ? 4.679   -20.487 -45.438 1.00 56.66  ? 869  VAL B HG12 1 
ATOM   10332 H HG13 . VAL B 1 308 ? 4.926   -19.646 -46.763 1.00 56.66  ? 869  VAL B HG13 1 
ATOM   10333 H HG21 . VAL B 1 308 ? 2.871   -20.961 -48.433 1.00 53.74  ? 869  VAL B HG21 1 
ATOM   10334 H HG22 . VAL B 1 308 ? 4.332   -20.709 -49.003 1.00 53.74  ? 869  VAL B HG22 1 
ATOM   10335 H HG23 . VAL B 1 308 ? 3.719   -22.175 -49.009 1.00 53.74  ? 869  VAL B HG23 1 
ATOM   10336 N N    . VAL B 1 309 ? 6.140   -23.256 -45.112 1.00 46.39  ? 870  VAL B N    1 
ATOM   10337 C CA   . VAL B 1 309 ? 6.651   -23.372 -43.747 1.00 51.30  ? 870  VAL B CA   1 
ATOM   10338 C C    . VAL B 1 309 ? 8.044   -23.980 -43.688 1.00 53.89  ? 870  VAL B C    1 
ATOM   10339 O O    . VAL B 1 309 ? 8.674   -23.956 -42.622 1.00 52.90  ? 870  VAL B O    1 
ATOM   10340 C CB   . VAL B 1 309 ? 5.601   -24.174 -42.947 1.00 46.41  ? 870  VAL B CB   1 
ATOM   10341 C CG1  . VAL B 1 309 ? 6.223   -25.085 -41.898 1.00 42.20  ? 870  VAL B CG1  1 
ATOM   10342 C CG2  . VAL B 1 309 ? 4.589   -23.227 -42.306 1.00 44.89  ? 870  VAL B CG2  1 
ATOM   10343 H H    . VAL B 1 309 ? 5.629   -23.907 -45.346 1.00 55.66  ? 870  VAL B H    1 
ATOM   10344 H HA   . VAL B 1 309 ? 6.702   -22.485 -43.358 1.00 61.56  ? 870  VAL B HA   1 
ATOM   10345 H HB   . VAL B 1 309 ? 5.114   -24.740 -43.567 1.00 55.70  ? 870  VAL B HB   1 
ATOM   10346 H HG11 . VAL B 1 309 ? 5.515   -25.558 -41.433 1.00 50.64  ? 870  VAL B HG11 1 
ATOM   10347 H HG12 . VAL B 1 309 ? 6.811   -25.718 -42.338 1.00 50.64  ? 870  VAL B HG12 1 
ATOM   10348 H HG13 . VAL B 1 309 ? 6.728   -24.544 -41.271 1.00 50.64  ? 870  VAL B HG13 1 
ATOM   10349 H HG21 . VAL B 1 309 ? 3.939   -23.748 -41.809 1.00 53.87  ? 870  VAL B HG21 1 
ATOM   10350 H HG22 . VAL B 1 309 ? 5.056   -22.623 -41.708 1.00 53.87  ? 870  VAL B HG22 1 
ATOM   10351 H HG23 . VAL B 1 309 ? 4.144   -22.722 -43.005 1.00 53.87  ? 870  VAL B HG23 1 
ATOM   10352 N N    . LYS B 1 310 ? 8.560   -24.484 -44.813 1.00 58.48  ? 871  LYS B N    1 
ATOM   10353 C CA   . LYS B 1 310 ? 9.827   -25.217 -44.865 1.00 59.59  ? 871  LYS B CA   1 
ATOM   10354 C C    . LYS B 1 310 ? 9.746   -26.534 -44.094 1.00 56.50  ? 871  LYS B C    1 
ATOM   10355 O O    . LYS B 1 310 ? 10.747  -27.015 -43.558 1.00 57.22  ? 871  LYS B O    1 
ATOM   10356 C CB   . LYS B 1 310 ? 10.995  -24.357 -44.362 1.00 58.97  ? 871  LYS B CB   1 
ATOM   10357 C CG   . LYS B 1 310 ? 11.151  -23.043 -45.117 1.00 57.99  ? 871  LYS B CG   1 
ATOM   10358 C CD   . LYS B 1 310 ? 12.316  -22.217 -44.598 1.00 58.47  ? 871  LYS B CD   1 
ATOM   10359 C CE   . LYS B 1 310 ? 12.494  -20.947 -45.419 1.00 60.72  ? 871  LYS B CE   1 
ATOM   10360 N NZ   . LYS B 1 310 ? 13.562  -20.059 -44.883 1.00 55.44  ? 871  LYS B NZ   1 
ATOM   10361 H H    . LYS B 1 310 ? 8.181   -24.410 -45.582 1.00 70.18  ? 871  LYS B H    1 
ATOM   10362 H HA   . LYS B 1 310 ? 10.011  -25.437 -45.792 1.00 71.51  ? 871  LYS B HA   1 
ATOM   10363 H HB2  . LYS B 1 310 ? 10.850  -24.148 -43.426 1.00 70.76  ? 871  LYS B HB2  1 
ATOM   10364 H HB3  . LYS B 1 310 ? 11.820  -24.858 -44.463 1.00 70.76  ? 871  LYS B HB3  1 
ATOM   10365 H HG2  . LYS B 1 310 ? 11.309  -23.232 -46.055 1.00 69.59  ? 871  LYS B HG2  1 
ATOM   10366 H HG3  . LYS B 1 310 ? 10.341  -22.520 -45.014 1.00 69.59  ? 871  LYS B HG3  1 
ATOM   10367 H HD2  . LYS B 1 310 ? 12.147  -21.964 -43.677 1.00 70.16  ? 871  LYS B HD2  1 
ATOM   10368 H HD3  . LYS B 1 310 ? 13.133  -22.737 -44.660 1.00 70.16  ? 871  LYS B HD3  1 
ATOM   10369 H HE2  . LYS B 1 310 ? 12.732  -21.189 -46.327 1.00 72.87  ? 871  LYS B HE2  1 
ATOM   10370 H HE3  . LYS B 1 310 ? 11.661  -20.450 -45.416 1.00 72.87  ? 871  LYS B HE3  1 
ATOM   10371 H HZ1  . LYS B 1 310 ? 13.634  -19.331 -45.389 1.00 66.53  ? 871  LYS B HZ1  1 
ATOM   10372 H HZ2  . LYS B 1 310 ? 13.365  -19.815 -44.050 1.00 66.53  ? 871  LYS B HZ2  1 
ATOM   10373 H HZ3  . LYS B 1 310 ? 14.342  -20.489 -44.881 1.00 66.53  ? 871  LYS B HZ3  1 
ATOM   10374 N N    . MET B 1 311 ? 8.534   -27.087 -44.020 1.00 57.83  ? 872  MET B N    1 
ATOM   10375 C CA   . MET B 1 311 ? 8.213   -28.416 -43.502 1.00 55.37  ? 872  MET B CA   1 
ATOM   10376 C C    . MET B 1 311 ? 8.295   -28.502 -41.983 1.00 54.22  ? 872  MET B C    1 
ATOM   10377 O O    . MET B 1 311 ? 7.632   -29.348 -41.373 1.00 53.91  ? 872  MET B O    1 
ATOM   10378 C CB   . MET B 1 311 ? 9.140   -29.474 -44.113 1.00 55.22  ? 872  MET B CB   1 
ATOM   10379 C CG   . MET B 1 311 ? 9.004   -29.643 -45.616 1.00 58.02  ? 872  MET B CG   1 
ATOM   10380 S SD   . MET B 1 311 ? 7.381   -30.250 -46.115 1.00 62.95  ? 872  MET B SD   1 
ATOM   10381 C CE   . MET B 1 311 ? 7.387   -31.898 -45.408 1.00 56.70  ? 872  MET B CE   1 
ATOM   10382 H H    . MET B 1 311 ? 7.829   -26.672 -44.286 1.00 69.40  ? 872  MET B H    1 
ATOM   10383 H HA   . MET B 1 311 ? 7.307   -28.636 -43.771 1.00 66.44  ? 872  MET B HA   1 
ATOM   10384 H HB2  . MET B 1 311 ? 10.059  -29.224 -43.928 1.00 66.26  ? 872  MET B HB2  1 
ATOM   10385 H HB3  . MET B 1 311 ? 8.945   -30.331 -43.703 1.00 66.26  ? 872  MET B HB3  1 
ATOM   10386 H HG2  . MET B 1 311 ? 9.147   -28.785 -46.044 1.00 69.62  ? 872  MET B HG2  1 
ATOM   10387 H HG3  . MET B 1 311 ? 9.668   -30.280 -45.923 1.00 69.62  ? 872  MET B HG3  1 
ATOM   10388 H HE1  . MET B 1 311 ? 6.545   -32.333 -45.615 1.00 68.04  ? 872  MET B HE1  1 
ATOM   10389 H HE2  . MET B 1 311 ? 8.123   -32.402 -45.788 1.00 68.04  ? 872  MET B HE2  1 
ATOM   10390 H HE3  . MET B 1 311 ? 7.496   -31.828 -44.446 1.00 68.04  ? 872  MET B HE3  1 
ATOM   10391 N N    . ASP B 1 312 ? 9.089   -27.637 -41.360 1.00 49.92  ? 873  ASP B N    1 
ATOM   10392 C CA   . ASP B 1 312 ? 8.972   -27.361 -39.934 1.00 47.77  ? 873  ASP B CA   1 
ATOM   10393 C C    . ASP B 1 312 ? 9.386   -25.914 -39.729 1.00 45.59  ? 873  ASP B C    1 
ATOM   10394 O O    . ASP B 1 312 ? 10.515  -25.558 -40.079 1.00 53.20  ? 873  ASP B O    1 
ATOM   10395 C CB   . ASP B 1 312 ? 9.848   -28.312 -39.116 1.00 51.64  ? 873  ASP B CB   1 
ATOM   10396 C CG   . ASP B 1 312 ? 9.382   -28.446 -37.682 1.00 50.74  ? 873  ASP B CG   1 
ATOM   10397 O OD1  . ASP B 1 312 ? 8.965   -27.427 -37.092 1.00 47.05  ? 873  ASP B OD1  1 
ATOM   10398 O OD2  . ASP B 1 312 ? 9.428   -29.574 -37.148 1.00 56.21  ? 873  ASP B OD2  1 
ATOM   10399 H H    . ASP B 1 312 ? 9.714   -27.191 -41.749 1.00 59.91  ? 873  ASP B H    1 
ATOM   10400 H HA   . ASP B 1 312 ? 8.049   -27.466 -39.653 1.00 57.33  ? 873  ASP B HA   1 
ATOM   10401 H HB2  . ASP B 1 312 ? 9.825   -29.192 -39.523 1.00 61.96  ? 873  ASP B HB2  1 
ATOM   10402 H HB3  . ASP B 1 312 ? 10.757  -27.974 -39.106 1.00 61.96  ? 873  ASP B HB3  1 
ATOM   10403 N N    . TRP B 1 313 ? 8.517   -25.087 -39.145 1.00 42.03  ? 874  TRP B N    1 
ATOM   10404 C CA   . TRP B 1 313 ? 8.891   -23.695 -38.918 1.00 47.29  ? 874  TRP B CA   1 
ATOM   10405 C C    . TRP B 1 313 ? 9.491   -23.456 -37.541 1.00 49.13  ? 874  TRP B C    1 
ATOM   10406 O O    . TRP B 1 313 ? 10.005  -22.361 -37.292 1.00 48.45  ? 874  TRP B O    1 
ATOM   10407 C CB   . TRP B 1 313 ? 7.695   -22.753 -39.129 1.00 42.30  ? 874  TRP B CB   1 
ATOM   10408 C CG   . TRP B 1 313 ? 6.497   -22.976 -38.259 1.00 37.49  ? 874  TRP B CG   1 
ATOM   10409 C CD1  . TRP B 1 313 ? 5.318   -23.555 -38.626 1.00 33.81  ? 874  TRP B CD1  1 
ATOM   10410 C CD2  . TRP B 1 313 ? 6.343   -22.586 -36.889 1.00 37.88  ? 874  TRP B CD2  1 
ATOM   10411 N NE1  . TRP B 1 313 ? 4.444   -23.563 -37.567 1.00 36.37  ? 874  TRP B NE1  1 
ATOM   10412 C CE2  . TRP B 1 313 ? 5.050   -22.975 -36.488 1.00 39.39  ? 874  TRP B CE2  1 
ATOM   10413 C CE3  . TRP B 1 313 ? 7.175   -21.952 -35.960 1.00 41.84  ? 874  TRP B CE3  1 
ATOM   10414 C CZ2  . TRP B 1 313 ? 4.570   -22.754 -35.199 1.00 42.37  ? 874  TRP B CZ2  1 
ATOM   10415 C CZ3  . TRP B 1 313 ? 6.697   -21.735 -34.680 1.00 44.76  ? 874  TRP B CZ3  1 
ATOM   10416 C CH2  . TRP B 1 313 ? 5.406   -22.135 -34.312 1.00 41.22  ? 874  TRP B CH2  1 
ATOM   10417 H H    . TRP B 1 313 ? 7.728   -25.301 -38.878 1.00 50.43  ? 874  TRP B H    1 
ATOM   10418 H HA   . TRP B 1 313 ? 9.566   -23.453 -39.571 1.00 56.75  ? 874  TRP B HA   1 
ATOM   10419 H HB2  . TRP B 1 313 ? 7.996   -21.844 -38.974 1.00 50.76  ? 874  TRP B HB2  1 
ATOM   10420 H HB3  . TRP B 1 313 ? 7.401   -22.840 -40.049 1.00 50.76  ? 874  TRP B HB3  1 
ATOM   10421 H HD1  . TRP B 1 313 ? 5.134   -23.897 -39.471 1.00 40.57  ? 874  TRP B HD1  1 
ATOM   10422 H HE1  . TRP B 1 313 ? 3.648   -23.888 -37.578 1.00 43.64  ? 874  TRP B HE1  1 
ATOM   10423 H HE3  . TRP B 1 313 ? 8.034   -21.685 -36.197 1.00 50.21  ? 874  TRP B HE3  1 
ATOM   10424 H HZ2  . TRP B 1 313 ? 3.714   -23.019 -34.951 1.00 50.84  ? 874  TRP B HZ2  1 
ATOM   10425 H HZ3  . TRP B 1 313 ? 7.242   -21.315 -34.054 1.00 53.71  ? 874  TRP B HZ3  1 
ATOM   10426 H HH2  . TRP B 1 313 ? 5.111   -21.976 -33.445 1.00 49.46  ? 874  TRP B HH2  1 
ATOM   10427 N N    . ARG B 1 314 ? 9.454   -24.449 -36.650 1.00 55.83  ? 875  ARG B N    1 
ATOM   10428 C CA   . ARG B 1 314 ? 10.099  -24.301 -35.352 1.00 51.95  ? 875  ARG B CA   1 
ATOM   10429 C C    . ARG B 1 314 ? 11.613  -24.418 -35.461 1.00 58.13  ? 875  ARG B C    1 
ATOM   10430 O O    . ARG B 1 314 ? 12.335  -23.799 -34.673 1.00 57.06  ? 875  ARG B O    1 
ATOM   10431 C CB   . ARG B 1 314 ? 9.561   -25.343 -34.372 1.00 56.62  ? 875  ARG B CB   1 
ATOM   10432 C CG   . ARG B 1 314 ? 8.044   -25.378 -34.272 1.00 54.47  ? 875  ARG B CG   1 
ATOM   10433 C CD   . ARG B 1 314 ? 7.595   -26.217 -33.085 1.00 59.13  ? 875  ARG B CD   1 
ATOM   10434 N NE   . ARG B 1 314 ? 8.295   -27.499 -33.030 1.00 69.96  ? 875  ARG B NE   1 
ATOM   10435 C CZ   . ARG B 1 314 ? 7.853   -28.634 -33.565 1.00 64.95  ? 875  ARG B CZ   1 
ATOM   10436 N NH1  . ARG B 1 314 ? 6.694   -28.675 -34.206 1.00 59.91  ? 875  ARG B NH1  1 
ATOM   10437 N NH2  . ARG B 1 314 ? 8.576   -29.741 -33.455 1.00 69.45  ? 875  ARG B NH2  1 
ATOM   10438 H H    . ARG B 1 314 ? 9.066   -25.206 -36.773 1.00 66.99  ? 875  ARG B H    1 
ATOM   10439 H HA   . ARG B 1 314 ? 9.893   -23.422 -34.997 1.00 62.34  ? 875  ARG B HA   1 
ATOM   10440 H HB2  . ARG B 1 314 ? 9.859   -26.221 -34.657 1.00 67.95  ? 875  ARG B HB2  1 
ATOM   10441 H HB3  . ARG B 1 314 ? 9.911   -25.148 -33.488 1.00 67.95  ? 875  ARG B HB3  1 
ATOM   10442 H HG2  . ARG B 1 314 ? 7.708   -24.475 -34.153 1.00 65.37  ? 875  ARG B HG2  1 
ATOM   10443 H HG3  . ARG B 1 314 ? 7.677   -25.770 -35.080 1.00 65.37  ? 875  ARG B HG3  1 
ATOM   10444 H HD2  . ARG B 1 314 ? 7.782   -25.734 -32.265 1.00 70.96  ? 875  ARG B HD2  1 
ATOM   10445 H HD3  . ARG B 1 314 ? 6.644   -26.394 -33.161 1.00 70.96  ? 875  ARG B HD3  1 
ATOM   10446 H HE   . ARG B 1 314 ? 9.050   -27.522 -32.619 1.00 83.96  ? 875  ARG B HE   1 
ATOM   10447 H HH11 . ARG B 1 314 ? 6.220   -27.961 -34.282 1.00 71.90  ? 875  ARG B HH11 1 
ATOM   10448 H HH12 . ARG B 1 314 ? 6.417   -29.414 -34.548 1.00 71.90  ? 875  ARG B HH12 1 
ATOM   10449 H HH21 . ARG B 1 314 ? 9.328   -29.723 -33.039 1.00 83.33  ? 875  ARG B HH21 1 
ATOM   10450 H HH22 . ARG B 1 314 ? 8.292   -30.476 -33.798 1.00 83.33  ? 875  ARG B HH22 1 
ATOM   10451 N N    . GLU B 1 315 ? 12.110  -25.194 -36.426 1.00 61.17  ? 876  GLU B N    1 
ATOM   10452 C CA   . GLU B 1 315 ? 13.546  -25.346 -36.625 1.00 70.43  ? 876  GLU B CA   1 
ATOM   10453 C C    . GLU B 1 315 ? 14.158  -24.210 -37.434 1.00 65.99  ? 876  GLU B C    1 
ATOM   10454 O O    . GLU B 1 315 ? 15.387  -24.077 -37.449 1.00 69.00  ? 876  GLU B O    1 
ATOM   10455 C CB   . GLU B 1 315 ? 13.839  -26.681 -37.316 1.00 71.97  ? 876  GLU B CB   1 
ATOM   10456 C CG   . GLU B 1 315 ? 13.441  -27.906 -36.502 1.00 75.46  ? 876  GLU B CG   1 
ATOM   10457 C CD   . GLU B 1 315 ? 14.188  -28.006 -35.185 1.00 88.58  ? 876  GLU B CD   1 
ATOM   10458 O OE1  . GLU B 1 315 ? 15.377  -27.621 -35.141 1.00 101.71 ? 876  GLU B OE1  1 
ATOM   10459 O OE2  . GLU B 1 315 ? 13.587  -28.464 -34.191 1.00 85.24  ? 876  GLU B OE2  1 
ATOM   10460 H H    . GLU B 1 315 ? 11.631  -25.645 -36.981 1.00 73.41  ? 876  GLU B H    1 
ATOM   10461 H HA   . GLU B 1 315 ? 13.981  -25.359 -35.758 1.00 84.51  ? 876  GLU B HA   1 
ATOM   10462 H HB2  . GLU B 1 315 ? 13.351  -26.711 -38.154 1.00 86.37  ? 876  GLU B HB2  1 
ATOM   10463 H HB3  . GLU B 1 315 ? 14.792  -26.739 -37.490 1.00 86.37  ? 876  GLU B HB3  1 
ATOM   10464 H HG2  . GLU B 1 315 ? 12.492  -27.860 -36.306 1.00 90.55  ? 876  GLU B HG2  1 
ATOM   10465 H HG3  . GLU B 1 315 ? 13.635  -28.705 -37.018 1.00 90.55  ? 876  GLU B HG3  1 
ATOM   10466 N N    . ASN B 1 316 ? 13.341  -23.397 -38.103 1.00 63.18  ? 877  ASN B N    1 
ATOM   10467 C CA   . ASN B 1 316 ? 13.825  -22.302 -38.933 1.00 60.68  ? 877  ASN B CA   1 
ATOM   10468 C C    . ASN B 1 316 ? 13.812  -20.953 -38.224 1.00 60.63  ? 877  ASN B C    1 
ATOM   10469 O O    . ASN B 1 316 ? 14.189  -19.948 -38.835 1.00 61.07  ? 877  ASN B O    1 
ATOM   10470 C CB   . ASN B 1 316 ? 12.996  -22.217 -40.217 1.00 56.25  ? 877  ASN B CB   1 
ATOM   10471 C CG   . ASN B 1 316 ? 13.287  -23.357 -41.171 1.00 53.63  ? 877  ASN B CG   1 
ATOM   10472 O OD1  . ASN B 1 316 ? 12.400  -24.137 -41.512 1.00 61.38  ? 877  ASN B OD1  1 
ATOM   10473 N ND2  . ASN B 1 316 ? 14.537  -23.461 -41.606 1.00 52.14  ? 877  ASN B ND2  1 
ATOM   10474 H H    . ASN B 1 316 ? 12.484  -23.464 -38.090 1.00 75.82  ? 877  ASN B H    1 
ATOM   10475 H HA   . ASN B 1 316 ? 14.742  -22.490 -39.187 1.00 72.82  ? 877  ASN B HA   1 
ATOM   10476 H HB2  . ASN B 1 316 ? 12.054  -22.248 -39.990 1.00 67.50  ? 877  ASN B HB2  1 
ATOM   10477 H HB3  . ASN B 1 316 ? 13.202  -21.385 -40.672 1.00 67.50  ? 877  ASN B HB3  1 
ATOM   10478 H HD21 . ASN B 1 316 ? 14.752  -24.092 -42.149 1.00 62.57  ? 877  ASN B HD21 1 
ATOM   10479 H HD22 . ASN B 1 316 ? 15.131  -22.897 -41.345 1.00 62.57  ? 877  ASN B HD22 1 
ATOM   10480 N N    . ILE B 1 317 ? 13.393  -20.903 -36.960 1.00 58.79  ? 878  ILE B N    1 
ATOM   10481 C CA   . ILE B 1 317 ? 13.369  -19.653 -36.204 1.00 61.56  ? 878  ILE B CA   1 
ATOM   10482 C C    . ILE B 1 317 ? 14.562  -19.622 -35.258 1.00 61.40  ? 878  ILE B C    1 
ATOM   10483 O O    . ILE B 1 317 ? 15.376  -20.552 -35.232 1.00 59.55  ? 878  ILE B O    1 
ATOM   10484 C CB   . ILE B 1 317 ? 12.046  -19.483 -35.433 1.00 61.20  ? 878  ILE B CB   1 
ATOM   10485 C CG1  . ILE B 1 317 ? 11.778  -20.696 -34.541 1.00 63.14  ? 878  ILE B CG1  1 
ATOM   10486 C CG2  . ILE B 1 317 ? 10.899  -19.271 -36.408 1.00 58.10  ? 878  ILE B CG2  1 
ATOM   10487 C CD1  . ILE B 1 317 ? 10.682  -20.477 -33.520 1.00 58.02  ? 878  ILE B CD1  1 
ATOM   10488 H H    . ILE B 1 317 ? 13.116  -21.584 -36.514 1.00 70.54  ? 878  ILE B H    1 
ATOM   10489 H HA   . ILE B 1 317 ? 13.456  -18.909 -36.820 1.00 73.87  ? 878  ILE B HA   1 
ATOM   10490 H HB   . ILE B 1 317 ? 12.118  -18.697 -34.869 1.00 73.44  ? 878  ILE B HB   1 
ATOM   10491 H HG12 . ILE B 1 317 ? 11.516  -21.444 -35.101 1.00 75.77  ? 878  ILE B HG12 1 
ATOM   10492 H HG13 . ILE B 1 317 ? 12.592  -20.916 -34.061 1.00 75.77  ? 878  ILE B HG13 1 
ATOM   10493 H HG21 . ILE B 1 317 ? 10.075  -19.166 -35.907 1.00 69.72  ? 878  ILE B HG21 1 
ATOM   10494 H HG22 . ILE B 1 317 ? 11.073  -18.473 -36.931 1.00 69.72  ? 878  ILE B HG22 1 
ATOM   10495 H HG23 . ILE B 1 317 ? 10.835  -20.043 -36.992 1.00 69.72  ? 878  ILE B HG23 1 
ATOM   10496 H HD11 . ILE B 1 317 ? 10.573  -21.287 -32.996 1.00 69.62  ? 878  ILE B HD11 1 
ATOM   10497 H HD12 . ILE B 1 317 ? 10.933  -19.740 -32.941 1.00 69.62  ? 878  ILE B HD12 1 
ATOM   10498 H HD13 . ILE B 1 317 ? 9.856   -20.269 -33.983 1.00 69.62  ? 878  ILE B HD13 1 
ATOM   10499 N N    . THR B 1 318 ? 14.669  -18.552 -34.478 1.00 66.59  ? 879  THR B N    1 
ATOM   10500 C CA   . THR B 1 318 ? 15.792  -18.368 -33.574 1.00 69.76  ? 879  THR B CA   1 
ATOM   10501 C C    . THR B 1 318 ? 15.618  -19.223 -32.323 1.00 69.19  ? 879  THR B C    1 
ATOM   10502 O O    . THR B 1 318 ? 14.502  -19.572 -31.930 1.00 77.24  ? 879  THR B O    1 
ATOM   10503 C CB   . THR B 1 318 ? 15.931  -16.897 -33.181 1.00 65.40  ? 879  THR B CB   1 
ATOM   10504 O OG1  . THR B 1 318 ? 14.729  -16.451 -32.542 1.00 69.04  ? 879  THR B OG1  1 
ATOM   10505 C CG2  . THR B 1 318 ? 16.206  -16.038 -34.406 1.00 69.46  ? 879  THR B CG2  1 
ATOM   10506 H H    . THR B 1 318 ? 14.096  -17.912 -34.456 1.00 79.91  ? 879  THR B H    1 
ATOM   10507 H HA   . THR B 1 318 ? 16.609  -18.642 -34.019 1.00 83.71  ? 879  THR B HA   1 
ATOM   10508 H HB   . THR B 1 318 ? 16.675  -16.798 -32.567 1.00 78.48  ? 879  THR B HB   1 
ATOM   10509 H HG1  . THR B 1 318 ? 14.585  -16.906 -31.851 1.00 82.84  ? 879  THR B HG1  1 
ATOM   10510 H HG21 . THR B 1 318 ? 16.292  -15.108 -34.145 1.00 83.36  ? 879  THR B HG21 1 
ATOM   10511 H HG22 . THR B 1 318 ? 17.029  -16.323 -34.832 1.00 83.36  ? 879  THR B HG22 1 
ATOM   10512 H HG23 . THR B 1 318 ? 15.477  -16.122 -35.040 1.00 83.36  ? 879  THR B HG23 1 
ATOM   10513 N N    . VAL B 1 319 ? 16.751  -19.560 -31.697 1.00 78.31  ? 880  VAL B N    1 
ATOM   10514 C CA   . VAL B 1 319 ? 16.706  -20.400 -30.495 1.00 71.39  ? 880  VAL B CA   1 
ATOM   10515 C C    . VAL B 1 319 ? 15.965  -19.715 -29.359 1.00 69.07  ? 880  VAL B C    1 
ATOM   10516 O O    . VAL B 1 319 ? 15.186  -20.388 -28.665 1.00 66.60  ? 880  VAL B O    1 
ATOM   10517 C CB   . VAL B 1 319 ? 18.130  -20.833 -30.105 1.00 61.52  ? 880  VAL B CB   1 
ATOM   10518 H H    . VAL B 1 319 ? 17.541  -19.322 -31.942 1.00 93.97  ? 880  VAL B H    1 
ATOM   10519 H HA   . VAL B 1 319 ? 16.212  -21.207 -30.711 1.00 85.67  ? 880  VAL B HA   1 
ATOM   10520 N N    . PRO B 1 320 ? 16.151  -18.418 -29.091 1.00 67.76  ? 881  PRO B N    1 
ATOM   10521 C CA   . PRO B 1 320 ? 15.386  -17.787 -28.001 1.00 66.57  ? 881  PRO B CA   1 
ATOM   10522 C C    . PRO B 1 320 ? 13.883  -17.897 -28.183 1.00 68.30  ? 881  PRO B C    1 
ATOM   10523 O O    . PRO B 1 320 ? 13.150  -18.025 -27.195 1.00 68.44  ? 881  PRO B O    1 
ATOM   10524 C CB   . PRO B 1 320 ? 15.862  -16.326 -28.044 1.00 65.67  ? 881  PRO B CB   1 
ATOM   10525 C CG   . PRO B 1 320 ? 17.192  -16.378 -28.723 1.00 63.21  ? 881  PRO B CG   1 
ATOM   10526 C CD   . PRO B 1 320 ? 17.058  -17.460 -29.742 1.00 65.45  ? 881  PRO B CD   1 
ATOM   10527 H HA   . PRO B 1 320 ? 15.634  -18.178 -27.148 1.00 79.88  ? 881  PRO B HA   1 
ATOM   10528 H HB2  . PRO B 1 320 ? 15.235  -15.792 -28.556 1.00 78.81  ? 881  PRO B HB2  1 
ATOM   10529 H HB3  . PRO B 1 320 ? 15.951  -15.983 -27.141 1.00 78.81  ? 881  PRO B HB3  1 
ATOM   10530 H HG2  . PRO B 1 320 ? 17.377  -15.526 -29.149 1.00 75.86  ? 881  PRO B HG2  1 
ATOM   10531 H HG3  . PRO B 1 320 ? 17.882  -16.597 -28.077 1.00 75.86  ? 881  PRO B HG3  1 
ATOM   10532 H HD2  . PRO B 1 320 ? 16.658  -17.113 -30.555 1.00 78.54  ? 881  PRO B HD2  1 
ATOM   10533 H HD3  . PRO B 1 320 ? 17.919  -17.872 -29.915 1.00 78.54  ? 881  PRO B HD3  1 
ATOM   10534 N N    . LEU B 1 321 ? 13.401  -17.849 -29.427 1.00 70.36  ? 882  LEU B N    1 
ATOM   10535 C CA   . LEU B 1 321 ? 11.974  -18.011 -29.679 1.00 66.29  ? 882  LEU B CA   1 
ATOM   10536 C C    . LEU B 1 321 ? 11.550  -19.473 -29.619 1.00 63.29  ? 882  LEU B C    1 
ATOM   10537 O O    . LEU B 1 321 ? 10.419  -19.767 -29.216 1.00 66.74  ? 882  LEU B O    1 
ATOM   10538 C CB   . LEU B 1 321 ? 11.615  -17.411 -31.038 1.00 62.67  ? 882  LEU B CB   1 
ATOM   10539 C CG   . LEU B 1 321 ? 10.124  -17.215 -31.318 1.00 56.17  ? 882  LEU B CG   1 
ATOM   10540 C CD1  . LEU B 1 321 ? 9.529   -16.164 -30.392 1.00 52.98  ? 882  LEU B CD1  1 
ATOM   10541 C CD2  . LEU B 1 321 ? 9.903   -16.832 -32.773 1.00 61.66  ? 882  LEU B CD2  1 
ATOM   10542 H H    . LEU B 1 321 ? 13.876  -17.726 -30.133 1.00 84.43  ? 882  LEU B H    1 
ATOM   10543 H HA   . LEU B 1 321 ? 11.478  -17.528 -28.999 1.00 79.55  ? 882  LEU B HA   1 
ATOM   10544 H HB2  . LEU B 1 321 ? 12.038  -16.541 -31.108 1.00 75.20  ? 882  LEU B HB2  1 
ATOM   10545 H HB3  . LEU B 1 321 ? 11.964  -17.995 -31.730 1.00 75.20  ? 882  LEU B HB3  1 
ATOM   10546 H HG   . LEU B 1 321 ? 9.661   -18.052 -31.156 1.00 67.41  ? 882  LEU B HG   1 
ATOM   10547 H HD11 . LEU B 1 321 ? 8.585   -16.063 -30.594 1.00 63.57  ? 882  LEU B HD11 1 
ATOM   10548 H HD12 . LEU B 1 321 ? 9.642   -16.453 -29.473 1.00 63.57  ? 882  LEU B HD12 1 
ATOM   10549 H HD13 . LEU B 1 321 ? 9.989   -15.322 -30.533 1.00 63.57  ? 882  LEU B HD13 1 
ATOM   10550 H HD21 . LEU B 1 321 ? 8.952   -16.713 -32.927 1.00 73.99  ? 882  LEU B HD21 1 
ATOM   10551 H HD22 . LEU B 1 321 ? 10.374  -16.004 -32.956 1.00 73.99  ? 882  LEU B HD22 1 
ATOM   10552 H HD23 . LEU B 1 321 ? 10.244  -17.540 -33.341 1.00 73.99  ? 882  LEU B HD23 1 
ATOM   10553 N N    . GLN B 1 322 ? 12.432  -20.394 -30.018 1.00 65.19  ? 883  GLN B N    1 
ATOM   10554 C CA   . GLN B 1 322 ? 12.140  -21.818 -29.883 1.00 70.23  ? 883  GLN B CA   1 
ATOM   10555 C C    . GLN B 1 322 ? 11.865  -22.182 -28.431 1.00 70.06  ? 883  GLN B C    1 
ATOM   10556 O O    . GLN B 1 322 ? 10.838  -22.793 -28.112 1.00 67.35  ? 883  GLN B O    1 
ATOM   10557 C CB   . GLN B 1 322 ? 13.307  -22.646 -30.418 1.00 73.81  ? 883  GLN B CB   1 
ATOM   10558 C CG   . GLN B 1 322 ? 13.304  -22.858 -31.915 1.00 71.72  ? 883  GLN B CG   1 
ATOM   10559 C CD   . GLN B 1 322 ? 14.573  -23.533 -32.401 1.00 87.18  ? 883  GLN B CD   1 
ATOM   10560 O OE1  . GLN B 1 322 ? 15.634  -23.396 -31.792 1.00 93.07  ? 883  GLN B OE1  1 
ATOM   10561 N NE2  . GLN B 1 322 ? 14.471  -24.272 -33.498 1.00 78.51  ? 883  GLN B NE2  1 
ATOM   10562 H H    . GLN B 1 322 ? 13.199  -20.219 -30.366 1.00 78.23  ? 883  GLN B H    1 
ATOM   10563 H HA   . GLN B 1 322 ? 11.351  -22.033 -30.404 1.00 84.27  ? 883  GLN B HA   1 
ATOM   10564 H HB2  . GLN B 1 322 ? 14.135  -22.197 -30.188 1.00 88.58  ? 883  GLN B HB2  1 
ATOM   10565 H HB3  . GLN B 1 322 ? 13.283  -23.520 -29.998 1.00 88.58  ? 883  GLN B HB3  1 
ATOM   10566 H HG2  . GLN B 1 322 ? 12.552  -23.422 -32.154 1.00 86.06  ? 883  GLN B HG2  1 
ATOM   10567 H HG3  . GLN B 1 322 ? 13.230  -21.999 -32.357 1.00 86.06  ? 883  GLN B HG3  1 
ATOM   10568 H HE21 . GLN B 1 322 ? 13.712  -24.350 -33.895 1.00 94.22  ? 883  GLN B HE21 1 
ATOM   10569 H HE22 . GLN B 1 322 ? 15.163  -24.674 -33.812 1.00 94.22  ? 883  GLN B HE22 1 
ATOM   10570 N N    . THR B 1 323 ? 12.783  -21.816 -27.534 1.00 74.50  ? 884  THR B N    1 
ATOM   10571 C CA   . THR B 1 323 ? 12.617  -22.141 -26.123 1.00 67.38  ? 884  THR B CA   1 
ATOM   10572 C C    . THR B 1 323 ? 11.404  -21.440 -25.531 1.00 69.43  ? 884  THR B C    1 
ATOM   10573 O O    . THR B 1 323 ? 10.751  -21.982 -24.632 1.00 73.66  ? 884  THR B O    1 
ATOM   10574 C CB   . THR B 1 323 ? 13.878  -21.759 -25.347 1.00 65.69  ? 884  THR B CB   1 
ATOM   10575 O OG1  . THR B 1 323 ? 14.050  -20.337 -25.380 1.00 67.30  ? 884  THR B OG1  1 
ATOM   10576 C CG2  . THR B 1 323 ? 15.106  -22.437 -25.948 1.00 63.17  ? 884  THR B CG2  1 
ATOM   10577 H H    . THR B 1 323 ? 13.503  -21.383 -27.718 1.00 89.40  ? 884  THR B H    1 
ATOM   10578 H HA   . THR B 1 323 ? 12.486  -23.098 -26.032 1.00 80.86  ? 884  THR B HA   1 
ATOM   10579 H HB   . THR B 1 323 ? 13.788  -22.050 -24.427 1.00 78.83  ? 884  THR B HB   1 
ATOM   10580 H HG1  . THR B 1 323 ? 14.742  -20.121 -24.954 1.00 80.76  ? 884  THR B HG1  1 
ATOM   10581 H HG21 . THR B 1 323 ? 15.899  -22.188 -25.448 1.00 75.80  ? 884  THR B HG21 1 
ATOM   10582 H HG22 . THR B 1 323 ? 15.002  -23.401 -25.914 1.00 75.80  ? 884  THR B HG22 1 
ATOM   10583 H HG23 . THR B 1 323 ? 15.216  -22.164 -26.872 1.00 75.80  ? 884  THR B HG23 1 
ATOM   10584 N N    . ASP B 1 324 ? 11.085  -20.243 -26.022 1.00 64.66  ? 885  ASP B N    1 
ATOM   10585 C CA   . ASP B 1 324 ? 9.908   -19.525 -25.553 1.00 64.65  ? 885  ASP B CA   1 
ATOM   10586 C C    . ASP B 1 324 ? 8.619   -20.062 -26.161 1.00 63.32  ? 885  ASP B C    1 
ATOM   10587 O O    . ASP B 1 324 ? 7.538   -19.769 -25.639 1.00 60.95  ? 885  ASP B O    1 
ATOM   10588 C CB   . ASP B 1 324 ? 10.049  -18.033 -25.864 1.00 60.31  ? 885  ASP B CB   1 
ATOM   10589 C CG   . ASP B 1 324 ? 9.194   -17.168 -24.959 1.00 64.01  ? 885  ASP B CG   1 
ATOM   10590 O OD1  . ASP B 1 324 ? 9.608   -16.921 -23.807 1.00 69.10  ? 885  ASP B OD1  1 
ATOM   10591 O OD2  . ASP B 1 324 ? 8.114   -16.728 -25.400 1.00 61.94  ? 885  ASP B OD2  1 
ATOM   10592 H H    . ASP B 1 324 ? 11.535  -19.827 -26.626 1.00 77.59  ? 885  ASP B H    1 
ATOM   10593 H HA   . ASP B 1 324 ? 9.845   -19.624 -24.590 1.00 77.58  ? 885  ASP B HA   1 
ATOM   10594 H HB2  . ASP B 1 324 ? 10.975  -17.771 -25.743 1.00 72.37  ? 885  ASP B HB2  1 
ATOM   10595 H HB3  . ASP B 1 324 ? 9.774   -17.873 -26.780 1.00 72.37  ? 885  ASP B HB3  1 
ATOM   10596 N N    . LEU B 1 325 ? 8.706   -20.833 -27.245 1.00 68.27  ? 886  LEU B N    1 
ATOM   10597 C CA   . LEU B 1 325 ? 7.545   -21.490 -27.831 1.00 71.73  ? 886  LEU B CA   1 
ATOM   10598 C C    . LEU B 1 325 ? 7.322   -22.890 -27.277 1.00 78.92  ? 886  LEU B C    1 
ATOM   10599 O O    . LEU B 1 325 ? 6.330   -23.534 -27.635 1.00 79.23  ? 886  LEU B O    1 
ATOM   10600 C CB   . LEU B 1 325 ? 7.677   -21.548 -29.358 1.00 65.22  ? 886  LEU B CB   1 
ATOM   10601 C CG   . LEU B 1 325 ? 7.326   -20.260 -30.109 1.00 62.19  ? 886  LEU B CG   1 
ATOM   10602 C CD1  . LEU B 1 325 ? 7.596   -20.427 -31.593 1.00 58.02  ? 886  LEU B CD1  1 
ATOM   10603 C CD2  . LEU B 1 325 ? 5.872   -19.857 -29.885 1.00 57.18  ? 886  LEU B CD2  1 
ATOM   10604 H H    . LEU B 1 325 ? 9.440   -20.991 -27.664 1.00 81.92  ? 886  LEU B H    1 
ATOM   10605 H HA   . LEU B 1 325 ? 6.756   -20.965 -27.625 1.00 86.08  ? 886  LEU B HA   1 
ATOM   10606 H HB2  . LEU B 1 325 ? 8.596   -21.769 -29.577 1.00 78.26  ? 886  LEU B HB2  1 
ATOM   10607 H HB3  . LEU B 1 325 ? 7.090   -22.245 -29.689 1.00 78.26  ? 886  LEU B HB3  1 
ATOM   10608 H HG   . LEU B 1 325 ? 7.889   -19.541 -29.782 1.00 74.62  ? 886  LEU B HG   1 
ATOM   10609 H HD11 . LEU B 1 325 ? 7.367   -19.602 -32.049 1.00 69.62  ? 886  LEU B HD11 1 
ATOM   10610 H HD12 . LEU B 1 325 ? 8.536   -20.627 -31.721 1.00 69.62  ? 886  LEU B HD12 1 
ATOM   10611 H HD13 . LEU B 1 325 ? 7.052   -21.155 -31.932 1.00 69.62  ? 886  LEU B HD13 1 
ATOM   10612 H HD21 . LEU B 1 325 ? 5.692   -19.040 -30.376 1.00 68.61  ? 886  LEU B HD21 1 
ATOM   10613 H HD22 . LEU B 1 325 ? 5.295   -20.568 -30.204 1.00 68.61  ? 886  LEU B HD22 1 
ATOM   10614 H HD23 . LEU B 1 325 ? 5.727   -19.712 -28.937 1.00 68.61  ? 886  LEU B HD23 1 
ATOM   10615 N N    . ARG B 1 326 ? 8.216   -23.374 -26.412 1.00 84.82  ? 887  ARG B N    1 
ATOM   10616 C CA   . ARG B 1 326 ? 7.907   -24.543 -25.600 1.00 79.67  ? 887  ARG B CA   1 
ATOM   10617 C C    . ARG B 1 326 ? 6.771   -24.271 -24.625 1.00 80.49  ? 887  ARG B C    1 
ATOM   10618 O O    . ARG B 1 326 ? 6.301   -25.206 -23.968 1.00 81.97  ? 887  ARG B O    1 
ATOM   10619 C CB   . ARG B 1 326 ? 9.147   -24.992 -24.825 1.00 78.67  ? 887  ARG B CB   1 
ATOM   10620 C CG   . ARG B 1 326 ? 10.318  -25.413 -25.697 1.00 82.86  ? 887  ARG B CG   1 
ATOM   10621 C CD   . ARG B 1 326 ? 11.595  -25.535 -24.880 1.00 83.80  ? 887  ARG B CD   1 
ATOM   10622 N NE   . ARG B 1 326 ? 12.702  -26.078 -25.662 1.00 87.15  ? 887  ARG B NE   1 
ATOM   10623 C CZ   . ARG B 1 326 ? 13.967  -26.105 -25.253 1.00 93.78  ? 887  ARG B CZ   1 
ATOM   10624 N NH1  . ARG B 1 326 ? 14.299  -25.612 -24.067 1.00 89.59  ? 887  ARG B NH1  1 
ATOM   10625 N NH2  . ARG B 1 326 ? 14.906  -26.622 -26.034 1.00 98.93  ? 887  ARG B NH2  1 
ATOM   10626 H H    . ARG B 1 326 ? 8.999   -23.044 -26.279 1.00 101.78 ? 887  ARG B H    1 
ATOM   10627 H HA   . ARG B 1 326 ? 7.637   -25.270 -26.182 1.00 95.60  ? 887  ARG B HA   1 
ATOM   10628 H HB2  . ARG B 1 326 ? 9.446   -24.258 -24.265 1.00 94.40  ? 887  ARG B HB2  1 
ATOM   10629 H HB3  . ARG B 1 326 ? 8.908   -25.750 -24.269 1.00 94.40  ? 887  ARG B HB3  1 
ATOM   10630 H HG2  . ARG B 1 326 ? 10.127  -26.276 -26.096 1.00 99.43  ? 887  ARG B HG2  1 
ATOM   10631 H HG3  . ARG B 1 326 ? 10.460  -24.746 -26.387 1.00 99.43  ? 887  ARG B HG3  1 
ATOM   10632 H HD2  . ARG B 1 326 ? 11.853  -24.656 -24.561 1.00 100.56 ? 887  ARG B HD2  1 
ATOM   10633 H HD3  . ARG B 1 326 ? 11.436  -26.129 -24.129 1.00 100.56 ? 887  ARG B HD3  1 
ATOM   10634 H HE   . ARG B 1 326 ? 12.524  -26.401 -26.438 1.00 104.58 ? 887  ARG B HE   1 
ATOM   10635 H HH11 . ARG B 1 326 ? 13.694  -25.276 -23.556 1.00 107.51 ? 887  ARG B HH11 1 
ATOM   10636 H HH12 . ARG B 1 326 ? 15.119  -25.631 -23.807 1.00 107.51 ? 887  ARG B HH12 1 
ATOM   10637 H HH21 . ARG B 1 326 ? 14.696  -26.941 -26.804 1.00 118.72 ? 887  ARG B HH21 1 
ATOM   10638 H HH22 . ARG B 1 326 ? 15.724  -26.637 -25.770 1.00 118.72 ? 887  ARG B HH22 1 
ATOM   10639 N N    . LYS B 1 327 ? 6.336   -23.012 -24.507 1.00 83.18  ? 888  LYS B N    1 
ATOM   10640 C CA   . LYS B 1 327 ? 5.214   -22.669 -23.641 1.00 81.97  ? 888  LYS B CA   1 
ATOM   10641 C C    . LYS B 1 327 ? 3.988   -23.526 -23.927 1.00 86.12  ? 888  LYS B C    1 
ATOM   10642 O O    . LYS B 1 327 ? 3.214   -23.823 -23.010 1.00 90.96  ? 888  LYS B O    1 
ATOM   10643 C CB   . LYS B 1 327 ? 4.865   -21.189 -23.807 1.00 77.25  ? 888  LYS B CB   1 
ATOM   10644 H H    . LYS B 1 327 ? 6.678   -22.339 -24.920 1.00 99.81  ? 888  LYS B H    1 
ATOM   10645 H HA   . LYS B 1 327 ? 5.472   -22.815 -22.717 1.00 98.37  ? 888  LYS B HA   1 
ATOM   10646 N N    . PHE B 1 328 ? 3.787   -23.922 -25.183 1.00 81.27  ? 889  PHE B N    1 
ATOM   10647 C CA   . PHE B 1 328 ? 2.646   -24.746 -25.559 1.00 79.87  ? 889  PHE B CA   1 
ATOM   10648 C C    . PHE B 1 328 ? 3.085   -25.810 -26.551 1.00 83.80  ? 889  PHE B C    1 
ATOM   10649 O O    . PHE B 1 328 ? 3.680   -25.493 -27.585 1.00 78.77  ? 889  PHE B O    1 
ATOM   10650 C CB   . PHE B 1 328 ? 1.528   -23.891 -26.167 1.00 77.58  ? 889  PHE B CB   1 
ATOM   10651 H H    . PHE B 1 328 ? 4.304   -23.723 -25.841 1.00 97.52  ? 889  PHE B H    1 
ATOM   10652 H HA   . PHE B 1 328 ? 2.296   -25.189 -24.770 1.00 95.84  ? 889  PHE B HA   1 
ATOM   10653 N N    . ARG B 1 329 ? 2.786   -27.069 -26.230 1.00 91.78  ? 890  ARG B N    1 
ATOM   10654 C CA   . ARG B 1 329 ? 2.952   -28.164 -27.176 1.00 85.23  ? 890  ARG B CA   1 
ATOM   10655 C C    . ARG B 1 329 ? 1.960   -28.091 -28.331 1.00 81.53  ? 890  ARG B C    1 
ATOM   10656 O O    . ARG B 1 329 ? 2.059   -28.898 -29.262 1.00 76.14  ? 890  ARG B O    1 
ATOM   10657 C CB   . ARG B 1 329 ? 2.804   -29.506 -26.456 1.00 76.50  ? 890  ARG B CB   1 
ATOM   10658 H H    . ARG B 1 329 ? 2.482   -27.314 -25.463 1.00 110.14 ? 890  ARG B H    1 
ATOM   10659 H HA   . ARG B 1 329 ? 3.846   -28.122 -27.549 1.00 102.28 ? 890  ARG B HA   1 
ATOM   10660 N N    . THR B 1 330 ? 1.014   -27.151 -28.291 1.00 78.09  ? 891  THR B N    1 
ATOM   10661 C CA   . THR B 1 330 ? -0.056  -27.063 -29.276 1.00 76.10  ? 891  THR B CA   1 
ATOM   10662 C C    . THR B 1 330 ? 0.366   -26.372 -30.567 1.00 73.86  ? 891  THR B C    1 
ATOM   10663 O O    . THR B 1 330 ? -0.466  -26.236 -31.471 1.00 66.19  ? 891  THR B O    1 
ATOM   10664 C CB   . THR B 1 330 ? -1.257  -26.323 -28.679 1.00 76.02  ? 891  THR B CB   1 
ATOM   10665 H H    . THR B 1 330 ? 0.973   -26.541 -27.686 1.00 93.71  ? 891  THR B H    1 
ATOM   10666 H HA   . THR B 1 330 ? -0.345  -27.961 -29.503 1.00 91.32  ? 891  THR B HA   1 
ATOM   10667 N N    . TYR B 1 331 ? 1.619   -25.933 -30.679 1.00 64.13  ? 892  TYR B N    1 
ATOM   10668 C CA   . TYR B 1 331 ? 2.118   -25.297 -31.894 1.00 62.81  ? 892  TYR B CA   1 
ATOM   10669 C C    . TYR B 1 331 ? 2.728   -26.373 -32.784 1.00 56.96  ? 892  TYR B C    1 
ATOM   10670 O O    . TYR B 1 331 ? 3.763   -26.957 -32.444 1.00 55.74  ? 892  TYR B O    1 
ATOM   10671 C CB   . TYR B 1 331 ? 3.146   -24.219 -31.560 1.00 58.99  ? 892  TYR B CB   1 
ATOM   10672 C CG   . TYR B 1 331 ? 2.560   -22.913 -31.071 1.00 51.88  ? 892  TYR B CG   1 
ATOM   10673 C CD1  . TYR B 1 331 ? 1.479   -22.326 -31.715 1.00 50.25  ? 892  TYR B CD1  1 
ATOM   10674 C CD2  . TYR B 1 331 ? 3.092   -22.264 -29.966 1.00 54.15  ? 892  TYR B CD2  1 
ATOM   10675 C CE1  . TYR B 1 331 ? 0.944   -21.134 -31.272 1.00 45.92  ? 892  TYR B CE1  1 
ATOM   10676 C CE2  . TYR B 1 331 ? 2.565   -21.070 -29.514 1.00 49.83  ? 892  TYR B CE2  1 
ATOM   10677 C CZ   . TYR B 1 331 ? 1.491   -20.509 -30.171 1.00 47.17  ? 892  TYR B CZ   1 
ATOM   10678 O OH   . TYR B 1 331 ? 0.961   -19.320 -29.727 1.00 42.78  ? 892  TYR B OH   1 
ATOM   10679 H H    . TYR B 1 331 ? 2.207   -25.994 -30.054 1.00 76.96  ? 892  TYR B H    1 
ATOM   10680 H HA   . TYR B 1 331 ? 1.381   -24.884 -32.371 1.00 75.37  ? 892  TYR B HA   1 
ATOM   10681 H HB2  . TYR B 1 331 ? 3.733   -24.556 -30.865 1.00 70.79  ? 892  TYR B HB2  1 
ATOM   10682 H HB3  . TYR B 1 331 ? 3.664   -24.028 -32.358 1.00 70.79  ? 892  TYR B HB3  1 
ATOM   10683 H HD1  . TYR B 1 331 ? 1.108   -22.745 -32.458 1.00 60.30  ? 892  TYR B HD1  1 
ATOM   10684 H HD2  . TYR B 1 331 ? 3.817   -22.640 -29.521 1.00 64.98  ? 892  TYR B HD2  1 
ATOM   10685 H HE1  . TYR B 1 331 ? 0.220   -20.753 -31.714 1.00 55.11  ? 892  TYR B HE1  1 
ATOM   10686 H HE2  . TYR B 1 331 ? 2.932   -20.648 -28.772 1.00 59.80  ? 892  TYR B HE2  1 
ATOM   10687 H HH   . TYR B 1 331 ? 1.384   -19.051 -29.054 1.00 51.34  ? 892  TYR B HH   1 
ATOM   10688 N N    . LYS B 1 332 ? 2.091   -26.630 -33.924 1.00 53.00  ? 893  LYS B N    1 
ATOM   10689 C CA   . LYS B 1 332 ? 2.526   -27.662 -34.855 1.00 54.56  ? 893  LYS B CA   1 
ATOM   10690 C C    . LYS B 1 332 ? 3.368   -27.026 -35.954 1.00 46.81  ? 893  LYS B C    1 
ATOM   10691 O O    . LYS B 1 332 ? 2.899   -26.136 -36.669 1.00 44.07  ? 893  LYS B O    1 
ATOM   10692 C CB   . LYS B 1 332 ? 1.328   -28.407 -35.445 1.00 49.56  ? 893  LYS B CB   1 
ATOM   10693 C CG   . LYS B 1 332 ? 0.565   -29.298 -34.461 1.00 57.35  ? 893  LYS B CG   1 
ATOM   10694 C CD   . LYS B 1 332 ? 1.492   -29.990 -33.462 1.00 65.54  ? 893  LYS B CD   1 
ATOM   10695 C CE   . LYS B 1 332 ? 0.761   -30.983 -32.575 1.00 64.63  ? 893  LYS B CE   1 
ATOM   10696 N NZ   . LYS B 1 332 ? -0.155  -31.878 -33.330 1.00 67.11  ? 893  LYS B NZ   1 
ATOM   10697 H H    . LYS B 1 332 ? 1.387   -26.209 -34.184 1.00 63.60  ? 893  LYS B H    1 
ATOM   10698 H HA   . LYS B 1 332 ? 3.080   -28.304 -34.383 1.00 65.47  ? 893  LYS B HA   1 
ATOM   10699 H HB2  . LYS B 1 332 ? 0.701   -27.754 -35.793 1.00 59.48  ? 893  LYS B HB2  1 
ATOM   10700 H HB3  . LYS B 1 332 ? 1.642   -28.973 -36.167 1.00 59.48  ? 893  LYS B HB3  1 
ATOM   10701 H HG2  . LYS B 1 332 ? -0.064  -28.754 -33.961 1.00 68.81  ? 893  LYS B HG2  1 
ATOM   10702 H HG3  . LYS B 1 332 ? 0.090   -29.984 -34.957 1.00 68.81  ? 893  LYS B HG3  1 
ATOM   10703 H HD2  . LYS B 1 332 ? 2.179   -30.472 -33.950 1.00 78.65  ? 893  LYS B HD2  1 
ATOM   10704 H HD3  . LYS B 1 332 ? 1.898   -29.320 -32.891 1.00 78.65  ? 893  LYS B HD3  1 
ATOM   10705 H HE2  . LYS B 1 332 ? 1.414   -31.538 -32.120 1.00 77.56  ? 893  LYS B HE2  1 
ATOM   10706 H HE3  . LYS B 1 332 ? 0.232   -30.494 -31.926 1.00 77.56  ? 893  LYS B HE3  1 
ATOM   10707 H HZ1  . LYS B 1 332 ? -0.559  -32.440 -32.771 1.00 80.53  ? 893  LYS B HZ1  1 
ATOM   10708 H HZ2  . LYS B 1 332 ? -0.772  -31.396 -33.752 1.00 80.53  ? 893  LYS B HZ2  1 
ATOM   10709 H HZ3  . LYS B 1 332 ? 0.305   -32.348 -33.930 1.00 80.53  ? 893  LYS B HZ3  1 
ATOM   10710 N N    . GLY B 1 333 ? 4.606   -27.497 -36.087 1.00 51.39  ? 894  GLY B N    1 
ATOM   10711 C CA   . GLY B 1 333 ? 5.577   -26.895 -36.980 1.00 46.69  ? 894  GLY B CA   1 
ATOM   10712 C C    . GLY B 1 333 ? 5.268   -27.054 -38.453 1.00 45.21  ? 894  GLY B C    1 
ATOM   10713 O O    . GLY B 1 333 ? 5.917   -26.396 -39.271 1.00 41.17  ? 894  GLY B O    1 
ATOM   10714 H H    . GLY B 1 333 ? 4.909   -28.178 -35.658 1.00 61.67  ? 894  GLY B H    1 
ATOM   10715 H HA2  . GLY B 1 333 ? 5.636   -25.946 -36.787 1.00 56.03  ? 894  GLY B HA2  1 
ATOM   10716 H HA3  . GLY B 1 333 ? 6.446   -27.291 -36.812 1.00 56.03  ? 894  GLY B HA3  1 
ATOM   10717 N N    . GLY B 1 334 ? 4.314   -27.908 -38.810 1.00 45.91  ? 895  GLY B N    1 
ATOM   10718 C CA   . GLY B 1 334 ? 3.897   -28.088 -40.184 1.00 35.81  ? 895  GLY B CA   1 
ATOM   10719 C C    . GLY B 1 334 ? 2.599   -27.401 -40.545 1.00 37.77  ? 895  GLY B C    1 
ATOM   10720 O O    . GLY B 1 334 ? 2.045   -27.683 -41.614 1.00 40.39  ? 895  GLY B O    1 
ATOM   10721 H H    . GLY B 1 334 ? 3.884   -28.404 -38.254 1.00 55.10  ? 895  GLY B H    1 
ATOM   10722 H HA2  . GLY B 1 334 ? 4.590   -27.747 -40.771 1.00 42.97  ? 895  GLY B HA2  1 
ATOM   10723 H HA3  . GLY B 1 334 ? 3.793   -29.036 -40.361 1.00 42.97  ? 895  GLY B HA3  1 
ATOM   10724 N N    . SER B 1 335 ? 2.094   -26.512 -39.692 1.00 34.91  ? 896  SER B N    1 
ATOM   10725 C CA   . SER B 1 335 ? 0.836   -25.813 -39.916 1.00 36.21  ? 896  SER B CA   1 
ATOM   10726 C C    . SER B 1 335 ? 1.097   -24.327 -40.117 1.00 36.69  ? 896  SER B C    1 
ATOM   10727 O O    . SER B 1 335 ? 1.719   -23.679 -39.267 1.00 31.76  ? 896  SER B O    1 
ATOM   10728 C CB   . SER B 1 335 ? -0.114  -26.020 -38.737 1.00 36.61  ? 896  SER B CB   1 
ATOM   10729 O OG   . SER B 1 335 ? -1.242  -25.169 -38.840 1.00 35.19  ? 896  SER B OG   1 
ATOM   10730 H H    . SER B 1 335 ? 2.477   -26.292 -38.955 1.00 41.89  ? 896  SER B H    1 
ATOM   10731 H HA   . SER B 1 335 ? 0.412   -26.160 -40.716 1.00 43.45  ? 896  SER B HA   1 
ATOM   10732 H HB2  . SER B 1 335 ? -0.414  -26.943 -38.732 1.00 43.93  ? 896  SER B HB2  1 
ATOM   10733 H HB3  . SER B 1 335 ? 0.357   -25.821 -37.913 1.00 43.93  ? 896  SER B HB3  1 
ATOM   10734 H HG   . SER B 1 335 ? -1.660  -25.331 -39.550 1.00 42.23  ? 896  SER B HG   1 
ATOM   10735 N N    . VAL B 1 336 ? 0.621   -23.794 -41.244 1.00 33.55  ? 897  VAL B N    1 
ATOM   10736 C CA   . VAL B 1 336 ? 0.678   -22.353 -41.472 1.00 33.21  ? 897  VAL B CA   1 
ATOM   10737 C C    . VAL B 1 336 ? -0.170  -21.626 -40.438 1.00 30.75  ? 897  VAL B C    1 
ATOM   10738 O O    . VAL B 1 336 ? 0.232   -20.587 -39.901 1.00 27.03  ? 897  VAL B O    1 
ATOM   10739 C CB   . VAL B 1 336 ? 0.217   -22.023 -42.905 1.00 32.52  ? 897  VAL B CB   1 
ATOM   10740 C CG1  . VAL B 1 336 ? 0.068   -20.515 -43.102 1.00 31.01  ? 897  VAL B CG1  1 
ATOM   10741 C CG2  . VAL B 1 336 ? 1.187   -22.603 -43.924 1.00 35.87  ? 897  VAL B CG2  1 
ATOM   10742 H H    . VAL B 1 336 ? 0.264   -24.242 -41.886 1.00 40.26  ? 897  VAL B H    1 
ATOM   10743 H HA   . VAL B 1 336 ? 1.595   -22.052 -41.374 1.00 39.85  ? 897  VAL B HA   1 
ATOM   10744 H HB   . VAL B 1 336 ? -0.651  -22.430 -43.056 1.00 39.02  ? 897  VAL B HB   1 
ATOM   10745 H HG11 . VAL B 1 336 ? -0.222  -20.343 -44.012 1.00 37.21  ? 897  VAL B HG11 1 
ATOM   10746 H HG12 . VAL B 1 336 ? -0.592  -20.179 -42.475 1.00 37.21  ? 897  VAL B HG12 1 
ATOM   10747 H HG13 . VAL B 1 336 ? 0.924   -20.090 -42.942 1.00 37.21  ? 897  VAL B HG13 1 
ATOM   10748 H HG21 . VAL B 1 336 ? 0.877   -22.383 -44.816 1.00 43.04  ? 897  VAL B HG21 1 
ATOM   10749 H HG22 . VAL B 1 336 ? 2.066   -22.221 -43.775 1.00 43.04  ? 897  VAL B HG22 1 
ATOM   10750 H HG23 . VAL B 1 336 ? 1.222   -23.567 -43.813 1.00 43.04  ? 897  VAL B HG23 1 
ATOM   10751 N N    . ARG B 1 337