data_4Z2A
# 
_entry.id   4Z2A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.307 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4Z2A         
WWPDB D_1000208481 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'Crystal structure of glycosylated mouse furin' 1P8J unspecified 
PDB 'Crystal structure of glycosylated human furin' 4OMC unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4Z2A 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gampe, R.T.' 1 
'Pearce, K.'  2 
'Reid, R.'    3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_id_ASTM           ACSFEN 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2053-230X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'BacMam production and crystal structure of nonglycosylated apo human furin at 1.89A resolution' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      S2053230X1900178X 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pearce, K.H.'    1 ? 
primary 'Overton, L.K.'   2 ? 
primary 'Grampe, R.T.'    3 ? 
primary 'Barret, G.B.'    4 ? 
primary 'Taylor, J.D.'    5 ? 
primary 'McKee, D.D.'     6 ? 
primary 'Campobassom, N.' 7 ? 
primary 'Nolte, R.T.'     8 ? 
primary 'Reid, R.A.'      9 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   122.410 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4Z2A 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     95.983 
_cell.length_a_esd                 ? 
_cell.length_b                     66.597 
_cell.length_b_esd                 ? 
_cell.length_c                     88.443 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4Z2A 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Furin           50505.551 1   3.4.21.75 'N387D, N440D' 'UNP Residues 110-74' ? 
2 non-polymer syn 'CALCIUM ION'   40.078    4   ?         ?              ?                     ? 
3 non-polymer syn 'PHOSPHATE ION' 94.971    2   ?         ?              ?                     ? 
4 non-polymer syn 1,2-ETHANEDIOL  62.068    1   ?         ?              ?                     ? 
5 water       nat water           18.015    408 ?         ?              ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dibasic-processing enzyme,Paired basic amino acid residue-cleaving enzyme,PACE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;YQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQM
NDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARL
AEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEK
QIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKDLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLL
DAGAMVALAQDWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPM
GTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;YQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQM
NDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARL
AEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEK
QIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKDLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLL
DAGAMVALAQDWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPM
GTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   TYR n 
1 2   GLN n 
1 3   GLU n 
1 4   PRO n 
1 5   THR n 
1 6   ASP n 
1 7   PRO n 
1 8   LYS n 
1 9   PHE n 
1 10  PRO n 
1 11  GLN n 
1 12  GLN n 
1 13  TRP n 
1 14  TYR n 
1 15  LEU n 
1 16  SER n 
1 17  GLY n 
1 18  VAL n 
1 19  THR n 
1 20  GLN n 
1 21  ARG n 
1 22  ASP n 
1 23  LEU n 
1 24  ASN n 
1 25  VAL n 
1 26  LYS n 
1 27  ALA n 
1 28  ALA n 
1 29  TRP n 
1 30  ALA n 
1 31  GLN n 
1 32  GLY n 
1 33  TYR n 
1 34  THR n 
1 35  GLY n 
1 36  HIS n 
1 37  GLY n 
1 38  ILE n 
1 39  VAL n 
1 40  VAL n 
1 41  SER n 
1 42  ILE n 
1 43  LEU n 
1 44  ASP n 
1 45  ASP n 
1 46  GLY n 
1 47  ILE n 
1 48  GLU n 
1 49  LYS n 
1 50  ASN n 
1 51  HIS n 
1 52  PRO n 
1 53  ASP n 
1 54  LEU n 
1 55  ALA n 
1 56  GLY n 
1 57  ASN n 
1 58  TYR n 
1 59  ASP n 
1 60  PRO n 
1 61  GLY n 
1 62  ALA n 
1 63  SER n 
1 64  PHE n 
1 65  ASP n 
1 66  VAL n 
1 67  ASN n 
1 68  ASP n 
1 69  GLN n 
1 70  ASP n 
1 71  PRO n 
1 72  ASP n 
1 73  PRO n 
1 74  GLN n 
1 75  PRO n 
1 76  ARG n 
1 77  TYR n 
1 78  THR n 
1 79  GLN n 
1 80  MET n 
1 81  ASN n 
1 82  ASP n 
1 83  ASN n 
1 84  ARG n 
1 85  HIS n 
1 86  GLY n 
1 87  THR n 
1 88  ARG n 
1 89  CYS n 
1 90  ALA n 
1 91  GLY n 
1 92  GLU n 
1 93  VAL n 
1 94  ALA n 
1 95  ALA n 
1 96  VAL n 
1 97  ALA n 
1 98  ASN n 
1 99  ASN n 
1 100 GLY n 
1 101 VAL n 
1 102 CYS n 
1 103 GLY n 
1 104 VAL n 
1 105 GLY n 
1 106 VAL n 
1 107 ALA n 
1 108 TYR n 
1 109 ASN n 
1 110 ALA n 
1 111 ARG n 
1 112 ILE n 
1 113 GLY n 
1 114 GLY n 
1 115 VAL n 
1 116 ARG n 
1 117 MET n 
1 118 LEU n 
1 119 ASP n 
1 120 GLY n 
1 121 GLU n 
1 122 VAL n 
1 123 THR n 
1 124 ASP n 
1 125 ALA n 
1 126 VAL n 
1 127 GLU n 
1 128 ALA n 
1 129 ARG n 
1 130 SER n 
1 131 LEU n 
1 132 GLY n 
1 133 LEU n 
1 134 ASN n 
1 135 PRO n 
1 136 ASN n 
1 137 HIS n 
1 138 ILE n 
1 139 HIS n 
1 140 ILE n 
1 141 TYR n 
1 142 SER n 
1 143 ALA n 
1 144 SER n 
1 145 TRP n 
1 146 GLY n 
1 147 PRO n 
1 148 GLU n 
1 149 ASP n 
1 150 ASP n 
1 151 GLY n 
1 152 LYS n 
1 153 THR n 
1 154 VAL n 
1 155 ASP n 
1 156 GLY n 
1 157 PRO n 
1 158 ALA n 
1 159 ARG n 
1 160 LEU n 
1 161 ALA n 
1 162 GLU n 
1 163 GLU n 
1 164 ALA n 
1 165 PHE n 
1 166 PHE n 
1 167 ARG n 
1 168 GLY n 
1 169 VAL n 
1 170 SER n 
1 171 GLN n 
1 172 GLY n 
1 173 ARG n 
1 174 GLY n 
1 175 GLY n 
1 176 LEU n 
1 177 GLY n 
1 178 SER n 
1 179 ILE n 
1 180 PHE n 
1 181 VAL n 
1 182 TRP n 
1 183 ALA n 
1 184 SER n 
1 185 GLY n 
1 186 ASN n 
1 187 GLY n 
1 188 GLY n 
1 189 ARG n 
1 190 GLU n 
1 191 HIS n 
1 192 ASP n 
1 193 SER n 
1 194 CYS n 
1 195 ASN n 
1 196 CYS n 
1 197 ASP n 
1 198 GLY n 
1 199 TYR n 
1 200 THR n 
1 201 ASN n 
1 202 SER n 
1 203 ILE n 
1 204 TYR n 
1 205 THR n 
1 206 LEU n 
1 207 SER n 
1 208 ILE n 
1 209 SER n 
1 210 SER n 
1 211 ALA n 
1 212 THR n 
1 213 GLN n 
1 214 PHE n 
1 215 GLY n 
1 216 ASN n 
1 217 VAL n 
1 218 PRO n 
1 219 TRP n 
1 220 TYR n 
1 221 SER n 
1 222 GLU n 
1 223 ALA n 
1 224 CYS n 
1 225 SER n 
1 226 SER n 
1 227 THR n 
1 228 LEU n 
1 229 ALA n 
1 230 THR n 
1 231 THR n 
1 232 TYR n 
1 233 SER n 
1 234 SER n 
1 235 GLY n 
1 236 ASN n 
1 237 GLN n 
1 238 ASN n 
1 239 GLU n 
1 240 LYS n 
1 241 GLN n 
1 242 ILE n 
1 243 VAL n 
1 244 THR n 
1 245 THR n 
1 246 ASP n 
1 247 LEU n 
1 248 ARG n 
1 249 GLN n 
1 250 LYS n 
1 251 CYS n 
1 252 THR n 
1 253 GLU n 
1 254 SER n 
1 255 HIS n 
1 256 THR n 
1 257 GLY n 
1 258 THR n 
1 259 SER n 
1 260 ALA n 
1 261 SER n 
1 262 ALA n 
1 263 PRO n 
1 264 LEU n 
1 265 ALA n 
1 266 ALA n 
1 267 GLY n 
1 268 ILE n 
1 269 ILE n 
1 270 ALA n 
1 271 LEU n 
1 272 THR n 
1 273 LEU n 
1 274 GLU n 
1 275 ALA n 
1 276 ASN n 
1 277 LYS n 
1 278 ASP n 
1 279 LEU n 
1 280 THR n 
1 281 TRP n 
1 282 ARG n 
1 283 ASP n 
1 284 MET n 
1 285 GLN n 
1 286 HIS n 
1 287 LEU n 
1 288 VAL n 
1 289 VAL n 
1 290 GLN n 
1 291 THR n 
1 292 SER n 
1 293 LYS n 
1 294 PRO n 
1 295 ALA n 
1 296 HIS n 
1 297 LEU n 
1 298 ASN n 
1 299 ALA n 
1 300 ASN n 
1 301 ASP n 
1 302 TRP n 
1 303 ALA n 
1 304 THR n 
1 305 ASN n 
1 306 GLY n 
1 307 VAL n 
1 308 GLY n 
1 309 ARG n 
1 310 LYS n 
1 311 VAL n 
1 312 SER n 
1 313 HIS n 
1 314 SER n 
1 315 TYR n 
1 316 GLY n 
1 317 TYR n 
1 318 GLY n 
1 319 LEU n 
1 320 LEU n 
1 321 ASP n 
1 322 ALA n 
1 323 GLY n 
1 324 ALA n 
1 325 MET n 
1 326 VAL n 
1 327 ALA n 
1 328 LEU n 
1 329 ALA n 
1 330 GLN n 
1 331 ASP n 
1 332 TRP n 
1 333 THR n 
1 334 THR n 
1 335 VAL n 
1 336 ALA n 
1 337 PRO n 
1 338 GLN n 
1 339 ARG n 
1 340 LYS n 
1 341 CYS n 
1 342 ILE n 
1 343 ILE n 
1 344 ASP n 
1 345 ILE n 
1 346 LEU n 
1 347 THR n 
1 348 GLU n 
1 349 PRO n 
1 350 LYS n 
1 351 ASP n 
1 352 ILE n 
1 353 GLY n 
1 354 LYS n 
1 355 ARG n 
1 356 LEU n 
1 357 GLU n 
1 358 VAL n 
1 359 ARG n 
1 360 LYS n 
1 361 THR n 
1 362 VAL n 
1 363 THR n 
1 364 ALA n 
1 365 CYS n 
1 366 LEU n 
1 367 GLY n 
1 368 GLU n 
1 369 PRO n 
1 370 ASN n 
1 371 HIS n 
1 372 ILE n 
1 373 THR n 
1 374 ARG n 
1 375 LEU n 
1 376 GLU n 
1 377 HIS n 
1 378 ALA n 
1 379 GLN n 
1 380 ALA n 
1 381 ARG n 
1 382 LEU n 
1 383 THR n 
1 384 LEU n 
1 385 SER n 
1 386 TYR n 
1 387 ASN n 
1 388 ARG n 
1 389 ARG n 
1 390 GLY n 
1 391 ASP n 
1 392 LEU n 
1 393 ALA n 
1 394 ILE n 
1 395 HIS n 
1 396 LEU n 
1 397 VAL n 
1 398 SER n 
1 399 PRO n 
1 400 MET n 
1 401 GLY n 
1 402 THR n 
1 403 ARG n 
1 404 SER n 
1 405 THR n 
1 406 LEU n 
1 407 LEU n 
1 408 ALA n 
1 409 ALA n 
1 410 ARG n 
1 411 PRO n 
1 412 HIS n 
1 413 ASP n 
1 414 TYR n 
1 415 SER n 
1 416 ALA n 
1 417 ASP n 
1 418 GLY n 
1 419 PHE n 
1 420 ASN n 
1 421 ASP n 
1 422 TRP n 
1 423 ALA n 
1 424 PHE n 
1 425 MET n 
1 426 THR n 
1 427 THR n 
1 428 HIS n 
1 429 SER n 
1 430 TRP n 
1 431 ASP n 
1 432 GLU n 
1 433 ASP n 
1 434 PRO n 
1 435 SER n 
1 436 GLY n 
1 437 GLU n 
1 438 TRP n 
1 439 VAL n 
1 440 LEU n 
1 441 GLU n 
1 442 ILE n 
1 443 GLU n 
1 444 ASN n 
1 445 THR n 
1 446 SER n 
1 447 GLU n 
1 448 ALA n 
1 449 ASN n 
1 450 ASN n 
1 451 TYR n 
1 452 GLY n 
1 453 THR n 
1 454 LEU n 
1 455 THR n 
1 456 LYS n 
1 457 PHE n 
1 458 THR n 
1 459 LEU n 
1 460 VAL n 
1 461 LEU n 
1 462 TYR n 
1 463 GLY n 
1 464 THR n 
1 465 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   465 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FURIN, FUR, PACE, PCSK3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Cricetulus griseus' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     10029 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FURIN_HUMAN 
_struct_ref.pdbx_db_accession          P09958 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;YQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQM
NDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARL
AEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEK
QIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLL
DAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPM
GTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
;
_struct_ref.pdbx_align_begin           110 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4Z2A 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 465 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P09958 
_struct_ref_seq.db_align_beg                  110 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  574 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       110 
_struct_ref_seq.pdbx_auth_seq_align_end       574 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4Z2A ASP A 278 ? UNP P09958 ASN 387 'engineered mutation' 387 1 
1 4Z2A ASP A 331 ? UNP P09958 ASN 440 'engineered mutation' 440 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ?                 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ?                 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4Z2A 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.36 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.94 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'Well 13% PEG 8K, 0.110M K-dihydrogen phosphate, 0.1M HEPES pH 7.5, 350 uL protein with 350uL well drops, MRC sitting drop' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU SATURN 944+' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-08-10 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU FR-E SUPERBRIGHT' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            11.830 
_reflns.entry_id                         4Z2A 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.890 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       37707 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.600 
_reflns.pdbx_Rmerge_I_obs                0.049 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         25.769 
_reflns.pdbx_netI_over_sigmaI            13.700 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.006 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         135597 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.890 1.960  ? ? ? ? ? 3678 ? 98.800  ? ? ? ? 0.148 ? ? ? ? ? ? ? ? 3.100 ? 1.079 ? ? ? ? 0 1  1 ? ? 
1.960 2.040  ? ? ? ? ? 3740 ? 99.900  ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 3.600 ? 0.884 ? ? ? ? 0 2  1 ? ? 
2.040 2.130  ? ? ? ? ? 3770 ? 99.800  ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 3.600 ? 1.028 ? ? ? ? 0 3  1 ? ? 
2.130 2.240  ? ? ? ? ? 3766 ? 100.000 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 3.600 ? 1.047 ? ? ? ? 0 4  1 ? ? 
2.240 2.380  ? ? ? ? ? 3756 ? 99.900  ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 3.600 ? 1.099 ? ? ? ? 0 5  1 ? ? 
2.380 2.570  ? ? ? ? ? 3773 ? 100.000 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 3.700 ? 0.949 ? ? ? ? 0 6  1 ? ? 
2.570 2.820  ? ? ? ? ? 3779 ? 99.900  ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 3.700 ? 1.002 ? ? ? ? 0 7  1 ? ? 
2.820 3.230  ? ? ? ? ? 3779 ? 100.000 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 3.700 ? 0.957 ? ? ? ? 0 8  1 ? ? 
3.230 4.070  ? ? ? ? ? 3800 ? 99.900  ? ? ? ? 0.031 ? ? ? ? ? ? ? ? 3.700 ? 1.052 ? ? ? ? 0 9  1 ? ? 
4.070 50.000 ? ? ? ? ? 3866 ? 99.700  ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 3.700 ? 0.977 ? ? ? ? 0 10 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                57.780 
_refine.B_iso_mean                               16.9953 
_refine.B_iso_min                                3.040 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4Z2A 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.8900 
_refine.ls_d_res_low                             29.5810 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     37664 
_refine.ls_number_reflns_R_free                  1173 
_refine.ls_number_reflns_R_work                  36491 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.7100 
_refine.ls_percent_reflns_R_free                 3.1100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1490 
_refine.ls_R_factor_R_free                       0.1834 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1479 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1P8J 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 18.3800 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.8900 
_refine_hist.d_res_low                        29.5810 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             408 
_refine_hist.number_atoms_total               3950 
_refine_hist.pdbx_number_residues_total       465 
_refine_hist.pdbx_B_iso_mean_ligand           24.58 
_refine_hist.pdbx_B_iso_mean_solvent          23.24 
_refine_hist.pdbx_number_atoms_protein        3524 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? ? ? c_bond_d  ? ? 
'X-RAY DIFFRACTION' ? 1.260 ? ? ? c_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.8900 1.9761  4615 . 129 4486 99.0000  . . . 0.2097 . 0.1736 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 1.9761 2.0802  4696 . 135 4561 100.0000 . . . 0.2265 . 0.1498 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 2.0802 2.2105  4688 . 131 4557 100.0000 . . . 0.2146 . 0.1389 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 2.2105 2.3811  4666 . 138 4528 99.0000  . . . 0.2110 . 0.1670 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 2.3811 2.6206  4715 . 154 4561 100.0000 . . . 0.1848 . 0.1475 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 2.6206 2.9995  4721 . 154 4567 100.0000 . . . 0.1871 . 0.1480 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 2.9995 3.7778  4724 . 156 4568 100.0000 . . . 0.1921 . 0.1434 . . . . . . 8 . . . 
'X-RAY DIFFRACTION' 3.7778 29.5845 4839 . 176 4663 100.0000 . . . 0.1360 . 0.1380 . . . . . . 8 . . . 
# 
_struct.entry_id                     4Z2A 
_struct.title                        'Crystal structure of unglycosylated apo human furin @1.89A' 
_struct.pdbx_descriptor              'Furin (E.C.3.4.21.75)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4Z2A 
_struct_keywords.text            'unglycosylated, apo, serine proteinase, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLN A 12  ? GLY A 17  ? GLN A 121 GLY A 126 1 ? 6  
HELX_P HELX_P2  AA2 VAL A 25  ? GLN A 31  ? VAL A 134 GLN A 140 1 ? 7  
HELX_P HELX_P3  AA3 LEU A 54  ? TYR A 58  ? LEU A 163 TYR A 167 5 ? 5  
HELX_P HELX_P4  AA4 ASP A 59  ? SER A 63  ? ASP A 168 SER A 172 5 ? 5  
HELX_P HELX_P5  AA5 ARG A 84  ? ALA A 95  ? ARG A 193 ALA A 204 1 ? 12 
HELX_P HELX_P6  AA6 THR A 123 ? GLY A 132 ? THR A 232 GLY A 241 1 ? 10 
HELX_P HELX_P7  AA7 ALA A 158 ? GLY A 172 ? ALA A 267 GLY A 281 1 ? 15 
HELX_P HELX_P8  AA8 ARG A 173 ? LEU A 176 ? ARG A 282 LEU A 285 5 ? 4  
HELX_P HELX_P9  AA9 GLY A 187 ? HIS A 191 ? GLY A 296 HIS A 300 5 ? 5  
HELX_P HELX_P10 AB1 SER A 193 ? ASP A 197 ? SER A 302 ASP A 306 5 ? 5  
HELX_P HELX_P11 AB2 GLY A 257 ? SER A 259 ? GLY A 366 SER A 368 5 ? 3  
HELX_P HELX_P12 AB3 ALA A 260 ? ASN A 276 ? ALA A 369 ASN A 385 1 ? 17 
HELX_P HELX_P13 AB4 THR A 280 ? SER A 292 ? THR A 389 SER A 401 1 ? 13 
HELX_P HELX_P14 AB5 ASP A 321 ? GLN A 330 ? ASP A 430 GLN A 439 1 ? 10 
HELX_P HELX_P15 AB6 ARG A 388 ? GLY A 390 ? ARG A 497 GLY A 499 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 102 SG  A ? ? 1_555 A CYS 251 SG A ? A CYS 211 A CYS 360  1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf2  disulf ? ? A CYS 102 SG  B ? ? 1_555 A CYS 251 SG B ? A CYS 211 A CYS 360  1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf3  disulf ? ? A CYS 194 SG  ? ? ? 1_555 A CYS 224 SG ? ? A CYS 303 A CYS 333  1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf4  disulf ? ? A CYS 341 SG  ? ? ? 1_555 A CYS 365 SG ? ? A CYS 450 A CYS 474  1_555 ? ? ? ? ? ? ? 2.060 ? 
metalc1  metalc ? ? A ASP 6   OD2 ? ? ? 1_555 B CA  .   CA ? ? A ASP 115 A CA  601  1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc2  metalc ? ? A ASP 53  OD1 ? ? ? 1_555 B CA  .   CA ? ? A ASP 162 A CA  601  1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc3  metalc ? ? A ASP 53  OD2 ? ? ? 1_555 B CA  .   CA ? ? A ASP 162 A CA  601  1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc4  metalc ? ? A ASP 65  OD2 ? ? ? 1_555 C CA  .   CA ? ? A ASP 174 A CA  602  1_555 ? ? ? ? ? ? ? 2.377 ? 
metalc5  metalc ? ? A ASP 70  OD1 ? ? ? 1_555 C CA  .   CA ? ? A ASP 179 A CA  602  1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc6  metalc ? ? A ASP 70  OD2 ? ? ? 1_555 C CA  .   CA ? ? A ASP 179 A CA  602  1_555 ? ? ? ? ? ? ? 2.635 ? 
metalc7  metalc ? ? A ASP 72  O   ? ? ? 1_555 C CA  .   CA ? ? A ASP 181 A CA  602  1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc8  metalc ? ? A VAL 96  O   ? ? ? 1_555 B CA  .   CA ? ? A VAL 205 A CA  601  1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc9  metalc ? ? A ASN 99  OD1 ? ? ? 1_555 B CA  .   CA ? ? A ASN 208 A CA  601  1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc10 metalc ? ? A VAL 101 O   ? ? ? 1_555 B CA  .   CA ? ? A VAL 210 A CA  601  1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc11 metalc ? ? A GLY 103 O   ? ? ? 1_555 B CA  .   CA ? ? A GLY 212 A CA  601  1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc12 metalc ? ? A ASP 149 OD1 ? ? ? 1_555 E CA  .   CA ? ? A ASP 258 A CA  604  1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc13 metalc ? ? A ASP 192 OD2 ? ? ? 1_555 E CA  .   CA ? ? A ASP 301 A CA  604  1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc14 metalc ? ? A THR 200 O   ? ? ? 1_555 D CA  .   CA ? ? A THR 309 A CA  603  1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc15 metalc ? ? A SER 202 O   ? ? ? 1_555 D CA  .   CA ? ? A SER 311 A CA  603  1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc16 metalc ? ? A THR 205 O   ? ? ? 1_555 D CA  .   CA ? ? A THR 314 A CA  603  1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc17 metalc ? ? A THR 205 OG1 ? ? ? 1_555 D CA  .   CA ? ? A THR 314 A CA  603  1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc18 metalc ? ? A SER 207 OG  ? ? ? 1_555 D CA  .   CA ? ? A SER 316 A CA  603  1_555 ? ? ? ? ? ? ? 2.628 ? 
metalc19 metalc ? ? A GLU 222 OE1 ? ? ? 1_555 E CA  .   CA ? ? A GLU 331 A CA  604  1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc20 metalc ? ? A GLU 222 OE2 ? ? ? 1_555 E CA  .   CA ? ? A GLU 331 A CA  604  1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc21 metalc ? ? C CA  .   CA  ? ? ? 1_555 I HOH .   O  ? ? A CA  602 A HOH 1047 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc22 metalc ? ? C CA  .   CA  ? ? ? 1_555 I HOH .   O  ? ? A CA  602 A HOH 745  1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc23 metalc ? ? C CA  .   CA  ? ? ? 1_555 I HOH .   O  ? ? A CA  602 A HOH 864  1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc24 metalc ? ? D CA  .   CA  ? ? ? 1_555 I HOH .   O  ? ? A CA  603 A HOH 788  1_555 ? ? ? ? ? ? ? 2.584 ? 
metalc25 metalc ? ? E CA  .   CA  ? ? ? 1_555 I HOH .   O  ? ? A CA  604 A HOH 925  1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc26 metalc ? ? E CA  .   CA  ? ? ? 1_555 I HOH .   O  ? ? A CA  604 A HOH 1001 1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc27 metalc ? ? E CA  .   CA  ? ? ? 1_555 I HOH .   O  ? ? A CA  604 A HOH 777  1_555 ? ? ? ? ? ? ? 2.389 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 64  ? ASP A 65  ? PHE A 173 ASP A 174 
AA1 2 ARG A 111 ? ARG A 116 ? ARG A 220 ARG A 225 
AA1 3 VAL A 39  ? ASP A 44  ? VAL A 148 ASP A 153 
AA1 4 ILE A 140 ? ALA A 143 ? ILE A 249 ALA A 252 
AA1 5 ILE A 179 ? ALA A 183 ? ILE A 288 ALA A 292 
AA1 6 THR A 205 ? ALA A 211 ? THR A 314 ALA A 320 
AA1 7 ALA A 229 ? TYR A 232 ? ALA A 338 TYR A 341 
AA2 1 ILE A 242 ? ASP A 246 ? ILE A 351 ASP A 355 
AA2 2 LYS A 250 ? HIS A 255 ? LYS A 359 HIS A 364 
AA3 1 ALA A 303 ? THR A 304 ? ALA A 412 THR A 413 
AA3 2 LYS A 310 ? VAL A 311 ? LYS A 419 VAL A 420 
AA4 1 ARG A 339 ? ASP A 344 ? ARG A 448 ASP A 453 
AA4 2 GLY A 452 ? THR A 464 ? GLY A 561 THR A 573 
AA4 3 LYS A 350 ? ASP A 351 ? LYS A 459 ASP A 460 
AA5 1 ARG A 339 ? ASP A 344 ? ARG A 448 ASP A 453 
AA5 2 GLY A 452 ? THR A 464 ? GLY A 561 THR A 573 
AA5 3 ARG A 374 ? TYR A 386 ? ARG A 483 TYR A 495 
AA5 4 PHE A 419 ? THR A 426 ? PHE A 528 THR A 535 
AA6 1 ARG A 355 ? VAL A 362 ? ARG A 464 VAL A 471 
AA6 2 GLY A 436 ? ASN A 444 ? GLY A 545 ASN A 553 
AA6 3 LEU A 392 ? VAL A 397 ? LEU A 501 VAL A 506 
AA6 4 ARG A 403 ? LEU A 407 ? ARG A 512 LEU A 516 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 64  ? N PHE A 173 O ARG A 116 ? O ARG A 225 
AA1 2 3 O VAL A 115 ? O VAL A 224 N ILE A 42  ? N ILE A 151 
AA1 3 4 N LEU A 43  ? N LEU A 152 O SER A 142 ? O SER A 251 
AA1 4 5 N TYR A 141 ? N TYR A 250 O VAL A 181 ? O VAL A 290 
AA1 5 6 N PHE A 180 ? N PHE A 289 O LEU A 206 ? O LEU A 315 
AA1 6 7 N SER A 209 ? N SER A 318 O ALA A 229 ? O ALA A 338 
AA2 1 2 N ASP A 246 ? N ASP A 355 O LYS A 250 ? O LYS A 359 
AA3 1 2 N ALA A 303 ? N ALA A 412 O VAL A 311 ? O VAL A 420 
AA4 1 2 N ILE A 343 ? N ILE A 452 O LEU A 459 ? O LEU A 568 
AA4 2 3 O LEU A 454 ? O LEU A 563 N LYS A 350 ? N LYS A 459 
AA5 1 2 N ILE A 343 ? N ILE A 452 O LEU A 459 ? O LEU A 568 
AA5 2 3 O TYR A 462 ? O TYR A 571 N GLU A 376 ? N GLU A 485 
AA5 3 4 N ALA A 378 ? N ALA A 487 O THR A 426 ? O THR A 535 
AA6 1 2 N VAL A 358 ? N VAL A 467 O LEU A 440 ? O LEU A 549 
AA6 2 3 O VAL A 439 ? O VAL A 548 N VAL A 397 ? N VAL A 506 
AA6 3 4 N LEU A 396 ? N LEU A 505 O SER A 404 ? O SER A 513 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA  601 ? 6 'binding site for residue CA A 601'  
AC2 Software A CA  602 ? 6 'binding site for residue CA A 602'  
AC3 Software A CA  603 ? 5 'binding site for residue CA A 603'  
AC4 Software A CA  604 ? 6 'binding site for residue CA A 604'  
AC5 Software A PO4 605 ? 7 'binding site for residue PO4 A 605' 
AC6 Software A PO4 606 ? 6 'binding site for residue PO4 A 606' 
AC7 Software A EDO 607 ? 5 'binding site for residue EDO A 607' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 6   ? ASP A 115  . ? 1_555 ? 
2  AC1 6 ASP A 53  ? ASP A 162  . ? 1_555 ? 
3  AC1 6 VAL A 96  ? VAL A 205  . ? 1_555 ? 
4  AC1 6 ASN A 99  ? ASN A 208  . ? 1_555 ? 
5  AC1 6 VAL A 101 ? VAL A 210  . ? 1_555 ? 
6  AC1 6 GLY A 103 ? GLY A 212  . ? 1_555 ? 
7  AC2 6 ASP A 65  ? ASP A 174  . ? 1_555 ? 
8  AC2 6 ASP A 70  ? ASP A 179  . ? 1_555 ? 
9  AC2 6 ASP A 72  ? ASP A 181  . ? 1_555 ? 
10 AC2 6 HOH I .   ? HOH A 745  . ? 1_555 ? 
11 AC2 6 HOH I .   ? HOH A 864  . ? 1_555 ? 
12 AC2 6 HOH I .   ? HOH A 1047 . ? 1_555 ? 
13 AC3 5 THR A 200 ? THR A 309  . ? 1_555 ? 
14 AC3 5 SER A 202 ? SER A 311  . ? 1_555 ? 
15 AC3 5 THR A 205 ? THR A 314  . ? 1_555 ? 
16 AC3 5 SER A 207 ? SER A 316  . ? 1_555 ? 
17 AC3 5 HOH I .   ? HOH A 788  . ? 1_555 ? 
18 AC4 6 ASP A 149 ? ASP A 258  . ? 1_555 ? 
19 AC4 6 ASP A 192 ? ASP A 301  . ? 1_555 ? 
20 AC4 6 GLU A 222 ? GLU A 331  . ? 1_555 ? 
21 AC4 6 HOH I .   ? HOH A 777  . ? 1_555 ? 
22 AC4 6 HOH I .   ? HOH A 925  . ? 1_555 ? 
23 AC4 6 HOH I .   ? HOH A 1001 . ? 1_555 ? 
24 AC5 7 ARG A 84  ? ARG A 193  . ? 1_555 ? 
25 AC5 7 HIS A 85  ? HIS A 194  . ? 1_555 ? 
26 AC5 7 ARG A 88  ? ARG A 197  . ? 1_555 ? 
27 AC5 7 SER A 254 ? SER A 363  . ? 1_555 ? 
28 AC5 7 HIS A 255 ? HIS A 364  . ? 1_555 ? 
29 AC5 7 THR A 256 ? THR A 365  . ? 1_555 ? 
30 AC5 7 PO4 G .   ? PO4 A 606  . ? 1_555 ? 
31 AC6 6 ARG A 84  ? ARG A 193  . ? 1_555 ? 
32 AC6 6 ARG A 88  ? ARG A 197  . ? 1_555 ? 
33 AC6 6 HIS A 191 ? HIS A 300  . ? 2_556 ? 
34 AC6 6 SER A 254 ? SER A 363  . ? 1_555 ? 
35 AC6 6 HIS A 412 ? HIS A 521  . ? 2_556 ? 
36 AC6 6 PO4 F .   ? PO4 A 605  . ? 1_555 ? 
37 AC7 5 ARG A 189 ? ARG A 298  . ? 2_556 ? 
38 AC7 5 TRP A 219 ? TRP A 328  . ? 1_555 ? 
39 AC7 5 THR A 256 ? THR A 365  . ? 1_555 ? 
40 AC7 5 GLY A 257 ? GLY A 366  . ? 1_555 ? 
41 AC7 5 HOH I .   ? HOH A 950  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4Z2A 
_atom_sites.fract_transf_matrix[1][1]   0.010419 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.006614 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015016 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013393 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . TYR A 1 1   ? -33.532 30.976  2.865  1.00 43.00 ? 110  TYR A N   1 
ATOM   2    C  CA  . TYR A 1 1   ? -33.446 30.190  4.094  1.00 42.28 ? 110  TYR A CA  1 
ATOM   3    C  C   . TYR A 1 1   ? -34.361 30.702  5.199  1.00 40.85 ? 110  TYR A C   1 
ATOM   4    O  O   . TYR A 1 1   ? -34.432 31.908  5.458  1.00 38.38 ? 110  TYR A O   1 
ATOM   5    C  CB  . TYR A 1 1   ? -32.026 30.189  4.652  1.00 38.32 ? 110  TYR A CB  1 
ATOM   6    C  CG  . TYR A 1 1   ? -31.974 29.790  6.113  1.00 37.50 ? 110  TYR A CG  1 
ATOM   7    C  CD1 . TYR A 1 1   ? -32.207 28.470  6.508  1.00 34.62 ? 110  TYR A CD1 1 
ATOM   8    C  CD2 . TYR A 1 1   ? -31.713 30.739  7.106  1.00 34.71 ? 110  TYR A CD2 1 
ATOM   9    C  CE1 . TYR A 1 1   ? -32.163 28.108  7.850  1.00 33.40 ? 110  TYR A CE1 1 
ATOM   10   C  CE2 . TYR A 1 1   ? -31.677 30.388  8.450  1.00 34.00 ? 110  TYR A CE2 1 
ATOM   11   C  CZ  . TYR A 1 1   ? -31.900 29.077  8.818  1.00 34.78 ? 110  TYR A CZ  1 
ATOM   12   O  OH  . TYR A 1 1   ? -31.855 28.744  10.155 1.00 34.00 ? 110  TYR A OH  1 
ATOM   13   N  N   . GLN A 1 2   ? -35.031 29.767  5.869  1.00 39.96 ? 111  GLN A N   1 
ATOM   14   C  CA  . GLN A 1 2   ? -35.829 30.078  7.047  1.00 32.21 ? 111  GLN A CA  1 
ATOM   15   C  C   . GLN A 1 2   ? -35.508 29.090  8.187  1.00 34.23 ? 111  GLN A C   1 
ATOM   16   O  O   . GLN A 1 2   ? -35.226 27.910  7.958  1.00 33.78 ? 111  GLN A O   1 
ATOM   17   C  CB  . GLN A 1 2   ? -37.314 30.052  6.690  1.00 32.39 ? 111  GLN A CB  1 
ATOM   18   N  N   . GLU A 1 3   ? -35.520 29.597  9.410  1.00 33.94 ? 112  GLU A N   1 
ATOM   19   C  CA  . GLU A 1 3   ? -35.302 28.788  10.609 1.00 32.96 ? 112  GLU A CA  1 
ATOM   20   C  C   . GLU A 1 3   ? -36.270 27.598  10.662 1.00 32.31 ? 112  GLU A C   1 
ATOM   21   O  O   . GLU A 1 3   ? -37.420 27.693  10.250 1.00 30.01 ? 112  GLU A O   1 
ATOM   22   C  CB  . GLU A 1 3   ? -35.523 29.669  11.820 1.00 34.86 ? 112  GLU A CB  1 
ATOM   23   C  CG  . GLU A 1 3   ? -34.674 29.341  12.999 1.00 35.68 ? 112  GLU A CG  1 
ATOM   24   C  CD  . GLU A 1 3   ? -34.686 30.441  14.020 1.00 43.49 ? 112  GLU A CD  1 
ATOM   25   O  OE1 . GLU A 1 3   ? -33.736 31.262  14.019 1.00 48.72 ? 112  GLU A OE1 1 
ATOM   26   O  OE2 . GLU A 1 3   ? -35.644 30.484  14.826 1.00 40.65 ? 112  GLU A OE2 1 
ATOM   27   N  N   . PRO A 1 4   ? -35.803 26.453  11.158 1.00 32.59 ? 113  PRO A N   1 
ATOM   28   C  CA  . PRO A 1 4   ? -36.715 25.307  11.229 1.00 26.47 ? 113  PRO A CA  1 
ATOM   29   C  C   . PRO A 1 4   ? -37.996 25.578  12.029 1.00 24.37 ? 113  PRO A C   1 
ATOM   30   O  O   . PRO A 1 4   ? -38.004 26.336  13.003 1.00 23.58 ? 113  PRO A O   1 
ATOM   31   C  CB  . PRO A 1 4   ? -35.869 24.233  11.918 1.00 25.39 ? 113  PRO A CB  1 
ATOM   32   C  CG  . PRO A 1 4   ? -34.453 24.596  11.561 1.00 22.50 ? 113  PRO A CG  1 
ATOM   33   C  CD  . PRO A 1 4   ? -34.410 26.087  11.471 1.00 25.26 ? 113  PRO A CD  1 
ATOM   34   N  N   . THR A 1 5   ? -39.063 24.907  11.611 1.00 22.76 ? 114  THR A N   1 
ATOM   35   C  CA  . THR A 1 5   ? -40.391 25.078  12.191 1.00 25.02 ? 114  THR A CA  1 
ATOM   36   C  C   . THR A 1 5   ? -40.782 23.888  13.058 1.00 21.12 ? 114  THR A C   1 
ATOM   37   O  O   . THR A 1 5   ? -41.881 23.860  13.605 1.00 19.87 ? 114  THR A O   1 
ATOM   38   C  CB  . THR A 1 5   ? -41.465 25.207  11.077 1.00 22.21 ? 114  THR A CB  1 
ATOM   39   O  OG1 . THR A 1 5   ? -41.350 24.099  10.188 1.00 18.74 ? 114  THR A OG1 1 
ATOM   40   C  CG2 . THR A 1 5   ? -41.289 26.511  10.291 1.00 25.27 ? 114  THR A CG2 1 
ATOM   41   N  N   . ASP A 1 6   ? -39.884 22.909  13.178 1.00 19.34 ? 115  ASP A N   1 
ATOM   42   C  CA  . ASP A 1 6   ? -40.164 21.683  13.904 1.00 18.02 ? 115  ASP A CA  1 
ATOM   43   C  C   . ASP A 1 6   ? -40.569 22.006  15.346 1.00 18.40 ? 115  ASP A C   1 
ATOM   44   O  O   . ASP A 1 6   ? -40.068 22.956  15.952 1.00 18.32 ? 115  ASP A O   1 
ATOM   45   C  CB  . ASP A 1 6   ? -38.953 20.759  13.883 1.00 17.22 ? 115  ASP A CB  1 
ATOM   46   C  CG  . ASP A 1 6   ? -38.509 20.429  12.480 1.00 17.57 ? 115  ASP A CG  1 
ATOM   47   O  OD1 . ASP A 1 6   ? -38.073 21.377  11.776 1.00 19.29 ? 115  ASP A OD1 1 
ATOM   48   O  OD2 . ASP A 1 6   ? -38.599 19.243  12.088 1.00 14.97 ? 115  ASP A OD2 1 
ATOM   49   N  N   . PRO A 1 7   ? -41.492 21.223  15.890 1.00 16.92 ? 116  PRO A N   1 
ATOM   50   C  CA  . PRO A 1 7   ? -42.101 21.554  17.186 1.00 19.96 ? 116  PRO A CA  1 
ATOM   51   C  C   . PRO A 1 7   ? -41.113 21.562  18.358 1.00 20.69 ? 116  PRO A C   1 
ATOM   52   O  O   . PRO A 1 7   ? -41.294 22.355  19.299 1.00 17.13 ? 116  PRO A O   1 
ATOM   53   C  CB  . PRO A 1 7   ? -43.176 20.477  17.354 1.00 18.27 ? 116  PRO A CB  1 
ATOM   54   C  CG  . PRO A 1 7   ? -42.746 19.362  16.503 1.00 18.33 ? 116  PRO A CG  1 
ATOM   55   C  CD  . PRO A 1 7   ? -41.963 19.935  15.363 1.00 16.46 ? 116  PRO A CD  1 
ATOM   56   N  N   . LYS A 1 8   ? -40.051 20.753  18.296 1.00 20.01 ? 117  LYS A N   1 
ATOM   57   C  CA  . LYS A 1 8   ? -39.081 20.709  19.401 1.00 15.32 ? 117  LYS A CA  1 
ATOM   58   C  C   . LYS A 1 8   ? -37.759 21.439  19.100 1.00 20.38 ? 117  LYS A C   1 
ATOM   59   O  O   . LYS A 1 8   ? -36.806 21.404  19.895 1.00 18.20 ? 117  LYS A O   1 
ATOM   60   C  CB  . LYS A 1 8   ? -38.843 19.254  19.819 1.00 17.45 ? 117  LYS A CB  1 
ATOM   61   C  CG  . LYS A 1 8   ? -40.073 18.595  20.441 1.00 18.54 ? 117  LYS A CG  1 
ATOM   62   C  CD  . LYS A 1 8   ? -40.447 19.288  21.746 1.00 23.78 ? 117  LYS A CD  1 
ATOM   63   C  CE  . LYS A 1 8   ? -41.567 18.573  22.476 1.00 28.05 ? 117  LYS A CE  1 
ATOM   64   N  NZ  . LYS A 1 8   ? -42.021 19.385  23.640 1.00 34.82 ? 117  LYS A NZ  1 
ATOM   65   N  N   . PHE A 1 9   ? -37.704 22.146  17.973 1.00 19.78 ? 118  PHE A N   1 
ATOM   66   C  CA  . PHE A 1 9   ? -36.495 22.892  17.646 1.00 19.59 ? 118  PHE A CA  1 
ATOM   67   C  C   . PHE A 1 9   ? -36.179 23.952  18.702 1.00 18.91 ? 118  PHE A C   1 
ATOM   68   O  O   . PHE A 1 9   ? -35.009 24.165  19.017 1.00 17.62 ? 118  PHE A O   1 
ATOM   69   C  CB  . PHE A 1 9   ? -36.551 23.534  16.246 1.00 19.59 ? 118  PHE A CB  1 
ATOM   70   C  CG  . PHE A 1 9   ? -35.374 24.428  15.954 1.00 18.03 ? 118  PHE A CG  1 
ATOM   71   C  CD1 . PHE A 1 9   ? -34.104 23.894  15.800 1.00 18.82 ? 118  PHE A CD1 1 
ATOM   72   C  CD2 . PHE A 1 9   ? -35.529 25.807  15.862 1.00 22.55 ? 118  PHE A CD2 1 
ATOM   73   C  CE1 . PHE A 1 9   ? -33.018 24.719  15.546 1.00 22.09 ? 118  PHE A CE1 1 
ATOM   74   C  CE2 . PHE A 1 9   ? -34.441 26.640  15.602 1.00 22.49 ? 118  PHE A CE2 1 
ATOM   75   C  CZ  . PHE A 1 9   ? -33.190 26.102  15.443 1.00 21.57 ? 118  PHE A CZ  1 
ATOM   76   N  N   . PRO A 1 10  ? -37.205 24.611  19.278 1.00 18.99 ? 119  PRO A N   1 
ATOM   77   C  CA  . PRO A 1 10  ? -36.828 25.570  20.329 1.00 21.05 ? 119  PRO A CA  1 
ATOM   78   C  C   . PRO A 1 10  ? -36.134 24.905  21.538 1.00 18.89 ? 119  PRO A C   1 
ATOM   79   O  O   . PRO A 1 10  ? -35.245 25.513  22.133 1.00 22.32 ? 119  PRO A O   1 
ATOM   80   C  CB  . PRO A 1 10  ? -38.169 26.200  20.727 1.00 20.06 ? 119  PRO A CB  1 
ATOM   81   C  CG  . PRO A 1 10  ? -39.004 26.092  19.483 1.00 25.01 ? 119  PRO A CG  1 
ATOM   82   C  CD  . PRO A 1 10  ? -38.607 24.783  18.848 1.00 22.74 ? 119  PRO A CD  1 
ATOM   83   N  N   . GLN A 1 11  ? -36.519 23.670  21.845 1.00 16.30 ? 120  GLN A N   1 
ATOM   84   C  CA  . GLN A 1 11  ? -35.935 22.867  22.915 1.00 18.00 ? 120  GLN A CA  1 
ATOM   85   C  C   . GLN A 1 11  ? -34.491 22.425  22.620 1.00 17.82 ? 120  GLN A C   1 
ATOM   86   O  O   . GLN A 1 11  ? -33.760 22.010  23.528 1.00 12.32 ? 120  GLN A O   1 
ATOM   87   C  CB  . GLN A 1 11  ? -36.791 21.606  23.140 1.00 21.05 ? 120  GLN A CB  1 
ATOM   88   C  CG  . GLN A 1 11  ? -38.073 21.825  23.938 1.00 21.96 ? 120  GLN A CG  1 
ATOM   89   C  CD  . GLN A 1 11  ? -39.034 22.758  23.248 1.00 26.15 ? 120  GLN A CD  1 
ATOM   90   O  OE1 . GLN A 1 11  ? -39.244 22.686  22.033 1.00 25.41 ? 120  GLN A OE1 1 
ATOM   91   N  NE2 . GLN A 1 11  ? -39.617 23.658  24.017 1.00 37.76 ? 120  GLN A NE2 1 
ATOM   92   N  N   . GLN A 1 12  ? -34.097 22.481  21.355 1.00 14.06 ? 121  GLN A N   1 
ATOM   93   C  CA  . GLN A 1 12  ? -32.731 22.109  20.935 1.00 13.03 ? 121  GLN A CA  1 
ATOM   94   C  C   . GLN A 1 12  ? -31.804 23.308  21.159 1.00 17.20 ? 121  GLN A C   1 
ATOM   95   O  O   . GLN A 1 12  ? -31.288 23.950  20.237 1.00 16.31 ? 121  GLN A O   1 
ATOM   96   C  CB  . GLN A 1 12  ? -32.722 21.624  19.484 1.00 14.27 ? 121  GLN A CB  1 
ATOM   97   C  CG  . GLN A 1 12  ? -33.480 20.313  19.311 1.00 14.74 ? 121  GLN A CG  1 
ATOM   98   C  CD  . GLN A 1 12  ? -33.433 19.728  17.907 1.00 16.64 ? 121  GLN A CD  1 
ATOM   99   O  OE1 . GLN A 1 12  ? -33.739 20.397  16.915 1.00 18.00 ? 121  GLN A OE1 1 
ATOM   100  N  NE2 . GLN A 1 12  ? -33.081 18.443  17.821 1.00 15.55 ? 121  GLN A NE2 1 
ATOM   101  N  N   . TRP A 1 13  ? -31.612 23.595  22.430 1.00 13.88 ? 122  TRP A N   1 
ATOM   102  C  CA  . TRP A 1 13  ? -30.959 24.801  22.888 1.00 13.03 ? 122  TRP A CA  1 
ATOM   103  C  C   . TRP A 1 13  ? -29.532 24.947  22.355 1.00 17.66 ? 122  TRP A C   1 
ATOM   104  O  O   . TRP A 1 13  ? -29.065 26.055  22.128 1.00 18.39 ? 122  TRP A O   1 
ATOM   105  C  CB  . TRP A 1 13  ? -30.961 24.797  24.414 1.00 12.23 ? 122  TRP A CB  1 
ATOM   106  C  CG  . TRP A 1 13  ? -30.363 23.567  24.996 1.00 14.67 ? 122  TRP A CG  1 
ATOM   107  C  CD1 . TRP A 1 13  ? -31.003 22.389  25.252 1.00 14.35 ? 122  TRP A CD1 1 
ATOM   108  C  CD2 . TRP A 1 13  ? -29.006 23.381  25.403 1.00 11.98 ? 122  TRP A CD2 1 
ATOM   109  N  NE1 . TRP A 1 13  ? -30.121 21.476  25.792 1.00 13.66 ? 122  TRP A NE1 1 
ATOM   110  C  CE2 . TRP A 1 13  ? -28.896 22.073  25.914 1.00 12.78 ? 122  TRP A CE2 1 
ATOM   111  C  CE3 . TRP A 1 13  ? -27.866 24.198  25.388 1.00 16.94 ? 122  TRP A CE3 1 
ATOM   112  C  CZ2 . TRP A 1 13  ? -27.688 21.554  26.397 1.00 14.86 ? 122  TRP A CZ2 1 
ATOM   113  C  CZ3 . TRP A 1 13  ? -26.664 23.683  25.872 1.00 12.46 ? 122  TRP A CZ3 1 
ATOM   114  C  CH2 . TRP A 1 13  ? -26.589 22.379  26.374 1.00 12.53 ? 122  TRP A CH2 1 
ATOM   115  N  N   . TYR A 1 14  ? -28.861 23.822  22.134 1.00 14.83 ? 123  TYR A N   1 
ATOM   116  C  CA  . TYR A 1 14  ? -27.481 23.797  21.590 1.00 17.40 ? 123  TYR A CA  1 
ATOM   117  C  C   . TYR A 1 14  ? -27.412 24.188  20.103 1.00 16.60 ? 123  TYR A C   1 
ATOM   118  O  O   . TYR A 1 14  ? -26.326 24.349  19.557 1.00 17.43 ? 123  TYR A O   1 
ATOM   119  C  CB  . TYR A 1 14  ? -26.859 22.402  21.779 1.00 17.84 ? 123  TYR A CB  1 
ATOM   120  C  CG  . TYR A 1 14  ? -27.859 21.305  21.550 1.00 12.34 ? 123  TYR A CG  1 
ATOM   121  C  CD1 . TYR A 1 14  ? -28.772 20.962  22.536 1.00 13.45 ? 123  TYR A CD1 1 
ATOM   122  C  CD2 . TYR A 1 14  ? -27.921 20.637  20.336 1.00 10.59 ? 123  TYR A CD2 1 
ATOM   123  C  CE1 . TYR A 1 14  ? -29.698 20.007  22.329 1.00 14.82 ? 123  TYR A CE1 1 
ATOM   124  C  CE2 . TYR A 1 14  ? -28.862 19.669  20.114 1.00 12.51 ? 123  TYR A CE2 1 
ATOM   125  C  CZ  . TYR A 1 14  ? -29.756 19.363  21.102 1.00 14.13 ? 123  TYR A CZ  1 
ATOM   126  O  OH  . TYR A 1 14  ? -30.709 18.402  20.909 1.00 15.09 ? 123  TYR A OH  1 
ATOM   127  N  N   . LEU A 1 15  ? -28.573 24.320  19.459 1.00 19.85 ? 124  LEU A N   1 
ATOM   128  C  CA  . LEU A 1 15  ? -28.684 24.800  18.080 1.00 22.20 ? 124  LEU A CA  1 
ATOM   129  C  C   . LEU A 1 15  ? -29.501 26.099  17.984 1.00 28.41 ? 124  LEU A C   1 
ATOM   130  O  O   . LEU A 1 15  ? -29.132 27.046  17.275 1.00 32.55 ? 124  LEU A O   1 
ATOM   131  C  CB  . LEU A 1 15  ? -29.443 23.776  17.220 1.00 16.98 ? 124  LEU A CB  1 
ATOM   132  C  CG  . LEU A 1 15  ? -29.128 22.286  17.244 1.00 13.52 ? 124  LEU A CG  1 
ATOM   133  C  CD1 . LEU A 1 15  ? -30.113 21.525  16.378 1.00 14.28 ? 124  LEU A CD1 1 
ATOM   134  C  CD2 . LEU A 1 15  ? -27.720 22.006  16.824 1.00 20.23 ? 124  LEU A CD2 1 
ATOM   135  N  N   . SER A 1 16  ? -30.667 26.115  18.625 1.00 27.10 ? 125  SER A N   1 
ATOM   136  C  CA  . SER A 1 16  ? -31.618 27.204  18.388 1.00 30.29 ? 125  SER A CA  1 
ATOM   137  C  C   . SER A 1 16  ? -31.264 28.393  19.262 1.00 38.65 ? 125  SER A C   1 
ATOM   138  O  O   . SER A 1 16  ? -31.672 29.525  18.979 1.00 43.82 ? 125  SER A O   1 
ATOM   139  C  CB  . SER A 1 16  ? -33.068 26.760  18.633 1.00 27.16 ? 125  SER A CB  1 
ATOM   140  O  OG  . SER A 1 16  ? -33.306 26.505  19.999 1.00 27.16 ? 125  SER A OG  1 
ATOM   141  N  N   . GLY A 1 17  ? -30.501 28.115  20.312 1.00 29.81 ? 126  GLY A N   1 
ATOM   142  C  CA  . GLY A 1 17  ? -30.063 29.107  21.268 1.00 33.73 ? 126  GLY A CA  1 
ATOM   143  C  C   . GLY A 1 17  ? -29.870 30.492  20.707 1.00 44.19 ? 126  GLY A C   1 
ATOM   144  O  O   . GLY A 1 17  ? -29.440 30.679  19.558 1.00 47.65 ? 126  GLY A O   1 
ATOM   145  N  N   . VAL A 1 18  ? -30.219 31.470  21.531 1.00 40.14 ? 127  VAL A N   1 
ATOM   146  C  CA  . VAL A 1 18  ? -30.028 32.877  21.210 1.00 50.94 ? 127  VAL A CA  1 
ATOM   147  C  C   . VAL A 1 18  ? -29.581 33.521  22.526 1.00 57.78 ? 127  VAL A C   1 
ATOM   148  O  O   . VAL A 1 18  ? -30.200 34.453  23.053 1.00 53.69 ? 127  VAL A O   1 
ATOM   149  C  CB  . VAL A 1 18  ? -31.320 33.533  20.655 1.00 44.42 ? 127  VAL A CB  1 
ATOM   150  N  N   . THR A 1 19  ? -28.518 32.941  23.075 1.00 53.90 ? 128  THR A N   1 
ATOM   151  C  CA  . THR A 1 19  ? -27.917 33.406  24.307 1.00 48.83 ? 128  THR A CA  1 
ATOM   152  C  C   . THR A 1 19  ? -26.429 33.401  24.053 1.00 47.01 ? 128  THR A C   1 
ATOM   153  O  O   . THR A 1 19  ? -25.628 33.577  24.975 1.00 42.39 ? 128  THR A O   1 
ATOM   154  C  CB  . THR A 1 19  ? -28.280 32.473  25.491 1.00 47.22 ? 128  THR A CB  1 
ATOM   155  O  OG1 . THR A 1 19  ? -27.648 31.194  25.327 1.00 50.68 ? 128  THR A OG1 1 
ATOM   156  C  CG2 . THR A 1 19  ? -29.774 32.267  25.552 1.00 43.50 ? 128  THR A CG2 1 
ATOM   157  N  N   . GLN A 1 20  ? -26.079 33.205  22.776 1.00 48.87 ? 129  GLN A N   1 
ATOM   158  C  CA  . GLN A 1 20  ? -24.693 33.039  22.343 1.00 50.64 ? 129  GLN A CA  1 
ATOM   159  C  C   . GLN A 1 20  ? -24.145 31.631  22.624 1.00 43.95 ? 129  GLN A C   1 
ATOM   160  O  O   . GLN A 1 20  ? -23.167 31.210  21.986 1.00 48.33 ? 129  GLN A O   1 
ATOM   161  C  CB  . GLN A 1 20  ? -23.788 34.095  22.993 1.00 47.20 ? 129  GLN A CB  1 
ATOM   162  N  N   . ARG A 1 21  ? -24.782 30.905  23.549 1.00 39.68 ? 130  ARG A N   1 
ATOM   163  C  CA  . ARG A 1 21  ? -24.212 29.668  24.099 1.00 33.07 ? 130  ARG A CA  1 
ATOM   164  C  C   . ARG A 1 21  ? -24.658 28.425  23.326 1.00 31.21 ? 130  ARG A C   1 
ATOM   165  O  O   . ARG A 1 21  ? -25.397 27.577  23.861 1.00 21.74 ? 130  ARG A O   1 
ATOM   166  C  CB  . ARG A 1 21  ? -24.600 29.520  25.575 1.00 34.28 ? 130  ARG A CB  1 
ATOM   167  C  CG  . ARG A 1 21  ? -24.170 30.690  26.463 1.00 41.64 ? 130  ARG A CG  1 
ATOM   168  C  CD  . ARG A 1 21  ? -22.779 31.215  26.098 1.00 40.72 ? 130  ARG A CD  1 
ATOM   169  N  NE  . ARG A 1 21  ? -22.399 32.393  26.882 1.00 47.22 ? 130  ARG A NE  1 
ATOM   170  N  N   . ASP A 1 22  ? -24.225 28.327  22.068 1.00 25.26 ? 131  ASP A N   1 
ATOM   171  C  CA  . ASP A 1 22  ? -24.654 27.241  21.200 1.00 21.54 ? 131  ASP A CA  1 
ATOM   172  C  C   . ASP A 1 22  ? -23.556 26.876  20.204 1.00 16.40 ? 131  ASP A C   1 
ATOM   173  O  O   . ASP A 1 22  ? -22.475 27.430  20.251 1.00 16.46 ? 131  ASP A O   1 
ATOM   174  C  CB  . ASP A 1 22  ? -25.972 27.586  20.489 1.00 23.42 ? 131  ASP A CB  1 
ATOM   175  C  CG  . ASP A 1 22  ? -25.910 28.889  19.725 1.00 27.20 ? 131  ASP A CG  1 
ATOM   176  O  OD1 . ASP A 1 22  ? -24.942 29.117  18.962 1.00 25.26 ? 131  ASP A OD1 1 
ATOM   177  O  OD2 . ASP A 1 22  ? -26.858 29.685  19.882 1.00 30.13 ? 131  ASP A OD2 1 
ATOM   178  N  N   . LEU A 1 23  ? -23.851 25.937  19.307 1.00 16.47 ? 132  LEU A N   1 
ATOM   179  C  CA  . LEU A 1 23  ? -22.856 25.390  18.405 1.00 11.76 ? 132  LEU A CA  1 
ATOM   180  C  C   . LEU A 1 23  ? -22.714 26.214  17.110 1.00 16.75 ? 132  LEU A C   1 
ATOM   181  O  O   . LEU A 1 23  ? -21.994 25.817  16.172 1.00 15.39 ? 132  LEU A O   1 
ATOM   182  C  CB  . LEU A 1 23  ? -23.230 23.951  18.081 1.00 14.18 ? 132  LEU A CB  1 
ATOM   183  C  CG  . LEU A 1 23  ? -23.142 22.993  19.269 1.00 12.80 ? 132  LEU A CG  1 
ATOM   184  C  CD1 . LEU A 1 23  ? -23.639 21.594  18.882 1.00 16.23 ? 132  LEU A CD1 1 
ATOM   185  C  CD2 . LEU A 1 23  ? -21.707 22.934  19.794 1.00 15.92 ? 132  LEU A CD2 1 
ATOM   186  N  N   . ASN A 1 24  ? -23.374 27.377  17.082 1.00 15.80 ? 133  ASN A N   1 
ATOM   187  C  CA  . ASN A 1 24  ? -23.315 28.296  15.932 1.00 19.71 ? 133  ASN A CA  1 
ATOM   188  C  C   . ASN A 1 24  ? -23.671 27.618  14.595 1.00 17.67 ? 133  ASN A C   1 
ATOM   189  O  O   . ASN A 1 24  ? -23.019 27.833  13.564 1.00 16.28 ? 133  ASN A O   1 
ATOM   190  C  CB  . ASN A 1 24  ? -21.937 28.962  15.874 1.00 16.17 ? 133  ASN A CB  1 
ATOM   191  C  CG  . ASN A 1 24  ? -21.924 30.222  15.014 1.00 20.15 ? 133  ASN A CG  1 
ATOM   192  O  OD1 . ASN A 1 24  ? -22.941 30.896  14.860 1.00 21.34 ? 133  ASN A OD1 1 
ATOM   193  N  ND2 . ASN A 1 24  ? -20.771 30.536  14.441 1.00 18.33 ? 133  ASN A ND2 1 
ATOM   194  N  N   . VAL A 1 25  ? -24.716 26.807  14.623 1.00 14.48 ? 134  VAL A N   1 
ATOM   195  C  CA  A VAL A 1 25  ? -25.132 26.051  13.443 0.48 15.74 ? 134  VAL A CA  1 
ATOM   196  C  CA  B VAL A 1 25  ? -25.142 26.037  13.466 0.52 15.74 ? 134  VAL A CA  1 
ATOM   197  C  C   . VAL A 1 25  ? -26.034 26.868  12.528 1.00 19.30 ? 134  VAL A C   1 
ATOM   198  O  O   . VAL A 1 25  ? -25.981 26.726  11.293 1.00 12.26 ? 134  VAL A O   1 
ATOM   199  C  CB  A VAL A 1 25  ? -25.848 24.717  13.803 0.48 16.98 ? 134  VAL A CB  1 
ATOM   200  C  CB  B VAL A 1 25  ? -25.854 24.736  13.936 0.52 17.01 ? 134  VAL A CB  1 
ATOM   201  C  CG1 A VAL A 1 25  ? -24.898 23.787  14.549 0.48 15.72 ? 134  VAL A CG1 1 
ATOM   202  C  CG1 B VAL A 1 25  ? -26.587 24.073  12.811 0.52 16.16 ? 134  VAL A CG1 1 
ATOM   203  C  CG2 A VAL A 1 25  ? -27.126 24.970  14.600 0.48 17.93 ? 134  VAL A CG2 1 
ATOM   204  C  CG2 B VAL A 1 25  ? -24.839 23.772  14.541 0.52 15.71 ? 134  VAL A CG2 1 
ATOM   205  N  N   . LYS A 1 26  ? -26.845 27.747  13.107 1.00 18.67 ? 135  LYS A N   1 
ATOM   206  C  CA  . LYS A 1 26  ? -27.716 28.583  12.283 1.00 17.78 ? 135  LYS A CA  1 
ATOM   207  C  C   . LYS A 1 26  ? -26.883 29.381  11.293 1.00 19.50 ? 135  LYS A C   1 
ATOM   208  O  O   . LYS A 1 26  ? -27.272 29.556  10.148 1.00 17.89 ? 135  LYS A O   1 
ATOM   209  C  CB  . LYS A 1 26  ? -28.541 29.531  13.147 1.00 19.09 ? 135  LYS A CB  1 
ATOM   210  C  CG  . LYS A 1 26  ? -29.707 28.854  13.842 1.00 25.21 ? 135  LYS A CG  1 
ATOM   211  C  CD  . LYS A 1 26  ? -30.551 29.843  14.670 1.00 30.06 ? 135  LYS A CD  1 
ATOM   212  C  CE  . LYS A 1 26  ? -29.952 30.049  16.062 1.00 35.50 ? 135  LYS A CE  1 
ATOM   213  N  NZ  . LYS A 1 26  ? -30.609 31.156  16.820 1.00 44.12 ? 135  LYS A NZ  1 
ATOM   214  N  N   . ALA A 1 27  ? -25.728 29.861  11.737 1.00 18.00 ? 136  ALA A N   1 
ATOM   215  C  CA  . ALA A 1 27  ? -24.843 30.612  10.856 1.00 20.43 ? 136  ALA A CA  1 
ATOM   216  C  C   . ALA A 1 27  ? -24.395 29.787  9.636  1.00 20.88 ? 136  ALA A C   1 
ATOM   217  O  O   . ALA A 1 27  ? -24.193 30.344  8.551  1.00 24.00 ? 136  ALA A O   1 
ATOM   218  C  CB  . ALA A 1 27  ? -23.632 31.117  11.623 1.00 21.53 ? 136  ALA A CB  1 
ATOM   219  N  N   . ALA A 1 28  ? -24.220 28.478  9.801  1.00 19.19 ? 137  ALA A N   1 
ATOM   220  C  CA  . ALA A 1 28  ? -23.852 27.621  8.671  1.00 19.84 ? 137  ALA A CA  1 
ATOM   221  C  C   . ALA A 1 28  ? -25.043 27.366  7.760  1.00 22.92 ? 137  ALA A C   1 
ATOM   222  O  O   . ALA A 1 28  ? -24.926 27.409  6.527  1.00 21.54 ? 137  ALA A O   1 
ATOM   223  C  CB  . ALA A 1 28  ? -23.269 26.277  9.160  1.00 16.30 ? 137  ALA A CB  1 
ATOM   224  N  N   . TRP A 1 29  ? -26.184 27.072  8.373  1.00 18.02 ? 138  TRP A N   1 
ATOM   225  C  CA  . TRP A 1 29  ? -27.416 26.854  7.628  1.00 18.12 ? 138  TRP A CA  1 
ATOM   226  C  C   . TRP A 1 29  ? -27.720 28.082  6.761  1.00 21.75 ? 138  TRP A C   1 
ATOM   227  O  O   . TRP A 1 29  ? -28.095 27.963  5.606  1.00 24.04 ? 138  TRP A O   1 
ATOM   228  C  CB  . TRP A 1 29  ? -28.584 26.647  8.582  1.00 19.70 ? 138  TRP A CB  1 
ATOM   229  C  CG  . TRP A 1 29  ? -28.553 25.390  9.378  1.00 15.97 ? 138  TRP A CG  1 
ATOM   230  C  CD1 . TRP A 1 29  ? -27.800 24.285  9.141  1.00 16.97 ? 138  TRP A CD1 1 
ATOM   231  C  CD2 . TRP A 1 29  ? -29.330 25.111  10.542 1.00 18.35 ? 138  TRP A CD2 1 
ATOM   232  N  NE1 . TRP A 1 29  ? -28.054 23.330  10.084 1.00 17.76 ? 138  TRP A NE1 1 
ATOM   233  C  CE2 . TRP A 1 29  ? -28.996 23.807  10.959 1.00 14.64 ? 138  TRP A CE2 1 
ATOM   234  C  CE3 . TRP A 1 29  ? -30.285 25.834  11.272 1.00 17.46 ? 138  TRP A CE3 1 
ATOM   235  C  CZ2 . TRP A 1 29  ? -29.585 23.200  12.072 1.00 17.58 ? 138  TRP A CZ2 1 
ATOM   236  C  CZ3 . TRP A 1 29  ? -30.872 25.230  12.387 1.00 18.14 ? 138  TRP A CZ3 1 
ATOM   237  C  CH2 . TRP A 1 29  ? -30.525 23.926  12.769 1.00 16.19 ? 138  TRP A CH2 1 
ATOM   238  N  N   . ALA A 1 30  ? -27.550 29.259  7.335  1.00 21.99 ? 139  ALA A N   1 
ATOM   239  C  CA  . ALA A 1 30  ? -27.884 30.495  6.637  1.00 24.20 ? 139  ALA A CA  1 
ATOM   240  C  C   . ALA A 1 30  ? -26.943 30.770  5.443  1.00 28.93 ? 139  ALA A C   1 
ATOM   241  O  O   . ALA A 1 30  ? -27.341 31.443  4.490  1.00 30.31 ? 139  ALA A O   1 
ATOM   242  C  CB  . ALA A 1 30  ? -27.867 31.652  7.614  1.00 28.03 ? 139  ALA A CB  1 
ATOM   243  N  N   . GLN A 1 31  ? -25.711 30.263  5.521  1.00 24.96 ? 140  GLN A N   1 
ATOM   244  C  CA  . GLN A 1 31  ? -24.735 30.309  4.421  1.00 26.53 ? 140  GLN A CA  1 
ATOM   245  C  C   . GLN A 1 31  ? -25.085 29.250  3.372  1.00 28.44 ? 140  GLN A C   1 
ATOM   246  O  O   . GLN A 1 31  ? -24.430 29.155  2.327  1.00 34.77 ? 140  GLN A O   1 
ATOM   247  C  CB  . GLN A 1 31  ? -23.310 30.032  4.921  1.00 30.57 ? 140  GLN A CB  1 
ATOM   248  C  CG  . GLN A 1 31  ? -22.660 31.077  5.817  1.00 34.49 ? 140  GLN A CG  1 
ATOM   249  C  CD  . GLN A 1 31  ? -21.172 30.754  6.118  1.00 51.57 ? 140  GLN A CD  1 
ATOM   250  O  OE1 . GLN A 1 31  ? -20.772 30.483  7.278  1.00 44.66 ? 140  GLN A OE1 1 
ATOM   251  N  NE2 . GLN A 1 31  ? -20.341 30.793  5.065  1.00 53.71 ? 140  GLN A NE2 1 
ATOM   252  N  N   . GLY A 1 32  ? -26.104 28.442  3.648  1.00 25.31 ? 141  GLY A N   1 
ATOM   253  C  CA  . GLY A 1 32  ? -26.573 27.443  2.701  1.00 23.23 ? 141  GLY A CA  1 
ATOM   254  C  C   . GLY A 1 32  ? -26.087 26.016  2.911  1.00 20.73 ? 141  GLY A C   1 
ATOM   255  O  O   . GLY A 1 32  ? -26.297 25.160  2.059  1.00 20.93 ? 141  GLY A O   1 
ATOM   256  N  N   . TYR A 1 33  ? -25.450 25.756  4.049  1.00 19.57 ? 142  TYR A N   1 
ATOM   257  C  CA  . TYR A 1 33  ? -24.874 24.450  4.335  1.00 19.09 ? 142  TYR A CA  1 
ATOM   258  C  C   . TYR A 1 33  ? -25.723 23.731  5.384  1.00 19.39 ? 142  TYR A C   1 
ATOM   259  O  O   . TYR A 1 33  ? -25.790 24.161  6.537  1.00 17.69 ? 142  TYR A O   1 
ATOM   260  C  CB  . TYR A 1 33  ? -23.423 24.609  4.812  1.00 19.81 ? 142  TYR A CB  1 
ATOM   261  C  CG  . TYR A 1 33  ? -22.550 25.209  3.743  1.00 18.03 ? 142  TYR A CG  1 
ATOM   262  C  CD1 . TYR A 1 33  ? -22.119 24.443  2.675  1.00 21.12 ? 142  TYR A CD1 1 
ATOM   263  C  CD2 . TYR A 1 33  ? -22.205 26.545  3.775  1.00 28.23 ? 142  TYR A CD2 1 
ATOM   264  C  CE1 . TYR A 1 33  ? -21.332 24.990  1.665  1.00 23.28 ? 142  TYR A CE1 1 
ATOM   265  C  CE2 . TYR A 1 33  ? -21.414 27.102  2.781  1.00 29.23 ? 142  TYR A CE2 1 
ATOM   266  C  CZ  . TYR A 1 33  ? -20.989 26.318  1.729  1.00 27.89 ? 142  TYR A CZ  1 
ATOM   267  O  OH  . TYR A 1 33  ? -20.211 26.871  0.735  1.00 36.02 ? 142  TYR A OH  1 
ATOM   268  N  N   . THR A 1 34  ? -26.348 22.643  4.938  1.00 16.46 ? 143  THR A N   1 
ATOM   269  C  CA  . THR A 1 34  ? -27.246 21.815  5.716  1.00 18.86 ? 143  THR A CA  1 
ATOM   270  C  C   . THR A 1 34  ? -26.896 20.328  5.583  1.00 18.51 ? 143  THR A C   1 
ATOM   271  O  O   . THR A 1 34  ? -27.599 19.481  6.123  1.00 19.34 ? 143  THR A O   1 
ATOM   272  C  CB  . THR A 1 34  ? -28.695 22.023  5.223  1.00 20.96 ? 143  THR A CB  1 
ATOM   273  O  OG1 . THR A 1 34  ? -28.781 21.652  3.845  1.00 27.23 ? 143  THR A OG1 1 
ATOM   274  C  CG2 . THR A 1 34  ? -29.091 23.466  5.349  1.00 25.53 ? 143  THR A CG2 1 
ATOM   275  N  N   . GLY A 1 35  ? -25.786 20.011  4.911  1.00 16.20 ? 144  GLY A N   1 
ATOM   276  C  CA  . GLY A 1 35  ? -25.332 18.630  4.766  1.00 13.92 ? 144  GLY A CA  1 
ATOM   277  C  C   . GLY A 1 35  ? -25.665 17.912  3.462  1.00 16.80 ? 144  GLY A C   1 
ATOM   278  O  O   . GLY A 1 35  ? -25.437 16.697  3.345  1.00 17.86 ? 144  GLY A O   1 
ATOM   279  N  N   . HIS A 1 36  ? -26.223 18.620  2.483  1.00 17.77 ? 145  HIS A N   1 
ATOM   280  C  CA  A HIS A 1 36  ? -26.577 17.995  1.212  0.46 17.94 ? 145  HIS A CA  1 
ATOM   281  C  CA  B HIS A 1 36  ? -26.584 17.973  1.227  0.54 17.91 ? 145  HIS A CA  1 
ATOM   282  C  C   . HIS A 1 36  ? -25.382 17.225  0.651  1.00 17.21 ? 145  HIS A C   1 
ATOM   283  O  O   . HIS A 1 36  ? -24.267 17.765  0.580  1.00 15.23 ? 145  HIS A O   1 
ATOM   284  C  CB  A HIS A 1 36  ? -27.010 19.051  0.188  0.46 20.02 ? 145  HIS A CB  1 
ATOM   285  C  CB  B HIS A 1 36  ? -27.103 18.996  0.212  0.54 20.03 ? 145  HIS A CB  1 
ATOM   286  C  CG  A HIS A 1 36  ? -28.410 19.555  0.371  0.46 20.18 ? 145  HIS A CG  1 
ATOM   287  C  CG  B HIS A 1 36  ? -27.497 18.395  -1.104 0.54 19.61 ? 145  HIS A CG  1 
ATOM   288  N  ND1 A HIS A 1 36  ? -28.692 20.772  0.951  0.46 20.77 ? 145  HIS A ND1 1 
ATOM   289  N  ND1 B HIS A 1 36  ? -26.660 18.384  -2.200 0.54 23.96 ? 145  HIS A ND1 1 
ATOM   290  C  CD2 A HIS A 1 36  ? -29.606 19.018  0.026  0.46 20.57 ? 145  HIS A CD2 1 
ATOM   291  C  CD2 B HIS A 1 36  ? -28.639 17.782  -1.497 0.54 21.77 ? 145  HIS A CD2 1 
ATOM   292  C  CE1 A HIS A 1 36  ? -30.001 20.960  0.964  0.46 20.36 ? 145  HIS A CE1 1 
ATOM   293  C  CE1 B HIS A 1 36  ? -27.266 17.785  -3.210 0.54 20.03 ? 145  HIS A CE1 1 
ATOM   294  N  NE2 A HIS A 1 36  ? -30.576 19.911  0.406  0.46 19.43 ? 145  HIS A NE2 1 
ATOM   295  N  NE2 B HIS A 1 36  ? -28.468 17.415  -2.811 0.54 22.26 ? 145  HIS A NE2 1 
ATOM   296  N  N   . GLY A 1 37  ? -25.615 15.974  0.262  1.00 15.92 ? 146  GLY A N   1 
ATOM   297  C  CA  . GLY A 1 37  ? -24.632 15.179  -0.449 1.00 18.03 ? 146  GLY A CA  1 
ATOM   298  C  C   . GLY A 1 37  ? -23.642 14.455  0.429  1.00 19.65 ? 146  GLY A C   1 
ATOM   299  O  O   . GLY A 1 37  ? -22.805 13.699  -0.051 1.00 16.98 ? 146  GLY A O   1 
ATOM   300  N  N   . ILE A 1 38  ? -23.732 14.699  1.731  1.00 20.25 ? 147  ILE A N   1 
ATOM   301  C  CA  . ILE A 1 38  ? -22.856 14.057  2.694  1.00 18.75 ? 147  ILE A CA  1 
ATOM   302  C  C   . ILE A 1 38  ? -23.593 12.891  3.331  1.00 16.95 ? 147  ILE A C   1 
ATOM   303  O  O   . ILE A 1 38  ? -24.807 12.959  3.555  1.00 16.65 ? 147  ILE A O   1 
ATOM   304  C  CB  . ILE A 1 38  ? -22.412 15.053  3.781  1.00 13.57 ? 147  ILE A CB  1 
ATOM   305  C  CG1 . ILE A 1 38  ? -21.762 16.287  3.146  1.00 15.92 ? 147  ILE A CG1 1 
ATOM   306  C  CG2 . ILE A 1 38  ? -21.446 14.386  4.756  1.00 14.99 ? 147  ILE A CG2 1 
ATOM   307  C  CD1 . ILE A 1 38  ? -20.555 15.987  2.282  1.00 16.88 ? 147  ILE A CD1 1 
ATOM   308  N  N   . VAL A 1 39  ? -22.830 11.858  3.676  1.00 14.23 ? 148  VAL A N   1 
ATOM   309  C  CA  . VAL A 1 39  ? -23.349 10.585  4.174  1.00 16.18 ? 148  VAL A CA  1 
ATOM   310  C  C   . VAL A 1 39  ? -22.673 10.248  5.487  1.00 15.32 ? 148  VAL A C   1 
ATOM   311  O  O   . VAL A 1 39  ? -21.439 10.166  5.537  1.00 14.84 ? 148  VAL A O   1 
ATOM   312  C  CB  . VAL A 1 39  ? -23.073 9.417   3.207  1.00 14.02 ? 148  VAL A CB  1 
ATOM   313  C  CG1 . VAL A 1 39  ? -23.590 8.109   3.781  1.00 14.82 ? 148  VAL A CG1 1 
ATOM   314  C  CG2 . VAL A 1 39  ? -23.724 9.689   1.872  1.00 17.23 ? 148  VAL A CG2 1 
ATOM   315  N  N   . VAL A 1 40  ? -23.480 10.024  6.532  1.00 15.74 ? 149  VAL A N   1 
ATOM   316  C  CA  . VAL A 1 40  ? -22.969 9.750   7.885  1.00 13.46 ? 149  VAL A CA  1 
ATOM   317  C  C   . VAL A 1 40  ? -23.543 8.429   8.393  1.00 13.56 ? 149  VAL A C   1 
ATOM   318  O  O   . VAL A 1 40  ? -24.700 8.104   8.122  1.00 15.95 ? 149  VAL A O   1 
ATOM   319  C  CB  . VAL A 1 40  ? -23.371 10.877  8.877  1.00 12.45 ? 149  VAL A CB  1 
ATOM   320  C  CG1 . VAL A 1 40  ? -22.759 10.619  10.272 1.00 13.49 ? 149  VAL A CG1 1 
ATOM   321  C  CG2 . VAL A 1 40  ? -22.997 12.265  8.304  1.00 12.15 ? 149  VAL A CG2 1 
ATOM   322  N  N   . SER A 1 41  ? -22.744 7.646   9.103  1.00 14.45 ? 150  SER A N   1 
ATOM   323  C  CA  . SER A 1 41  ? -23.231 6.382   9.618  1.00 13.19 ? 150  SER A CA  1 
ATOM   324  C  C   . SER A 1 41  ? -22.950 6.217   11.121 1.00 14.67 ? 150  SER A C   1 
ATOM   325  O  O   . SER A 1 41  ? -21.836 6.450   11.571 1.00 13.77 ? 150  SER A O   1 
ATOM   326  C  CB  . SER A 1 41  ? -22.629 5.228   8.828  1.00 17.89 ? 150  SER A CB  1 
ATOM   327  O  OG  . SER A 1 41  ? -23.105 3.990   9.312  1.00 16.98 ? 150  SER A OG  1 
ATOM   328  N  N   . ILE A 1 42  ? -23.978 5.831   11.878 1.00 14.83 ? 151  ILE A N   1 
ATOM   329  C  CA  . ILE A 1 42  ? -23.889 5.611   13.340 1.00 12.92 ? 151  ILE A CA  1 
ATOM   330  C  C   . ILE A 1 42  ? -23.521 4.169   13.623 1.00 13.08 ? 151  ILE A C   1 
ATOM   331  O  O   . ILE A 1 42  ? -24.298 3.279   13.321 1.00 14.10 ? 151  ILE A O   1 
ATOM   332  C  CB  . ILE A 1 42  ? -25.263 5.868   14.019 1.00 12.38 ? 151  ILE A CB  1 
ATOM   333  C  CG1 . ILE A 1 42  ? -25.795 7.265   13.669 1.00 14.72 ? 151  ILE A CG1 1 
ATOM   334  C  CG2 . ILE A 1 42  ? -25.168 5.737   15.489 1.00 16.54 ? 151  ILE A CG2 1 
ATOM   335  C  CD1 . ILE A 1 42  ? -24.780 8.419   13.985 1.00 15.36 ? 151  ILE A CD1 1 
ATOM   336  N  N   . LEU A 1 43  ? -22.337 3.926   14.189 1.00 12.84 ? 152  LEU A N   1 
ATOM   337  C  CA  . LEU A 1 43  ? -21.913 2.561   14.494 1.00 13.28 ? 152  LEU A CA  1 
ATOM   338  C  C   . LEU A 1 43  ? -22.343 2.266   15.931 1.00 19.10 ? 152  LEU A C   1 
ATOM   339  O  O   . LEU A 1 43  ? -21.694 2.697   16.893 1.00 14.36 ? 152  LEU A O   1 
ATOM   340  C  CB  . LEU A 1 43  ? -20.403 2.384   14.330 1.00 14.59 ? 152  LEU A CB  1 
ATOM   341  C  CG  . LEU A 1 43  ? -19.748 2.867   13.035 1.00 15.75 ? 152  LEU A CG  1 
ATOM   342  C  CD1 . LEU A 1 43  ? -18.256 2.549   13.017 1.00 16.89 ? 152  LEU A CD1 1 
ATOM   343  C  CD2 . LEU A 1 43  ? -20.424 2.274   11.833 1.00 17.90 ? 152  LEU A CD2 1 
ATOM   344  N  N   . ASP A 1 44  ? -23.456 1.557   16.083 1.00 16.06 ? 153  ASP A N   1 
ATOM   345  C  CA  . ASP A 1 44  ? -24.033 1.412   17.425 1.00 14.86 ? 153  ASP A CA  1 
ATOM   346  C  C   . ASP A 1 44  ? -25.005 0.209   17.483 1.00 17.04 ? 153  ASP A C   1 
ATOM   347  O  O   . ASP A 1 44  ? -24.687 -0.862  16.944 1.00 15.55 ? 153  ASP A O   1 
ATOM   348  C  CB  . ASP A 1 44  ? -24.698 2.731   17.842 1.00 14.66 ? 153  ASP A CB  1 
ATOM   349  C  CG  . ASP A 1 44  ? -24.839 2.861   19.348 1.00 21.63 ? 153  ASP A CG  1 
ATOM   350  O  OD1 . ASP A 1 44  ? -25.797 2.308   19.876 1.00 14.54 ? 153  ASP A OD1 1 
ATOM   351  O  OD2 . ASP A 1 44  ? -23.988 3.500   20.014 1.00 24.75 ? 153  ASP A OD2 1 
ATOM   352  N  N   . ASP A 1 45  ? -26.157 0.367   18.136 1.00 14.73 ? 154  ASP A N   1 
ATOM   353  C  CA  . ASP A 1 45  ? -27.030 -0.774  18.415 1.00 15.39 ? 154  ASP A CA  1 
ATOM   354  C  C   . ASP A 1 45  ? -28.138 -0.931  17.379 1.00 16.57 ? 154  ASP A C   1 
ATOM   355  O  O   . ASP A 1 45  ? -29.090 -1.706  17.581 1.00 15.66 ? 154  ASP A O   1 
ATOM   356  C  CB  . ASP A 1 45  ? -27.607 -0.651  19.825 1.00 15.99 ? 154  ASP A CB  1 
ATOM   357  C  CG  . ASP A 1 45  ? -28.345 0.670   20.048 1.00 16.36 ? 154  ASP A CG  1 
ATOM   358  O  OD1 . ASP A 1 45  ? -28.667 1.343   19.054 1.00 13.05 ? 154  ASP A OD1 1 
ATOM   359  O  OD2 . ASP A 1 45  ? -28.622 1.028   21.224 1.00 15.93 ? 154  ASP A OD2 1 
ATOM   360  N  N   . GLY A 1 46  ? -28.004 -0.203  16.270 1.00 14.98 ? 155  GLY A N   1 
ATOM   361  C  CA  . GLY A 1 46  ? -28.991 -0.202  15.198 1.00 14.93 ? 155  GLY A CA  1 
ATOM   362  C  C   . GLY A 1 46  ? -29.679 1.146   14.983 1.00 17.09 ? 155  GLY A C   1 
ATOM   363  O  O   . GLY A 1 46  ? -29.481 2.103   15.728 1.00 14.94 ? 155  GLY A O   1 
ATOM   364  N  N   . ILE A 1 47  ? -30.500 1.223   13.941 1.00 16.37 ? 156  ILE A N   1 
ATOM   365  C  CA  . ILE A 1 47  ? -31.209 2.450   13.637 1.00 14.46 ? 156  ILE A CA  1 
ATOM   366  C  C   . ILE A 1 47  ? -32.638 2.165   13.171 1.00 17.76 ? 156  ILE A C   1 
ATOM   367  O  O   . ILE A 1 47  ? -32.882 1.294   12.342 1.00 16.31 ? 156  ILE A O   1 
ATOM   368  C  CB  . ILE A 1 47  ? -30.437 3.299   12.599 1.00 19.39 ? 156  ILE A CB  1 
ATOM   369  C  CG1 . ILE A 1 47  ? -31.197 4.578   12.253 1.00 20.18 ? 156  ILE A CG1 1 
ATOM   370  C  CG2 . ILE A 1 47  ? -30.209 2.515   11.340 1.00 17.37 ? 156  ILE A CG2 1 
ATOM   371  C  CD1 . ILE A 1 47  ? -30.416 5.522   11.343 1.00 16.35 ? 156  ILE A CD1 1 
ATOM   372  N  N   . GLU A 1 48  ? -33.579 2.903   13.749 1.00 17.00 ? 157  GLU A N   1 
ATOM   373  C  CA  . GLU A 1 48  ? -34.977 2.773   13.413 1.00 16.19 ? 157  GLU A CA  1 
ATOM   374  C  C   . GLU A 1 48  ? -35.233 3.543   12.112 1.00 17.15 ? 157  GLU A C   1 
ATOM   375  O  O   . GLU A 1 48  ? -35.630 4.693   12.124 1.00 17.54 ? 157  GLU A O   1 
ATOM   376  C  CB  . GLU A 1 48  ? -35.826 3.295   14.589 1.00 16.38 ? 157  GLU A CB  1 
ATOM   377  C  CG  . GLU A 1 48  ? -37.314 3.039   14.436 1.00 18.90 ? 157  GLU A CG  1 
ATOM   378  C  CD  . GLU A 1 48  ? -38.090 3.346   15.693 1.00 18.06 ? 157  GLU A CD  1 
ATOM   379  O  OE1 . GLU A 1 48  ? -38.477 4.515   15.855 1.00 20.14 ? 157  GLU A OE1 1 
ATOM   380  O  OE2 . GLU A 1 48  ? -38.300 2.417   16.508 1.00 16.47 ? 157  GLU A OE2 1 
ATOM   381  N  N   . LYS A 1 49  ? -34.974 2.890   10.977 1.00 16.82 ? 158  LYS A N   1 
ATOM   382  C  CA  . LYS A 1 49  ? -34.956 3.576   9.689  1.00 17.43 ? 158  LYS A CA  1 
ATOM   383  C  C   . LYS A 1 49  ? -36.296 4.137   9.263  1.00 18.89 ? 158  LYS A C   1 
ATOM   384  O  O   . LYS A 1 49  ? -36.343 5.045   8.423  1.00 21.46 ? 158  LYS A O   1 
ATOM   385  C  CB  . LYS A 1 49  ? -34.433 2.647   8.603  1.00 19.62 ? 158  LYS A CB  1 
ATOM   386  C  CG  . LYS A 1 49  ? -35.350 1.482   8.282  1.00 19.09 ? 158  LYS A CG  1 
ATOM   387  C  CD  . LYS A 1 49  ? -34.690 0.556   7.261  1.00 23.07 ? 158  LYS A CD  1 
ATOM   388  C  CE  . LYS A 1 49  ? -35.518 -0.665  7.020  1.00 24.99 ? 158  LYS A CE  1 
ATOM   389  N  NZ  . LYS A 1 49  ? -35.529 -1.536  8.220  1.00 29.10 ? 158  LYS A NZ  1 
ATOM   390  N  N   . ASN A 1 50  ? -37.372 3.599   9.840  1.00 19.77 ? 159  ASN A N   1 
ATOM   391  C  CA  . ASN A 1 50  ? -38.739 4.053   9.563  1.00 21.02 ? 159  ASN A CA  1 
ATOM   392  C  C   . ASN A 1 50  ? -39.210 5.131   10.544 1.00 22.29 ? 159  ASN A C   1 
ATOM   393  O  O   . ASN A 1 50  ? -40.367 5.545   10.530 1.00 18.50 ? 159  ASN A O   1 
ATOM   394  C  CB  . ASN A 1 50  ? -39.696 2.873   9.662  1.00 26.33 ? 159  ASN A CB  1 
ATOM   395  C  CG  . ASN A 1 50  ? -39.616 2.166   11.020 1.00 34.94 ? 159  ASN A CG  1 
ATOM   396  O  OD1 . ASN A 1 50  ? -38.522 1.809   11.508 1.00 31.91 ? 159  ASN A OD1 1 
ATOM   397  N  ND2 . ASN A 1 50  ? -40.774 1.949   11.632 1.00 38.37 ? 159  ASN A ND2 1 
ATOM   398  N  N   . HIS A 1 51  ? -38.320 5.594   11.415 1.00 19.51 ? 160  HIS A N   1 
ATOM   399  C  CA  . HIS A 1 51  ? -38.684 6.716   12.260 1.00 21.45 ? 160  HIS A CA  1 
ATOM   400  C  C   . HIS A 1 51  ? -39.152 7.905   11.400 1.00 17.66 ? 160  HIS A C   1 
ATOM   401  O  O   . HIS A 1 51  ? -38.483 8.268   10.430 1.00 16.69 ? 160  HIS A O   1 
ATOM   402  C  CB  . HIS A 1 51  ? -37.513 7.121   13.168 1.00 16.52 ? 160  HIS A CB  1 
ATOM   403  C  CG  . HIS A 1 51  ? -37.934 7.971   14.315 1.00 14.80 ? 160  HIS A CG  1 
ATOM   404  N  ND1 . HIS A 1 51  ? -38.360 9.266   14.140 1.00 15.61 ? 160  HIS A ND1 1 
ATOM   405  C  CD2 . HIS A 1 51  ? -38.027 7.721   15.641 1.00 17.87 ? 160  HIS A CD2 1 
ATOM   406  C  CE1 . HIS A 1 51  ? -38.685 9.789   15.309 1.00 17.10 ? 160  HIS A CE1 1 
ATOM   407  N  NE2 . HIS A 1 51  ? -38.484 8.871   16.241 1.00 16.67 ? 160  HIS A NE2 1 
ATOM   408  N  N   . PRO A 1 52  ? -40.303 8.511   11.748 1.00 16.98 ? 161  PRO A N   1 
ATOM   409  C  CA  . PRO A 1 52  ? -40.845 9.665   10.999 1.00 17.15 ? 161  PRO A CA  1 
ATOM   410  C  C   . PRO A 1 52  ? -39.873 10.835  10.827 1.00 19.51 ? 161  PRO A C   1 
ATOM   411  O  O   . PRO A 1 52  ? -39.992 11.548  9.838  1.00 17.27 ? 161  PRO A O   1 
ATOM   412  C  CB  . PRO A 1 52  ? -42.041 10.133  11.856 1.00 17.81 ? 161  PRO A CB  1 
ATOM   413  C  CG  . PRO A 1 52  ? -42.350 9.028   12.750 1.00 23.42 ? 161  PRO A CG  1 
ATOM   414  C  CD  . PRO A 1 52  ? -41.129 8.190   12.926 1.00 18.79 ? 161  PRO A CD  1 
ATOM   415  N  N   . ASP A 1 53  ? -38.983 11.079  11.790 1.00 16.61 ? 162  ASP A N   1 
ATOM   416  C  CA  . ASP A 1 53  ? -37.908 12.074  11.630 1.00 15.09 ? 162  ASP A CA  1 
ATOM   417  C  C   . ASP A 1 53  ? -36.563 11.598  11.035 1.00 15.16 ? 162  ASP A C   1 
ATOM   418  O  O   . ASP A 1 53  ? -35.652 12.416  10.864 1.00 16.66 ? 162  ASP A O   1 
ATOM   419  C  CB  . ASP A 1 53  ? -37.670 12.805  12.954 1.00 13.02 ? 162  ASP A CB  1 
ATOM   420  C  CG  . ASP A 1 53  ? -37.740 14.317  12.823 1.00 15.81 ? 162  ASP A CG  1 
ATOM   421  O  OD1 . ASP A 1 53  ? -38.356 14.834  11.855 1.00 16.74 ? 162  ASP A OD1 1 
ATOM   422  O  OD2 . ASP A 1 53  ? -37.172 15.016  13.697 1.00 17.36 ? 162  ASP A OD2 1 
ATOM   423  N  N   . LEU A 1 54  ? -36.453 10.309  10.705 1.00 15.12 ? 163  LEU A N   1 
ATOM   424  C  CA  . LEU A 1 54  ? -35.281 9.787   9.996  1.00 15.64 ? 163  LEU A CA  1 
ATOM   425  C  C   . LEU A 1 54  ? -35.549 9.286   8.569  1.00 19.65 ? 163  LEU A C   1 
ATOM   426  O  O   . LEU A 1 54  ? -34.687 9.419   7.692  1.00 15.51 ? 163  LEU A O   1 
ATOM   427  C  CB  . LEU A 1 54  ? -34.670 8.628   10.774 1.00 13.79 ? 163  LEU A CB  1 
ATOM   428  C  CG  . LEU A 1 54  ? -34.175 8.960   12.188 1.00 15.24 ? 163  LEU A CG  1 
ATOM   429  C  CD1 . LEU A 1 54  ? -33.597 7.709   12.827 1.00 16.29 ? 163  LEU A CD1 1 
ATOM   430  C  CD2 . LEU A 1 54  ? -33.142 10.068  12.136 1.00 16.52 ? 163  LEU A CD2 1 
ATOM   431  N  N   . ALA A 1 55  ? -36.723 8.689   8.338  1.00 16.16 ? 164  ALA A N   1 
ATOM   432  C  CA  . ALA A 1 55  ? -36.968 7.974   7.081  1.00 16.23 ? 164  ALA A CA  1 
ATOM   433  C  C   . ALA A 1 55  ? -36.623 8.817   5.852  1.00 16.29 ? 164  ALA A C   1 
ATOM   434  O  O   . ALA A 1 55  ? -36.128 8.302   4.854  1.00 17.52 ? 164  ALA A O   1 
ATOM   435  C  CB  . ALA A 1 55  ? -38.440 7.496   7.018  1.00 18.38 ? 164  ALA A CB  1 
ATOM   436  N  N   . GLY A 1 56  ? -36.895 10.109  5.919  1.00 16.51 ? 165  GLY A N   1 
ATOM   437  C  CA  . GLY A 1 56  ? -36.697 10.990  4.782  1.00 19.21 ? 165  GLY A CA  1 
ATOM   438  C  C   . GLY A 1 56  ? -35.233 11.137  4.393  1.00 21.91 ? 165  GLY A C   1 
ATOM   439  O  O   . GLY A 1 56  ? -34.921 11.459  3.240  1.00 16.56 ? 165  GLY A O   1 
ATOM   440  N  N   . ASN A 1 57  ? -34.343 10.920  5.360  1.00 14.95 ? 166  ASN A N   1 
ATOM   441  C  CA  . ASN A 1 57  ? -32.897 11.022  5.119  1.00 17.66 ? 166  ASN A CA  1 
ATOM   442  C  C   . ASN A 1 57  ? -32.188 9.671   5.188  1.00 17.60 ? 166  ASN A C   1 
ATOM   443  O  O   . ASN A 1 57  ? -30.969 9.607   5.043  1.00 17.15 ? 166  ASN A O   1 
ATOM   444  C  CB  . ASN A 1 57  ? -32.274 11.967  6.138  1.00 13.34 ? 166  ASN A CB  1 
ATOM   445  C  CG  . ASN A 1 57  ? -32.612 13.414  5.865  1.00 19.05 ? 166  ASN A CG  1 
ATOM   446  O  OD1 . ASN A 1 57  ? -32.953 13.769  4.738  1.00 19.08 ? 166  ASN A OD1 1 
ATOM   447  N  ND2 . ASN A 1 57  ? -32.509 14.267  6.887  1.00 15.45 ? 166  ASN A ND2 1 
ATOM   448  N  N   . TYR A 1 58  ? -32.932 8.588   5.413  1.00 19.41 ? 167  TYR A N   1 
ATOM   449  C  CA  . TYR A 1 58  ? -32.296 7.285   5.609  1.00 15.26 ? 167  TYR A CA  1 
ATOM   450  C  C   . TYR A 1 58  ? -31.615 6.781   4.351  1.00 21.99 ? 167  TYR A C   1 
ATOM   451  O  O   . TYR A 1 58  ? -32.139 6.913   3.242  1.00 18.51 ? 167  TYR A O   1 
ATOM   452  C  CB  . TYR A 1 58  ? -33.303 6.242   6.056  1.00 19.47 ? 167  TYR A CB  1 
ATOM   453  C  CG  . TYR A 1 58  ? -32.692 4.868   6.235  1.00 19.47 ? 167  TYR A CG  1 
ATOM   454  C  CD1 . TYR A 1 58  ? -31.886 4.587   7.322  1.00 16.01 ? 167  TYR A CD1 1 
ATOM   455  C  CD2 . TYR A 1 58  ? -32.923 3.854   5.308  1.00 16.49 ? 167  TYR A CD2 1 
ATOM   456  C  CE1 . TYR A 1 58  ? -31.332 3.348   7.483  1.00 17.35 ? 167  TYR A CE1 1 
ATOM   457  C  CE2 . TYR A 1 58  ? -32.375 2.619   5.470  1.00 18.25 ? 167  TYR A CE2 1 
ATOM   458  C  CZ  . TYR A 1 58  ? -31.590 2.365   6.561  1.00 17.04 ? 167  TYR A CZ  1 
ATOM   459  O  OH  . TYR A 1 58  ? -31.035 1.124   6.733  1.00 19.20 ? 167  TYR A OH  1 
ATOM   460  N  N   . ASP A 1 59  ? -30.454 6.177   4.537  1.00 19.54 ? 168  ASP A N   1 
ATOM   461  C  CA  . ASP A 1 59  ? -29.654 5.709   3.420  1.00 19.49 ? 168  ASP A CA  1 
ATOM   462  C  C   . ASP A 1 59  ? -29.208 4.285   3.661  1.00 16.46 ? 168  ASP A C   1 
ATOM   463  O  O   . ASP A 1 59  ? -28.340 4.020   4.506  1.00 19.43 ? 168  ASP A O   1 
ATOM   464  C  CB  . ASP A 1 59  ? -28.451 6.618   3.243  1.00 20.29 ? 168  ASP A CB  1 
ATOM   465  C  CG  . ASP A 1 59  ? -27.581 6.235   2.059  1.00 21.90 ? 168  ASP A CG  1 
ATOM   466  O  OD1 . ASP A 1 59  ? -27.917 5.300   1.279  1.00 21.17 ? 168  ASP A OD1 1 
ATOM   467  O  OD2 . ASP A 1 59  ? -26.551 6.900   1.914  1.00 20.61 ? 168  ASP A OD2 1 
ATOM   468  N  N   . PRO A 1 60  ? -29.806 3.341   2.921  1.00 19.15 ? 169  PRO A N   1 
ATOM   469  C  CA  . PRO A 1 60  ? -29.442 1.930   3.059  1.00 17.61 ? 169  PRO A CA  1 
ATOM   470  C  C   . PRO A 1 60  ? -27.986 1.732   2.711  1.00 18.22 ? 169  PRO A C   1 
ATOM   471  O  O   . PRO A 1 60  ? -27.395 0.772   3.193  1.00 19.06 ? 169  PRO A O   1 
ATOM   472  C  CB  . PRO A 1 60  ? -30.304 1.229   2.002  1.00 21.96 ? 169  PRO A CB  1 
ATOM   473  C  CG  . PRO A 1 60  ? -31.373 2.166   1.685  1.00 23.63 ? 169  PRO A CG  1 
ATOM   474  C  CD  . PRO A 1 60  ? -30.852 3.550   1.914  1.00 20.40 ? 169  PRO A CD  1 
ATOM   475  N  N   . GLY A 1 61  ? -27.433 2.630   1.886  1.00 18.00 ? 170  GLY A N   1 
ATOM   476  C  CA  . GLY A 1 61  ? -26.055 2.530   1.449  1.00 19.25 ? 170  GLY A CA  1 
ATOM   477  C  C   . GLY A 1 61  ? -25.088 2.831   2.583  1.00 19.67 ? 170  GLY A C   1 
ATOM   478  O  O   . GLY A 1 61  ? -23.906 2.490   2.510  1.00 21.77 ? 170  GLY A O   1 
ATOM   479  N  N   . ALA A 1 62  ? -25.590 3.478   3.628  1.00 16.96 ? 171  ALA A N   1 
ATOM   480  C  CA  . ALA A 1 62  ? -24.781 3.841   4.784  1.00 14.96 ? 171  ALA A CA  1 
ATOM   481  C  C   . ALA A 1 62  ? -25.023 2.907   5.959  1.00 17.49 ? 171  ALA A C   1 
ATOM   482  O  O   . ALA A 1 62  ? -24.564 3.171   7.075  1.00 20.57 ? 171  ALA A O   1 
ATOM   483  C  CB  . ALA A 1 62  ? -25.093 5.262   5.191  1.00 16.37 ? 171  ALA A CB  1 
ATOM   484  N  N   . SER A 1 63  ? -25.750 1.811   5.724  1.00 17.12 ? 172  SER A N   1 
ATOM   485  C  CA  . SER A 1 63  ? -26.190 0.964   6.814  1.00 18.00 ? 172  SER A CA  1 
ATOM   486  C  C   . SER A 1 63  ? -25.903 -0.489  6.569  1.00 20.81 ? 172  SER A C   1 
ATOM   487  O  O   . SER A 1 63  ? -25.860 -0.949  5.423  1.00 20.45 ? 172  SER A O   1 
ATOM   488  C  CB  . SER A 1 63  ? -27.701 1.130   7.036  1.00 18.76 ? 172  SER A CB  1 
ATOM   489  O  OG  . SER A 1 63  ? -28.046 2.490   7.174  1.00 17.82 ? 172  SER A OG  1 
ATOM   490  N  N   . PHE A 1 64  ? -25.716 -1.210  7.662  1.00 16.94 ? 173  PHE A N   1 
ATOM   491  C  CA  . PHE A 1 64  ? -25.592 -2.651  7.625  1.00 18.67 ? 173  PHE A CA  1 
ATOM   492  C  C   . PHE A 1 64  ? -25.879 -3.245  9.001  1.00 20.33 ? 173  PHE A C   1 
ATOM   493  O  O   . PHE A 1 64  ? -25.907 -2.530  10.021 1.00 21.21 ? 173  PHE A O   1 
ATOM   494  C  CB  . PHE A 1 64  ? -24.199 -3.072  7.141  1.00 21.64 ? 173  PHE A CB  1 
ATOM   495  C  CG  . PHE A 1 64  ? -24.136 -4.490  6.652  1.00 21.14 ? 173  PHE A CG  1 
ATOM   496  C  CD1 . PHE A 1 64  ? -24.668 -4.828  5.420  1.00 23.14 ? 173  PHE A CD1 1 
ATOM   497  C  CD2 . PHE A 1 64  ? -23.545 -5.483  7.419  1.00 22.08 ? 173  PHE A CD2 1 
ATOM   498  C  CE1 . PHE A 1 64  ? -24.623 -6.156  4.967  1.00 27.54 ? 173  PHE A CE1 1 
ATOM   499  C  CE2 . PHE A 1 64  ? -23.491 -6.806  6.963  1.00 24.08 ? 173  PHE A CE2 1 
ATOM   500  C  CZ  . PHE A 1 64  ? -24.032 -7.133  5.748  1.00 19.54 ? 173  PHE A CZ  1 
ATOM   501  N  N   . ASP A 1 65  ? -26.115 -4.556  9.032  1.00 20.36 ? 174  ASP A N   1 
ATOM   502  C  CA  . ASP A 1 65  ? -26.323 -5.269  10.285 1.00 19.41 ? 174  ASP A CA  1 
ATOM   503  C  C   . ASP A 1 65  ? -25.237 -6.315  10.403 1.00 19.03 ? 174  ASP A C   1 
ATOM   504  O  O   . ASP A 1 65  ? -25.313 -7.389  9.774  1.00 18.98 ? 174  ASP A O   1 
ATOM   505  C  CB  . ASP A 1 65  ? -27.723 -5.900  10.324 1.00 20.75 ? 174  ASP A CB  1 
ATOM   506  C  CG  . ASP A 1 65  ? -28.023 -6.579  11.643 1.00 19.64 ? 174  ASP A CG  1 
ATOM   507  O  OD1 . ASP A 1 65  ? -27.055 -6.893  12.402 1.00 17.41 ? 174  ASP A OD1 1 
ATOM   508  O  OD2 . ASP A 1 65  ? -29.230 -6.829  11.909 1.00 20.27 ? 174  ASP A OD2 1 
ATOM   509  N  N   . VAL A 1 66  ? -24.202 -5.984  11.176 1.00 16.72 ? 175  VAL A N   1 
ATOM   510  C  CA  . VAL A 1 66  ? -23.071 -6.878  11.367 1.00 17.88 ? 175  VAL A CA  1 
ATOM   511  C  C   . VAL A 1 66  ? -23.409 -7.950  12.385 1.00 20.73 ? 175  VAL A C   1 
ATOM   512  O  O   . VAL A 1 66  ? -22.814 -9.038  12.393 1.00 21.02 ? 175  VAL A O   1 
ATOM   513  C  CB  . VAL A 1 66  ? -21.815 -6.088  11.816 1.00 19.14 ? 175  VAL A CB  1 
ATOM   514  C  CG1 . VAL A 1 66  ? -20.663 -7.018  12.147 1.00 19.35 ? 175  VAL A CG1 1 
ATOM   515  C  CG2 . VAL A 1 66  ? -21.416 -5.129  10.718 1.00 17.53 ? 175  VAL A CG2 1 
ATOM   516  N  N   . ASN A 1 67  ? -24.353 -7.662  13.269 1.00 18.92 ? 176  ASN A N   1 
ATOM   517  C  CA  . ASN A 1 67  ? -24.695 -8.664  14.272 1.00 22.90 ? 176  ASN A CA  1 
ATOM   518  C  C   . ASN A 1 67  ? -25.362 -9.873  13.599 1.00 18.75 ? 176  ASN A C   1 
ATOM   519  O  O   . ASN A 1 67  ? -25.064 -11.008 13.942 1.00 22.90 ? 176  ASN A O   1 
ATOM   520  C  CB  . ASN A 1 67  ? -25.611 -8.098  15.373 1.00 18.81 ? 176  ASN A CB  1 
ATOM   521  C  CG  . ASN A 1 67  ? -24.927 -7.052  16.242 1.00 18.04 ? 176  ASN A CG  1 
ATOM   522  O  OD1 . ASN A 1 67  ? -25.424 -5.945  16.361 1.00 19.94 ? 176  ASN A OD1 1 
ATOM   523  N  ND2 . ASN A 1 67  ? -23.787 -7.400  16.848 1.00 16.63 ? 176  ASN A ND2 1 
ATOM   524  N  N   . ASP A 1 68  ? -26.266 -9.614  12.661 1.00 19.69 ? 177  ASP A N   1 
ATOM   525  C  CA  . ASP A 1 68  ? -27.011 -10.682 11.986 1.00 21.11 ? 177  ASP A CA  1 
ATOM   526  C  C   . ASP A 1 68  ? -26.531 -10.935 10.560 1.00 23.74 ? 177  ASP A C   1 
ATOM   527  O  O   . ASP A 1 68  ? -27.031 -11.842 9.890  1.00 24.58 ? 177  ASP A O   1 
ATOM   528  C  CB  . ASP A 1 68  ? -28.514 -10.374 11.943 1.00 19.11 ? 177  ASP A CB  1 
ATOM   529  C  CG  . ASP A 1 68  ? -29.186 -10.529 13.307 1.00 22.25 ? 177  ASP A CG  1 
ATOM   530  O  OD1 . ASP A 1 68  ? -28.524 -10.976 14.289 1.00 19.00 ? 177  ASP A OD1 1 
ATOM   531  O  OD2 . ASP A 1 68  ? -30.393 -10.188 13.375 1.00 23.81 ? 177  ASP A OD2 1 
ATOM   532  N  N   . GLN A 1 69  ? -25.573 -10.133 10.106 1.00 20.23 ? 178  GLN A N   1 
ATOM   533  C  CA  . GLN A 1 69  ? -25.005 -10.265 8.768  1.00 22.30 ? 178  GLN A CA  1 
ATOM   534  C  C   . GLN A 1 69  ? -26.088 -10.157 7.718  1.00 23.12 ? 178  GLN A C   1 
ATOM   535  O  O   . GLN A 1 69  ? -26.297 -11.093 6.966  1.00 24.87 ? 178  GLN A O   1 
ATOM   536  C  CB  . GLN A 1 69  ? -24.229 -11.588 8.643  1.00 26.22 ? 178  GLN A CB  1 
ATOM   537  C  CG  . GLN A 1 69  ? -23.302 -11.828 9.858  1.00 31.43 ? 178  GLN A CG  1 
ATOM   538  C  CD  . GLN A 1 69  ? -22.184 -12.849 9.635  1.00 44.55 ? 178  GLN A CD  1 
ATOM   539  O  OE1 . GLN A 1 69  ? -22.019 -13.391 8.536  1.00 54.02 ? 178  GLN A OE1 1 
ATOM   540  N  NE2 . GLN A 1 69  ? -21.393 -13.096 10.686 1.00 38.47 ? 178  GLN A NE2 1 
ATOM   541  N  N   . ASP A 1 70  ? -26.783 -9.014  7.693  1.00 19.39 ? 179  ASP A N   1 
ATOM   542  C  CA  . ASP A 1 70  ? -27.768 -8.676  6.657  1.00 22.90 ? 179  ASP A CA  1 
ATOM   543  C  C   . ASP A 1 70  ? -27.819 -7.153  6.514  1.00 23.11 ? 179  ASP A C   1 
ATOM   544  O  O   . ASP A 1 70  ? -27.309 -6.440  7.372  1.00 23.77 ? 179  ASP A O   1 
ATOM   545  C  CB  . ASP A 1 70  ? -29.162 -9.181  7.031  1.00 28.98 ? 179  ASP A CB  1 
ATOM   546  C  CG  . ASP A 1 70  ? -29.778 -8.388  8.192  1.00 24.49 ? 179  ASP A CG  1 
ATOM   547  O  OD1 . ASP A 1 70  ? -29.670 -8.863  9.327  1.00 29.56 ? 179  ASP A OD1 1 
ATOM   548  O  OD2 . ASP A 1 70  ? -30.316 -7.270  7.970  1.00 26.59 ? 179  ASP A OD2 1 
ATOM   549  N  N   . PRO A 1 71  ? -28.438 -6.644  5.440  1.00 20.85 ? 180  PRO A N   1 
ATOM   550  C  CA  . PRO A 1 71  ? -28.385 -5.191  5.175  1.00 27.08 ? 180  PRO A CA  1 
ATOM   551  C  C   . PRO A 1 71  ? -29.200 -4.268  6.086  1.00 24.27 ? 180  PRO A C   1 
ATOM   552  O  O   . PRO A 1 71  ? -28.950 -3.053  6.050  1.00 25.79 ? 180  PRO A O   1 
ATOM   553  C  CB  . PRO A 1 71  ? -28.913 -5.069  3.737  1.00 26.46 ? 180  PRO A CB  1 
ATOM   554  C  CG  . PRO A 1 71  ? -28.672 -6.437  3.122  1.00 32.40 ? 180  PRO A CG  1 
ATOM   555  C  CD  . PRO A 1 71  ? -28.870 -7.412  4.261  1.00 25.82 ? 180  PRO A CD  1 
ATOM   556  N  N   . ASP A 1 72  ? -30.124 -4.810  6.881  1.00 23.30 ? 181  ASP A N   1 
ATOM   557  C  CA  . ASP A 1 72  ? -31.140 -3.998  7.563  1.00 20.17 ? 181  ASP A CA  1 
ATOM   558  C  C   . ASP A 1 72  ? -30.761 -3.778  9.041  1.00 18.67 ? 181  ASP A C   1 
ATOM   559  O  O   . ASP A 1 72  ? -30.692 -4.737  9.820  1.00 16.85 ? 181  ASP A O   1 
ATOM   560  C  CB  . ASP A 1 72  ? -32.508 -4.700  7.436  1.00 22.98 ? 181  ASP A CB  1 
ATOM   561  C  CG  . ASP A 1 72  ? -33.643 -3.934  8.109  1.00 25.32 ? 181  ASP A CG  1 
ATOM   562  O  OD1 . ASP A 1 72  ? -33.401 -2.902  8.772  1.00 23.37 ? 181  ASP A OD1 1 
ATOM   563  O  OD2 . ASP A 1 72  ? -34.804 -4.370  7.973  1.00 28.90 ? 181  ASP A OD2 1 
ATOM   564  N  N   . PRO A 1 73  ? -30.487 -2.516  9.415  1.00 19.18 ? 182  PRO A N   1 
ATOM   565  C  CA  . PRO A 1 73  ? -29.957 -2.226  10.750 1.00 16.61 ? 182  PRO A CA  1 
ATOM   566  C  C   . PRO A 1 73  ? -31.032 -2.010  11.812 1.00 19.46 ? 182  PRO A C   1 
ATOM   567  O  O   . PRO A 1 73  ? -30.729 -1.467  12.890 1.00 16.87 ? 182  PRO A O   1 
ATOM   568  C  CB  . PRO A 1 73  ? -29.205 -0.927  10.536 1.00 16.62 ? 182  PRO A CB  1 
ATOM   569  C  CG  . PRO A 1 73  ? -30.023 -0.206  9.526  1.00 18.23 ? 182  PRO A CG  1 
ATOM   570  C  CD  . PRO A 1 73  ? -30.470 -1.314  8.560  1.00 19.05 ? 182  PRO A CD  1 
ATOM   571  N  N   . GLN A 1 74  ? -32.265 -2.429  11.531 1.00 18.98 ? 183  GLN A N   1 
ATOM   572  C  CA  . GLN A 1 74  ? -33.360 -2.158  12.452 1.00 19.21 ? 183  GLN A CA  1 
ATOM   573  C  C   . GLN A 1 74  ? -33.030 -2.750  13.815 1.00 17.19 ? 183  GLN A C   1 
ATOM   574  O  O   . GLN A 1 74  ? -32.544 -3.883  13.903 1.00 18.75 ? 183  GLN A O   1 
ATOM   575  C  CB  . GLN A 1 74  ? -34.674 -2.719  11.912 1.00 22.01 ? 183  GLN A CB  1 
ATOM   576  C  CG  . GLN A 1 74  ? -35.918 -2.202  12.630 1.00 29.50 ? 183  GLN A CG  1 
ATOM   577  C  CD  . GLN A 1 74  ? -36.381 -0.844  12.094 1.00 28.16 ? 183  GLN A CD  1 
ATOM   578  O  OE1 . GLN A 1 74  ? -36.057 -0.471  10.972 1.00 34.60 ? 183  GLN A OE1 1 
ATOM   579  N  NE2 . GLN A 1 74  ? -37.114 -0.102  12.903 1.00 24.87 ? 183  GLN A NE2 1 
ATOM   580  N  N   . PRO A 1 75  ? -33.272 -1.979  14.895 1.00 17.04 ? 184  PRO A N   1 
ATOM   581  C  CA  . PRO A 1 75  ? -32.917 -2.501  16.215 1.00 15.26 ? 184  PRO A CA  1 
ATOM   582  C  C   . PRO A 1 75  ? -33.951 -3.478  16.744 1.00 19.11 ? 184  PRO A C   1 
ATOM   583  O  O   . PRO A 1 75  ? -35.059 -3.547  16.211 1.00 20.35 ? 184  PRO A O   1 
ATOM   584  C  CB  . PRO A 1 75  ? -32.871 -1.241  17.102 1.00 19.99 ? 184  PRO A CB  1 
ATOM   585  C  CG  . PRO A 1 75  ? -33.717 -0.229  16.414 1.00 18.27 ? 184  PRO A CG  1 
ATOM   586  C  CD  . PRO A 1 75  ? -33.721 -0.572  14.939 1.00 18.54 ? 184  PRO A CD  1 
ATOM   587  N  N   . ARG A 1 76  ? -33.578 -4.207  17.780 1.00 15.01 ? 185  ARG A N   1 
ATOM   588  C  CA  . ARG A 1 76  ? -34.491 -5.074  18.520 1.00 16.70 ? 185  ARG A CA  1 
ATOM   589  C  C   . ARG A 1 76  ? -35.154 -4.300  19.668 1.00 19.67 ? 185  ARG A C   1 
ATOM   590  O  O   . ARG A 1 76  ? -34.511 -3.473  20.338 1.00 16.61 ? 185  ARG A O   1 
ATOM   591  C  CB  . ARG A 1 76  ? -33.737 -6.297  19.048 1.00 19.38 ? 185  ARG A CB  1 
ATOM   592  C  CG  . ARG A 1 76  ? -33.419 -7.332  17.925 1.00 21.28 ? 185  ARG A CG  1 
ATOM   593  C  CD  . ARG A 1 76  ? -32.999 -8.702  18.464 1.00 26.12 ? 185  ARG A CD  1 
ATOM   594  N  NE  . ARG A 1 76  ? -31.710 -8.691  19.169 1.00 24.54 ? 185  ARG A NE  1 
ATOM   595  C  CZ  . ARG A 1 76  ? -31.046 -9.785  19.550 1.00 25.91 ? 185  ARG A CZ  1 
ATOM   596  N  NH1 . ARG A 1 76  ? -31.540 -11.002 19.312 1.00 22.00 ? 185  ARG A NH1 1 
ATOM   597  N  NH2 . ARG A 1 76  ? -29.872 -9.670  20.174 1.00 26.57 ? 185  ARG A NH2 1 
ATOM   598  N  N   . TYR A 1 77  ? -36.441 -4.563  19.866 1.00 16.26 ? 186  TYR A N   1 
ATOM   599  C  CA  . TYR A 1 77  ? -37.230 -3.864  20.869 1.00 18.43 ? 186  TYR A CA  1 
ATOM   600  C  C   . TYR A 1 77  ? -37.341 -4.689  22.166 1.00 18.33 ? 186  TYR A C   1 
ATOM   601  O  O   . TYR A 1 77  ? -37.650 -5.894  22.148 1.00 19.31 ? 186  TYR A O   1 
ATOM   602  C  CB  . TYR A 1 77  ? -38.586 -3.534  20.287 1.00 14.18 ? 186  TYR A CB  1 
ATOM   603  C  CG  . TYR A 1 77  ? -38.474 -2.610  19.118 1.00 14.27 ? 186  TYR A CG  1 
ATOM   604  C  CD1 . TYR A 1 77  ? -38.184 -3.094  17.850 1.00 22.70 ? 186  TYR A CD1 1 
ATOM   605  C  CD2 . TYR A 1 77  ? -38.629 -1.246  19.278 1.00 15.42 ? 186  TYR A CD2 1 
ATOM   606  C  CE1 . TYR A 1 77  ? -38.048 -2.241  16.779 1.00 19.41 ? 186  TYR A CE1 1 
ATOM   607  C  CE2 . TYR A 1 77  ? -38.501 -0.382  18.223 1.00 16.02 ? 186  TYR A CE2 1 
ATOM   608  C  CZ  . TYR A 1 77  ? -38.205 -0.878  16.976 1.00 18.32 ? 186  TYR A CZ  1 
ATOM   609  O  OH  . TYR A 1 77  ? -38.090 -0.011  15.927 1.00 16.84 ? 186  TYR A OH  1 
ATOM   610  N  N   . THR A 1 78  ? -37.024 -4.049  23.288 1.00 15.01 ? 187  THR A N   1 
ATOM   611  C  CA  . THR A 1 78  ? -37.024 -4.720  24.582 1.00 12.58 ? 187  THR A CA  1 
ATOM   612  C  C   . THR A 1 78  ? -37.626 -3.780  25.607 1.00 17.01 ? 187  THR A C   1 
ATOM   613  O  O   . THR A 1 78  ? -37.715 -2.571  25.379 1.00 14.80 ? 187  THR A O   1 
ATOM   614  C  CB  . THR A 1 78  ? -35.589 -5.088  25.051 1.00 18.96 ? 187  THR A CB  1 
ATOM   615  O  OG1 . THR A 1 78  ? -34.782 -3.908  25.031 1.00 15.06 ? 187  THR A OG1 1 
ATOM   616  C  CG2 . THR A 1 78  ? -34.953 -6.141  24.140 1.00 17.25 ? 187  THR A CG2 1 
ATOM   617  N  N   . GLN A 1 79  ? -38.031 -4.329  26.745 1.00 17.44 ? 188  GLN A N   1 
ATOM   618  C  CA  . GLN A 1 79  ? -38.715 -3.533  27.755 1.00 17.05 ? 188  GLN A CA  1 
ATOM   619  C  C   . GLN A 1 79  ? -37.846 -2.381  28.276 1.00 17.68 ? 188  GLN A C   1 
ATOM   620  O  O   . GLN A 1 79  ? -38.367 -1.300  28.544 1.00 17.11 ? 188  GLN A O   1 
ATOM   621  C  CB  . GLN A 1 79  ? -39.207 -4.414  28.907 1.00 13.72 ? 188  GLN A CB  1 
ATOM   622  C  CG  . GLN A 1 79  ? -40.385 -5.286  28.518 1.00 16.67 ? 188  GLN A CG  1 
ATOM   623  C  CD  . GLN A 1 79  ? -41.611 -4.444  28.138 1.00 24.96 ? 188  GLN A CD  1 
ATOM   624  O  OE1 . GLN A 1 79  ? -41.961 -3.486  28.833 1.00 23.89 ? 188  GLN A OE1 1 
ATOM   625  N  NE2 . GLN A 1 79  ? -42.248 -4.790  27.016 1.00 26.22 ? 188  GLN A NE2 1 
ATOM   626  N  N   . MET A 1 80  ? -36.539 -2.613  28.390 1.00 18.26 ? 189  MET A N   1 
ATOM   627  C  CA  A MET A 1 80  ? -35.608 -1.597  28.880 0.38 18.96 ? 189  MET A CA  1 
ATOM   628  C  CA  B MET A 1 80  ? -35.611 -1.592  28.888 0.62 18.90 ? 189  MET A CA  1 
ATOM   629  C  C   . MET A 1 80  ? -35.110 -0.672  27.768 1.00 20.47 ? 189  MET A C   1 
ATOM   630  O  O   . MET A 1 80  ? -34.332 0.242   28.012 1.00 18.62 ? 189  MET A O   1 
ATOM   631  C  CB  A MET A 1 80  ? -34.419 -2.272  29.562 0.38 21.18 ? 189  MET A CB  1 
ATOM   632  C  CB  B MET A 1 80  ? -34.421 -2.246  29.605 0.62 21.19 ? 189  MET A CB  1 
ATOM   633  C  CG  A MET A 1 80  ? -34.760 -2.907  30.902 0.38 22.08 ? 189  MET A CG  1 
ATOM   634  C  CG  B MET A 1 80  ? -34.725 -2.793  31.015 0.62 22.13 ? 189  MET A CG  1 
ATOM   635  S  SD  A MET A 1 80  ? -33.479 -4.006  31.503 0.38 31.68 ? 189  MET A SD  1 
ATOM   636  S  SD  B MET A 1 80  ? -35.374 -1.520  32.139 0.62 22.71 ? 189  MET A SD  1 
ATOM   637  C  CE  A MET A 1 80  ? -31.998 -3.043  31.197 0.38 25.03 ? 189  MET A CE  1 
ATOM   638  C  CE  B MET A 1 80  ? -33.990 -0.382  32.211 0.62 23.69 ? 189  MET A CE  1 
ATOM   639  N  N   . ASN A 1 81  ? -35.565 -0.897  26.545 1.00 17.20 ? 190  ASN A N   1 
ATOM   640  C  CA  . ASN A 1 81  ? -35.165 -0.057  25.412 1.00 17.37 ? 190  ASN A CA  1 
ATOM   641  C  C   . ASN A 1 81  ? -33.658 -0.012  25.259 1.00 17.27 ? 190  ASN A C   1 
ATOM   642  O  O   . ASN A 1 81  ? -33.074 1.030   24.948 1.00 16.38 ? 190  ASN A O   1 
ATOM   643  C  CB  . ASN A 1 81  ? -35.741 1.355   25.539 1.00 16.92 ? 190  ASN A CB  1 
ATOM   644  C  CG  . ASN A 1 81  ? -37.255 1.350   25.457 1.00 22.37 ? 190  ASN A CG  1 
ATOM   645  O  OD1 . ASN A 1 81  ? -37.819 0.748   24.555 1.00 19.53 ? 190  ASN A OD1 1 
ATOM   646  N  ND2 . ASN A 1 81  ? -37.921 1.968   26.440 1.00 21.13 ? 190  ASN A ND2 1 
ATOM   647  N  N   . ASP A 1 82  ? -33.040 -1.170  25.452 1.00 16.64 ? 191  ASP A N   1 
ATOM   648  C  CA  . ASP A 1 82  ? -31.595 -1.302  25.358 1.00 18.13 ? 191  ASP A CA  1 
ATOM   649  C  C   . ASP A 1 82  ? -31.010 -0.780  24.043 1.00 21.95 ? 191  ASP A C   1 
ATOM   650  O  O   . ASP A 1 82  ? -29.866 -0.309  24.019 1.00 21.05 ? 191  ASP A O   1 
ATOM   651  C  CB  . ASP A 1 82  ? -31.209 -2.772  25.495 1.00 22.46 ? 191  ASP A CB  1 
ATOM   652  C  CG  . ASP A 1 82  ? -31.707 -3.386  26.773 1.00 24.81 ? 191  ASP A CG  1 
ATOM   653  O  OD1 . ASP A 1 82  ? -32.849 -3.929  26.786 1.00 20.06 ? 191  ASP A OD1 1 
ATOM   654  O  OD2 . ASP A 1 82  ? -30.944 -3.336  27.749 1.00 22.73 ? 191  ASP A OD2 1 
ATOM   655  N  N   . ASN A 1 83  ? -31.765 -0.876  22.948 1.00 14.76 ? 192  ASN A N   1 
ATOM   656  C  CA  . ASN A 1 83  ? -31.208 -0.589  21.634 1.00 13.19 ? 192  ASN A CA  1 
ATOM   657  C  C   . ASN A 1 83  ? -31.697 0.731   21.067 1.00 15.23 ? 192  ASN A C   1 
ATOM   658  O  O   . ASN A 1 83  ? -31.882 0.885   19.869 1.00 18.50 ? 192  ASN A O   1 
ATOM   659  C  CB  . ASN A 1 83  ? -31.502 -1.755  20.685 1.00 16.83 ? 192  ASN A CB  1 
ATOM   660  C  CG  . ASN A 1 83  ? -30.927 -3.044  21.197 1.00 17.33 ? 192  ASN A CG  1 
ATOM   661  O  OD1 . ASN A 1 83  ? -29.711 -3.161  21.356 1.00 16.83 ? 192  ASN A OD1 1 
ATOM   662  N  ND2 . ASN A 1 83  ? -31.791 -4.008  21.514 1.00 15.76 ? 192  ASN A ND2 1 
ATOM   663  N  N   . ARG A 1 84  ? -31.877 1.694   21.957 1.00 14.77 ? 193  ARG A N   1 
ATOM   664  C  CA  A ARG A 1 84  ? -32.364 3.013   21.597 0.54 16.27 ? 193  ARG A CA  1 
ATOM   665  C  CA  B ARG A 1 84  ? -32.371 3.000   21.561 0.46 16.26 ? 193  ARG A CA  1 
ATOM   666  C  C   . ARG A 1 84  ? -31.250 3.955   21.145 1.00 13.72 ? 193  ARG A C   1 
ATOM   667  O  O   . ARG A 1 84  ? -31.522 5.005   20.583 1.00 13.81 ? 193  ARG A O   1 
ATOM   668  C  CB  A ARG A 1 84  ? -33.040 3.649   22.813 0.54 17.33 ? 193  ARG A CB  1 
ATOM   669  C  CB  B ARG A 1 84  ? -33.159 3.636   22.711 0.46 17.37 ? 193  ARG A CB  1 
ATOM   670  C  CG  A ARG A 1 84  ? -32.072 3.958   23.946 0.54 17.75 ? 193  ARG A CG  1 
ATOM   671  C  CG  B ARG A 1 84  ? -32.295 4.085   23.878 0.46 17.88 ? 193  ARG A CG  1 
ATOM   672  C  CD  A ARG A 1 84  ? -32.805 4.380   25.220 0.54 18.40 ? 193  ARG A CD  1 
ATOM   673  C  CD  B ARG A 1 84  ? -33.146 4.499   25.080 0.46 18.30 ? 193  ARG A CD  1 
ATOM   674  N  NE  A ARG A 1 84  ? -31.875 4.692   26.303 0.54 20.99 ? 193  ARG A NE  1 
ATOM   675  N  NE  B ARG A 1 84  ? -32.332 5.021   26.174 0.46 20.50 ? 193  ARG A NE  1 
ATOM   676  C  CZ  A ARG A 1 84  ? -31.343 3.797   27.134 0.54 23.47 ? 193  ARG A CZ  1 
ATOM   677  C  CZ  B ARG A 1 84  ? -32.737 5.145   27.437 0.46 23.24 ? 193  ARG A CZ  1 
ATOM   678  N  NH1 A ARG A 1 84  ? -31.636 2.507   27.031 0.54 19.12 ? 193  ARG A NH1 1 
ATOM   679  N  NH1 B ARG A 1 84  ? -33.961 4.776   27.808 0.46 21.90 ? 193  ARG A NH1 1 
ATOM   680  N  NH2 A ARG A 1 84  ? -30.502 4.196   28.078 0.54 27.94 ? 193  ARG A NH2 1 
ATOM   681  N  NH2 B ARG A 1 84  ? -31.901 5.632   28.344 0.46 26.72 ? 193  ARG A NH2 1 
ATOM   682  N  N   . HIS A 1 85  ? -30.000 3.593   21.432 1.00 11.60 ? 194  HIS A N   1 
ATOM   683  C  CA  . HIS A 1 85  ? -28.923 4.576   21.343 1.00 14.51 ? 194  HIS A CA  1 
ATOM   684  C  C   . HIS A 1 85  ? -28.611 5.048   19.918 1.00 12.69 ? 194  HIS A C   1 
ATOM   685  O  O   . HIS A 1 85  ? -28.432 6.246   19.688 1.00 13.86 ? 194  HIS A O   1 
ATOM   686  C  CB  . HIS A 1 85  ? -27.663 4.066   22.044 1.00 20.27 ? 194  HIS A CB  1 
ATOM   687  C  CG  . HIS A 1 85  ? -27.829 3.879   23.519 1.00 24.90 ? 194  HIS A CG  1 
ATOM   688  N  ND1 . HIS A 1 85  ? -27.778 2.640   24.130 1.00 27.65 ? 194  HIS A ND1 1 
ATOM   689  C  CD2 . HIS A 1 85  ? -28.070 4.775   24.510 1.00 32.04 ? 194  HIS A CD2 1 
ATOM   690  C  CE1 . HIS A 1 85  ? -27.949 2.786   25.434 1.00 27.49 ? 194  HIS A CE1 1 
ATOM   691  N  NE2 . HIS A 1 85  ? -28.141 4.071   25.689 1.00 26.39 ? 194  HIS A NE2 1 
ATOM   692  N  N   . GLY A 1 86  ? -28.561 4.119   18.971 1.00 13.69 ? 195  GLY A N   1 
ATOM   693  C  CA  . GLY A 1 86  ? -28.227 4.469   17.596 1.00 12.32 ? 195  GLY A CA  1 
ATOM   694  C  C   . GLY A 1 86  ? -29.262 5.396   16.977 1.00 14.37 ? 195  GLY A C   1 
ATOM   695  O  O   . GLY A 1 86  ? -28.924 6.340   16.243 1.00 13.17 ? 195  GLY A O   1 
ATOM   696  N  N   . THR A 1 87  ? -30.535 5.139   17.285 1.00 12.28 ? 196  THR A N   1 
ATOM   697  C  CA  . THR A 1 87  ? -31.609 5.968   16.784 1.00 14.39 ? 196  THR A CA  1 
ATOM   698  C  C   . THR A 1 87  ? -31.529 7.384   17.345 1.00 13.37 ? 196  THR A C   1 
ATOM   699  O  O   . THR A 1 87  ? -31.760 8.354   16.622 1.00 13.52 ? 196  THR A O   1 
ATOM   700  C  CB  . THR A 1 87  ? -32.970 5.319   17.106 1.00 13.12 ? 196  THR A CB  1 
ATOM   701  O  OG1 . THR A 1 87  ? -33.090 4.132   16.329 1.00 13.93 ? 196  THR A OG1 1 
ATOM   702  C  CG2 . THR A 1 87  ? -34.132 6.246   16.779 1.00 11.83 ? 196  THR A CG2 1 
ATOM   703  N  N   . ARG A 1 88  ? -31.218 7.501   18.636 1.00 12.48 ? 197  ARG A N   1 
ATOM   704  C  CA  . ARG A 1 88  ? -31.017 8.814   19.245 1.00 13.13 ? 197  ARG A CA  1 
ATOM   705  C  C   . ARG A 1 88  ? -29.875 9.576   18.558 1.00 15.01 ? 197  ARG A C   1 
ATOM   706  O  O   . ARG A 1 88  ? -30.012 10.755  18.204 1.00 11.31 ? 197  ARG A O   1 
ATOM   707  C  CB  . ARG A 1 88  ? -30.707 8.665   20.750 1.00 13.86 ? 197  ARG A CB  1 
ATOM   708  C  CG  . ARG A 1 88  ? -31.890 8.202   21.547 1.00 12.02 ? 197  ARG A CG  1 
ATOM   709  C  CD  . ARG A 1 88  ? -31.619 7.972   23.039 1.00 14.98 ? 197  ARG A CD  1 
ATOM   710  N  NE  . ARG A 1 88  ? -32.887 7.733   23.711 1.00 11.31 ? 197  ARG A NE  1 
ATOM   711  C  CZ  . ARG A 1 88  ? -33.149 8.015   24.987 1.00 15.81 ? 197  ARG A CZ  1 
ATOM   712  N  NH1 . ARG A 1 88  ? -32.214 8.509   25.775 1.00 17.15 ? 197  ARG A NH1 1 
ATOM   713  N  NH2 . ARG A 1 88  ? -34.360 7.785   25.481 1.00 18.91 ? 197  ARG A NH2 1 
ATOM   714  N  N   . CYS A 1 89  ? -28.755 8.892   18.360 1.00 12.15 ? 198  CYS A N   1 
ATOM   715  C  CA  . CYS A 1 89  ? -27.588 9.534   17.786 1.00 11.27 ? 198  CYS A CA  1 
ATOM   716  C  C   . CYS A 1 89  ? -27.846 9.947   16.327 1.00 11.36 ? 198  CYS A C   1 
ATOM   717  O  O   . CYS A 1 89  ? -27.436 11.022  15.903 1.00 10.20 ? 198  CYS A O   1 
ATOM   718  C  CB  . CYS A 1 89  ? -26.380 8.606   17.913 1.00 13.72 ? 198  CYS A CB  1 
ATOM   719  S  SG  . CYS A 1 89  ? -25.816 8.381   19.623 1.00 15.87 ? 198  CYS A SG  1 
ATOM   720  N  N   . ALA A 1 90  ? -28.562 9.104   15.580 1.00 15.42 ? 199  ALA A N   1 
ATOM   721  C  CA  . ALA A 1 90  ? -28.849 9.360   14.153 1.00 12.09 ? 199  ALA A CA  1 
ATOM   722  C  C   . ALA A 1 90  ? -29.630 10.656  13.948 1.00 12.06 ? 199  ALA A C   1 
ATOM   723  O  O   . ALA A 1 90  ? -29.333 11.467  13.051 1.00 11.10 ? 199  ALA A O   1 
ATOM   724  C  CB  . ALA A 1 90  ? -29.617 8.196   13.573 1.00 12.86 ? 199  ALA A CB  1 
ATOM   725  N  N   . GLY A 1 91  ? -30.630 10.843  14.806 1.00 11.39 ? 200  GLY A N   1 
ATOM   726  C  CA  . GLY A 1 91  ? -31.388 12.068  14.852 1.00 10.28 ? 200  GLY A CA  1 
ATOM   727  C  C   . GLY A 1 91  ? -30.581 13.309  15.138 1.00 14.14 ? 200  GLY A C   1 
ATOM   728  O  O   . GLY A 1 91  ? -30.893 14.357  14.596 1.00 11.04 ? 200  GLY A O   1 
ATOM   729  N  N   . GLU A 1 92  ? -29.560 13.212  16.000 1.00 12.29 ? 201  GLU A N   1 
ATOM   730  C  CA  . GLU A 1 92  ? -28.745 14.370  16.289 1.00 10.17 ? 201  GLU A CA  1 
ATOM   731  C  C   . GLU A 1 92  ? -28.040 14.868  15.027 1.00 10.35 ? 201  GLU A C   1 
ATOM   732  O  O   . GLU A 1 92  ? -27.906 16.064  14.815 1.00 11.94 ? 201  GLU A O   1 
ATOM   733  C  CB  . GLU A 1 92  ? -27.698 14.039  17.342 1.00 11.23 ? 201  GLU A CB  1 
ATOM   734  C  CG  . GLU A 1 92  ? -28.252 13.743  18.702 1.00 11.79 ? 201  GLU A CG  1 
ATOM   735  C  CD  . GLU A 1 92  ? -27.123 13.504  19.666 1.00 13.11 ? 201  GLU A CD  1 
ATOM   736  O  OE1 . GLU A 1 92  ? -26.515 14.503  20.112 1.00 11.21 ? 201  GLU A OE1 1 
ATOM   737  O  OE2 . GLU A 1 92  ? -26.825 12.320  19.910 1.00 14.98 ? 201  GLU A OE2 1 
ATOM   738  N  N   . VAL A 1 93  ? -27.561 13.936  14.229 1.00 12.25 ? 202  VAL A N   1 
ATOM   739  C  CA  . VAL A 1 93  ? -26.858 14.275  12.999 1.00 11.57 ? 202  VAL A CA  1 
ATOM   740  C  C   . VAL A 1 93  ? -27.832 14.784  11.938 1.00 12.08 ? 202  VAL A C   1 
ATOM   741  O  O   . VAL A 1 93  ? -27.579 15.821  11.288 1.00 13.11 ? 202  VAL A O   1 
ATOM   742  C  CB  . VAL A 1 93  ? -26.134 13.046  12.421 1.00 12.16 ? 202  VAL A CB  1 
ATOM   743  C  CG1 . VAL A 1 93  ? -25.356 13.410  11.136 1.00 11.31 ? 202  VAL A CG1 1 
ATOM   744  C  CG2 . VAL A 1 93  ? -25.176 12.451  13.434 1.00 11.67 ? 202  VAL A CG2 1 
ATOM   745  N  N   . ALA A 1 94  ? -28.956 14.078  11.773 1.00 11.35 ? 203  ALA A N   1 
ATOM   746  C  CA  . ALA A 1 94  ? -29.710 14.190  10.501 1.00 13.78 ? 203  ALA A CA  1 
ATOM   747  C  C   . ALA A 1 94  ? -31.235 14.031  10.565 1.00 16.85 ? 203  ALA A C   1 
ATOM   748  O  O   . ALA A 1 94  ? -31.868 13.667  9.562  1.00 17.75 ? 203  ALA A O   1 
ATOM   749  C  CB  . ALA A 1 94  ? -29.130 13.183  9.460  1.00 12.95 ? 203  ALA A CB  1 
ATOM   750  N  N   . ALA A 1 95  ? -31.842 14.270  11.714 1.00 13.78 ? 204  ALA A N   1 
ATOM   751  C  CA  . ALA A 1 95  ? -33.298 14.289  11.733 1.00 14.88 ? 204  ALA A CA  1 
ATOM   752  C  C   . ALA A 1 95  ? -33.817 15.298  10.698 1.00 14.65 ? 204  ALA A C   1 
ATOM   753  O  O   . ALA A 1 95  ? -33.256 16.386  10.504 1.00 14.64 ? 204  ALA A O   1 
ATOM   754  C  CB  . ALA A 1 95  ? -33.842 14.627  13.117 1.00 15.27 ? 204  ALA A CB  1 
ATOM   755  N  N   . VAL A 1 96  ? -34.918 14.931  10.053 1.00 17.55 ? 205  VAL A N   1 
ATOM   756  C  CA  . VAL A 1 96  ? -35.526 15.752  9.012  1.00 13.88 ? 205  VAL A CA  1 
ATOM   757  C  C   . VAL A 1 96  ? -36.034 17.056  9.583  1.00 16.25 ? 205  VAL A C   1 
ATOM   758  O  O   . VAL A 1 96  ? -36.542 17.084  10.717 1.00 16.29 ? 205  VAL A O   1 
ATOM   759  C  CB  . VAL A 1 96  ? -36.701 14.952  8.384  1.00 19.02 ? 205  VAL A CB  1 
ATOM   760  C  CG1 . VAL A 1 96  ? -37.463 15.786  7.374  1.00 22.50 ? 205  VAL A CG1 1 
ATOM   761  C  CG2 . VAL A 1 96  ? -36.173 13.679  7.745  1.00 16.33 ? 205  VAL A CG2 1 
ATOM   762  N  N   . ALA A 1 97  ? -35.875 18.137  8.820  1.00 15.04 ? 206  ALA A N   1 
ATOM   763  C  CA  . ALA A 1 97  ? -36.357 19.457  9.204  1.00 16.28 ? 206  ALA A CA  1 
ATOM   764  C  C   . ALA A 1 97  ? -37.690 19.770  8.551  1.00 19.07 ? 206  ALA A C   1 
ATOM   765  O  O   . ALA A 1 97  ? -38.020 19.236  7.476  1.00 18.12 ? 206  ALA A O   1 
ATOM   766  C  CB  . ALA A 1 97  ? -35.349 20.562  8.840  1.00 18.23 ? 206  ALA A CB  1 
ATOM   767  N  N   . ASN A 1 98  ? -38.418 20.668  9.205  1.00 18.98 ? 207  ASN A N   1 
ATOM   768  C  CA  . ASN A 1 98  ? -39.601 21.302  8.623  1.00 22.06 ? 207  ASN A CA  1 
ATOM   769  C  C   . ASN A 1 98  ? -40.718 20.331  8.310  1.00 20.35 ? 207  ASN A C   1 
ATOM   770  O  O   . ASN A 1 98  ? -41.524 20.561  7.405  1.00 21.28 ? 207  ASN A O   1 
ATOM   771  C  CB  . ASN A 1 98  ? -39.199 22.106  7.381  1.00 19.03 ? 207  ASN A CB  1 
ATOM   772  C  CG  . ASN A 1 98  ? -38.273 23.242  7.724  1.00 23.50 ? 207  ASN A CG  1 
ATOM   773  O  OD1 . ASN A 1 98  ? -38.535 24.003  8.658  1.00 21.76 ? 207  ASN A OD1 1 
ATOM   774  N  ND2 . ASN A 1 98  ? -37.147 23.327  7.019  1.00 24.34 ? 207  ASN A ND2 1 
ATOM   775  N  N   . ASN A 1 99  ? -40.811 19.274  9.104  1.00 16.83 ? 208  ASN A N   1 
ATOM   776  C  CA  . ASN A 1 99  ? -41.767 18.222  8.844  1.00 17.85 ? 208  ASN A CA  1 
ATOM   777  C  C   . ASN A 1 99  ? -42.713 18.000  10.030 1.00 19.26 ? 208  ASN A C   1 
ATOM   778  O  O   . ASN A 1 99  ? -43.369 16.963  10.104 1.00 19.58 ? 208  ASN A O   1 
ATOM   779  C  CB  . ASN A 1 99  ? -41.038 16.938  8.504  1.00 17.50 ? 208  ASN A CB  1 
ATOM   780  C  CG  . ASN A 1 99  ? -40.314 16.340  9.707  1.00 17.93 ? 208  ASN A CG  1 
ATOM   781  O  OD1 . ASN A 1 99  ? -39.930 17.057  10.630 1.00 17.34 ? 208  ASN A OD1 1 
ATOM   782  N  ND2 . ASN A 1 99  ? -40.125 15.029  9.693  1.00 17.50 ? 208  ASN A ND2 1 
ATOM   783  N  N   . GLY A 1 100 ? -42.770 18.974  10.943 1.00 19.58 ? 209  GLY A N   1 
ATOM   784  C  CA  . GLY A 1 100 ? -43.722 18.955  12.041 1.00 18.37 ? 209  GLY A CA  1 
ATOM   785  C  C   . GLY A 1 100 ? -43.500 17.865  13.070 1.00 20.32 ? 209  GLY A C   1 
ATOM   786  O  O   . GLY A 1 100 ? -44.379 17.572  13.899 1.00 17.13 ? 209  GLY A O   1 
ATOM   787  N  N   . VAL A 1 101 ? -42.302 17.290  13.044 1.00 16.79 ? 210  VAL A N   1 
ATOM   788  C  CA  . VAL A 1 101 ? -41.959 16.182  13.916 1.00 17.19 ? 210  VAL A CA  1 
ATOM   789  C  C   . VAL A 1 101 ? -40.676 16.477  14.681 1.00 15.36 ? 210  VAL A C   1 
ATOM   790  O  O   . VAL A 1 101 ? -39.680 16.842  14.084 1.00 14.73 ? 210  VAL A O   1 
ATOM   791  C  CB  . VAL A 1 101 ? -41.731 14.901  13.092 1.00 16.46 ? 210  VAL A CB  1 
ATOM   792  C  CG1 . VAL A 1 101 ? -41.260 13.756  13.986 1.00 18.13 ? 210  VAL A CG1 1 
ATOM   793  C  CG2 . VAL A 1 101 ? -42.998 14.510  12.338 1.00 22.51 ? 210  VAL A CG2 1 
ATOM   794  N  N   . CYS A 1 102 ? -40.735 16.293  15.996 1.00 18.74 ? 211  CYS A N   1 
ATOM   795  C  CA  A CYS A 1 102 ? -39.578 16.405  16.903 0.79 18.33 ? 211  CYS A CA  1 
ATOM   796  C  CA  B CYS A 1 102 ? -39.551 16.397  16.857 0.21 18.14 ? 211  CYS A CA  1 
ATOM   797  C  C   . CYS A 1 102 ? -38.737 17.666  16.586 1.00 17.63 ? 211  CYS A C   1 
ATOM   798  O  O   . CYS A 1 102 ? -39.281 18.786  16.496 1.00 16.47 ? 211  CYS A O   1 
ATOM   799  C  CB  A CYS A 1 102 ? -38.758 15.090  16.878 0.79 16.01 ? 211  CYS A CB  1 
ATOM   800  C  CB  B CYS A 1 102 ? -38.639 15.176  16.671 0.21 16.36 ? 211  CYS A CB  1 
ATOM   801  S  SG  A CYS A 1 102 ? -37.630 14.757  18.321 0.79 14.71 ? 211  CYS A SG  1 
ATOM   802  S  SG  B CYS A 1 102 ? -39.358 13.562  16.999 0.21 16.95 ? 211  CYS A SG  1 
ATOM   803  N  N   . GLY A 1 103 ? -37.422 17.502  16.450 1.00 16.08 ? 212  GLY A N   1 
ATOM   804  C  CA  . GLY A 1 103 ? -36.545 18.622  16.158 1.00 14.89 ? 212  GLY A CA  1 
ATOM   805  C  C   . GLY A 1 103 ? -35.890 18.430  14.816 1.00 16.79 ? 212  GLY A C   1 
ATOM   806  O  O   . GLY A 1 103 ? -36.509 17.888  13.885 1.00 14.20 ? 212  GLY A O   1 
ATOM   807  N  N   . VAL A 1 104 ? -34.629 18.851  14.718 1.00 16.37 ? 213  VAL A N   1 
ATOM   808  C  CA  . VAL A 1 104 ? -33.859 18.661  13.497 1.00 16.32 ? 213  VAL A CA  1 
ATOM   809  C  C   . VAL A 1 104 ? -32.440 18.158  13.783 1.00 15.92 ? 213  VAL A C   1 
ATOM   810  O  O   . VAL A 1 104 ? -31.924 18.309  14.882 1.00 13.85 ? 213  VAL A O   1 
ATOM   811  C  CB  . VAL A 1 104 ? -33.710 19.973  12.725 1.00 14.34 ? 213  VAL A CB  1 
ATOM   812  C  CG1 . VAL A 1 104 ? -35.062 20.582  12.456 1.00 16.30 ? 213  VAL A CG1 1 
ATOM   813  C  CG2 . VAL A 1 104 ? -32.818 20.956  13.491 1.00 15.71 ? 213  VAL A CG2 1 
ATOM   814  N  N   . GLY A 1 105 ? -31.809 17.585  12.770 1.00 15.04 ? 214  GLY A N   1 
ATOM   815  C  CA  . GLY A 1 105 ? -30.395 17.261  12.867 1.00 12.33 ? 214  GLY A CA  1 
ATOM   816  C  C   . GLY A 1 105 ? -29.561 18.500  12.620 1.00 15.59 ? 214  GLY A C   1 
ATOM   817  O  O   . GLY A 1 105 ? -30.021 19.475  12.015 1.00 14.44 ? 214  GLY A O   1 
ATOM   818  N  N   . VAL A 1 106 ? -28.309 18.459  13.070 1.00 12.65 ? 215  VAL A N   1 
ATOM   819  C  CA  . VAL A 1 106 ? -27.343 19.475  12.696 1.00 13.91 ? 215  VAL A CA  1 
ATOM   820  C  C   . VAL A 1 106 ? -27.233 19.557  11.180 1.00 13.86 ? 215  VAL A C   1 
ATOM   821  O  O   . VAL A 1 106 ? -27.144 20.658  10.607 1.00 14.54 ? 215  VAL A O   1 
ATOM   822  C  CB  . VAL A 1 106 ? -25.955 19.140  13.266 1.00 11.87 ? 215  VAL A CB  1 
ATOM   823  C  CG1 . VAL A 1 106 ? -24.889 20.119  12.762 1.00 12.79 ? 215  VAL A CG1 1 
ATOM   824  C  CG2 . VAL A 1 106 ? -26.031 19.155  14.786 1.00 11.00 ? 215  VAL A CG2 1 
ATOM   825  N  N   . ALA A 1 107 ? -27.189 18.390  10.560 1.00 10.15 ? 216  ALA A N   1 
ATOM   826  C  CA  . ALA A 1 107 ? -27.054 18.265  9.105  1.00 15.15 ? 216  ALA A CA  1 
ATOM   827  C  C   . ALA A 1 107 ? -28.340 17.693  8.527  1.00 13.03 ? 216  ALA A C   1 
ATOM   828  O  O   . ALA A 1 107 ? -28.388 16.548  8.087  1.00 14.55 ? 216  ALA A O   1 
ATOM   829  C  CB  . ALA A 1 107 ? -25.922 17.372  8.779  1.00 13.34 ? 216  ALA A CB  1 
ATOM   830  N  N   . TYR A 1 108 ? -29.384 18.503  8.540  1.00 14.69 ? 217  TYR A N   1 
ATOM   831  C  CA  . TYR A 1 108 ? -30.709 17.975  8.281  1.00 15.58 ? 217  TYR A CA  1 
ATOM   832  C  C   . TYR A 1 108 ? -30.994 17.627  6.835  1.00 16.61 ? 217  TYR A C   1 
ATOM   833  O  O   . TYR A 1 108 ? -32.036 17.052  6.565  1.00 15.64 ? 217  TYR A O   1 
ATOM   834  C  CB  . TYR A 1 108 ? -31.792 18.901  8.820  1.00 13.44 ? 217  TYR A CB  1 
ATOM   835  C  CG  . TYR A 1 108 ? -31.787 20.344  8.385  1.00 14.32 ? 217  TYR A CG  1 
ATOM   836  C  CD1 . TYR A 1 108 ? -32.122 20.721  7.091  1.00 16.37 ? 217  TYR A CD1 1 
ATOM   837  C  CD2 . TYR A 1 108 ? -31.577 21.346  9.323  1.00 16.90 ? 217  TYR A CD2 1 
ATOM   838  C  CE1 . TYR A 1 108 ? -32.166 22.087  6.723  1.00 20.34 ? 217  TYR A CE1 1 
ATOM   839  C  CE2 . TYR A 1 108 ? -31.638 22.694  8.986  1.00 22.01 ? 217  TYR A CE2 1 
ATOM   840  C  CZ  . TYR A 1 108 ? -31.937 23.066  7.685  1.00 23.55 ? 217  TYR A CZ  1 
ATOM   841  O  OH  . TYR A 1 108 ? -32.000 24.417  7.381  1.00 23.03 ? 217  TYR A OH  1 
ATOM   842  N  N   . ASN A 1 109 ? -30.062 17.935  5.924  1.00 17.34 ? 218  ASN A N   1 
ATOM   843  C  CA  . ASN A 1 109 ? -30.173 17.444  4.539  1.00 16.72 ? 218  ASN A CA  1 
ATOM   844  C  C   . ASN A 1 109 ? -29.098 16.424  4.199  1.00 18.83 ? 218  ASN A C   1 
ATOM   845  O  O   . ASN A 1 109 ? -28.929 16.081  3.044  1.00 17.57 ? 218  ASN A O   1 
ATOM   846  C  CB  . ASN A 1 109 ? -30.141 18.602  3.526  1.00 17.79 ? 218  ASN A CB  1 
ATOM   847  C  CG  . ASN A 1 109 ? -31.395 19.453  3.574  1.00 23.11 ? 218  ASN A CG  1 
ATOM   848  O  OD1 . ASN A 1 109 ? -31.323 20.685  3.591  1.00 26.41 ? 218  ASN A OD1 1 
ATOM   849  N  ND2 . ASN A 1 109 ? -32.557 18.802  3.628  1.00 18.99 ? 218  ASN A ND2 1 
ATOM   850  N  N   . ALA A 1 110 ? -28.362 15.951  5.207  1.00 16.75 ? 219  ALA A N   1 
ATOM   851  C  CA  . ALA A 1 110 ? -27.439 14.855  5.021  1.00 15.35 ? 219  ALA A CA  1 
ATOM   852  C  C   . ALA A 1 110 ? -28.199 13.548  4.978  1.00 17.69 ? 219  ALA A C   1 
ATOM   853  O  O   . ALA A 1 110 ? -29.353 13.461  5.408  1.00 21.53 ? 219  ALA A O   1 
ATOM   854  C  CB  . ALA A 1 110 ? -26.403 14.814  6.144  1.00 15.47 ? 219  ALA A CB  1 
ATOM   855  N  N   . ARG A 1 111 ? -27.546 12.521  4.455  1.00 15.36 ? 220  ARG A N   1 
ATOM   856  C  CA  A ARG A 1 111 ? -28.094 11.183  4.464  0.53 15.95 ? 220  ARG A CA  1 
ATOM   857  C  CA  B ARG A 1 111 ? -28.131 11.202  4.486  0.47 15.98 ? 220  ARG A CA  1 
ATOM   858  C  C   . ARG A 1 111 ? -27.517 10.443  5.640  1.00 16.95 ? 220  ARG A C   1 
ATOM   859  O  O   . ARG A 1 111 ? -26.348 10.605  5.948  1.00 14.75 ? 220  ARG A O   1 
ATOM   860  C  CB  A ARG A 1 111 ? -27.754 10.462  3.174  0.53 20.86 ? 220  ARG A CB  1 
ATOM   861  C  CB  B ARG A 1 111 ? -27.980 10.487  3.146  0.47 20.92 ? 220  ARG A CB  1 
ATOM   862  C  CG  A ARG A 1 111 ? -28.658 10.864  2.036  0.53 20.72 ? 220  ARG A CG  1 
ATOM   863  C  CG  B ARG A 1 111 ? -29.285 10.535  2.342  0.47 21.78 ? 220  ARG A CG  1 
ATOM   864  C  CD  A ARG A 1 111 ? -28.388 10.019  0.836  0.53 21.72 ? 220  ARG A CD  1 
ATOM   865  C  CD  B ARG A 1 111 ? -29.099 10.332  0.855  0.47 23.20 ? 220  ARG A CD  1 
ATOM   866  N  NE  A ARG A 1 111 ? -27.255 10.533  0.091  0.53 22.94 ? 220  ARG A NE  1 
ATOM   867  N  NE  B ARG A 1 111 ? -29.402 8.965   0.442  0.47 25.89 ? 220  ARG A NE  1 
ATOM   868  C  CZ  A ARG A 1 111 ? -26.607 9.863   -0.848 0.53 19.60 ? 220  ARG A CZ  1 
ATOM   869  C  CZ  B ARG A 1 111 ? -30.587 8.379   0.570  0.47 23.14 ? 220  ARG A CZ  1 
ATOM   870  N  NH1 A ARG A 1 111 ? -26.969 8.625   -1.164 0.53 25.30 ? 220  ARG A NH1 1 
ATOM   871  N  NH1 B ARG A 1 111 ? -31.610 9.034   1.100  0.47 22.73 ? 220  ARG A NH1 1 
ATOM   872  N  NH2 A ARG A 1 111 ? -25.597 10.444  -1.465 0.53 20.22 ? 220  ARG A NH2 1 
ATOM   873  N  NH2 B ARG A 1 111 ? -30.741 7.129   0.160  0.47 24.99 ? 220  ARG A NH2 1 
ATOM   874  N  N   . ILE A 1 112 ? -28.340 9.641   6.295  1.00 16.44 ? 221  ILE A N   1 
ATOM   875  C  CA  . ILE A 1 112 ? -27.939 9.004   7.545  1.00 14.97 ? 221  ILE A CA  1 
ATOM   876  C  C   . ILE A 1 112 ? -28.184 7.510   7.451  1.00 15.40 ? 221  ILE A C   1 
ATOM   877  O  O   . ILE A 1 112 ? -29.228 7.059   6.951  1.00 18.83 ? 221  ILE A O   1 
ATOM   878  C  CB  . ILE A 1 112 ? -28.710 9.653   8.745  1.00 14.92 ? 221  ILE A CB  1 
ATOM   879  C  CG1 . ILE A 1 112 ? -28.172 9.176   10.103 1.00 14.37 ? 221  ILE A CG1 1 
ATOM   880  C  CG2 . ILE A 1 112 ? -30.243 9.407   8.625  1.00 14.67 ? 221  ILE A CG2 1 
ATOM   881  C  CD1 . ILE A 1 112 ? -26.679 9.532   10.366 1.00 14.85 ? 221  ILE A CD1 1 
ATOM   882  N  N   . GLY A 1 113 ? -27.217 6.745   7.927  1.00 12.64 ? 222  GLY A N   1 
ATOM   883  C  CA  . GLY A 1 113 ? -27.369 5.317   8.090  1.00 13.93 ? 222  GLY A CA  1 
ATOM   884  C  C   . GLY A 1 113 ? -26.890 4.865   9.461  1.00 16.63 ? 222  GLY A C   1 
ATOM   885  O  O   . GLY A 1 113 ? -26.412 5.656   10.297 1.00 14.60 ? 222  GLY A O   1 
ATOM   886  N  N   . GLY A 1 114 ? -27.013 3.578   9.710  1.00 15.28 ? 223  GLY A N   1 
ATOM   887  C  CA  . GLY A 1 114 ? -26.488 3.016   10.927 1.00 17.14 ? 223  GLY A CA  1 
ATOM   888  C  C   . GLY A 1 114 ? -25.981 1.622   10.699 1.00 15.29 ? 223  GLY A C   1 
ATOM   889  O  O   . GLY A 1 114 ? -26.467 0.896   9.845  1.00 14.22 ? 223  GLY A O   1 
ATOM   890  N  N   . VAL A 1 115 ? -24.995 1.245   11.488 1.00 15.40 ? 224  VAL A N   1 
ATOM   891  C  CA  . VAL A 1 115 ? -24.550 -0.131  11.530 1.00 17.21 ? 224  VAL A CA  1 
ATOM   892  C  C   . VAL A 1 115 ? -24.990 -0.729  12.838 1.00 15.00 ? 224  VAL A C   1 
ATOM   893  O  O   . VAL A 1 115 ? -24.690 -0.205  13.909 1.00 16.45 ? 224  VAL A O   1 
ATOM   894  C  CB  . VAL A 1 115 ? -23.045 -0.241  11.426 1.00 18.15 ? 224  VAL A CB  1 
ATOM   895  C  CG1 . VAL A 1 115 ? -22.609 -1.692  11.535 1.00 15.13 ? 224  VAL A CG1 1 
ATOM   896  C  CG2 . VAL A 1 115 ? -22.596 0.364   10.134 1.00 14.41 ? 224  VAL A CG2 1 
ATOM   897  N  N   . ARG A 1 116 ? -25.720 -1.828  12.744 1.00 14.61 ? 225  ARG A N   1 
ATOM   898  C  CA  . ARG A 1 116 ? -26.146 -2.569  13.917 1.00 15.29 ? 225  ARG A CA  1 
ATOM   899  C  C   . ARG A 1 116 ? -25.023 -3.518  14.224 1.00 18.60 ? 225  ARG A C   1 
ATOM   900  O  O   . ARG A 1 116 ? -24.801 -4.491  13.480 1.00 17.05 ? 225  ARG A O   1 
ATOM   901  C  CB  . ARG A 1 116 ? -27.441 -3.357  13.638 1.00 15.15 ? 225  ARG A CB  1 
ATOM   902  C  CG  . ARG A 1 116 ? -27.950 -4.115  14.840 1.00 17.66 ? 225  ARG A CG  1 
ATOM   903  C  CD  . ARG A 1 116 ? -29.360 -4.698  14.632 1.00 16.73 ? 225  ARG A CD  1 
ATOM   904  N  NE  . ARG A 1 116 ? -29.697 -5.530  15.783 1.00 16.66 ? 225  ARG A NE  1 
ATOM   905  C  CZ  . ARG A 1 116 ? -29.683 -6.860  15.805 1.00 20.07 ? 225  ARG A CZ  1 
ATOM   906  N  NH1 . ARG A 1 116 ? -29.371 -7.574  14.719 1.00 22.58 ? 225  ARG A NH1 1 
ATOM   907  N  NH2 . ARG A 1 116 ? -29.971 -7.494  16.928 1.00 18.95 ? 225  ARG A NH2 1 
ATOM   908  N  N   . MET A 1 117 ? -24.308 -3.222  15.303 1.00 16.26 ? 226  MET A N   1 
ATOM   909  C  CA  . MET A 1 117 ? -23.140 -3.994  15.673 1.00 16.59 ? 226  MET A CA  1 
ATOM   910  C  C   . MET A 1 117 ? -22.924 -4.198  17.161 1.00 15.43 ? 226  MET A C   1 
ATOM   911  O  O   . MET A 1 117 ? -22.088 -5.025  17.524 1.00 14.64 ? 226  MET A O   1 
ATOM   912  C  CB  . MET A 1 117 ? -21.855 -3.430  14.999 1.00 17.46 ? 226  MET A CB  1 
ATOM   913  C  CG  . MET A 1 117 ? -21.599 -1.921  15.074 1.00 15.23 ? 226  MET A CG  1 
ATOM   914  S  SD  . MET A 1 117 ? -20.961 -1.337  16.652 1.00 18.95 ? 226  MET A SD  1 
ATOM   915  C  CE  . MET A 1 117 ? -19.460 -2.298  16.872 1.00 17.53 ? 226  MET A CE  1 
ATOM   916  N  N   . LEU A 1 118 ? -23.672 -3.504  18.032 1.00 14.92 ? 227  LEU A N   1 
ATOM   917  C  CA  . LEU A 1 118 ? -23.466 -3.652  19.482 1.00 16.50 ? 227  LEU A CA  1 
ATOM   918  C  C   . LEU A 1 118 ? -24.391 -4.708  20.111 1.00 15.12 ? 227  LEU A C   1 
ATOM   919  O  O   . LEU A 1 118 ? -24.165 -5.155  21.227 1.00 16.89 ? 227  LEU A O   1 
ATOM   920  C  CB  . LEU A 1 118 ? -23.656 -2.318  20.223 1.00 15.66 ? 227  LEU A CB  1 
ATOM   921  C  CG  . LEU A 1 118 ? -22.611 -1.207  19.941 1.00 16.84 ? 227  LEU A CG  1 
ATOM   922  C  CD1 . LEU A 1 118 ? -22.836 0.070   20.790 1.00 15.56 ? 227  LEU A CD1 1 
ATOM   923  C  CD2 . LEU A 1 118 ? -21.196 -1.719  20.151 1.00 20.65 ? 227  LEU A CD2 1 
ATOM   924  N  N   . ASP A 1 119 ? -25.427 -5.089  19.391 1.00 17.87 ? 228  ASP A N   1 
ATOM   925  C  CA  . ASP A 1 119 ? -26.450 -5.985  19.938 1.00 16.00 ? 228  ASP A CA  1 
ATOM   926  C  C   . ASP A 1 119 ? -26.103 -7.440  19.593 1.00 18.54 ? 228  ASP A C   1 
ATOM   927  O  O   . ASP A 1 119 ? -26.792 -8.103  18.811 1.00 17.95 ? 228  ASP A O   1 
ATOM   928  C  CB  . ASP A 1 119 ? -27.799 -5.595  19.365 1.00 16.52 ? 228  ASP A CB  1 
ATOM   929  C  CG  . ASP A 1 119 ? -28.966 -6.320  20.042 1.00 17.78 ? 228  ASP A CG  1 
ATOM   930  O  OD1 . ASP A 1 119 ? -28.758 -6.955  21.084 1.00 15.67 ? 228  ASP A OD1 1 
ATOM   931  O  OD2 . ASP A 1 119 ? -30.087 -6.244  19.517 1.00 19.41 ? 228  ASP A OD2 1 
ATOM   932  N  N   . GLY A 1 120 ? -25.026 -7.924  20.193 1.00 20.48 ? 229  GLY A N   1 
ATOM   933  C  CA  . GLY A 1 120 ? -24.479 -9.231  19.867 1.00 23.14 ? 229  GLY A CA  1 
ATOM   934  C  C   . GLY A 1 120 ? -23.083 -9.295  20.418 1.00 20.67 ? 229  GLY A C   1 
ATOM   935  O  O   . GLY A 1 120 ? -22.673 -8.379  21.127 1.00 19.32 ? 229  GLY A O   1 
ATOM   936  N  N   . GLU A 1 121 ? -22.344 -10.357 20.104 1.00 24.55 ? 230  GLU A N   1 
ATOM   937  C  CA  . GLU A 1 121 ? -20.981 -10.481 20.603 1.00 23.49 ? 230  GLU A CA  1 
ATOM   938  C  C   . GLU A 1 121 ? -20.123 -9.560  19.760 1.00 23.95 ? 230  GLU A C   1 
ATOM   939  O  O   . GLU A 1 121 ? -20.128 -9.669  18.532 1.00 23.44 ? 230  GLU A O   1 
ATOM   940  C  CB  . GLU A 1 121 ? -20.441 -11.910 20.494 1.00 26.95 ? 230  GLU A CB  1 
ATOM   941  C  CG  . GLU A 1 121 ? -19.151 -12.106 21.293 1.00 33.01 ? 230  GLU A CG  1 
ATOM   942  C  CD  . GLU A 1 121 ? -18.383 -13.384 20.947 1.00 38.46 ? 230  GLU A CD  1 
ATOM   943  O  OE1 . GLU A 1 121 ? -18.798 -14.124 20.023 1.00 39.93 ? 230  GLU A OE1 1 
ATOM   944  O  OE2 . GLU A 1 121 ? -17.344 -13.629 21.603 1.00 41.49 ? 230  GLU A OE2 1 
ATOM   945  N  N   . VAL A 1 122 ? -19.406 -8.659  20.425 1.00 21.48 ? 231  VAL A N   1 
ATOM   946  C  CA  . VAL A 1 122 ? -18.618 -7.639  19.734 1.00 22.47 ? 231  VAL A CA  1 
ATOM   947  C  C   . VAL A 1 122 ? -17.167 -8.069  19.699 1.00 22.12 ? 231  VAL A C   1 
ATOM   948  O  O   . VAL A 1 122 ? -16.428 -7.915  20.655 1.00 20.56 ? 231  VAL A O   1 
ATOM   949  C  CB  . VAL A 1 122 ? -18.749 -6.272  20.417 1.00 24.85 ? 231  VAL A CB  1 
ATOM   950  C  CG1 . VAL A 1 122 ? -18.045 -5.187  19.582 1.00 23.36 ? 231  VAL A CG1 1 
ATOM   951  C  CG2 . VAL A 1 122 ? -20.228 -5.931  20.626 1.00 20.96 ? 231  VAL A CG2 1 
ATOM   952  N  N   . THR A 1 123 ? -16.780 -8.660  18.587 1.00 19.91 ? 232  THR A N   1 
ATOM   953  C  CA  . THR A 1 123 ? -15.425 -9.158  18.431 1.00 22.79 ? 232  THR A CA  1 
ATOM   954  C  C   . THR A 1 123 ? -14.586 -8.145  17.657 1.00 17.19 ? 232  THR A C   1 
ATOM   955  O  O   . THR A 1 123 ? -15.110 -7.186  17.112 1.00 16.30 ? 232  THR A O   1 
ATOM   956  C  CB  . THR A 1 123 ? -15.442 -10.444 17.615 1.00 15.53 ? 232  THR A CB  1 
ATOM   957  O  OG1 . THR A 1 123 ? -16.022 -10.164 16.340 1.00 20.38 ? 232  THR A OG1 1 
ATOM   958  C  CG2 . THR A 1 123 ? -16.276 -11.518 18.328 1.00 22.61 ? 232  THR A CG2 1 
ATOM   959  N  N   . ASP A 1 124 ? -13.293 -8.402  17.565 1.00 19.16 ? 233  ASP A N   1 
ATOM   960  C  CA  . ASP A 1 124 ? -12.409 -7.569  16.768 1.00 14.63 ? 233  ASP A CA  1 
ATOM   961  C  C   . ASP A 1 124 ? -12.934 -7.508  15.338 1.00 17.92 ? 233  ASP A C   1 
ATOM   962  O  O   . ASP A 1 124 ? -12.994 -6.450  14.708 1.00 15.08 ? 233  ASP A O   1 
ATOM   963  C  CB  . ASP A 1 124 ? -11.020 -8.177  16.825 1.00 18.10 ? 233  ASP A CB  1 
ATOM   964  C  CG  . ASP A 1 124 ? -9.966  -7.331  16.150 1.00 16.84 ? 233  ASP A CG  1 
ATOM   965  O  OD1 . ASP A 1 124 ? -10.085 -6.083  16.138 1.00 16.05 ? 233  ASP A OD1 1 
ATOM   966  O  OD2 . ASP A 1 124 ? -8.985  -7.928  15.662 1.00 16.54 ? 233  ASP A OD2 1 
ATOM   967  N  N   . ALA A 1 125 ? -13.371 -8.654  14.832 1.00 18.73 ? 234  ALA A N   1 
ATOM   968  C  CA  . ALA A 1 125 ? -13.836 -8.752  13.459 1.00 17.84 ? 234  ALA A CA  1 
ATOM   969  C  C   . ALA A 1 125 ? -15.112 -7.938  13.236 1.00 15.56 ? 234  ALA A C   1 
ATOM   970  O  O   . ALA A 1 125 ? -15.280 -7.314  12.185 1.00 15.22 ? 234  ALA A O   1 
ATOM   971  C  CB  . ALA A 1 125 ? -14.070 -10.230 13.088 1.00 20.75 ? 234  ALA A CB  1 
ATOM   972  N  N   . VAL A 1 126 ? -16.009 -7.949  14.220 1.00 16.44 ? 235  VAL A N   1 
ATOM   973  C  CA  . VAL A 1 126 ? -17.244 -7.171  14.129 1.00 15.24 ? 235  VAL A CA  1 
ATOM   974  C  C   . VAL A 1 126 ? -16.916 -5.681  14.039 1.00 15.07 ? 235  VAL A C   1 
ATOM   975  O  O   . VAL A 1 126 ? -17.494 -4.939  13.250 1.00 17.33 ? 235  VAL A O   1 
ATOM   976  C  CB  . VAL A 1 126 ? -18.136 -7.416  15.351 1.00 17.88 ? 235  VAL A CB  1 
ATOM   977  C  CG1 . VAL A 1 126 ? -19.179 -6.301  15.526 1.00 18.45 ? 235  VAL A CG1 1 
ATOM   978  C  CG2 . VAL A 1 126 ? -18.836 -8.789  15.243 1.00 21.45 ? 235  VAL A CG2 1 
ATOM   979  N  N   . GLU A 1 127 ? -15.962 -5.260  14.847 1.00 15.94 ? 236  GLU A N   1 
ATOM   980  C  CA  . GLU A 1 127 ? -15.549 -3.864  14.879 1.00 15.41 ? 236  GLU A CA  1 
ATOM   981  C  C   . GLU A 1 127 ? -14.950 -3.472  13.532 1.00 15.26 ? 236  GLU A C   1 
ATOM   982  O  O   . GLU A 1 127 ? -15.326 -2.450  12.955 1.00 15.55 ? 236  GLU A O   1 
ATOM   983  C  CB  . GLU A 1 127 ? -14.553 -3.633  16.024 1.00 14.62 ? 236  GLU A CB  1 
ATOM   984  C  CG  . GLU A 1 127 ? -15.215 -3.505  17.407 1.00 16.52 ? 236  GLU A CG  1 
ATOM   985  C  CD  . GLU A 1 127 ? -14.234 -3.309  18.561 1.00 17.75 ? 236  GLU A CD  1 
ATOM   986  O  OE1 . GLU A 1 127 ? -13.015 -3.093  18.326 1.00 16.80 ? 236  GLU A OE1 1 
ATOM   987  O  OE2 . GLU A 1 127 ? -14.693 -3.371  19.732 1.00 21.68 ? 236  GLU A OE2 1 
ATOM   988  N  N   . ALA A 1 128 ? -14.038 -4.296  13.022 1.00 13.92 ? 237  ALA A N   1 
ATOM   989  C  CA  . ALA A 1 128 ? -13.380 -4.002  11.753 1.00 13.91 ? 237  ALA A CA  1 
ATOM   990  C  C   . ALA A 1 128 ? -14.382 -3.894  10.613 1.00 15.81 ? 237  ALA A C   1 
ATOM   991  O  O   . ALA A 1 128 ? -14.257 -3.040  9.734  1.00 12.89 ? 237  ALA A O   1 
ATOM   992  C  CB  . ALA A 1 128 ? -12.340 -5.053  11.439 1.00 15.82 ? 237  ALA A CB  1 
ATOM   993  N  N   . ARG A 1 129 ? -15.387 -4.754  10.623 1.00 17.34 ? 238  ARG A N   1 
ATOM   994  C  CA  A ARG A 1 129 ? -16.364 -4.781  9.542  0.50 18.47 ? 238  ARG A CA  1 
ATOM   995  C  CA  B ARG A 1 129 ? -16.353 -4.765  9.535  0.50 18.46 ? 238  ARG A CA  1 
ATOM   996  C  C   . ARG A 1 129 ? -17.208 -3.509  9.562  1.00 14.54 ? 238  ARG A C   1 
ATOM   997  O  O   . ARG A 1 129 ? -17.574 -2.970  8.517  1.00 17.65 ? 238  ARG A O   1 
ATOM   998  C  CB  A ARG A 1 129 ? -17.243 -6.039  9.661  0.50 20.85 ? 238  ARG A CB  1 
ATOM   999  C  CB  B ARG A 1 129 ? -17.233 -6.017  9.594  0.50 20.88 ? 238  ARG A CB  1 
ATOM   1000 C  CG  A ARG A 1 129 ? -17.838 -6.512  8.330  0.50 22.65 ? 238  ARG A CG  1 
ATOM   1001 C  CG  B ARG A 1 129 ? -18.469 -5.896  8.717  0.50 21.96 ? 238  ARG A CG  1 
ATOM   1002 C  CD  A ARG A 1 129 ? -18.690 -7.779  8.469  0.50 25.75 ? 238  ARG A CD  1 
ATOM   1003 C  CD  B ARG A 1 129 ? -18.799 -7.164  7.946  0.50 26.10 ? 238  ARG A CD  1 
ATOM   1004 N  NE  A ARG A 1 129 ? -19.478 -8.027  7.257  0.50 26.97 ? 238  ARG A NE  1 
ATOM   1005 N  NE  B ARG A 1 129 ? -19.738 -6.861  6.865  0.50 25.77 ? 238  ARG A NE  1 
ATOM   1006 C  CZ  A ARG A 1 129 ? -20.295 -9.060  7.082  0.50 26.80 ? 238  ARG A CZ  1 
ATOM   1007 C  CZ  B ARG A 1 129 ? -19.379 -6.432  5.661  0.50 23.40 ? 238  ARG A CZ  1 
ATOM   1008 N  NH1 A ARG A 1 129 ? -20.454 -9.959  8.042  0.50 28.38 ? 238  ARG A NH1 1 
ATOM   1009 N  NH1 B ARG A 1 129 ? -18.099 -6.286  5.358  0.50 28.85 ? 238  ARG A NH1 1 
ATOM   1010 N  NH2 A ARG A 1 129 ? -20.960 -9.189  5.942  0.50 28.00 ? 238  ARG A NH2 1 
ATOM   1011 N  NH2 B ARG A 1 129 ? -20.300 -6.171  4.749  0.50 25.68 ? 238  ARG A NH2 1 
ATOM   1012 N  N   . SER A 1 130 ? -17.503 -3.030  10.762 1.00 16.09 ? 239  SER A N   1 
ATOM   1013 C  CA  . SER A 1 130 ? -18.290 -1.814  10.953 1.00 14.88 ? 239  SER A CA  1 
ATOM   1014 C  C   . SER A 1 130 ? -17.507 -0.569  10.510 1.00 12.01 ? 239  SER A C   1 
ATOM   1015 O  O   . SER A 1 130 ? -18.000 0.239   9.735  1.00 13.69 ? 239  SER A O   1 
ATOM   1016 C  CB  . SER A 1 130 ? -18.712 -1.705  12.434 1.00 19.68 ? 239  SER A CB  1 
ATOM   1017 O  OG  . SER A 1 130 ? -19.374 -2.888  12.875 1.00 16.35 ? 239  SER A OG  1 
ATOM   1018 N  N   . LEU A 1 131 ? -16.261 -0.453  10.968 1.00 15.06 ? 240  LEU A N   1 
ATOM   1019 C  CA  . LEU A 1 131 ? -15.393 0.666   10.586 1.00 14.99 ? 240  LEU A CA  1 
ATOM   1020 C  C   . LEU A 1 131 ? -15.149 0.724   9.090  1.00 16.96 ? 240  LEU A C   1 
ATOM   1021 O  O   . LEU A 1 131 ? -14.914 1.798   8.539  1.00 19.37 ? 240  LEU A O   1 
ATOM   1022 C  CB  . LEU A 1 131 ? -14.041 0.548   11.307 1.00 14.41 ? 240  LEU A CB  1 
ATOM   1023 C  CG  . LEU A 1 131 ? -14.092 0.639   12.822 1.00 14.51 ? 240  LEU A CG  1 
ATOM   1024 C  CD1 . LEU A 1 131 ? -12.762 0.189   13.444 1.00 13.50 ? 240  LEU A CD1 1 
ATOM   1025 C  CD2 . LEU A 1 131 ? -14.405 2.088   13.222 1.00 13.06 ? 240  LEU A CD2 1 
ATOM   1026 N  N   . GLY A 1 132 ? -15.179 -0.437  8.436  1.00 14.78 ? 241  GLY A N   1 
ATOM   1027 C  CA  . GLY A 1 132 ? -14.865 -0.529  7.018  1.00 16.86 ? 241  GLY A CA  1 
ATOM   1028 C  C   . GLY A 1 132 ? -16.084 -0.598  6.104  1.00 18.79 ? 241  GLY A C   1 
ATOM   1029 O  O   . GLY A 1 132 ? -15.973 -0.919  4.924  1.00 19.18 ? 241  GLY A O   1 
ATOM   1030 N  N   . LEU A 1 133 ? -17.268 -0.322  6.625  1.00 15.43 ? 242  LEU A N   1 
ATOM   1031 C  CA  . LEU A 1 133 ? -18.455 -0.412  5.777  1.00 18.01 ? 242  LEU A CA  1 
ATOM   1032 C  C   . LEU A 1 133 ? -18.417 0.634   4.668  1.00 19.34 ? 242  LEU A C   1 
ATOM   1033 O  O   . LEU A 1 133 ? -18.262 1.811   4.943  1.00 15.91 ? 242  LEU A O   1 
ATOM   1034 C  CB  . LEU A 1 133 ? -19.744 -0.236  6.616  1.00 17.27 ? 242  LEU A CB  1 
ATOM   1035 C  CG  . LEU A 1 133 ? -21.030 -0.342  5.785  1.00 17.34 ? 242  LEU A CG  1 
ATOM   1036 C  CD1 . LEU A 1 133 ? -21.180 -1.740  5.227  1.00 20.60 ? 242  LEU A CD1 1 
ATOM   1037 C  CD2 . LEU A 1 133 ? -22.283 0.027   6.581  1.00 17.15 ? 242  LEU A CD2 1 
ATOM   1038 N  N   . ASN A 1 134 ? -18.579 0.202   3.415  1.00 15.77 ? 243  ASN A N   1 
ATOM   1039 C  CA  . ASN A 1 134 ? -18.749 1.115   2.269  1.00 14.73 ? 243  ASN A CA  1 
ATOM   1040 C  C   . ASN A 1 134 ? -17.998 2.439   2.325  1.00 18.74 ? 243  ASN A C   1 
ATOM   1041 O  O   . ASN A 1 134 ? -18.603 3.512   2.220  1.00 18.27 ? 243  ASN A O   1 
ATOM   1042 C  CB  . ASN A 1 134 ? -20.237 1.377   2.035  1.00 16.76 ? 243  ASN A CB  1 
ATOM   1043 C  CG  . ASN A 1 134 ? -21.023 0.096   1.905  1.00 18.85 ? 243  ASN A CG  1 
ATOM   1044 O  OD1 . ASN A 1 134 ? -20.458 -0.946  1.556  1.00 26.91 ? 243  ASN A OD1 1 
ATOM   1045 N  ND2 . ASN A 1 134 ? -22.325 0.151   2.186  1.00 26.84 ? 243  ASN A ND2 1 
ATOM   1046 N  N   . PRO A 1 135 ? -16.661 2.367   2.436  1.00 17.63 ? 244  PRO A N   1 
ATOM   1047 C  CA  . PRO A 1 135 ? -15.797 3.523   2.729  1.00 15.29 ? 244  PRO A CA  1 
ATOM   1048 C  C   . PRO A 1 135 ? -15.735 4.561   1.613  1.00 18.34 ? 244  PRO A C   1 
ATOM   1049 O  O   . PRO A 1 135 ? -15.264 5.669   1.858  1.00 15.82 ? 244  PRO A O   1 
ATOM   1050 C  CB  . PRO A 1 135 ? -14.432 2.894   2.945  1.00 21.73 ? 244  PRO A CB  1 
ATOM   1051 C  CG  . PRO A 1 135 ? -14.694 1.473   3.196  1.00 25.80 ? 244  PRO A CG  1 
ATOM   1052 C  CD  . PRO A 1 135 ? -15.898 1.115   2.409  1.00 20.03 ? 244  PRO A CD  1 
ATOM   1053 N  N   . ASN A 1 136 ? -16.208 4.222   0.415  1.00 18.98 ? 245  ASN A N   1 
ATOM   1054 C  CA  . ASN A 1 136 ? -16.318 5.211   -0.647 1.00 16.69 ? 245  ASN A CA  1 
ATOM   1055 C  C   . ASN A 1 136 ? -17.730 5.729   -0.810 1.00 20.28 ? 245  ASN A C   1 
ATOM   1056 O  O   . ASN A 1 136 ? -17.993 6.570   -1.669 1.00 20.97 ? 245  ASN A O   1 
ATOM   1057 C  CB  . ASN A 1 136 ? -15.792 4.673   -1.974 1.00 20.69 ? 245  ASN A CB  1 
ATOM   1058 C  CG  . ASN A 1 136 ? -14.283 4.535   -1.982 1.00 23.00 ? 245  ASN A CG  1 
ATOM   1059 O  OD1 . ASN A 1 136 ? -13.564 5.199   -1.228 1.00 24.63 ? 245  ASN A OD1 1 
ATOM   1060 N  ND2 . ASN A 1 136 ? -13.799 3.661   -2.823 1.00 29.18 ? 245  ASN A ND2 1 
ATOM   1061 N  N   . HIS A 1 137 ? -18.645 5.249   0.020  1.00 16.88 ? 246  HIS A N   1 
ATOM   1062 C  CA  . HIS A 1 137 ? -19.977 5.839   0.061  1.00 17.93 ? 246  HIS A CA  1 
ATOM   1063 C  C   . HIS A 1 137 ? -20.198 6.674   1.333  1.00 15.18 ? 246  HIS A C   1 
ATOM   1064 O  O   . HIS A 1 137 ? -20.689 7.794   1.265  1.00 16.15 ? 246  HIS A O   1 
ATOM   1065 C  CB  . HIS A 1 137 ? -21.074 4.777   -0.057 1.00 16.56 ? 246  HIS A CB  1 
ATOM   1066 C  CG  . HIS A 1 137 ? -22.448 5.358   -0.042 1.00 17.44 ? 246  HIS A CG  1 
ATOM   1067 N  ND1 . HIS A 1 137 ? -22.972 6.053   -1.112 1.00 18.26 ? 246  HIS A ND1 1 
ATOM   1068 C  CD2 . HIS A 1 137 ? -23.385 5.414   0.939  1.00 18.00 ? 246  HIS A CD2 1 
ATOM   1069 C  CE1 . HIS A 1 137 ? -24.181 6.485   -0.807 1.00 19.41 ? 246  HIS A CE1 1 
ATOM   1070 N  NE2 . HIS A 1 137 ? -24.457 6.112   0.433  1.00 19.02 ? 246  HIS A NE2 1 
ATOM   1071 N  N   . ILE A 1 138 ? -19.818 6.128   2.475  1.00 13.86 ? 247  ILE A N   1 
ATOM   1072 C  CA  . ILE A 1 138 ? -19.973 6.835   3.750  1.00 14.99 ? 247  ILE A CA  1 
ATOM   1073 C  C   . ILE A 1 138 ? -18.795 7.795   3.954  1.00 14.71 ? 247  ILE A C   1 
ATOM   1074 O  O   . ILE A 1 138 ? -17.629 7.377   3.792  1.00 18.92 ? 247  ILE A O   1 
ATOM   1075 C  CB  . ILE A 1 138 ? -19.953 5.818   4.917  1.00 15.74 ? 247  ILE A CB  1 
ATOM   1076 C  CG1 . ILE A 1 138 ? -21.181 4.884   4.855  1.00 13.56 ? 247  ILE A CG1 1 
ATOM   1077 C  CG2 . ILE A 1 138 ? -19.871 6.548   6.258  1.00 12.94 ? 247  ILE A CG2 1 
ATOM   1078 C  CD1 . ILE A 1 138 ? -21.039 3.610   5.681  1.00 12.07 ? 247  ILE A CD1 1 
ATOM   1079 N  N   . HIS A 1 139 ? -19.067 9.056   4.297  1.00 12.03 ? 248  HIS A N   1 
ATOM   1080 C  CA  . HIS A 1 139 ? -17.986 10.027  4.531  1.00 12.90 ? 248  HIS A CA  1 
ATOM   1081 C  C   . HIS A 1 139 ? -17.484 10.020  5.965  1.00 17.00 ? 248  HIS A C   1 
ATOM   1082 O  O   . HIS A 1 139 ? -16.273 10.117  6.233  1.00 14.65 ? 248  HIS A O   1 
ATOM   1083 C  CB  . HIS A 1 139 ? -18.470 11.441  4.230  1.00 16.47 ? 248  HIS A CB  1 
ATOM   1084 C  CG  . HIS A 1 139 ? -18.840 11.667  2.799  1.00 19.67 ? 248  HIS A CG  1 
ATOM   1085 N  ND1 . HIS A 1 139 ? -20.129 11.544  2.334  1.00 19.61 ? 248  HIS A ND1 1 
ATOM   1086 C  CD2 . HIS A 1 139 ? -18.093 12.043  1.733  1.00 28.12 ? 248  HIS A CD2 1 
ATOM   1087 C  CE1 . HIS A 1 139 ? -20.160 11.794  1.039  1.00 19.22 ? 248  HIS A CE1 1 
ATOM   1088 N  NE2 . HIS A 1 139 ? -18.939 12.106  0.650  1.00 22.06 ? 248  HIS A NE2 1 
ATOM   1089 N  N   . ILE A 1 140 ? -18.443 9.904   6.878  1.00 13.87 ? 249  ILE A N   1 
ATOM   1090 C  CA  . ILE A 1 140 ? -18.242 10.156  8.296  1.00 14.34 ? 249  ILE A CA  1 
ATOM   1091 C  C   . ILE A 1 140 ? -18.904 9.059   9.119  1.00 13.24 ? 249  ILE A C   1 
ATOM   1092 O  O   . ILE A 1 140 ? -20.071 8.704   8.891  1.00 15.37 ? 249  ILE A O   1 
ATOM   1093 C  CB  . ILE A 1 140 ? -18.883 11.481  8.703  1.00 11.89 ? 249  ILE A CB  1 
ATOM   1094 C  CG1 . ILE A 1 140 ? -18.212 12.662  7.999  1.00 15.94 ? 249  ILE A CG1 1 
ATOM   1095 C  CG2 . ILE A 1 140 ? -18.848 11.662  10.233 1.00 11.50 ? 249  ILE A CG2 1 
ATOM   1096 C  CD1 . ILE A 1 140 ? -19.110 13.890  7.883  1.00 15.98 ? 249  ILE A CD1 1 
ATOM   1097 N  N   . TYR A 1 141 ? -18.153 8.528   10.077 1.00 10.76 ? 250  TYR A N   1 
ATOM   1098 C  CA  . TYR A 1 141 ? -18.649 7.506   10.981 1.00 12.74 ? 250  TYR A CA  1 
ATOM   1099 C  C   . TYR A 1 141 ? -18.663 8.058   12.397 1.00 13.56 ? 250  TYR A C   1 
ATOM   1100 O  O   . TYR A 1 141 ? -17.760 8.812   12.791 1.00 14.74 ? 250  TYR A O   1 
ATOM   1101 C  CB  . TYR A 1 141 ? -17.703 6.318   10.958 1.00 15.86 ? 250  TYR A CB  1 
ATOM   1102 C  CG  . TYR A 1 141 ? -17.525 5.651   9.622  1.00 11.12 ? 250  TYR A CG  1 
ATOM   1103 C  CD1 . TYR A 1 141 ? -16.661 6.178   8.677  1.00 13.79 ? 250  TYR A CD1 1 
ATOM   1104 C  CD2 . TYR A 1 141 ? -18.188 4.469   9.321  1.00 16.54 ? 250  TYR A CD2 1 
ATOM   1105 C  CE1 . TYR A 1 141 ? -16.464 5.565   7.456  1.00 16.55 ? 250  TYR A CE1 1 
ATOM   1106 C  CE2 . TYR A 1 141 ? -17.989 3.832   8.076  1.00 15.87 ? 250  TYR A CE2 1 
ATOM   1107 C  CZ  . TYR A 1 141 ? -17.120 4.392   7.158  1.00 15.43 ? 250  TYR A CZ  1 
ATOM   1108 O  OH  . TYR A 1 141 ? -16.894 3.803   5.919  1.00 17.99 ? 250  TYR A OH  1 
ATOM   1109 N  N   . SER A 1 142 ? -19.666 7.700   13.174 1.00 11.78 ? 251  SER A N   1 
ATOM   1110 C  CA  . SER A 1 142 ? -19.781 8.228   14.535 1.00 14.15 ? 251  SER A CA  1 
ATOM   1111 C  C   . SER A 1 142 ? -19.949 7.068   15.494 1.00 15.76 ? 251  SER A C   1 
ATOM   1112 O  O   . SER A 1 142 ? -20.800 6.201   15.274 1.00 14.74 ? 251  SER A O   1 
ATOM   1113 C  CB  . SER A 1 142 ? -20.968 9.203   14.622 1.00 17.79 ? 251  SER A CB  1 
ATOM   1114 O  OG  . SER A 1 142 ? -21.118 9.726   15.937 1.00 18.52 ? 251  SER A OG  1 
ATOM   1115 N  N   . ALA A 1 143 ? -19.142 7.030   16.557 1.00 15.60 ? 252  ALA A N   1 
ATOM   1116 C  CA  . ALA A 1 143 ? -19.168 5.897   17.484 1.00 16.76 ? 252  ALA A CA  1 
ATOM   1117 C  C   . ALA A 1 143 ? -18.728 6.304   18.895 1.00 17.44 ? 252  ALA A C   1 
ATOM   1118 O  O   . ALA A 1 143 ? -18.087 7.339   19.081 1.00 14.18 ? 252  ALA A O   1 
ATOM   1119 C  CB  . ALA A 1 143 ? -18.244 4.781   16.973 1.00 17.20 ? 252  ALA A CB  1 
ATOM   1120 N  N   . SER A 1 144 ? -19.067 5.493   19.886 1.00 14.65 ? 253  SER A N   1 
ATOM   1121 C  CA  . SER A 1 144 ? -18.685 5.812   21.266 1.00 17.56 ? 253  SER A CA  1 
ATOM   1122 C  C   . SER A 1 144 ? -18.282 4.568   22.024 1.00 23.63 ? 253  SER A C   1 
ATOM   1123 O  O   . SER A 1 144 ? -18.376 4.516   23.263 1.00 23.83 ? 253  SER A O   1 
ATOM   1124 C  CB  . SER A 1 144 ? -19.863 6.421   22.015 1.00 20.06 ? 253  SER A CB  1 
ATOM   1125 O  OG  . SER A 1 144 ? -20.915 5.471   22.030 1.00 22.25 ? 253  SER A OG  1 
ATOM   1126 N  N   . TRP A 1 145 ? -17.851 3.543   21.319 1.00 21.43 ? 254  TRP A N   1 
ATOM   1127 C  CA  . TRP A 1 145 ? -17.523 2.355   22.068 1.00 28.08 ? 254  TRP A CA  1 
ATOM   1128 C  C   . TRP A 1 145 ? -16.056 2.374   22.467 1.00 22.15 ? 254  TRP A C   1 
ATOM   1129 O  O   . TRP A 1 145 ? -15.244 3.187   21.971 1.00 20.57 ? 254  TRP A O   1 
ATOM   1130 C  CB  . TRP A 1 145 ? -17.955 1.053   21.365 1.00 28.88 ? 254  TRP A CB  1 
ATOM   1131 C  CG  . TRP A 1 145 ? -18.161 1.123   19.877 1.00 20.84 ? 254  TRP A CG  1 
ATOM   1132 C  CD1 . TRP A 1 145 ? -19.271 1.557   19.224 1.00 21.30 ? 254  TRP A CD1 1 
ATOM   1133 C  CD2 . TRP A 1 145 ? -17.250 0.699   18.883 1.00 20.13 ? 254  TRP A CD2 1 
ATOM   1134 N  NE1 . TRP A 1 145 ? -19.104 1.431   17.866 1.00 19.96 ? 254  TRP A NE1 1 
ATOM   1135 C  CE2 . TRP A 1 145 ? -17.858 0.914   17.631 1.00 21.00 ? 254  TRP A CE2 1 
ATOM   1136 C  CE3 . TRP A 1 145 ? -15.971 0.154   18.918 1.00 27.03 ? 254  TRP A CE3 1 
ATOM   1137 C  CZ2 . TRP A 1 145 ? -17.225 0.621   16.438 1.00 23.41 ? 254  TRP A CZ2 1 
ATOM   1138 C  CZ3 . TRP A 1 145 ? -15.349 -0.135  17.726 1.00 18.44 ? 254  TRP A CZ3 1 
ATOM   1139 C  CH2 . TRP A 1 145 ? -15.961 0.096   16.511 1.00 19.94 ? 254  TRP A CH2 1 
ATOM   1140 N  N   . GLY A 1 146 ? -15.745 1.511   23.419 1.00 20.21 ? 255  GLY A N   1 
ATOM   1141 C  CA  . GLY A 1 146 ? -14.401 1.419   23.947 1.00 19.86 ? 255  GLY A CA  1 
ATOM   1142 C  C   . GLY A 1 146 ? -14.473 0.602   25.205 1.00 18.37 ? 255  GLY A C   1 
ATOM   1143 O  O   . GLY A 1 146 ? -15.535 0.075   25.531 1.00 13.13 ? 255  GLY A O   1 
ATOM   1144 N  N   . PRO A 1 147 ? -13.353 0.516   25.926 1.00 16.26 ? 256  PRO A N   1 
ATOM   1145 C  CA  . PRO A 1 147 ? -13.259 -0.290  27.138 1.00 14.23 ? 256  PRO A CA  1 
ATOM   1146 C  C   . PRO A 1 147 ? -14.207 0.251   28.171 1.00 14.30 ? 256  PRO A C   1 
ATOM   1147 O  O   . PRO A 1 147 ? -14.560 1.436   28.152 1.00 14.24 ? 256  PRO A O   1 
ATOM   1148 C  CB  . PRO A 1 147 ? -11.832 -0.055  27.624 1.00 14.01 ? 256  PRO A CB  1 
ATOM   1149 C  CG  . PRO A 1 147 ? -11.132 0.690   26.544 1.00 15.71 ? 256  PRO A CG  1 
ATOM   1150 C  CD  . PRO A 1 147 ? -12.150 1.327   25.684 1.00 16.36 ? 256  PRO A CD  1 
ATOM   1151 N  N   . GLU A 1 148 ? -14.612 -0.623  29.076 1.00 13.42 ? 257  GLU A N   1 
ATOM   1152 C  CA  A GLU A 1 148 ? -15.463 -0.224  30.176 0.41 14.58 ? 257  GLU A CA  1 
ATOM   1153 C  CA  B GLU A 1 148 ? -15.434 -0.252  30.211 0.59 14.55 ? 257  GLU A CA  1 
ATOM   1154 C  C   . GLU A 1 148 ? -14.895 1.020   30.862 1.00 13.11 ? 257  GLU A C   1 
ATOM   1155 O  O   . GLU A 1 148 ? -13.698 1.093   31.189 1.00 11.41 ? 257  GLU A O   1 
ATOM   1156 C  CB  A GLU A 1 148 ? -15.579 -1.362  31.183 0.41 17.20 ? 257  GLU A CB  1 
ATOM   1157 C  CB  B GLU A 1 148 ? -15.380 -1.385  31.230 0.59 17.38 ? 257  GLU A CB  1 
ATOM   1158 C  CG  A GLU A 1 148 ? -16.795 -1.267  32.066 0.41 18.28 ? 257  GLU A CG  1 
ATOM   1159 C  CG  B GLU A 1 148 ? -16.293 -1.228  32.410 0.59 17.84 ? 257  GLU A CG  1 
ATOM   1160 C  CD  A GLU A 1 148 ? -16.948 -2.460  32.984 0.41 19.06 ? 257  GLU A CD  1 
ATOM   1161 C  CD  B GLU A 1 148 ? -17.762 -1.393  32.040 0.59 18.42 ? 257  GLU A CD  1 
ATOM   1162 O  OE1 A GLU A 1 148 ? -17.881 -2.437  33.813 0.41 19.92 ? 257  GLU A OE1 1 
ATOM   1163 O  OE1 B GLU A 1 148 ? -18.064 -2.161  31.096 0.59 18.29 ? 257  GLU A OE1 1 
ATOM   1164 O  OE2 A GLU A 1 148 ? -16.134 -3.403  32.886 0.41 18.38 ? 257  GLU A OE2 1 
ATOM   1165 O  OE2 B GLU A 1 148 ? -18.601 -0.744  32.696 0.59 17.30 ? 257  GLU A OE2 1 
ATOM   1166 N  N   . ASP A 1 149 ? -15.777 1.989   31.092 1.00 11.49 ? 258  ASP A N   1 
ATOM   1167 C  CA  . ASP A 1 149 ? -15.428 3.223   31.774 1.00 11.99 ? 258  ASP A CA  1 
ATOM   1168 C  C   . ASP A 1 149 ? -15.448 3.060   33.289 1.00 12.52 ? 258  ASP A C   1 
ATOM   1169 O  O   . ASP A 1 149 ? -16.080 3.860   33.980 1.00 13.65 ? 258  ASP A O   1 
ATOM   1170 C  CB  . ASP A 1 149 ? -16.412 4.348   31.374 1.00 11.66 ? 258  ASP A CB  1 
ATOM   1171 C  CG  . ASP A 1 149 ? -16.253 4.792   29.925 1.00 13.93 ? 258  ASP A CG  1 
ATOM   1172 O  OD1 . ASP A 1 149 ? -15.103 4.764   29.418 1.00 12.09 ? 258  ASP A OD1 1 
ATOM   1173 O  OD2 . ASP A 1 149 ? -17.282 5.185   29.305 1.00 10.29 ? 258  ASP A OD2 1 
ATOM   1174 N  N   . ASP A 1 150 ? -14.749 2.051   33.810 1.00 12.91 ? 259  ASP A N   1 
ATOM   1175 C  CA  . ASP A 1 150 ? -14.677 1.831   35.260 1.00 12.90 ? 259  ASP A CA  1 
ATOM   1176 C  C   . ASP A 1 150 ? -13.492 2.519   35.922 1.00 12.45 ? 259  ASP A C   1 
ATOM   1177 O  O   . ASP A 1 150 ? -13.324 2.437   37.120 1.00 11.61 ? 259  ASP A O   1 
ATOM   1178 C  CB  . ASP A 1 150 ? -14.656 0.332   35.615 1.00 15.37 ? 259  ASP A CB  1 
ATOM   1179 C  CG  . ASP A 1 150 ? -13.492 -0.453  34.946 1.00 18.53 ? 259  ASP A CG  1 
ATOM   1180 O  OD1 . ASP A 1 150 ? -12.590 0.152   34.300 1.00 13.09 ? 259  ASP A OD1 1 
ATOM   1181 O  OD2 . ASP A 1 150 ? -13.504 -1.709  35.065 1.00 14.72 ? 259  ASP A OD2 1 
ATOM   1182 N  N   . GLY A 1 151 ? -12.650 3.174   35.144 1.00 11.68 ? 260  GLY A N   1 
ATOM   1183 C  CA  . GLY A 1 151 ? -11.504 3.874   35.720 1.00 13.05 ? 260  GLY A CA  1 
ATOM   1184 C  C   . GLY A 1 151 ? -10.381 2.930   36.142 1.00 10.14 ? 260  GLY A C   1 
ATOM   1185 O  O   . GLY A 1 151 ? -9.453  3.333   36.846 1.00 11.95 ? 260  GLY A O   1 
ATOM   1186 N  N   . LYS A 1 152 ? -10.471 1.683   35.690 1.00 11.70 ? 261  LYS A N   1 
ATOM   1187 C  CA  . LYS A 1 152 ? -9.495  0.632   36.009 1.00 13.26 ? 261  LYS A CA  1 
ATOM   1188 C  C   . LYS A 1 152 ? -8.946  -0.073  34.780 1.00 16.52 ? 261  LYS A C   1 
ATOM   1189 O  O   . LYS A 1 152 ? -8.048  -0.906  34.891 1.00 16.14 ? 261  LYS A O   1 
ATOM   1190 C  CB  . LYS A 1 152 ? -10.187 -0.438  36.867 1.00 19.92 ? 261  LYS A CB  1 
ATOM   1191 C  CG  . LYS A 1 152 ? -10.857 0.111   38.091 1.00 20.66 ? 261  LYS A CG  1 
ATOM   1192 C  CD  . LYS A 1 152 ? -11.320 -0.996  39.021 1.00 21.85 ? 261  LYS A CD  1 
ATOM   1193 C  CE  . LYS A 1 152 ? -12.451 -1.789  38.456 1.00 27.06 ? 261  LYS A CE  1 
ATOM   1194 N  NZ  . LYS A 1 152 ? -12.906 -2.759  39.497 1.00 33.64 ? 261  LYS A NZ  1 
ATOM   1195 N  N   . THR A 1 153 ? -9.502  0.201   33.601 1.00 13.08 ? 262  THR A N   1 
ATOM   1196 C  CA  . THR A 1 153 ? -9.160  -0.594  32.422 1.00 16.01 ? 262  THR A CA  1 
ATOM   1197 C  C   . THR A 1 153 ? -8.230  0.169   31.470 1.00 14.65 ? 262  THR A C   1 
ATOM   1198 O  O   . THR A 1 153 ? -8.349  1.393   31.325 1.00 12.05 ? 262  THR A O   1 
ATOM   1199 C  CB  . THR A 1 153 ? -10.453 -0.993  31.659 1.00 15.93 ? 262  THR A CB  1 
ATOM   1200 O  OG1 . THR A 1 153 ? -11.335 -1.657  32.559 1.00 17.21 ? 262  THR A OG1 1 
ATOM   1201 C  CG2 . THR A 1 153 ? -10.171 -1.895  30.500 1.00 17.15 ? 262  THR A CG2 1 
ATOM   1202 N  N   . VAL A 1 154 ? -7.289  -0.548  30.854 1.00 14.37 ? 263  VAL A N   1 
ATOM   1203 C  CA  . VAL A 1 154 ? -6.506  -0.008  29.749 1.00 11.87 ? 263  VAL A CA  1 
ATOM   1204 C  C   . VAL A 1 154 ? -6.664  -0.987  28.608 1.00 12.91 ? 263  VAL A C   1 
ATOM   1205 O  O   . VAL A 1 154 ? -6.266  -2.154  28.738 1.00 14.46 ? 263  VAL A O   1 
ATOM   1206 C  CB  . VAL A 1 154 ? -5.018  0.104   30.081 1.00 11.95 ? 263  VAL A CB  1 
ATOM   1207 C  CG1 . VAL A 1 154 ? -4.256  0.750   28.924 1.00 13.33 ? 263  VAL A CG1 1 
ATOM   1208 C  CG2 . VAL A 1 154 ? -4.810  0.901   31.361 1.00 12.44 ? 263  VAL A CG2 1 
ATOM   1209 N  N   . ASP A 1 155 ? -7.232  -0.526  27.498 1.00 11.40 ? 264  ASP A N   1 
ATOM   1210 C  CA  . ASP A 1 155 ? -7.516  -1.389  26.354 1.00 13.43 ? 264  ASP A CA  1 
ATOM   1211 C  C   . ASP A 1 155 ? -7.849  -0.535  25.141 1.00 16.48 ? 264  ASP A C   1 
ATOM   1212 O  O   . ASP A 1 155 ? -8.164  0.650   25.250 1.00 13.33 ? 264  ASP A O   1 
ATOM   1213 C  CB  . ASP A 1 155 ? -8.693  -2.325  26.670 1.00 14.39 ? 264  ASP A CB  1 
ATOM   1214 C  CG  . ASP A 1 155 ? -8.675  -3.614  25.863 1.00 21.10 ? 264  ASP A CG  1 
ATOM   1215 O  OD1 . ASP A 1 155 ? -7.827  -3.782  24.959 1.00 20.99 ? 264  ASP A OD1 1 
ATOM   1216 O  OD2 . ASP A 1 155 ? -9.537  -4.462  26.144 1.00 22.95 ? 264  ASP A OD2 1 
ATOM   1217 N  N   . GLY A 1 156 ? -7.794  -1.143  23.971 1.00 14.24 ? 265  GLY A N   1 
ATOM   1218 C  CA  . GLY A 1 156 ? -8.101  -0.426  22.747 1.00 17.30 ? 265  GLY A CA  1 
ATOM   1219 C  C   . GLY A 1 156 ? -8.399  -1.409  21.638 1.00 17.99 ? 265  GLY A C   1 
ATOM   1220 O  O   . GLY A 1 156 ? -8.609  -2.593  21.915 1.00 16.40 ? 265  GLY A O   1 
ATOM   1221 N  N   . PRO A 1 157 ? -8.419  -0.929  20.384 1.00 15.96 ? 266  PRO A N   1 
ATOM   1222 C  CA  . PRO A 1 157 ? -8.709  -1.840  19.264 1.00 14.55 ? 266  PRO A CA  1 
ATOM   1223 C  C   . PRO A 1 157 ? -7.656  -2.937  19.121 1.00 16.43 ? 266  PRO A C   1 
ATOM   1224 O  O   . PRO A 1 157 ? -6.466  -2.660  19.271 1.00 15.60 ? 266  PRO A O   1 
ATOM   1225 C  CB  . PRO A 1 157 ? -8.690  -0.927  18.031 1.00 14.77 ? 266  PRO A CB  1 
ATOM   1226 C  CG  . PRO A 1 157 ? -7.892  0.302   18.437 1.00 16.86 ? 266  PRO A CG  1 
ATOM   1227 C  CD  . PRO A 1 157 ? -7.997  0.419   19.945 1.00 15.78 ? 266  PRO A CD  1 
ATOM   1228 N  N   . ALA A 1 158 ? -8.097  -4.153  18.811 1.00 16.55 ? 267  ALA A N   1 
ATOM   1229 C  CA  . ALA A 1 158 ? -7.175  -5.254  18.505 1.00 15.52 ? 267  ALA A CA  1 
ATOM   1230 C  C   . ALA A 1 158 ? -6.792  -5.133  17.018 1.00 19.80 ? 267  ALA A C   1 
ATOM   1231 O  O   . ALA A 1 158 ? -7.150  -4.121  16.373 1.00 14.78 ? 267  ALA A O   1 
ATOM   1232 C  CB  . ALA A 1 158 ? -7.839  -6.593  18.821 1.00 18.59 ? 267  ALA A CB  1 
ATOM   1233 N  N   . ARG A 1 159 ? -6.085  -6.132  16.467 1.00 17.20 ? 268  ARG A N   1 
ATOM   1234 C  CA  . ARG A 1 159 ? -5.421  -5.959  15.166 1.00 18.36 ? 268  ARG A CA  1 
ATOM   1235 C  C   . ARG A 1 159 ? -6.341  -5.645  14.002 1.00 17.23 ? 268  ARG A C   1 
ATOM   1236 O  O   . ARG A 1 159 ? -6.036  -4.790  13.165 1.00 13.07 ? 268  ARG A O   1 
ATOM   1237 C  CB  . ARG A 1 159 ? -4.567  -7.185  14.834 1.00 20.99 ? 268  ARG A CB  1 
ATOM   1238 C  CG  . ARG A 1 159 ? -3.744  -7.008  13.544 1.00 24.28 ? 268  ARG A CG  1 
ATOM   1239 C  CD  . ARG A 1 159 ? -2.985  -8.294  13.156 1.00 30.84 ? 268  ARG A CD  1 
ATOM   1240 N  NE  . ARG A 1 159 ? -3.871  -9.453  13.238 1.00 38.45 ? 268  ARG A NE  1 
ATOM   1241 C  CZ  . ARG A 1 159 ? -4.496  -10.012 12.203 1.00 42.40 ? 268  ARG A CZ  1 
ATOM   1242 N  NH1 . ARG A 1 159 ? -4.332  -9.541  10.967 1.00 45.20 ? 268  ARG A NH1 1 
ATOM   1243 N  NH2 . ARG A 1 159 ? -5.286  -11.057 12.409 1.00 39.91 ? 268  ARG A NH2 1 
ATOM   1244 N  N   . LEU A 1 160 ? -7.467  -6.329  13.898 1.00 14.42 ? 269  LEU A N   1 
ATOM   1245 C  CA  . LEU A 1 160 ? -8.298  -6.101  12.727 1.00 14.80 ? 269  LEU A CA  1 
ATOM   1246 C  C   . LEU A 1 160 ? -8.893  -4.711  12.732 1.00 15.36 ? 269  LEU A C   1 
ATOM   1247 O  O   . LEU A 1 160 ? -8.935  -4.038  11.689 1.00 13.67 ? 269  LEU A O   1 
ATOM   1248 C  CB  . LEU A 1 160 ? -9.409  -7.147  12.622 1.00 16.81 ? 269  LEU A CB  1 
ATOM   1249 C  CG  . LEU A 1 160 ? -8.857  -8.573  12.416 1.00 20.93 ? 269  LEU A CG  1 
ATOM   1250 C  CD1 . LEU A 1 160 ? -10.018 -9.565  12.419 1.00 21.98 ? 269  LEU A CD1 1 
ATOM   1251 C  CD2 . LEU A 1 160 ? -8.042  -8.658  11.137 1.00 18.98 ? 269  LEU A CD2 1 
ATOM   1252 N  N   . ALA A 1 161 ? -9.369  -4.274  13.900 1.00 16.07 ? 270  ALA A N   1 
ATOM   1253 C  CA  . ALA A 1 161 ? -9.944  -2.929  14.003 1.00 12.55 ? 270  ALA A CA  1 
ATOM   1254 C  C   . ALA A 1 161 ? -8.891  -1.837  13.797 1.00 12.94 ? 270  ALA A C   1 
ATOM   1255 O  O   . ALA A 1 161 ? -9.160  -0.841  13.137 1.00 15.07 ? 270  ALA A O   1 
ATOM   1256 C  CB  . ALA A 1 161 ? -10.697 -2.749  15.358 1.00 15.47 ? 270  ALA A CB  1 
ATOM   1257 N  N   . GLU A 1 162 ? -7.697  -2.027  14.335 1.00 13.80 ? 271  GLU A N   1 
ATOM   1258 C  CA  . GLU A 1 162 ? -6.603  -1.093  14.110 1.00 13.12 ? 271  GLU A CA  1 
ATOM   1259 C  C   . GLU A 1 162 ? -6.314  -0.973  12.619 1.00 14.93 ? 271  GLU A C   1 
ATOM   1260 O  O   . GLU A 1 162 ? -6.181  0.135   12.089 1.00 16.60 ? 271  GLU A O   1 
ATOM   1261 C  CB  . GLU A 1 162 ? -5.365  -1.549  14.877 1.00 17.72 ? 271  GLU A CB  1 
ATOM   1262 C  CG  . GLU A 1 162 ? -4.191  -0.607  14.764 1.00 24.16 ? 271  GLU A CG  1 
ATOM   1263 C  CD  . GLU A 1 162 ? -4.461  0.736   15.453 1.00 34.24 ? 271  GLU A CD  1 
ATOM   1264 O  OE1 . GLU A 1 162 ? -5.560  0.898   16.036 1.00 36.79 ? 271  GLU A OE1 1 
ATOM   1265 O  OE2 . GLU A 1 162 ? -3.575  1.627   15.412 1.00 38.15 ? 271  GLU A OE2 1 
ATOM   1266 N  N   . GLU A 1 163 ? -6.253  -2.113  11.929 1.00 14.70 ? 272  GLU A N   1 
ATOM   1267 C  CA  . GLU A 1 163 ? -5.995  -2.104  10.484 1.00 18.31 ? 272  GLU A CA  1 
ATOM   1268 C  C   . GLU A 1 163 ? -7.131  -1.440  9.703  1.00 14.25 ? 272  GLU A C   1 
ATOM   1269 O  O   . GLU A 1 163 ? -6.893  -0.793  8.696  1.00 12.98 ? 272  GLU A O   1 
ATOM   1270 C  CB  . GLU A 1 163 ? -5.739  -3.529  9.977  1.00 18.53 ? 272  GLU A CB  1 
ATOM   1271 C  CG  . GLU A 1 163 ? -4.415  -4.118  10.554 1.00 20.20 ? 272  GLU A CG  1 
ATOM   1272 C  CD  . GLU A 1 163 ? -4.131  -5.569  10.139 1.00 31.47 ? 272  GLU A CD  1 
ATOM   1273 O  OE1 . GLU A 1 163 ? -5.018  -6.222  9.528  1.00 29.39 ? 272  GLU A OE1 1 
ATOM   1274 O  OE2 . GLU A 1 163 ? -3.008  -6.051  10.448 1.00 31.62 ? 272  GLU A OE2 1 
ATOM   1275 N  N   . ALA A 1 164 ? -8.363  -1.603  10.176 1.00 14.09 ? 273  ALA A N   1 
ATOM   1276 C  CA  . ALA A 1 164 ? -9.508  -0.954  9.532  1.00 13.84 ? 273  ALA A CA  1 
ATOM   1277 C  C   . ALA A 1 164 ? -9.482  0.564   9.716  1.00 14.28 ? 273  ALA A C   1 
ATOM   1278 O  O   . ALA A 1 164 ? -9.874  1.314   8.813  1.00 13.55 ? 273  ALA A O   1 
ATOM   1279 C  CB  . ALA A 1 164 ? -10.821 -1.531  10.058 1.00 14.65 ? 273  ALA A CB  1 
ATOM   1280 N  N   . PHE A 1 165 ? -9.061  1.032   10.886 1.00 12.76 ? 274  PHE A N   1 
ATOM   1281 C  CA  . PHE A 1 165 ? -8.890  2.469   11.082 1.00 13.54 ? 274  PHE A CA  1 
ATOM   1282 C  C   . PHE A 1 165 ? -7.874  2.975   10.070 1.00 12.31 ? 274  PHE A C   1 
ATOM   1283 O  O   . PHE A 1 165 ? -8.050  4.025   9.455  1.00 13.10 ? 274  PHE A O   1 
ATOM   1284 C  CB  . PHE A 1 165 ? -8.371  2.789   12.488 1.00 14.17 ? 274  PHE A CB  1 
ATOM   1285 C  CG  . PHE A 1 165 ? -9.452  2.930   13.539 1.00 14.96 ? 274  PHE A CG  1 
ATOM   1286 C  CD1 . PHE A 1 165 ? -10.517 3.804   13.357 1.00 13.29 ? 274  PHE A CD1 1 
ATOM   1287 C  CD2 . PHE A 1 165 ? -9.388  2.213   14.717 1.00 14.77 ? 274  PHE A CD2 1 
ATOM   1288 C  CE1 . PHE A 1 165 ? -11.513 3.938   14.334 1.00 14.58 ? 274  PHE A CE1 1 
ATOM   1289 C  CE2 . PHE A 1 165 ? -10.384 2.354   15.689 1.00 15.36 ? 274  PHE A CE2 1 
ATOM   1290 C  CZ  . PHE A 1 165 ? -11.447 3.235   15.480 1.00 11.38 ? 274  PHE A CZ  1 
ATOM   1291 N  N   . PHE A 1 166 ? -6.778  2.242   9.935  1.00 16.11 ? 275  PHE A N   1 
ATOM   1292 C  CA  . PHE A 1 166 ? -5.680  2.712   9.081  1.00 16.48 ? 275  PHE A CA  1 
ATOM   1293 C  C   . PHE A 1 166 ? -6.063  2.680   7.628  1.00 16.72 ? 275  PHE A C   1 
ATOM   1294 O  O   . PHE A 1 166 ? -5.822  3.639   6.910  1.00 15.19 ? 275  PHE A O   1 
ATOM   1295 C  CB  . PHE A 1 166 ? -4.418  1.891   9.283  1.00 15.32 ? 275  PHE A CB  1 
ATOM   1296 C  CG  . PHE A 1 166 ? -3.315  2.277   8.353  1.00 20.54 ? 275  PHE A CG  1 
ATOM   1297 C  CD1 . PHE A 1 166 ? -2.574  3.427   8.581  1.00 23.93 ? 275  PHE A CD1 1 
ATOM   1298 C  CD2 . PHE A 1 166 ? -3.052  1.519   7.220  1.00 19.57 ? 275  PHE A CD2 1 
ATOM   1299 C  CE1 . PHE A 1 166 ? -1.558  3.801   7.700  1.00 27.37 ? 275  PHE A CE1 1 
ATOM   1300 C  CE2 . PHE A 1 166 ? -2.034  1.876   6.340  1.00 23.08 ? 275  PHE A CE2 1 
ATOM   1301 C  CZ  . PHE A 1 166 ? -1.288  3.019   6.582  1.00 27.97 ? 275  PHE A CZ  1 
ATOM   1302 N  N   . ARG A 1 167 ? -6.666  1.571   7.194  1.00 19.03 ? 276  ARG A N   1 
ATOM   1303 C  CA  . ARG A 1 167 ? -7.176  1.453   5.829  1.00 14.72 ? 276  ARG A CA  1 
ATOM   1304 C  C   . ARG A 1 167 ? -8.213  2.555   5.582  1.00 17.38 ? 276  ARG A C   1 
ATOM   1305 O  O   . ARG A 1 167 ? -8.229  3.160   4.518  1.00 17.58 ? 276  ARG A O   1 
ATOM   1306 C  CB  . ARG A 1 167 ? -7.799  0.061   5.619  1.00 17.42 ? 276  ARG A CB  1 
ATOM   1307 C  CG  . ARG A 1 167 ? -7.903  -0.424  4.171  1.00 27.94 ? 276  ARG A CG  1 
ATOM   1308 C  CD  . ARG A 1 167 ? -8.086  -1.972  4.106  1.00 31.62 ? 276  ARG A CD  1 
ATOM   1309 N  NE  . ARG A 1 167 ? -8.931  -2.447  5.201  1.00 32.31 ? 276  ARG A NE  1 
ATOM   1310 C  CZ  . ARG A 1 167 ? -8.602  -3.379  6.101  1.00 28.67 ? 276  ARG A CZ  1 
ATOM   1311 N  NH1 . ARG A 1 167 ? -9.468  -3.676  7.055  1.00 26.11 ? 276  ARG A NH1 1 
ATOM   1312 N  NH2 . ARG A 1 167 ? -7.446  -4.040  6.047  1.00 31.79 ? 276  ARG A NH2 1 
ATOM   1313 N  N   . GLY A 1 168 ? -9.053  2.830   6.583  1.00 15.57 ? 277  GLY A N   1 
ATOM   1314 C  CA  . GLY A 1 168 ? -10.060 3.872   6.475  1.00 15.97 ? 277  GLY A CA  1 
ATOM   1315 C  C   . GLY A 1 168 ? -9.468  5.247   6.180  1.00 14.10 ? 277  GLY A C   1 
ATOM   1316 O  O   . GLY A 1 168 ? -9.875  5.914   5.247  1.00 13.63 ? 277  GLY A O   1 
ATOM   1317 N  N   . VAL A 1 169 ? -8.524  5.698   7.000  1.00 13.27 ? 278  VAL A N   1 
ATOM   1318 C  CA  . VAL A 1 169 ? -7.991  7.034   6.813  1.00 11.24 ? 278  VAL A CA  1 
ATOM   1319 C  C   . VAL A 1 169 ? -7.068  7.081   5.573  1.00 12.82 ? 278  VAL A C   1 
ATOM   1320 O  O   . VAL A 1 169 ? -6.909  8.121   4.951  1.00 13.32 ? 278  VAL A O   1 
ATOM   1321 C  CB  . VAL A 1 169 ? -7.238  7.541   8.069  1.00 13.87 ? 278  VAL A CB  1 
ATOM   1322 C  CG1 . VAL A 1 169 ? -8.166  7.623   9.289  1.00 11.25 ? 278  VAL A CG1 1 
ATOM   1323 C  CG2 . VAL A 1 169 ? -6.018  6.677   8.341  1.00 14.63 ? 278  VAL A CG2 1 
ATOM   1324 N  N   . SER A 1 170 ? -6.484  5.942   5.217  1.00 13.90 ? 279  SER A N   1 
ATOM   1325 C  CA  . SER A 1 170 ? -5.578  5.845   4.064  1.00 14.74 ? 279  SER A CA  1 
ATOM   1326 C  C   . SER A 1 170 ? -6.282  5.831   2.726  1.00 19.05 ? 279  SER A C   1 
ATOM   1327 O  O   . SER A 1 170 ? -5.950  6.606   1.822  1.00 16.75 ? 279  SER A O   1 
ATOM   1328 C  CB  . SER A 1 170 ? -4.760  4.561   4.191  1.00 15.41 ? 279  SER A CB  1 
ATOM   1329 O  OG  . SER A 1 170 ? -3.799  4.780   5.177  1.00 26.57 ? 279  SER A OG  1 
ATOM   1330 N  N   . GLN A 1 171 ? -7.265  4.944   2.619  1.00 17.74 ? 280  GLN A N   1 
ATOM   1331 C  CA  . GLN A 1 171 ? -7.927  4.629   1.359  1.00 19.76 ? 280  GLN A CA  1 
ATOM   1332 C  C   . GLN A 1 171 ? -9.381  5.062   1.276  1.00 19.21 ? 280  GLN A C   1 
ATOM   1333 O  O   . GLN A 1 171 ? -9.946  5.175   0.176  1.00 16.01 ? 280  GLN A O   1 
ATOM   1334 C  CB  . GLN A 1 171 ? -7.887  3.111   1.146  1.00 22.99 ? 280  GLN A CB  1 
ATOM   1335 C  CG  . GLN A 1 171 ? -6.501  2.545   0.854  1.00 27.51 ? 280  GLN A CG  1 
ATOM   1336 C  CD  . GLN A 1 171 ? -6.583  1.090   0.404  1.00 40.74 ? 280  GLN A CD  1 
ATOM   1337 O  OE1 . GLN A 1 171 ? -7.332  0.762   -0.518 1.00 45.20 ? 280  GLN A OE1 1 
ATOM   1338 N  NE2 . GLN A 1 171 ? -5.844  0.210   1.074  1.00 32.59 ? 280  GLN A NE2 1 
ATOM   1339 N  N   . GLY A 1 172 ? -10.017 5.272   2.426  1.00 14.26 ? 281  GLY A N   1 
ATOM   1340 C  CA  . GLY A 1 172 ? -11.413 5.648   2.426  1.00 15.18 ? 281  GLY A CA  1 
ATOM   1341 C  C   . GLY A 1 172 ? -11.653 6.946   1.678  1.00 14.81 ? 281  GLY A C   1 
ATOM   1342 O  O   . GLY A 1 172 ? -10.717 7.757   1.503  1.00 14.26 ? 281  GLY A O   1 
ATOM   1343 N  N   . ARG A 1 173 ? -12.901 7.151   1.261  1.00 14.95 ? 282  ARG A N   1 
ATOM   1344 C  CA  . ARG A 1 173 ? -13.308 8.383   0.575  1.00 15.66 ? 282  ARG A CA  1 
ATOM   1345 C  C   . ARG A 1 173 ? -12.343 8.711   -0.563 1.00 17.39 ? 282  ARG A C   1 
ATOM   1346 O  O   . ARG A 1 173 ? -11.841 9.848   -0.693 1.00 14.06 ? 282  ARG A O   1 
ATOM   1347 C  CB  . ARG A 1 173 ? -13.352 9.576   1.538  1.00 18.05 ? 282  ARG A CB  1 
ATOM   1348 C  CG  . ARG A 1 173 ? -14.600 9.741   2.311  1.00 21.26 ? 282  ARG A CG  1 
ATOM   1349 C  CD  . ARG A 1 173 ? -14.804 11.204  2.670  1.00 18.30 ? 282  ARG A CD  1 
ATOM   1350 N  NE  . ARG A 1 173 ? -13.705 11.684  3.486  1.00 15.70 ? 282  ARG A NE  1 
ATOM   1351 C  CZ  . ARG A 1 173 ? -13.184 12.905  3.436  1.00 15.20 ? 282  ARG A CZ  1 
ATOM   1352 N  NH1 . ARG A 1 173 ? -12.182 13.188  4.247  1.00 15.62 ? 282  ARG A NH1 1 
ATOM   1353 N  NH2 . ARG A 1 173 ? -13.615 13.822  2.573  1.00 14.06 ? 282  ARG A NH2 1 
ATOM   1354 N  N   . GLY A 1 174 ? -12.087 7.710   -1.397 1.00 17.34 ? 283  GLY A N   1 
ATOM   1355 C  CA  . GLY A 1 174 ? -11.291 7.925   -2.600 1.00 14.93 ? 283  GLY A CA  1 
ATOM   1356 C  C   . GLY A 1 174 ? -9.871  8.371   -2.289 1.00 17.30 ? 283  GLY A C   1 
ATOM   1357 O  O   . GLY A 1 174 ? -9.194  8.922   -3.141 1.00 17.38 ? 283  GLY A O   1 
ATOM   1358 N  N   . GLY A 1 175 ? -9.400  8.109   -1.076 1.00 14.35 ? 284  GLY A N   1 
ATOM   1359 C  CA  . GLY A 1 175 ? -8.077  8.539   -0.670 1.00 12.35 ? 284  GLY A CA  1 
ATOM   1360 C  C   . GLY A 1 175 ? -8.027  9.716   0.299  1.00 16.04 ? 284  GLY A C   1 
ATOM   1361 O  O   . GLY A 1 175 ? -6.965  10.013  0.849  1.00 12.91 ? 284  GLY A O   1 
ATOM   1362 N  N   . LEU A 1 176 ? -9.155  10.404  0.505  1.00 15.16 ? 285  LEU A N   1 
ATOM   1363 C  CA  . LEU A 1 176 ? -9.185  11.561  1.378  1.00 13.61 ? 285  LEU A CA  1 
ATOM   1364 C  C   . LEU A 1 176 ? -9.245  11.117  2.840  1.00 14.23 ? 285  LEU A C   1 
ATOM   1365 O  O   . LEU A 1 176 ? -8.816  11.843  3.734  1.00 14.10 ? 285  LEU A O   1 
ATOM   1366 C  CB  . LEU A 1 176 ? -10.387 12.434  1.073  1.00 13.38 ? 285  LEU A CB  1 
ATOM   1367 C  CG  . LEU A 1 176 ? -10.461 12.983  -0.352 1.00 15.42 ? 285  LEU A CG  1 
ATOM   1368 C  CD1 . LEU A 1 176 ? -11.813 13.644  -0.607 1.00 19.12 ? 285  LEU A CD1 1 
ATOM   1369 C  CD2 . LEU A 1 176 ? -9.298  13.966  -0.608 1.00 15.46 ? 285  LEU A CD2 1 
ATOM   1370 N  N   . GLY A 1 177 ? -9.797  9.932   3.070  1.00 13.65 ? 286  GLY A N   1 
ATOM   1371 C  CA  . GLY A 1 177 ? -9.813  9.334   4.390  1.00 12.80 ? 286  GLY A CA  1 
ATOM   1372 C  C   . GLY A 1 177 ? -11.155 9.406   5.081  1.00 10.71 ? 286  GLY A C   1 
ATOM   1373 O  O   . GLY A 1 177 ? -11.728 10.479  5.246  1.00 13.15 ? 286  GLY A O   1 
ATOM   1374 N  N   . SER A 1 178 ? -11.647 8.253   5.506  1.00 13.75 ? 287  SER A N   1 
ATOM   1375 C  CA  . SER A 1 178 ? -12.800 8.197   6.400  1.00 12.26 ? 287  SER A CA  1 
ATOM   1376 C  C   . SER A 1 178 ? -12.606 9.140   7.581  1.00 13.73 ? 287  SER A C   1 
ATOM   1377 O  O   . SER A 1 178 ? -11.503 9.236   8.156  1.00 11.76 ? 287  SER A O   1 
ATOM   1378 C  CB  . SER A 1 178 ? -12.982 6.786   6.969  1.00 14.26 ? 287  SER A CB  1 
ATOM   1379 O  OG  . SER A 1 178 ? -13.165 5.795   5.986  1.00 13.27 ? 287  SER A OG  1 
ATOM   1380 N  N   . ILE A 1 179 ? -13.666 9.834   7.968  1.00 11.99 ? 288  ILE A N   1 
ATOM   1381 C  CA  . ILE A 1 179 ? -13.593 10.643  9.171  1.00 11.47 ? 288  ILE A CA  1 
ATOM   1382 C  C   . ILE A 1 179 ? -14.276 9.861   10.298 1.00 12.19 ? 288  ILE A C   1 
ATOM   1383 O  O   . ILE A 1 179 ? -15.476 9.675   10.267 1.00 10.91 ? 288  ILE A O   1 
ATOM   1384 C  CB  . ILE A 1 179 ? -14.250 12.019  8.944  1.00 13.13 ? 288  ILE A CB  1 
ATOM   1385 C  CG1 . ILE A 1 179 ? -13.471 12.778  7.851  1.00 11.23 ? 288  ILE A CG1 1 
ATOM   1386 C  CG2 . ILE A 1 179 ? -14.274 12.823  10.249 1.00 11.86 ? 288  ILE A CG2 1 
ATOM   1387 C  CD1 . ILE A 1 179 ? -14.137 14.077  7.384  1.00 14.95 ? 288  ILE A CD1 1 
ATOM   1388 N  N   . PHE A 1 180 ? -13.503 9.396   11.275 1.00 9.98  ? 289  PHE A N   1 
ATOM   1389 C  CA  . PHE A 1 180 ? -14.057 8.648   12.411 1.00 13.98 ? 289  PHE A CA  1 
ATOM   1390 C  C   . PHE A 1 180 ? -14.236 9.595   13.616 1.00 12.72 ? 289  PHE A C   1 
ATOM   1391 O  O   . PHE A 1 180 ? -13.255 10.013  14.223 1.00 10.63 ? 289  PHE A O   1 
ATOM   1392 C  CB  . PHE A 1 180 ? -13.146 7.489   12.817 1.00 11.45 ? 289  PHE A CB  1 
ATOM   1393 C  CG  . PHE A 1 180 ? -12.927 6.466   11.730 1.00 10.20 ? 289  PHE A CG  1 
ATOM   1394 C  CD1 . PHE A 1 180 ? -13.940 5.587   11.373 1.00 13.83 ? 289  PHE A CD1 1 
ATOM   1395 C  CD2 . PHE A 1 180 ? -11.705 6.378   11.083 1.00 13.14 ? 289  PHE A CD2 1 
ATOM   1396 C  CE1 . PHE A 1 180 ? -13.736 4.644   10.356 1.00 12.99 ? 289  PHE A CE1 1 
ATOM   1397 C  CE2 . PHE A 1 180 ? -11.489 5.432   10.079 1.00 13.60 ? 289  PHE A CE2 1 
ATOM   1398 C  CZ  . PHE A 1 180 ? -12.508 4.571   9.716  1.00 14.56 ? 289  PHE A CZ  1 
ATOM   1399 N  N   . VAL A 1 181 ? -15.478 9.933   13.945 1.00 11.75 ? 290  VAL A N   1 
ATOM   1400 C  CA  . VAL A 1 181 ? -15.753 10.834  15.079 1.00 12.58 ? 290  VAL A CA  1 
ATOM   1401 C  C   . VAL A 1 181 ? -16.070 9.997   16.304 1.00 14.28 ? 290  VAL A C   1 
ATOM   1402 O  O   . VAL A 1 181 ? -16.891 9.063   16.224 1.00 12.00 ? 290  VAL A O   1 
ATOM   1403 C  CB  . VAL A 1 181 ? -16.956 11.758  14.774 1.00 14.96 ? 290  VAL A CB  1 
ATOM   1404 C  CG1 . VAL A 1 181 ? -17.203 12.755  15.933 1.00 10.36 ? 290  VAL A CG1 1 
ATOM   1405 C  CG2 . VAL A 1 181 ? -16.715 12.494  13.479 1.00 12.44 ? 290  VAL A CG2 1 
ATOM   1406 N  N   . TRP A 1 182 ? -15.420 10.298  17.432 1.00 10.48 ? 291  TRP A N   1 
ATOM   1407 C  CA  . TRP A 1 182 ? -15.516 9.454   18.604 1.00 8.54  ? 291  TRP A CA  1 
ATOM   1408 C  C   . TRP A 1 182 ? -15.864 10.241  19.869 1.00 11.83 ? 291  TRP A C   1 
ATOM   1409 O  O   . TRP A 1 182 ? -15.416 11.352  20.064 1.00 11.52 ? 291  TRP A O   1 
ATOM   1410 C  CB  . TRP A 1 182 ? -14.197 8.707   18.859 1.00 11.89 ? 291  TRP A CB  1 
ATOM   1411 C  CG  . TRP A 1 182 ? -14.390 7.250   19.149 1.00 12.71 ? 291  TRP A CG  1 
ATOM   1412 C  CD1 . TRP A 1 182 ? -14.488 6.651   20.378 1.00 13.89 ? 291  TRP A CD1 1 
ATOM   1413 C  CD2 . TRP A 1 182 ? -14.530 6.197   18.186 1.00 13.31 ? 291  TRP A CD2 1 
ATOM   1414 N  NE1 . TRP A 1 182 ? -14.682 5.302   20.240 1.00 15.82 ? 291  TRP A NE1 1 
ATOM   1415 C  CE2 . TRP A 1 182 ? -14.705 4.994   18.903 1.00 16.54 ? 291  TRP A CE2 1 
ATOM   1416 C  CE3 . TRP A 1 182 ? -14.514 6.157   16.788 1.00 13.16 ? 291  TRP A CE3 1 
ATOM   1417 C  CZ2 . TRP A 1 182 ? -14.858 3.760   18.266 1.00 15.24 ? 291  TRP A CZ2 1 
ATOM   1418 C  CZ3 . TRP A 1 182 ? -14.664 4.939   16.164 1.00 14.23 ? 291  TRP A CZ3 1 
ATOM   1419 C  CH2 . TRP A 1 182 ? -14.834 3.759   16.902 1.00 14.12 ? 291  TRP A CH2 1 
ATOM   1420 N  N   . ALA A 1 183 ? -16.648 9.623   20.734 1.00 11.15 ? 292  ALA A N   1 
ATOM   1421 C  CA  . ALA A 1 183 ? -16.895 10.144  22.071 1.00 11.56 ? 292  ALA A CA  1 
ATOM   1422 C  C   . ALA A 1 183 ? -15.751 9.723   22.981 1.00 10.94 ? 292  ALA A C   1 
ATOM   1423 O  O   . ALA A 1 183 ? -15.264 8.610   22.865 1.00 16.00 ? 292  ALA A O   1 
ATOM   1424 C  CB  . ALA A 1 183 ? -18.218 9.608   22.599 1.00 10.08 ? 292  ALA A CB  1 
ATOM   1425 N  N   . SER A 1 184 ? -15.354 10.576  23.917 1.00 10.19 ? 293  SER A N   1 
ATOM   1426 C  CA  . SER A 1 184 ? -14.160 10.303  24.718 1.00 10.69 ? 293  SER A CA  1 
ATOM   1427 C  C   . SER A 1 184 ? -14.391 9.500   25.988 1.00 11.96 ? 293  SER A C   1 
ATOM   1428 O  O   . SER A 1 184 ? -13.431 9.122   26.667 1.00 10.04 ? 293  SER A O   1 
ATOM   1429 C  CB  . SER A 1 184 ? -13.466 11.608  25.108 1.00 12.16 ? 293  SER A CB  1 
ATOM   1430 O  OG  . SER A 1 184 ? -14.375 12.455  25.801 1.00 11.27 ? 293  SER A OG  1 
ATOM   1431 N  N   . GLY A 1 185 ? -15.644 9.311   26.365 1.00 9.73  ? 294  GLY A N   1 
ATOM   1432 C  CA  . GLY A 1 185 ? -15.935 8.394   27.444 1.00 12.88 ? 294  GLY A CA  1 
ATOM   1433 C  C   . GLY A 1 185 ? -16.891 8.978   28.467 1.00 12.12 ? 294  GLY A C   1 
ATOM   1434 O  O   . GLY A 1 185 ? -17.087 10.196  28.547 1.00 11.38 ? 294  GLY A O   1 
ATOM   1435 N  N   . ASN A 1 186 ? -17.476 8.092   29.260 1.00 8.70  ? 295  ASN A N   1 
ATOM   1436 C  CA  . ASN A 1 186 ? -18.413 8.490   30.291 1.00 8.09  ? 295  ASN A CA  1 
ATOM   1437 C  C   . ASN A 1 186 ? -17.984 8.108   31.709 1.00 10.53 ? 295  ASN A C   1 
ATOM   1438 O  O   . ASN A 1 186 ? -18.835 8.016   32.595 1.00 12.83 ? 295  ASN A O   1 
ATOM   1439 C  CB  . ASN A 1 186 ? -19.764 7.857   30.012 1.00 10.80 ? 295  ASN A CB  1 
ATOM   1440 C  CG  . ASN A 1 186 ? -20.516 8.576   28.914 1.00 15.40 ? 295  ASN A CG  1 
ATOM   1441 O  OD1 . ASN A 1 186 ? -20.489 9.803   28.842 1.00 16.41 ? 295  ASN A OD1 1 
ATOM   1442 N  ND2 . ASN A 1 186 ? -21.244 7.833   28.109 1.00 17.27 ? 295  ASN A ND2 1 
ATOM   1443 N  N   . GLY A 1 187 ? -16.687 7.896   31.930 1.00 11.78 ? 296  GLY A N   1 
ATOM   1444 C  CA  . GLY A 1 187 ? -16.199 7.365   33.206 1.00 9.00  ? 296  GLY A CA  1 
ATOM   1445 C  C   . GLY A 1 187 ? -15.788 8.367   34.262 1.00 9.37  ? 296  GLY A C   1 
ATOM   1446 O  O   . GLY A 1 187 ? -15.060 8.017   35.207 1.00 12.05 ? 296  GLY A O   1 
ATOM   1447 N  N   . GLY A 1 188 ? -16.257 9.602   34.136 1.00 8.01  ? 297  GLY A N   1 
ATOM   1448 C  CA  . GLY A 1 188 ? -15.912 10.663  35.088 1.00 7.70  ? 297  GLY A CA  1 
ATOM   1449 C  C   . GLY A 1 188 ? -16.139 10.352  36.559 1.00 11.27 ? 297  GLY A C   1 
ATOM   1450 O  O   . GLY A 1 188 ? -15.319 10.706  37.403 1.00 11.66 ? 297  GLY A O   1 
ATOM   1451 N  N   . ARG A 1 189 ? -17.256 9.700   36.882 1.00 12.19 ? 298  ARG A N   1 
ATOM   1452 C  CA  . ARG A 1 189 ? -17.571 9.354   38.287 1.00 9.99  ? 298  ARG A CA  1 
ATOM   1453 C  C   . ARG A 1 189 ? -16.495 8.424   38.864 1.00 12.19 ? 298  ARG A C   1 
ATOM   1454 O  O   . ARG A 1 189 ? -16.226 8.422   40.077 1.00 13.52 ? 298  ARG A O   1 
ATOM   1455 C  CB  . ARG A 1 189 ? -18.948 8.686   38.353 1.00 12.07 ? 298  ARG A CB  1 
ATOM   1456 C  CG  . ARG A 1 189 ? -19.408 8.273   39.759 1.00 13.90 ? 298  ARG A CG  1 
ATOM   1457 C  CD  . ARG A 1 189 ? -20.730 7.556   39.642 1.00 17.43 ? 298  ARG A CD  1 
ATOM   1458 N  NE  . ARG A 1 189 ? -21.294 7.211   40.946 1.00 16.29 ? 298  ARG A NE  1 
ATOM   1459 C  CZ  . ARG A 1 189 ? -21.021 6.096   41.615 1.00 22.93 ? 298  ARG A CZ  1 
ATOM   1460 N  NH1 . ARG A 1 189 ? -20.163 5.198   41.122 1.00 21.85 ? 298  ARG A NH1 1 
ATOM   1461 N  NH2 . ARG A 1 189 ? -21.610 5.880   42.796 1.00 21.62 ? 298  ARG A NH2 1 
ATOM   1462 N  N   . GLU A 1 190 ? -15.875 7.643   37.987 1.00 11.24 ? 299  GLU A N   1 
ATOM   1463 C  CA  . GLU A 1 190 ? -14.891 6.642   38.412 1.00 13.12 ? 299  GLU A CA  1 
ATOM   1464 C  C   . GLU A 1 190 ? -13.464 7.172   38.259 1.00 12.41 ? 299  GLU A C   1 
ATOM   1465 O  O   . GLU A 1 190 ? -12.503 6.406   38.356 1.00 12.68 ? 299  GLU A O   1 
ATOM   1466 C  CB  . GLU A 1 190 ? -15.071 5.342   37.601 1.00 13.17 ? 299  GLU A CB  1 
ATOM   1467 C  CG  . GLU A 1 190 ? -16.501 4.827   37.518 1.00 12.79 ? 299  GLU A CG  1 
ATOM   1468 C  CD  . GLU A 1 190 ? -17.194 4.741   38.877 1.00 20.25 ? 299  GLU A CD  1 
ATOM   1469 O  OE1 . GLU A 1 190 ? -16.517 4.391   39.867 1.00 20.14 ? 299  GLU A OE1 1 
ATOM   1470 O  OE2 . GLU A 1 190 ? -18.418 5.027   38.938 1.00 18.91 ? 299  GLU A OE2 1 
ATOM   1471 N  N   . HIS A 1 191 ? -13.340 8.481   38.005 1.00 11.90 ? 300  HIS A N   1 
ATOM   1472 C  CA  . HIS A 1 191 ? -12.053 9.144   37.756 1.00 10.61 ? 300  HIS A CA  1 
ATOM   1473 C  C   . HIS A 1 191 ? -11.285 8.557   36.589 1.00 10.72 ? 300  HIS A C   1 
ATOM   1474 O  O   . HIS A 1 191 ? -10.057 8.536   36.591 1.00 12.16 ? 300  HIS A O   1 
ATOM   1475 C  CB  . HIS A 1 191 ? -11.165 9.136   38.997 1.00 17.10 ? 300  HIS A CB  1 
ATOM   1476 C  CG  . HIS A 1 191 ? -11.900 9.435   40.254 1.00 14.22 ? 300  HIS A CG  1 
ATOM   1477 N  ND1 . HIS A 1 191 ? -12.288 10.710  40.606 1.00 21.07 ? 300  HIS A ND1 1 
ATOM   1478 C  CD2 . HIS A 1 191 ? -12.342 8.615   41.245 1.00 21.31 ? 300  HIS A CD2 1 
ATOM   1479 C  CE1 . HIS A 1 191 ? -12.943 10.663  41.757 1.00 24.45 ? 300  HIS A CE1 1 
ATOM   1480 N  NE2 . HIS A 1 191 ? -12.987 9.405   42.164 1.00 22.33 ? 300  HIS A NE2 1 
ATOM   1481 N  N   . ASP A 1 192 ? -12.001 8.123   35.561 1.00 9.57  ? 301  ASP A N   1 
ATOM   1482 C  CA  . ASP A 1 192 ? -11.352 7.543   34.398 1.00 10.64 ? 301  ASP A CA  1 
ATOM   1483 C  C   . ASP A 1 192 ? -10.588 8.634   33.612 1.00 16.75 ? 301  ASP A C   1 
ATOM   1484 O  O   . ASP A 1 192 ? -10.897 9.836   33.713 1.00 11.25 ? 301  ASP A O   1 
ATOM   1485 C  CB  . ASP A 1 192 ? -12.408 6.837   33.541 1.00 11.00 ? 301  ASP A CB  1 
ATOM   1486 C  CG  . ASP A 1 192 ? -11.825 5.801   32.606 1.00 12.17 ? 301  ASP A CG  1 
ATOM   1487 O  OD1 . ASP A 1 192 ? -10.592 5.566   32.671 1.00 10.29 ? 301  ASP A OD1 1 
ATOM   1488 O  OD2 . ASP A 1 192 ? -12.606 5.207   31.807 1.00 10.86 ? 301  ASP A OD2 1 
ATOM   1489 N  N   . SER A 1 193 ? -9.581  8.203   32.847 1.00 11.46 ? 302  SER A N   1 
ATOM   1490 C  CA  . SER A 1 193 ? -8.662  9.104   32.178 1.00 12.18 ? 302  SER A CA  1 
ATOM   1491 C  C   . SER A 1 193 ? -8.649  8.561   30.760 1.00 14.09 ? 302  SER A C   1 
ATOM   1492 O  O   . SER A 1 193 ? -8.281  7.414   30.563 1.00 19.65 ? 302  SER A O   1 
ATOM   1493 C  CB  . SER A 1 193 ? -7.280  9.003   32.860 1.00 18.68 ? 302  SER A CB  1 
ATOM   1494 O  OG  . SER A 1 193 ? -6.387  10.055  32.499 1.00 19.39 ? 302  SER A OG  1 
ATOM   1495 N  N   . CYS A 1 194 ? -9.105  9.330   29.773 1.00 11.74 ? 303  CYS A N   1 
ATOM   1496 C  CA  . CYS A 1 194 ? -9.459  8.730   28.488 1.00 13.92 ? 303  CYS A CA  1 
ATOM   1497 C  C   . CYS A 1 194 ? -8.269  8.317   27.605 1.00 13.41 ? 303  CYS A C   1 
ATOM   1498 O  O   . CYS A 1 194 ? -8.483  7.641   26.602 1.00 11.64 ? 303  CYS A O   1 
ATOM   1499 C  CB  . CYS A 1 194 ? -10.503 9.551   27.709 1.00 12.93 ? 303  CYS A CB  1 
ATOM   1500 S  SG  . CYS A 1 194 ? -10.371 11.360  27.741 1.00 15.04 ? 303  CYS A SG  1 
ATOM   1501 N  N   . ASN A 1 195 ? -7.027  8.644   27.979 1.00 12.80 ? 304  ASN A N   1 
ATOM   1502 C  CA  . ASN A 1 195 ? -5.898  8.087   27.215 1.00 10.80 ? 304  ASN A CA  1 
ATOM   1503 C  C   . ASN A 1 195 ? -5.737  6.579   27.455 1.00 12.00 ? 304  ASN A C   1 
ATOM   1504 O  O   . ASN A 1 195 ? -4.975  5.933   26.746 1.00 12.55 ? 304  ASN A O   1 
ATOM   1505 C  CB  . ASN A 1 195 ? -4.563  8.771   27.506 1.00 14.81 ? 304  ASN A CB  1 
ATOM   1506 C  CG  . ASN A 1 195 ? -4.437  10.146  26.840 1.00 16.02 ? 304  ASN A CG  1 
ATOM   1507 O  OD1 . ASN A 1 195 ? -5.276  10.546  26.019 1.00 20.33 ? 304  ASN A OD1 1 
ATOM   1508 N  ND2 . ASN A 1 195 ? -3.392  10.884  27.225 1.00 12.27 ? 304  ASN A ND2 1 
ATOM   1509 N  N   . CYS A 1 196 ? -6.448  6.033   28.450 1.00 13.07 ? 305  CYS A N   1 
ATOM   1510 C  CA  . CYS A 1 196 ? -6.481  4.584   28.699 1.00 10.16 ? 305  CYS A CA  1 
ATOM   1511 C  C   . CYS A 1 196 ? -7.488  3.852   27.800 1.00 10.98 ? 305  CYS A C   1 
ATOM   1512 O  O   . CYS A 1 196 ? -7.682  2.628   27.920 1.00 12.12 ? 305  CYS A O   1 
ATOM   1513 C  CB  . CYS A 1 196 ? -6.816  4.319   30.158 1.00 9.64  ? 305  CYS A CB  1 
ATOM   1514 S  SG  . CYS A 1 196 ? -5.536  4.935   31.286 1.00 11.94 ? 305  CYS A SG  1 
ATOM   1515 N  N   . ASP A 1 197 ? -8.102  4.603   26.893 1.00 10.06 ? 306  ASP A N   1 
ATOM   1516 C  CA  . ASP A 1 197 ? -9.068  4.082   25.916 1.00 11.51 ? 306  ASP A CA  1 
ATOM   1517 C  C   . ASP A 1 197 ? -8.463  4.251   24.522 1.00 11.46 ? 306  ASP A C   1 
ATOM   1518 O  O   . ASP A 1 197 ? -8.411  5.360   24.000 1.00 11.26 ? 306  ASP A O   1 
ATOM   1519 C  CB  . ASP A 1 197 ? -10.378 4.869   26.090 1.00 11.30 ? 306  ASP A CB  1 
ATOM   1520 C  CG  . ASP A 1 197 ? -11.412 4.594   25.015 1.00 15.02 ? 306  ASP A CG  1 
ATOM   1521 O  OD1 . ASP A 1 197 ? -11.083 4.031   23.940 1.00 12.45 ? 306  ASP A OD1 1 
ATOM   1522 O  OD2 . ASP A 1 197 ? -12.587 5.006   25.254 1.00 14.99 ? 306  ASP A OD2 1 
ATOM   1523 N  N   . GLY A 1 198 ? -7.963  3.150   23.948 1.00 12.24 ? 307  GLY A N   1 
ATOM   1524 C  CA  . GLY A 1 198 ? -7.278  3.196   22.663 1.00 13.68 ? 307  GLY A CA  1 
ATOM   1525 C  C   . GLY A 1 198 ? -8.093  3.596   21.438 1.00 11.23 ? 307  GLY A C   1 
ATOM   1526 O  O   . GLY A 1 198 ? -7.526  3.849   20.379 1.00 12.18 ? 307  GLY A O   1 
ATOM   1527 N  N   . TYR A 1 199 ? -9.419  3.614   21.549 1.00 11.43 ? 308  TYR A N   1 
ATOM   1528 C  CA  . TYR A 1 199 ? -10.259 4.057   20.456 1.00 12.58 ? 308  TYR A CA  1 
ATOM   1529 C  C   . TYR A 1 199 ? -10.242 5.583   20.400 1.00 11.00 ? 308  TYR A C   1 
ATOM   1530 O  O   . TYR A 1 199 ? -9.938  6.177   19.366 1.00 12.56 ? 308  TYR A O   1 
ATOM   1531 C  CB  . TYR A 1 199 ? -11.684 3.537   20.613 1.00 11.54 ? 308  TYR A CB  1 
ATOM   1532 C  CG  . TYR A 1 199 ? -11.759 2.030   20.556 1.00 12.81 ? 308  TYR A CG  1 
ATOM   1533 C  CD1 . TYR A 1 199 ? -11.523 1.272   21.692 1.00 12.42 ? 308  TYR A CD1 1 
ATOM   1534 C  CD2 . TYR A 1 199 ? -12.058 1.364   19.365 1.00 14.28 ? 308  TYR A CD2 1 
ATOM   1535 C  CE1 . TYR A 1 199 ? -11.584 -0.116  21.655 1.00 17.13 ? 308  TYR A CE1 1 
ATOM   1536 C  CE2 . TYR A 1 199 ? -12.115 -0.023  19.315 1.00 15.66 ? 308  TYR A CE2 1 
ATOM   1537 C  CZ  . TYR A 1 199 ? -11.868 -0.761  20.457 1.00 18.77 ? 308  TYR A CZ  1 
ATOM   1538 O  OH  . TYR A 1 199 ? -11.951 -2.141  20.447 1.00 15.52 ? 308  TYR A OH  1 
ATOM   1539 N  N   . THR A 1 200 ? -10.487 6.212   21.541 1.00 11.88 ? 309  THR A N   1 
ATOM   1540 C  CA  . THR A 1 200 ? -10.503 7.665   21.570 1.00 11.94 ? 309  THR A CA  1 
ATOM   1541 C  C   . THR A 1 200 ? -9.073  8.232   21.500 1.00 10.03 ? 309  THR A C   1 
ATOM   1542 O  O   . THR A 1 200 ? -8.861  9.282   20.908 1.00 12.65 ? 309  THR A O   1 
ATOM   1543 C  CB  . THR A 1 200 ? -11.327 8.213   22.765 1.00 12.63 ? 309  THR A CB  1 
ATOM   1544 O  OG1 . THR A 1 200 ? -11.476 9.635   22.626 1.00 12.33 ? 309  THR A OG1 1 
ATOM   1545 C  CG2 . THR A 1 200 ? -10.660 7.895   24.097 1.00 15.04 ? 309  THR A CG2 1 
ATOM   1546 N  N   . ASN A 1 201 ? -8.098  7.524   22.065 1.00 12.06 ? 310  ASN A N   1 
ATOM   1547 C  CA  . ASN A 1 201 ? -6.705  7.976   22.138 1.00 11.09 ? 310  ASN A CA  1 
ATOM   1548 C  C   . ASN A 1 201 ? -5.968  7.855   20.770 1.00 13.72 ? 310  ASN A C   1 
ATOM   1549 O  O   . ASN A 1 201 ? -4.840  8.329   20.599 1.00 16.18 ? 310  ASN A O   1 
ATOM   1550 C  CB  . ASN A 1 201 ? -6.040  7.188   23.265 1.00 13.13 ? 310  ASN A CB  1 
ATOM   1551 C  CG  . ASN A 1 201 ? -4.590  7.521   23.475 1.00 18.39 ? 310  ASN A CG  1 
ATOM   1552 O  OD1 . ASN A 1 201 ? -4.227  8.622   23.891 1.00 24.05 ? 310  ASN A OD1 1 
ATOM   1553 N  ND2 . ASN A 1 201 ? -3.741  6.542   23.230 1.00 22.13 ? 310  ASN A ND2 1 
ATOM   1554 N  N   . SER A 1 202 ? -6.644  7.294   19.777 1.00 14.05 ? 311  SER A N   1 
ATOM   1555 C  CA  . SER A 1 202 ? -6.083  7.111   18.426 1.00 12.84 ? 311  SER A CA  1 
ATOM   1556 C  C   . SER A 1 202 ? -5.961  8.410   17.675 1.00 11.33 ? 311  SER A C   1 
ATOM   1557 O  O   . SER A 1 202 ? -6.815  9.290   17.812 1.00 10.67 ? 311  SER A O   1 
ATOM   1558 C  CB  . SER A 1 202 ? -7.018  6.205   17.621 1.00 12.66 ? 311  SER A CB  1 
ATOM   1559 O  OG  . SER A 1 202 ? -6.549  5.976   16.303 1.00 14.06 ? 311  SER A OG  1 
ATOM   1560 N  N   . ILE A 1 203 ? -4.926  8.538   16.848 1.00 13.27 ? 312  ILE A N   1 
ATOM   1561 C  CA  . ILE A 1 203 ? -4.865  9.720   15.970 1.00 10.84 ? 312  ILE A CA  1 
ATOM   1562 C  C   . ILE A 1 203 ? -5.906  9.658   14.878 1.00 10.69 ? 312  ILE A C   1 
ATOM   1563 O  O   . ILE A 1 203 ? -6.256  10.691  14.293 1.00 9.63  ? 312  ILE A O   1 
ATOM   1564 C  CB  . ILE A 1 203 ? -3.486  9.909   15.316 1.00 12.27 ? 312  ILE A CB  1 
ATOM   1565 C  CG1 . ILE A 1 203 ? -3.229  8.863   14.228 1.00 12.71 ? 312  ILE A CG1 1 
ATOM   1566 C  CG2 . ILE A 1 203 ? -2.397  9.871   16.378 1.00 13.89 ? 312  ILE A CG2 1 
ATOM   1567 C  CD1 . ILE A 1 203 ? -1.875  9.068   13.524 1.00 14.62 ? 312  ILE A CD1 1 
ATOM   1568 N  N   . TYR A 1 204 ? -6.419  8.453   14.613 1.00 10.89 ? 313  TYR A N   1 
ATOM   1569 C  CA  . TYR A 1 204 ? -7.347  8.240   13.511 1.00 11.48 ? 313  TYR A CA  1 
ATOM   1570 C  C   . TYR A 1 204 ? -8.773  8.671   13.847 1.00 11.30 ? 313  TYR A C   1 
ATOM   1571 O  O   . TYR A 1 204 ? -9.632  8.771   12.960 1.00 11.03 ? 313  TYR A O   1 
ATOM   1572 C  CB  . TYR A 1 204 ? -7.347  6.763   13.115 1.00 13.25 ? 313  TYR A CB  1 
ATOM   1573 C  CG  . TYR A 1 204 ? -5.974  6.273   12.714 1.00 14.20 ? 313  TYR A CG  1 
ATOM   1574 C  CD1 . TYR A 1 204 ? -5.192  7.000   11.854 1.00 14.98 ? 313  TYR A CD1 1 
ATOM   1575 C  CD2 . TYR A 1 204 ? -5.467  5.073   13.212 1.00 20.79 ? 313  TYR A CD2 1 
ATOM   1576 C  CE1 . TYR A 1 204 ? -3.931  6.560   11.479 1.00 19.75 ? 313  TYR A CE1 1 
ATOM   1577 C  CE2 . TYR A 1 204 ? -4.199  4.620   12.836 1.00 24.68 ? 313  TYR A CE2 1 
ATOM   1578 C  CZ  . TYR A 1 204 ? -3.445  5.380   11.977 1.00 22.25 ? 313  TYR A CZ  1 
ATOM   1579 O  OH  . TYR A 1 204 ? -2.189  4.960   11.592 1.00 34.44 ? 313  TYR A OH  1 
ATOM   1580 N  N   . THR A 1 205 ? -9.041  8.827   15.131 1.00 9.71  ? 314  THR A N   1 
ATOM   1581 C  CA  . THR A 1 205 ? -10.354 9.222   15.594 1.00 8.90  ? 314  THR A CA  1 
ATOM   1582 C  C   . THR A 1 205 ? -10.309 10.678  16.005 1.00 8.95  ? 314  THR A C   1 
ATOM   1583 O  O   . THR A 1 205 ? -9.345  11.140  16.589 1.00 10.30 ? 314  THR A O   1 
ATOM   1584 C  CB  . THR A 1 205 ? -10.864 8.346   16.757 1.00 11.33 ? 314  THR A CB  1 
ATOM   1585 O  OG1 . THR A 1 205 ? -9.940  8.388   17.866 1.00 11.30 ? 314  THR A OG1 1 
ATOM   1586 C  CG2 . THR A 1 205 ? -11.044 6.930   16.284 1.00 11.79 ? 314  THR A CG2 1 
ATOM   1587 N  N   . LEU A 1 206 ? -11.335 11.403  15.604 1.00 8.47  ? 315  LEU A N   1 
ATOM   1588 C  CA  . LEU A 1 206 ? -11.484 12.784  15.924 1.00 11.08 ? 315  LEU A CA  1 
ATOM   1589 C  C   . LEU A 1 206 ? -12.381 12.790  17.174 1.00 10.19 ? 315  LEU A C   1 
ATOM   1590 O  O   . LEU A 1 206 ? -13.585 12.546  17.105 1.00 10.20 ? 315  LEU A O   1 
ATOM   1591 C  CB  . LEU A 1 206 ? -12.126 13.500  14.734 1.00 9.32  ? 315  LEU A CB  1 
ATOM   1592 C  CG  . LEU A 1 206 ? -11.994 15.014  14.715 1.00 11.83 ? 315  LEU A CG  1 
ATOM   1593 C  CD1 . LEU A 1 206 ? -12.441 15.547  13.348 1.00 10.28 ? 315  LEU A CD1 1 
ATOM   1594 C  CD2 . LEU A 1 206 ? -12.794 15.671  15.828 1.00 7.59  ? 315  LEU A CD2 1 
ATOM   1595 N  N   . SER A 1 207 ? -11.762 13.029  18.324 1.00 10.75 ? 316  SER A N   1 
ATOM   1596 C  CA  . SER A 1 207 ? -12.408 12.790  19.602 1.00 10.73 ? 316  SER A CA  1 
ATOM   1597 C  C   . SER A 1 207 ? -13.013 14.013  20.241 1.00 9.32  ? 316  SER A C   1 
ATOM   1598 O  O   . SER A 1 207 ? -12.407 15.089  20.286 1.00 8.75  ? 316  SER A O   1 
ATOM   1599 C  CB  . SER A 1 207 ? -11.395 12.173  20.566 1.00 10.55 ? 316  SER A CB  1 
ATOM   1600 O  OG  . SER A 1 207 ? -11.026 10.883  20.105 1.00 11.92 ? 316  SER A OG  1 
ATOM   1601 N  N   . ILE A 1 208 ? -14.185 13.784  20.823 1.00 9.13  ? 317  ILE A N   1 
ATOM   1602 C  CA  . ILE A 1 208 ? -15.073 14.841  21.299 1.00 10.48 ? 317  ILE A CA  1 
ATOM   1603 C  C   . ILE A 1 208 ? -15.553 14.548  22.724 1.00 9.64  ? 317  ILE A C   1 
ATOM   1604 O  O   . ILE A 1 208 ? -15.964 13.400  23.050 1.00 8.49  ? 317  ILE A O   1 
ATOM   1605 C  CB  . ILE A 1 208 ? -16.314 14.940  20.373 1.00 12.56 ? 317  ILE A CB  1 
ATOM   1606 C  CG1 . ILE A 1 208 ? -15.900 15.166  18.916 1.00 8.51  ? 317  ILE A CG1 1 
ATOM   1607 C  CG2 . ILE A 1 208 ? -17.286 16.035  20.853 1.00 13.97 ? 317  ILE A CG2 1 
ATOM   1608 C  CD1 . ILE A 1 208 ? -15.243 16.534  18.616 1.00 12.48 ? 317  ILE A CD1 1 
ATOM   1609 N  N   . SER A 1 209 ? -15.509 15.595  23.554 1.00 9.31  ? 318  SER A N   1 
ATOM   1610 C  CA  . SER A 1 209 ? -16.010 15.576  24.928 1.00 9.81  ? 318  SER A CA  1 
ATOM   1611 C  C   . SER A 1 209 ? -17.212 16.508  25.078 1.00 9.84  ? 318  SER A C   1 
ATOM   1612 O  O   . SER A 1 209 ? -17.661 17.089  24.083 1.00 9.61  ? 318  SER A O   1 
ATOM   1613 C  CB  . SER A 1 209 ? -14.894 16.006  25.872 1.00 9.00  ? 318  SER A CB  1 
ATOM   1614 O  OG  . SER A 1 209 ? -13.866 15.030  25.842 1.00 9.64  ? 318  SER A OG  1 
ATOM   1615 N  N   . SER A 1 210 ? -17.727 16.641  26.306 1.00 8.81  ? 319  SER A N   1 
ATOM   1616 C  CA  . SER A 1 210 ? -18.980 17.352  26.546 1.00 9.59  ? 319  SER A CA  1 
ATOM   1617 C  C   . SER A 1 210 ? -18.849 18.580  27.433 1.00 11.41 ? 319  SER A C   1 
ATOM   1618 O  O   . SER A 1 210 ? -17.936 18.676  28.254 1.00 10.85 ? 319  SER A O   1 
ATOM   1619 C  CB  . SER A 1 210 ? -19.986 16.432  27.217 1.00 9.08  ? 319  SER A CB  1 
ATOM   1620 O  OG  . SER A 1 210 ? -20.210 15.258  26.474 1.00 10.07 ? 319  SER A OG  1 
ATOM   1621 N  N   . ALA A 1 211 ? -19.786 19.506  27.263 1.00 9.49  ? 320  ALA A N   1 
ATOM   1622 C  CA  . ALA A 1 211 ? -19.959 20.634  28.181 1.00 9.58  ? 320  ALA A CA  1 
ATOM   1623 C  C   . ALA A 1 211 ? -21.430 20.692  28.580 1.00 10.40 ? 320  ALA A C   1 
ATOM   1624 O  O   . ALA A 1 211 ? -22.301 20.410  27.777 1.00 10.72 ? 320  ALA A O   1 
ATOM   1625 C  CB  . ALA A 1 211 ? -19.572 21.925  27.506 1.00 11.27 ? 320  ALA A CB  1 
ATOM   1626 N  N   . THR A 1 212 ? -21.704 21.075  29.816 1.00 13.41 ? 321  THR A N   1 
ATOM   1627 C  CA  . THR A 1 212 ? -23.084 21.262  30.238 1.00 9.77  ? 321  THR A CA  1 
ATOM   1628 C  C   . THR A 1 212 ? -23.633 22.580  29.718 1.00 11.45 ? 321  THR A C   1 
ATOM   1629 O  O   . THR A 1 212 ? -22.888 23.445  29.247 1.00 10.13 ? 321  THR A O   1 
ATOM   1630 C  CB  . THR A 1 212 ? -23.214 21.279  31.757 1.00 11.13 ? 321  THR A CB  1 
ATOM   1631 O  OG1 . THR A 1 212 ? -22.619 22.475  32.254 1.00 12.02 ? 321  THR A OG1 1 
ATOM   1632 C  CG2 . THR A 1 212 ? -22.588 20.013  32.409 1.00 10.71 ? 321  THR A CG2 1 
ATOM   1633 N  N   . GLN A 1 213 ? -24.948 22.743  29.829 1.00 9.79  ? 322  GLN A N   1 
ATOM   1634 C  CA  . GLN A 1 213 ? -25.611 23.956  29.355 1.00 12.30 ? 322  GLN A CA  1 
ATOM   1635 C  C   . GLN A 1 213 ? -25.009 25.214  29.956 1.00 14.59 ? 322  GLN A C   1 
ATOM   1636 O  O   . GLN A 1 213 ? -24.857 26.214  29.264 1.00 10.77 ? 322  GLN A O   1 
ATOM   1637 C  CB  . GLN A 1 213 ? -27.108 23.935  29.677 1.00 13.14 ? 322  GLN A CB  1 
ATOM   1638 C  CG  . GLN A 1 213 ? -27.854 25.126  29.060 1.00 14.72 ? 322  GLN A CG  1 
ATOM   1639 C  CD  . GLN A 1 213 ? -29.345 25.089  29.294 1.00 14.14 ? 322  GLN A CD  1 
ATOM   1640 O  OE1 . GLN A 1 213 ? -29.825 24.421  30.209 1.00 13.18 ? 322  GLN A OE1 1 
ATOM   1641 N  NE2 . GLN A 1 213 ? -30.096 25.831  28.465 1.00 17.68 ? 322  GLN A NE2 1 
ATOM   1642 N  N   . PHE A 1 214 ? -24.676 25.177  31.239 1.00 14.62 ? 323  PHE A N   1 
ATOM   1643 C  CA  . PHE A 1 214 ? -24.139 26.376  31.889 1.00 13.30 ? 323  PHE A CA  1 
ATOM   1644 C  C   . PHE A 1 214 ? -22.617 26.508  31.667 1.00 14.66 ? 323  PHE A C   1 
ATOM   1645 O  O   . PHE A 1 214 ? -21.966 27.360  32.263 1.00 13.45 ? 323  PHE A O   1 
ATOM   1646 C  CB  . PHE A 1 214 ? -24.468 26.381  33.376 1.00 10.47 ? 323  PHE A CB  1 
ATOM   1647 C  CG  . PHE A 1 214 ? -25.941 26.312  33.687 1.00 11.56 ? 323  PHE A CG  1 
ATOM   1648 C  CD1 . PHE A 1 214 ? -26.902 26.632  32.732 1.00 11.69 ? 323  PHE A CD1 1 
ATOM   1649 C  CD2 . PHE A 1 214 ? -26.360 25.897  34.943 1.00 14.17 ? 323  PHE A CD2 1 
ATOM   1650 C  CE1 . PHE A 1 214 ? -28.245 26.558  33.025 1.00 13.91 ? 323  PHE A CE1 1 
ATOM   1651 C  CE2 . PHE A 1 214 ? -27.712 25.826  35.258 1.00 13.06 ? 323  PHE A CE2 1 
ATOM   1652 C  CZ  . PHE A 1 214 ? -28.661 26.152  34.276 1.00 11.68 ? 323  PHE A CZ  1 
ATOM   1653 N  N   . GLY A 1 215 ? -22.065 25.647  30.820 1.00 13.07 ? 324  GLY A N   1 
ATOM   1654 C  CA  . GLY A 1 215 ? -20.681 25.756  30.378 1.00 12.94 ? 324  GLY A CA  1 
ATOM   1655 C  C   . GLY A 1 215 ? -19.692 25.070  31.301 1.00 14.35 ? 324  GLY A C   1 
ATOM   1656 O  O   . GLY A 1 215 ? -18.530 25.459  31.346 1.00 12.17 ? 324  GLY A O   1 
ATOM   1657 N  N   . ASN A 1 216 ? -20.137 24.029  32.008 1.00 8.22  ? 325  ASN A N   1 
ATOM   1658 C  CA  . ASN A 1 216 ? -19.262 23.319  32.941 1.00 11.59 ? 325  ASN A CA  1 
ATOM   1659 C  C   . ASN A 1 216 ? -18.862 21.929  32.474 1.00 12.04 ? 325  ASN A C   1 
ATOM   1660 O  O   . ASN A 1 216 ? -19.411 21.428  31.505 1.00 9.08  ? 325  ASN A O   1 
ATOM   1661 C  CB  . ASN A 1 216 ? -19.914 23.260  34.295 1.00 11.03 ? 325  ASN A CB  1 
ATOM   1662 C  CG  . ASN A 1 216 ? -19.927 24.617  34.960 1.00 16.68 ? 325  ASN A CG  1 
ATOM   1663 O  OD1 . ASN A 1 216 ? -18.903 25.320  34.977 1.00 17.40 ? 325  ASN A OD1 1 
ATOM   1664 N  ND2 . ASN A 1 216 ? -21.082 25.018  35.455 1.00 14.35 ? 325  ASN A ND2 1 
ATOM   1665 N  N   . VAL A 1 217 ? -17.878 21.342  33.151 1.00 10.46 ? 326  VAL A N   1 
ATOM   1666 C  CA  . VAL A 1 217 ? -17.443 19.979  32.862 1.00 9.91  ? 326  VAL A CA  1 
ATOM   1667 C  C   . VAL A 1 217 ? -18.387 18.999  33.567 1.00 10.69 ? 326  VAL A C   1 
ATOM   1668 O  O   . VAL A 1 217 ? -18.408 18.940  34.794 1.00 8.67  ? 326  VAL A O   1 
ATOM   1669 C  CB  . VAL A 1 217 ? -16.004 19.764  33.379 1.00 12.05 ? 326  VAL A CB  1 
ATOM   1670 C  CG1 . VAL A 1 217 ? -15.568 18.332  33.183 1.00 7.67  ? 326  VAL A CG1 1 
ATOM   1671 C  CG2 . VAL A 1 217 ? -15.038 20.700  32.673 1.00 12.66 ? 326  VAL A CG2 1 
ATOM   1672 N  N   . PRO A 1 218 ? -19.169 18.218  32.797 1.00 9.76  ? 327  PRO A N   1 
ATOM   1673 C  CA  . PRO A 1 218 ? -20.179 17.319  33.372 1.00 9.56  ? 327  PRO A CA  1 
ATOM   1674 C  C   . PRO A 1 218 ? -19.579 16.228  34.252 1.00 9.09  ? 327  PRO A C   1 
ATOM   1675 O  O   . PRO A 1 218 ? -18.416 15.814  34.089 1.00 8.72  ? 327  PRO A O   1 
ATOM   1676 C  CB  . PRO A 1 218 ? -20.827 16.651  32.147 1.00 10.33 ? 327  PRO A CB  1 
ATOM   1677 C  CG  . PRO A 1 218 ? -20.297 17.371  30.948 1.00 12.86 ? 327  PRO A CG  1 
ATOM   1678 C  CD  . PRO A 1 218 ? -19.090 18.127  31.330 1.00 10.17 ? 327  PRO A CD  1 
ATOM   1679 N  N   . TRP A 1 219 ? -20.395 15.736  35.173 1.00 11.12 ? 328  TRP A N   1 
ATOM   1680 C  CA  . TRP A 1 219 ? -19.955 14.705  36.086 1.00 8.36  ? 328  TRP A CA  1 
ATOM   1681 C  C   . TRP A 1 219 ? -19.313 13.523  35.382 1.00 12.14 ? 328  TRP A C   1 
ATOM   1682 O  O   . TRP A 1 219 ? -18.356 12.934  35.913 1.00 10.02 ? 328  TRP A O   1 
ATOM   1683 C  CB  . TRP A 1 219 ? -21.118 14.217  36.970 1.00 10.37 ? 328  TRP A CB  1 
ATOM   1684 C  CG  . TRP A 1 219 ? -22.247 13.484  36.252 1.00 10.55 ? 328  TRP A CG  1 
ATOM   1685 C  CD1 . TRP A 1 219 ? -23.370 14.020  35.731 1.00 10.69 ? 328  TRP A CD1 1 
ATOM   1686 C  CD2 . TRP A 1 219 ? -22.340 12.077  36.037 1.00 10.50 ? 328  TRP A CD2 1 
ATOM   1687 N  NE1 . TRP A 1 219 ? -24.170 13.037  35.206 1.00 10.76 ? 328  TRP A NE1 1 
ATOM   1688 C  CE2 . TRP A 1 219 ? -23.555 11.833  35.374 1.00 10.94 ? 328  TRP A CE2 1 
ATOM   1689 C  CE3 . TRP A 1 219 ? -21.514 10.997  36.354 1.00 11.04 ? 328  TRP A CE3 1 
ATOM   1690 C  CZ2 . TRP A 1 219 ? -23.967 10.556  35.014 1.00 11.96 ? 328  TRP A CZ2 1 
ATOM   1691 C  CZ3 . TRP A 1 219 ? -21.917 9.729   35.997 1.00 12.99 ? 328  TRP A CZ3 1 
ATOM   1692 C  CH2 . TRP A 1 219 ? -23.135 9.518   35.329 1.00 13.82 ? 328  TRP A CH2 1 
ATOM   1693 N  N   . TYR A 1 220 ? -19.827 13.178  34.201 1.00 9.63  ? 329  TYR A N   1 
ATOM   1694 C  CA  . TYR A 1 220 ? -19.423 11.941  33.513 1.00 9.90  ? 329  TYR A CA  1 
ATOM   1695 C  C   . TYR A 1 220 ? -18.185 12.097  32.614 1.00 9.15  ? 329  TYR A C   1 
ATOM   1696 O  O   . TYR A 1 220 ? -17.653 11.108  32.092 1.00 9.57  ? 329  TYR A O   1 
ATOM   1697 C  CB  . TYR A 1 220 ? -20.606 11.377  32.685 1.00 10.89 ? 329  TYR A CB  1 
ATOM   1698 C  CG  . TYR A 1 220 ? -21.191 12.421  31.758 1.00 11.89 ? 329  TYR A CG  1 
ATOM   1699 C  CD1 . TYR A 1 220 ? -20.552 12.757  30.583 1.00 8.94  ? 329  TYR A CD1 1 
ATOM   1700 C  CD2 . TYR A 1 220 ? -22.370 13.112  32.094 1.00 10.42 ? 329  TYR A CD2 1 
ATOM   1701 C  CE1 . TYR A 1 220 ? -21.058 13.744  29.746 1.00 11.31 ? 329  TYR A CE1 1 
ATOM   1702 C  CE2 . TYR A 1 220 ? -22.880 14.093  31.266 1.00 11.43 ? 329  TYR A CE2 1 
ATOM   1703 C  CZ  . TYR A 1 220 ? -22.212 14.410  30.091 1.00 9.50  ? 329  TYR A CZ  1 
ATOM   1704 O  OH  . TYR A 1 220 ? -22.701 15.393  29.263 1.00 11.27 ? 329  TYR A OH  1 
ATOM   1705 N  N   . SER A 1 221 ? -17.735 13.334  32.432 1.00 11.74 ? 330  SER A N   1 
ATOM   1706 C  CA  . SER A 1 221 ? -16.598 13.620  31.557 1.00 10.99 ? 330  SER A CA  1 
ATOM   1707 C  C   . SER A 1 221 ? -15.283 12.953  31.965 1.00 9.28  ? 330  SER A C   1 
ATOM   1708 O  O   . SER A 1 221 ? -14.937 12.881  33.150 1.00 10.89 ? 330  SER A O   1 
ATOM   1709 C  CB  . SER A 1 221 ? -16.354 15.134  31.474 1.00 9.11  ? 330  SER A CB  1 
ATOM   1710 O  OG  . SER A 1 221 ? -15.261 15.396  30.605 1.00 8.94  ? 330  SER A OG  1 
ATOM   1711 N  N   . GLU A 1 222 ? -14.555 12.465  30.967 1.00 9.36  ? 331  GLU A N   1 
ATOM   1712 C  CA  . GLU A 1 222 ? -13.165 12.074  31.156 1.00 9.68  ? 331  GLU A CA  1 
ATOM   1713 C  C   . GLU A 1 222 ? -12.205 13.064  30.490 1.00 8.68  ? 331  GLU A C   1 
ATOM   1714 O  O   . GLU A 1 222 ? -12.361 13.421  29.314 1.00 11.75 ? 331  GLU A O   1 
ATOM   1715 C  CB  . GLU A 1 222 ? -12.925 10.697  30.584 1.00 10.79 ? 331  GLU A CB  1 
ATOM   1716 C  CG  . GLU A 1 222 ? -13.836 9.614   31.155 1.00 10.58 ? 331  GLU A CG  1 
ATOM   1717 C  CD  . GLU A 1 222 ? -13.516 8.256   30.557 1.00 11.38 ? 331  GLU A CD  1 
ATOM   1718 O  OE1 . GLU A 1 222 ? -12.309 7.994   30.304 1.00 9.87  ? 331  GLU A OE1 1 
ATOM   1719 O  OE2 . GLU A 1 222 ? -14.471 7.486   30.300 1.00 9.96  ? 331  GLU A OE2 1 
ATOM   1720 N  N   . ALA A 1 223 ? -11.204 13.492  31.242 1.00 9.05  ? 332  ALA A N   1 
ATOM   1721 C  CA  . ALA A 1 223 ? -10.166 14.386  30.741 1.00 11.02 ? 332  ALA A CA  1 
ATOM   1722 C  C   . ALA A 1 223 ? -9.042  13.550  30.170 1.00 11.01 ? 332  ALA A C   1 
ATOM   1723 O  O   . ALA A 1 223 ? -8.687  12.530  30.758 1.00 11.52 ? 332  ALA A O   1 
ATOM   1724 C  CB  . ALA A 1 223 ? -9.601  15.246  31.868 1.00 11.38 ? 332  ALA A CB  1 
ATOM   1725 N  N   . CYS A 1 224 ? -8.483  13.999  29.046 1.00 10.33 ? 333  CYS A N   1 
ATOM   1726 C  CA  . CYS A 1 224 ? -7.238  13.441  28.491 1.00 13.34 ? 333  CYS A CA  1 
ATOM   1727 C  C   . CYS A 1 224 ? -6.679  14.303  27.356 1.00 10.21 ? 333  CYS A C   1 
ATOM   1728 O  O   . CYS A 1 224 ? -7.396  15.117  26.757 1.00 11.42 ? 333  CYS A O   1 
ATOM   1729 C  CB  . CYS A 1 224 ? -7.405  11.997  28.016 1.00 12.34 ? 333  CYS A CB  1 
ATOM   1730 S  SG  . CYS A 1 224 ? -8.645  11.769  26.735 1.00 14.39 ? 333  CYS A SG  1 
ATOM   1731 N  N   . SER A 1 225 ? -5.395  14.124  27.056 1.00 11.01 ? 334  SER A N   1 
ATOM   1732 C  CA  . SER A 1 225 ? -4.720  14.983  26.071 1.00 10.26 ? 334  SER A CA  1 
ATOM   1733 C  C   . SER A 1 225 ? -5.102  14.635  24.644 1.00 9.91  ? 334  SER A C   1 
ATOM   1734 O  O   . SER A 1 225 ? -4.759  15.370  23.728 1.00 13.26 ? 334  SER A O   1 
ATOM   1735 C  CB  . SER A 1 225 ? -3.180  14.900  26.219 1.00 8.48  ? 334  SER A CB  1 
ATOM   1736 O  OG  . SER A 1 225 ? -2.733  13.544  26.210 1.00 9.32  ? 334  SER A OG  1 
ATOM   1737 N  N   . SER A 1 226 ? -5.757  13.492  24.444 1.00 9.93  ? 335  SER A N   1 
ATOM   1738 C  CA  . SER A 1 226 ? -6.064  12.998  23.095 1.00 8.47  ? 335  SER A CA  1 
ATOM   1739 C  C   . SER A 1 226 ? -7.311  13.655  22.522 1.00 11.07 ? 335  SER A C   1 
ATOM   1740 O  O   . SER A 1 226 ? -7.518  13.660  21.313 1.00 10.13 ? 335  SER A O   1 
ATOM   1741 C  CB  . SER A 1 226 ? -6.235  11.476  23.095 1.00 11.53 ? 335  SER A CB  1 
ATOM   1742 O  OG  . SER A 1 226 ? -7.245  11.047  24.009 1.00 13.63 ? 335  SER A OG  1 
ATOM   1743 N  N   . THR A 1 227 ? -8.147  14.220  23.387 1.00 11.72 ? 336  THR A N   1 
ATOM   1744 C  CA  . THR A 1 227 ? -9.374  14.891  22.942 1.00 7.28  ? 336  THR A CA  1 
ATOM   1745 C  C   . THR A 1 227 ? -9.041  16.158  22.114 1.00 8.49  ? 336  THR A C   1 
ATOM   1746 O  O   . THR A 1 227 ? -8.081  16.872  22.391 1.00 9.71  ? 336  THR A O   1 
ATOM   1747 C  CB  . THR A 1 227 ? -10.237 15.255  24.158 1.00 10.08 ? 336  THR A CB  1 
ATOM   1748 O  OG1 . THR A 1 227 ? -10.658 14.044  24.788 1.00 9.95  ? 336  THR A OG1 1 
ATOM   1749 C  CG2 . THR A 1 227 ? -11.461 16.065  23.761 1.00 11.58 ? 336  THR A CG2 1 
ATOM   1750 N  N   . LEU A 1 228 ? -9.848  16.412  21.089 1.00 12.16 ? 337  LEU A N   1 
ATOM   1751 C  CA  . LEU A 1 228 ? -9.655  17.550  20.217 1.00 10.25 ? 337  LEU A CA  1 
ATOM   1752 C  C   . LEU A 1 228 ? -10.612 18.698  20.520 1.00 9.54  ? 337  LEU A C   1 
ATOM   1753 O  O   . LEU A 1 228 ? -10.230 19.881  20.431 1.00 10.75 ? 337  LEU A O   1 
ATOM   1754 C  CB  . LEU A 1 228 ? -9.832  17.117  18.759 1.00 10.58 ? 337  LEU A CB  1 
ATOM   1755 C  CG  . LEU A 1 228 ? -8.575  16.709  18.023 1.00 13.94 ? 337  LEU A CG  1 
ATOM   1756 C  CD1 . LEU A 1 228 ? -8.984  16.356  16.617 1.00 17.04 ? 337  LEU A CD1 1 
ATOM   1757 C  CD2 . LEU A 1 228 ? -7.461  17.785  18.028 1.00 12.07 ? 337  LEU A CD2 1 
ATOM   1758 N  N   . ALA A 1 229 ? -11.862 18.373  20.855 1.00 9.61  ? 338  ALA A N   1 
ATOM   1759 C  CA  . ALA A 1 229 ? -12.864 19.418  21.005 1.00 8.71  ? 338  ALA A CA  1 
ATOM   1760 C  C   . ALA A 1 229 ? -14.141 18.947  21.696 1.00 11.19 ? 338  ALA A C   1 
ATOM   1761 O  O   . ALA A 1 229 ? -14.249 17.795  22.127 1.00 9.48  ? 338  ALA A O   1 
ATOM   1762 C  CB  . ALA A 1 229 ? -13.213 19.994  19.662 1.00 10.51 ? 338  ALA A CB  1 
ATOM   1763 N  N   . THR A 1 230 ? -15.102 19.865  21.786 1.00 10.30 ? 339  THR A N   1 
ATOM   1764 C  CA  . THR A 1 230 ? -16.283 19.694  22.634 1.00 10.51 ? 339  THR A CA  1 
ATOM   1765 C  C   . THR A 1 230 ? -17.600 20.069  21.959 1.00 10.95 ? 339  THR A C   1 
ATOM   1766 O  O   . THR A 1 230 ? -17.667 21.032  21.190 1.00 9.63  ? 339  THR A O   1 
ATOM   1767 C  CB  . THR A 1 230 ? -16.130 20.571  23.903 1.00 8.45  ? 339  THR A CB  1 
ATOM   1768 O  OG1 . THR A 1 230 ? -14.943 20.192  24.597 1.00 10.97 ? 339  THR A OG1 1 
ATOM   1769 C  CG2 . THR A 1 230 ? -17.330 20.433  24.833 1.00 8.93  ? 339  THR A CG2 1 
ATOM   1770 N  N   . THR A 1 231 ? -18.666 19.342  22.306 1.00 10.12 ? 340  THR A N   1 
ATOM   1771 C  CA  . THR A 1 231 ? -20.016 19.811  22.036 1.00 9.92  ? 340  THR A CA  1 
ATOM   1772 C  C   . THR A 1 231 ? -20.874 19.652  23.268 1.00 9.91  ? 340  THR A C   1 
ATOM   1773 O  O   . THR A 1 231 ? -20.552 18.895  24.186 1.00 9.55  ? 340  THR A O   1 
ATOM   1774 C  CB  . THR A 1 231 ? -20.701 19.039  20.910 1.00 10.58 ? 340  THR A CB  1 
ATOM   1775 O  OG1 . THR A 1 231 ? -20.956 17.702  21.325 1.00 15.40 ? 340  THR A OG1 1 
ATOM   1776 C  CG2 . THR A 1 231 ? -19.836 19.021  19.691 1.00 11.69 ? 340  THR A CG2 1 
ATOM   1777 N  N   . TYR A 1 232 ? -21.966 20.404  23.292 1.00 9.86  ? 341  TYR A N   1 
ATOM   1778 C  CA  . TYR A 1 232 ? -22.880 20.367  24.416 1.00 10.10 ? 341  TYR A CA  1 
ATOM   1779 C  C   . TYR A 1 232 ? -23.501 18.990  24.616 1.00 10.00 ? 341  TYR A C   1 
ATOM   1780 O  O   . TYR A 1 232 ? -23.767 18.252  23.651 1.00 11.08 ? 341  TYR A O   1 
ATOM   1781 C  CB  . TYR A 1 232 ? -23.971 21.435  24.217 1.00 10.10 ? 341  TYR A CB  1 
ATOM   1782 C  CG  . TYR A 1 232 ? -23.478 22.832  24.449 1.00 10.74 ? 341  TYR A CG  1 
ATOM   1783 C  CD1 . TYR A 1 232 ? -23.049 23.234  25.715 1.00 10.34 ? 341  TYR A CD1 1 
ATOM   1784 C  CD2 . TYR A 1 232 ? -23.449 23.781  23.410 1.00 13.25 ? 341  TYR A CD2 1 
ATOM   1785 C  CE1 . TYR A 1 232 ? -22.609 24.518  25.943 1.00 10.69 ? 341  TYR A CE1 1 
ATOM   1786 C  CE2 . TYR A 1 232 ? -23.008 25.082  23.642 1.00 13.31 ? 341  TYR A CE2 1 
ATOM   1787 C  CZ  . TYR A 1 232 ? -22.589 25.425  24.906 1.00 14.40 ? 341  TYR A CZ  1 
ATOM   1788 O  OH  . TYR A 1 232 ? -22.146 26.684  25.163 1.00 18.25 ? 341  TYR A OH  1 
ATOM   1789 N  N   . SER A 1 233 ? -23.729 18.645  25.891 1.00 12.33 ? 342  SER A N   1 
ATOM   1790 C  CA  . SER A 1 233 ? -24.566 17.520  26.245 1.00 9.00  ? 342  SER A CA  1 
ATOM   1791 C  C   . SER A 1 233 ? -25.249 17.817  27.588 1.00 10.58 ? 342  SER A C   1 
ATOM   1792 O  O   . SER A 1 233 ? -25.473 18.985  27.916 1.00 9.80  ? 342  SER A O   1 
ATOM   1793 C  CB  . SER A 1 233 ? -23.753 16.221  26.315 1.00 12.19 ? 342  SER A CB  1 
ATOM   1794 O  OG  . SER A 1 233 ? -24.646 15.125  26.445 1.00 12.28 ? 342  SER A OG  1 
ATOM   1795 N  N   . SER A 1 234 ? -25.604 16.765  28.337 1.00 9.28  ? 343  SER A N   1 
ATOM   1796 C  CA  . SER A 1 234 ? -26.353 16.897  29.586 1.00 7.52  ? 343  SER A CA  1 
ATOM   1797 C  C   . SER A 1 234 ? -25.487 17.260  30.778 1.00 9.56  ? 343  SER A C   1 
ATOM   1798 O  O   . SER A 1 234 ? -24.272 17.190  30.715 1.00 11.00 ? 343  SER A O   1 
ATOM   1799 C  CB  . SER A 1 234 ? -27.067 15.582  29.916 1.00 9.31  ? 343  SER A CB  1 
ATOM   1800 O  OG  . SER A 1 234 ? -26.117 14.546  30.038 1.00 12.04 ? 343  SER A OG  1 
ATOM   1801 N  N   . GLY A 1 235 ? -26.142 17.655  31.870 1.00 10.17 ? 344  GLY A N   1 
ATOM   1802 C  CA  . GLY A 1 235 ? -25.459 18.080  33.082 1.00 8.42  ? 344  GLY A CA  1 
ATOM   1803 C  C   . GLY A 1 235 ? -26.321 17.726  34.281 1.00 12.07 ? 344  GLY A C   1 
ATOM   1804 O  O   . GLY A 1 235 ? -26.807 16.582  34.403 1.00 9.03  ? 344  GLY A O   1 
ATOM   1805 N  N   . ASN A 1 236 ? -26.520 18.712  35.151 1.00 8.54  ? 345  ASN A N   1 
ATOM   1806 C  CA  . ASN A 1 236 ? -27.339 18.551  36.335 1.00 10.52 ? 345  ASN A CA  1 
ATOM   1807 C  C   . ASN A 1 236 ? -28.817 18.740  36.018 1.00 9.23  ? 345  ASN A C   1 
ATOM   1808 O  O   . ASN A 1 236 ? -29.216 18.898  34.840 1.00 9.57  ? 345  ASN A O   1 
ATOM   1809 C  CB  . ASN A 1 236 ? -26.870 19.506  37.453 1.00 8.76  ? 345  ASN A CB  1 
ATOM   1810 C  CG  . ASN A 1 236 ? -27.115 20.986  37.132 1.00 9.24  ? 345  ASN A CG  1 
ATOM   1811 O  OD1 . ASN A 1 236 ? -28.110 21.342  36.499 1.00 9.91  ? 345  ASN A OD1 1 
ATOM   1812 N  ND2 . ASN A 1 236 ? -26.198 21.852  37.561 1.00 10.03 ? 345  ASN A ND2 1 
ATOM   1813 N  N   . GLN A 1 237 ? -29.655 18.664  37.043 1.00 9.45  ? 346  GLN A N   1 
ATOM   1814 C  CA  . GLN A 1 237 ? -31.095 18.620  36.778 1.00 10.58 ? 346  GLN A CA  1 
ATOM   1815 C  C   . GLN A 1 237 ? -31.706 19.977  36.488 1.00 12.98 ? 346  GLN A C   1 
ATOM   1816 O  O   . GLN A 1 237 ? -32.891 20.076  36.187 1.00 13.03 ? 346  GLN A O   1 
ATOM   1817 C  CB  . GLN A 1 237 ? -31.825 17.873  37.895 1.00 10.24 ? 346  GLN A CB  1 
ATOM   1818 C  CG  . GLN A 1 237 ? -31.398 16.421  37.940 1.00 12.37 ? 346  GLN A CG  1 
ATOM   1819 C  CD  . GLN A 1 237 ? -32.181 15.618  38.937 1.00 14.35 ? 346  GLN A CD  1 
ATOM   1820 O  OE1 . GLN A 1 237 ? -33.351 15.874  39.149 1.00 20.99 ? 346  GLN A OE1 1 
ATOM   1821 N  NE2 . GLN A 1 237 ? -31.539 14.658  39.570 1.00 10.82 ? 346  GLN A NE2 1 
ATOM   1822 N  N   . ASN A 1 238 ? -30.909 21.032  36.553 1.00 9.54  ? 347  ASN A N   1 
ATOM   1823 C  CA  . ASN A 1 238 ? -31.379 22.363  36.146 1.00 11.47 ? 347  ASN A CA  1 
ATOM   1824 C  C   . ASN A 1 238 ? -30.972 22.693  34.699 1.00 14.83 ? 347  ASN A C   1 
ATOM   1825 O  O   . ASN A 1 238 ? -31.380 23.713  34.129 1.00 12.76 ? 347  ASN A O   1 
ATOM   1826 C  CB  . ASN A 1 238 ? -30.769 23.425  37.037 1.00 11.49 ? 347  ASN A CB  1 
ATOM   1827 C  CG  . ASN A 1 238 ? -31.074 23.202  38.498 1.00 16.93 ? 347  ASN A CG  1 
ATOM   1828 O  OD1 . ASN A 1 238 ? -30.268 22.649  39.209 1.00 18.35 ? 347  ASN A OD1 1 
ATOM   1829 N  ND2 . ASN A 1 238 ? -32.241 23.617  38.936 1.00 21.79 ? 347  ASN A ND2 1 
ATOM   1830 N  N   . GLU A 1 239 ? -30.127 21.839  34.141 1.00 11.15 ? 348  GLU A N   1 
ATOM   1831 C  CA  . GLU A 1 239 ? -29.592 22.040  32.800 1.00 11.27 ? 348  GLU A CA  1 
ATOM   1832 C  C   . GLU A 1 239 ? -30.338 21.148  31.810 1.00 12.48 ? 348  GLU A C   1 
ATOM   1833 O  O   . GLU A 1 239 ? -30.678 20.011  32.114 1.00 11.58 ? 348  GLU A O   1 
ATOM   1834 C  CB  . GLU A 1 239 ? -28.096 21.753  32.808 1.00 10.90 ? 348  GLU A CB  1 
ATOM   1835 C  CG  . GLU A 1 239 ? -27.303 22.740  33.658 1.00 9.19  ? 348  GLU A CG  1 
ATOM   1836 C  CD  . GLU A 1 239 ? -25.829 22.378  33.800 1.00 10.76 ? 348  GLU A CD  1 
ATOM   1837 O  OE1 . GLU A 1 239 ? -25.533 21.228  34.231 1.00 12.80 ? 348  GLU A OE1 1 
ATOM   1838 O  OE2 . GLU A 1 239 ? -24.963 23.234  33.499 1.00 10.77 ? 348  GLU A OE2 1 
ATOM   1839 N  N   . LYS A 1 240 ? -30.624 21.679  30.628 1.00 11.57 ? 349  LYS A N   1 
ATOM   1840 C  CA  . LYS A 1 240 ? -31.316 20.902  29.605 1.00 11.07 ? 349  LYS A CA  1 
ATOM   1841 C  C   . LYS A 1 240 ? -30.450 19.789  29.023 1.00 12.86 ? 349  LYS A C   1 
ATOM   1842 O  O   . LYS A 1 240 ? -29.243 19.736  29.259 1.00 11.92 ? 349  LYS A O   1 
ATOM   1843 C  CB  . LYS A 1 240 ? -31.823 21.840  28.520 1.00 13.48 ? 349  LYS A CB  1 
ATOM   1844 C  CG  . LYS A 1 240 ? -32.936 22.758  29.067 1.00 17.36 ? 349  LYS A CG  1 
ATOM   1845 C  CD  . LYS A 1 240 ? -33.225 23.941  28.131 1.00 21.44 ? 349  LYS A CD  1 
ATOM   1846 N  N   . GLN A 1 241 ? -31.070 18.875  28.293 1.00 8.55  ? 350  GLN A N   1 
ATOM   1847 C  CA  . GLN A 1 241 ? -30.326 17.737  27.749 1.00 13.29 ? 350  GLN A CA  1 
ATOM   1848 C  C   . GLN A 1 241 ? -30.448 17.702  26.221 1.00 12.39 ? 350  GLN A C   1 
ATOM   1849 O  O   . GLN A 1 241 ? -30.828 18.707  25.579 1.00 12.29 ? 350  GLN A O   1 
ATOM   1850 C  CB  . GLN A 1 241 ? -30.825 16.437  28.414 1.00 13.22 ? 350  GLN A CB  1 
ATOM   1851 C  CG  . GLN A 1 241 ? -30.761 16.554  29.954 1.00 11.58 ? 350  GLN A CG  1 
ATOM   1852 C  CD  . GLN A 1 241 ? -31.040 15.268  30.708 1.00 14.05 ? 350  GLN A CD  1 
ATOM   1853 O  OE1 . GLN A 1 241 ? -31.751 14.385  30.251 1.00 11.10 ? 350  GLN A OE1 1 
ATOM   1854 N  NE2 . GLN A 1 241 ? -30.460 15.162  31.881 1.00 12.82 ? 350  GLN A NE2 1 
ATOM   1855 N  N   . ILE A 1 242 ? -30.163 16.560  25.626 1.00 10.11 ? 351  ILE A N   1 
ATOM   1856 C  CA  . ILE A 1 242 ? -30.199 16.493  24.172 1.00 10.72 ? 351  ILE A CA  1 
ATOM   1857 C  C   . ILE A 1 242 ? -31.564 15.986  23.694 1.00 11.78 ? 351  ILE A C   1 
ATOM   1858 O  O   . ILE A 1 242 ? -32.120 15.018  24.234 1.00 11.95 ? 351  ILE A O   1 
ATOM   1859 C  CB  . ILE A 1 242 ? -29.059 15.633  23.601 1.00 12.44 ? 351  ILE A CB  1 
ATOM   1860 C  CG1 . ILE A 1 242 ? -27.676 16.196  23.994 1.00 12.85 ? 351  ILE A CG1 1 
ATOM   1861 C  CG2 . ILE A 1 242 ? -29.147 15.553  22.082 1.00 14.99 ? 351  ILE A CG2 1 
ATOM   1862 C  CD1 . ILE A 1 242 ? -27.425 17.668  23.670 1.00 12.05 ? 351  ILE A CD1 1 
ATOM   1863 N  N   . VAL A 1 243 ? -32.101 16.688  22.701 1.00 12.51 ? 352  VAL A N   1 
ATOM   1864 C  CA  . VAL A 1 243 ? -33.456 16.459  22.196 1.00 14.69 ? 352  VAL A CA  1 
ATOM   1865 C  C   . VAL A 1 243 ? -33.369 15.817  20.815 1.00 13.05 ? 352  VAL A C   1 
ATOM   1866 O  O   . VAL A 1 243 ? -32.782 16.394  19.887 1.00 14.05 ? 352  VAL A O   1 
ATOM   1867 C  CB  . VAL A 1 243 ? -34.227 17.793  22.096 1.00 16.59 ? 352  VAL A CB  1 
ATOM   1868 C  CG1 . VAL A 1 243 ? -35.585 17.590  21.410 1.00 19.21 ? 352  VAL A CG1 1 
ATOM   1869 C  CG2 . VAL A 1 243 ? -34.392 18.397  23.480 1.00 16.65 ? 352  VAL A CG2 1 
ATOM   1870 N  N   . THR A 1 244 ? -33.923 14.616  20.668 1.00 12.53 ? 353  THR A N   1 
ATOM   1871 C  CA  . THR A 1 244 ? -33.709 13.900  19.431 1.00 14.22 ? 353  THR A CA  1 
ATOM   1872 C  C   . THR A 1 244 ? -34.710 12.779  19.229 1.00 16.64 ? 353  THR A C   1 
ATOM   1873 O  O   . THR A 1 244 ? -35.614 12.563  20.055 1.00 14.32 ? 353  THR A O   1 
ATOM   1874 C  CB  . THR A 1 244 ? -32.265 13.310  19.414 1.00 13.70 ? 353  THR A CB  1 
ATOM   1875 O  OG1 . THR A 1 244 ? -31.957 12.786  18.117 1.00 14.50 ? 353  THR A OG1 1 
ATOM   1876 C  CG2 . THR A 1 244 ? -32.111 12.205  20.460 1.00 13.79 ? 353  THR A CG2 1 
ATOM   1877 N  N   . THR A 1 245 ? -34.529 12.060  18.124 1.00 14.54 ? 354  THR A N   1 
ATOM   1878 C  CA  . THR A 1 245 ? -35.359 10.908  17.793 1.00 14.52 ? 354  THR A CA  1 
ATOM   1879 C  C   . THR A 1 245 ? -35.095 9.754   18.758 1.00 18.60 ? 354  THR A C   1 
ATOM   1880 O  O   . THR A 1 245 ? -33.952 9.472   19.111 1.00 17.36 ? 354  THR A O   1 
ATOM   1881 C  CB  . THR A 1 245 ? -35.053 10.419  16.358 1.00 15.28 ? 354  THR A CB  1 
ATOM   1882 O  OG1 . THR A 1 245 ? -33.639 10.387  16.183 1.00 16.91 ? 354  THR A OG1 1 
ATOM   1883 C  CG2 . THR A 1 245 ? -35.634 11.335  15.332 1.00 14.01 ? 354  THR A CG2 1 
ATOM   1884 N  N   . ASP A 1 246 ? -36.158 9.070   19.176 1.00 18.55 ? 355  ASP A N   1 
ATOM   1885 C  CA  . ASP A 1 246 ? -36.030 7.921   20.066 1.00 13.92 ? 355  ASP A CA  1 
ATOM   1886 C  C   . ASP A 1 246 ? -36.724 6.714   19.469 1.00 17.76 ? 355  ASP A C   1 
ATOM   1887 O  O   . ASP A 1 246 ? -37.592 6.839   18.603 1.00 18.16 ? 355  ASP A O   1 
ATOM   1888 C  CB  . ASP A 1 246 ? -36.677 8.230   21.416 1.00 17.29 ? 355  ASP A CB  1 
ATOM   1889 C  CG  . ASP A 1 246 ? -36.088 7.418   22.568 1.00 18.85 ? 355  ASP A CG  1 
ATOM   1890 O  OD1 . ASP A 1 246 ? -35.226 6.541   22.338 1.00 13.80 ? 355  ASP A OD1 1 
ATOM   1891 O  OD2 . ASP A 1 246 ? -36.533 7.655   23.721 1.00 17.04 ? 355  ASP A OD2 1 
ATOM   1892 N  N   . LEU A 1 247 ? -36.356 5.554   19.996 1.00 16.96 ? 356  LEU A N   1 
ATOM   1893 C  CA  . LEU A 1 247 ? -36.937 4.278   19.644 1.00 15.29 ? 356  LEU A CA  1 
ATOM   1894 C  C   . LEU A 1 247 ? -38.470 4.310   19.728 1.00 20.21 ? 356  LEU A C   1 
ATOM   1895 O  O   . LEU A 1 247 ? -39.025 5.019   20.558 1.00 19.95 ? 356  LEU A O   1 
ATOM   1896 C  CB  . LEU A 1 247 ? -36.386 3.248   20.630 1.00 17.96 ? 356  LEU A CB  1 
ATOM   1897 C  CG  . LEU A 1 247 ? -36.419 1.780   20.237 1.00 19.07 ? 356  LEU A CG  1 
ATOM   1898 C  CD1 . LEU A 1 247 ? -35.576 1.558   18.983 1.00 19.41 ? 356  LEU A CD1 1 
ATOM   1899 C  CD2 . LEU A 1 247 ? -35.945 0.922   21.403 1.00 16.96 ? 356  LEU A CD2 1 
ATOM   1900 N  N   . ARG A 1 248 ? -39.143 3.513   18.895 1.00 16.43 ? 357  ARG A N   1 
ATOM   1901 C  CA  . ARG A 1 248 ? -40.598 3.424   18.910 1.00 20.08 ? 357  ARG A CA  1 
ATOM   1902 C  C   . ARG A 1 248 ? -41.223 4.706   18.340 1.00 19.91 ? 357  ARG A C   1 
ATOM   1903 O  O   . ARG A 1 248 ? -42.324 5.089   18.710 1.00 15.95 ? 357  ARG A O   1 
ATOM   1904 C  CB  . ARG A 1 248 ? -41.122 3.132   20.329 1.00 18.54 ? 357  ARG A CB  1 
ATOM   1905 C  CG  . ARG A 1 248 ? -40.550 1.896   20.968 1.00 19.16 ? 357  ARG A CG  1 
ATOM   1906 C  CD  . ARG A 1 248 ? -40.955 1.744   22.459 1.00 25.31 ? 357  ARG A CD  1 
ATOM   1907 N  NE  . ARG A 1 248 ? -40.168 0.697   23.111 1.00 17.85 ? 357  ARG A NE  1 
ATOM   1908 C  CZ  . ARG A 1 248 ? -40.405 -0.597  22.941 1.00 18.86 ? 357  ARG A CZ  1 
ATOM   1909 N  NH1 . ARG A 1 248 ? -39.620 -1.515  23.510 1.00 18.53 ? 357  ARG A NH1 1 
ATOM   1910 N  NH2 . ARG A 1 248 ? -41.402 -0.981  22.160 1.00 15.98 ? 357  ARG A NH2 1 
ATOM   1911 N  N   . GLN A 1 249 ? -40.499 5.362   17.430 1.00 19.60 ? 358  GLN A N   1 
ATOM   1912 C  CA  . GLN A 1 249 ? -40.999 6.528   16.702 1.00 18.30 ? 358  GLN A CA  1 
ATOM   1913 C  C   . GLN A 1 249 ? -41.303 7.701   17.628 1.00 19.87 ? 358  GLN A C   1 
ATOM   1914 O  O   . GLN A 1 249 ? -42.222 8.478   17.375 1.00 16.40 ? 358  GLN A O   1 
ATOM   1915 C  CB  . GLN A 1 249 ? -42.249 6.165   15.866 1.00 18.18 ? 358  GLN A CB  1 
ATOM   1916 C  CG  . GLN A 1 249 ? -42.041 4.950   14.958 1.00 24.08 ? 358  GLN A CG  1 
ATOM   1917 C  CD  . GLN A 1 249 ? -42.955 4.957   13.742 1.00 28.96 ? 358  GLN A CD  1 
ATOM   1918 O  OE1 . GLN A 1 249 ? -44.110 5.364   13.815 1.00 32.23 ? 358  GLN A OE1 1 
ATOM   1919 N  NE2 . GLN A 1 249 ? -42.425 4.521   12.608 1.00 40.62 ? 358  GLN A NE2 1 
ATOM   1920 N  N   . LYS A 1 250 ? -40.506 7.846   18.681 1.00 18.14 ? 359  LYS A N   1 
ATOM   1921 C  CA  . LYS A 1 250 ? -40.748 8.862   19.698 1.00 15.02 ? 359  LYS A CA  1 
ATOM   1922 C  C   . LYS A 1 250 ? -39.736 10.006  19.613 1.00 18.65 ? 359  LYS A C   1 
ATOM   1923 O  O   . LYS A 1 250 ? -38.814 9.977   18.791 1.00 14.25 ? 359  LYS A O   1 
ATOM   1924 C  CB  . LYS A 1 250 ? -40.687 8.215   21.077 1.00 18.34 ? 359  LYS A CB  1 
ATOM   1925 C  CG  . LYS A 1 250 ? -41.894 7.333   21.403 1.00 22.61 ? 359  LYS A CG  1 
ATOM   1926 C  CD  . LYS A 1 250 ? -41.640 6.485   22.644 1.00 28.66 ? 359  LYS A CD  1 
ATOM   1927 C  CE  . LYS A 1 250 ? -42.934 5.817   23.141 1.00 38.60 ? 359  LYS A CE  1 
ATOM   1928 N  NZ  . LYS A 1 250 ? -42.718 4.897   24.321 1.00 34.69 ? 359  LYS A NZ  1 
ATOM   1929 N  N   . CYS A 1 251 ? -39.965 11.042  20.419 1.00 17.48 ? 360  CYS A N   1 
ATOM   1930 C  CA  A CYS A 1 251 ? -39.047 12.157  20.518 0.75 16.17 ? 360  CYS A CA  1 
ATOM   1931 C  CA  B CYS A 1 251 ? -39.045 12.173  20.539 0.25 16.22 ? 360  CYS A CA  1 
ATOM   1932 C  C   . CYS A 1 251 ? -38.626 12.275  21.986 1.00 19.22 ? 360  CYS A C   1 
ATOM   1933 O  O   . CYS A 1 251 ? -39.471 12.462  22.855 1.00 22.77 ? 360  CYS A O   1 
ATOM   1934 C  CB  A CYS A 1 251 ? -39.750 13.417  20.018 0.75 16.86 ? 360  CYS A CB  1 
ATOM   1935 C  CB  B CYS A 1 251 ? -39.715 13.499  20.178 0.25 16.91 ? 360  CYS A CB  1 
ATOM   1936 S  SG  A CYS A 1 251 ? -38.785 14.920  20.007 0.75 15.26 ? 360  CYS A SG  1 
ATOM   1937 S  SG  B CYS A 1 251 ? -40.572 13.573  18.617 0.25 19.91 ? 360  CYS A SG  1 
ATOM   1938 N  N   . THR A 1 252 ? -37.329 12.173  22.259 1.00 13.81 ? 361  THR A N   1 
ATOM   1939 C  CA  . THR A 1 252 ? -36.834 12.268  23.637 1.00 13.53 ? 361  THR A CA  1 
ATOM   1940 C  C   . THR A 1 252 ? -36.224 13.639  23.885 1.00 15.01 ? 361  THR A C   1 
ATOM   1941 O  O   . THR A 1 252 ? -35.668 14.265  22.968 1.00 13.76 ? 361  THR A O   1 
ATOM   1942 C  CB  . THR A 1 252 ? -35.792 11.160  23.979 1.00 16.32 ? 361  THR A CB  1 
ATOM   1943 O  OG1 . THR A 1 252 ? -35.379 11.265  25.360 1.00 13.19 ? 361  THR A OG1 1 
ATOM   1944 C  CG2 . THR A 1 252 ? -34.551 11.249  23.090 1.00 13.12 ? 361  THR A CG2 1 
ATOM   1945 N  N   . GLU A 1 253 ? -36.359 14.116  25.120 1.00 15.18 ? 362  GLU A N   1 
ATOM   1946 C  CA  . GLU A 1 253 ? -35.680 15.336  25.551 1.00 18.64 ? 362  GLU A CA  1 
ATOM   1947 C  C   . GLU A 1 253 ? -34.583 15.017  26.592 1.00 13.93 ? 362  GLU A C   1 
ATOM   1948 O  O   . GLU A 1 253 ? -34.043 15.921  27.237 1.00 15.80 ? 362  GLU A O   1 
ATOM   1949 C  CB  . GLU A 1 253 ? -36.699 16.368  26.094 1.00 16.01 ? 362  GLU A CB  1 
ATOM   1950 C  CG  . GLU A 1 253 ? -37.641 16.898  24.990 1.00 19.26 ? 362  GLU A CG  1 
ATOM   1951 C  CD  . GLU A 1 253 ? -38.611 17.955  25.480 1.00 28.03 ? 362  GLU A CD  1 
ATOM   1952 O  OE1 . GLU A 1 253 ? -38.174 18.867  26.212 1.00 29.79 ? 362  GLU A OE1 1 
ATOM   1953 O  OE2 . GLU A 1 253 ? -39.806 17.869  25.133 1.00 26.17 ? 362  GLU A OE2 1 
ATOM   1954 N  N   . SER A 1 254 ? -34.231 13.734  26.707 1.00 14.42 ? 363  SER A N   1 
ATOM   1955 C  CA  A SER A 1 254 ? -33.380 13.284  27.804 0.80 15.28 ? 363  SER A CA  1 
ATOM   1956 C  CA  B SER A 1 254 ? -33.394 13.257  27.804 0.20 15.35 ? 363  SER A CA  1 
ATOM   1957 C  C   . SER A 1 254 ? -32.237 12.366  27.352 1.00 14.75 ? 363  SER A C   1 
ATOM   1958 O  O   . SER A 1 254 ? -31.874 11.408  28.040 1.00 13.39 ? 363  SER A O   1 
ATOM   1959 C  CB  A SER A 1 254 ? -34.238 12.627  28.910 0.80 18.31 ? 363  SER A CB  1 
ATOM   1960 C  CB  B SER A 1 254 ? -34.252 12.486  28.812 0.20 18.25 ? 363  SER A CB  1 
ATOM   1961 O  OG  A SER A 1 254 ? -34.906 11.449  28.453 0.80 17.83 ? 363  SER A OG  1 
ATOM   1962 O  OG  B SER A 1 254 ? -35.198 13.331  29.436 0.20 17.33 ? 363  SER A OG  1 
ATOM   1963 N  N   . HIS A 1 255 ? -31.651 12.680  26.199 1.00 14.27 ? 364  HIS A N   1 
ATOM   1964 C  CA  . HIS A 1 255 ? -30.461 11.968  25.703 1.00 12.43 ? 364  HIS A CA  1 
ATOM   1965 C  C   . HIS A 1 255 ? -29.270 12.630  26.408 1.00 12.41 ? 364  HIS A C   1 
ATOM   1966 O  O   . HIS A 1 255 ? -29.206 13.861  26.510 1.00 11.56 ? 364  HIS A O   1 
ATOM   1967 C  CB  . HIS A 1 255 ? -30.403 12.122  24.187 1.00 11.99 ? 364  HIS A CB  1 
ATOM   1968 C  CG  . HIS A 1 255 ? -29.321 11.342  23.508 1.00 13.29 ? 364  HIS A CG  1 
ATOM   1969 N  ND1 . HIS A 1 255 ? -28.853 10.131  23.969 1.00 12.86 ? 364  HIS A ND1 1 
ATOM   1970 C  CD2 . HIS A 1 255 ? -28.645 11.591  22.357 1.00 14.83 ? 364  HIS A CD2 1 
ATOM   1971 C  CE1 . HIS A 1 255 ? -27.928 9.677   23.146 1.00 14.62 ? 364  HIS A CE1 1 
ATOM   1972 N  NE2 . HIS A 1 255 ? -27.785 10.546  22.159 1.00 16.35 ? 364  HIS A NE2 1 
ATOM   1973 N  N   . THR A 1 256 ? -28.357 11.811  26.910 1.00 13.08 ? 365  THR A N   1 
ATOM   1974 C  CA  . THR A 1 256 ? -27.350 12.249  27.880 1.00 11.82 ? 365  THR A CA  1 
ATOM   1975 C  C   . THR A 1 256 ? -25.935 11.709  27.618 1.00 14.43 ? 365  THR A C   1 
ATOM   1976 O  O   . THR A 1 256 ? -25.731 10.781  26.832 1.00 11.95 ? 365  THR A O   1 
ATOM   1977 C  CB  . THR A 1 256 ? -27.719 11.782  29.308 1.00 15.33 ? 365  THR A CB  1 
ATOM   1978 O  OG1 . THR A 1 256 ? -27.647 10.359  29.387 1.00 12.67 ? 365  THR A OG1 1 
ATOM   1979 C  CG2 . THR A 1 256 ? -29.108 12.246  29.717 1.00 15.28 ? 365  THR A CG2 1 
ATOM   1980 N  N   . GLY A 1 257 ? -24.953 12.312  28.277 1.00 10.54 ? 366  GLY A N   1 
ATOM   1981 C  CA  . GLY A 1 257 ? -23.599 11.784  28.262 1.00 9.92  ? 366  GLY A CA  1 
ATOM   1982 C  C   . GLY A 1 257 ? -22.778 12.131  27.042 1.00 12.11 ? 366  GLY A C   1 
ATOM   1983 O  O   . GLY A 1 257 ? -23.223 12.817  26.083 1.00 9.89  ? 366  GLY A O   1 
ATOM   1984 N  N   . THR A 1 258 ? -21.543 11.649  27.061 1.00 9.85  ? 367  THR A N   1 
ATOM   1985 C  CA  . THR A 1 258 ? -20.574 12.066  26.054 1.00 12.20 ? 367  THR A CA  1 
ATOM   1986 C  C   . THR A 1 258 ? -20.931 11.436  24.720 1.00 11.98 ? 367  THR A C   1 
ATOM   1987 O  O   . THR A 1 258 ? -20.586 11.940  23.669 1.00 12.43 ? 367  THR A O   1 
ATOM   1988 C  CB  . THR A 1 258 ? -19.157 11.711  26.477 1.00 10.75 ? 367  THR A CB  1 
ATOM   1989 O  OG1 . THR A 1 258 ? -18.946 12.186  27.814 1.00 12.32 ? 367  THR A OG1 1 
ATOM   1990 C  CG2 . THR A 1 258 ? -18.095 12.365  25.526 1.00 11.63 ? 367  THR A CG2 1 
ATOM   1991 N  N   . SER A 1 259 ? -21.680 10.354  24.774 1.00 13.31 ? 368  SER A N   1 
ATOM   1992 C  CA  A SER A 1 259 ? -22.112 9.669   23.565 0.72 13.15 ? 368  SER A CA  1 
ATOM   1993 C  CA  B SER A 1 259 ? -22.115 9.657   23.570 0.28 13.18 ? 368  SER A CA  1 
ATOM   1994 C  C   . SER A 1 259 ? -23.113 10.485  22.776 1.00 14.70 ? 368  SER A C   1 
ATOM   1995 O  O   . SER A 1 259 ? -23.340 10.215  21.586 1.00 14.98 ? 368  SER A O   1 
ATOM   1996 C  CB  A SER A 1 259 ? -22.683 8.302   23.930 0.72 16.12 ? 368  SER A CB  1 
ATOM   1997 C  CB  B SER A 1 259 ? -22.750 8.316   23.928 0.28 16.09 ? 368  SER A CB  1 
ATOM   1998 O  OG  A SER A 1 259 ? -21.686 7.534   24.585 0.72 18.42 ? 368  SER A OG  1 
ATOM   1999 O  OG  B SER A 1 259 ? -24.114 8.487   24.248 0.28 14.83 ? 368  SER A OG  1 
ATOM   2000 N  N   . ALA A 1 260 ? -23.718 11.484  23.424 1.00 11.94 ? 369  ALA A N   1 
ATOM   2001 C  CA  . ALA A 1 260 ? -24.586 12.397  22.700 1.00 11.84 ? 369  ALA A CA  1 
ATOM   2002 C  C   . ALA A 1 260 ? -23.777 13.551  22.075 1.00 14.07 ? 369  ALA A C   1 
ATOM   2003 O  O   . ALA A 1 260 ? -24.295 14.270  21.227 1.00 13.25 ? 369  ALA A O   1 
ATOM   2004 C  CB  . ALA A 1 260 ? -25.708 12.949  23.605 1.00 9.80  ? 369  ALA A CB  1 
ATOM   2005 N  N   . SER A 1 261 ? -22.525 13.739  22.480 1.00 11.99 ? 370  SER A N   1 
ATOM   2006 C  CA  . SER A 1 261 ? -21.732 14.827  21.922 1.00 9.67  ? 370  SER A CA  1 
ATOM   2007 C  C   . SER A 1 261 ? -21.110 14.470  20.592 1.00 12.25 ? 370  SER A C   1 
ATOM   2008 O  O   . SER A 1 261 ? -20.997 15.314  19.700 1.00 12.03 ? 370  SER A O   1 
ATOM   2009 C  CB  . SER A 1 261 ? -20.626 15.248  22.898 1.00 9.85  ? 370  SER A CB  1 
ATOM   2010 O  OG  . SER A 1 261 ? -21.191 15.940  23.980 1.00 10.70 ? 370  SER A OG  1 
ATOM   2011 N  N   . ALA A 1 262 ? -20.658 13.230  20.452 1.00 11.79 ? 371  ALA A N   1 
ATOM   2012 C  CA  . ALA A 1 262 ? -20.012 12.844  19.221 1.00 12.19 ? 371  ALA A CA  1 
ATOM   2013 C  C   . ALA A 1 262 ? -20.901 13.065  17.979 1.00 12.78 ? 371  ALA A C   1 
ATOM   2014 O  O   . ALA A 1 262 ? -20.416 13.532  16.958 1.00 11.19 ? 371  ALA A O   1 
ATOM   2015 C  CB  . ALA A 1 262 ? -19.535 11.413  19.298 1.00 11.97 ? 371  ALA A CB  1 
ATOM   2016 N  N   . PRO A 1 263 ? -22.184 12.677  18.048 1.00 12.63 ? 372  PRO A N   1 
ATOM   2017 C  CA  . PRO A 1 263 ? -23.074 12.860  16.892 1.00 11.36 ? 372  PRO A CA  1 
ATOM   2018 C  C   . PRO A 1 263 ? -23.292 14.327  16.491 1.00 10.87 ? 372  PRO A C   1 
ATOM   2019 O  O   . PRO A 1 263 ? -23.391 14.621  15.288 1.00 11.85 ? 372  PRO A O   1 
ATOM   2020 C  CB  . PRO A 1 263 ? -24.382 12.214  17.362 1.00 11.66 ? 372  PRO A CB  1 
ATOM   2021 C  CG  . PRO A 1 263 ? -23.963 11.214  18.361 1.00 13.38 ? 372  PRO A CG  1 
ATOM   2022 C  CD  . PRO A 1 263 ? -22.783 11.793  19.055 1.00 12.50 ? 372  PRO A CD  1 
ATOM   2023 N  N   . LEU A 1 264 ? -23.354 15.246  17.455 1.00 9.03  ? 373  LEU A N   1 
ATOM   2024 C  CA  . LEU A 1 264 ? -23.429 16.665  17.114 1.00 11.58 ? 373  LEU A CA  1 
ATOM   2025 C  C   . LEU A 1 264 ? -22.154 17.064  16.368 1.00 12.17 ? 373  LEU A C   1 
ATOM   2026 O  O   . LEU A 1 264 ? -22.217 17.757  15.356 1.00 11.00 ? 373  LEU A O   1 
ATOM   2027 C  CB  . LEU A 1 264 ? -23.653 17.532  18.351 1.00 9.44  ? 373  LEU A CB  1 
ATOM   2028 C  CG  . LEU A 1 264 ? -24.940 17.253  19.120 1.00 9.99  ? 373  LEU A CG  1 
ATOM   2029 C  CD1 . LEU A 1 264 ? -24.936 17.953  20.500 1.00 12.29 ? 373  LEU A CD1 1 
ATOM   2030 C  CD2 . LEU A 1 264 ? -26.165 17.669  18.326 1.00 11.84 ? 373  LEU A CD2 1 
ATOM   2031 N  N   . ALA A 1 265 ? -21.002 16.573  16.822 1.00 9.89  ? 374  ALA A N   1 
ATOM   2032 C  CA  . ALA A 1 265 ? -19.762 16.850  16.109 1.00 11.73 ? 374  ALA A CA  1 
ATOM   2033 C  C   . ALA A 1 265 ? -19.808 16.270  14.694 1.00 11.62 ? 374  ALA A C   1 
ATOM   2034 O  O   . ALA A 1 265 ? -19.442 16.937  13.712 1.00 10.85 ? 374  ALA A O   1 
ATOM   2035 C  CB  . ALA A 1 265 ? -18.553 16.305  16.902 1.00 11.30 ? 374  ALA A CB  1 
ATOM   2036 N  N   . ALA A 1 266 ? -20.277 15.029  14.578 1.00 10.48 ? 375  ALA A N   1 
ATOM   2037 C  CA  . ALA A 1 266 ? -20.423 14.391  13.265 1.00 11.11 ? 375  ALA A CA  1 
ATOM   2038 C  C   . ALA A 1 266 ? -21.266 15.251  12.303 1.00 9.49  ? 375  ALA A C   1 
ATOM   2039 O  O   . ALA A 1 266 ? -20.921 15.422  11.115 1.00 13.95 ? 375  ALA A O   1 
ATOM   2040 C  CB  . ALA A 1 266 ? -21.017 12.981  13.423 1.00 10.34 ? 375  ALA A CB  1 
ATOM   2041 N  N   . GLY A 1 267 ? -22.354 15.814  12.816 1.00 10.97 ? 376  GLY A N   1 
ATOM   2042 C  CA  . GLY A 1 267 ? -23.217 16.688  12.028 1.00 9.74  ? 376  GLY A CA  1 
ATOM   2043 C  C   . GLY A 1 267 ? -22.512 17.959  11.579 1.00 12.23 ? 376  GLY A C   1 
ATOM   2044 O  O   . GLY A 1 267 ? -22.602 18.380  10.396 1.00 13.27 ? 376  GLY A O   1 
ATOM   2045 N  N   . ILE A 1 268 ? -21.800 18.595  12.511 1.00 12.33 ? 377  ILE A N   1 
ATOM   2046 C  CA  . ILE A 1 268 ? -21.010 19.784  12.167 1.00 8.69  ? 377  ILE A CA  1 
ATOM   2047 C  C   . ILE A 1 268 ? -19.955 19.469  11.114 1.00 12.03 ? 377  ILE A C   1 
ATOM   2048 O  O   . ILE A 1 268 ? -19.691 20.257  10.195 1.00 11.68 ? 377  ILE A O   1 
ATOM   2049 C  CB  . ILE A 1 268 ? -20.378 20.407  13.440 1.00 10.57 ? 377  ILE A CB  1 
ATOM   2050 C  CG1 . ILE A 1 268 ? -21.497 20.960  14.327 1.00 11.26 ? 377  ILE A CG1 1 
ATOM   2051 C  CG2 . ILE A 1 268 ? -19.381 21.519  13.098 1.00 10.09 ? 377  ILE A CG2 1 
ATOM   2052 C  CD1 . ILE A 1 268 ? -21.027 21.476  15.681 1.00 12.04 ? 377  ILE A CD1 1 
ATOM   2053 N  N   . ILE A 1 269 ? -19.378 18.285  11.212 1.00 11.44 ? 378  ILE A N   1 
ATOM   2054 C  CA  . ILE A 1 269 ? -18.333 17.888  10.284 1.00 11.22 ? 378  ILE A CA  1 
ATOM   2055 C  C   . ILE A 1 269 ? -18.936 17.637  8.891  1.00 11.86 ? 378  ILE A C   1 
ATOM   2056 O  O   . ILE A 1 269 ? -18.316 17.936  7.881  1.00 12.11 ? 378  ILE A O   1 
ATOM   2057 C  CB  . ILE A 1 269 ? -17.546 16.671  10.860 1.00 10.05 ? 378  ILE A CB  1 
ATOM   2058 C  CG1 . ILE A 1 269 ? -16.631 17.168  11.984 1.00 13.11 ? 378  ILE A CG1 1 
ATOM   2059 C  CG2 . ILE A 1 269 ? -16.716 15.977  9.796  1.00 10.36 ? 378  ILE A CG2 1 
ATOM   2060 C  CD1 . ILE A 1 269 ? -16.183 16.097  12.964 1.00 15.62 ? 378  ILE A CD1 1 
ATOM   2061 N  N   . ALA A 1 270 ? -20.167 17.120  8.847  1.00 11.05 ? 379  ALA A N   1 
ATOM   2062 C  CA  . ALA A 1 270 ? -20.908 16.997  7.603  1.00 9.66  ? 379  ALA A CA  1 
ATOM   2063 C  C   . ALA A 1 270 ? -21.150 18.351  6.927  1.00 13.59 ? 379  ALA A C   1 
ATOM   2064 O  O   . ALA A 1 270 ? -20.980 18.458  5.716  1.00 14.60 ? 379  ALA A O   1 
ATOM   2065 C  CB  . ALA A 1 270 ? -22.242 16.261  7.845  1.00 11.33 ? 379  ALA A CB  1 
ATOM   2066 N  N   . LEU A 1 271 ? -21.562 19.371  7.689  1.00 13.34 ? 380  LEU A N   1 
ATOM   2067 C  CA  . LEU A 1 271 ? -21.715 20.716  7.151  1.00 15.41 ? 380  LEU A CA  1 
ATOM   2068 C  C   . LEU A 1 271 ? -20.382 21.204  6.576  1.00 16.50 ? 380  LEU A C   1 
ATOM   2069 O  O   . LEU A 1 271 ? -20.335 21.817  5.512  1.00 13.92 ? 380  LEU A O   1 
ATOM   2070 C  CB  . LEU A 1 271 ? -22.181 21.706  8.225  1.00 11.71 ? 380  LEU A CB  1 
ATOM   2071 C  CG  . LEU A 1 271 ? -23.504 21.378  8.942  1.00 12.46 ? 380  LEU A CG  1 
ATOM   2072 C  CD1 . LEU A 1 271 ? -23.825 22.476  9.925  1.00 11.50 ? 380  LEU A CD1 1 
ATOM   2073 C  CD2 . LEU A 1 271 ? -24.673 21.217  7.933  1.00 15.56 ? 380  LEU A CD2 1 
ATOM   2074 N  N   . THR A 1 272 ? -19.300 20.930  7.295  1.00 14.46 ? 381  THR A N   1 
ATOM   2075 C  CA  . THR A 1 272 ? -17.987 21.389  6.863  1.00 12.98 ? 381  THR A CA  1 
ATOM   2076 C  C   . THR A 1 272 ? -17.532 20.692  5.583  1.00 15.00 ? 381  THR A C   1 
ATOM   2077 O  O   . THR A 1 272 ? -16.930 21.335  4.706  1.00 15.00 ? 381  THR A O   1 
ATOM   2078 C  CB  . THR A 1 272 ? -16.958 21.182  7.972  1.00 15.11 ? 381  THR A CB  1 
ATOM   2079 O  OG1 . THR A 1 272 ? -17.448 21.802  9.157  1.00 13.45 ? 381  THR A OG1 1 
ATOM   2080 C  CG2 . THR A 1 272 ? -15.610 21.797  7.614  1.00 13.96 ? 381  THR A CG2 1 
ATOM   2081 N  N   . LEU A 1 273 ? -17.826 19.400  5.460  1.00 14.40 ? 382  LEU A N   1 
ATOM   2082 C  CA  . LEU A 1 273 ? -17.458 18.648  4.262  1.00 14.50 ? 382  LEU A CA  1 
ATOM   2083 C  C   . LEU A 1 273 ? -18.277 19.114  3.072  1.00 16.55 ? 382  LEU A C   1 
ATOM   2084 O  O   . LEU A 1 273 ? -17.777 19.157  1.938  1.00 15.95 ? 382  LEU A O   1 
ATOM   2085 C  CB  . LEU A 1 273 ? -17.701 17.151  4.446  1.00 12.11 ? 382  LEU A CB  1 
ATOM   2086 C  CG  . LEU A 1 273 ? -16.550 16.234  4.774  1.00 21.85 ? 382  LEU A CG  1 
ATOM   2087 C  CD1 . LEU A 1 273 ? -17.010 14.797  4.526  1.00 19.75 ? 382  LEU A CD1 1 
ATOM   2088 C  CD2 . LEU A 1 273 ? -15.233 16.587  4.001  1.00 17.90 ? 382  LEU A CD2 1 
ATOM   2089 N  N   . GLU A 1 274 ? -19.542 19.445  3.308  1.00 17.00 ? 383  GLU A N   1 
ATOM   2090 C  CA  . GLU A 1 274 ? -20.338 20.051  2.249  1.00 15.34 ? 383  GLU A CA  1 
ATOM   2091 C  C   . GLU A 1 274 ? -19.649 21.322  1.768  1.00 17.18 ? 383  GLU A C   1 
ATOM   2092 O  O   . GLU A 1 274 ? -19.617 21.611  0.572  1.00 16.87 ? 383  GLU A O   1 
ATOM   2093 C  CB  . GLU A 1 274 ? -21.782 20.369  2.704  1.00 16.78 ? 383  GLU A CB  1 
ATOM   2094 C  CG  . GLU A 1 274 ? -22.657 20.706  1.494  1.00 16.36 ? 383  GLU A CG  1 
ATOM   2095 C  CD  . GLU A 1 274 ? -24.057 21.211  1.833  1.00 21.76 ? 383  GLU A CD  1 
ATOM   2096 O  OE1 . GLU A 1 274 ? -24.422 21.310  3.042  1.00 19.04 ? 383  GLU A OE1 1 
ATOM   2097 O  OE2 . GLU A 1 274 ? -24.800 21.511  0.866  1.00 18.01 ? 383  GLU A OE2 1 
ATOM   2098 N  N   . ALA A 1 275 ? -19.086 22.086  2.691  1.00 14.28 ? 384  ALA A N   1 
ATOM   2099 C  CA  . ALA A 1 275 ? -18.440 23.345  2.334  1.00 17.40 ? 384  ALA A CA  1 
ATOM   2100 C  C   . ALA A 1 275 ? -17.146 23.135  1.542  1.00 18.99 ? 384  ALA A C   1 
ATOM   2101 O  O   . ALA A 1 275 ? -16.717 24.008  0.784  1.00 16.10 ? 384  ALA A O   1 
ATOM   2102 C  CB  . ALA A 1 275 ? -18.157 24.168  3.580  1.00 17.74 ? 384  ALA A CB  1 
ATOM   2103 N  N   . ASN A 1 276 ? -16.520 21.982  1.726  1.00 15.72 ? 385  ASN A N   1 
ATOM   2104 C  CA  . ASN A 1 276 ? -15.294 21.650  1.004  1.00 13.41 ? 385  ASN A CA  1 
ATOM   2105 C  C   . ASN A 1 276 ? -15.136 20.153  1.005  1.00 16.27 ? 385  ASN A C   1 
ATOM   2106 O  O   . ASN A 1 276 ? -14.595 19.549  1.958  1.00 12.89 ? 385  ASN A O   1 
ATOM   2107 C  CB  . ASN A 1 276 ? -14.066 22.312  1.643  1.00 12.01 ? 385  ASN A CB  1 
ATOM   2108 C  CG  . ASN A 1 276 ? -12.779 22.008  0.886  1.00 14.41 ? 385  ASN A CG  1 
ATOM   2109 O  OD1 . ASN A 1 276 ? -12.735 21.119  0.040  1.00 14.44 ? 385  ASN A OD1 1 
ATOM   2110 N  ND2 . ASN A 1 276 ? -11.732 22.748  1.190  1.00 14.59 ? 385  ASN A ND2 1 
ATOM   2111 N  N   . LYS A 1 277 ? -15.618 19.532  -0.065 1.00 12.37 ? 386  LYS A N   1 
ATOM   2112 C  CA  . LYS A 1 277 ? -15.637 18.082  -0.150 1.00 14.28 ? 386  LYS A CA  1 
ATOM   2113 C  C   . LYS A 1 277 ? -14.258 17.486  -0.362 1.00 13.94 ? 386  LYS A C   1 
ATOM   2114 O  O   . LYS A 1 277 ? -14.121 16.266  -0.342 1.00 14.88 ? 386  LYS A O   1 
ATOM   2115 C  CB  . LYS A 1 277 ? -16.575 17.639  -1.276 1.00 17.90 ? 386  LYS A CB  1 
ATOM   2116 C  CG  . LYS A 1 277 ? -17.990 18.187  -1.083 1.00 20.33 ? 386  LYS A CG  1 
ATOM   2117 N  N   . ASP A 1 278 ? -13.246 18.328  -0.580 1.00 12.23 ? 387  ASP A N   1 
ATOM   2118 C  CA  . ASP A 1 278 ? -11.891 17.829  -0.734 1.00 12.01 ? 387  ASP A CA  1 
ATOM   2119 C  C   . ASP A 1 278 ? -11.073 17.793  0.548  1.00 14.38 ? 387  ASP A C   1 
ATOM   2120 O  O   . ASP A 1 278 ? -9.893  17.454  0.503  1.00 14.34 ? 387  ASP A O   1 
ATOM   2121 C  CB  . ASP A 1 278 ? -11.133 18.642  -1.791 1.00 16.07 ? 387  ASP A CB  1 
ATOM   2122 C  CG  . ASP A 1 278 ? -11.727 18.457  -3.166 1.00 18.54 ? 387  ASP A CG  1 
ATOM   2123 O  OD1 . ASP A 1 278 ? -11.893 17.288  -3.554 1.00 14.65 ? 387  ASP A OD1 1 
ATOM   2124 O  OD2 . ASP A 1 278 ? -12.064 19.472  -3.826 1.00 20.75 ? 387  ASP A OD2 1 
ATOM   2125 N  N   . LEU A 1 279 ? -11.692 18.105  1.689  1.00 15.63 ? 388  LEU A N   1 
ATOM   2126 C  CA  . LEU A 1 279 ? -10.987 18.016  2.968  1.00 14.49 ? 388  LEU A CA  1 
ATOM   2127 C  C   . LEU A 1 279 ? -10.603 16.576  3.316  1.00 12.31 ? 388  LEU A C   1 
ATOM   2128 O  O   . LEU A 1 279 ? -11.435 15.669  3.234  1.00 12.22 ? 388  LEU A O   1 
ATOM   2129 C  CB  . LEU A 1 279 ? -11.855 18.569  4.082  1.00 12.00 ? 388  LEU A CB  1 
ATOM   2130 C  CG  . LEU A 1 279 ? -12.177 20.054  4.010  1.00 12.69 ? 388  LEU A CG  1 
ATOM   2131 C  CD1 . LEU A 1 279 ? -13.286 20.368  4.977  1.00 14.91 ? 388  LEU A CD1 1 
ATOM   2132 C  CD2 . LEU A 1 279 ? -10.949 20.906  4.325  1.00 13.98 ? 388  LEU A CD2 1 
ATOM   2133 N  N   . THR A 1 280 ? -9.341  16.355  3.701  1.00 11.47 ? 389  THR A N   1 
ATOM   2134 C  CA  . THR A 1 280 ? -8.918  15.025  4.119  1.00 12.32 ? 389  THR A CA  1 
ATOM   2135 C  C   . THR A 1 280 ? -9.201  14.860  5.612  1.00 11.95 ? 389  THR A C   1 
ATOM   2136 O  O   . THR A 1 280 ? -9.572  15.815  6.297  1.00 11.97 ? 389  THR A O   1 
ATOM   2137 C  CB  . THR A 1 280 ? -7.414  14.793  3.923  1.00 12.55 ? 389  THR A CB  1 
ATOM   2138 O  OG1 . THR A 1 280 ? -6.707  15.649  4.822  1.00 10.71 ? 389  THR A OG1 1 
ATOM   2139 C  CG2 . THR A 1 280 ? -6.994  15.090  2.503  1.00 12.41 ? 389  THR A CG2 1 
ATOM   2140 N  N   . TRP A 1 281 ? -8.972  13.650  6.096  1.00 12.44 ? 390  TRP A N   1 
ATOM   2141 C  CA  . TRP A 1 281 ? -9.224  13.311  7.481  1.00 12.90 ? 390  TRP A CA  1 
ATOM   2142 C  C   . TRP A 1 281 ? -8.324  14.161  8.371  1.00 13.84 ? 390  TRP A C   1 
ATOM   2143 O  O   . TRP A 1 281 ? -8.745  14.565  9.446  1.00 10.88 ? 390  TRP A O   1 
ATOM   2144 C  CB  . TRP A 1 281 ? -9.018  11.794  7.683  1.00 12.97 ? 390  TRP A CB  1 
ATOM   2145 C  CG  . TRP A 1 281 ? -7.565  11.324  7.620  1.00 12.59 ? 390  TRP A CG  1 
ATOM   2146 C  CD1 . TRP A 1 281 ? -6.859  10.980  6.507  1.00 12.49 ? 390  TRP A CD1 1 
ATOM   2147 C  CD2 . TRP A 1 281 ? -6.666  11.152  8.730  1.00 10.09 ? 390  TRP A CD2 1 
ATOM   2148 N  NE1 . TRP A 1 281 ? -5.571  10.613  6.849  1.00 12.61 ? 390  TRP A NE1 1 
ATOM   2149 C  CE2 . TRP A 1 281 ? -5.436  10.694  8.208  1.00 11.02 ? 390  TRP A CE2 1 
ATOM   2150 C  CE3 . TRP A 1 281 ? -6.788  11.337  10.123 1.00 11.84 ? 390  TRP A CE3 1 
ATOM   2151 C  CZ2 . TRP A 1 281 ? -4.328  10.417  9.022  1.00 11.70 ? 390  TRP A CZ2 1 
ATOM   2152 C  CZ3 . TRP A 1 281 ? -5.694  11.068  10.928 1.00 10.01 ? 390  TRP A CZ3 1 
ATOM   2153 C  CH2 . TRP A 1 281 ? -4.468  10.609  10.366 1.00 9.45  ? 390  TRP A CH2 1 
ATOM   2154 N  N   . ARG A 1 282 ? -7.112  14.484  7.907  1.00 8.91  ? 391  ARG A N   1 
ATOM   2155 C  CA  . ARG A 1 282 ? -6.243  15.367  8.668  1.00 7.88  ? 391  ARG A CA  1 
ATOM   2156 C  C   . ARG A 1 282 ? -6.682  16.818  8.565  1.00 11.20 ? 391  ARG A C   1 
ATOM   2157 O  O   . ARG A 1 282 ? -6.665  17.545  9.579  1.00 10.16 ? 391  ARG A O   1 
ATOM   2158 C  CB  . ARG A 1 282 ? -4.773  15.206  8.264  1.00 11.06 ? 391  ARG A CB  1 
ATOM   2159 C  CG  . ARG A 1 282 ? -4.119  14.003  8.918  1.00 12.43 ? 391  ARG A CG  1 
ATOM   2160 C  CD  . ARG A 1 282 ? -2.853  13.582  8.195  1.00 14.22 ? 391  ARG A CD  1 
ATOM   2161 N  NE  . ARG A 1 282 ? -1.839  14.633  8.221  1.00 10.08 ? 391  ARG A NE  1 
ATOM   2162 C  CZ  . ARG A 1 282 ? -1.240  15.155  7.146  1.00 13.07 ? 391  ARG A CZ  1 
ATOM   2163 N  NH1 . ARG A 1 282 ? -0.337  16.111  7.315  1.00 10.68 ? 391  ARG A NH1 1 
ATOM   2164 N  NH2 . ARG A 1 282 ? -1.521  14.744  5.906  1.00 12.37 ? 391  ARG A NH2 1 
ATOM   2165 N  N   . ASP A 1 283 ? -7.079  17.257  7.364  1.00 11.04 ? 392  ASP A N   1 
ATOM   2166 C  CA  . ASP A 1 283 ? -7.570  18.643  7.192  1.00 10.76 ? 392  ASP A CA  1 
ATOM   2167 C  C   . ASP A 1 283 ? -8.680  18.884  8.214  1.00 10.11 ? 392  ASP A C   1 
ATOM   2168 O  O   . ASP A 1 283 ? -8.738  19.933  8.840  1.00 11.25 ? 392  ASP A O   1 
ATOM   2169 C  CB  . ASP A 1 283 ? -8.171  18.889  5.798  1.00 10.95 ? 392  ASP A CB  1 
ATOM   2170 C  CG  . ASP A 1 283 ? -7.116  18.969  4.679  1.00 16.06 ? 392  ASP A CG  1 
ATOM   2171 O  OD1 . ASP A 1 283 ? -5.986  19.458  4.938  1.00 13.12 ? 392  ASP A OD1 1 
ATOM   2172 O  OD2 . ASP A 1 283 ? -7.448  18.552  3.537  1.00 12.49 ? 392  ASP A OD2 1 
ATOM   2173 N  N   . MET A 1 284 ? -9.560  17.905  8.397  1.00 9.54  ? 393  MET A N   1 
ATOM   2174 C  CA  . MET A 1 284 ? -10.706 18.117  9.281  1.00 9.40  ? 393  MET A CA  1 
ATOM   2175 C  C   . MET A 1 284 ? -10.221 18.331  10.707 1.00 10.38 ? 393  MET A C   1 
ATOM   2176 O  O   . MET A 1 284 ? -10.744 19.190  11.444 1.00 10.60 ? 393  MET A O   1 
ATOM   2177 C  CB  . MET A 1 284 ? -11.686 16.935  9.234  1.00 9.64  ? 393  MET A CB  1 
ATOM   2178 C  CG  . MET A 1 284 ? -13.082 17.241  9.896  1.00 10.15 ? 393  MET A CG  1 
ATOM   2179 S  SD  . MET A 1 284 ? -14.005 18.602  9.082  1.00 12.55 ? 393  MET A SD  1 
ATOM   2180 C  CE  . MET A 1 284 ? -14.357 17.830  7.511  1.00 12.84 ? 393  MET A CE  1 
ATOM   2181 N  N   . GLN A 1 285 ? -9.232  17.558  11.125 1.00 10.21 ? 394  GLN A N   1 
ATOM   2182 C  CA  . GLN A 1 285 ? -8.724  17.760  12.467 1.00 8.15  ? 394  GLN A CA  1 
ATOM   2183 C  C   . GLN A 1 285 ? -8.105  19.141  12.604 1.00 10.28 ? 394  GLN A C   1 
ATOM   2184 O  O   . GLN A 1 285 ? -8.269  19.793  13.633 1.00 11.73 ? 394  GLN A O   1 
ATOM   2185 C  CB  . GLN A 1 285 ? -7.743  16.646  12.853 1.00 10.70 ? 394  GLN A CB  1 
ATOM   2186 C  CG  . GLN A 1 285 ? -8.447  15.308  12.929 1.00 8.95  ? 394  GLN A CG  1 
ATOM   2187 C  CD  . GLN A 1 285 ? -7.654  14.203  13.584 1.00 9.64  ? 394  GLN A CD  1 
ATOM   2188 O  OE1 . GLN A 1 285 ? -6.753  14.432  14.410 1.00 13.77 ? 394  GLN A OE1 1 
ATOM   2189 N  NE2 . GLN A 1 285 ? -8.008  12.967  13.235 1.00 9.74  ? 394  GLN A NE2 1 
ATOM   2190 N  N   . HIS A 1 286 ? -7.357  19.580  11.588 1.00 10.47 ? 395  HIS A N   1 
ATOM   2191 C  CA  . HIS A 1 286 ? -6.793  20.937  11.597 1.00 11.21 ? 395  HIS A CA  1 
ATOM   2192 C  C   . HIS A 1 286 ? -7.892  22.001  11.739 1.00 11.39 ? 395  HIS A C   1 
ATOM   2193 O  O   . HIS A 1 286 ? -7.725  22.975  12.488 1.00 11.88 ? 395  HIS A O   1 
ATOM   2194 C  CB  . HIS A 1 286 ? -6.026  21.219  10.295 1.00 13.53 ? 395  HIS A CB  1 
ATOM   2195 C  CG  . HIS A 1 286 ? -4.645  20.652  10.257 1.00 12.77 ? 395  HIS A CG  1 
ATOM   2196 N  ND1 . HIS A 1 286 ? -3.548  21.345  10.722 1.00 13.17 ? 395  HIS A ND1 1 
ATOM   2197 C  CD2 . HIS A 1 286 ? -4.168  19.494  9.745  1.00 11.57 ? 395  HIS A CD2 1 
ATOM   2198 C  CE1 . HIS A 1 286 ? -2.462  20.623  10.522 1.00 10.31 ? 395  HIS A CE1 1 
ATOM   2199 N  NE2 . HIS A 1 286 ? -2.813  19.489  9.946  1.00 10.83 ? 395  HIS A NE2 1 
ATOM   2200 N  N   . LEU A 1 287 ? -9.004  21.838  11.023 1.00 10.34 ? 396  LEU A N   1 
ATOM   2201 C  CA  . LEU A 1 287 ? -10.078 22.838  11.093 1.00 11.70 ? 396  LEU A CA  1 
ATOM   2202 C  C   . LEU A 1 287 ? -10.639 22.922  12.514 1.00 12.85 ? 396  LEU A C   1 
ATOM   2203 O  O   . LEU A 1 287 ? -10.969 24.006  13.023 1.00 11.86 ? 396  LEU A O   1 
ATOM   2204 C  CB  . LEU A 1 287 ? -11.216 22.489  10.130 1.00 11.42 ? 396  LEU A CB  1 
ATOM   2205 C  CG  . LEU A 1 287 ? -10.946 22.652  8.625  1.00 13.30 ? 396  LEU A CG  1 
ATOM   2206 C  CD1 . LEU A 1 287 ? -12.220 22.381  7.817  1.00 18.69 ? 396  LEU A CD1 1 
ATOM   2207 C  CD2 . LEU A 1 287 ? -10.431 24.026  8.311  1.00 19.92 ? 396  LEU A CD2 1 
ATOM   2208 N  N   . VAL A 1 288 ? -10.805 21.761  13.133 1.00 12.22 ? 397  VAL A N   1 
ATOM   2209 C  CA  . VAL A 1 288 ? -11.342 21.710  14.492 1.00 10.07 ? 397  VAL A CA  1 
ATOM   2210 C  C   . VAL A 1 288 ? -10.380 22.391  15.476 1.00 9.83  ? 397  VAL A C   1 
ATOM   2211 O  O   . VAL A 1 288 ? -10.787 23.171  16.366 1.00 11.66 ? 397  VAL A O   1 
ATOM   2212 C  CB  . VAL A 1 288 ? -11.607 20.263  14.897 1.00 10.32 ? 397  VAL A CB  1 
ATOM   2213 C  CG1 . VAL A 1 288 ? -11.823 20.133  16.402 1.00 8.57  ? 397  VAL A CG1 1 
ATOM   2214 C  CG2 . VAL A 1 288 ? -12.795 19.728  14.117 1.00 10.72 ? 397  VAL A CG2 1 
ATOM   2215 N  N   . VAL A 1 289 ? -9.096  22.111  15.314 1.00 10.32 ? 398  VAL A N   1 
ATOM   2216 C  CA  . VAL A 1 289 ? -8.085  22.763  16.154 1.00 9.67  ? 398  VAL A CA  1 
ATOM   2217 C  C   . VAL A 1 289 ? -8.149  24.289  16.000 1.00 9.12  ? 398  VAL A C   1 
ATOM   2218 O  O   . VAL A 1 289 ? -8.177  25.012  16.999 1.00 11.45 ? 398  VAL A O   1 
ATOM   2219 C  CB  . VAL A 1 289 ? -6.665  22.267  15.828 1.00 9.56  ? 398  VAL A CB  1 
ATOM   2220 C  CG1 . VAL A 1 289 ? -5.616  23.137  16.500 1.00 13.21 ? 398  VAL A CG1 1 
ATOM   2221 C  CG2 . VAL A 1 289 ? -6.511  20.825  16.270 1.00 11.92 ? 398  VAL A CG2 1 
ATOM   2222 N  N   . GLN A 1 290 ? -8.193  24.776  14.767 1.00 11.40 ? 399  GLN A N   1 
ATOM   2223 C  CA  . GLN A 1 290 ? -8.152  26.227  14.514 1.00 9.66  ? 399  GLN A CA  1 
ATOM   2224 C  C   . GLN A 1 290 ? -9.409  26.989  14.916 1.00 13.14 ? 399  GLN A C   1 
ATOM   2225 O  O   . GLN A 1 290 ? -9.318  28.148  15.339 1.00 14.68 ? 399  GLN A O   1 
ATOM   2226 C  CB  . GLN A 1 290 ? -7.834  26.511  13.048 1.00 15.56 ? 399  GLN A CB  1 
ATOM   2227 C  CG  . GLN A 1 290 ? -6.405  26.099  12.666 1.00 14.15 ? 399  GLN A CG  1 
ATOM   2228 C  CD  . GLN A 1 290 ? -5.845  26.895  11.517 1.00 15.59 ? 399  GLN A CD  1 
ATOM   2229 O  OE1 . GLN A 1 290 ? -6.418  27.901  11.105 1.00 12.28 ? 399  GLN A OE1 1 
ATOM   2230 N  NE2 . GLN A 1 290 ? -4.719  26.455  10.998 1.00 14.13 ? 399  GLN A NE2 1 
ATOM   2231 N  N   . THR A 1 291 ? -10.575 26.358  14.846 1.00 10.12 ? 400  THR A N   1 
ATOM   2232 C  CA  . THR A 1 291 ? -11.815 27.135  14.936 1.00 11.37 ? 400  THR A CA  1 
ATOM   2233 C  C   . THR A 1 291 ? -12.605 26.909  16.204 1.00 11.47 ? 400  THR A C   1 
ATOM   2234 O  O   . THR A 1 291 ? -13.568 27.631  16.465 1.00 11.15 ? 400  THR A O   1 
ATOM   2235 C  CB  . THR A 1 291 ? -12.787 26.844  13.778 1.00 11.90 ? 400  THR A CB  1 
ATOM   2236 O  OG1 . THR A 1 291 ? -13.202 25.473  13.836 1.00 12.62 ? 400  THR A OG1 1 
ATOM   2237 C  CG2 . THR A 1 291 ? -12.149 27.154  12.432 1.00 13.72 ? 400  THR A CG2 1 
ATOM   2238 N  N   . SER A 1 292 ? -12.225 25.927  17.005 1.00 10.72 ? 401  SER A N   1 
ATOM   2239 C  CA  . SER A 1 292 ? -12.987 25.670  18.224 1.00 10.22 ? 401  SER A CA  1 
ATOM   2240 C  C   . SER A 1 292 ? -12.803 26.770  19.269 1.00 13.64 ? 401  SER A C   1 
ATOM   2241 O  O   . SER A 1 292 ? -11.739 27.379  19.365 1.00 14.05 ? 401  SER A O   1 
ATOM   2242 C  CB  . SER A 1 292 ? -12.623 24.305  18.762 1.00 8.61  ? 401  SER A CB  1 
ATOM   2243 O  OG  . SER A 1 292 ? -12.994 23.340  17.810 1.00 9.31  ? 401  SER A OG  1 
ATOM   2244 N  N   . LYS A 1 293 ? -13.849 27.004  20.047 1.00 11.86 ? 402  LYS A N   1 
ATOM   2245 C  CA  . LYS A 1 293 ? -13.926 28.156  20.947 1.00 15.03 ? 402  LYS A CA  1 
ATOM   2246 C  C   . LYS A 1 293 ? -13.911 27.811  22.451 1.00 13.59 ? 402  LYS A C   1 
ATOM   2247 O  O   . LYS A 1 293 ? -14.864 27.222  22.972 1.00 10.95 ? 402  LYS A O   1 
ATOM   2248 C  CB  . LYS A 1 293 ? -15.208 28.928  20.643 1.00 13.41 ? 402  LYS A CB  1 
ATOM   2249 C  CG  . LYS A 1 293 ? -15.283 29.417  19.216 1.00 15.41 ? 402  LYS A CG  1 
ATOM   2250 C  CD  . LYS A 1 293 ? -14.043 30.213  18.830 1.00 15.31 ? 402  LYS A CD  1 
ATOM   2251 C  CE  . LYS A 1 293 ? -14.304 31.076  17.564 1.00 18.95 ? 402  LYS A CE  1 
ATOM   2252 N  NZ  . LYS A 1 293 ? -14.601 30.275  16.317 1.00 14.57 ? 402  LYS A NZ  1 
ATOM   2253 N  N   . PRO A 1 294 ? -12.851 28.223  23.162 1.00 11.54 ? 403  PRO A N   1 
ATOM   2254 C  CA  . PRO A 1 294 ? -12.848 28.077  24.619 1.00 12.21 ? 403  PRO A CA  1 
ATOM   2255 C  C   . PRO A 1 294 ? -13.826 29.003  25.322 1.00 17.67 ? 403  PRO A C   1 
ATOM   2256 O  O   . PRO A 1 294 ? -14.253 28.680  26.422 1.00 17.53 ? 403  PRO A O   1 
ATOM   2257 C  CB  . PRO A 1 294 ? -11.428 28.494  25.015 1.00 14.74 ? 403  PRO A CB  1 
ATOM   2258 C  CG  . PRO A 1 294 ? -10.630 28.302  23.792 1.00 14.39 ? 403  PRO A CG  1 
ATOM   2259 C  CD  . PRO A 1 294 ? -11.538 28.653  22.658 1.00 14.08 ? 403  PRO A CD  1 
ATOM   2260 N  N   . ALA A 1 295 ? -14.197 30.108  24.666 1.00 15.10 ? 404  ALA A N   1 
ATOM   2261 C  CA  . ALA A 1 295 ? -14.783 31.272  25.341 1.00 24.03 ? 404  ALA A CA  1 
ATOM   2262 C  C   . ALA A 1 295 ? -15.743 30.970  26.473 1.00 22.98 ? 404  ALA A C   1 
ATOM   2263 O  O   . ALA A 1 295 ? -15.515 31.398  27.595 1.00 32.62 ? 404  ALA A O   1 
ATOM   2264 C  CB  . ALA A 1 295 ? -15.462 32.181  24.349 1.00 24.22 ? 404  ALA A CB  1 
ATOM   2265 N  N   . HIS A 1 296 ? -16.829 30.266  26.198 1.00 20.12 ? 405  HIS A N   1 
ATOM   2266 C  CA  . HIS A 1 296 ? -17.864 30.152  27.237 1.00 30.07 ? 405  HIS A CA  1 
ATOM   2267 C  C   . HIS A 1 296 ? -17.710 28.908  28.127 1.00 26.21 ? 405  HIS A C   1 
ATOM   2268 O  O   . HIS A 1 296 ? -18.691 28.455  28.743 1.00 23.43 ? 405  HIS A O   1 
ATOM   2269 C  CB  . HIS A 1 296 ? -19.253 30.132  26.586 1.00 27.20 ? 405  HIS A CB  1 
ATOM   2270 N  N   . LEU A 1 297 ? -16.512 28.330  28.167 1.00 19.25 ? 406  LEU A N   1 
ATOM   2271 C  CA  . LEU A 1 297 ? -16.357 27.035  28.818 1.00 18.55 ? 406  LEU A CA  1 
ATOM   2272 C  C   . LEU A 1 297 ? -15.500 27.123  30.049 1.00 17.17 ? 406  LEU A C   1 
ATOM   2273 O  O   . LEU A 1 297 ? -14.370 27.545  30.000 1.00 19.18 ? 406  LEU A O   1 
ATOM   2274 C  CB  . LEU A 1 297 ? -15.796 25.993  27.866 1.00 13.69 ? 406  LEU A CB  1 
ATOM   2275 C  CG  . LEU A 1 297 ? -16.670 25.648  26.665 1.00 16.24 ? 406  LEU A CG  1 
ATOM   2276 C  CD1 . LEU A 1 297 ? -16.023 24.552  25.894 1.00 17.85 ? 406  LEU A CD1 1 
ATOM   2277 C  CD2 . LEU A 1 297 ? -18.037 25.222  27.091 1.00 18.99 ? 406  LEU A CD2 1 
ATOM   2278 N  N   . ASN A 1 298 ? -16.050 26.682  31.169 1.00 13.87 ? 407  ASN A N   1 
ATOM   2279 C  CA  . ASN A 1 298 ? -15.340 26.730  32.426 1.00 16.92 ? 407  ASN A CA  1 
ATOM   2280 C  C   . ASN A 1 298 ? -14.520 25.475  32.713 1.00 13.87 ? 407  ASN A C   1 
ATOM   2281 O  O   . ASN A 1 298 ? -15.045 24.366  32.737 1.00 14.17 ? 407  ASN A O   1 
ATOM   2282 C  CB  . ASN A 1 298 ? -16.348 26.989  33.544 1.00 13.82 ? 407  ASN A CB  1 
ATOM   2283 C  CG  . ASN A 1 298 ? -17.177 28.236  33.272 1.00 23.33 ? 407  ASN A CG  1 
ATOM   2284 O  OD1 . ASN A 1 298 ? -16.629 29.304  32.975 1.00 26.10 ? 407  ASN A OD1 1 
ATOM   2285 N  ND2 . ASN A 1 298 ? -18.500 28.096  33.314 1.00 18.82 ? 407  ASN A ND2 1 
ATOM   2286 N  N   . ALA A 1 299 ? -13.227 25.664  32.925 1.00 12.46 ? 408  ALA A N   1 
ATOM   2287 C  CA  . ALA A 1 299 ? -12.351 24.569  33.336 1.00 14.19 ? 408  ALA A CA  1 
ATOM   2288 C  C   . ALA A 1 299 ? -11.239 25.142  34.169 1.00 16.62 ? 408  ALA A C   1 
ATOM   2289 O  O   . ALA A 1 299 ? -10.891 26.304  34.017 1.00 17.96 ? 408  ALA A O   1 
ATOM   2290 C  CB  . ALA A 1 299 ? -11.774 23.861  32.123 1.00 13.49 ? 408  ALA A CB  1 
ATOM   2291 N  N   . ASN A 1 300 ? -10.642 24.313  35.009 1.00 18.45 ? 409  ASN A N   1 
ATOM   2292 C  CA  A ASN A 1 300 ? -9.523  24.743  35.838 0.64 20.06 ? 409  ASN A CA  1 
ATOM   2293 C  CA  B ASN A 1 300 ? -9.532  24.738  35.847 0.36 20.03 ? 409  ASN A CA  1 
ATOM   2294 C  C   . ASN A 1 300 ? -8.172  24.433  35.234 1.00 18.35 ? 409  ASN A C   1 
ATOM   2295 O  O   . ASN A 1 300 ? -7.152  24.637  35.882 1.00 18.30 ? 409  ASN A O   1 
ATOM   2296 C  CB  A ASN A 1 300 ? -9.589  24.072  37.207 0.64 22.90 ? 409  ASN A CB  1 
ATOM   2297 C  CB  B ASN A 1 300 ? -9.616  24.062  37.219 0.36 22.83 ? 409  ASN A CB  1 
ATOM   2298 C  CG  A ASN A 1 300 ? -10.765 24.541  38.013 0.64 23.50 ? 409  ASN A CG  1 
ATOM   2299 C  CG  B ASN A 1 300 ? -9.858  22.568  37.119 0.36 22.69 ? 409  ASN A CG  1 
ATOM   2300 O  OD1 A ASN A 1 300 ? -10.960 25.747  38.196 0.64 21.75 ? 409  ASN A OD1 1 
ATOM   2301 O  OD1 B ASN A 1 300 ? -10.979 22.092  37.362 0.36 27.02 ? 409  ASN A OD1 1 
ATOM   2302 N  ND2 A ASN A 1 300 ? -11.591 23.592  38.464 0.64 27.04 ? 409  ASN A ND2 1 
ATOM   2303 N  ND2 B ASN A 1 300 ? -8.815  21.817  36.757 0.36 19.50 ? 409  ASN A ND2 1 
ATOM   2304 N  N   . ASP A 1 301 ? -8.154  23.930  34.001 1.00 13.76 ? 410  ASP A N   1 
ATOM   2305 C  CA  . ASP A 1 301 ? -6.883  23.542  33.406 1.00 12.82 ? 410  ASP A CA  1 
ATOM   2306 C  C   . ASP A 1 301 ? -6.625  24.154  32.035 1.00 13.31 ? 410  ASP A C   1 
ATOM   2307 O  O   . ASP A 1 301 ? -5.805  23.640  31.275 1.00 16.00 ? 410  ASP A O   1 
ATOM   2308 C  CB  . ASP A 1 301 ? -6.805  22.026  33.295 1.00 15.57 ? 410  ASP A CB  1 
ATOM   2309 C  CG  . ASP A 1 301 ? -7.623  21.484  32.133 1.00 12.42 ? 410  ASP A CG  1 
ATOM   2310 O  OD1 . ASP A 1 301 ? -8.646  22.103  31.789 1.00 12.13 ? 410  ASP A OD1 1 
ATOM   2311 O  OD2 . ASP A 1 301 ? -7.241  20.442  31.549 1.00 13.78 ? 410  ASP A OD2 1 
ATOM   2312 N  N   . TRP A 1 302 ? -7.275  25.260  31.717 1.00 12.49 ? 411  TRP A N   1 
ATOM   2313 C  CA  . TRP A 1 302 ? -6.978  25.925  30.459 1.00 10.78 ? 411  TRP A CA  1 
ATOM   2314 C  C   . TRP A 1 302 ? -5.533  26.359  30.495 1.00 12.88 ? 411  TRP A C   1 
ATOM   2315 O  O   . TRP A 1 302 ? -5.055  26.914  31.487 1.00 11.30 ? 411  TRP A O   1 
ATOM   2316 C  CB  . TRP A 1 302 ? -7.877  27.143  30.229 1.00 14.45 ? 411  TRP A CB  1 
ATOM   2317 C  CG  . TRP A 1 302 ? -9.297  26.839  29.776 1.00 10.78 ? 411  TRP A CG  1 
ATOM   2318 C  CD1 . TRP A 1 302 ? -10.441 27.051  30.476 1.00 14.83 ? 411  TRP A CD1 1 
ATOM   2319 C  CD2 . TRP A 1 302 ? -9.694  26.290  28.523 1.00 10.17 ? 411  TRP A CD2 1 
ATOM   2320 N  NE1 . TRP A 1 302 ? -11.532 26.653  29.736 1.00 10.24 ? 411  TRP A NE1 1 
ATOM   2321 C  CE2 . TRP A 1 302 ? -11.095 26.176  28.536 1.00 10.52 ? 411  TRP A CE2 1 
ATOM   2322 C  CE3 . TRP A 1 302 ? -8.998  25.877  27.379 1.00 11.79 ? 411  TRP A CE3 1 
ATOM   2323 C  CZ2 . TRP A 1 302 ? -11.815 25.671  27.455 1.00 10.30 ? 411  TRP A CZ2 1 
ATOM   2324 C  CZ3 . TRP A 1 302 ? -9.724  25.379  26.305 1.00 13.13 ? 411  TRP A CZ3 1 
ATOM   2325 C  CH2 . TRP A 1 302 ? -11.106 25.267  26.361 1.00 13.59 ? 411  TRP A CH2 1 
ATOM   2326 N  N   . ALA A 1 303 ? -4.842  26.141  29.396 1.00 12.60 ? 412  ALA A N   1 
ATOM   2327 C  CA  . ALA A 1 303 ? -3.448  26.553  29.269 1.00 12.45 ? 412  ALA A CA  1 
ATOM   2328 C  C   . ALA A 1 303 ? -3.175  26.907  27.819 1.00 12.18 ? 412  ALA A C   1 
ATOM   2329 O  O   . ALA A 1 303 ? -3.751  26.322  26.908 1.00 14.98 ? 412  ALA A O   1 
ATOM   2330 C  CB  . ALA A 1 303 ? -2.495  25.454  29.761 1.00 13.50 ? 412  ALA A CB  1 
ATOM   2331 N  N   . THR A 1 304 ? -2.276  27.858  27.603 1.00 12.75 ? 413  THR A N   1 
ATOM   2332 C  CA  . THR A 1 304 ? -1.971  28.325  26.266 1.00 13.27 ? 413  THR A CA  1 
ATOM   2333 C  C   . THR A 1 304 ? -0.726  27.644  25.744 1.00 13.94 ? 413  THR A C   1 
ATOM   2334 O  O   . THR A 1 304 ? 0.310   27.656  26.402 1.00 11.39 ? 413  THR A O   1 
ATOM   2335 C  CB  . THR A 1 304 ? -1.780  29.846  26.248 1.00 15.64 ? 413  THR A CB  1 
ATOM   2336 O  OG1 . THR A 1 304 ? -2.977  30.460  26.727 1.00 15.28 ? 413  THR A OG1 1 
ATOM   2337 C  CG2 . THR A 1 304 ? -1.493  30.353  24.820 1.00 13.22 ? 413  THR A CG2 1 
ATOM   2338 N  N   . ASN A 1 305 ? -0.845  27.029  24.576 1.00 11.87 ? 414  ASN A N   1 
ATOM   2339 C  CA  . ASN A 1 305 ? 0.244   26.217  24.054 1.00 13.49 ? 414  ASN A CA  1 
ATOM   2340 C  C   . ASN A 1 305 ? 1.289   27.053  23.324 1.00 15.57 ? 414  ASN A C   1 
ATOM   2341 O  O   . ASN A 1 305 ? 1.232   28.295  23.356 1.00 13.94 ? 414  ASN A O   1 
ATOM   2342 C  CB  . ASN A 1 305 ? -0.300  25.059  23.185 1.00 11.18 ? 414  ASN A CB  1 
ATOM   2343 C  CG  . ASN A 1 305 ? -0.904  25.513  21.848 1.00 11.93 ? 414  ASN A CG  1 
ATOM   2344 O  OD1 . ASN A 1 305 ? -0.731  26.637  21.397 1.00 11.84 ? 414  ASN A OD1 1 
ATOM   2345 N  ND2 . ASN A 1 305 ? -1.583  24.575  21.183 1.00 11.55 ? 414  ASN A ND2 1 
ATOM   2346 N  N   . GLY A 1 306 ? 2.251   26.393  22.683 1.00 12.31 ? 415  GLY A N   1 
ATOM   2347 C  CA  . GLY A 1 306 ? 3.362   27.116  22.075 1.00 13.25 ? 415  GLY A CA  1 
ATOM   2348 C  C   . GLY A 1 306 ? 2.992   27.993  20.879 1.00 12.27 ? 415  GLY A C   1 
ATOM   2349 O  O   . GLY A 1 306 ? 3.769   28.857  20.446 1.00 13.73 ? 415  GLY A O   1 
ATOM   2350 N  N   . VAL A 1 307 ? 1.806   27.789  20.327 1.00 11.45 ? 416  VAL A N   1 
ATOM   2351 C  CA  . VAL A 1 307 ? 1.399   28.589  19.174 1.00 12.90 ? 416  VAL A CA  1 
ATOM   2352 C  C   . VAL A 1 307 ? 0.260   29.538  19.579 1.00 14.92 ? 416  VAL A C   1 
ATOM   2353 O  O   . VAL A 1 307 ? -0.386  30.119  18.731 1.00 15.64 ? 416  VAL A O   1 
ATOM   2354 C  CB  . VAL A 1 307 ? 1.008   27.725  17.950 1.00 10.52 ? 416  VAL A CB  1 
ATOM   2355 C  CG1 . VAL A 1 307 ? 2.213   26.951  17.454 1.00 14.72 ? 416  VAL A CG1 1 
ATOM   2356 C  CG2 . VAL A 1 307 ? -0.124  26.778  18.287 1.00 15.62 ? 416  VAL A CG2 1 
ATOM   2357 N  N   . GLY A 1 308 ? 0.022   29.682  20.881 1.00 11.92 ? 417  GLY A N   1 
ATOM   2358 C  CA  . GLY A 1 308 ? -0.953  30.658  21.355 1.00 14.20 ? 417  GLY A CA  1 
ATOM   2359 C  C   . GLY A 1 308 ? -2.414  30.217  21.386 1.00 13.99 ? 417  GLY A C   1 
ATOM   2360 O  O   . GLY A 1 308 ? -3.310  31.058  21.483 1.00 13.19 ? 417  GLY A O   1 
ATOM   2361 N  N   . ARG A 1 309 ? -2.680  28.918  21.305 1.00 12.14 ? 418  ARG A N   1 
ATOM   2362 C  CA  . ARG A 1 309 ? -4.068  28.446  21.405 1.00 11.06 ? 418  ARG A CA  1 
ATOM   2363 C  C   . ARG A 1 309 ? -4.344  27.928  22.803 1.00 14.30 ? 418  ARG A C   1 
ATOM   2364 O  O   . ARG A 1 309 ? -3.492  27.246  23.397 1.00 11.53 ? 418  ARG A O   1 
ATOM   2365 C  CB  . ARG A 1 309 ? -4.328  27.336  20.395 1.00 14.40 ? 418  ARG A CB  1 
ATOM   2366 C  CG  . ARG A 1 309 ? -4.158  27.733  18.952 1.00 15.94 ? 418  ARG A CG  1 
ATOM   2367 C  CD  . ARG A 1 309 ? -4.743  26.688  18.014 1.00 14.34 ? 418  ARG A CD  1 
ATOM   2368 N  NE  . ARG A 1 309 ? -4.637  27.137  16.637 1.00 12.84 ? 418  ARG A NE  1 
ATOM   2369 C  CZ  . ARG A 1 309 ? -3.763  26.672  15.746 1.00 14.64 ? 418  ARG A CZ  1 
ATOM   2370 N  NH1 . ARG A 1 309 ? -3.761  27.153  14.514 1.00 17.22 ? 418  ARG A NH1 1 
ATOM   2371 N  NH2 . ARG A 1 309 ? -2.905  25.722  16.064 1.00 12.67 ? 418  ARG A NH2 1 
ATOM   2372 N  N   . LYS A 1 310 ? -5.532  28.230  23.327 1.00 12.40 ? 419  LYS A N   1 
ATOM   2373 C  CA  . LYS A 1 310 ? -5.934  27.743  24.649 1.00 11.43 ? 419  LYS A CA  1 
ATOM   2374 C  C   . LYS A 1 310 ? -6.449  26.312  24.503 1.00 12.15 ? 419  LYS A C   1 
ATOM   2375 O  O   . LYS A 1 310 ? -7.181  25.996  23.575 1.00 12.85 ? 419  LYS A O   1 
ATOM   2376 C  CB  . LYS A 1 310 ? -7.046  28.608  25.265 1.00 13.65 ? 419  LYS A CB  1 
ATOM   2377 C  CG  . LYS A 1 310 ? -6.685  30.055  25.499 1.00 21.28 ? 419  LYS A CG  1 
ATOM   2378 C  CD  . LYS A 1 310 ? -7.879  30.879  26.019 1.00 23.31 ? 419  LYS A CD  1 
ATOM   2379 C  CE  . LYS A 1 310 ? -8.617  30.209  27.187 1.00 18.30 ? 419  LYS A CE  1 
ATOM   2380 N  NZ  . LYS A 1 310 ? -9.586  31.153  27.938 1.00 24.45 ? 419  LYS A NZ  1 
ATOM   2381 N  N   . VAL A 1 311 ? -6.028  25.457  25.417 1.00 9.63  ? 420  VAL A N   1 
ATOM   2382 C  CA  . VAL A 1 311 ? -6.336  24.043  25.336 1.00 10.41 ? 420  VAL A CA  1 
ATOM   2383 C  C   . VAL A 1 311 ? -6.564  23.486  26.730 1.00 10.00 ? 420  VAL A C   1 
ATOM   2384 O  O   . VAL A 1 311 ? -5.927  23.916  27.693 1.00 11.71 ? 420  VAL A O   1 
ATOM   2385 C  CB  . VAL A 1 311 ? -5.272  23.251  24.517 1.00 11.79 ? 420  VAL A CB  1 
ATOM   2386 C  CG1 . VAL A 1 311 ? -3.970  23.123  25.250 1.00 18.30 ? 420  VAL A CG1 1 
ATOM   2387 C  CG2 . VAL A 1 311 ? -5.810  21.907  24.136 1.00 11.61 ? 420  VAL A CG2 1 
ATOM   2388 N  N   . SER A 1 312 ? -7.540  22.580  26.825 1.00 10.71 ? 421  SER A N   1 
ATOM   2389 C  CA  . SER A 1 312 ? -7.916  21.958  28.077 1.00 9.32  ? 421  SER A CA  1 
ATOM   2390 C  C   . SER A 1 312 ? -7.971  20.448  27.881 1.00 10.71 ? 421  SER A C   1 
ATOM   2391 O  O   . SER A 1 312 ? -8.221  19.973  26.786 1.00 10.45 ? 421  SER A O   1 
ATOM   2392 C  CB  . SER A 1 312 ? -9.275  22.455  28.542 1.00 11.62 ? 421  SER A CB  1 
ATOM   2393 O  OG  . SER A 1 312 ? -9.818  21.644  29.573 1.00 12.64 ? 421  SER A OG  1 
ATOM   2394 N  N   . HIS A 1 313 ? -7.712  19.695  28.940 1.00 9.54  ? 422  HIS A N   1 
ATOM   2395 C  CA  . HIS A 1 313 ? -7.857  18.242  28.853 1.00 9.26  ? 422  HIS A CA  1 
ATOM   2396 C  C   . HIS A 1 313 ? -9.326  17.795  28.911 1.00 7.86  ? 422  HIS A C   1 
ATOM   2397 O  O   . HIS A 1 313 ? -9.650  16.678  28.498 1.00 8.94  ? 422  HIS A O   1 
ATOM   2398 C  CB  . HIS A 1 313 ? -7.016  17.552  29.941 1.00 11.17 ? 422  HIS A CB  1 
ATOM   2399 C  CG  . HIS A 1 313 ? -5.547  17.765  29.764 1.00 10.18 ? 422  HIS A CG  1 
ATOM   2400 N  ND1 . HIS A 1 313 ? -4.902  18.914  30.182 1.00 14.26 ? 422  HIS A ND1 1 
ATOM   2401 C  CD2 . HIS A 1 313 ? -4.606  16.995  29.178 1.00 9.14  ? 422  HIS A CD2 1 
ATOM   2402 C  CE1 . HIS A 1 313 ? -3.620  18.837  29.861 1.00 10.97 ? 422  HIS A CE1 1 
ATOM   2403 N  NE2 . HIS A 1 313 ? -3.414  17.679  29.252 1.00 8.88  ? 422  HIS A NE2 1 
ATOM   2404 N  N   . SER A 1 314 ? -10.203 18.631  29.471 1.00 8.71  ? 423  SER A N   1 
ATOM   2405 C  CA  . SER A 1 314 ? -11.626 18.301  29.483 1.00 9.71  ? 423  SER A CA  1 
ATOM   2406 C  C   . SER A 1 314 ? -12.266 18.651  28.155 1.00 10.47 ? 423  SER A C   1 
ATOM   2407 O  O   . SER A 1 314 ? -13.224 18.001  27.737 1.00 9.21  ? 423  SER A O   1 
ATOM   2408 C  CB  . SER A 1 314 ? -12.387 19.074  30.568 1.00 8.95  ? 423  SER A CB  1 
ATOM   2409 O  OG  . SER A 1 314 ? -11.982 18.649  31.844 1.00 8.64  ? 423  SER A OG  1 
ATOM   2410 N  N   . TYR A 1 315 ? -11.771 19.705  27.508 1.00 11.56 ? 424  TYR A N   1 
ATOM   2411 C  CA  . TYR A 1 315 ? -12.496 20.261  26.365 1.00 10.87 ? 424  TYR A CA  1 
ATOM   2412 C  C   . TYR A 1 315 ? -11.731 20.253  25.039 1.00 10.65 ? 424  TYR A C   1 
ATOM   2413 O  O   . TYR A 1 315 ? -12.277 20.662  24.005 1.00 11.40 ? 424  TYR A O   1 
ATOM   2414 C  CB  . TYR A 1 315 ? -12.879 21.704  26.646 1.00 9.85  ? 424  TYR A CB  1 
ATOM   2415 C  CG  . TYR A 1 315 ? -13.814 21.997  27.797 1.00 9.04  ? 424  TYR A CG  1 
ATOM   2416 C  CD1 . TYR A 1 315 ? -15.048 21.357  27.923 1.00 12.03 ? 424  TYR A CD1 1 
ATOM   2417 C  CD2 . TYR A 1 315 ? -13.479 22.965  28.748 1.00 11.55 ? 424  TYR A CD2 1 
ATOM   2418 C  CE1 . TYR A 1 315 ? -15.941 21.690  28.951 1.00 10.35 ? 424  TYR A CE1 1 
ATOM   2419 C  CE2 . TYR A 1 315 ? -14.367 23.305  29.786 1.00 11.12 ? 424  TYR A CE2 1 
ATOM   2420 C  CZ  . TYR A 1 315 ? -15.590 22.653  29.876 1.00 13.80 ? 424  TYR A CZ  1 
ATOM   2421 O  OH  . TYR A 1 315 ? -16.448 22.970  30.883 1.00 13.57 ? 424  TYR A OH  1 
ATOM   2422 N  N   . GLY A 1 316 ? -10.464 19.843  25.061 1.00 9.21  ? 425  GLY A N   1 
ATOM   2423 C  CA  . GLY A 1 316 ? -9.599  20.054  23.914 1.00 10.55 ? 425  GLY A CA  1 
ATOM   2424 C  C   . GLY A 1 316 ? -9.454  21.544  23.603 1.00 11.46 ? 425  GLY A C   1 
ATOM   2425 O  O   . GLY A 1 316 ? -9.161  22.370  24.494 1.00 8.58  ? 425  GLY A O   1 
ATOM   2426 N  N   . TYR A 1 317 ? -9.666  21.887  22.336 1.00 8.41  ? 426  TYR A N   1 
ATOM   2427 C  CA  . TYR A 1 317 ? -9.540  23.261  21.865 1.00 7.52  ? 426  TYR A CA  1 
ATOM   2428 C  C   . TYR A 1 317 ? -10.829 24.060  22.085 1.00 10.86 ? 426  TYR A C   1 
ATOM   2429 O  O   . TYR A 1 317 ? -10.896 25.245  21.754 1.00 12.28 ? 426  TYR A O   1 
ATOM   2430 C  CB  . TYR A 1 317 ? -9.099  23.275  20.387 1.00 11.64 ? 426  TYR A CB  1 
ATOM   2431 C  CG  . TYR A 1 317 ? -7.647  22.889  20.308 1.00 10.07 ? 426  TYR A CG  1 
ATOM   2432 C  CD1 . TYR A 1 317 ? -6.668  23.834  20.494 1.00 8.69  ? 426  TYR A CD1 1 
ATOM   2433 C  CD2 . TYR A 1 317 ? -7.262  21.570  20.132 1.00 9.17  ? 426  TYR A CD2 1 
ATOM   2434 C  CE1 . TYR A 1 317 ? -5.304  23.502  20.477 1.00 11.13 ? 426  TYR A CE1 1 
ATOM   2435 C  CE2 . TYR A 1 317 ? -5.911  21.217  20.117 1.00 10.00 ? 426  TYR A CE2 1 
ATOM   2436 C  CZ  . TYR A 1 317 ? -4.934  22.185  20.296 1.00 10.22 ? 426  TYR A CZ  1 
ATOM   2437 O  OH  . TYR A 1 317 ? -3.588  21.870  20.295 1.00 8.76  ? 426  TYR A OH  1 
ATOM   2438 N  N   . GLY A 1 318 ? -11.836 23.431  22.685 1.00 9.69  ? 427  GLY A N   1 
ATOM   2439 C  CA  . GLY A 1 318 ? -13.049 24.145  23.035 1.00 7.77  ? 427  GLY A CA  1 
ATOM   2440 C  C   . GLY A 1 318 ? -14.263 23.679  22.269 1.00 11.50 ? 427  GLY A C   1 
ATOM   2441 O  O   . GLY A 1 318 ? -14.310 22.578  21.694 1.00 10.64 ? 427  GLY A O   1 
ATOM   2442 N  N   . LEU A 1 319 ? -15.274 24.519  22.265 1.00 9.13  ? 428  LEU A N   1 
ATOM   2443 C  CA  . LEU A 1 319 ? -16.531 24.161  21.640 1.00 10.06 ? 428  LEU A CA  1 
ATOM   2444 C  C   . LEU A 1 319 ? -16.468 24.218  20.117 1.00 11.67 ? 428  LEU A C   1 
ATOM   2445 O  O   . LEU A 1 319 ? -15.934 25.183  19.545 1.00 12.16 ? 428  LEU A O   1 
ATOM   2446 C  CB  . LEU A 1 319 ? -17.598 25.129  22.126 1.00 14.92 ? 428  LEU A CB  1 
ATOM   2447 C  CG  . LEU A 1 319 ? -19.011 24.636  21.979 1.00 14.20 ? 428  LEU A CG  1 
ATOM   2448 C  CD1 . LEU A 1 319 ? -19.280 23.579  23.055 1.00 15.73 ? 428  LEU A CD1 1 
ATOM   2449 C  CD2 . LEU A 1 319 ? -19.981 25.811  22.087 1.00 19.48 ? 428  LEU A CD2 1 
ATOM   2450 N  N   . LEU A 1 320 ? -17.038 23.217  19.444 1.00 10.81 ? 429  LEU A N   1 
ATOM   2451 C  CA  . LEU A 1 320 ? -17.152 23.291  17.981 1.00 11.86 ? 429  LEU A CA  1 
ATOM   2452 C  C   . LEU A 1 320 ? -18.050 24.476  17.622 1.00 13.81 ? 429  LEU A C   1 
ATOM   2453 O  O   . LEU A 1 320 ? -18.988 24.804  18.351 1.00 14.85 ? 429  LEU A O   1 
ATOM   2454 C  CB  . LEU A 1 320 ? -17.737 21.994  17.392 1.00 11.79 ? 429  LEU A CB  1 
ATOM   2455 C  CG  . LEU A 1 320 ? -16.894 20.714  17.399 1.00 7.92  ? 429  LEU A CG  1 
ATOM   2456 C  CD1 . LEU A 1 320 ? -17.641 19.621  16.644 1.00 11.06 ? 429  LEU A CD1 1 
ATOM   2457 C  CD2 . LEU A 1 320 ? -15.513 20.921  16.802 1.00 10.61 ? 429  LEU A CD2 1 
ATOM   2458 N  N   . ASP A 1 321 ? -17.737 25.099  16.493 1.00 13.04 ? 430  ASP A N   1 
ATOM   2459 C  CA  . ASP A 1 321 ? -18.351 26.332  16.009 1.00 11.17 ? 430  ASP A CA  1 
ATOM   2460 C  C   . ASP A 1 321 ? -18.579 26.098  14.507 1.00 12.62 ? 430  ASP A C   1 
ATOM   2461 O  O   . ASP A 1 321 ? -17.662 26.199  13.693 1.00 12.84 ? 430  ASP A O   1 
ATOM   2462 C  CB  . ASP A 1 321 ? -17.377 27.503  16.259 1.00 14.35 ? 430  ASP A CB  1 
ATOM   2463 C  CG  . ASP A 1 321 ? -17.855 28.830  15.668 1.00 16.41 ? 430  ASP A CG  1 
ATOM   2464 O  OD1 . ASP A 1 321 ? -18.745 28.796  14.795 1.00 15.22 ? 430  ASP A OD1 1 
ATOM   2465 O  OD2 . ASP A 1 321 ? -17.328 29.899  16.077 1.00 13.26 ? 430  ASP A OD2 1 
ATOM   2466 N  N   . ALA A 1 322 ? -19.800 25.749  14.151 1.00 11.13 ? 431  ALA A N   1 
ATOM   2467 C  CA  . ALA A 1 322 ? -20.108 25.297  12.808 1.00 15.09 ? 431  ALA A CA  1 
ATOM   2468 C  C   . ALA A 1 322 ? -19.890 26.409  11.786 1.00 14.11 ? 431  ALA A C   1 
ATOM   2469 O  O   . ALA A 1 322 ? -19.377 26.175  10.688 1.00 13.56 ? 431  ALA A O   1 
ATOM   2470 C  CB  . ALA A 1 322 ? -21.548 24.801  12.762 1.00 13.43 ? 431  ALA A CB  1 
ATOM   2471 N  N   . GLY A 1 323 ? -20.285 27.622  12.155 1.00 14.40 ? 432  GLY A N   1 
ATOM   2472 C  CA  . GLY A 1 323 ? -20.101 28.766  11.286 1.00 16.43 ? 432  GLY A CA  1 
ATOM   2473 C  C   . GLY A 1 323 ? -18.647 28.984  10.930 1.00 15.74 ? 432  GLY A C   1 
ATOM   2474 O  O   . GLY A 1 323 ? -18.293 29.226  9.765  1.00 17.68 ? 432  GLY A O   1 
ATOM   2475 N  N   . ALA A 1 324 ? -17.795 28.915  11.946 1.00 14.31 ? 433  ALA A N   1 
ATOM   2476 C  CA  . ALA A 1 324 ? -16.365 29.078  11.750 1.00 13.86 ? 433  ALA A CA  1 
ATOM   2477 C  C   . ALA A 1 324 ? -15.759 27.910  10.980 1.00 15.30 ? 433  ALA A C   1 
ATOM   2478 O  O   . ALA A 1 324 ? -14.842 28.118  10.180 1.00 14.41 ? 433  ALA A O   1 
ATOM   2479 C  CB  . ALA A 1 324 ? -15.653 29.254  13.091 1.00 16.10 ? 433  ALA A CB  1 
ATOM   2480 N  N   . MET A 1 325 ? -16.244 26.692  11.225 1.00 12.90 ? 434  MET A N   1 
ATOM   2481 C  CA  . MET A 1 325 ? -15.747 25.524  10.511 1.00 12.28 ? 434  MET A CA  1 
ATOM   2482 C  C   . MET A 1 325 ? -16.004 25.651  9.016  1.00 16.30 ? 434  MET A C   1 
ATOM   2483 O  O   . MET A 1 325 ? -15.103 25.474  8.197  1.00 15.04 ? 434  MET A O   1 
ATOM   2484 C  CB  . MET A 1 325 ? -16.412 24.252  11.028 1.00 12.23 ? 434  MET A CB  1 
ATOM   2485 C  CG  . MET A 1 325 ? -15.866 23.791  12.376 1.00 11.25 ? 434  MET A CG  1 
ATOM   2486 S  SD  . MET A 1 325 ? -14.300 22.898  12.215 1.00 13.90 ? 434  MET A SD  1 
ATOM   2487 C  CE  . MET A 1 325 ? -14.885 21.334  11.556 1.00 13.06 ? 434  MET A CE  1 
ATOM   2488 N  N   . VAL A 1 326 ? -17.244 25.974  8.673  1.00 15.21 ? 435  VAL A N   1 
ATOM   2489 C  CA  . VAL A 1 326 ? -17.629 26.131  7.269  1.00 16.83 ? 435  VAL A CA  1 
ATOM   2490 C  C   . VAL A 1 326 ? -16.878 27.262  6.591  1.00 15.95 ? 435  VAL A C   1 
ATOM   2491 O  O   . VAL A 1 326 ? -16.462 27.147  5.428  1.00 18.83 ? 435  VAL A O   1 
ATOM   2492 C  CB  . VAL A 1 326 ? -19.141 26.367  7.158  1.00 17.56 ? 435  VAL A CB  1 
ATOM   2493 C  CG1 . VAL A 1 326 ? -19.496 26.904  5.782  1.00 31.21 ? 435  VAL A CG1 1 
ATOM   2494 C  CG2 . VAL A 1 326 ? -19.866 25.076  7.450  1.00 15.01 ? 435  VAL A CG2 1 
ATOM   2495 N  N   . ALA A 1 327 ? -16.680 28.352  7.320  1.00 18.27 ? 436  ALA A N   1 
ATOM   2496 C  CA  . ALA A 1 327 ? -15.991 29.498  6.781  1.00 18.76 ? 436  ALA A CA  1 
ATOM   2497 C  C   . ALA A 1 327 ? -14.535 29.150  6.473  1.00 20.32 ? 436  ALA A C   1 
ATOM   2498 O  O   . ALA A 1 327 ? -14.057 29.404  5.362  1.00 20.16 ? 436  ALA A O   1 
ATOM   2499 C  CB  . ALA A 1 327 ? -16.072 30.640  7.745  1.00 19.59 ? 436  ALA A CB  1 
ATOM   2500 N  N   . LEU A 1 328 ? -13.837 28.551  7.439  1.00 15.79 ? 437  LEU A N   1 
ATOM   2501 C  CA  . LEU A 1 328 ? -12.431 28.207  7.226  1.00 18.37 ? 437  LEU A CA  1 
ATOM   2502 C  C   . LEU A 1 328 ? -12.302 27.151  6.143  1.00 17.18 ? 437  LEU A C   1 
ATOM   2503 O  O   . LEU A 1 328 ? -11.378 27.222  5.321  1.00 16.65 ? 437  LEU A O   1 
ATOM   2504 C  CB  . LEU A 1 328 ? -11.750 27.757  8.514  1.00 17.89 ? 437  LEU A CB  1 
ATOM   2505 C  CG  . LEU A 1 328 ? -10.245 27.466  8.429  1.00 18.98 ? 437  LEU A CG  1 
ATOM   2506 C  CD1 . LEU A 1 328 ? -9.456  28.655  7.900  1.00 18.94 ? 437  LEU A CD1 1 
ATOM   2507 C  CD2 . LEU A 1 328 ? -9.735  27.058  9.804  1.00 13.44 ? 437  LEU A CD2 1 
ATOM   2508 N  N   . ALA A 1 329 ? -13.246 26.207  6.100  1.00 15.58 ? 438  ALA A N   1 
ATOM   2509 C  CA  . ALA A 1 329 ? -13.202 25.133  5.098  1.00 18.52 ? 438  ALA A CA  1 
ATOM   2510 C  C   . ALA A 1 329 ? -13.104 25.705  3.668  1.00 18.75 ? 438  ALA A C   1 
ATOM   2511 O  O   . ALA A 1 329 ? -12.395 25.164  2.814  1.00 16.63 ? 438  ALA A O   1 
ATOM   2512 C  CB  . ALA A 1 329 ? -14.424 24.235  5.223  1.00 17.13 ? 438  ALA A CB  1 
ATOM   2513 N  N   . GLN A 1 330 ? -13.817 26.799  3.427  1.00 17.94 ? 439  GLN A N   1 
ATOM   2514 C  CA  . GLN A 1 330 ? -13.912 27.379  2.087  1.00 18.23 ? 439  GLN A CA  1 
ATOM   2515 C  C   . GLN A 1 330 ? -12.613 28.050  1.656  1.00 25.82 ? 439  GLN A C   1 
ATOM   2516 O  O   . GLN A 1 330 ? -12.441 28.386  0.489  1.00 29.08 ? 439  GLN A O   1 
ATOM   2517 C  CB  . GLN A 1 330 ? -15.048 28.409  2.045  1.00 23.07 ? 439  GLN A CB  1 
ATOM   2518 C  CG  . GLN A 1 330 ? -16.438 27.795  2.141  1.00 26.21 ? 439  GLN A CG  1 
ATOM   2519 C  CD  . GLN A 1 330 ? -17.555 28.822  2.390  1.00 33.33 ? 439  GLN A CD  1 
ATOM   2520 O  OE1 . GLN A 1 330 ? -18.656 28.680  1.869  1.00 39.31 ? 439  GLN A OE1 1 
ATOM   2521 N  NE2 . GLN A 1 330 ? -17.281 29.833  3.211  1.00 32.84 ? 439  GLN A NE2 1 
ATOM   2522 N  N   . ASP A 1 331 ? -11.702 28.258  2.594  1.00 22.95 ? 440  ASP A N   1 
ATOM   2523 C  CA  . ASP A 1 331 ? -10.439 28.914  2.286  1.00 28.44 ? 440  ASP A CA  1 
ATOM   2524 C  C   . ASP A 1 331 ? -9.241  28.010  2.548  1.00 23.97 ? 440  ASP A C   1 
ATOM   2525 O  O   . ASP A 1 331 ? -8.103  28.457  2.519  1.00 26.35 ? 440  ASP A O   1 
ATOM   2526 C  CB  . ASP A 1 331 ? -10.307 30.167  3.131  1.00 25.14 ? 440  ASP A CB  1 
ATOM   2527 C  CG  . ASP A 1 331 ? -11.424 31.141  2.883  1.00 40.71 ? 440  ASP A CG  1 
ATOM   2528 O  OD1 . ASP A 1 331 ? -11.735 31.396  1.693  1.00 50.23 ? 440  ASP A OD1 1 
ATOM   2529 O  OD2 . ASP A 1 331 ? -12.002 31.640  3.874  1.00 44.93 ? 440  ASP A OD2 1 
ATOM   2530 N  N   . TRP A 1 332 ? -9.500  26.739  2.796  1.00 20.54 ? 441  TRP A N   1 
ATOM   2531 C  CA  . TRP A 1 332 ? -8.462  25.858  3.310  1.00 21.64 ? 441  TRP A CA  1 
ATOM   2532 C  C   . TRP A 1 332 ? -7.610  25.238  2.202  1.00 20.76 ? 441  TRP A C   1 
ATOM   2533 O  O   . TRP A 1 332 ? -8.139  24.728  1.220  1.00 21.48 ? 441  TRP A O   1 
ATOM   2534 C  CB  . TRP A 1 332 ? -9.098  24.749  4.142  1.00 16.25 ? 441  TRP A CB  1 
ATOM   2535 C  CG  . TRP A 1 332 ? -8.094  23.926  4.844  1.00 17.36 ? 441  TRP A CG  1 
ATOM   2536 C  CD1 . TRP A 1 332 ? -7.710  22.661  4.511  1.00 13.88 ? 441  TRP A CD1 1 
ATOM   2537 C  CD2 . TRP A 1 332 ? -7.331  24.288  6.006  1.00 14.66 ? 441  TRP A CD2 1 
ATOM   2538 N  NE1 . TRP A 1 332 ? -6.764  22.209  5.395  1.00 14.14 ? 441  TRP A NE1 1 
ATOM   2539 C  CE2 . TRP A 1 332 ? -6.499  23.189  6.313  1.00 15.82 ? 441  TRP A CE2 1 
ATOM   2540 C  CE3 . TRP A 1 332 ? -7.272  25.421  6.817  1.00 17.69 ? 441  TRP A CE3 1 
ATOM   2541 C  CZ2 . TRP A 1 332 ? -5.626  23.186  7.402  1.00 14.44 ? 441  TRP A CZ2 1 
ATOM   2542 C  CZ3 . TRP A 1 332 ? -6.395  25.425  7.885  1.00 16.54 ? 441  TRP A CZ3 1 
ATOM   2543 C  CH2 . TRP A 1 332 ? -5.576  24.314  8.165  1.00 16.49 ? 441  TRP A CH2 1 
ATOM   2544 N  N   . THR A 1 333 ? -6.290  25.294  2.370  1.00 18.17 ? 442  THR A N   1 
ATOM   2545 C  CA  . THR A 1 333 ? -5.382  24.571  1.491  1.00 18.90 ? 442  THR A CA  1 
ATOM   2546 C  C   . THR A 1 333 ? -5.044  23.230  2.113  1.00 17.06 ? 442  THR A C   1 
ATOM   2547 O  O   . THR A 1 333 ? -4.595  23.164  3.254  1.00 16.90 ? 442  THR A O   1 
ATOM   2548 C  CB  . THR A 1 333 ? -4.079  25.331  1.283  1.00 19.61 ? 442  THR A CB  1 
ATOM   2549 O  OG1 . THR A 1 333 ? -4.370  26.558  0.607  1.00 26.92 ? 442  THR A OG1 1 
ATOM   2550 C  CG2 . THR A 1 333 ? -3.110  24.504  0.444  1.00 23.22 ? 442  THR A CG2 1 
ATOM   2551 N  N   . THR A 1 334 ? -5.246  22.165  1.353  1.00 14.15 ? 443  THR A N   1 
ATOM   2552 C  CA  . THR A 1 334 ? -5.108  20.832  1.897  1.00 14.85 ? 443  THR A CA  1 
ATOM   2553 C  C   . THR A 1 334 ? -3.670  20.639  2.359  1.00 16.77 ? 443  THR A C   1 
ATOM   2554 O  O   . THR A 1 334 ? -2.721  21.167  1.745  1.00 14.39 ? 443  THR A O   1 
ATOM   2555 C  CB  . THR A 1 334 ? -5.568  19.761  0.888  1.00 17.75 ? 443  THR A CB  1 
ATOM   2556 O  OG1 . THR A 1 334 ? -5.755  18.521  1.564  1.00 14.66 ? 443  THR A OG1 1 
ATOM   2557 C  CG2 . THR A 1 334 ? -4.539  19.565  -0.233 1.00 17.59 ? 443  THR A CG2 1 
ATOM   2558 N  N   . VAL A 1 335 ? -3.503  19.932  3.471  1.00 13.60 ? 444  VAL A N   1 
ATOM   2559 C  CA  . VAL A 1 335 ? -2.177  19.801  4.082  1.00 17.34 ? 444  VAL A CA  1 
ATOM   2560 C  C   . VAL A 1 335 ? -1.202  18.880  3.325  1.00 15.16 ? 444  VAL A C   1 
ATOM   2561 O  O   . VAL A 1 335 ? -1.605  18.009  2.558  1.00 14.72 ? 444  VAL A O   1 
ATOM   2562 C  CB  . VAL A 1 335 ? -2.292  19.331  5.550  1.00 15.36 ? 444  VAL A CB  1 
ATOM   2563 C  CG1 . VAL A 1 335 ? -3.055  20.367  6.353  1.00 17.24 ? 444  VAL A CG1 1 
ATOM   2564 C  CG2 . VAL A 1 335 ? -2.977  17.972  5.638  1.00 11.74 ? 444  VAL A CG2 1 
ATOM   2565 N  N   . ALA A 1 336 ? 0.092   19.111  3.540  1.00 14.57 ? 445  ALA A N   1 
ATOM   2566 C  CA  . ALA A 1 336 ? 1.131   18.269  2.971  1.00 15.74 ? 445  ALA A CA  1 
ATOM   2567 C  C   . ALA A 1 336 ? 1.066   16.843  3.524  1.00 17.27 ? 445  ALA A C   1 
ATOM   2568 O  O   . ALA A 1 336 ? 0.374   16.580  4.516  1.00 15.89 ? 445  ALA A O   1 
ATOM   2569 C  CB  . ALA A 1 336 ? 2.513   18.890  3.259  1.00 15.69 ? 445  ALA A CB  1 
ATOM   2570 N  N   . PRO A 1 337 ? 1.800   15.912  2.893  1.00 16.83 ? 446  PRO A N   1 
ATOM   2571 C  CA  . PRO A 1 337 ? 1.828   14.515  3.322  1.00 16.40 ? 446  PRO A CA  1 
ATOM   2572 C  C   . PRO A 1 337 ? 2.224   14.356  4.794  1.00 14.98 ? 446  PRO A C   1 
ATOM   2573 O  O   . PRO A 1 337 ? 3.085   15.084  5.290  1.00 14.82 ? 446  PRO A O   1 
ATOM   2574 C  CB  . PRO A 1 337 ? 2.906   13.901  2.415  1.00 19.79 ? 446  PRO A CB  1 
ATOM   2575 C  CG  . PRO A 1 337 ? 2.776   14.680  1.145  1.00 17.11 ? 446  PRO A CG  1 
ATOM   2576 C  CD  . PRO A 1 337 ? 2.544   16.106  1.628  1.00 19.96 ? 446  PRO A CD  1 
ATOM   2577 N  N   . GLN A 1 338 ? 1.585   13.409  5.466  1.00 13.54 ? 447  GLN A N   1 
ATOM   2578 C  CA  . GLN A 1 338 ? 1.865   13.130  6.854  1.00 12.80 ? 447  GLN A CA  1 
ATOM   2579 C  C   . GLN A 1 338 ? 3.230   12.482  7.006  1.00 16.60 ? 447  GLN A C   1 
ATOM   2580 O  O   . GLN A 1 338 ? 3.517   11.460  6.362  1.00 14.84 ? 447  GLN A O   1 
ATOM   2581 C  CB  . GLN A 1 338 ? 0.801   12.185  7.401  1.00 15.63 ? 447  GLN A CB  1 
ATOM   2582 C  CG  . GLN A 1 338 ? 0.830   12.026  8.907  1.00 12.57 ? 447  GLN A CG  1 
ATOM   2583 C  CD  . GLN A 1 338 ? 0.153   10.751  9.349  1.00 19.15 ? 447  GLN A CD  1 
ATOM   2584 O  OE1 . GLN A 1 338 ? 0.326   9.689   8.738  1.00 21.47 ? 447  GLN A OE1 1 
ATOM   2585 N  NE2 . GLN A 1 338 ? -0.632  10.844  10.399 1.00 14.18 ? 447  GLN A NE2 1 
ATOM   2586 N  N   . ARG A 1 339 ? 4.065   13.062  7.863  1.00 14.15 ? 448  ARG A N   1 
ATOM   2587 C  CA  . ARG A 1 339 ? 5.341   12.441  8.215  1.00 15.00 ? 448  ARG A CA  1 
ATOM   2588 C  C   . ARG A 1 339 ? 5.220   11.797  9.599  1.00 15.35 ? 448  ARG A C   1 
ATOM   2589 O  O   . ARG A 1 339 ? 4.409   12.231  10.417 1.00 12.94 ? 448  ARG A O   1 
ATOM   2590 C  CB  . ARG A 1 339 ? 6.453   13.500  8.212  1.00 13.30 ? 448  ARG A CB  1 
ATOM   2591 C  CG  . ARG A 1 339 ? 6.709   14.070  6.839  1.00 13.14 ? 448  ARG A CG  1 
ATOM   2592 C  CD  . ARG A 1 339 ? 7.560   15.315  6.842  1.00 14.24 ? 448  ARG A CD  1 
ATOM   2593 N  NE  . ARG A 1 339 ? 7.842   15.712  5.461  1.00 14.32 ? 448  ARG A NE  1 
ATOM   2594 C  CZ  . ARG A 1 339 ? 9.027   16.100  5.008  1.00 16.03 ? 448  ARG A CZ  1 
ATOM   2595 N  NH1 . ARG A 1 339 ? 10.066  16.212  5.820  1.00 14.30 ? 448  ARG A NH1 1 
ATOM   2596 N  NH2 . ARG A 1 339 ? 9.173   16.394  3.722  1.00 14.64 ? 448  ARG A NH2 1 
ATOM   2597 N  N   . LYS A 1 340 ? 6.045   10.785  9.858  1.00 10.89 ? 449  LYS A N   1 
ATOM   2598 C  CA  . LYS A 1 340 ? 6.072   10.127  11.145 1.00 10.37 ? 449  LYS A CA  1 
ATOM   2599 C  C   . LYS A 1 340 ? 7.537   9.939   11.507 1.00 15.64 ? 449  LYS A C   1 
ATOM   2600 O  O   . LYS A 1 340 ? 8.287   9.275   10.769 1.00 10.99 ? 449  LYS A O   1 
ATOM   2601 C  CB  . LYS A 1 340 ? 5.330   8.781   11.046 1.00 13.97 ? 449  LYS A CB  1 
ATOM   2602 C  CG  . LYS A 1 340 ? 5.263   7.969   12.342 1.00 11.88 ? 449  LYS A CG  1 
ATOM   2603 C  CD  . LYS A 1 340 ? 4.695   6.590   12.078 1.00 17.11 ? 449  LYS A CD  1 
ATOM   2604 C  CE  . LYS A 1 340 ? 4.536   5.806   13.362 1.00 24.55 ? 449  LYS A CE  1 
ATOM   2605 N  NZ  . LYS A 1 340 ? 4.150   4.386   13.130 1.00 26.83 ? 449  LYS A NZ  1 
ATOM   2606 N  N   . CYS A 1 341 ? 7.946   10.572  12.614 1.00 11.83 ? 450  CYS A N   1 
ATOM   2607 C  CA  . CYS A 1 341 ? 9.312   10.511  13.105 1.00 12.71 ? 450  CYS A CA  1 
ATOM   2608 C  C   . CYS A 1 341 ? 9.309   9.781   14.441 1.00 12.97 ? 450  CYS A C   1 
ATOM   2609 O  O   . CYS A 1 341 ? 8.675   10.226  15.415 1.00 13.53 ? 450  CYS A O   1 
ATOM   2610 C  CB  . CYS A 1 341 ? 9.890   11.929  13.247 1.00 10.62 ? 450  CYS A CB  1 
ATOM   2611 S  SG  . CYS A 1 341 ? 11.527  12.065  14.017 1.00 13.50 ? 450  CYS A SG  1 
ATOM   2612 N  N   . ILE A 1 342 ? 10.016  8.662   14.486 1.00 10.82 ? 451  ILE A N   1 
ATOM   2613 C  CA  . ILE A 1 342 ? 10.034  7.770   15.649 1.00 14.02 ? 451  ILE A CA  1 
ATOM   2614 C  C   . ILE A 1 342 ? 11.364  7.940   16.360 1.00 17.38 ? 451  ILE A C   1 
ATOM   2615 O  O   . ILE A 1 342 ? 12.430  7.765   15.751 1.00 14.36 ? 451  ILE A O   1 
ATOM   2616 C  CB  . ILE A 1 342 ? 9.846   6.282   15.215 1.00 15.57 ? 451  ILE A CB  1 
ATOM   2617 C  CG1 . ILE A 1 342 ? 8.528   6.120   14.440 1.00 14.53 ? 451  ILE A CG1 1 
ATOM   2618 C  CG2 . ILE A 1 342 ? 9.890   5.338   16.421 1.00 17.68 ? 451  ILE A CG2 1 
ATOM   2619 C  CD1 . ILE A 1 342 ? 8.349   4.797   13.708 1.00 20.32 ? 451  ILE A CD1 1 
ATOM   2620 N  N   . ILE A 1 343 ? 11.313  8.299   17.638 1.00 13.91 ? 452  ILE A N   1 
ATOM   2621 C  CA  . ILE A 1 343 ? 12.544  8.546   18.403 1.00 13.56 ? 452  ILE A CA  1 
ATOM   2622 C  C   . ILE A 1 343 ? 12.589  7.671   19.650 1.00 14.63 ? 452  ILE A C   1 
ATOM   2623 O  O   . ILE A 1 343 ? 11.706  7.769   20.508 1.00 12.41 ? 452  ILE A O   1 
ATOM   2624 C  CB  . ILE A 1 343 ? 12.638  10.036  18.829 1.00 14.03 ? 452  ILE A CB  1 
ATOM   2625 C  CG1 . ILE A 1 343 ? 12.342  10.951  17.637 1.00 16.55 ? 452  ILE A CG1 1 
ATOM   2626 C  CG2 . ILE A 1 343 ? 14.006  10.362  19.410 1.00 13.77 ? 452  ILE A CG2 1 
ATOM   2627 C  CD1 . ILE A 1 343 ? 12.023  12.364  18.006 1.00 18.31 ? 452  ILE A CD1 1 
ATOM   2628 N  N   . ASP A 1 344 ? 13.600  6.800   19.739 1.00 11.72 ? 453  ASP A N   1 
ATOM   2629 C  CA  . ASP A 1 344 ? 13.829  6.010   20.946 1.00 17.17 ? 453  ASP A CA  1 
ATOM   2630 C  C   . ASP A 1 344 ? 14.532  6.881   21.969 1.00 16.39 ? 453  ASP A C   1 
ATOM   2631 O  O   . ASP A 1 344 ? 15.660  7.339   21.732 1.00 15.40 ? 453  ASP A O   1 
ATOM   2632 C  CB  . ASP A 1 344 ? 14.686  4.771   20.631 1.00 17.94 ? 453  ASP A CB  1 
ATOM   2633 C  CG  . ASP A 1 344 ? 14.014  3.848   19.634 1.00 20.59 ? 453  ASP A CG  1 
ATOM   2634 O  OD1 . ASP A 1 344 ? 12.803  3.590   19.800 1.00 21.63 ? 453  ASP A OD1 1 
ATOM   2635 O  OD2 . ASP A 1 344 ? 14.679  3.402   18.676 1.00 20.60 ? 453  ASP A OD2 1 
ATOM   2636 N  N   . ILE A 1 345 ? 13.878  7.143   23.097 1.00 12.80 ? 454  ILE A N   1 
ATOM   2637 C  CA  . ILE A 1 345 ? 14.412  8.106   24.049 1.00 13.70 ? 454  ILE A CA  1 
ATOM   2638 C  C   . ILE A 1 345 ? 15.371  7.477   25.066 1.00 17.28 ? 454  ILE A C   1 
ATOM   2639 O  O   . ILE A 1 345 ? 16.397  8.061   25.383 1.00 15.15 ? 454  ILE A O   1 
ATOM   2640 C  CB  . ILE A 1 345 ? 13.290  8.870   24.807 1.00 17.62 ? 454  ILE A CB  1 
ATOM   2641 C  CG1 . ILE A 1 345 ? 12.372  9.619   23.831 1.00 15.31 ? 454  ILE A CG1 1 
ATOM   2642 C  CG2 . ILE A 1 345 ? 13.886  9.848   25.806 1.00 14.04 ? 454  ILE A CG2 1 
ATOM   2643 C  CD1 . ILE A 1 345 ? 13.028  10.777  23.058 1.00 17.56 ? 454  ILE A CD1 1 
ATOM   2644 N  N   . LEU A 1 346 ? 15.031  6.299   25.577 1.00 18.47 ? 455  LEU A N   1 
ATOM   2645 C  CA  . LEU A 1 346 ? 15.820  5.674   26.634 1.00 19.11 ? 455  LEU A CA  1 
ATOM   2646 C  C   . LEU A 1 346 ? 17.008  4.844   26.145 1.00 24.77 ? 455  LEU A C   1 
ATOM   2647 O  O   . LEU A 1 346 ? 16.900  4.084   25.185 1.00 24.62 ? 455  LEU A O   1 
ATOM   2648 C  CB  . LEU A 1 346 ? 14.949  4.748   27.468 1.00 18.60 ? 455  LEU A CB  1 
ATOM   2649 C  CG  . LEU A 1 346 ? 13.867  5.315   28.385 1.00 20.22 ? 455  LEU A CG  1 
ATOM   2650 C  CD1 . LEU A 1 346 ? 13.456  4.212   29.338 1.00 17.91 ? 455  LEU A CD1 1 
ATOM   2651 C  CD2 . LEU A 1 346 ? 14.291  6.559   29.147 1.00 19.96 ? 455  LEU A CD2 1 
ATOM   2652 N  N   . THR A 1 347 ? 18.105  4.962   26.885 1.00 25.77 ? 456  THR A N   1 
ATOM   2653 C  CA  . THR A 1 347 ? 19.347  4.242   26.635 1.00 29.36 ? 456  THR A CA  1 
ATOM   2654 C  C   . THR A 1 347 ? 19.531  3.134   27.686 1.00 34.23 ? 456  THR A C   1 
ATOM   2655 O  O   . THR A 1 347 ? 20.455  2.341   27.606 1.00 36.13 ? 456  THR A O   1 
ATOM   2656 C  CB  . THR A 1 347 ? 20.530  5.207   26.747 1.00 30.38 ? 456  THR A CB  1 
ATOM   2657 O  OG1 . THR A 1 347 ? 20.798  5.481   28.127 1.00 40.59 ? 456  THR A OG1 1 
ATOM   2658 C  CG2 . THR A 1 347 ? 20.232  6.540   26.042 1.00 37.33 ? 456  THR A CG2 1 
ATOM   2659 N  N   . GLU A 1 348 ? 18.649  3.099   28.677 1.00 23.56 ? 457  GLU A N   1 
ATOM   2660 C  CA  . GLU A 1 348 ? 18.710  2.125   29.762 1.00 22.79 ? 457  GLU A CA  1 
ATOM   2661 C  C   . GLU A 1 348 ? 17.409  2.281   30.520 1.00 20.75 ? 457  GLU A C   1 
ATOM   2662 O  O   . GLU A 1 348 ? 16.834  3.359   30.526 1.00 18.04 ? 457  GLU A O   1 
ATOM   2663 C  CB  . GLU A 1 348 ? 19.849  2.452   30.724 1.00 26.82 ? 457  GLU A CB  1 
ATOM   2664 C  CG  . GLU A 1 348 ? 19.599  3.750   31.480 1.00 28.91 ? 457  GLU A CG  1 
ATOM   2665 C  CD  . GLU A 1 348 ? 20.695  4.132   32.455 1.00 41.60 ? 457  GLU A CD  1 
ATOM   2666 O  OE1 . GLU A 1 348 ? 21.812  3.572   32.360 1.00 54.59 ? 457  GLU A OE1 1 
ATOM   2667 O  OE2 . GLU A 1 348 ? 20.430  4.991   33.330 1.00 39.90 ? 457  GLU A OE2 1 
ATOM   2668 N  N   . PRO A 1 349 ? 16.951  1.219   31.199 1.00 21.43 ? 458  PRO A N   1 
ATOM   2669 C  CA  . PRO A 1 349 ? 15.738  1.379   32.027 1.00 17.58 ? 458  PRO A CA  1 
ATOM   2670 C  C   . PRO A 1 349 ? 15.932  2.366   33.187 1.00 21.74 ? 458  PRO A C   1 
ATOM   2671 O  O   . PRO A 1 349 ? 17.054  2.563   33.669 1.00 18.40 ? 458  PRO A O   1 
ATOM   2672 C  CB  . PRO A 1 349 ? 15.488  -0.037  32.548 1.00 16.71 ? 458  PRO A CB  1 
ATOM   2673 C  CG  . PRO A 1 349 ? 16.828  -0.687  32.536 1.00 25.94 ? 458  PRO A CG  1 
ATOM   2674 C  CD  . PRO A 1 349 ? 17.526  -0.130  31.316 1.00 19.93 ? 458  PRO A CD  1 
ATOM   2675 N  N   . LYS A 1 350 ? 14.843  2.988   33.642 1.00 17.12 ? 459  LYS A N   1 
ATOM   2676 C  CA  . LYS A 1 350 ? 14.922  3.987   34.703 1.00 15.51 ? 459  LYS A CA  1 
ATOM   2677 C  C   . LYS A 1 350 ? 13.990  3.651   35.838 1.00 17.84 ? 459  LYS A C   1 
ATOM   2678 O  O   . LYS A 1 350 ? 12.816  3.372   35.626 1.00 13.45 ? 459  LYS A O   1 
ATOM   2679 C  CB  . LYS A 1 350 ? 14.519  5.355   34.166 1.00 20.23 ? 459  LYS A CB  1 
ATOM   2680 C  CG  . LYS A 1 350 ? 15.348  5.836   32.985 1.00 22.43 ? 459  LYS A CG  1 
ATOM   2681 C  CD  . LYS A 1 350 ? 16.712  6.288   33.414 1.00 25.38 ? 459  LYS A CD  1 
ATOM   2682 C  CE  . LYS A 1 350 ? 17.413  7.048   32.290 1.00 29.05 ? 459  LYS A CE  1 
ATOM   2683 N  NZ  . LYS A 1 350 ? 18.825  7.313   32.694 1.00 41.67 ? 459  LYS A NZ  1 
ATOM   2684 N  N   . ASP A 1 351 ? 14.501  3.698   37.054 1.00 19.41 ? 460  ASP A N   1 
ATOM   2685 C  CA  . ASP A 1 351 ? 13.666  3.468   38.214 1.00 20.63 ? 460  ASP A CA  1 
ATOM   2686 C  C   . ASP A 1 351 ? 12.657  4.615   38.377 1.00 20.13 ? 460  ASP A C   1 
ATOM   2687 O  O   . ASP A 1 351 ? 13.010  5.796   38.233 1.00 18.64 ? 460  ASP A O   1 
ATOM   2688 C  CB  . ASP A 1 351 ? 14.545  3.333   39.461 1.00 23.33 ? 460  ASP A CB  1 
ATOM   2689 C  CG  . ASP A 1 351 ? 13.728  3.127   40.734 1.00 25.59 ? 460  ASP A CG  1 
ATOM   2690 O  OD1 . ASP A 1 351 ? 13.109  2.054   40.852 1.00 29.36 ? 460  ASP A OD1 1 
ATOM   2691 O  OD2 . ASP A 1 351 ? 13.716  4.021   41.612 1.00 26.96 ? 460  ASP A OD2 1 
ATOM   2692 N  N   . ILE A 1 352 ? 11.400  4.282   38.680 1.00 16.60 ? 461  ILE A N   1 
ATOM   2693 C  CA  . ILE A 1 352 ? 10.384  5.311   38.810 1.00 15.57 ? 461  ILE A CA  1 
ATOM   2694 C  C   . ILE A 1 352 ? 10.301  5.805   40.246 1.00 20.97 ? 461  ILE A C   1 
ATOM   2695 O  O   . ILE A 1 352 ? 10.378  7.006   40.509 1.00 19.74 ? 461  ILE A O   1 
ATOM   2696 C  CB  . ILE A 1 352 ? 9.011   4.806   38.330 1.00 14.76 ? 461  ILE A CB  1 
ATOM   2697 C  CG1 . ILE A 1 352 ? 9.058   4.502   36.837 1.00 11.97 ? 461  ILE A CG1 1 
ATOM   2698 C  CG2 . ILE A 1 352 ? 7.909   5.837   38.628 1.00 12.56 ? 461  ILE A CG2 1 
ATOM   2699 C  CD1 . ILE A 1 352 ? 7.839   3.784   36.356 1.00 13.16 ? 461  ILE A CD1 1 
ATOM   2700 N  N   . GLY A 1 353 ? 10.144  4.881   41.187 1.00 17.28 ? 462  GLY A N   1 
ATOM   2701 C  CA  . GLY A 1 353 ? 10.073  5.255   42.588 1.00 20.39 ? 462  GLY A CA  1 
ATOM   2702 C  C   . GLY A 1 353 ? 8.958   6.260   42.820 1.00 20.75 ? 462  GLY A C   1 
ATOM   2703 O  O   . GLY A 1 353 ? 7.823   6.067   42.355 1.00 22.09 ? 462  GLY A O   1 
ATOM   2704 N  N   . LYS A 1 354 ? 9.289   7.330   43.536 1.00 16.25 ? 463  LYS A N   1 
ATOM   2705 C  CA  . LYS A 1 354 ? 8.347   8.377   43.891 1.00 19.70 ? 463  LYS A CA  1 
ATOM   2706 C  C   . LYS A 1 354 ? 8.138   9.302   42.710 1.00 20.47 ? 463  LYS A C   1 
ATOM   2707 O  O   . LYS A 1 354 ? 7.057   9.864   42.517 1.00 18.22 ? 463  LYS A O   1 
ATOM   2708 C  CB  . LYS A 1 354 ? 8.896   9.174   45.084 1.00 18.46 ? 463  LYS A CB  1 
ATOM   2709 C  CG  . LYS A 1 354 ? 8.030   10.331  45.519 1.00 24.90 ? 463  LYS A CG  1 
ATOM   2710 C  CD  . LYS A 1 354 ? 6.637   9.849   45.951 1.00 23.78 ? 463  LYS A CD  1 
ATOM   2711 C  CE  . LYS A 1 354 ? 5.711   11.001  46.393 1.00 25.70 ? 463  LYS A CE  1 
ATOM   2712 N  NZ  . LYS A 1 354 ? 4.397   10.435  46.804 1.00 24.08 ? 463  LYS A NZ  1 
ATOM   2713 N  N   . ARG A 1 355 ? 9.193   9.464   41.915 1.00 20.09 ? 464  ARG A N   1 
ATOM   2714 C  CA  . ARG A 1 355 ? 9.166   10.417  40.816 1.00 18.55 ? 464  ARG A CA  1 
ATOM   2715 C  C   . ARG A 1 355 ? 10.326  10.157  39.857 1.00 19.17 ? 464  ARG A C   1 
ATOM   2716 O  O   . ARG A 1 355 ? 11.435  9.783   40.295 1.00 17.79 ? 464  ARG A O   1 
ATOM   2717 C  CB  . ARG A 1 355 ? 9.251   11.842  41.336 1.00 18.33 ? 464  ARG A CB  1 
ATOM   2718 C  CG  . ARG A 1 355 ? 9.295   12.859  40.205 1.00 24.70 ? 464  ARG A CG  1 
ATOM   2719 C  CD  . ARG A 1 355 ? 8.980   14.293  40.641 1.00 32.02 ? 464  ARG A CD  1 
ATOM   2720 N  NE  . ARG A 1 355 ? 7.789   14.817  39.955 1.00 43.29 ? 464  ARG A NE  1 
ATOM   2721 C  CZ  . ARG A 1 355 ? 7.791   15.530  38.827 1.00 48.13 ? 464  ARG A CZ  1 
ATOM   2722 N  NH1 . ARG A 1 355 ? 6.629   15.948  38.314 1.00 43.83 ? 464  ARG A NH1 1 
ATOM   2723 N  NH2 . ARG A 1 355 ? 8.936   15.833  38.208 1.00 46.85 ? 464  ARG A NH2 1 
ATOM   2724 N  N   . LEU A 1 356 ? 10.052  10.333  38.561 1.00 12.72 ? 465  LEU A N   1 
ATOM   2725 C  CA  . LEU A 1 356 ? 11.068  10.209  37.516 1.00 11.96 ? 465  LEU A CA  1 
ATOM   2726 C  C   . LEU A 1 356 ? 10.891  11.321  36.495 1.00 15.99 ? 465  LEU A C   1 
ATOM   2727 O  O   . LEU A 1 356 ? 9.776   11.636  36.083 1.00 13.42 ? 465  LEU A O   1 
ATOM   2728 C  CB  . LEU A 1 356 ? 10.988  8.842   36.833 1.00 14.27 ? 465  LEU A CB  1 
ATOM   2729 C  CG  . LEU A 1 356 ? 11.806  8.623   35.553 1.00 14.04 ? 465  LEU A CG  1 
ATOM   2730 C  CD1 . LEU A 1 356 ? 13.320  8.718   35.813 1.00 16.60 ? 465  LEU A CD1 1 
ATOM   2731 C  CD2 . LEU A 1 356 ? 11.452  7.289   34.922 1.00 16.69 ? 465  LEU A CD2 1 
ATOM   2732 N  N   . GLU A 1 357 ? 11.996  11.938  36.105 1.00 14.48 ? 466  GLU A N   1 
ATOM   2733 C  CA  . GLU A 1 357 ? 11.978  12.896  35.009 1.00 15.36 ? 466  GLU A CA  1 
ATOM   2734 C  C   . GLU A 1 357 ? 12.980  12.463  33.957 1.00 14.35 ? 466  GLU A C   1 
ATOM   2735 O  O   . GLU A 1 357 ? 14.119  12.173  34.274 1.00 18.01 ? 466  GLU A O   1 
ATOM   2736 C  CB  . GLU A 1 357 ? 12.298  14.290  35.536 1.00 21.69 ? 466  GLU A CB  1 
ATOM   2737 C  CG  . GLU A 1 357 ? 12.315  15.364  34.498 1.00 24.16 ? 466  GLU A CG  1 
ATOM   2738 C  CD  . GLU A 1 357 ? 12.808  16.683  35.072 1.00 24.15 ? 466  GLU A CD  1 
ATOM   2739 O  OE1 . GLU A 1 357 ? 13.957  17.063  34.767 1.00 27.54 ? 466  GLU A OE1 1 
ATOM   2740 O  OE2 . GLU A 1 357 ? 12.060  17.300  35.853 1.00 32.21 ? 466  GLU A OE2 1 
ATOM   2741 N  N   . VAL A 1 358 ? 12.532  12.371  32.707 1.00 14.11 ? 467  VAL A N   1 
ATOM   2742 C  CA  . VAL A 1 358 ? 13.400  11.995  31.600 1.00 14.97 ? 467  VAL A CA  1 
ATOM   2743 C  C   . VAL A 1 358 ? 13.407  13.134  30.598 1.00 17.55 ? 467  VAL A C   1 
ATOM   2744 O  O   . VAL A 1 358 ? 12.355  13.483  30.047 1.00 15.25 ? 467  VAL A O   1 
ATOM   2745 C  CB  . VAL A 1 358 ? 12.901  10.749  30.888 1.00 15.62 ? 467  VAL A CB  1 
ATOM   2746 C  CG1 . VAL A 1 358 ? 13.742  10.479  29.635 1.00 15.72 ? 467  VAL A CG1 1 
ATOM   2747 C  CG2 . VAL A 1 358 ? 12.914  9.551   31.848 1.00 16.46 ? 467  VAL A CG2 1 
ATOM   2748 N  N   . ARG A 1 359 ? 14.592  13.695  30.366 1.00 12.03 ? 468  ARG A N   1 
ATOM   2749 C  CA  . ARG A 1 359 ? 14.771  14.814  29.449 1.00 14.71 ? 468  ARG A CA  1 
ATOM   2750 C  C   . ARG A 1 359 ? 15.584  14.376  28.264 1.00 15.10 ? 468  ARG A C   1 
ATOM   2751 O  O   . ARG A 1 359 ? 16.612  13.703  28.425 1.00 13.28 ? 468  ARG A O   1 
ATOM   2752 C  CB  . ARG A 1 359 ? 15.514  15.957  30.135 1.00 15.46 ? 468  ARG A CB  1 
ATOM   2753 C  CG  . ARG A 1 359 ? 14.861  16.385  31.390 1.00 19.78 ? 468  ARG A CG  1 
ATOM   2754 C  CD  . ARG A 1 359 ? 15.701  17.386  32.138 1.00 28.61 ? 468  ARG A CD  1 
ATOM   2755 N  NE  . ARG A 1 359 ? 15.485  18.723  31.633 1.00 29.61 ? 468  ARG A NE  1 
ATOM   2756 C  CZ  . ARG A 1 359 ? 14.651  19.611  32.161 1.00 31.54 ? 468  ARG A CZ  1 
ATOM   2757 N  NH1 . ARG A 1 359 ? 13.920  19.316  33.227 1.00 27.67 ? 468  ARG A NH1 1 
ATOM   2758 N  NH2 . ARG A 1 359 ? 14.539  20.805  31.596 1.00 25.61 ? 468  ARG A NH2 1 
ATOM   2759 N  N   . LYS A 1 360 ? 15.131  14.756  27.074 1.00 13.99 ? 469  LYS A N   1 
ATOM   2760 C  CA  . LYS A 1 360 ? 15.858  14.456  25.856 1.00 11.80 ? 469  LYS A CA  1 
ATOM   2761 C  C   . LYS A 1 360 ? 15.696  15.512  24.779 1.00 12.51 ? 469  LYS A C   1 
ATOM   2762 O  O   . LYS A 1 360 ? 14.582  15.930  24.456 1.00 10.91 ? 469  LYS A O   1 
ATOM   2763 C  CB  . LYS A 1 360 ? 15.397  13.128  25.298 1.00 17.90 ? 469  LYS A CB  1 
ATOM   2764 C  CG  . LYS A 1 360 ? 15.953  12.835  23.947 1.00 17.08 ? 469  LYS A CG  1 
ATOM   2765 C  CD  . LYS A 1 360 ? 16.898  11.688  24.026 1.00 23.28 ? 469  LYS A CD  1 
ATOM   2766 C  CE  . LYS A 1 360 ? 18.274  12.160  24.289 1.00 29.50 ? 469  LYS A CE  1 
ATOM   2767 N  NZ  . LYS A 1 360 ? 19.101  11.705  23.129 1.00 32.29 ? 469  LYS A NZ  1 
ATOM   2768 N  N   . THR A 1 361 ? 16.821  15.919  24.195 1.00 12.94 ? 470  THR A N   1 
ATOM   2769 C  CA  . THR A 1 361 ? 16.807  16.885  23.114 1.00 13.73 ? 470  THR A CA  1 
ATOM   2770 C  C   . THR A 1 361 ? 16.793  16.108  21.812 1.00 15.68 ? 470  THR A C   1 
ATOM   2771 O  O   . THR A 1 361 ? 17.648  15.252  21.567 1.00 14.15 ? 470  THR A O   1 
ATOM   2772 C  CB  . THR A 1 361 ? 18.024  17.841  23.199 1.00 12.33 ? 470  THR A CB  1 
ATOM   2773 O  OG1 . THR A 1 361 ? 17.886  18.632  24.381 1.00 14.54 ? 470  THR A OG1 1 
ATOM   2774 C  CG2 . THR A 1 361 ? 18.094  18.782  22.002 1.00 16.65 ? 470  THR A CG2 1 
ATOM   2775 N  N   . VAL A 1 362 ? 15.800  16.402  20.986 1.00 12.51 ? 471  VAL A N   1 
ATOM   2776 C  CA  . VAL A 1 362 ? 15.596  15.671  19.750 1.00 11.77 ? 471  VAL A CA  1 
ATOM   2777 C  C   . VAL A 1 362 ? 15.667  16.661  18.588 1.00 13.99 ? 471  VAL A C   1 
ATOM   2778 O  O   . VAL A 1 362 ? 15.478  17.875  18.776 1.00 13.25 ? 471  VAL A O   1 
ATOM   2779 C  CB  . VAL A 1 362 ? 14.222  14.973  19.738 1.00 12.44 ? 471  VAL A CB  1 
ATOM   2780 C  CG1 . VAL A 1 362 ? 14.014  14.206  21.012 1.00 15.17 ? 471  VAL A CG1 1 
ATOM   2781 C  CG2 . VAL A 1 362 ? 13.104  15.986  19.537 1.00 11.41 ? 471  VAL A CG2 1 
ATOM   2782 N  N   . THR A 1 363 ? 15.929  16.129  17.399 1.00 11.75 ? 472  THR A N   1 
ATOM   2783 C  CA  . THR A 1 363 ? 16.003  16.921  16.180 1.00 12.67 ? 472  THR A CA  1 
ATOM   2784 C  C   . THR A 1 363 ? 14.755  16.729  15.324 1.00 16.00 ? 472  THR A C   1 
ATOM   2785 O  O   . THR A 1 363 ? 14.623  17.342  14.275 1.00 13.04 ? 472  THR A O   1 
ATOM   2786 C  CB  . THR A 1 363 ? 17.215  16.508  15.330 1.00 16.46 ? 472  THR A CB  1 
ATOM   2787 O  OG1 . THR A 1 363 ? 17.033  15.166  14.886 1.00 15.90 ? 472  THR A OG1 1 
ATOM   2788 C  CG2 . THR A 1 363 ? 18.512  16.594  16.137 1.00 17.88 ? 472  THR A CG2 1 
ATOM   2789 N  N   . ALA A 1 364 ? 13.869  15.834  15.748 1.00 12.20 ? 473  ALA A N   1 
ATOM   2790 C  CA  . ALA A 1 364 ? 12.642  15.555  14.995 1.00 12.29 ? 473  ALA A CA  1 
ATOM   2791 C  C   . ALA A 1 364 ? 12.966  15.178  13.545 1.00 14.94 ? 473  ALA A C   1 
ATOM   2792 O  O   . ALA A 1 364 ? 12.370  15.695  12.586 1.00 11.92 ? 473  ALA A O   1 
ATOM   2793 C  CB  . ALA A 1 364 ? 11.678  16.739  15.062 1.00 12.76 ? 473  ALA A CB  1 
ATOM   2794 N  N   . CYS A 1 365 ? 13.920  14.262  13.418 1.00 12.34 ? 474  CYS A N   1 
ATOM   2795 C  CA  . CYS A 1 365 ? 14.305  13.681  12.145 1.00 14.63 ? 474  CYS A CA  1 
ATOM   2796 C  C   . CYS A 1 365 ? 14.877  14.697  11.174 1.00 14.43 ? 474  CYS A C   1 
ATOM   2797 O  O   . CYS A 1 365 ? 14.732  14.565  9.956  1.00 14.14 ? 474  CYS A O   1 
ATOM   2798 C  CB  . CYS A 1 365 ? 13.144  12.906  11.514 1.00 14.37 ? 474  CYS A CB  1 
ATOM   2799 S  SG  . CYS A 1 365 ? 12.717  11.429  12.461 1.00 16.14 ? 474  CYS A SG  1 
ATOM   2800 N  N   . LEU A 1 366 ? 15.585  15.675  11.719 1.00 14.25 ? 475  LEU A N   1 
ATOM   2801 C  CA  . LEU A 1 366 ? 16.308  16.635  10.909 1.00 13.65 ? 475  LEU A CA  1 
ATOM   2802 C  C   . LEU A 1 366 ? 17.174  15.950  9.868  1.00 15.58 ? 475  LEU A C   1 
ATOM   2803 O  O   . LEU A 1 366 ? 17.894  14.994  10.178 1.00 16.66 ? 475  LEU A O   1 
ATOM   2804 C  CB  . LEU A 1 366 ? 17.228  17.459  11.787 1.00 14.04 ? 475  LEU A CB  1 
ATOM   2805 C  CG  . LEU A 1 366 ? 17.988  18.578  11.058 1.00 16.67 ? 475  LEU A CG  1 
ATOM   2806 C  CD1 . LEU A 1 366 ? 17.052  19.635  10.545 1.00 14.94 ? 475  LEU A CD1 1 
ATOM   2807 C  CD2 . LEU A 1 366 ? 19.018  19.171  11.999 1.00 21.80 ? 475  LEU A CD2 1 
ATOM   2808 N  N   . GLY A 1 367 ? 17.140  16.485  8.655  1.00 16.13 ? 476  GLY A N   1 
ATOM   2809 C  CA  . GLY A 1 367 ? 17.960  15.980  7.564  1.00 19.74 ? 476  GLY A CA  1 
ATOM   2810 C  C   . GLY A 1 367 ? 17.305  14.855  6.782  1.00 22.53 ? 476  GLY A C   1 
ATOM   2811 O  O   . GLY A 1 367 ? 17.822  14.455  5.731  1.00 18.76 ? 476  GLY A O   1 
ATOM   2812 N  N   . GLU A 1 368 ? 16.164  14.362  7.267  1.00 15.93 ? 477  GLU A N   1 
ATOM   2813 C  CA  . GLU A 1 368 ? 15.543  13.165  6.689  1.00 18.17 ? 477  GLU A CA  1 
ATOM   2814 C  C   . GLU A 1 368 ? 14.173  13.473  6.087  1.00 15.76 ? 477  GLU A C   1 
ATOM   2815 O  O   . GLU A 1 368 ? 13.601  14.528  6.356  1.00 14.96 ? 477  GLU A O   1 
ATOM   2816 C  CB  . GLU A 1 368 ? 15.387  12.077  7.758  1.00 17.56 ? 477  GLU A CB  1 
ATOM   2817 C  CG  . GLU A 1 368 ? 16.689  11.675  8.428  1.00 17.53 ? 477  GLU A CG  1 
ATOM   2818 C  CD  . GLU A 1 368 ? 17.668  11.009  7.467  1.00 29.12 ? 477  GLU A CD  1 
ATOM   2819 O  OE1 . GLU A 1 368 ? 17.228  10.283  6.540  1.00 29.66 ? 477  GLU A OE1 1 
ATOM   2820 O  OE2 . GLU A 1 368 ? 18.892  11.214  7.632  1.00 35.07 ? 477  GLU A OE2 1 
ATOM   2821 N  N   . PRO A 1 369 ? 13.634  12.538  5.282  1.00 14.13 ? 478  PRO A N   1 
ATOM   2822 C  CA  . PRO A 1 369 ? 12.331  12.721  4.637  1.00 12.82 ? 478  PRO A CA  1 
ATOM   2823 C  C   . PRO A 1 369 ? 11.151  12.772  5.621  1.00 16.82 ? 478  PRO A C   1 
ATOM   2824 O  O   . PRO A 1 369 ? 10.058  13.166  5.233  1.00 16.28 ? 478  PRO A O   1 
ATOM   2825 C  CB  . PRO A 1 369 ? 12.203  11.479  3.754  1.00 14.89 ? 478  PRO A CB  1 
ATOM   2826 C  CG  . PRO A 1 369 ? 13.598  11.091  3.468  1.00 19.22 ? 478  PRO A CG  1 
ATOM   2827 C  CD  . PRO A 1 369 ? 14.338  11.359  4.752  1.00 16.62 ? 478  PRO A CD  1 
ATOM   2828 N  N   . ASN A 1 370 ? 11.361  12.347  6.864  1.00 13.27 ? 479  ASN A N   1 
ATOM   2829 C  CA  . ASN A 1 370 ? 10.311  12.475  7.865  1.00 15.90 ? 479  ASN A CA  1 
ATOM   2830 C  C   . ASN A 1 370 ? 10.577  13.588  8.881  1.00 14.99 ? 479  ASN A C   1 
ATOM   2831 O  O   . ASN A 1 370 ? 9.984   13.614  9.967  1.00 16.04 ? 479  ASN A O   1 
ATOM   2832 C  CB  . ASN A 1 370 ? 10.070  11.136  8.563  1.00 16.29 ? 479  ASN A CB  1 
ATOM   2833 C  CG  . ASN A 1 370 ? 11.326  10.559  9.171  1.00 18.03 ? 479  ASN A CG  1 
ATOM   2834 O  OD1 . ASN A 1 370 ? 12.453  10.979  8.855  1.00 17.61 ? 479  ASN A OD1 1 
ATOM   2835 N  ND2 . ASN A 1 370 ? 11.152  9.548   10.007 1.00 17.28 ? 479  ASN A ND2 1 
ATOM   2836 N  N   . HIS A 1 371 ? 11.441  14.526  8.523  1.00 13.03 ? 480  HIS A N   1 
ATOM   2837 C  CA  . HIS A 1 371 ? 11.665  15.719  9.332  1.00 12.51 ? 480  HIS A CA  1 
ATOM   2838 C  C   . HIS A 1 371 ? 10.344  16.443  9.551  1.00 12.79 ? 480  HIS A C   1 
ATOM   2839 O  O   . HIS A 1 371 ? 9.608   16.715  8.605  1.00 12.86 ? 480  HIS A O   1 
ATOM   2840 C  CB  . HIS A 1 371 ? 12.645  16.632  8.599  1.00 12.92 ? 480  HIS A CB  1 
ATOM   2841 C  CG  . HIS A 1 371 ? 12.958  17.927  9.290  1.00 12.78 ? 480  HIS A CG  1 
ATOM   2842 N  ND1 . HIS A 1 371 ? 13.143  18.046  10.658 1.00 16.08 ? 480  HIS A ND1 1 
ATOM   2843 C  CD2 . HIS A 1 371 ? 13.158  19.161  8.782  1.00 8.90  ? 480  HIS A CD2 1 
ATOM   2844 C  CE1 . HIS A 1 371 ? 13.457  19.297  10.947 1.00 8.89  ? 480  HIS A CE1 1 
ATOM   2845 N  NE2 . HIS A 1 371 ? 13.454  19.998  9.830  1.00 15.66 ? 480  HIS A NE2 1 
ATOM   2846 N  N   . ILE A 1 372 ? 10.054  16.778  10.798 1.00 12.40 ? 481  ILE A N   1 
ATOM   2847 C  CA  . ILE A 1 372 ? 8.816   17.468  11.122 1.00 10.68 ? 481  ILE A CA  1 
ATOM   2848 C  C   . ILE A 1 372 ? 9.125   18.797  11.795 1.00 12.28 ? 481  ILE A C   1 
ATOM   2849 O  O   . ILE A 1 372 ? 9.814   18.838  12.815 1.00 10.98 ? 481  ILE A O   1 
ATOM   2850 C  CB  . ILE A 1 372 ? 7.934   16.613  12.078 1.00 13.28 ? 481  ILE A CB  1 
ATOM   2851 C  CG1 . ILE A 1 372 ? 7.398   15.382  11.339 1.00 11.61 ? 481  ILE A CG1 1 
ATOM   2852 C  CG2 . ILE A 1 372 ? 6.753   17.457  12.686 1.00 11.96 ? 481  ILE A CG2 1 
ATOM   2853 C  CD1 . ILE A 1 372 ? 6.826   14.377  12.256 1.00 12.66 ? 481  ILE A CD1 1 
ATOM   2854 N  N   . THR A 1 373 ? 8.589   19.869  11.222 1.00 13.21 ? 482  THR A N   1 
ATOM   2855 C  CA  . THR A 1 373 ? 8.706   21.206  11.781 1.00 11.94 ? 482  THR A CA  1 
ATOM   2856 C  C   . THR A 1 373 ? 7.361   21.713  12.274 1.00 14.41 ? 482  THR A C   1 
ATOM   2857 O  O   . THR A 1 373 ? 7.284   22.705  13.010 1.00 11.24 ? 482  THR A O   1 
ATOM   2858 C  CB  . THR A 1 373 ? 9.220   22.210  10.731 1.00 15.25 ? 482  THR A CB  1 
ATOM   2859 O  OG1 . THR A 1 373 ? 8.273   22.284  9.679  1.00 13.44 ? 482  THR A OG1 1 
ATOM   2860 C  CG2 . THR A 1 373 ? 10.580  21.787  10.158 1.00 16.63 ? 482  THR A CG2 1 
ATOM   2861 N  N   . ARG A 1 374 ? 6.294   21.030  11.865 1.00 15.16 ? 483  ARG A N   1 
ATOM   2862 C  CA  . ARG A 1 374 ? 4.941   21.417  12.225 1.00 11.82 ? 483  ARG A CA  1 
ATOM   2863 C  C   . ARG A 1 374 ? 4.215   20.186  12.746 1.00 11.20 ? 483  ARG A C   1 
ATOM   2864 O  O   . ARG A 1 374 ? 3.788   19.344  11.977 1.00 9.81  ? 483  ARG A O   1 
ATOM   2865 C  CB  . ARG A 1 374 ? 4.202   21.957  10.989 1.00 14.43 ? 483  ARG A CB  1 
ATOM   2866 C  CG  . ARG A 1 374 ? 4.801   23.227  10.396 1.00 21.03 ? 483  ARG A CG  1 
ATOM   2867 N  N   . LEU A 1 375 ? 4.119   20.068  14.061 1.00 12.57 ? 484  LEU A N   1 
ATOM   2868 C  CA  . LEU A 1 375 ? 3.560   18.883  14.679 1.00 13.36 ? 484  LEU A CA  1 
ATOM   2869 C  C   . LEU A 1 375 ? 2.059   18.812  14.462 1.00 12.75 ? 484  LEU A C   1 
ATOM   2870 O  O   . LEU A 1 375 ? 1.389   19.833  14.412 1.00 10.32 ? 484  LEU A O   1 
ATOM   2871 C  CB  . LEU A 1 375 ? 3.858   18.922  16.184 1.00 12.75 ? 484  LEU A CB  1 
ATOM   2872 C  CG  . LEU A 1 375 ? 3.748   17.662  17.023 1.00 13.42 ? 484  LEU A CG  1 
ATOM   2873 C  CD1 . LEU A 1 375 ? 4.742   16.574  16.554 1.00 11.18 ? 484  LEU A CD1 1 
ATOM   2874 C  CD2 . LEU A 1 375 ? 3.940   17.997  18.509 1.00 12.71 ? 484  LEU A CD2 1 
ATOM   2875 N  N   . GLU A 1 376 ? 1.543   17.595  14.347 1.00 10.14 ? 485  GLU A N   1 
ATOM   2876 C  CA  . GLU A 1 376 ? 0.132   17.358  14.498 1.00 10.23 ? 485  GLU A CA  1 
ATOM   2877 C  C   . GLU A 1 376 ? -0.029  16.613  15.824 1.00 12.22 ? 485  GLU A C   1 
ATOM   2878 O  O   . GLU A 1 376 ? 0.116   17.216  16.896 1.00 9.78  ? 485  GLU A O   1 
ATOM   2879 C  CB  . GLU A 1 376 ? -0.397  16.623  13.265 1.00 11.68 ? 485  GLU A CB  1 
ATOM   2880 C  CG  . GLU A 1 376 ? -0.409  17.568  12.065 1.00 11.15 ? 485  GLU A CG  1 
ATOM   2881 C  CD  . GLU A 1 376 ? -0.693  16.901  10.729 1.00 11.51 ? 485  GLU A CD  1 
ATOM   2882 O  OE1 . GLU A 1 376 ? -0.957  15.681  10.692 1.00 11.01 ? 485  GLU A OE1 1 
ATOM   2883 O  OE2 . GLU A 1 376 ? -0.700  17.641  9.725  1.00 10.40 ? 485  GLU A OE2 1 
ATOM   2884 N  N   . HIS A 1 377 ? -0.270  15.315  15.766 1.00 9.86  ? 486  HIS A N   1 
ATOM   2885 C  CA  . HIS A 1 377 ? -0.293  14.502  16.975 1.00 11.30 ? 486  HIS A CA  1 
ATOM   2886 C  C   . HIS A 1 377 ? 1.132   14.188  17.451 1.00 11.76 ? 486  HIS A C   1 
ATOM   2887 O  O   . HIS A 1 377 ? 2.063   14.167  16.652 1.00 10.14 ? 486  HIS A O   1 
ATOM   2888 C  CB  . HIS A 1 377 ? -0.977  13.167  16.706 1.00 9.00  ? 486  HIS A CB  1 
ATOM   2889 C  CG  . HIS A 1 377 ? -2.215  13.285  15.886 1.00 9.77  ? 486  HIS A CG  1 
ATOM   2890 N  ND1 . HIS A 1 377 ? -2.186  13.399  14.516 1.00 10.23 ? 486  HIS A ND1 1 
ATOM   2891 C  CD2 . HIS A 1 377 ? -3.522  13.321  16.243 1.00 10.75 ? 486  HIS A CD2 1 
ATOM   2892 C  CE1 . HIS A 1 377 ? -3.424  13.487  14.056 1.00 8.84  ? 486  HIS A CE1 1 
ATOM   2893 N  NE2 . HIS A 1 377 ? -4.255  13.444  15.083 1.00 11.24 ? 486  HIS A NE2 1 
ATOM   2894 N  N   . ALA A 1 378 ? 1.263   13.937  18.755 1.00 10.71 ? 487  ALA A N   1 
ATOM   2895 C  CA  . ALA A 1 378 ? 2.470   13.322  19.328 1.00 9.90  ? 487  ALA A CA  1 
ATOM   2896 C  C   . ALA A 1 378 ? 2.045   12.169  20.213 1.00 9.58  ? 487  ALA A C   1 
ATOM   2897 O  O   . ALA A 1 378 ? 1.011   12.255  20.866 1.00 11.00 ? 487  ALA A O   1 
ATOM   2898 C  CB  . ALA A 1 378 ? 3.239   14.323  20.157 1.00 12.74 ? 487  ALA A CB  1 
ATOM   2899 N  N   . GLN A 1 379 ? 2.822   11.085  20.211 1.00 10.86 ? 488  GLN A N   1 
ATOM   2900 C  CA  . GLN A 1 379 ? 2.624   9.969   21.138 1.00 11.66 ? 488  GLN A CA  1 
ATOM   2901 C  C   . GLN A 1 379 ? 3.868   9.762   21.971 1.00 12.26 ? 488  GLN A C   1 
ATOM   2902 O  O   . GLN A 1 379 ? 5.006   9.980   21.506 1.00 10.66 ? 488  GLN A O   1 
ATOM   2903 C  CB  . GLN A 1 379 ? 2.332   8.660   20.394 1.00 11.99 ? 488  GLN A CB  1 
ATOM   2904 C  CG  . GLN A 1 379 ? 1.031   8.675   19.582 1.00 13.54 ? 488  GLN A CG  1 
ATOM   2905 C  CD  . GLN A 1 379 ? 0.961   7.563   18.567 1.00 17.37 ? 488  GLN A CD  1 
ATOM   2906 O  OE1 . GLN A 1 379 ? 1.951   7.243   17.918 1.00 14.90 ? 488  GLN A OE1 1 
ATOM   2907 N  NE2 . GLN A 1 379 ? -0.220  6.956   18.426 1.00 15.51 ? 488  GLN A NE2 1 
ATOM   2908 N  N   . ALA A 1 380 ? 3.640   9.380   23.223 1.00 10.30 ? 489  ALA A N   1 
ATOM   2909 C  CA  . ALA A 1 380 ? 4.684   8.805   24.047 1.00 11.16 ? 489  ALA A CA  1 
ATOM   2910 C  C   . ALA A 1 380 ? 4.284   7.348   24.277 1.00 12.20 ? 489  ALA A C   1 
ATOM   2911 O  O   . ALA A 1 380 ? 3.303   7.076   24.982 1.00 12.20 ? 489  ALA A O   1 
ATOM   2912 C  CB  . ALA A 1 380 ? 4.792   9.531   25.357 1.00 13.00 ? 489  ALA A CB  1 
ATOM   2913 N  N   . ARG A 1 381 ? 5.000   6.429   23.626 1.00 10.34 ? 490  ARG A N   1 
ATOM   2914 C  CA  . ARG A 1 381 ? 4.730   4.999   23.788 1.00 13.58 ? 490  ARG A CA  1 
ATOM   2915 C  C   . ARG A 1 381 ? 5.575   4.512   24.965 1.00 13.92 ? 490  ARG A C   1 
ATOM   2916 O  O   . ARG A 1 381 ? 6.812   4.425   24.881 1.00 12.15 ? 490  ARG A O   1 
ATOM   2917 C  CB  . ARG A 1 381 ? 5.094   4.209   22.532 1.00 13.67 ? 490  ARG A CB  1 
ATOM   2918 C  CG  . ARG A 1 381 ? 4.422   4.673   21.226 1.00 10.09 ? 490  ARG A CG  1 
ATOM   2919 C  CD  . ARG A 1 381 ? 4.574   3.616   20.127 1.00 16.75 ? 490  ARG A CD  1 
ATOM   2920 N  NE  . ARG A 1 381 ? 3.855   2.410   20.524 1.00 16.04 ? 490  ARG A NE  1 
ATOM   2921 C  CZ  . ARG A 1 381 ? 2.689   2.013   20.029 1.00 19.45 ? 490  ARG A CZ  1 
ATOM   2922 N  NH1 . ARG A 1 381 ? 2.094   2.703   19.058 1.00 20.55 ? 490  ARG A NH1 1 
ATOM   2923 N  NH2 . ARG A 1 381 ? 2.104   0.931   20.533 1.00 15.45 ? 490  ARG A NH2 1 
ATOM   2924 N  N   . LEU A 1 382 ? 4.911   4.172   26.053 1.00 11.02 ? 491  LEU A N   1 
ATOM   2925 C  CA  . LEU A 1 382 ? 5.616   3.845   27.282 1.00 10.65 ? 491  LEU A CA  1 
ATOM   2926 C  C   . LEU A 1 382 ? 5.464   2.394   27.648 1.00 12.78 ? 491  LEU A C   1 
ATOM   2927 O  O   . LEU A 1 382 ? 4.365   1.847   27.606 1.00 12.32 ? 491  LEU A O   1 
ATOM   2928 C  CB  . LEU A 1 382 ? 5.089   4.702   28.440 1.00 11.81 ? 491  LEU A CB  1 
ATOM   2929 C  CG  . LEU A 1 382 ? 5.153   6.205   28.229 1.00 11.99 ? 491  LEU A CG  1 
ATOM   2930 C  CD1 . LEU A 1 382 ? 4.663   6.955   29.479 1.00 12.67 ? 491  LEU A CD1 1 
ATOM   2931 C  CD2 . LEU A 1 382 ? 6.594   6.632   27.881 1.00 12.26 ? 491  LEU A CD2 1 
ATOM   2932 N  N   . THR A 1 383 ? 6.574   1.791   28.058 1.00 11.90 ? 492  THR A N   1 
ATOM   2933 C  CA  . THR A 1 383 ? 6.549   0.481   28.688 1.00 12.71 ? 492  THR A CA  1 
ATOM   2934 C  C   . THR A 1 383 ? 7.096   0.616   30.106 1.00 14.21 ? 492  THR A C   1 
ATOM   2935 O  O   . THR A 1 383 ? 8.209   1.095   30.320 1.00 15.37 ? 492  THR A O   1 
ATOM   2936 C  CB  . THR A 1 383 ? 7.379   -0.536  27.897 1.00 12.35 ? 492  THR A CB  1 
ATOM   2937 O  OG1 . THR A 1 383 ? 6.963   -0.542  26.527 1.00 12.73 ? 492  THR A OG1 1 
ATOM   2938 C  CG2 . THR A 1 383 ? 7.226   -1.936  28.465 1.00 13.44 ? 492  THR A CG2 1 
ATOM   2939 N  N   . LEU A 1 384 ? 6.295   0.234   31.087 1.00 12.91 ? 493  LEU A N   1 
ATOM   2940 C  CA  . LEU A 1 384 ? 6.704   0.375   32.477 1.00 14.27 ? 493  LEU A CA  1 
ATOM   2941 C  C   . LEU A 1 384 ? 5.997   -0.630  33.370 1.00 13.71 ? 493  LEU A C   1 
ATOM   2942 O  O   . LEU A 1 384 ? 4.878   -1.072  33.073 1.00 13.74 ? 493  LEU A O   1 
ATOM   2943 C  CB  . LEU A 1 384 ? 6.419   1.804   32.993 1.00 13.59 ? 493  LEU A CB  1 
ATOM   2944 C  CG  . LEU A 1 384 ? 4.970   2.277   33.162 1.00 11.24 ? 493  LEU A CG  1 
ATOM   2945 C  CD1 . LEU A 1 384 ? 4.398   1.909   34.515 1.00 12.08 ? 493  LEU A CD1 1 
ATOM   2946 C  CD2 . LEU A 1 384 ? 4.874   3.786   32.968 1.00 11.92 ? 493  LEU A CD2 1 
ATOM   2947 N  N   . SER A 1 385 ? 6.650   -0.949  34.481 1.00 13.94 ? 494  SER A N   1 
ATOM   2948 C  CA  . SER A 1 385 ? 6.058   -1.762  35.527 1.00 15.61 ? 494  SER A CA  1 
ATOM   2949 C  C   . SER A 1 385 ? 5.753   -0.821  36.661 1.00 13.27 ? 494  SER A C   1 
ATOM   2950 O  O   . SER A 1 385 ? 6.447   0.188   36.828 1.00 14.27 ? 494  SER A O   1 
ATOM   2951 C  CB  . SER A 1 385 ? 7.045   -2.840  35.996 1.00 16.14 ? 494  SER A CB  1 
ATOM   2952 O  OG  . SER A 1 385 ? 8.350   -2.295  36.176 1.00 15.68 ? 494  SER A OG  1 
ATOM   2953 N  N   . TYR A 1 386 ? 4.706   -1.125  37.424 1.00 12.84 ? 495  TYR A N   1 
ATOM   2954 C  CA  . TYR A 1 386 ? 4.406   -0.393  38.649 1.00 11.50 ? 495  TYR A CA  1 
ATOM   2955 C  C   . TYR A 1 386 ? 3.482   -1.252  39.484 1.00 12.62 ? 495  TYR A C   1 
ATOM   2956 O  O   . TYR A 1 386 ? 2.733   -2.046  38.948 1.00 11.73 ? 495  TYR A O   1 
ATOM   2957 C  CB  . TYR A 1 386 ? 3.744   0.939   38.364 1.00 13.78 ? 495  TYR A CB  1 
ATOM   2958 C  CG  . TYR A 1 386 ? 4.112   1.997   39.370 1.00 13.05 ? 495  TYR A CG  1 
ATOM   2959 C  CD1 . TYR A 1 386 ? 5.424   2.388   39.514 1.00 14.10 ? 495  TYR A CD1 1 
ATOM   2960 C  CD2 . TYR A 1 386 ? 3.159   2.586   40.192 1.00 14.72 ? 495  TYR A CD2 1 
ATOM   2961 C  CE1 . TYR A 1 386 ? 5.788   3.334   40.413 1.00 16.12 ? 495  TYR A CE1 1 
ATOM   2962 C  CE2 . TYR A 1 386 ? 3.525   3.551   41.119 1.00 13.59 ? 495  TYR A CE2 1 
ATOM   2963 C  CZ  . TYR A 1 386 ? 4.851   3.912   41.220 1.00 14.37 ? 495  TYR A CZ  1 
ATOM   2964 O  OH  . TYR A 1 386 ? 5.289   4.851   42.127 1.00 17.79 ? 495  TYR A OH  1 
ATOM   2965 N  N   . ASN A 1 387 ? 3.548   -1.099  40.798 1.00 14.59 ? 496  ASN A N   1 
ATOM   2966 C  CA  . ASN A 1 387 ? 2.774   -1.960  41.685 1.00 15.84 ? 496  ASN A CA  1 
ATOM   2967 C  C   . ASN A 1 387 ? 1.296   -1.578  41.785 1.00 15.06 ? 496  ASN A C   1 
ATOM   2968 O  O   . ASN A 1 387 ? 0.452   -2.447  42.019 1.00 16.21 ? 496  ASN A O   1 
ATOM   2969 C  CB  . ASN A 1 387 ? 3.401   -2.025  43.082 1.00 14.22 ? 496  ASN A CB  1 
ATOM   2970 C  CG  . ASN A 1 387 ? 3.377   -0.715  43.804 1.00 15.85 ? 496  ASN A CG  1 
ATOM   2971 O  OD1 . ASN A 1 387 ? 3.959   0.287   43.356 1.00 13.18 ? 496  ASN A OD1 1 
ATOM   2972 N  ND2 . ASN A 1 387 ? 2.732   -0.713  44.974 1.00 16.26 ? 496  ASN A ND2 1 
ATOM   2973 N  N   . ARG A 1 388 ? 0.999   -0.291  41.625 1.00 14.25 ? 497  ARG A N   1 
ATOM   2974 C  CA  . ARG A 1 388 ? -0.389  0.218   41.641 1.00 14.82 ? 497  ARG A CA  1 
ATOM   2975 C  C   . ARG A 1 388 ? -0.574  1.302   40.567 1.00 13.56 ? 497  ARG A C   1 
ATOM   2976 O  O   . ARG A 1 388 ? -0.265  2.464   40.804 1.00 11.56 ? 497  ARG A O   1 
ATOM   2977 C  CB  . ARG A 1 388 ? -0.761  0.806   42.998 1.00 13.53 ? 497  ARG A CB  1 
ATOM   2978 C  CG  . ARG A 1 388 ? -2.280  1.060   43.136 1.00 14.34 ? 497  ARG A CG  1 
ATOM   2979 C  CD  . ARG A 1 388 ? -2.691  1.444   44.533 1.00 21.70 ? 497  ARG A CD  1 
ATOM   2980 N  NE  . ARG A 1 388 ? -4.122  1.189   44.690 1.00 17.31 ? 497  ARG A NE  1 
ATOM   2981 C  CZ  . ARG A 1 388 ? -5.073  1.993   44.230 1.00 20.13 ? 497  ARG A CZ  1 
ATOM   2982 N  NH1 . ARG A 1 388 ? -4.746  3.117   43.600 1.00 17.72 ? 497  ARG A NH1 1 
ATOM   2983 N  NH2 . ARG A 1 388 ? -6.349  1.667   44.402 1.00 18.34 ? 497  ARG A NH2 1 
ATOM   2984 N  N   . ARG A 1 389 ? -1.089  0.898   39.408 1.00 13.50 ? 498  ARG A N   1 
ATOM   2985 C  CA  . ARG A 1 389 ? -1.096  1.739   38.212 1.00 13.86 ? 498  ARG A CA  1 
ATOM   2986 C  C   . ARG A 1 389 ? -1.772  3.092   38.424 1.00 11.38 ? 498  ARG A C   1 
ATOM   2987 O  O   . ARG A 1 389 ? -1.270  4.128   38.002 1.00 11.40 ? 498  ARG A O   1 
ATOM   2988 C  CB  . ARG A 1 389 ? -1.769  0.990   37.069 1.00 15.75 ? 498  ARG A CB  1 
ATOM   2989 C  CG  . ARG A 1 389 ? -1.444  1.552   35.686 1.00 12.83 ? 498  ARG A CG  1 
ATOM   2990 C  CD  . ARG A 1 389 ? -1.807  0.571   34.607 1.00 15.77 ? 498  ARG A CD  1 
ATOM   2991 N  NE  . ARG A 1 389 ? -3.195  0.115   34.737 1.00 13.08 ? 498  ARG A NE  1 
ATOM   2992 C  CZ  . ARG A 1 389 ? -3.715  -0.916  34.092 1.00 13.73 ? 498  ARG A CZ  1 
ATOM   2993 N  NH1 . ARG A 1 389 ? -2.979  -1.600  33.254 1.00 12.53 ? 498  ARG A NH1 1 
ATOM   2994 N  NH2 . ARG A 1 389 ? -4.993  -1.263  34.292 1.00 16.27 ? 498  ARG A NH2 1 
ATOM   2995 N  N   . GLY A 1 390 ? -2.908  3.080   39.092 1.00 14.66 ? 499  GLY A N   1 
ATOM   2996 C  CA  . GLY A 1 390 ? -3.691  4.292   39.276 1.00 14.00 ? 499  GLY A CA  1 
ATOM   2997 C  C   . GLY A 1 390 ? -3.060  5.369   40.130 1.00 13.54 ? 499  GLY A C   1 
ATOM   2998 O  O   . GLY A 1 390 ? -3.551  6.501   40.164 1.00 15.60 ? 499  GLY A O   1 
ATOM   2999 N  N   . ASP A 1 391 ? -1.985  5.046   40.839 1.00 11.35 ? 500  ASP A N   1 
ATOM   3000 C  CA  . ASP A 1 391 ? -1.320  6.072   41.624 1.00 12.85 ? 500  ASP A CA  1 
ATOM   3001 C  C   . ASP A 1 391 ? -0.397  6.948   40.775 1.00 13.31 ? 500  ASP A C   1 
ATOM   3002 O  O   . ASP A 1 391 ? 0.028   8.030   41.199 1.00 14.20 ? 500  ASP A O   1 
ATOM   3003 C  CB  . ASP A 1 391 ? -0.534  5.442   42.762 1.00 13.35 ? 500  ASP A CB  1 
ATOM   3004 C  CG  . ASP A 1 391 ? -1.424  4.931   43.875 1.00 21.35 ? 500  ASP A CG  1 
ATOM   3005 O  OD1 . ASP A 1 391 ? -2.665  5.173   43.818 1.00 16.45 ? 500  ASP A OD1 1 
ATOM   3006 O  OD2 . ASP A 1 391 ? -0.861  4.293   44.801 1.00 16.57 ? 500  ASP A OD2 1 
ATOM   3007 N  N   . LEU A 1 392 ? -0.112  6.500   39.561 1.00 14.04 ? 501  LEU A N   1 
ATOM   3008 C  CA  . LEU A 1 392 ? 0.715   7.264   38.642 1.00 10.17 ? 501  LEU A CA  1 
ATOM   3009 C  C   . LEU A 1 392 ? -0.021  8.438   37.988 1.00 12.25 ? 501  LEU A C   1 
ATOM   3010 O  O   . LEU A 1 392 ? -1.183  8.310   37.604 1.00 12.14 ? 501  LEU A O   1 
ATOM   3011 C  CB  . LEU A 1 392 ? 1.195   6.338   37.522 1.00 11.88 ? 501  LEU A CB  1 
ATOM   3012 C  CG  . LEU A 1 392 ? 2.141   5.202   37.919 1.00 14.62 ? 501  LEU A CG  1 
ATOM   3013 C  CD1 . LEU A 1 392 ? 2.357   4.284   36.761 1.00 14.30 ? 501  LEU A CD1 1 
ATOM   3014 C  CD2 . LEU A 1 392 ? 3.491   5.743   38.400 1.00 13.37 ? 501  LEU A CD2 1 
ATOM   3015 N  N   . ALA A 1 393 ? 0.694   9.546   37.823 1.00 10.05 ? 502  ALA A N   1 
ATOM   3016 C  CA  . ALA A 1 393 ? 0.334   10.622  36.895 1.00 9.74  ? 502  ALA A CA  1 
ATOM   3017 C  C   . ALA A 1 393 ? 1.538   10.790  35.987 1.00 13.27 ? 502  ALA A C   1 
ATOM   3018 O  O   . ALA A 1 393 ? 2.688   10.731  36.450 1.00 12.34 ? 502  ALA A O   1 
ATOM   3019 C  CB  . ALA A 1 393 ? 0.046   11.922  37.638 1.00 9.72  ? 502  ALA A CB  1 
ATOM   3020 N  N   . ILE A 1 394 ? 1.282   11.050  34.710 1.00 8.43  ? 503  ILE A N   1 
ATOM   3021 C  CA  . ILE A 1 394 ? 2.338   11.148  33.718 1.00 9.23  ? 503  ILE A CA  1 
ATOM   3022 C  C   . ILE A 1 394 ? 2.114   12.405  32.893 1.00 8.44  ? 503  ILE A C   1 
ATOM   3023 O  O   . ILE A 1 394 ? 0.992   12.648  32.455 1.00 10.41 ? 503  ILE A O   1 
ATOM   3024 C  CB  . ILE A 1 394 ? 2.293   9.930   32.781 1.00 9.95  ? 503  ILE A CB  1 
ATOM   3025 C  CG1 . ILE A 1 394 ? 2.500   8.660   33.602 1.00 12.45 ? 503  ILE A CG1 1 
ATOM   3026 C  CG2 . ILE A 1 394 ? 3.385   10.045  31.743 1.00 10.40 ? 503  ILE A CG2 1 
ATOM   3027 C  CD1 . ILE A 1 394 ? 2.420   7.339   32.814 1.00 15.88 ? 503  ILE A CD1 1 
ATOM   3028 N  N   . HIS A 1 395 ? 3.161   13.208  32.700 1.00 9.79  ? 504  HIS A N   1 
ATOM   3029 C  CA  . HIS A 1 395 ? 3.069   14.435  31.904 1.00 8.98  ? 504  HIS A CA  1 
ATOM   3030 C  C   . HIS A 1 395 ? 4.188   14.454  30.874 1.00 11.70 ? 504  HIS A C   1 
ATOM   3031 O  O   . HIS A 1 395 ? 5.252   13.854  31.086 1.00 10.89 ? 504  HIS A O   1 
ATOM   3032 C  CB  . HIS A 1 395 ? 3.211   15.692  32.778 1.00 11.86 ? 504  HIS A CB  1 
ATOM   3033 C  CG  . HIS A 1 395 ? 2.091   15.863  33.751 1.00 13.54 ? 504  HIS A CG  1 
ATOM   3034 N  ND1 . HIS A 1 395 ? 2.031   15.164  34.933 1.00 14.44 ? 504  HIS A ND1 1 
ATOM   3035 C  CD2 . HIS A 1 395 ? 0.959   16.604  33.690 1.00 12.91 ? 504  HIS A CD2 1 
ATOM   3036 C  CE1 . HIS A 1 395 ? 0.918   15.481  35.574 1.00 15.47 ? 504  HIS A CE1 1 
ATOM   3037 N  NE2 . HIS A 1 395 ? 0.251   16.352  34.840 1.00 15.81 ? 504  HIS A NE2 1 
ATOM   3038 N  N   . LEU A 1 396 ? 3.939   15.172  29.782 1.00 9.58  ? 505  LEU A N   1 
ATOM   3039 C  CA  . LEU A 1 396 ? 4.893   15.325  28.685 1.00 10.29 ? 505  LEU A CA  1 
ATOM   3040 C  C   . LEU A 1 396 ? 4.970   16.810  28.362 1.00 11.68 ? 505  LEU A C   1 
ATOM   3041 O  O   . LEU A 1 396 ? 3.934   17.428  28.123 1.00 10.60 ? 505  LEU A O   1 
ATOM   3042 C  CB  . LEU A 1 396 ? 4.406   14.562  27.463 1.00 10.92 ? 505  LEU A CB  1 
ATOM   3043 C  CG  . LEU A 1 396 ? 5.329   14.605  26.219 1.00 11.06 ? 505  LEU A CG  1 
ATOM   3044 C  CD1 . LEU A 1 396 ? 6.648   13.898  26.577 1.00 11.98 ? 505  LEU A CD1 1 
ATOM   3045 C  CD2 . LEU A 1 396 ? 4.696   13.965  25.041 1.00 11.59 ? 505  LEU A CD2 1 
ATOM   3046 N  N   . VAL A 1 397 ? 6.171   17.383  28.404 1.00 11.21 ? 506  VAL A N   1 
ATOM   3047 C  CA  . VAL A 1 397 ? 6.350   18.806  28.111 1.00 10.50 ? 506  VAL A CA  1 
ATOM   3048 C  C   . VAL A 1 397 ? 7.110   18.945  26.791 1.00 10.30 ? 506  VAL A C   1 
ATOM   3049 O  O   . VAL A 1 397 ? 8.161   18.343  26.611 1.00 8.94  ? 506  VAL A O   1 
ATOM   3050 C  CB  . VAL A 1 397 ? 7.166   19.496  29.205 1.00 10.24 ? 506  VAL A CB  1 
ATOM   3051 C  CG1 . VAL A 1 397 ? 7.173   21.001  29.019 1.00 8.78  ? 506  VAL A CG1 1 
ATOM   3052 C  CG2 . VAL A 1 397 ? 6.628   19.121  30.596 1.00 14.89 ? 506  VAL A CG2 1 
ATOM   3053 N  N   . SER A 1 398 ? 6.582   19.743  25.871 1.00 9.27  ? 507  SER A N   1 
ATOM   3054 C  CA  . SER A 1 398 ? 7.223   19.964  24.592 1.00 10.57 ? 507  SER A CA  1 
ATOM   3055 C  C   . SER A 1 398 ? 8.320   21.005  24.720 1.00 10.26 ? 507  SER A C   1 
ATOM   3056 O  O   . SER A 1 398 ? 8.337   21.773  25.712 1.00 11.58 ? 507  SER A O   1 
ATOM   3057 C  CB  . SER A 1 398 ? 6.200   20.476  23.594 1.00 8.16  ? 507  SER A CB  1 
ATOM   3058 O  OG  . SER A 1 398 ? 5.758   21.769  23.975 1.00 12.39 ? 507  SER A OG  1 
ATOM   3059 N  N   . PRO A 1 399 ? 9.217   21.092  23.711 1.00 8.62  ? 508  PRO A N   1 
ATOM   3060 C  CA  . PRO A 1 399 ? 10.308  22.087  23.803 1.00 8.63  ? 508  PRO A CA  1 
ATOM   3061 C  C   . PRO A 1 399 ? 9.807   23.535  23.964 1.00 11.02 ? 508  PRO A C   1 
ATOM   3062 O  O   . PRO A 1 399 ? 10.426  24.337  24.694 1.00 12.51 ? 508  PRO A O   1 
ATOM   3063 C  CB  . PRO A 1 399 ? 11.072  21.909  22.480 1.00 12.92 ? 508  PRO A CB  1 
ATOM   3064 C  CG  . PRO A 1 399 ? 10.773  20.493  22.056 1.00 11.45 ? 508  PRO A CG  1 
ATOM   3065 C  CD  . PRO A 1 399 ? 9.367   20.215  22.532 1.00 11.10 ? 508  PRO A CD  1 
ATOM   3066 N  N   . MET A 1 400 ? 8.683   23.850  23.330 1.00 10.61 ? 509  MET A N   1 
ATOM   3067 C  CA  . MET A 1 400 ? 8.080   25.177  23.455 1.00 12.52 ? 509  MET A CA  1 
ATOM   3068 C  C   . MET A 1 400 ? 7.409   25.409  24.823 1.00 14.40 ? 509  MET A C   1 
ATOM   3069 O  O   . MET A 1 400 ? 7.021   26.539  25.146 1.00 14.38 ? 509  MET A O   1 
ATOM   3070 C  CB  . MET A 1 400 ? 7.058   25.421  22.341 1.00 13.85 ? 509  MET A CB  1 
ATOM   3071 C  CG  . MET A 1 400 ? 7.676   25.567  20.932 1.00 13.88 ? 509  MET A CG  1 
ATOM   3072 S  SD  . MET A 1 400 ? 6.442   25.755  19.630 1.00 11.98 ? 509  MET A SD  1 
ATOM   3073 C  CE  . MET A 1 400 ? 6.918   27.318  18.910 1.00 16.46 ? 509  MET A CE  1 
ATOM   3074 N  N   . GLY A 1 401 ? 7.224   24.349  25.606 1.00 12.35 ? 510  GLY A N   1 
ATOM   3075 C  CA  . GLY A 1 401 ? 6.851   24.499  27.002 1.00 13.22 ? 510  GLY A CA  1 
ATOM   3076 C  C   . GLY A 1 401 ? 5.466   23.986  27.357 1.00 11.97 ? 510  GLY A C   1 
ATOM   3077 O  O   . GLY A 1 401 ? 4.995   24.168  28.471 1.00 9.61  ? 510  GLY A O   1 
ATOM   3078 N  N   . THR A 1 402 ? 4.804   23.337  26.415 1.00 10.23 ? 511  THR A N   1 
ATOM   3079 C  CA  . THR A 1 402 ? 3.428   22.917  26.633 1.00 8.66  ? 511  THR A CA  1 
ATOM   3080 C  C   . THR A 1 402 ? 3.379   21.601  27.401 1.00 10.95 ? 511  THR A C   1 
ATOM   3081 O  O   . THR A 1 402 ? 3.932   20.595  26.964 1.00 11.20 ? 511  THR A O   1 
ATOM   3082 C  CB  . THR A 1 402 ? 2.704   22.752  25.313 1.00 12.45 ? 511  THR A CB  1 
ATOM   3083 O  OG1 . THR A 1 402 ? 2.789   23.977  24.568 1.00 11.96 ? 511  THR A OG1 1 
ATOM   3084 C  CG2 . THR A 1 402 ? 1.223   22.358  25.522 1.00 7.96  ? 511  THR A CG2 1 
ATOM   3085 N  N   . ARG A 1 403 ? 2.727   21.638  28.561 1.00 10.94 ? 512  ARG A N   1 
ATOM   3086 C  CA  . ARG A 1 403 ? 2.559   20.473  29.420 1.00 12.63 ? 512  ARG A CA  1 
ATOM   3087 C  C   . ARG A 1 403 ? 1.262   19.715  29.096 1.00 12.51 ? 512  ARG A C   1 
ATOM   3088 O  O   . ARG A 1 403 ? 0.155   20.224  29.277 1.00 14.12 ? 512  ARG A O   1 
ATOM   3089 C  CB  . ARG A 1 403 ? 2.559   20.896  30.898 1.00 13.25 ? 512  ARG A CB  1 
ATOM   3090 C  CG  . ARG A 1 403 ? 3.696   21.870  31.289 1.00 16.32 ? 512  ARG A CG  1 
ATOM   3091 C  CD  . ARG A 1 403 ? 3.740   22.154  32.814 1.00 25.78 ? 512  ARG A CD  1 
ATOM   3092 N  NE  . ARG A 1 403 ? 3.317   20.975  33.573 1.00 21.37 ? 512  ARG A NE  1 
ATOM   3093 C  CZ  . ARG A 1 403 ? 4.128   20.020  33.985 1.00 22.91 ? 512  ARG A CZ  1 
ATOM   3094 N  NH1 . ARG A 1 403 ? 5.433   20.119  33.746 1.00 29.86 ? 512  ARG A NH1 1 
ATOM   3095 N  NH2 . ARG A 1 403 ? 3.640   18.985  34.655 1.00 20.91 ? 512  ARG A NH2 1 
ATOM   3096 N  N   . SER A 1 404 ? 1.416   18.497  28.610 1.00 11.69 ? 513  SER A N   1 
ATOM   3097 C  CA  . SER A 1 404 ? 0.294   17.623  28.358 1.00 11.13 ? 513  SER A CA  1 
ATOM   3098 C  C   . SER A 1 404 ? 0.267   16.616  29.469 1.00 11.87 ? 513  SER A C   1 
ATOM   3099 O  O   . SER A 1 404 ? 1.290   16.036  29.795 1.00 11.55 ? 513  SER A O   1 
ATOM   3100 C  CB  . SER A 1 404 ? 0.465   16.871  27.040 1.00 9.43  ? 513  SER A CB  1 
ATOM   3101 O  OG  . SER A 1 404 ? 0.367   17.714  25.887 1.00 8.74  ? 513  SER A OG  1 
ATOM   3102 N  N   . THR A 1 405 ? -0.890  16.459  30.096 1.00 9.66  ? 514  THR A N   1 
ATOM   3103 C  CA  . THR A 1 405 ? -1.139  15.328  30.973 1.00 11.36 ? 514  THR A CA  1 
ATOM   3104 C  C   . THR A 1 405 ? -1.451  14.079  30.154 1.00 12.99 ? 514  THR A C   1 
ATOM   3105 O  O   . THR A 1 405 ? -2.486  13.980  29.505 1.00 12.17 ? 514  THR A O   1 
ATOM   3106 C  CB  . THR A 1 405 ? -2.301  15.630  31.932 1.00 11.34 ? 514  THR A CB  1 
ATOM   3107 O  OG1 . THR A 1 405 ? -2.045  16.868  32.599 1.00 13.03 ? 514  THR A OG1 1 
ATOM   3108 C  CG2 . THR A 1 405 ? -2.413  14.527  32.975 1.00 15.69 ? 514  THR A CG2 1 
ATOM   3109 N  N   . LEU A 1 406 ? -0.541  13.130  30.191 1.00 8.14  ? 515  LEU A N   1 
ATOM   3110 C  CA  . LEU A 1 406 ? -0.741  11.880  29.485 1.00 8.83  ? 515  LEU A CA  1 
ATOM   3111 C  C   . LEU A 1 406 ? -1.624  10.915  30.277 1.00 14.40 ? 515  LEU A C   1 
ATOM   3112 O  O   . LEU A 1 406 ? -2.347  10.109  29.683 1.00 12.33 ? 515  LEU A O   1 
ATOM   3113 C  CB  . LEU A 1 406 ? 0.614   11.241  29.202 1.00 10.46 ? 515  LEU A CB  1 
ATOM   3114 C  CG  . LEU A 1 406 ? 1.571   12.031  28.287 1.00 9.48  ? 515  LEU A CG  1 
ATOM   3115 C  CD1 . LEU A 1 406 ? 2.785   11.195  27.986 1.00 11.71 ? 515  LEU A CD1 1 
ATOM   3116 C  CD2 . LEU A 1 406 ? 0.905   12.465  27.004 1.00 13.24 ? 515  LEU A CD2 1 
ATOM   3117 N  N   . LEU A 1 407 ? -1.549  11.007  31.611 1.00 11.29 ? 516  LEU A N   1 
ATOM   3118 C  CA  . LEU A 1 407 ? -2.272  10.119  32.495 1.00 10.93 ? 516  LEU A CA  1 
ATOM   3119 C  C   . LEU A 1 407 ? -2.462  10.841  33.812 1.00 10.08 ? 516  LEU A C   1 
ATOM   3120 O  O   . LEU A 1 407 ? -1.485  11.281  34.411 1.00 9.83  ? 516  LEU A O   1 
ATOM   3121 C  CB  . LEU A 1 407 ? -1.495  8.816   32.717 1.00 10.53 ? 516  LEU A CB  1 
ATOM   3122 C  CG  . LEU A 1 407 ? -2.152  7.816   33.660 1.00 10.20 ? 516  LEU A CG  1 
ATOM   3123 C  CD1 . LEU A 1 407 ? -3.494  7.327   33.110 1.00 11.67 ? 516  LEU A CD1 1 
ATOM   3124 C  CD2 . LEU A 1 407 ? -1.231  6.612   33.956 1.00 12.07 ? 516  LEU A CD2 1 
ATOM   3125 N  N   . ALA A 1 408 ? -3.703  10.999  34.251 1.00 11.98 ? 517  ALA A N   1 
ATOM   3126 C  CA  . ALA A 1 408 ? -3.976  11.491  35.601 1.00 10.25 ? 517  ALA A CA  1 
ATOM   3127 C  C   . ALA A 1 408 ? -4.130  10.290  36.521 1.00 11.18 ? 517  ALA A C   1 
ATOM   3128 O  O   . ALA A 1 408 ? -4.404  9.167   36.062 1.00 11.65 ? 517  ALA A O   1 
ATOM   3129 C  CB  . ALA A 1 408 ? -5.256  12.342  35.637 1.00 14.19 ? 517  ALA A CB  1 
ATOM   3130 N  N   . ALA A 1 409 ? -3.959  10.523  37.822 1.00 12.16 ? 518  ALA A N   1 
ATOM   3131 C  CA  . ALA A 1 409 ? -4.258  9.503   38.828 1.00 11.97 ? 518  ALA A CA  1 
ATOM   3132 C  C   . ALA A 1 409 ? -5.664  8.905   38.605 1.00 13.69 ? 518  ALA A C   1 
ATOM   3133 O  O   . ALA A 1 409 ? -6.639  9.618   38.330 1.00 11.27 ? 518  ALA A O   1 
ATOM   3134 C  CB  . ALA A 1 409 ? -4.126  10.096  40.247 1.00 16.39 ? 518  ALA A CB  1 
ATOM   3135 N  N   . ARG A 1 410 ? -5.748  7.584   38.672 1.00 9.69  ? 519  ARG A N   1 
ATOM   3136 C  CA  . ARG A 1 410 ? -7.018  6.877   38.574 1.00 9.95  ? 519  ARG A CA  1 
ATOM   3137 C  C   . ARG A 1 410 ? -7.127  6.035   39.829 1.00 11.51 ? 519  ARG A C   1 
ATOM   3138 O  O   . ARG A 1 410 ? -6.669  4.913   39.859 1.00 13.03 ? 519  ARG A O   1 
ATOM   3139 C  CB  . ARG A 1 410 ? -7.048  5.980   37.329 1.00 15.03 ? 519  ARG A CB  1 
ATOM   3140 C  CG  . ARG A 1 410 ? -7.081  6.725   36.007 1.00 10.59 ? 519  ARG A CG  1 
ATOM   3141 C  CD  . ARG A 1 410 ? -7.705  5.842   34.913 1.00 13.94 ? 519  ARG A CD  1 
ATOM   3142 N  NE  . ARG A 1 410 ? -6.986  4.569   34.771 1.00 12.44 ? 519  ARG A NE  1 
ATOM   3143 C  CZ  . ARG A 1 410 ? -7.385  3.573   33.987 1.00 11.48 ? 519  ARG A CZ  1 
ATOM   3144 N  NH1 . ARG A 1 410 ? -6.699  2.447   33.945 1.00 13.25 ? 519  ARG A NH1 1 
ATOM   3145 N  NH2 . ARG A 1 410 ? -8.483  3.696   33.253 1.00 12.26 ? 519  ARG A NH2 1 
ATOM   3146 N  N   . PRO A 1 411 ? -7.716  6.599   40.887 1.00 11.84 ? 520  PRO A N   1 
ATOM   3147 C  CA  . PRO A 1 411 ? -7.659  6.016   42.232 1.00 17.74 ? 520  PRO A CA  1 
ATOM   3148 C  C   . PRO A 1 411 ? -8.199  4.602   42.318 1.00 16.42 ? 520  PRO A C   1 
ATOM   3149 O  O   . PRO A 1 411 ? -7.744  3.837   43.166 1.00 18.52 ? 520  PRO A O   1 
ATOM   3150 C  CB  . PRO A 1 411 ? -8.498  6.998   43.082 1.00 18.26 ? 520  PRO A CB  1 
ATOM   3151 C  CG  . PRO A 1 411 ? -8.419  8.277   42.337 1.00 22.87 ? 520  PRO A CG  1 
ATOM   3152 C  CD  . PRO A 1 411 ? -8.371  7.913   40.884 1.00 14.69 ? 520  PRO A CD  1 
ATOM   3153 N  N   . HIS A 1 412 ? -9.162  4.247   41.476 1.00 13.59 ? 521  HIS A N   1 
ATOM   3154 C  CA  . HIS A 1 412 ? -9.708  2.916   41.524 1.00 13.26 ? 521  HIS A CA  1 
ATOM   3155 C  C   . HIS A 1 412 ? -8.832  1.873   40.826 1.00 15.01 ? 521  HIS A C   1 
ATOM   3156 O  O   . HIS A 1 412 ? -9.105  0.671   40.929 1.00 15.52 ? 521  HIS A O   1 
ATOM   3157 C  CB  . HIS A 1 412 ? -11.106 2.878   40.898 1.00 13.85 ? 521  HIS A CB  1 
ATOM   3158 C  CG  . HIS A 1 412 ? -12.095 3.776   41.577 1.00 16.40 ? 521  HIS A CG  1 
ATOM   3159 N  ND1 . HIS A 1 412 ? -13.424 3.817   41.220 1.00 20.38 ? 521  HIS A ND1 1 
ATOM   3160 C  CD2 . HIS A 1 412 ? -11.940 4.693   42.561 1.00 22.30 ? 521  HIS A CD2 1 
ATOM   3161 C  CE1 . HIS A 1 412 ? -14.054 4.704   41.972 1.00 21.30 ? 521  HIS A CE1 1 
ATOM   3162 N  NE2 . HIS A 1 412 ? -13.177 5.255   42.792 1.00 20.67 ? 521  HIS A NE2 1 
ATOM   3163 N  N   . ASP A 1 413 ? -7.807  2.309   40.092 1.00 13.36 ? 522  ASP A N   1 
ATOM   3164 C  CA  . ASP A 1 413 ? -7.041  1.374   39.260 1.00 13.48 ? 522  ASP A CA  1 
ATOM   3165 C  C   . ASP A 1 413 ? -5.926  0.761   40.094 1.00 15.83 ? 522  ASP A C   1 
ATOM   3166 O  O   . ASP A 1 413 ? -4.862  1.370   40.278 1.00 15.20 ? 522  ASP A O   1 
ATOM   3167 C  CB  . ASP A 1 413 ? -6.469  2.090   38.016 1.00 11.86 ? 522  ASP A CB  1 
ATOM   3168 C  CG  . ASP A 1 413 ? -5.637  1.180   37.135 1.00 14.60 ? 522  ASP A CG  1 
ATOM   3169 O  OD1 . ASP A 1 413 ? -5.650  -0.050  37.369 1.00 14.26 ? 522  ASP A OD1 1 
ATOM   3170 O  OD2 . ASP A 1 413 ? -4.991  1.693   36.174 1.00 13.24 ? 522  ASP A OD2 1 
ATOM   3171 N  N   . TYR A 1 414 ? -6.162  -0.448  40.612 1.00 18.71 ? 523  TYR A N   1 
ATOM   3172 C  CA  . TYR A 1 414 ? -5.140  -1.110  41.431 1.00 14.21 ? 523  TYR A CA  1 
ATOM   3173 C  C   . TYR A 1 414 ? -4.357  -2.168  40.650 1.00 19.05 ? 523  TYR A C   1 
ATOM   3174 O  O   . TYR A 1 414 ? -3.696  -3.046  41.228 1.00 17.50 ? 523  TYR A O   1 
ATOM   3175 C  CB  . TYR A 1 414 ? -5.777  -1.686  42.692 1.00 17.48 ? 523  TYR A CB  1 
ATOM   3176 C  CG  . TYR A 1 414 ? -6.815  -2.739  42.401 1.00 16.66 ? 523  TYR A CG  1 
ATOM   3177 C  CD1 . TYR A 1 414 ? -8.163  -2.422  42.347 1.00 20.87 ? 523  TYR A CD1 1 
ATOM   3178 C  CD2 . TYR A 1 414 ? -6.446  -4.047  42.203 1.00 18.57 ? 523  TYR A CD2 1 
ATOM   3179 C  CE1 . TYR A 1 414 ? -9.123  -3.412  42.102 1.00 22.72 ? 523  TYR A CE1 1 
ATOM   3180 C  CE2 . TYR A 1 414 ? -7.384  -5.026  41.958 1.00 22.86 ? 523  TYR A CE2 1 
ATOM   3181 C  CZ  . TYR A 1 414 ? -8.712  -4.698  41.897 1.00 24.37 ? 523  TYR A CZ  1 
ATOM   3182 O  OH  . TYR A 1 414 ? -9.624  -5.685  41.648 1.00 30.97 ? 523  TYR A OH  1 
ATOM   3183 N  N   . SER A 1 415 ? -4.406  -2.087  39.323 1.00 15.82 ? 524  SER A N   1 
ATOM   3184 C  CA  . SER A 1 415 ? -3.653  -3.011  38.501 1.00 15.38 ? 524  SER A CA  1 
ATOM   3185 C  C   . SER A 1 415 ? -2.144  -3.009  38.788 1.00 17.05 ? 524  SER A C   1 
ATOM   3186 O  O   . SER A 1 415 ? -1.531  -1.955  39.044 1.00 14.03 ? 524  SER A O   1 
ATOM   3187 C  CB  . SER A 1 415 ? -3.860  -2.688  37.043 1.00 19.20 ? 524  SER A CB  1 
ATOM   3188 O  OG  . SER A 1 415 ? -3.164  -3.617  36.246 1.00 17.61 ? 524  SER A OG  1 
ATOM   3189 N  N   . ALA A 1 416 ? -1.556  -4.200  38.696 1.00 18.05 ? 525  ALA A N   1 
ATOM   3190 C  CA  . ALA A 1 416 ? -0.118  -4.388  38.860 1.00 17.28 ? 525  ALA A CA  1 
ATOM   3191 C  C   . ALA A 1 416 ? 0.498   -4.711  37.509 1.00 19.32 ? 525  ALA A C   1 
ATOM   3192 O  O   . ALA A 1 416 ? 1.655   -5.089  37.437 1.00 21.00 ? 525  ALA A O   1 
ATOM   3193 C  CB  . ALA A 1 416 ? 0.168   -5.516  39.857 1.00 19.58 ? 525  ALA A CB  1 
ATOM   3194 N  N   . ASP A 1 417 ? -0.276  -4.516  36.443 1.00 14.77 ? 526  ASP A N   1 
ATOM   3195 C  CA  . ASP A 1 417 ? 0.141   -4.867  35.098 1.00 16.85 ? 526  ASP A CA  1 
ATOM   3196 C  C   . ASP A 1 417 ? 0.950   -3.788  34.374 1.00 15.45 ? 526  ASP A C   1 
ATOM   3197 O  O   . ASP A 1 417 ? 1.509   -4.060  33.324 1.00 16.66 ? 526  ASP A O   1 
ATOM   3198 C  CB  . ASP A 1 417 ? -1.089  -5.189  34.238 1.00 22.48 ? 526  ASP A CB  1 
ATOM   3199 C  CG  . ASP A 1 417 ? -1.842  -6.441  34.704 1.00 31.39 ? 526  ASP A CG  1 
ATOM   3200 O  OD1 . ASP A 1 417 ? -1.253  -7.288  35.408 1.00 28.76 ? 526  ASP A OD1 1 
ATOM   3201 O  OD2 . ASP A 1 417 ? -3.038  -6.561  34.333 1.00 39.69 ? 526  ASP A OD2 1 
ATOM   3202 N  N   . GLY A 1 418 ? 0.979   -2.561  34.891 1.00 14.66 ? 527  GLY A N   1 
ATOM   3203 C  CA  . GLY A 1 418 ? 1.721   -1.479  34.245 1.00 14.69 ? 527  GLY A CA  1 
ATOM   3204 C  C   . GLY A 1 418 ? 1.182   -1.155  32.855 1.00 13.63 ? 527  GLY A C   1 
ATOM   3205 O  O   . GLY A 1 418 ? -0.013  -1.320  32.587 1.00 12.63 ? 527  GLY A O   1 
ATOM   3206 N  N   . PHE A 1 419 ? 2.069   -0.687  31.973 1.00 12.90 ? 528  PHE A N   1 
ATOM   3207 C  CA  . PHE A 1 419 ? 1.745   -0.351  30.589 1.00 13.32 ? 528  PHE A CA  1 
ATOM   3208 C  C   . PHE A 1 419 ? 2.706   -1.068  29.642 1.00 13.78 ? 528  PHE A C   1 
ATOM   3209 O  O   . PHE A 1 419 ? 3.906   -1.060  29.842 1.00 14.05 ? 528  PHE A O   1 
ATOM   3210 C  CB  . PHE A 1 419 ? 1.829   1.161   30.348 1.00 11.26 ? 528  PHE A CB  1 
ATOM   3211 C  CG  . PHE A 1 419 ? 0.728   1.944   31.015 1.00 12.96 ? 528  PHE A CG  1 
ATOM   3212 C  CD1 . PHE A 1 419 ? -0.540  2.022   30.445 1.00 12.19 ? 528  PHE A CD1 1 
ATOM   3213 C  CD2 . PHE A 1 419 ? 0.938   2.533   32.239 1.00 12.25 ? 528  PHE A CD2 1 
ATOM   3214 C  CE1 . PHE A 1 419 ? -1.553  2.733   31.058 1.00 13.38 ? 528  PHE A CE1 1 
ATOM   3215 C  CE2 . PHE A 1 419 ? -0.079  3.239   32.867 1.00 13.92 ? 528  PHE A CE2 1 
ATOM   3216 C  CZ  . PHE A 1 419 ? -1.329  3.346   32.269 1.00 11.96 ? 528  PHE A CZ  1 
ATOM   3217 N  N   . ASN A 1 420 ? 2.164   -1.703  28.621 1.00 12.67 ? 529  ASN A N   1 
ATOM   3218 C  CA  . ASN A 1 420 ? 2.979   -2.467  27.691 1.00 12.74 ? 529  ASN A CA  1 
ATOM   3219 C  C   . ASN A 1 420 ? 2.965   -1.769  26.353 1.00 14.10 ? 529  ASN A C   1 
ATOM   3220 O  O   . ASN A 1 420 ? 2.013   -1.911  25.576 1.00 13.11 ? 529  ASN A O   1 
ATOM   3221 C  CB  . ASN A 1 420 ? 2.428   -3.886  27.569 1.00 17.44 ? 529  ASN A CB  1 
ATOM   3222 C  CG  . ASN A 1 420 ? 3.221   -4.735  26.625 1.00 24.71 ? 529  ASN A CG  1 
ATOM   3223 O  OD1 . ASN A 1 420 ? 4.259   -4.326  26.110 1.00 23.67 ? 529  ASN A OD1 1 
ATOM   3224 N  ND2 . ASN A 1 420 ? 2.734   -5.934  26.380 1.00 30.43 ? 529  ASN A ND2 1 
ATOM   3225 N  N   . ASP A 1 421 ? 4.000   -0.981  26.096 1.00 14.94 ? 530  ASP A N   1 
ATOM   3226 C  CA  . ASP A 1 421 ? 4.081   -0.210  24.859 1.00 11.84 ? 530  ASP A CA  1 
ATOM   3227 C  C   . ASP A 1 421 ? 2.753   0.513   24.573 1.00 16.05 ? 530  ASP A C   1 
ATOM   3228 O  O   . ASP A 1 421 ? 2.203   0.434   23.467 1.00 14.00 ? 530  ASP A O   1 
ATOM   3229 C  CB  . ASP A 1 421 ? 4.486   -1.112  23.705 1.00 11.96 ? 530  ASP A CB  1 
ATOM   3230 C  CG  . ASP A 1 421 ? 4.861   -0.333  22.472 1.00 17.31 ? 530  ASP A CG  1 
ATOM   3231 O  OD1 . ASP A 1 421 ? 5.436   0.767   22.618 1.00 17.02 ? 530  ASP A OD1 1 
ATOM   3232 O  OD2 . ASP A 1 421 ? 4.575   -0.811  21.347 1.00 19.20 ? 530  ASP A OD2 1 
ATOM   3233 N  N   . TRP A 1 422 ? 2.247   1.224   25.585 1.00 12.08 ? 531  TRP A N   1 
ATOM   3234 C  CA  . TRP A 1 422 ? 0.994   1.950   25.452 1.00 11.71 ? 531  TRP A CA  1 
ATOM   3235 C  C   . TRP A 1 422 ? 1.251   3.356   24.892 1.00 13.49 ? 531  TRP A C   1 
ATOM   3236 O  O   . TRP A 1 422 ? 2.006   4.138   25.455 1.00 12.01 ? 531  TRP A O   1 
ATOM   3237 C  CB  . TRP A 1 422 ? 0.254   2.014   26.784 1.00 12.57 ? 531  TRP A CB  1 
ATOM   3238 C  CG  . TRP A 1 422 ? -1.122  2.581   26.621 1.00 14.58 ? 531  TRP A CG  1 
ATOM   3239 C  CD1 . TRP A 1 422 ? -1.541  3.860   26.916 1.00 15.66 ? 531  TRP A CD1 1 
ATOM   3240 C  CD2 . TRP A 1 422 ? -2.261  1.896   26.090 1.00 11.77 ? 531  TRP A CD2 1 
ATOM   3241 N  NE1 . TRP A 1 422 ? -2.878  4.007   26.584 1.00 14.00 ? 531  TRP A NE1 1 
ATOM   3242 C  CE2 . TRP A 1 422 ? -3.337  2.814   26.076 1.00 14.49 ? 531  TRP A CE2 1 
ATOM   3243 C  CE3 . TRP A 1 422 ? -2.470  0.593   25.613 1.00 17.03 ? 531  TRP A CE3 1 
ATOM   3244 C  CZ2 . TRP A 1 422 ? -4.611  2.466   25.615 1.00 13.44 ? 531  TRP A CZ2 1 
ATOM   3245 C  CZ3 . TRP A 1 422 ? -3.730  0.246   25.150 1.00 16.42 ? 531  TRP A CZ3 1 
ATOM   3246 C  CH2 . TRP A 1 422 ? -4.787  1.184   25.156 1.00 15.34 ? 531  TRP A CH2 1 
ATOM   3247 N  N   . ALA A 1 423 ? 0.609   3.670   23.781 1.00 13.57 ? 532  ALA A N   1 
ATOM   3248 C  CA  . ALA A 1 423 ? 0.793   4.949   23.116 1.00 11.95 ? 532  ALA A CA  1 
ATOM   3249 C  C   . ALA A 1 423 ? -0.080  6.059   23.693 1.00 14.19 ? 532  ALA A C   1 
ATOM   3250 O  O   . ALA A 1 423 ? -1.186  6.247   23.238 1.00 23.64 ? 532  ALA A O   1 
ATOM   3251 C  CB  . ALA A 1 423 ? 0.461   4.784   21.632 1.00 17.98 ? 532  ALA A CB  1 
ATOM   3252 N  N   . PHE A 1 424 ? 0.377   6.793   24.695 1.00 11.19 ? 533  PHE A N   1 
ATOM   3253 C  CA  . PHE A 1 424 ? -0.401  7.944   25.157 1.00 10.42 ? 533  PHE A CA  1 
ATOM   3254 C  C   . PHE A 1 424 ? -0.328  9.071   24.100 1.00 10.78 ? 533  PHE A C   1 
ATOM   3255 O  O   . PHE A 1 424 ? 0.766   9.446   23.688 1.00 11.53 ? 533  PHE A O   1 
ATOM   3256 C  CB  . PHE A 1 424 ? 0.175   8.446   26.476 1.00 8.83  ? 533  PHE A CB  1 
ATOM   3257 C  CG  . PHE A 1 424 ? 0.177   7.420   27.559 1.00 8.06  ? 533  PHE A CG  1 
ATOM   3258 C  CD1 . PHE A 1 424 ? -0.873  7.359   28.471 1.00 10.08 ? 533  PHE A CD1 1 
ATOM   3259 C  CD2 . PHE A 1 424 ? 1.238   6.545   27.712 1.00 12.05 ? 533  PHE A CD2 1 
ATOM   3260 C  CE1 . PHE A 1 424 ? -0.884  6.413   29.487 1.00 11.42 ? 533  PHE A CE1 1 
ATOM   3261 C  CE2 . PHE A 1 424 ? 1.243   5.602   28.756 1.00 12.34 ? 533  PHE A CE2 1 
ATOM   3262 C  CZ  . PHE A 1 424 ? 0.176   5.538   29.630 1.00 12.12 ? 533  PHE A CZ  1 
ATOM   3263 N  N   . MET A 1 425 ? -1.472  9.613   23.674 1.00 10.49 ? 534  MET A N   1 
ATOM   3264 C  CA  . MET A 1 425 ? -1.465  10.624  22.606 1.00 10.33 ? 534  MET A CA  1 
ATOM   3265 C  C   . MET A 1 425 ? -1.855  12.018  23.107 1.00 10.41 ? 534  MET A C   1 
ATOM   3266 O  O   . MET A 1 425 ? -2.737  12.146  23.944 1.00 7.88  ? 534  MET A O   1 
ATOM   3267 C  CB  . MET A 1 425 ? -2.386  10.192  21.448 1.00 10.91 ? 534  MET A CB  1 
ATOM   3268 C  CG  . MET A 1 425 ? -2.226  11.036  20.174 1.00 11.36 ? 534  MET A CG  1 
ATOM   3269 S  SD  . MET A 1 425 ? -3.359  12.451  20.121 1.00 10.58 ? 534  MET A SD  1 
ATOM   3270 C  CE  . MET A 1 425 ? -4.871  11.649  19.693 1.00 9.37  ? 534  MET A CE  1 
ATOM   3271 N  N   . THR A 1 426 ? -1.177  13.054  22.597 1.00 9.84  ? 535  THR A N   1 
ATOM   3272 C  CA  . THR A 1 426 ? -1.599  14.427  22.874 1.00 7.28  ? 535  THR A CA  1 
ATOM   3273 C  C   . THR A 1 426 ? -1.787  15.254  21.613 1.00 9.44  ? 535  THR A C   1 
ATOM   3274 O  O   . THR A 1 426 ? -0.958  15.217  20.679 1.00 8.16  ? 535  THR A O   1 
ATOM   3275 C  CB  . THR A 1 426 ? -0.633  15.179  23.819 1.00 10.23 ? 535  THR A CB  1 
ATOM   3276 O  OG1 . THR A 1 426 ? -1.094  16.529  23.972 1.00 10.90 ? 535  THR A OG1 1 
ATOM   3277 C  CG2 . THR A 1 426 ? 0.790   15.181  23.263 1.00 11.19 ? 535  THR A CG2 1 
ATOM   3278 N  N   . THR A 1 427 ? -2.878  16.013  21.602 1.00 6.61  ? 536  THR A N   1 
ATOM   3279 C  CA  . THR A 1 427 ? -3.167  16.977  20.537 1.00 9.13  ? 536  THR A CA  1 
ATOM   3280 C  C   . THR A 1 427 ? -2.772  18.419  20.921 1.00 9.69  ? 536  THR A C   1 
ATOM   3281 O  O   . THR A 1 427 ? -2.948  19.357  20.143 1.00 10.04 ? 536  THR A O   1 
ATOM   3282 C  CB  . THR A 1 427 ? -4.681  16.984  20.267 1.00 9.33  ? 536  THR A CB  1 
ATOM   3283 O  OG1 . THR A 1 427 ? -5.345  17.495  21.426 1.00 12.75 ? 536  THR A OG1 1 
ATOM   3284 C  CG2 . THR A 1 427 ? -5.191  15.592  19.997 1.00 9.94  ? 536  THR A CG2 1 
ATOM   3285 N  N   . HIS A 1 428 ? -2.242  18.599  22.125 1.00 9.54  ? 537  HIS A N   1 
ATOM   3286 C  CA  . HIS A 1 428 ? -2.095  19.929  22.728 1.00 9.25  ? 537  HIS A CA  1 
ATOM   3287 C  C   . HIS A 1 428 ? -0.922  20.713  22.171 1.00 10.39 ? 537  HIS A C   1 
ATOM   3288 O  O   . HIS A 1 428 ? -0.809  21.917  22.431 1.00 10.44 ? 537  HIS A O   1 
ATOM   3289 C  CB  . HIS A 1 428 ? -1.956  19.814  24.253 1.00 7.55  ? 537  HIS A CB  1 
ATOM   3290 C  CG  . HIS A 1 428 ? -3.227  19.435  24.940 1.00 8.58  ? 537  HIS A CG  1 
ATOM   3291 N  ND1 . HIS A 1 428 ? -3.508  19.793  26.240 1.00 12.42 ? 537  HIS A ND1 1 
ATOM   3292 C  CD2 . HIS A 1 428 ? -4.300  18.739  24.502 1.00 9.37  ? 537  HIS A CD2 1 
ATOM   3293 C  CE1 . HIS A 1 428 ? -4.703  19.336  26.574 1.00 12.91 ? 537  HIS A CE1 1 
ATOM   3294 N  NE2 . HIS A 1 428 ? -5.202  18.690  25.537 1.00 9.71  ? 537  HIS A NE2 1 
ATOM   3295 N  N   . SER A 1 429 ? -0.068  20.039  21.408 1.00 8.37  ? 538  SER A N   1 
ATOM   3296 C  CA  . SER A 1 429 ? 1.092   20.684  20.806 1.00 10.18 ? 538  SER A CA  1 
ATOM   3297 C  C   . SER A 1 429 ? 0.964   20.810  19.300 1.00 11.45 ? 538  SER A C   1 
ATOM   3298 O  O   . SER A 1 429 ? 1.936   21.087  18.602 1.00 9.05  ? 538  SER A O   1 
ATOM   3299 C  CB  . SER A 1 429 ? 2.371   19.949  21.198 1.00 9.29  ? 538  SER A CB  1 
ATOM   3300 O  OG  . SER A 1 429 ? 2.691   20.232  22.559 1.00 10.67 ? 538  SER A OG  1 
ATOM   3301 N  N   . TRP A 1 430 ? -0.268  20.675  18.811 1.00 10.31 ? 539  TRP A N   1 
ATOM   3302 C  CA  . TRP A 1 430 ? -0.569  20.854  17.388 1.00 11.46 ? 539  TRP A CA  1 
ATOM   3303 C  C   . TRP A 1 430 ? 0.014   22.181  16.863 1.00 11.19 ? 539  TRP A C   1 
ATOM   3304 O  O   . TRP A 1 430 ? -0.175  23.228  17.478 1.00 9.56  ? 539  TRP A O   1 
ATOM   3305 C  CB  . TRP A 1 430 ? -2.085  20.846  17.214 1.00 11.52 ? 539  TRP A CB  1 
ATOM   3306 C  CG  . TRP A 1 430 ? -2.588  20.487  15.859 1.00 11.98 ? 539  TRP A CG  1 
ATOM   3307 C  CD1 . TRP A 1 430 ? -2.726  21.328  14.792 1.00 11.48 ? 539  TRP A CD1 1 
ATOM   3308 C  CD2 . TRP A 1 430 ? -3.073  19.204  15.421 1.00 9.22  ? 539  TRP A CD2 1 
ATOM   3309 N  NE1 . TRP A 1 430 ? -3.252  20.645  13.720 1.00 13.51 ? 539  TRP A NE1 1 
ATOM   3310 C  CE2 . TRP A 1 430 ? -3.449  19.339  14.068 1.00 8.81  ? 539  TRP A CE2 1 
ATOM   3311 C  CE3 . TRP A 1 430 ? -3.200  17.957  16.036 1.00 8.54  ? 539  TRP A CE3 1 
ATOM   3312 C  CZ2 . TRP A 1 430 ? -3.985  18.280  13.322 1.00 12.96 ? 539  TRP A CZ2 1 
ATOM   3313 C  CZ3 . TRP A 1 430 ? -3.726  16.902  15.298 1.00 11.69 ? 539  TRP A CZ3 1 
ATOM   3314 C  CH2 . TRP A 1 430 ? -4.112  17.070  13.954 1.00 10.72 ? 539  TRP A CH2 1 
ATOM   3315 N  N   . ASP A 1 431 ? 0.705   22.106  15.726 1.00 10.06 ? 540  ASP A N   1 
ATOM   3316 C  CA  . ASP A 1 431 ? 1.362   23.239  15.044 1.00 11.38 ? 540  ASP A CA  1 
ATOM   3317 C  C   . ASP A 1 431 ? 2.653   23.770  15.660 1.00 12.71 ? 540  ASP A C   1 
ATOM   3318 O  O   . ASP A 1 431 ? 3.307   24.637  15.076 1.00 11.11 ? 540  ASP A O   1 
ATOM   3319 C  CB  . ASP A 1 431 ? 0.393   24.398  14.829 1.00 10.69 ? 540  ASP A CB  1 
ATOM   3320 C  CG  . ASP A 1 431 ? -0.574  24.136  13.707 1.00 13.94 ? 540  ASP A CG  1 
ATOM   3321 O  OD1 . ASP A 1 431 ? -0.156  23.525  12.697 1.00 11.92 ? 540  ASP A OD1 1 
ATOM   3322 O  OD2 . ASP A 1 431 ? -1.726  24.581  13.833 1.00 13.56 ? 540  ASP A OD2 1 
ATOM   3323 N  N   . GLU A 1 432 ? 3.034   23.248  16.813 1.00 11.77 ? 541  GLU A N   1 
ATOM   3324 C  CA  . GLU A 1 432 ? 4.350   23.539  17.389 1.00 11.30 ? 541  GLU A CA  1 
ATOM   3325 C  C   . GLU A 1 432 ? 5.496   22.927  16.584 1.00 12.08 ? 541  GLU A C   1 
ATOM   3326 O  O   . GLU A 1 432 ? 5.323   21.971  15.803 1.00 10.49 ? 541  GLU A O   1 
ATOM   3327 C  CB  . GLU A 1 432 ? 4.432   23.016  18.828 1.00 9.73  ? 541  GLU A CB  1 
ATOM   3328 C  CG  . GLU A 1 432 ? 3.422   23.698  19.772 1.00 11.26 ? 541  GLU A CG  1 
ATOM   3329 C  CD  . GLU A 1 432 ? 3.599   23.258  21.218 1.00 12.30 ? 541  GLU A CD  1 
ATOM   3330 O  OE1 . GLU A 1 432 ? 4.594   22.563  21.529 1.00 13.60 ? 541  GLU A OE1 1 
ATOM   3331 O  OE2 . GLU A 1 432 ? 2.731   23.589  22.044 1.00 11.50 ? 541  GLU A OE2 1 
ATOM   3332 N  N   . ASP A 1 433 ? 6.674   23.498  16.795 1.00 10.41 ? 542  ASP A N   1 
ATOM   3333 C  CA  . ASP A 1 433 ? 7.934   22.926  16.298 1.00 11.31 ? 542  ASP A CA  1 
ATOM   3334 C  C   . ASP A 1 433 ? 8.453   21.986  17.384 1.00 10.65 ? 542  ASP A C   1 
ATOM   3335 O  O   . ASP A 1 433 ? 8.716   22.416  18.521 1.00 10.43 ? 542  ASP A O   1 
ATOM   3336 C  CB  . ASP A 1 433 ? 8.954   24.043  16.026 1.00 13.36 ? 542  ASP A CB  1 
ATOM   3337 C  CG  . ASP A 1 433 ? 10.261  23.524  15.460 1.00 17.96 ? 542  ASP A CG  1 
ATOM   3338 O  OD1 . ASP A 1 433 ? 10.520  22.307  15.551 1.00 16.81 ? 542  ASP A OD1 1 
ATOM   3339 O  OD2 . ASP A 1 433 ? 11.049  24.350  14.920 1.00 19.56 ? 542  ASP A OD2 1 
ATOM   3340 N  N   . PRO A 1 434 ? 8.573   20.692  17.051 1.00 12.46 ? 543  PRO A N   1 
ATOM   3341 C  CA  . PRO A 1 434 ? 8.912   19.678  18.051 1.00 9.32  ? 543  PRO A CA  1 
ATOM   3342 C  C   . PRO A 1 434 ? 10.417  19.508  18.275 1.00 13.71 ? 543  PRO A C   1 
ATOM   3343 O  O   . PRO A 1 434 ? 10.818  18.614  19.007 1.00 13.28 ? 543  PRO A O   1 
ATOM   3344 C  CB  . PRO A 1 434 ? 8.344   18.401  17.435 1.00 12.22 ? 543  PRO A CB  1 
ATOM   3345 C  CG  . PRO A 1 434 ? 8.525   18.599  15.941 1.00 11.17 ? 543  PRO A CG  1 
ATOM   3346 C  CD  . PRO A 1 434 ? 8.253   20.093  15.729 1.00 11.10 ? 543  PRO A CD  1 
ATOM   3347 N  N   . SER A 1 435 ? 11.235  20.343  17.635 1.00 12.68 ? 544  SER A N   1 
ATOM   3348 C  CA  A SER A 1 435 ? 12.676  20.277  17.823 0.24 13.94 ? 544  SER A CA  1 
ATOM   3349 C  CA  B SER A 1 435 ? 12.681  20.312  17.813 0.76 13.81 ? 544  SER A CA  1 
ATOM   3350 C  C   . SER A 1 435 ? 13.080  20.894  19.155 1.00 13.27 ? 544  SER A C   1 
ATOM   3351 O  O   . SER A 1 435 ? 12.592  21.953  19.538 1.00 11.65 ? 544  SER A O   1 
ATOM   3352 C  CB  A SER A 1 435 ? 13.390  20.993  16.678 0.24 17.15 ? 544  SER A CB  1 
ATOM   3353 C  CB  B SER A 1 435 ? 13.357  21.104  16.679 0.76 17.35 ? 544  SER A CB  1 
ATOM   3354 O  OG  A SER A 1 435 ? 12.936  22.328  16.578 0.24 15.87 ? 544  SER A OG  1 
ATOM   3355 O  OG  B SER A 1 435 ? 14.686  21.478  17.004 0.76 18.96 ? 544  SER A OG  1 
ATOM   3356 N  N   . GLY A 1 436 ? 13.964  20.207  19.866 1.00 11.53 ? 545  GLY A N   1 
ATOM   3357 C  CA  . GLY A 1 436 ? 14.431  20.686  21.144 1.00 12.34 ? 545  GLY A CA  1 
ATOM   3358 C  C   . GLY A 1 436 ? 14.153  19.684  22.241 1.00 11.88 ? 545  GLY A C   1 
ATOM   3359 O  O   . GLY A 1 436 ? 13.967  18.487  21.971 1.00 12.49 ? 545  GLY A O   1 
ATOM   3360 N  N   . GLU A 1 437 ? 14.120  20.174  23.476 1.00 11.13 ? 546  GLU A N   1 
ATOM   3361 C  CA  . GLU A 1 437 ? 14.084  19.289  24.638 1.00 13.46 ? 546  GLU A CA  1 
ATOM   3362 C  C   . GLU A 1 437 ? 12.657  18.937  25.045 1.00 12.33 ? 546  GLU A C   1 
ATOM   3363 O  O   . GLU A 1 437 ? 11.865  19.820  25.351 1.00 10.43 ? 546  GLU A O   1 
ATOM   3364 C  CB  . GLU A 1 437 ? 14.780  19.947  25.830 1.00 13.46 ? 546  GLU A CB  1 
ATOM   3365 C  CG  . GLU A 1 437 ? 14.869  19.033  27.044 1.00 16.03 ? 546  GLU A CG  1 
ATOM   3366 C  CD  . GLU A 1 437 ? 15.635  19.638  28.184 1.00 18.12 ? 546  GLU A CD  1 
ATOM   3367 O  OE1 . GLU A 1 437 ? 15.159  20.659  28.720 1.00 16.94 ? 546  GLU A OE1 1 
ATOM   3368 O  OE2 . GLU A 1 437 ? 16.691  19.093  28.543 1.00 16.49 ? 546  GLU A OE2 1 
ATOM   3369 N  N   . TRP A 1 438 ? 12.354  17.642  25.051 1.00 10.71 ? 547  TRP A N   1 
ATOM   3370 C  CA  . TRP A 1 438 ? 11.093  17.135  25.580 1.00 10.51 ? 547  TRP A CA  1 
ATOM   3371 C  C   . TRP A 1 438 ? 11.358  16.611  26.980 1.00 11.40 ? 547  TRP A C   1 
ATOM   3372 O  O   . TRP A 1 438 ? 12.453  16.122  27.265 1.00 11.35 ? 547  TRP A O   1 
ATOM   3373 C  CB  . TRP A 1 438 ? 10.555  15.987  24.728 1.00 10.47 ? 547  TRP A CB  1 
ATOM   3374 C  CG  . TRP A 1 438 ? 10.007  16.436  23.409 1.00 10.28 ? 547  TRP A CG  1 
ATOM   3375 C  CD1 . TRP A 1 438 ? 10.727  16.800  22.307 1.00 9.57  ? 547  TRP A CD1 1 
ATOM   3376 C  CD2 . TRP A 1 438 ? 8.626   16.576  23.052 1.00 8.95  ? 547  TRP A CD2 1 
ATOM   3377 N  NE1 . TRP A 1 438 ? 9.875   17.158  21.285 1.00 10.57 ? 547  TRP A NE1 1 
ATOM   3378 C  CE2 . TRP A 1 438 ? 8.582   17.032  21.722 1.00 7.89  ? 547  TRP A CE2 1 
ATOM   3379 C  CE3 . TRP A 1 438 ? 7.418   16.357  23.731 1.00 10.12 ? 547  TRP A CE3 1 
ATOM   3380 C  CZ2 . TRP A 1 438 ? 7.392   17.278  21.067 1.00 7.33  ? 547  TRP A CZ2 1 
ATOM   3381 C  CZ3 . TRP A 1 438 ? 6.272   16.596  23.092 1.00 10.16 ? 547  TRP A CZ3 1 
ATOM   3382 C  CH2 . TRP A 1 438 ? 6.250   17.046  21.753 1.00 10.43 ? 547  TRP A CH2 1 
ATOM   3383 N  N   . VAL A 1 439 ? 10.353  16.698  27.839 1.00 12.17 ? 548  VAL A N   1 
ATOM   3384 C  CA  . VAL A 1 439 ? 10.484  16.211  29.216 1.00 8.84  ? 548  VAL A CA  1 
ATOM   3385 C  C   . VAL A 1 439 ? 9.309   15.323  29.543 1.00 12.74 ? 548  VAL A C   1 
ATOM   3386 O  O   . VAL A 1 439 ? 8.170   15.727  29.363 1.00 11.84 ? 548  VAL A O   1 
ATOM   3387 C  CB  . VAL A 1 439 ? 10.513  17.356  30.240 1.00 13.07 ? 548  VAL A CB  1 
ATOM   3388 C  CG1 . VAL A 1 439 ? 10.719  16.788  31.688 1.00 15.19 ? 548  VAL A CG1 1 
ATOM   3389 C  CG2 . VAL A 1 439 ? 11.601  18.332  29.889 1.00 16.36 ? 548  VAL A CG2 1 
ATOM   3390 N  N   . LEU A 1 440 ? 9.607   14.101  29.978 1.00 12.16 ? 549  LEU A N   1 
ATOM   3391 C  CA  . LEU A 1 440 ? 8.611   13.164  30.479 1.00 11.47 ? 549  LEU A CA  1 
ATOM   3392 C  C   . LEU A 1 440 ? 8.693   13.145  32.001 1.00 12.09 ? 549  LEU A C   1 
ATOM   3393 O  O   . LEU A 1 440 ? 9.799   13.016  32.560 1.00 13.77 ? 549  LEU A O   1 
ATOM   3394 C  CB  . LEU A 1 440 ? 8.848   11.750  29.925 1.00 12.14 ? 549  LEU A CB  1 
ATOM   3395 C  CG  . LEU A 1 440 ? 7.819   10.684  30.382 1.00 11.77 ? 549  LEU A CG  1 
ATOM   3396 C  CD1 . LEU A 1 440 ? 6.466   10.836  29.668 1.00 11.65 ? 549  LEU A CD1 1 
ATOM   3397 C  CD2 . LEU A 1 440 ? 8.375   9.253   30.190 1.00 11.84 ? 549  LEU A CD2 1 
ATOM   3398 N  N   . GLU A 1 441 ? 7.538   13.297  32.660 1.00 10.36 ? 550  GLU A N   1 
ATOM   3399 C  CA  . GLU A 1 441 ? 7.430   13.255  34.129 1.00 10.67 ? 550  GLU A CA  1 
ATOM   3400 C  C   . GLU A 1 441 ? 6.530   12.102  34.533 1.00 13.88 ? 550  GLU A C   1 
ATOM   3401 O  O   . GLU A 1 441 ? 5.446   11.978  34.000 1.00 15.63 ? 550  GLU A O   1 
ATOM   3402 C  CB  . GLU A 1 441 ? 6.818   14.549  34.682 1.00 10.25 ? 550  GLU A CB  1 
ATOM   3403 C  CG  . GLU A 1 441 ? 7.605   15.804  34.327 1.00 18.21 ? 550  GLU A CG  1 
ATOM   3404 C  CD  . GLU A 1 441 ? 6.869   17.084  34.681 1.00 24.11 ? 550  GLU A CD  1 
ATOM   3405 O  OE1 . GLU A 1 441 ? 5.744   16.994  35.205 1.00 29.40 ? 550  GLU A OE1 1 
ATOM   3406 O  OE2 . GLU A 1 441 ? 7.417   18.176  34.440 1.00 27.48 ? 550  GLU A OE2 1 
ATOM   3407 N  N   . ILE A 1 442 ? 6.978   11.258  35.457 1.00 13.34 ? 551  ILE A N   1 
ATOM   3408 C  CA  . ILE A 1 442 ? 6.128   10.203  36.010 1.00 11.92 ? 551  ILE A CA  1 
ATOM   3409 C  C   . ILE A 1 442 ? 6.179   10.386  37.517 1.00 13.37 ? 551  ILE A C   1 
ATOM   3410 O  O   . ILE A 1 442 ? 7.271   10.465  38.106 1.00 14.70 ? 551  ILE A O   1 
ATOM   3411 C  CB  . ILE A 1 442 ? 6.626   8.795   35.627 1.00 13.46 ? 551  ILE A CB  1 
ATOM   3412 C  CG1 . ILE A 1 442 ? 6.732   8.660   34.090 1.00 15.32 ? 551  ILE A CG1 1 
ATOM   3413 C  CG2 . ILE A 1 442 ? 5.712   7.709   36.243 1.00 14.60 ? 551  ILE A CG2 1 
ATOM   3414 C  CD1 . ILE A 1 442 ? 7.231   7.251   33.599 1.00 14.76 ? 551  ILE A CD1 1 
ATOM   3415 N  N   . GLU A 1 443 ? 5.011   10.479  38.151 0.83 11.69 ? 552  GLU A N   1 
ATOM   3416 C  CA  . GLU A 1 443 ? 4.949   10.784  39.573 0.83 11.89 ? 552  GLU A CA  1 
ATOM   3417 C  C   . GLU A 1 443 ? 4.016   9.828   40.286 0.83 15.49 ? 552  GLU A C   1 
ATOM   3418 O  O   . GLU A 1 443 ? 2.942   9.489   39.783 0.83 10.20 ? 552  GLU A O   1 
ATOM   3419 C  CB  . GLU A 1 443 ? 4.469   12.228  39.764 0.83 18.44 ? 552  GLU A CB  1 
ATOM   3420 C  CG  . GLU A 1 443 ? 3.982   12.603  41.169 0.83 25.87 ? 552  GLU A CG  1 
ATOM   3421 C  CD  . GLU A 1 443 ? 5.051   13.264  42.079 0.83 34.55 ? 552  GLU A CD  1 
ATOM   3422 O  OE1 . GLU A 1 443 ? 4.800   13.389  43.306 0.83 38.51 ? 552  GLU A OE1 1 
ATOM   3423 O  OE2 . GLU A 1 443 ? 6.130   13.656  41.583 0.83 38.21 ? 552  GLU A OE2 1 
ATOM   3424 N  N   . ASN A 1 444 ? 4.432   9.402   41.472 1.00 14.74 ? 553  ASN A N   1 
ATOM   3425 C  CA  . ASN A 1 444 ? 3.552   8.680   42.372 1.00 15.19 ? 553  ASN A CA  1 
ATOM   3426 C  C   . ASN A 1 444 ? 2.751   9.700   43.150 1.00 16.62 ? 553  ASN A C   1 
ATOM   3427 O  O   . ASN A 1 444 ? 3.319   10.434  43.970 1.00 14.59 ? 553  ASN A O   1 
ATOM   3428 C  CB  . ASN A 1 444 ? 4.375   7.828   43.340 1.00 17.56 ? 553  ASN A CB  1 
ATOM   3429 C  CG  . ASN A 1 444 ? 3.517   7.180   44.401 1.00 19.68 ? 553  ASN A CG  1 
ATOM   3430 O  OD1 . ASN A 1 444 ? 2.302   7.056   44.239 1.00 15.39 ? 553  ASN A OD1 1 
ATOM   3431 N  ND2 . ASN A 1 444 ? 4.150   6.749   45.498 1.00 16.91 ? 553  ASN A ND2 1 
ATOM   3432 N  N   . THR A 1 445 ? 1.447   9.778   42.877 1.00 12.49 ? 554  THR A N   1 
ATOM   3433 C  CA  . THR A 1 445 ? 0.611   10.817  43.487 1.00 15.16 ? 554  THR A CA  1 
ATOM   3434 C  C   . THR A 1 445 ? 0.095   10.425  44.861 1.00 17.23 ? 554  THR A C   1 
ATOM   3435 O  O   . THR A 1 445 ? -0.523  11.229  45.535 1.00 15.97 ? 554  THR A O   1 
ATOM   3436 C  CB  . THR A 1 445 ? -0.615  11.185  42.628 1.00 13.72 ? 554  THR A CB  1 
ATOM   3437 O  OG1 . THR A 1 445 ? -1.504  10.062  42.553 1.00 13.64 ? 554  THR A OG1 1 
ATOM   3438 C  CG2 . THR A 1 445 ? -0.172  11.587  41.226 1.00 12.52 ? 554  THR A CG2 1 
ATOM   3439 N  N   . SER A 1 446 ? 0.348   9.186   45.250 1.00 15.21 ? 555  SER A N   1 
ATOM   3440 C  CA  . SER A 1 446 ? -0.099  8.657   46.522 1.00 18.50 ? 555  SER A CA  1 
ATOM   3441 C  C   . SER A 1 446 ? 0.998   8.789   47.567 1.00 21.92 ? 555  SER A C   1 
ATOM   3442 O  O   . SER A 1 446 ? 2.160   8.978   47.232 1.00 17.28 ? 555  SER A O   1 
ATOM   3443 C  CB  . SER A 1 446 ? -0.451  7.190   46.341 1.00 20.25 ? 555  SER A CB  1 
ATOM   3444 O  OG  . SER A 1 446 ? -0.585  6.548   47.588 1.00 27.64 ? 555  SER A OG  1 
ATOM   3445 N  N   . GLU A 1 447 ? 0.623   8.682   48.840 1.00 19.42 ? 556  GLU A N   1 
ATOM   3446 C  CA  . GLU A 1 447 ? 1.608   8.679   49.915 1.00 25.64 ? 556  GLU A CA  1 
ATOM   3447 C  C   . GLU A 1 447 ? 2.181   7.274   50.121 1.00 20.63 ? 556  GLU A C   1 
ATOM   3448 O  O   . GLU A 1 447 ? 3.078   7.087   50.937 1.00 21.00 ? 556  GLU A O   1 
ATOM   3449 C  CB  . GLU A 1 447 ? 0.970   9.183   51.220 1.00 28.70 ? 556  GLU A CB  1 
ATOM   3450 C  CG  . GLU A 1 447 ? 0.449   10.591  51.097 1.00 32.53 ? 556  GLU A CG  1 
ATOM   3451 C  CD  . GLU A 1 447 ? -0.403  11.031  52.263 1.00 46.40 ? 556  GLU A CD  1 
ATOM   3452 O  OE1 . GLU A 1 447 ? -0.112  12.128  52.797 1.00 51.31 ? 556  GLU A OE1 1 
ATOM   3453 O  OE2 . GLU A 1 447 ? -1.358  10.301  52.632 1.00 48.23 ? 556  GLU A OE2 1 
ATOM   3454 N  N   . ALA A 1 448 ? 1.639   6.296   49.398 1.00 18.26 ? 557  ALA A N   1 
ATOM   3455 C  CA  . ALA A 1 448 ? 2.095   4.914   49.478 1.00 20.27 ? 557  ALA A CA  1 
ATOM   3456 C  C   . ALA A 1 448 ? 3.526   4.802   48.944 1.00 22.23 ? 557  ALA A C   1 
ATOM   3457 O  O   . ALA A 1 448 ? 3.930   5.575   48.073 1.00 18.27 ? 557  ALA A O   1 
ATOM   3458 C  CB  . ALA A 1 448 ? 1.168   4.008   48.678 1.00 18.08 ? 557  ALA A CB  1 
ATOM   3459 N  N   . ASN A 1 449 ? 4.299   3.844   49.459 1.00 19.29 ? 558  ASN A N   1 
ATOM   3460 C  CA  . ASN A 1 449 ? 5.621   3.642   48.910 1.00 18.35 ? 558  ASN A CA  1 
ATOM   3461 C  C   . ASN A 1 449 ? 5.550   2.723   47.700 1.00 22.39 ? 558  ASN A C   1 
ATOM   3462 O  O   . ASN A 1 449 ? 5.569   1.490   47.829 1.00 20.18 ? 558  ASN A O   1 
ATOM   3463 C  CB  . ASN A 1 449 ? 6.604   3.099   49.917 1.00 24.22 ? 558  ASN A CB  1 
ATOM   3464 C  CG  . ASN A 1 449 ? 8.035   3.352   49.469 1.00 32.73 ? 558  ASN A CG  1 
ATOM   3465 O  OD1 . ASN A 1 449 ? 8.592   4.415   49.739 1.00 43.49 ? 558  ASN A OD1 1 
ATOM   3466 N  ND2 . ASN A 1 449 ? 8.604   2.416   48.714 1.00 35.08 ? 558  ASN A ND2 1 
ATOM   3467 N  N   . ASN A 1 450 ? 5.423   3.336   46.528 1.00 16.16 ? 559  ASN A N   1 
ATOM   3468 C  CA  . ASN A 1 450 ? 5.213   2.587   45.307 1.00 14.05 ? 559  ASN A CA  1 
ATOM   3469 C  C   . ASN A 1 450 ? 6.524   2.404   44.554 1.00 15.33 ? 559  ASN A C   1 
ATOM   3470 O  O   . ASN A 1 450 ? 7.495   3.078   44.845 1.00 16.77 ? 559  ASN A O   1 
ATOM   3471 C  CB  . ASN A 1 450 ? 4.140   3.279   44.455 1.00 13.96 ? 559  ASN A CB  1 
ATOM   3472 C  CG  . ASN A 1 450 ? 2.738   3.169   45.076 1.00 18.08 ? 559  ASN A CG  1 
ATOM   3473 O  OD1 . ASN A 1 450 ? 2.424   2.201   45.792 1.00 18.47 ? 559  ASN A OD1 1 
ATOM   3474 N  ND2 . ASN A 1 450 ? 1.886   4.150   44.791 1.00 16.92 ? 559  ASN A ND2 1 
ATOM   3475 N  N   . TYR A 1 451 ? 6.558   1.496   43.586 1.00 16.27 ? 560  TYR A N   1 
ATOM   3476 C  CA  . TYR A 1 451 ? 7.814   1.174   42.929 1.00 13.36 ? 560  TYR A CA  1 
ATOM   3477 C  C   . TYR A 1 451 ? 7.579   0.578   41.554 1.00 12.00 ? 560  TYR A C   1 
ATOM   3478 O  O   . TYR A 1 451 ? 6.604   -0.114  41.318 1.00 14.16 ? 560  TYR A O   1 
ATOM   3479 C  CB  . TYR A 1 451 ? 8.607   0.192   43.813 1.00 13.72 ? 560  TYR A CB  1 
ATOM   3480 C  CG  . TYR A 1 451 ? 7.703   -0.868  44.394 1.00 13.99 ? 560  TYR A CG  1 
ATOM   3481 C  CD1 . TYR A 1 451 ? 7.020   -0.638  45.580 1.00 15.83 ? 560  TYR A CD1 1 
ATOM   3482 C  CD2 . TYR A 1 451 ? 7.481   -2.066  43.733 1.00 11.56 ? 560  TYR A CD2 1 
ATOM   3483 C  CE1 . TYR A 1 451 ? 6.153   -1.579  46.097 1.00 15.92 ? 560  TYR A CE1 1 
ATOM   3484 C  CE2 . TYR A 1 451 ? 6.614   -3.024  44.247 1.00 9.39  ? 560  TYR A CE2 1 
ATOM   3485 C  CZ  . TYR A 1 451 ? 5.952   -2.768  45.437 1.00 12.72 ? 560  TYR A CZ  1 
ATOM   3486 O  OH  . TYR A 1 451 ? 5.057   -3.680  45.962 1.00 15.22 ? 560  TYR A OH  1 
ATOM   3487 N  N   . GLY A 1 452 ? 8.520   0.815   40.651 1.00 13.67 ? 561  GLY A N   1 
ATOM   3488 C  CA  . GLY A 1 452 ? 8.430   0.260   39.336 1.00 15.18 ? 561  GLY A CA  1 
ATOM   3489 C  C   . GLY A 1 452 ? 9.525   0.812   38.468 1.00 15.56 ? 561  GLY A C   1 
ATOM   3490 O  O   . GLY A 1 452 ? 10.401  1.549   38.931 1.00 14.18 ? 561  GLY A O   1 
ATOM   3491 N  N   . THR A 1 453 ? 9.468   0.435   37.202 1.00 15.24 ? 562  THR A N   1 
ATOM   3492 C  CA  . THR A 1 453 ? 10.540  0.733   36.280 1.00 12.98 ? 562  THR A CA  1 
ATOM   3493 C  C   . THR A 1 453 ? 10.012  1.109   34.898 1.00 15.74 ? 562  THR A C   1 
ATOM   3494 O  O   . THR A 1 453 ? 9.158   0.427   34.340 1.00 15.23 ? 562  THR A O   1 
ATOM   3495 C  CB  . THR A 1 453 ? 11.457  -0.492  36.146 1.00 16.65 ? 562  THR A CB  1 
ATOM   3496 O  OG1 . THR A 1 453 ? 11.864  -0.931  37.458 1.00 16.41 ? 562  THR A OG1 1 
ATOM   3497 C  CG2 . THR A 1 453 ? 12.653  -0.147  35.329 1.00 15.27 ? 562  THR A CG2 1 
ATOM   3498 N  N   . LEU A 1 454 ? 10.546  2.195   34.345 1.00 15.69 ? 563  LEU A N   1 
ATOM   3499 C  CA  . LEU A 1 454 ? 10.271  2.556   32.956 1.00 11.95 ? 563  LEU A CA  1 
ATOM   3500 C  C   . LEU A 1 454 ? 11.314  1.919   32.040 1.00 14.36 ? 563  LEU A C   1 
ATOM   3501 O  O   . LEU A 1 454 ? 12.505  2.240   32.134 1.00 16.98 ? 563  LEU A O   1 
ATOM   3502 C  CB  . LEU A 1 454 ? 10.330  4.058   32.800 1.00 8.10  ? 563  LEU A CB  1 
ATOM   3503 C  CG  . LEU A 1 454 ? 10.121  4.552   31.368 1.00 12.27 ? 563  LEU A CG  1 
ATOM   3504 C  CD1 . LEU A 1 454 ? 8.688   4.369   30.941 1.00 10.46 ? 563  LEU A CD1 1 
ATOM   3505 C  CD2 . LEU A 1 454 ? 10.541  5.990   31.264 1.00 12.94 ? 563  LEU A CD2 1 
ATOM   3506 N  N   . THR A 1 455 ? 10.894  1.009   31.170 1.00 13.60 ? 564  THR A N   1 
ATOM   3507 C  CA  . THR A 1 455 ? 11.856  0.294   30.335 1.00 13.88 ? 564  THR A CA  1 
ATOM   3508 C  C   . THR A 1 455 ? 11.862  0.748   28.887 1.00 15.60 ? 564  THR A C   1 
ATOM   3509 O  O   . THR A 1 455 ? 12.784  0.455   28.148 1.00 14.46 ? 564  THR A O   1 
ATOM   3510 C  CB  . THR A 1 455 ? 11.620  -1.208  30.356 1.00 14.48 ? 564  THR A CB  1 
ATOM   3511 O  OG1 . THR A 1 455 ? 10.308  -1.499  29.843 1.00 14.33 ? 564  THR A OG1 1 
ATOM   3512 C  CG2 . THR A 1 455 ? 11.751  -1.741  31.760 1.00 15.38 ? 564  THR A CG2 1 
ATOM   3513 N  N   . LYS A 1 456 ? 10.840  1.461   28.455 1.00 13.61 ? 565  LYS A N   1 
ATOM   3514 C  CA  . LYS A 1 456 ? 10.862  1.990   27.104 1.00 13.37 ? 565  LYS A CA  1 
ATOM   3515 C  C   . LYS A 1 456 ? 10.045  3.271   26.996 1.00 15.07 ? 565  LYS A C   1 
ATOM   3516 O  O   . LYS A 1 456 ? 8.923   3.344   27.496 1.00 11.27 ? 565  LYS A O   1 
ATOM   3517 C  CB  . LYS A 1 456 ? 10.346  0.942   26.099 1.00 16.60 ? 565  LYS A CB  1 
ATOM   3518 C  CG  . LYS A 1 456 ? 10.692  1.269   24.643 1.00 17.18 ? 565  LYS A CG  1 
ATOM   3519 C  CD  . LYS A 1 456 ? 10.185  0.198   23.698 1.00 20.97 ? 565  LYS A CD  1 
ATOM   3520 C  CE  . LYS A 1 456 ? 10.593  0.469   22.247 1.00 24.02 ? 565  LYS A CE  1 
ATOM   3521 N  NZ  . LYS A 1 456 ? 10.081  -0.609  21.364 1.00 25.76 ? 565  LYS A NZ  1 
ATOM   3522 N  N   . PHE A 1 457 ? 10.610  4.264   26.311 1.00 13.07 ? 566  PHE A N   1 
ATOM   3523 C  CA  . PHE A 1 457 ? 9.906   5.521   26.003 1.00 13.29 ? 566  PHE A CA  1 
ATOM   3524 C  C   . PHE A 1 457 ? 10.212  5.879   24.557 1.00 13.59 ? 566  PHE A C   1 
ATOM   3525 O  O   . PHE A 1 457 ? 11.333  6.286   24.226 1.00 13.66 ? 566  PHE A O   1 
ATOM   3526 C  CB  . PHE A 1 457 ? 10.384  6.618   26.976 1.00 14.42 ? 566  PHE A CB  1 
ATOM   3527 C  CG  . PHE A 1 457 ? 9.952   8.037   26.620 1.00 10.45 ? 566  PHE A CG  1 
ATOM   3528 C  CD1 . PHE A 1 457 ? 8.932   8.290   25.744 1.00 9.75  ? 566  PHE A CD1 1 
ATOM   3529 C  CD2 . PHE A 1 457 ? 10.605  9.117   27.207 1.00 9.55  ? 566  PHE A CD2 1 
ATOM   3530 C  CE1 . PHE A 1 457 ? 8.563   9.614   25.451 1.00 12.49 ? 566  PHE A CE1 1 
ATOM   3531 C  CE2 . PHE A 1 457 ? 10.256  10.402  26.933 1.00 12.72 ? 566  PHE A CE2 1 
ATOM   3532 C  CZ  . PHE A 1 457 ? 9.220   10.668  26.055 1.00 11.63 ? 566  PHE A CZ  1 
ATOM   3533 N  N   . THR A 1 458 ? 9.226   5.677   23.684 1.00 11.30 ? 567  THR A N   1 
ATOM   3534 C  CA  . THR A 1 458 ? 9.364   6.044   22.284 1.00 12.11 ? 567  THR A CA  1 
ATOM   3535 C  C   . THR A 1 458 ? 8.550   7.308   22.056 1.00 12.15 ? 567  THR A C   1 
ATOM   3536 O  O   . THR A 1 458 ? 7.360   7.348   22.369 1.00 11.73 ? 567  THR A O   1 
ATOM   3537 C  CB  . THR A 1 458 ? 8.801   4.949   21.359 1.00 16.07 ? 567  THR A CB  1 
ATOM   3538 O  OG1 . THR A 1 458 ? 9.342   3.671   21.723 1.00 16.04 ? 567  THR A OG1 1 
ATOM   3539 C  CG2 . THR A 1 458 ? 9.096   5.250   19.924 1.00 11.91 ? 567  THR A CG2 1 
ATOM   3540 N  N   . LEU A 1 459 ? 9.191   8.349   21.551 1.00 10.71 ? 568  LEU A N   1 
ATOM   3541 C  CA  . LEU A 1 459 ? 8.473   9.571   21.210 1.00 10.48 ? 568  LEU A CA  1 
ATOM   3542 C  C   . LEU A 1 459 ? 8.131   9.476   19.735 1.00 9.46  ? 568  LEU A C   1 
ATOM   3543 O  O   . LEU A 1 459 ? 9.006   9.303   18.887 1.00 11.41 ? 568  LEU A O   1 
ATOM   3544 C  CB  . LEU A 1 459 ? 9.334   10.799  21.508 1.00 10.35 ? 568  LEU A CB  1 
ATOM   3545 C  CG  . LEU A 1 459 ? 8.738   12.166  21.170 1.00 12.59 ? 568  LEU A CG  1 
ATOM   3546 C  CD1 . LEU A 1 459 ? 7.499   12.419  21.998 1.00 11.52 ? 568  LEU A CD1 1 
ATOM   3547 C  CD2 . LEU A 1 459 ? 9.782   13.249  21.395 1.00 10.45 ? 568  LEU A CD2 1 
ATOM   3548 N  N   . VAL A 1 460 ? 6.851   9.541   19.419 1.00 12.34 ? 569  VAL A N   1 
ATOM   3549 C  CA  . VAL A 1 460 ? 6.415   9.496   18.017 1.00 10.14 ? 569  VAL A CA  1 
ATOM   3550 C  C   . VAL A 1 460 ? 5.764   10.816  17.641 1.00 11.11 ? 569  VAL A C   1 
ATOM   3551 O  O   . VAL A 1 460 ? 4.769   11.223  18.232 1.00 9.84  ? 569  VAL A O   1 
ATOM   3552 C  CB  . VAL A 1 460 ? 5.416   8.342   17.760 1.00 10.42 ? 569  VAL A CB  1 
ATOM   3553 C  CG1 . VAL A 1 460 ? 5.073   8.209   16.249 1.00 11.53 ? 569  VAL A CG1 1 
ATOM   3554 C  CG2 . VAL A 1 460 ? 5.949   7.007   18.275 1.00 11.02 ? 569  VAL A CG2 1 
ATOM   3555 N  N   . LEU A 1 461 ? 6.343   11.478  16.646 1.00 10.84 ? 570  LEU A N   1 
ATOM   3556 C  CA  . LEU A 1 461 ? 5.908   12.785  16.202 1.00 10.67 ? 570  LEU A CA  1 
ATOM   3557 C  C   . LEU A 1 461 ? 5.265   12.627  14.816 1.00 10.14 ? 570  LEU A C   1 
ATOM   3558 O  O   . LEU A 1 461 ? 5.791   11.898  13.961 1.00 10.90 ? 570  LEU A O   1 
ATOM   3559 C  CB  . LEU A 1 461 ? 7.102   13.720  16.086 1.00 10.48 ? 570  LEU A CB  1 
ATOM   3560 C  CG  . LEU A 1 461 ? 8.021   13.827  17.318 1.00 10.59 ? 570  LEU A CG  1 
ATOM   3561 C  CD1 . LEU A 1 461 ? 9.225   14.663  16.969 1.00 12.34 ? 570  LEU A CD1 1 
ATOM   3562 C  CD2 . LEU A 1 461 ? 7.221   14.418  18.485 1.00 11.35 ? 570  LEU A CD2 1 
ATOM   3563 N  N   . TYR A 1 462 ? 4.105   13.246  14.634 1.00 12.94 ? 571  TYR A N   1 
ATOM   3564 C  CA  . TYR A 1 462 ? 3.409   13.260  13.350 1.00 8.79  ? 571  TYR A CA  1 
ATOM   3565 C  C   . TYR A 1 462 ? 3.353   14.699  12.886 1.00 12.20 ? 571  TYR A C   1 
ATOM   3566 O  O   . TYR A 1 462 ? 3.283   15.615  13.704 1.00 13.42 ? 571  TYR A O   1 
ATOM   3567 C  CB  . TYR A 1 462 ? 1.979   12.725  13.473 1.00 11.17 ? 571  TYR A CB  1 
ATOM   3568 C  CG  . TYR A 1 462 ? 1.900   11.270  13.830 1.00 11.50 ? 571  TYR A CG  1 
ATOM   3569 C  CD1 . TYR A 1 462 ? 1.859   10.869  15.169 1.00 12.80 ? 571  TYR A CD1 1 
ATOM   3570 C  CD2 . TYR A 1 462 ? 1.885   10.292  12.842 1.00 11.61 ? 571  TYR A CD2 1 
ATOM   3571 C  CE1 . TYR A 1 462 ? 1.801   9.530   15.517 1.00 12.29 ? 571  TYR A CE1 1 
ATOM   3572 C  CE2 . TYR A 1 462 ? 1.834   8.943   13.180 1.00 15.12 ? 571  TYR A CE2 1 
ATOM   3573 C  CZ  . TYR A 1 462 ? 1.769   8.576   14.529 1.00 13.69 ? 571  TYR A CZ  1 
ATOM   3574 O  OH  . TYR A 1 462 ? 1.721   7.253   14.893 1.00 17.40 ? 571  TYR A OH  1 
ATOM   3575 N  N   . GLY A 1 463 ? 3.356   14.924  11.573 1.00 12.10 ? 572  GLY A N   1 
ATOM   3576 C  CA  . GLY A 1 463 ? 3.146   16.268  11.074 1.00 12.54 ? 572  GLY A CA  1 
ATOM   3577 C  C   . GLY A 1 463 ? 3.810   16.507  9.728  1.00 12.39 ? 572  GLY A C   1 
ATOM   3578 O  O   . GLY A 1 463 ? 3.995   15.570  8.960  1.00 13.52 ? 572  GLY A O   1 
ATOM   3579 N  N   . THR A 1 464 ? 4.180   17.759  9.478  1.00 12.52 ? 573  THR A N   1 
ATOM   3580 C  CA  . THR A 1 464 ? 4.668   18.194  8.171  1.00 12.69 ? 573  THR A CA  1 
ATOM   3581 C  C   . THR A 1 464 ? 5.935   19.023  8.320  1.00 14.35 ? 573  THR A C   1 
ATOM   3582 O  O   . THR A 1 464 ? 6.391   19.241  9.446  1.00 12.81 ? 573  THR A O   1 
ATOM   3583 C  CB  . THR A 1 464 ? 3.592   19.021  7.431  1.00 15.30 ? 573  THR A CB  1 
ATOM   3584 O  OG1 . THR A 1 464 ? 3.271   20.189  8.190  1.00 14.99 ? 573  THR A OG1 1 
ATOM   3585 C  CG2 . THR A 1 464 ? 2.335   18.190  7.213  1.00 11.45 ? 573  THR A CG2 1 
ATOM   3586 N  N   . ALA A 1 465 ? 6.512   19.447  7.185  1.00 13.71 ? 574  ALA A N   1 
ATOM   3587 C  CA  . ALA A 1 465 ? 7.760   20.239  7.157  1.00 17.90 ? 574  ALA A CA  1 
ATOM   3588 C  C   . ALA A 1 465 ? 7.601   21.555  6.386  1.00 19.54 ? 574  ALA A C   1 
ATOM   3589 O  O   . ALA A 1 465 ? 6.467   22.011  6.233  1.00 25.73 ? 574  ALA A O   1 
ATOM   3590 C  CB  . ALA A 1 465 ? 8.892   19.429  6.553  1.00 15.73 ? 574  ALA A CB  1 
HETATM 3591 CA CA  . CA  B 2 .   ? -38.155 17.073  12.370 1.00 16.31 ? 601  CA  A CA  1 
HETATM 3592 CA CA  . CA  C 2 .   ? -31.110 -6.903  10.456 0.83 18.20 ? 602  CA  A CA  1 
HETATM 3593 CA CA  . CA  D 2 .   ? -8.807  10.398  18.784 0.60 11.09 ? 603  CA  A CA  1 
HETATM 3594 CA CA  . CA  E 2 .   ? -13.028 5.682   29.609 1.00 9.96  ? 604  CA  A CA  1 
HETATM 3595 P  P   . PO4 F 3 .   ? -28.770 7.968   26.820 0.62 25.03 ? 605  PO4 A P   1 
HETATM 3596 O  O1  . PO4 F 3 .   ? -29.524 8.028   25.500 0.62 19.27 ? 605  PO4 A O1  1 
HETATM 3597 O  O2  . PO4 F 3 .   ? -27.282 8.086   26.549 0.62 23.77 ? 605  PO4 A O2  1 
HETATM 3598 O  O3  . PO4 F 3 .   ? -29.062 6.639   27.441 0.62 24.99 ? 605  PO4 A O3  1 
HETATM 3599 O  O4  . PO4 F 3 .   ? -29.284 9.083   27.734 0.62 17.76 ? 605  PO4 A O4  1 
HETATM 3600 P  P   . PO4 G 3 .   ? -33.238 8.104   29.335 1.00 45.96 ? 606  PO4 A P   1 
HETATM 3601 O  O1  . PO4 G 3 .   ? -34.184 8.823   28.377 1.00 26.86 ? 606  PO4 A O1  1 
HETATM 3602 O  O2  . PO4 G 3 .   ? -32.005 7.558   28.623 1.00 30.99 ? 606  PO4 A O2  1 
HETATM 3603 O  O3  . PO4 G 3 .   ? -34.014 6.940   29.919 1.00 33.73 ? 606  PO4 A O3  1 
HETATM 3604 O  O4  . PO4 G 3 .   ? -32.717 9.072   30.397 1.00 34.52 ? 606  PO4 A O4  1 
HETATM 3605 C  C1  . EDO H 4 .   ? -24.886 10.047  30.986 1.00 19.66 ? 607  EDO A C1  1 
HETATM 3606 O  O1  . EDO H 4 .   ? -25.772 9.775   32.081 1.00 28.40 ? 607  EDO A O1  1 
HETATM 3607 C  C2  . EDO H 4 .   ? -23.529 9.474   31.373 1.00 18.67 ? 607  EDO A C2  1 
HETATM 3608 O  O2  . EDO H 4 .   ? -23.702 8.070   31.596 1.00 25.75 ? 607  EDO A O2  1 
HETATM 3609 O  O   . HOH I 5 .   ? -12.223 21.577  35.614 1.00 24.37 ? 701  HOH A O   1 
HETATM 3610 O  O   . HOH I 5 .   ? -6.896  -6.237  8.253  1.00 24.73 ? 702  HOH A O   1 
HETATM 3611 O  O   . HOH I 5 .   ? -4.393  12.740  29.763 1.00 19.76 ? 703  HOH A O   1 
HETATM 3612 O  O   . HOH I 5 .   ? -27.363 0.269   22.991 1.00 28.68 ? 704  HOH A O   1 
HETATM 3613 O  O   . HOH I 5 .   ? -18.574 25.637  -0.384 1.00 25.09 ? 705  HOH A O   1 
HETATM 3614 O  O   . HOH I 5 .   ? 6.276   -4.501  24.860 1.00 32.47 ? 706  HOH A O   1 
HETATM 3615 O  O   . HOH I 5 .   ? -40.408 4.454   24.874 1.00 31.24 ? 707  HOH A O   1 
HETATM 3616 O  O   . HOH I 5 .   ? -36.370 20.246  27.066 1.00 26.95 ? 708  HOH A O   1 
HETATM 3617 O  O   . HOH I 5 .   ? -12.704 19.956  -6.117 1.00 21.05 ? 709  HOH A O   1 
HETATM 3618 O  O   . HOH I 5 .   ? -27.363 -7.869  22.850 1.00 27.78 ? 710  HOH A O   1 
HETATM 3619 O  O   . HOH I 5 .   ? -5.900  28.795  1.501  1.00 28.97 ? 711  HOH A O   1 
HETATM 3620 O  O   . HOH I 5 .   ? 6.327   24.678  30.540 1.00 23.28 ? 712  HOH A O   1 
HETATM 3621 O  O   . HOH I 5 .   ? 8.080   6.334   48.189 1.00 28.35 ? 713  HOH A O   1 
HETATM 3622 O  O   . HOH I 5 .   ? -11.908 -3.876  26.774 1.00 29.21 ? 714  HOH A O   1 
HETATM 3623 O  O   . HOH I 5 .   ? -9.223  -5.012  9.377  1.00 18.87 ? 715  HOH A O   1 
HETATM 3624 O  O   . HOH I 5 .   ? 12.976  23.878  13.356 1.00 28.55 ? 716  HOH A O   1 
HETATM 3625 O  O   . HOH I 5 .   ? 10.863  1.987   42.033 1.00 17.79 ? 717  HOH A O   1 
HETATM 3626 O  O   . HOH I 5 .   ? -26.991 27.882  16.186 1.00 20.48 ? 718  HOH A O   1 
HETATM 3627 O  O   . HOH I 5 .   ? -29.497 -10.353 16.560 1.00 21.75 ? 719  HOH A O   1 
HETATM 3628 O  O   . HOH I 5 .   ? -2.072  4.032   47.038 1.00 23.21 ? 720  HOH A O   1 
HETATM 3629 O  O   . HOH I 5 .   ? 2.960   -2.727  20.834 1.00 28.87 ? 721  HOH A O   1 
HETATM 3630 O  O   . HOH I 5 .   ? -23.610 8.795   26.737 1.00 16.71 ? 722  HOH A O   1 
HETATM 3631 O  O   . HOH I 5 .   ? -31.376 2.345   17.825 1.00 15.98 ? 723  HOH A O   1 
HETATM 3632 O  O   . HOH I 5 .   ? -4.985  32.206  23.054 1.00 26.42 ? 724  HOH A O   1 
HETATM 3633 O  O   . HOH I 5 .   ? -27.111 -10.570 18.160 1.00 19.21 ? 725  HOH A O   1 
HETATM 3634 O  O   . HOH I 5 .   ? -8.296  -10.388 15.971 1.00 28.73 ? 726  HOH A O   1 
HETATM 3635 O  O   . HOH I 5 .   ? -17.507 -3.836  5.881  1.00 24.53 ? 727  HOH A O   1 
HETATM 3636 O  O   . HOH I 5 .   ? -28.728 -1.423  4.069  1.00 20.64 ? 728  HOH A O   1 
HETATM 3637 O  O   . HOH I 5 .   ? -8.588  27.417  33.674 1.00 19.34 ? 729  HOH A O   1 
HETATM 3638 O  O   . HOH I 5 .   ? -8.939  22.406  0.423  1.00 24.52 ? 730  HOH A O   1 
HETATM 3639 O  O   . HOH I 5 .   ? 9.596   0.227   47.745 1.00 33.31 ? 731  HOH A O   1 
HETATM 3640 O  O   . HOH I 5 .   ? 2.877   4.937   17.180 1.00 19.33 ? 732  HOH A O   1 
HETATM 3641 O  O   . HOH I 5 .   ? -17.517 32.321  15.172 1.00 22.06 ? 733  HOH A O   1 
HETATM 3642 O  O   . HOH I 5 .   ? -3.719  9.504   43.780 1.00 27.98 ? 734  HOH A O   1 
HETATM 3643 O  O   . HOH I 5 .   ? -26.282 12.701  1.130  1.00 19.15 ? 735  HOH A O   1 
HETATM 3644 O  O   . HOH I 5 .   ? -38.905 11.371  7.489  1.00 20.87 ? 736  HOH A O   1 
HETATM 3645 O  O   . HOH I 5 .   ? -40.850 -0.555  28.434 1.00 19.34 ? 737  HOH A O   1 
HETATM 3646 O  O   . HOH I 5 .   ? 14.126  16.885  5.398  1.00 27.69 ? 738  HOH A O   1 
HETATM 3647 O  O   . HOH I 5 .   ? -2.848  27.612  32.667 1.00 15.35 ? 739  HOH A O   1 
HETATM 3648 O  O   . HOH I 5 .   ? -32.407 25.310  4.974  1.00 24.65 ? 740  HOH A O   1 
HETATM 3649 O  O   . HOH I 5 .   ? -5.223  3.233   19.339 1.00 17.65 ? 741  HOH A O   1 
HETATM 3650 O  O   . HOH I 5 .   ? -1.069  7.615   9.462  1.00 27.28 ? 742  HOH A O   1 
HETATM 3651 O  O   . HOH I 5 .   ? 5.297   -0.325  18.893 1.00 27.65 ? 743  HOH A O   1 
HETATM 3652 O  O   . HOH I 5 .   ? 5.002   16.553  4.313  1.00 17.38 ? 744  HOH A O   1 
HETATM 3653 O  O   . HOH I 5 .   ? -32.337 -5.877  12.238 1.00 23.63 ? 745  HOH A O   1 
HETATM 3654 O  O   . HOH I 5 .   ? -23.940 21.108  -1.561 1.00 24.19 ? 746  HOH A O   1 
HETATM 3655 O  O   . HOH I 5 .   ? -12.770 -3.449  7.629  1.00 26.66 ? 747  HOH A O   1 
HETATM 3656 O  O   . HOH I 5 .   ? 13.227  8.003   39.632 1.00 19.63 ? 748  HOH A O   1 
HETATM 3657 O  O   . HOH I 5 .   ? -26.992 22.669  1.688  1.00 25.64 ? 749  HOH A O   1 
HETATM 3658 O  O   . HOH I 5 .   ? -14.704 24.853  -0.651 1.00 26.62 ? 750  HOH A O   1 
HETATM 3659 O  O   . HOH I 5 .   ? 18.009  17.388  27.062 1.00 18.77 ? 751  HOH A O   1 
HETATM 3660 O  O   . HOH I 5 .   ? -31.508 -0.669  4.889  1.00 23.63 ? 752  HOH A O   1 
HETATM 3661 O  O   . HOH I 5 .   ? -25.918 6.903   23.203 1.00 21.24 ? 753  HOH A O   1 
HETATM 3662 O  O   . HOH I 5 .   ? 11.623  20.676  13.822 1.00 13.68 ? 754  HOH A O   1 
HETATM 3663 O  O   . HOH I 5 .   ? -3.363  32.829  25.675 1.00 23.97 ? 755  HOH A O   1 
HETATM 3664 O  O   . HOH I 5 .   ? -21.965 29.143  34.185 1.00 24.01 ? 756  HOH A O   1 
HETATM 3665 O  O   . HOH I 5 .   ? -16.806 6.117   24.623 1.00 28.97 ? 757  HOH A O   1 
HETATM 3666 O  O   . HOH I 5 .   ? -1.011  13.325  11.846 1.00 10.16 ? 758  HOH A O   1 
HETATM 3667 O  O   . HOH I 5 .   ? -38.737 8.701   24.688 1.00 22.71 ? 759  HOH A O   1 
HETATM 3668 O  O   . HOH I 5 .   ? -27.398 -13.150 15.237 1.00 23.95 ? 760  HOH A O   1 
HETATM 3669 O  O   . HOH I 5 .   ? 6.521   -2.508  40.235 1.00 19.76 ? 761  HOH A O   1 
HETATM 3670 O  O   . HOH I 5 .   ? 14.513  9.658   9.816  1.00 26.57 ? 762  HOH A O   1 
HETATM 3671 O  O   . HOH I 5 .   ? -38.097 26.591  7.961  1.00 30.93 ? 763  HOH A O   1 
HETATM 3672 O  O   . HOH I 5 .   ? -11.630 -3.552  34.950 1.00 20.90 ? 764  HOH A O   1 
HETATM 3673 O  O   . HOH I 5 .   ? -9.904  11.498  23.626 1.00 9.85  ? 765  HOH A O   1 
HETATM 3674 O  O   . HOH I 5 .   ? -5.283  -4.997  35.495 1.00 29.92 ? 766  HOH A O   1 
HETATM 3675 O  O   . HOH I 5 .   ? -36.355 5.000   26.722 1.00 28.46 ? 767  HOH A O   1 
HETATM 3676 O  O   . HOH I 5 .   ? 15.728  18.166  7.191  1.00 16.31 ? 768  HOH A O   1 
HETATM 3677 O  O   . HOH I 5 .   ? 18.466  8.692   23.869 1.00 32.91 ? 769  HOH A O   1 
HETATM 3678 O  O   . HOH I 5 .   ? -5.394  10.231  30.054 1.00 22.59 ? 770  HOH A O   1 
HETATM 3679 O  O   . HOH I 5 .   ? -7.483  17.254  -0.573 1.00 18.89 ? 771  HOH A O   1 
HETATM 3680 O  O   . HOH I 5 .   ? -34.980 15.660  30.675 1.00 29.15 ? 772  HOH A O   1 
HETATM 3681 O  O   . HOH I 5 .   ? -15.637 17.618  29.215 1.00 9.83  ? 773  HOH A O   1 
HETATM 3682 O  O   . HOH I 5 .   ? -19.653 5.328   36.614 1.00 18.64 ? 774  HOH A O   1 
HETATM 3683 O  O   . HOH I 5 .   ? -11.617 15.027  27.343 1.00 10.30 ? 775  HOH A O   1 
HETATM 3684 O  O   . HOH I 5 .   ? -31.382 13.635  2.602  1.00 25.33 ? 776  HOH A O   1 
HETATM 3685 O  O   . HOH I 5 .   ? -13.009 6.540   27.380 1.00 11.08 ? 777  HOH A O   1 
HETATM 3686 O  O   . HOH I 5 .   ? -3.849  16.599  2.378  1.00 18.76 ? 778  HOH A O   1 
HETATM 3687 O  O   . HOH I 5 .   ? 12.024  3.522   22.339 1.00 16.05 ? 779  HOH A O   1 
HETATM 3688 O  O   . HOH I 5 .   ? 3.878   -3.787  36.786 1.00 20.20 ? 780  HOH A O   1 
HETATM 3689 O  O   . HOH I 5 .   ? -17.409 3.339   42.139 1.00 28.74 ? 781  HOH A O   1 
HETATM 3690 O  O   . HOH I 5 .   ? 13.777  0.292   38.840 1.00 28.71 ? 782  HOH A O   1 
HETATM 3691 O  O   . HOH I 5 .   ? -4.518  6.807   42.835 1.00 22.86 ? 783  HOH A O   1 
HETATM 3692 O  O   . HOH I 5 .   ? -22.119 8.358   20.125 1.00 20.18 ? 784  HOH A O   1 
HETATM 3693 O  O   . HOH I 5 .   ? -37.188 9.834   26.687 1.00 21.44 ? 785  HOH A O   1 
HETATM 3694 O  O   . HOH I 5 .   ? -8.559  26.917  21.492 1.00 14.30 ? 786  HOH A O   1 
HETATM 3695 O  O   . HOH I 5 .   ? -25.578 30.655  14.577 1.00 22.24 ? 787  HOH A O   1 
HETATM 3696 O  O   . HOH I 5 .   ? -8.659  12.968  19.008 1.00 11.29 ? 788  HOH A O   1 
HETATM 3697 O  O   . HOH I 5 .   ? -35.040 25.253  7.926  1.00 27.60 ? 789  HOH A O   1 
HETATM 3698 O  O   . HOH I 5 .   ? -5.802  9.974   3.247  1.00 19.15 ? 790  HOH A O   1 
HETATM 3699 O  O   . HOH I 5 .   ? 18.287  20.152  30.397 1.00 30.64 ? 791  HOH A O   1 
HETATM 3700 O  O   . HOH I 5 .   ? -30.574 -3.856  18.137 1.00 19.40 ? 792  HOH A O   1 
HETATM 3701 O  O   . HOH I 5 .   ? -24.413 2.645   22.510 1.00 22.93 ? 793  HOH A O   1 
HETATM 3702 O  O   . HOH I 5 .   ? -27.632 30.413  22.771 1.00 39.43 ? 794  HOH A O   1 
HETATM 3703 O  O   . HOH I 5 .   ? -15.583 14.144  0.792  1.00 20.76 ? 795  HOH A O   1 
HETATM 3704 O  O   . HOH I 5 .   ? 20.442  6.531   30.562 1.00 37.31 ? 796  HOH A O   1 
HETATM 3705 O  O   . HOH I 5 .   ? -1.893  -2.887  43.232 1.00 17.41 ? 797  HOH A O   1 
HETATM 3706 O  O   . HOH I 5 .   ? -10.625 10.045  10.825 1.00 9.39  ? 798  HOH A O   1 
HETATM 3707 O  O   . HOH I 5 .   ? -33.108 25.545  35.039 1.00 26.51 ? 799  HOH A O   1 
HETATM 3708 O  O   . HOH I 5 .   ? -18.682 7.952   35.269 1.00 15.87 ? 800  HOH A O   1 
HETATM 3709 O  O   . HOH I 5 .   ? -17.637 26.999  36.638 1.00 23.96 ? 801  HOH A O   1 
HETATM 3710 O  O   . HOH I 5 .   ? -11.570 0.593   6.865  1.00 23.22 ? 802  HOH A O   1 
HETATM 3711 O  O   . HOH I 5 .   ? -2.856  -6.528  38.391 1.00 27.70 ? 803  HOH A O   1 
HETATM 3712 O  O   . HOH I 5 .   ? -7.436  12.442  33.136 1.00 16.83 ? 804  HOH A O   1 
HETATM 3713 O  O   . HOH I 5 .   ? -10.855 -4.709  18.312 1.00 13.52 ? 805  HOH A O   1 
HETATM 3714 O  O   . HOH I 5 .   ? -8.161  10.388  36.152 1.00 14.55 ? 806  HOH A O   1 
HETATM 3715 O  O   . HOH I 5 .   ? -27.247 4.864   -1.286 1.00 25.12 ? 807  HOH A O   1 
HETATM 3716 O  O   . HOH I 5 .   ? -14.787 5.759   23.902 1.00 22.94 ? 808  HOH A O   1 
HETATM 3717 O  O   . HOH I 5 .   ? -15.585 -3.090  36.071 1.00 28.65 ? 809  HOH A O   1 
HETATM 3718 O  O   . HOH I 5 .   ? -15.053 6.828   4.364  1.00 17.32 ? 810  HOH A O   1 
HETATM 3719 O  O   . HOH I 5 .   ? -23.023 33.551  14.383 1.00 28.43 ? 811  HOH A O   1 
HETATM 3720 O  O   . HOH I 5 .   ? 18.583  14.310  12.849 1.00 22.34 ? 812  HOH A O   1 
HETATM 3721 O  O   . HOH I 5 .   ? 5.594   24.767  13.432 1.00 26.88 ? 813  HOH A O   1 
HETATM 3722 O  O   . HOH I 5 .   ? -28.946 17.794  32.391 1.00 8.46  ? 814  HOH A O   1 
HETATM 3723 O  O   . HOH I 5 .   ? -21.561 4.363   19.199 1.00 26.06 ? 815  HOH A O   1 
HETATM 3724 O  O   . HOH I 5 .   ? -10.787 -4.075  22.527 1.00 19.36 ? 816  HOH A O   1 
HETATM 3725 O  O   . HOH I 5 .   ? -28.104 14.708  0.864  1.00 18.97 ? 817  HOH A O   1 
HETATM 3726 O  O   . HOH I 5 .   ? -19.720 4.183   29.922 1.00 18.56 ? 818  HOH A O   1 
HETATM 3727 O  O   . HOH I 5 .   ? 16.028  21.297  14.657 1.00 25.04 ? 819  HOH A O   1 
HETATM 3728 O  O   . HOH I 5 .   ? -18.685 4.276   34.599 1.00 22.82 ? 820  HOH A O   1 
HETATM 3729 O  O   . HOH I 5 .   ? -0.606  15.823  1.306  1.00 22.88 ? 821  HOH A O   1 
HETATM 3730 O  O   . HOH I 5 .   ? -9.569  8.951   -5.825 1.00 24.45 ? 822  HOH A O   1 
HETATM 3731 O  O   . HOH I 5 .   ? 3.730   13.477  36.205 1.00 14.19 ? 823  HOH A O   1 
HETATM 3732 O  O   . HOH I 5 .   ? 0.619   -1.447  37.357 1.00 13.23 ? 824  HOH A O   1 
HETATM 3733 O  O   . HOH I 5 .   ? -2.062  1.692   13.159 1.00 22.42 ? 825  HOH A O   1 
HETATM 3734 O  O   . HOH I 5 .   ? -42.433 21.771  11.073 1.00 20.08 ? 826  HOH A O   1 
HETATM 3735 O  O   . HOH I 5 .   ? -5.231  3.619   16.596 1.00 25.19 ? 827  HOH A O   1 
HETATM 3736 O  O   . HOH I 5 .   ? -30.240 16.886  18.704 1.00 15.25 ? 828  HOH A O   1 
HETATM 3737 O  O   . HOH I 5 .   ? -20.746 20.175  -1.440 1.00 22.75 ? 829  HOH A O   1 
HETATM 3738 O  O   . HOH I 5 .   ? 9.666   -3.467  34.106 1.00 19.68 ? 830  HOH A O   1 
HETATM 3739 O  O   . HOH I 5 .   ? 10.856  24.015  19.175 1.00 13.87 ? 831  HOH A O   1 
HETATM 3740 O  O   . HOH I 5 .   ? 0.482   20.950  12.095 1.00 12.98 ? 832  HOH A O   1 
HETATM 3741 O  O   . HOH I 5 .   ? -15.483 12.382  28.323 1.00 8.94  ? 833  HOH A O   1 
HETATM 3742 O  O   . HOH I 5 .   ? -36.263 -8.120  21.417 1.00 14.14 ? 834  HOH A O   1 
HETATM 3743 O  O   . HOH I 5 .   ? -7.495  11.957  39.432 1.00 20.50 ? 835  HOH A O   1 
HETATM 3744 O  O   . HOH I 5 .   ? 9.737   19.469  33.826 1.00 31.59 ? 836  HOH A O   1 
HETATM 3745 O  O   . HOH I 5 .   ? -10.079 5.265   38.874 1.00 14.22 ? 837  HOH A O   1 
HETATM 3746 O  O   . HOH I 5 .   ? -28.126 -0.386  26.121 1.00 33.64 ? 838  HOH A O   1 
HETATM 3747 O  O   . HOH I 5 .   ? -3.537  24.006  11.872 1.00 17.17 ? 839  HOH A O   1 
HETATM 3748 O  O   . HOH I 5 .   ? -23.009 31.045  18.906 1.00 38.38 ? 840  HOH A O   1 
HETATM 3749 O  O   . HOH I 5 .   ? -2.514  24.095  18.591 1.00 12.10 ? 841  HOH A O   1 
HETATM 3750 O  O   . HOH I 5 .   ? 16.077  10.285  34.014 1.00 27.00 ? 842  HOH A O   1 
HETATM 3751 O  O   . HOH I 5 .   ? 0.983   19.918  9.660  1.00 12.02 ? 843  HOH A O   1 
HETATM 3752 O  O   . HOH I 5 .   ? -33.898 2.130   29.941 1.00 29.67 ? 844  HOH A O   1 
HETATM 3753 O  O   . HOH I 5 .   ? -22.007 27.360  27.809 1.00 26.53 ? 845  HOH A O   1 
HETATM 3754 O  O   . HOH I 5 .   ? -4.222  14.560  4.476  1.00 20.28 ? 846  HOH A O   1 
HETATM 3755 O  O   . HOH I 5 .   ? -26.191 14.402  32.769 1.00 11.16 ? 847  HOH A O   1 
HETATM 3756 O  O   . HOH I 5 .   ? -7.497  17.276  25.065 1.00 8.01  ? 848  HOH A O   1 
HETATM 3757 O  O   . HOH I 5 .   ? 3.537   2.521   51.731 1.00 24.82 ? 849  HOH A O   1 
HETATM 3758 O  O   . HOH I 5 .   ? -13.072 16.158  32.165 1.00 9.26  ? 850  HOH A O   1 
HETATM 3759 O  O   . HOH I 5 .   ? -32.757 18.319  32.679 1.00 16.63 ? 851  HOH A O   1 
HETATM 3760 O  O   . HOH I 5 .   ? -37.093 4.498   5.845  1.00 24.57 ? 852  HOH A O   1 
HETATM 3761 O  O   . HOH I 5 .   ? 7.337   29.032  24.050 1.00 20.54 ? 853  HOH A O   1 
HETATM 3762 O  O   . HOH I 5 .   ? -33.802 18.593  27.804 1.00 16.30 ? 854  HOH A O   1 
HETATM 3763 O  O   . HOH I 5 .   ? -35.573 15.342  15.903 1.00 14.44 ? 855  HOH A O   1 
HETATM 3764 O  O   . HOH I 5 .   ? 2.726   18.786  24.980 1.00 12.24 ? 856  HOH A O   1 
HETATM 3765 O  O   . HOH I 5 .   ? 13.009  22.282  28.185 1.00 18.40 ? 857  HOH A O   1 
HETATM 3766 O  O   . HOH I 5 .   ? 7.062   1.561   24.761 1.00 14.26 ? 858  HOH A O   1 
HETATM 3767 O  O   . HOH I 5 .   ? -31.810 25.303  31.893 1.00 15.25 ? 859  HOH A O   1 
HETATM 3768 O  O   . HOH I 5 .   ? 7.567   1.688   21.026 1.00 22.56 ? 860  HOH A O   1 
HETATM 3769 O  O   . HOH I 5 .   ? -26.567 20.433  29.987 1.00 7.15  ? 861  HOH A O   1 
HETATM 3770 O  O   . HOH I 5 .   ? -23.571 20.300  35.926 1.00 11.25 ? 862  HOH A O   1 
HETATM 3771 O  O   . HOH I 5 .   ? -37.428 -6.618  18.320 1.00 16.09 ? 863  HOH A O   1 
HETATM 3772 O  O   . HOH I 5 .   ? -31.673 -8.983  11.216 1.00 32.19 ? 864  HOH A O   1 
HETATM 3773 O  O   . HOH I 5 .   ? -20.595 29.486  -0.046 1.00 33.63 ? 865  HOH A O   1 
HETATM 3774 O  O   . HOH I 5 .   ? 12.813  23.803  25.983 1.00 13.28 ? 866  HOH A O   1 
HETATM 3775 O  O   . HOH I 5 .   ? -10.931 12.582  34.037 1.00 13.28 ? 867  HOH A O   1 
HETATM 3776 O  O   . HOH I 5 .   ? -13.376 3.023   6.594  1.00 12.42 ? 868  HOH A O   1 
HETATM 3777 O  O   . HOH I 5 .   ? -32.893 22.859  2.913  1.00 33.82 ? 869  HOH A O   1 
HETATM 3778 O  O   . HOH I 5 .   ? -2.045  17.358  36.016 1.00 24.44 ? 870  HOH A O   1 
HETATM 3779 O  O   . HOH I 5 .   ? -0.677  19.230  32.133 1.00 17.29 ? 871  HOH A O   1 
HETATM 3780 O  O   . HOH I 5 .   ? -1.266  21.332  -0.606 1.00 24.99 ? 872  HOH A O   1 
HETATM 3781 O  O   . HOH I 5 .   ? -10.038 2.540   29.448 1.00 11.04 ? 873  HOH A O   1 
HETATM 3782 O  O   . HOH I 5 .   ? -41.945 -3.696  21.982 1.00 22.69 ? 874  HOH A O   1 
HETATM 3783 O  O   . HOH I 5 .   ? 7.817   -2.043  22.084 1.00 26.93 ? 875  HOH A O   1 
HETATM 3784 O  O   . HOH I 5 .   ? -22.509 -4.543  23.368 1.00 26.38 ? 876  HOH A O   1 
HETATM 3785 O  O   . HOH I 5 .   ? -14.484 1.844   39.571 1.00 25.19 ? 877  HOH A O   1 
HETATM 3786 O  O   . HOH I 5 .   ? -22.553 7.862   17.414 1.00 16.95 ? 878  HOH A O   1 
HETATM 3787 O  O   . HOH I 5 .   ? -2.447  6.943   20.268 1.00 16.73 ? 879  HOH A O   1 
HETATM 3788 O  O   . HOH I 5 .   ? -1.951  21.510  27.791 1.00 14.72 ? 880  HOH A O   1 
HETATM 3789 O  O   . HOH I 5 .   ? -17.014 10.321  41.962 1.00 18.70 ? 881  HOH A O   1 
HETATM 3790 O  O   . HOH I 5 .   ? 5.843   3.267   11.216 1.00 30.98 ? 882  HOH A O   1 
HETATM 3791 O  O   . HOH I 5 .   ? -8.146  27.291  18.615 1.00 17.77 ? 883  HOH A O   1 
HETATM 3792 O  O   . HOH I 5 .   ? 7.350   22.304  21.118 1.00 12.04 ? 884  HOH A O   1 
HETATM 3793 O  O   . HOH I 5 .   ? 14.583  20.015  13.442 1.00 22.07 ? 885  HOH A O   1 
HETATM 3794 O  O   . HOH I 5 .   ? -39.399 18.210  5.264  1.00 26.49 ? 886  HOH A O   1 
HETATM 3795 O  O   . HOH I 5 .   ? -30.424 -13.439 18.496 1.00 22.98 ? 887  HOH A O   1 
HETATM 3796 O  O   . HOH I 5 .   ? -28.212 27.939  24.020 1.00 26.87 ? 888  HOH A O   1 
HETATM 3797 O  O   . HOH I 5 .   ? -10.176 29.400  18.211 1.00 20.41 ? 889  HOH A O   1 
HETATM 3798 O  O   . HOH I 5 .   ? -30.078 26.632  4.134  1.00 27.16 ? 890  HOH A O   1 
HETATM 3799 O  O   . HOH I 5 .   ? -22.243 -10.067 16.732 1.00 21.53 ? 891  HOH A O   1 
HETATM 3800 O  O   . HOH I 5 .   ? -9.687  -6.827  24.640 1.00 33.90 ? 892  HOH A O   1 
HETATM 3801 O  O   . HOH I 5 .   ? -20.531 28.702  24.067 1.00 30.63 ? 893  HOH A O   1 
HETATM 3802 O  O   . HOH I 5 .   ? 0.174   17.598  19.712 1.00 9.38  ? 894  HOH A O   1 
HETATM 3803 O  O   . HOH I 5 .   ? -13.827 15.234  -2.939 1.00 20.36 ? 895  HOH A O   1 
HETATM 3804 O  O   . HOH I 5 .   ? -34.444 -2.151  22.858 1.00 14.58 ? 896  HOH A O   1 
HETATM 3805 O  O   . HOH I 5 .   ? 10.041  26.111  26.845 1.00 11.30 ? 897  HOH A O   1 
HETATM 3806 O  O   . HOH I 5 .   ? -4.164  4.314   35.564 1.00 13.93 ? 898  HOH A O   1 
HETATM 3807 O  O   . HOH I 5 .   ? -7.488  -3.225  36.388 1.00 28.45 ? 899  HOH A O   1 
HETATM 3808 O  O   . HOH I 5 .   ? -3.351  6.658   36.790 1.00 11.67 ? 900  HOH A O   1 
HETATM 3809 O  O   . HOH I 5 .   ? -29.239 15.507  35.351 1.00 13.56 ? 901  HOH A O   1 
HETATM 3810 O  O   . HOH I 5 .   ? -4.300  21.928  28.870 1.00 17.10 ? 902  HOH A O   1 
HETATM 3811 O  O   . HOH I 5 .   ? -19.981 27.453  18.920 1.00 19.57 ? 903  HOH A O   1 
HETATM 3812 O  O   . HOH I 5 .   ? 5.719   19.120  4.491  1.00 15.77 ? 904  HOH A O   1 
HETATM 3813 O  O   . HOH I 5 .   ? 18.024  6.728   29.092 1.00 30.92 ? 905  HOH A O   1 
HETATM 3814 O  O   . HOH I 5 .   ? 15.801  7.087   17.986 1.00 18.95 ? 906  HOH A O   1 
HETATM 3815 O  O   . HOH I 5 .   ? -23.528 23.686  35.949 1.00 12.82 ? 907  HOH A O   1 
HETATM 3816 O  O   . HOH I 5 .   ? -10.196 12.913  11.226 1.00 11.76 ? 908  HOH A O   1 
HETATM 3817 O  O   . HOH I 5 .   ? -29.560 17.873  16.375 1.00 11.87 ? 909  HOH A O   1 
HETATM 3818 O  O   . HOH I 5 .   ? -34.956 15.745  4.426  1.00 26.29 ? 910  HOH A O   1 
HETATM 3819 O  O   . HOH I 5 .   ? -25.901 26.898  26.565 1.00 27.25 ? 911  HOH A O   1 
HETATM 3820 O  O   . HOH I 5 .   ? -26.426 1.837   14.830 1.00 15.79 ? 912  HOH A O   1 
HETATM 3821 O  O   . HOH I 5 .   ? -13.050 29.875  29.071 1.00 23.91 ? 913  HOH A O   1 
HETATM 3822 O  O   . HOH I 5 .   ? -13.565 30.624  10.541 1.00 16.55 ? 914  HOH A O   1 
HETATM 3823 O  O   . HOH I 5 .   ? -18.464 1.520   30.316 1.00 21.54 ? 915  HOH A O   1 
HETATM 3824 O  O   . HOH I 5 .   ? -14.110 32.331  14.425 1.00 22.58 ? 916  HOH A O   1 
HETATM 3825 O  O   . HOH I 5 .   ? -14.924 24.261  15.741 1.00 9.43  ? 917  HOH A O   1 
HETATM 3826 O  O   . HOH I 5 .   ? 0.342   0.724   47.040 1.00 22.62 ? 918  HOH A O   1 
HETATM 3827 O  O   . HOH I 5 .   ? -42.978 15.351  17.467 1.00 17.86 ? 919  HOH A O   1 
HETATM 3828 O  O   . HOH I 5 .   ? 5.045   8.181   48.411 1.00 26.80 ? 920  HOH A O   1 
HETATM 3829 O  O   . HOH I 5 .   ? -44.965 7.857   17.801 1.00 27.71 ? 921  HOH A O   1 
HETATM 3830 O  O   . HOH I 5 .   ? 7.800   -2.673  24.837 1.00 19.09 ? 922  HOH A O   1 
HETATM 3831 O  O   . HOH I 5 .   ? -2.074  8.595   49.748 1.00 27.41 ? 923  HOH A O   1 
HETATM 3832 O  O   . HOH I 5 .   ? 10.822  27.064  15.751 1.00 23.09 ? 924  HOH A O   1 
HETATM 3833 O  O   . HOH I 5 .   ? -12.649 3.438   28.841 1.00 10.02 ? 925  HOH A O   1 
HETATM 3834 O  O   . HOH I 5 .   ? -12.637 -4.048  31.718 1.00 23.40 ? 926  HOH A O   1 
HETATM 3835 O  O   . HOH I 5 .   ? 6.911   19.642  36.833 1.00 36.83 ? 927  HOH A O   1 
HETATM 3836 O  O   . HOH I 5 .   ? -18.155 12.933  38.758 1.00 12.76 ? 928  HOH A O   1 
HETATM 3837 O  O   . HOH I 5 .   ? 16.729  22.921  27.976 1.00 29.36 ? 929  HOH A O   1 
HETATM 3838 O  O   . HOH I 5 .   ? -44.098 -1.619  29.134 1.00 24.86 ? 930  HOH A O   1 
HETATM 3839 O  O   . HOH I 5 .   ? 2.360   26.688  28.136 1.00 26.44 ? 931  HOH A O   1 
HETATM 3840 O  O   . HOH I 5 .   ? -17.346 14.517  28.212 1.00 9.23  ? 932  HOH A O   1 
HETATM 3841 O  O   . HOH I 5 .   ? -37.950 0.908   30.307 1.00 21.30 ? 933  HOH A O   1 
HETATM 3842 O  O   . HOH I 5 .   ? 3.863   26.446  25.532 1.00 17.71 ? 934  HOH A O   1 
HETATM 3843 O  O   . HOH I 5 .   ? 10.355  21.157  27.643 1.00 18.94 ? 935  HOH A O   1 
HETATM 3844 O  O   . HOH I 5 .   ? 16.856  12.792  31.863 1.00 22.11 ? 936  HOH A O   1 
HETATM 3845 O  O   . HOH I 5 .   ? 13.054  3.973   24.848 1.00 12.90 ? 937  HOH A O   1 
HETATM 3846 O  O   . HOH I 5 .   ? -41.921 11.075  16.197 1.00 30.08 ? 938  HOH A O   1 
HETATM 3847 O  O   . HOH I 5 .   ? 15.086  12.689  15.513 1.00 21.67 ? 939  HOH A O   1 
HETATM 3848 O  O   . HOH I 5 .   ? -6.123  22.553  -1.350 1.00 19.28 ? 940  HOH A O   1 
HETATM 3849 O  O   . HOH I 5 .   ? 8.296   6.482   10.104 1.00 24.89 ? 941  HOH A O   1 
HETATM 3850 O  O   . HOH I 5 .   ? -32.765 15.482  16.460 1.00 16.81 ? 942  HOH A O   1 
HETATM 3851 O  O   . HOH I 5 .   ? -16.856 -12.546 14.963 1.00 29.92 ? 943  HOH A O   1 
HETATM 3852 O  O   . HOH I 5 .   ? 16.425  14.073  3.247  1.00 24.37 ? 944  HOH A O   1 
HETATM 3853 O  O   . HOH I 5 .   ? -4.279  -3.915  32.148 1.00 20.79 ? 945  HOH A O   1 
HETATM 3854 O  O   . HOH I 5 .   ? -17.206 28.778  23.583 1.00 23.19 ? 946  HOH A O   1 
HETATM 3855 O  O   . HOH I 5 .   ? -36.269 4.562   24.153 1.00 26.20 ? 947  HOH A O   1 
HETATM 3856 O  O   . HOH I 5 .   ? -5.112  26.987  4.383  1.00 24.70 ? 948  HOH A O   1 
HETATM 3857 O  O   . HOH I 5 .   ? -28.100 -11.939 20.027 1.00 28.56 ? 949  HOH A O   1 
HETATM 3858 O  O   . HOH I 5 .   ? -21.491 6.951   33.077 1.00 15.61 ? 950  HOH A O   1 
HETATM 3859 O  O   . HOH I 5 .   ? -37.764 12.876  27.318 1.00 18.45 ? 951  HOH A O   1 
HETATM 3860 O  O   . HOH I 5 .   ? -42.662 11.845  8.775  1.00 33.69 ? 952  HOH A O   1 
HETATM 3861 O  O   . HOH I 5 .   ? 1.160   23.913  29.408 1.00 24.05 ? 953  HOH A O   1 
HETATM 3862 O  O   . HOH I 5 .   ? 11.627  7.754   12.222 1.00 16.46 ? 954  HOH A O   1 
HETATM 3863 O  O   . HOH I 5 .   ? -38.773 4.244   23.333 1.00 27.58 ? 955  HOH A O   1 
HETATM 3864 O  O   . HOH I 5 .   ? -24.958 -1.307  2.697  1.00 23.39 ? 956  HOH A O   1 
HETATM 3865 O  O   . HOH I 5 .   ? 8.255   11.848  3.390  1.00 24.27 ? 957  HOH A O   1 
HETATM 3866 O  O   . HOH I 5 .   ? 14.400  23.008  24.007 1.00 13.41 ? 958  HOH A O   1 
HETATM 3867 O  O   . HOH I 5 .   ? -34.805 17.890  6.139  1.00 17.80 ? 959  HOH A O   1 
HETATM 3868 O  O   . HOH I 5 .   ? -1.070  22.278  30.914 1.00 31.46 ? 960  HOH A O   1 
HETATM 3869 O  O   . HOH I 5 .   ? -0.327  11.840  3.955  1.00 20.85 ? 961  HOH A O   1 
HETATM 3870 O  O   . HOH I 5 .   ? -17.561 1.920   -0.714 1.00 18.38 ? 962  HOH A O   1 
HETATM 3871 O  O   . HOH I 5 .   ? -11.459 2.476   32.408 1.00 12.49 ? 963  HOH A O   1 
HETATM 3872 O  O   . HOH I 5 .   ? -8.068  -5.379  22.523 1.00 30.55 ? 964  HOH A O   1 
HETATM 3873 O  O   . HOH I 5 .   ? -13.388 -1.608  3.795  1.00 29.32 ? 965  HOH A O   1 
HETATM 3874 O  O   . HOH I 5 .   ? -26.907 31.070  17.325 1.00 34.05 ? 966  HOH A O   1 
HETATM 3875 O  O   . HOH I 5 .   ? 16.357  13.251  17.391 1.00 19.48 ? 967  HOH A O   1 
HETATM 3876 O  O   . HOH I 5 .   ? -24.277 5.891   21.649 1.00 30.71 ? 968  HOH A O   1 
HETATM 3877 O  O   . HOH I 5 .   ? -7.105  26.854  37.769 1.00 26.34 ? 969  HOH A O   1 
HETATM 3878 O  O   . HOH I 5 .   ? -28.128 -2.830  27.198 1.00 35.68 ? 970  HOH A O   1 
HETATM 3879 O  O   . HOH I 5 .   ? 8.614   -2.588  31.951 1.00 17.87 ? 971  HOH A O   1 
HETATM 3880 O  O   . HOH I 5 .   ? -31.391 -6.855  22.332 1.00 21.97 ? 972  HOH A O   1 
HETATM 3881 O  O   . HOH I 5 .   ? 3.692   22.981  7.456  1.00 36.52 ? 973  HOH A O   1 
HETATM 3882 O  O   . HOH I 5 .   ? -6.938  12.816  16.835 1.00 14.15 ? 974  HOH A O   1 
HETATM 3883 O  O   . HOH I 5 .   ? 10.988  1.749   18.437 1.00 29.99 ? 975  HOH A O   1 
HETATM 3884 O  O   . HOH I 5 .   ? -2.314  12.066  5.034  1.00 25.27 ? 976  HOH A O   1 
HETATM 3885 O  O   . HOH I 5 .   ? 7.008   22.368  32.720 1.00 27.13 ? 977  HOH A O   1 
HETATM 3886 O  O   . HOH I 5 .   ? -34.084 14.043  32.057 1.00 30.83 ? 978  HOH A O   1 
HETATM 3887 O  O   . HOH I 5 .   ? -13.321 31.469  22.215 1.00 16.01 ? 979  HOH A O   1 
HETATM 3888 O  O   . HOH I 5 .   ? -7.596  29.382  21.582 1.00 16.62 ? 980  HOH A O   1 
HETATM 3889 O  O   . HOH I 5 .   ? 19.433  15.198  25.332 1.00 17.83 ? 981  HOH A O   1 
HETATM 3890 O  O   . HOH I 5 .   ? 14.388  11.936  37.813 1.00 19.31 ? 982  HOH A O   1 
HETATM 3891 O  O   . HOH I 5 .   ? -4.920  -8.255  18.138 1.00 27.70 ? 983  HOH A O   1 
HETATM 3892 O  O   . HOH I 5 .   ? -13.524 -3.341  28.783 1.00 17.06 ? 984  HOH A O   1 
HETATM 3893 O  O   . HOH I 5 .   ? -40.749 13.779  7.102  1.00 27.04 ? 985  HOH A O   1 
HETATM 3894 O  O   . HOH I 5 .   ? -21.388 6.487   -3.558 1.00 31.13 ? 986  HOH A O   1 
HETATM 3895 O  O   . HOH I 5 .   ? 6.972   5.970   45.840 1.00 18.67 ? 987  HOH A O   1 
HETATM 3896 O  O   . HOH I 5 .   ? -21.509 9.345   -1.107 1.00 18.06 ? 988  HOH A O   1 
HETATM 3897 O  O   . HOH I 5 .   ? 0.985   -5.009  43.387 1.00 20.81 ? 989  HOH A O   1 
HETATM 3898 O  O   . HOH I 5 .   ? -37.091 10.204  30.001 1.00 27.85 ? 990  HOH A O   1 
HETATM 3899 O  O   . HOH I 5 .   ? -16.727 12.515  -1.270 1.00 26.69 ? 991  HOH A O   1 
HETATM 3900 O  O   . HOH I 5 .   ? 7.076   9.495   7.403  1.00 20.14 ? 992  HOH A O   1 
HETATM 3901 O  O   . HOH I 5 .   ? -1.323  1.910   22.390 1.00 21.09 ? 993  HOH A O   1 
HETATM 3902 O  O   . HOH I 5 .   ? -15.069 3.749   26.375 1.00 27.86 ? 994  HOH A O   1 
HETATM 3903 O  O   . HOH I 5 .   ? -12.428 -11.284 15.824 1.00 20.09 ? 995  HOH A O   1 
HETATM 3904 O  O   . HOH I 5 .   ? -12.219 -10.575 19.275 1.00 21.00 ? 996  HOH A O   1 
HETATM 3905 O  O   . HOH I 5 .   ? 0.678   21.485  5.223  1.00 20.76 ? 997  HOH A O   1 
HETATM 3906 O  O   . HOH I 5 .   ? -35.494 -5.379  28.654 1.00 20.58 ? 998  HOH A O   1 
HETATM 3907 O  O   . HOH I 5 .   ? -3.468  21.855  31.696 1.00 22.63 ? 999  HOH A O   1 
HETATM 3908 O  O   . HOH I 5 .   ? -32.982 26.527  28.595 1.00 30.09 ? 1000 HOH A O   1 
HETATM 3909 O  O   . HOH I 5 .   ? -10.585 5.380   29.624 1.00 10.27 ? 1001 HOH A O   1 
HETATM 3910 O  O   . HOH I 5 .   ? 14.609  9.648   14.985 1.00 25.62 ? 1002 HOH A O   1 
HETATM 3911 O  O   . HOH I 5 .   ? -3.458  13.283  38.865 1.00 13.78 ? 1003 HOH A O   1 
HETATM 3912 O  O   . HOH I 5 .   ? -21.444 27.780  36.554 1.00 23.51 ? 1004 HOH A O   1 
HETATM 3913 O  O   . HOH I 5 .   ? -6.702  -3.272  31.960 1.00 20.23 ? 1005 HOH A O   1 
HETATM 3914 O  O   . HOH I 5 .   ? -36.538 5.521   3.801  1.00 28.47 ? 1006 HOH A O   1 
HETATM 3915 O  O   . HOH I 5 .   ? -42.599 11.332  21.841 1.00 22.22 ? 1007 HOH A O   1 
HETATM 3916 O  O   . HOH I 5 .   ? -17.334 2.011   27.128 1.00 27.92 ? 1008 HOH A O   1 
HETATM 3917 O  O   . HOH I 5 .   ? -27.950 -13.715 7.709  1.00 28.21 ? 1009 HOH A O   1 
HETATM 3918 O  O   . HOH I 5 .   ? -6.534  29.443  16.194 1.00 25.90 ? 1010 HOH A O   1 
HETATM 3919 O  O   . HOH I 5 .   ? 2.802   12.857  47.644 1.00 37.48 ? 1011 HOH A O   1 
HETATM 3920 O  O   . HOH I 5 .   ? 1.985   3.324   14.948 1.00 36.31 ? 1012 HOH A O   1 
HETATM 3921 O  O   . HOH I 5 .   ? -17.184 8.399   0.603  1.00 24.21 ? 1013 HOH A O   1 
HETATM 3922 O  O   . HOH I 5 .   ? -27.667 -4.121  23.372 1.00 34.51 ? 1014 HOH A O   1 
HETATM 3923 O  O   . HOH I 5 .   ? -0.309  -1.177  22.908 1.00 31.75 ? 1015 HOH A O   1 
HETATM 3924 O  O   . HOH I 5 .   ? -14.713 -2.596  22.671 1.00 31.21 ? 1016 HOH A O   1 
HETATM 3925 O  O   . HOH I 5 .   ? -3.049  6.148   16.707 1.00 13.91 ? 1017 HOH A O   1 
HETATM 3926 O  O   . HOH I 5 .   ? -4.989  -1.250  21.539 1.00 26.40 ? 1018 HOH A O   1 
HETATM 3927 O  O   . HOH I 5 .   ? -12.425 28.723  32.953 1.00 16.50 ? 1019 HOH A O   1 
HETATM 3928 O  O   . HOH I 5 .   ? -3.342  25.048  5.312  1.00 30.72 ? 1020 HOH A O   1 
HETATM 3929 O  O   . HOH I 5 .   ? -28.948 27.740  26.369 1.00 30.07 ? 1021 HOH A O   1 
HETATM 3930 O  O   . HOH I 5 .   ? 3.985   21.261  4.603  1.00 30.03 ? 1022 HOH A O   1 
HETATM 3931 O  O   . HOH I 5 .   ? -11.055 30.495  16.267 1.00 27.51 ? 1023 HOH A O   1 
HETATM 3932 O  O   . HOH I 5 .   ? -3.155  9.399   5.406  1.00 24.88 ? 1024 HOH A O   1 
HETATM 3933 O  O   . HOH I 5 .   ? 6.611   15.500  2.294  1.00 17.05 ? 1025 HOH A O   1 
HETATM 3934 O  O   . HOH I 5 .   ? 0.284   20.639  33.878 1.00 29.38 ? 1026 HOH A O   1 
HETATM 3935 O  O   . HOH I 5 .   ? 4.620   -4.317  39.805 1.00 23.61 ? 1027 HOH A O   1 
HETATM 3936 O  O   . HOH I 5 .   ? -31.728 16.092  34.534 1.00 18.02 ? 1028 HOH A O   1 
HETATM 3937 O  O   . HOH I 5 .   ? 17.701  10.058  31.774 1.00 31.65 ? 1029 HOH A O   1 
HETATM 3938 O  O   . HOH I 5 .   ? -15.481 7.962   -2.879 1.00 33.10 ? 1030 HOH A O   1 
HETATM 3939 O  O   . HOH I 5 .   ? -21.630 4.745   28.459 1.00 33.70 ? 1031 HOH A O   1 
HETATM 3940 O  O   . HOH I 5 .   ? -24.762 -11.677 16.998 1.00 32.47 ? 1032 HOH A O   1 
HETATM 3941 O  O   . HOH I 5 .   ? -30.949 6.659   31.444 1.00 34.76 ? 1033 HOH A O   1 
HETATM 3942 O  O   . HOH I 5 .   ? -18.498 8.185   25.663 1.00 15.79 ? 1034 HOH A O   1 
HETATM 3943 O  O   . HOH I 5 .   ? -1.580  24.068  26.534 1.00 21.03 ? 1035 HOH A O   1 
HETATM 3944 O  O   . HOH I 5 .   ? -0.834  5.098   15.950 1.00 19.45 ? 1036 HOH A O   1 
HETATM 3945 O  O   . HOH I 5 .   ? -36.648 2.797   29.249 1.00 24.31 ? 1037 HOH A O   1 
HETATM 3946 O  O   . HOH I 5 .   ? -23.036 17.378  35.916 1.00 3.04  ? 1038 HOH A O   1 
HETATM 3947 O  O   . HOH I 5 .   ? -1.321  24.801  9.964  1.00 26.90 ? 1039 HOH A O   1 
HETATM 3948 O  O   . HOH I 5 .   ? -33.542 -8.599  21.833 1.00 16.94 ? 1040 HOH A O   1 
HETATM 3949 O  O   . HOH I 5 .   ? -27.101 12.180  34.123 1.00 16.28 ? 1041 HOH A O   1 
HETATM 3950 O  O   . HOH I 5 .   ? -5.005  -3.060  23.523 1.00 30.86 ? 1042 HOH A O   1 
HETATM 3951 O  O   . HOH I 5 .   ? -1.114  -2.807  25.853 1.00 27.03 ? 1043 HOH A O   1 
HETATM 3952 O  O   . HOH I 5 .   ? -1.150  2.239   18.790 1.00 29.61 ? 1044 HOH A O   1 
HETATM 3953 O  O   . HOH I 5 .   ? -13.540 -6.196  21.038 1.00 28.16 ? 1045 HOH A O   1 
HETATM 3954 O  O   . HOH I 5 .   ? -13.898 30.098  34.712 1.00 38.34 ? 1046 HOH A O   1 
HETATM 3955 O  O   . HOH I 5 .   ? -33.247 -7.077  9.580  1.00 24.12 ? 1047 HOH A O   1 
HETATM 3956 O  O   . HOH I 5 .   ? 5.445   3.376   16.099 1.00 31.91 ? 1048 HOH A O   1 
HETATM 3957 O  O   . HOH I 5 .   ? 17.423  9.214   28.408 1.00 33.72 ? 1049 HOH A O   1 
HETATM 3958 O  O   . HOH I 5 .   ? -31.448 2.228   30.728 1.00 33.28 ? 1050 HOH A O   1 
HETATM 3959 O  O   . HOH I 5 .   ? -19.076 33.033  26.289 1.00 37.27 ? 1051 HOH A O   1 
HETATM 3960 O  O   . HOH I 5 .   ? -30.027 -13.559 16.039 1.00 23.26 ? 1052 HOH A O   1 
HETATM 3961 O  O   . HOH I 5 .   ? -11.901 -2.461  24.457 1.00 26.03 ? 1053 HOH A O   1 
HETATM 3962 O  O   . HOH I 5 .   ? -20.230 8.472   -3.623 1.00 33.63 ? 1054 HOH A O   1 
HETATM 3963 O  O   . HOH I 5 .   ? -5.509  16.680  33.245 1.00 21.71 ? 1055 HOH A O   1 
HETATM 3964 O  O   . HOH I 5 .   ? -34.491 21.690  33.484 1.00 27.36 ? 1056 HOH A O   1 
HETATM 3965 O  O   . HOH I 5 .   ? -1.908  7.874   6.667  1.00 30.15 ? 1057 HOH A O   1 
HETATM 3966 O  O   . HOH I 5 .   ? 1.736   5.224   53.642 1.00 36.14 ? 1058 HOH A O   1 
HETATM 3967 O  O   . HOH I 5 .   ? 16.344  13.235  36.838 1.00 30.98 ? 1059 HOH A O   1 
HETATM 3968 O  O   . HOH I 5 .   ? -16.500 9.818   -1.456 1.00 27.99 ? 1060 HOH A O   1 
HETATM 3969 O  O   . HOH I 5 .   ? -5.540  14.328  31.377 1.00 12.91 ? 1061 HOH A O   1 
HETATM 3970 O  O   . HOH I 5 .   ? -2.646  -0.506  11.801 1.00 27.79 ? 1062 HOH A O   1 
HETATM 3971 O  O   . HOH I 5 .   ? 7.370   19.372  2.602  1.00 19.89 ? 1063 HOH A O   1 
HETATM 3972 O  O   . HOH I 5 .   ? -37.389 5.526   28.848 1.00 31.41 ? 1064 HOH A O   1 
HETATM 3973 O  O   . HOH I 5 .   ? -20.614 4.807   32.543 1.00 26.81 ? 1065 HOH A O   1 
HETATM 3974 O  O   . HOH I 5 .   ? 0.050   21.981  7.974  1.00 21.48 ? 1066 HOH A O   1 
HETATM 3975 O  O   . HOH I 5 .   ? 2.421   12.371  50.058 1.00 37.33 ? 1067 HOH A O   1 
HETATM 3976 O  O   . HOH I 5 .   ? 11.165  2.381   44.681 1.00 28.92 ? 1068 HOH A O   1 
HETATM 3977 O  O   . HOH I 5 .   ? -4.537  12.335  3.694  1.00 25.72 ? 1069 HOH A O   1 
HETATM 3978 O  O   . HOH I 5 .   ? -2.846  4.299   18.898 1.00 23.49 ? 1070 HOH A O   1 
HETATM 3979 O  O   . HOH I 5 .   ? -26.820 3.026   29.062 1.00 38.43 ? 1071 HOH A O   1 
HETATM 3980 O  O   . HOH I 5 .   ? -10.891 32.273  24.581 1.00 28.98 ? 1072 HOH A O   1 
HETATM 3981 O  O   . HOH I 5 .   ? -11.612 -6.488  20.397 1.00 27.98 ? 1073 HOH A O   1 
HETATM 3982 O  O   . HOH I 5 .   ? -18.057 -10.103 11.038 1.00 29.29 ? 1074 HOH A O   1 
HETATM 3983 O  O   . HOH I 5 .   ? 17.225  11.936  12.809 1.00 33.59 ? 1075 HOH A O   1 
HETATM 3984 O  O   . HOH I 5 .   ? -34.115 31.476  -0.925 1.00 37.54 ? 1076 HOH A O   1 
HETATM 3985 O  O   . HOH I 5 .   ? -0.545  -1.918  46.680 1.00 24.12 ? 1077 HOH A O   1 
HETATM 3986 O  O   . HOH I 5 .   ? 10.756  5.753   10.777 1.00 33.53 ? 1078 HOH A O   1 
HETATM 3987 O  O   . HOH I 5 .   ? -3.275  13.392  41.524 1.00 31.49 ? 1079 HOH A O   1 
HETATM 3988 O  O   . HOH I 5 .   ? -34.677 18.014  30.498 1.00 25.56 ? 1080 HOH A O   1 
HETATM 3989 O  O   . HOH I 5 .   ? -30.913 -6.909  25.100 1.00 29.60 ? 1081 HOH A O   1 
HETATM 3990 O  O   . HOH I 5 .   ? 14.464  8.287   12.315 1.00 28.74 ? 1082 HOH A O   1 
HETATM 3991 O  O   . HOH I 5 .   ? -0.352  15.669  38.781 1.00 30.16 ? 1083 HOH A O   1 
HETATM 3992 O  O   . HOH I 5 .   ? -8.591  12.844  35.267 1.00 20.42 ? 1084 HOH A O   1 
HETATM 3993 O  O   . HOH I 5 .   ? -11.869 29.309  40.040 1.00 23.69 ? 1085 HOH A O   1 
HETATM 3994 O  O   . HOH I 5 .   ? 15.382  9.485   39.048 1.00 28.88 ? 1086 HOH A O   1 
HETATM 3995 O  O   . HOH I 5 .   ? 5.377   -5.818  35.664 1.00 33.56 ? 1087 HOH A O   1 
HETATM 3996 O  O   . HOH I 5 .   ? -23.945 30.406  34.398 1.00 37.08 ? 1088 HOH A O   1 
HETATM 3997 O  O   . HOH I 5 .   ? -6.148  13.943  39.193 1.00 26.77 ? 1089 HOH A O   1 
HETATM 3998 O  O   . HOH I 5 .   ? 21.146  15.500  12.963 1.00 28.13 ? 1090 HOH A O   1 
HETATM 3999 O  O   . HOH I 5 .   ? -6.314  12.830  -2.376 1.00 21.62 ? 1091 HOH A O   1 
HETATM 4000 O  O   . HOH I 5 .   ? -10.866 31.464  20.533 1.00 29.22 ? 1092 HOH A O   1 
HETATM 4001 O  O   . HOH I 5 .   ? -8.586  21.782  -1.947 1.00 27.59 ? 1093 HOH A O   1 
HETATM 4002 O  O   . HOH I 5 .   ? -6.872  30.143  18.892 1.00 25.62 ? 1094 HOH A O   1 
HETATM 4003 O  O   . HOH I 5 .   ? -37.637 16.718  39.542 1.00 23.19 ? 1095 HOH A O   1 
HETATM 4004 O  O   . HOH I 5 .   ? -31.577 27.880  32.753 1.00 31.78 ? 1096 HOH A O   1 
HETATM 4005 O  O   . HOH I 5 .   ? -21.012 36.550  27.393 1.00 39.42 ? 1097 HOH A O   1 
HETATM 4006 O  O   . HOH I 5 .   ? 9.547   21.156  31.963 1.00 25.81 ? 1098 HOH A O   1 
HETATM 4007 O  O   . HOH I 5 .   ? -25.989 -15.392 13.634 1.00 34.86 ? 1099 HOH A O   1 
HETATM 4008 O  O   . HOH I 5 .   ? 7.111   -4.468  31.118 1.00 28.40 ? 1100 HOH A O   1 
HETATM 4009 O  O   . HOH I 5 .   ? 16.653  8.862   36.373 1.00 31.31 ? 1101 HOH A O   1 
HETATM 4010 O  O   . HOH I 5 .   ? 17.203  23.078  25.411 1.00 24.04 ? 1102 HOH A O   1 
HETATM 4011 O  O   . HOH I 5 .   ? 2.912   22.865  2.795  1.00 30.62 ? 1103 HOH A O   1 
HETATM 4012 O  O   . HOH I 5 .   ? -15.963 32.759  21.013 1.00 29.60 ? 1104 HOH A O   1 
HETATM 4013 O  O   . HOH I 5 .   ? -14.880 34.525  18.835 1.00 36.51 ? 1105 HOH A O   1 
HETATM 4014 O  O   . HOH I 5 .   ? -9.187  31.486  22.467 1.00 24.59 ? 1106 HOH A O   1 
HETATM 4015 O  O   . HOH I 5 .   ? 14.481  -3.306  33.413 1.00 24.56 ? 1107 HOH A O   1 
HETATM 4016 O  O   . HOH I 5 .   ? -7.543  14.877  35.548 1.00 26.45 ? 1108 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   TYR 1   110 110 TYR TYR A . n 
A 1 2   GLN 2   111 111 GLN GLN A . n 
A 1 3   GLU 3   112 112 GLU GLU A . n 
A 1 4   PRO 4   113 113 PRO PRO A . n 
A 1 5   THR 5   114 114 THR THR A . n 
A 1 6   ASP 6   115 115 ASP ASP A . n 
A 1 7   PRO 7   116 116 PRO PRO A . n 
A 1 8   LYS 8   117 117 LYS LYS A . n 
A 1 9   PHE 9   118 118 PHE PHE A . n 
A 1 10  PRO 10  119 119 PRO PRO A . n 
A 1 11  GLN 11  120 120 GLN GLN A . n 
A 1 12  GLN 12  121 121 GLN GLN A . n 
A 1 13  TRP 13  122 122 TRP TRP A . n 
A 1 14  TYR 14  123 123 TYR TYR A . n 
A 1 15  LEU 15  124 124 LEU LEU A . n 
A 1 16  SER 16  125 125 SER SER A . n 
A 1 17  GLY 17  126 126 GLY GLY A . n 
A 1 18  VAL 18  127 127 VAL VAL A . n 
A 1 19  THR 19  128 128 THR THR A . n 
A 1 20  GLN 20  129 129 GLN GLN A . n 
A 1 21  ARG 21  130 130 ARG ARG A . n 
A 1 22  ASP 22  131 131 ASP ASP A . n 
A 1 23  LEU 23  132 132 LEU LEU A . n 
A 1 24  ASN 24  133 133 ASN ASN A . n 
A 1 25  VAL 25  134 134 VAL VAL A . n 
A 1 26  LYS 26  135 135 LYS LYS A . n 
A 1 27  ALA 27  136 136 ALA ALA A . n 
A 1 28  ALA 28  137 137 ALA ALA A . n 
A 1 29  TRP 29  138 138 TRP TRP A . n 
A 1 30  ALA 30  139 139 ALA ALA A . n 
A 1 31  GLN 31  140 140 GLN GLN A . n 
A 1 32  GLY 32  141 141 GLY GLY A . n 
A 1 33  TYR 33  142 142 TYR TYR A . n 
A 1 34  THR 34  143 143 THR THR A . n 
A 1 35  GLY 35  144 144 GLY GLY A . n 
A 1 36  HIS 36  145 145 HIS HIS A . n 
A 1 37  GLY 37  146 146 GLY GLY A . n 
A 1 38  ILE 38  147 147 ILE ILE A . n 
A 1 39  VAL 39  148 148 VAL VAL A . n 
A 1 40  VAL 40  149 149 VAL VAL A . n 
A 1 41  SER 41  150 150 SER SER A . n 
A 1 42  ILE 42  151 151 ILE ILE A . n 
A 1 43  LEU 43  152 152 LEU LEU A . n 
A 1 44  ASP 44  153 153 ASP ASP A . n 
A 1 45  ASP 45  154 154 ASP ASP A . n 
A 1 46  GLY 46  155 155 GLY GLY A . n 
A 1 47  ILE 47  156 156 ILE ILE A . n 
A 1 48  GLU 48  157 157 GLU GLU A . n 
A 1 49  LYS 49  158 158 LYS LYS A . n 
A 1 50  ASN 50  159 159 ASN ASN A . n 
A 1 51  HIS 51  160 160 HIS HIS A . n 
A 1 52  PRO 52  161 161 PRO PRO A . n 
A 1 53  ASP 53  162 162 ASP ASP A . n 
A 1 54  LEU 54  163 163 LEU LEU A . n 
A 1 55  ALA 55  164 164 ALA ALA A . n 
A 1 56  GLY 56  165 165 GLY GLY A . n 
A 1 57  ASN 57  166 166 ASN ASN A . n 
A 1 58  TYR 58  167 167 TYR TYR A . n 
A 1 59  ASP 59  168 168 ASP ASP A . n 
A 1 60  PRO 60  169 169 PRO PRO A . n 
A 1 61  GLY 61  170 170 GLY GLY A . n 
A 1 62  ALA 62  171 171 ALA ALA A . n 
A 1 63  SER 63  172 172 SER SER A . n 
A 1 64  PHE 64  173 173 PHE PHE A . n 
A 1 65  ASP 65  174 174 ASP ASP A . n 
A 1 66  VAL 66  175 175 VAL VAL A . n 
A 1 67  ASN 67  176 176 ASN ASN A . n 
A 1 68  ASP 68  177 177 ASP ASP A . n 
A 1 69  GLN 69  178 178 GLN GLN A . n 
A 1 70  ASP 70  179 179 ASP ASP A . n 
A 1 71  PRO 71  180 180 PRO PRO A . n 
A 1 72  ASP 72  181 181 ASP ASP A . n 
A 1 73  PRO 73  182 182 PRO PRO A . n 
A 1 74  GLN 74  183 183 GLN GLN A . n 
A 1 75  PRO 75  184 184 PRO PRO A . n 
A 1 76  ARG 76  185 185 ARG ARG A . n 
A 1 77  TYR 77  186 186 TYR TYR A . n 
A 1 78  THR 78  187 187 THR THR A . n 
A 1 79  GLN 79  188 188 GLN GLN A . n 
A 1 80  MET 80  189 189 MET MET A . n 
A 1 81  ASN 81  190 190 ASN ASN A . n 
A 1 82  ASP 82  191 191 ASP ASP A . n 
A 1 83  ASN 83  192 192 ASN ASN A . n 
A 1 84  ARG 84  193 193 ARG ARG A . n 
A 1 85  HIS 85  194 194 HIS HIS A . n 
A 1 86  GLY 86  195 195 GLY GLY A . n 
A 1 87  THR 87  196 196 THR THR A . n 
A 1 88  ARG 88  197 197 ARG ARG A . n 
A 1 89  CYS 89  198 198 CYS CYS A . n 
A 1 90  ALA 90  199 199 ALA ALA A . n 
A 1 91  GLY 91  200 200 GLY GLY A . n 
A 1 92  GLU 92  201 201 GLU GLU A . n 
A 1 93  VAL 93  202 202 VAL VAL A . n 
A 1 94  ALA 94  203 203 ALA ALA A . n 
A 1 95  ALA 95  204 204 ALA ALA A . n 
A 1 96  VAL 96  205 205 VAL VAL A . n 
A 1 97  ALA 97  206 206 ALA ALA A . n 
A 1 98  ASN 98  207 207 ASN ASN A . n 
A 1 99  ASN 99  208 208 ASN ASN A . n 
A 1 100 GLY 100 209 209 GLY GLY A . n 
A 1 101 VAL 101 210 210 VAL VAL A . n 
A 1 102 CYS 102 211 211 CYS CYS A . n 
A 1 103 GLY 103 212 212 GLY GLY A . n 
A 1 104 VAL 104 213 213 VAL VAL A . n 
A 1 105 GLY 105 214 214 GLY GLY A . n 
A 1 106 VAL 106 215 215 VAL VAL A . n 
A 1 107 ALA 107 216 216 ALA ALA A . n 
A 1 108 TYR 108 217 217 TYR TYR A . n 
A 1 109 ASN 109 218 218 ASN ASN A . n 
A 1 110 ALA 110 219 219 ALA ALA A . n 
A 1 111 ARG 111 220 220 ARG ARG A . n 
A 1 112 ILE 112 221 221 ILE ILE A . n 
A 1 113 GLY 113 222 222 GLY GLY A . n 
A 1 114 GLY 114 223 223 GLY GLY A . n 
A 1 115 VAL 115 224 224 VAL VAL A . n 
A 1 116 ARG 116 225 225 ARG ARG A . n 
A 1 117 MET 117 226 226 MET MET A . n 
A 1 118 LEU 118 227 227 LEU LEU A . n 
A 1 119 ASP 119 228 228 ASP ASP A . n 
A 1 120 GLY 120 229 229 GLY GLY A . n 
A 1 121 GLU 121 230 230 GLU GLU A . n 
A 1 122 VAL 122 231 231 VAL VAL A . n 
A 1 123 THR 123 232 232 THR THR A . n 
A 1 124 ASP 124 233 233 ASP ASP A . n 
A 1 125 ALA 125 234 234 ALA ALA A . n 
A 1 126 VAL 126 235 235 VAL VAL A . n 
A 1 127 GLU 127 236 236 GLU GLU A . n 
A 1 128 ALA 128 237 237 ALA ALA A . n 
A 1 129 ARG 129 238 238 ARG ARG A . n 
A 1 130 SER 130 239 239 SER SER A . n 
A 1 131 LEU 131 240 240 LEU LEU A . n 
A 1 132 GLY 132 241 241 GLY GLY A . n 
A 1 133 LEU 133 242 242 LEU LEU A . n 
A 1 134 ASN 134 243 243 ASN ASN A . n 
A 1 135 PRO 135 244 244 PRO PRO A . n 
A 1 136 ASN 136 245 245 ASN ASN A . n 
A 1 137 HIS 137 246 246 HIS HIS A . n 
A 1 138 ILE 138 247 247 ILE ILE A . n 
A 1 139 HIS 139 248 248 HIS HIS A . n 
A 1 140 ILE 140 249 249 ILE ILE A . n 
A 1 141 TYR 141 250 250 TYR TYR A . n 
A 1 142 SER 142 251 251 SER SER A . n 
A 1 143 ALA 143 252 252 ALA ALA A . n 
A 1 144 SER 144 253 253 SER SER A . n 
A 1 145 TRP 145 254 254 TRP TRP A . n 
A 1 146 GLY 146 255 255 GLY GLY A . n 
A 1 147 PRO 147 256 256 PRO PRO A . n 
A 1 148 GLU 148 257 257 GLU GLU A . n 
A 1 149 ASP 149 258 258 ASP ASP A . n 
A 1 150 ASP 150 259 259 ASP ASP A . n 
A 1 151 GLY 151 260 260 GLY GLY A . n 
A 1 152 LYS 152 261 261 LYS LYS A . n 
A 1 153 THR 153 262 262 THR THR A . n 
A 1 154 VAL 154 263 263 VAL VAL A . n 
A 1 155 ASP 155 264 264 ASP ASP A . n 
A 1 156 GLY 156 265 265 GLY GLY A . n 
A 1 157 PRO 157 266 266 PRO PRO A . n 
A 1 158 ALA 158 267 267 ALA ALA A . n 
A 1 159 ARG 159 268 268 ARG ARG A . n 
A 1 160 LEU 160 269 269 LEU LEU A . n 
A 1 161 ALA 161 270 270 ALA ALA A . n 
A 1 162 GLU 162 271 271 GLU GLU A . n 
A 1 163 GLU 163 272 272 GLU GLU A . n 
A 1 164 ALA 164 273 273 ALA ALA A . n 
A 1 165 PHE 165 274 274 PHE PHE A . n 
A 1 166 PHE 166 275 275 PHE PHE A . n 
A 1 167 ARG 167 276 276 ARG ARG A . n 
A 1 168 GLY 168 277 277 GLY GLY A . n 
A 1 169 VAL 169 278 278 VAL VAL A . n 
A 1 170 SER 170 279 279 SER SER A . n 
A 1 171 GLN 171 280 280 GLN GLN A . n 
A 1 172 GLY 172 281 281 GLY GLY A . n 
A 1 173 ARG 173 282 282 ARG ARG A . n 
A 1 174 GLY 174 283 283 GLY GLY A . n 
A 1 175 GLY 175 284 284 GLY GLY A . n 
A 1 176 LEU 176 285 285 LEU LEU A . n 
A 1 177 GLY 177 286 286 GLY GLY A . n 
A 1 178 SER 178 287 287 SER SER A . n 
A 1 179 ILE 179 288 288 ILE ILE A . n 
A 1 180 PHE 180 289 289 PHE PHE A . n 
A 1 181 VAL 181 290 290 VAL VAL A . n 
A 1 182 TRP 182 291 291 TRP TRP A . n 
A 1 183 ALA 183 292 292 ALA ALA A . n 
A 1 184 SER 184 293 293 SER SER A . n 
A 1 185 GLY 185 294 294 GLY GLY A . n 
A 1 186 ASN 186 295 295 ASN ASN A . n 
A 1 187 GLY 187 296 296 GLY GLY A . n 
A 1 188 GLY 188 297 297 GLY GLY A . n 
A 1 189 ARG 189 298 298 ARG ARG A . n 
A 1 190 GLU 190 299 299 GLU GLU A . n 
A 1 191 HIS 191 300 300 HIS HIS A . n 
A 1 192 ASP 192 301 301 ASP ASP A . n 
A 1 193 SER 193 302 302 SER SER A . n 
A 1 194 CYS 194 303 303 CYS CYS A . n 
A 1 195 ASN 195 304 304 ASN ASN A . n 
A 1 196 CYS 196 305 305 CYS CYS A . n 
A 1 197 ASP 197 306 306 ASP ASP A . n 
A 1 198 GLY 198 307 307 GLY GLY A . n 
A 1 199 TYR 199 308 308 TYR TYR A . n 
A 1 200 THR 200 309 309 THR THR A . n 
A 1 201 ASN 201 310 310 ASN ASN A . n 
A 1 202 SER 202 311 311 SER SER A . n 
A 1 203 ILE 203 312 312 ILE ILE A . n 
A 1 204 TYR 204 313 313 TYR TYR A . n 
A 1 205 THR 205 314 314 THR THR A . n 
A 1 206 LEU 206 315 315 LEU LEU A . n 
A 1 207 SER 207 316 316 SER SER A . n 
A 1 208 ILE 208 317 317 ILE ILE A . n 
A 1 209 SER 209 318 318 SER SER A . n 
A 1 210 SER 210 319 319 SER SER A . n 
A 1 211 ALA 211 320 320 ALA ALA A . n 
A 1 212 THR 212 321 321 THR THR A . n 
A 1 213 GLN 213 322 322 GLN GLN A . n 
A 1 214 PHE 214 323 323 PHE PHE A . n 
A 1 215 GLY 215 324 324 GLY GLY A . n 
A 1 216 ASN 216 325 325 ASN ASN A . n 
A 1 217 VAL 217 326 326 VAL VAL A . n 
A 1 218 PRO 218 327 327 PRO PRO A . n 
A 1 219 TRP 219 328 328 TRP TRP A . n 
A 1 220 TYR 220 329 329 TYR TYR A . n 
A 1 221 SER 221 330 330 SER SER A . n 
A 1 222 GLU 222 331 331 GLU GLU A . n 
A 1 223 ALA 223 332 332 ALA ALA A . n 
A 1 224 CYS 224 333 333 CYS CYS A . n 
A 1 225 SER 225 334 334 SER SER A . n 
A 1 226 SER 226 335 335 SER SER A . n 
A 1 227 THR 227 336 336 THR THR A . n 
A 1 228 LEU 228 337 337 LEU LEU A . n 
A 1 229 ALA 229 338 338 ALA ALA A . n 
A 1 230 THR 230 339 339 THR THR A . n 
A 1 231 THR 231 340 340 THR THR A . n 
A 1 232 TYR 232 341 341 TYR TYR A . n 
A 1 233 SER 233 342 342 SER SER A . n 
A 1 234 SER 234 343 343 SER SER A . n 
A 1 235 GLY 235 344 344 GLY GLY A . n 
A 1 236 ASN 236 345 345 ASN ASN A . n 
A 1 237 GLN 237 346 346 GLN GLN A . n 
A 1 238 ASN 238 347 347 ASN ASN A . n 
A 1 239 GLU 239 348 348 GLU GLU A . n 
A 1 240 LYS 240 349 349 LYS LYS A . n 
A 1 241 GLN 241 350 350 GLN GLN A . n 
A 1 242 ILE 242 351 351 ILE ILE A . n 
A 1 243 VAL 243 352 352 VAL VAL A . n 
A 1 244 THR 244 353 353 THR THR A . n 
A 1 245 THR 245 354 354 THR THR A . n 
A 1 246 ASP 246 355 355 ASP ASP A . n 
A 1 247 LEU 247 356 356 LEU LEU A . n 
A 1 248 ARG 248 357 357 ARG ARG A . n 
A 1 249 GLN 249 358 358 GLN GLN A . n 
A 1 250 LYS 250 359 359 LYS LYS A . n 
A 1 251 CYS 251 360 360 CYS CYS A . n 
A 1 252 THR 252 361 361 THR THR A . n 
A 1 253 GLU 253 362 362 GLU GLU A . n 
A 1 254 SER 254 363 363 SER SER A . n 
A 1 255 HIS 255 364 364 HIS HIS A . n 
A 1 256 THR 256 365 365 THR THR A . n 
A 1 257 GLY 257 366 366 GLY GLY A . n 
A 1 258 THR 258 367 367 THR THR A . n 
A 1 259 SER 259 368 368 SER SER A . n 
A 1 260 ALA 260 369 369 ALA ALA A . n 
A 1 261 SER 261 370 370 SER SER A . n 
A 1 262 ALA 262 371 371 ALA ALA A . n 
A 1 263 PRO 263 372 372 PRO PRO A . n 
A 1 264 LEU 264 373 373 LEU LEU A . n 
A 1 265 ALA 265 374 374 ALA ALA A . n 
A 1 266 ALA 266 375 375 ALA ALA A . n 
A 1 267 GLY 267 376 376 GLY GLY A . n 
A 1 268 ILE 268 377 377 ILE ILE A . n 
A 1 269 ILE 269 378 378 ILE ILE A . n 
A 1 270 ALA 270 379 379 ALA ALA A . n 
A 1 271 LEU 271 380 380 LEU LEU A . n 
A 1 272 THR 272 381 381 THR THR A . n 
A 1 273 LEU 273 382 382 LEU LEU A . n 
A 1 274 GLU 274 383 383 GLU GLU A . n 
A 1 275 ALA 275 384 384 ALA ALA A . n 
A 1 276 ASN 276 385 385 ASN ASN A . n 
A 1 277 LYS 277 386 386 LYS LYS A . n 
A 1 278 ASP 278 387 387 ASP ASP A . n 
A 1 279 LEU 279 388 388 LEU LEU A . n 
A 1 280 THR 280 389 389 THR THR A . n 
A 1 281 TRP 281 390 390 TRP TRP A . n 
A 1 282 ARG 282 391 391 ARG ARG A . n 
A 1 283 ASP 283 392 392 ASP ASP A . n 
A 1 284 MET 284 393 393 MET MET A . n 
A 1 285 GLN 285 394 394 GLN GLN A . n 
A 1 286 HIS 286 395 395 HIS HIS A . n 
A 1 287 LEU 287 396 396 LEU LEU A . n 
A 1 288 VAL 288 397 397 VAL VAL A . n 
A 1 289 VAL 289 398 398 VAL VAL A . n 
A 1 290 GLN 290 399 399 GLN GLN A . n 
A 1 291 THR 291 400 400 THR THR A . n 
A 1 292 SER 292 401 401 SER SER A . n 
A 1 293 LYS 293 402 402 LYS LYS A . n 
A 1 294 PRO 294 403 403 PRO PRO A . n 
A 1 295 ALA 295 404 404 ALA ALA A . n 
A 1 296 HIS 296 405 405 HIS HIS A . n 
A 1 297 LEU 297 406 406 LEU LEU A . n 
A 1 298 ASN 298 407 407 ASN ASN A . n 
A 1 299 ALA 299 408 408 ALA ALA A . n 
A 1 300 ASN 300 409 409 ASN ASN A . n 
A 1 301 ASP 301 410 410 ASP ASP A . n 
A 1 302 TRP 302 411 411 TRP TRP A . n 
A 1 303 ALA 303 412 412 ALA ALA A . n 
A 1 304 THR 304 413 413 THR THR A . n 
A 1 305 ASN 305 414 414 ASN ASN A . n 
A 1 306 GLY 306 415 415 GLY GLY A . n 
A 1 307 VAL 307 416 416 VAL VAL A . n 
A 1 308 GLY 308 417 417 GLY GLY A . n 
A 1 309 ARG 309 418 418 ARG ARG A . n 
A 1 310 LYS 310 419 419 LYS LYS A . n 
A 1 311 VAL 311 420 420 VAL VAL A . n 
A 1 312 SER 312 421 421 SER SER A . n 
A 1 313 HIS 313 422 422 HIS HIS A . n 
A 1 314 SER 314 423 423 SER SER A . n 
A 1 315 TYR 315 424 424 TYR TYR A . n 
A 1 316 GLY 316 425 425 GLY GLY A . n 
A 1 317 TYR 317 426 426 TYR TYR A . n 
A 1 318 GLY 318 427 427 GLY GLY A . n 
A 1 319 LEU 319 428 428 LEU LEU A . n 
A 1 320 LEU 320 429 429 LEU LEU A . n 
A 1 321 ASP 321 430 430 ASP ASP A . n 
A 1 322 ALA 322 431 431 ALA ALA A . n 
A 1 323 GLY 323 432 432 GLY GLY A . n 
A 1 324 ALA 324 433 433 ALA ALA A . n 
A 1 325 MET 325 434 434 MET MET A . n 
A 1 326 VAL 326 435 435 VAL VAL A . n 
A 1 327 ALA 327 436 436 ALA ALA A . n 
A 1 328 LEU 328 437 437 LEU LEU A . n 
A 1 329 ALA 329 438 438 ALA ALA A . n 
A 1 330 GLN 330 439 439 GLN GLN A . n 
A 1 331 ASP 331 440 440 ASP ASP A . n 
A 1 332 TRP 332 441 441 TRP TRP A . n 
A 1 333 THR 333 442 442 THR THR A . n 
A 1 334 THR 334 443 443 THR THR A . n 
A 1 335 VAL 335 444 444 VAL VAL A . n 
A 1 336 ALA 336 445 445 ALA ALA A . n 
A 1 337 PRO 337 446 446 PRO PRO A . n 
A 1 338 GLN 338 447 447 GLN GLN A . n 
A 1 339 ARG 339 448 448 ARG ARG A . n 
A 1 340 LYS 340 449 449 LYS LYS A . n 
A 1 341 CYS 341 450 450 CYS CYS A . n 
A 1 342 ILE 342 451 451 ILE ILE A . n 
A 1 343 ILE 343 452 452 ILE ILE A . n 
A 1 344 ASP 344 453 453 ASP ASP A . n 
A 1 345 ILE 345 454 454 ILE ILE A . n 
A 1 346 LEU 346 455 455 LEU LEU A . n 
A 1 347 THR 347 456 456 THR THR A . n 
A 1 348 GLU 348 457 457 GLU GLU A . n 
A 1 349 PRO 349 458 458 PRO PRO A . n 
A 1 350 LYS 350 459 459 LYS LYS A . n 
A 1 351 ASP 351 460 460 ASP ASP A . n 
A 1 352 ILE 352 461 461 ILE ILE A . n 
A 1 353 GLY 353 462 462 GLY GLY A . n 
A 1 354 LYS 354 463 463 LYS LYS A . n 
A 1 355 ARG 355 464 464 ARG ARG A . n 
A 1 356 LEU 356 465 465 LEU LEU A . n 
A 1 357 GLU 357 466 466 GLU GLU A . n 
A 1 358 VAL 358 467 467 VAL VAL A . n 
A 1 359 ARG 359 468 468 ARG ARG A . n 
A 1 360 LYS 360 469 469 LYS LYS A . n 
A 1 361 THR 361 470 470 THR THR A . n 
A 1 362 VAL 362 471 471 VAL VAL A . n 
A 1 363 THR 363 472 472 THR THR A . n 
A 1 364 ALA 364 473 473 ALA ALA A . n 
A 1 365 CYS 365 474 474 CYS CYS A . n 
A 1 366 LEU 366 475 475 LEU LEU A . n 
A 1 367 GLY 367 476 476 GLY GLY A . n 
A 1 368 GLU 368 477 477 GLU GLU A . n 
A 1 369 PRO 369 478 478 PRO PRO A . n 
A 1 370 ASN 370 479 479 ASN ASN A . n 
A 1 371 HIS 371 480 480 HIS HIS A . n 
A 1 372 ILE 372 481 481 ILE ILE A . n 
A 1 373 THR 373 482 482 THR THR A . n 
A 1 374 ARG 374 483 483 ARG ARG A . n 
A 1 375 LEU 375 484 484 LEU LEU A . n 
A 1 376 GLU 376 485 485 GLU GLU A . n 
A 1 377 HIS 377 486 486 HIS HIS A . n 
A 1 378 ALA 378 487 487 ALA ALA A . n 
A 1 379 GLN 379 488 488 GLN GLN A . n 
A 1 380 ALA 380 489 489 ALA ALA A . n 
A 1 381 ARG 381 490 490 ARG ARG A . n 
A 1 382 LEU 382 491 491 LEU LEU A . n 
A 1 383 THR 383 492 492 THR THR A . n 
A 1 384 LEU 384 493 493 LEU LEU A . n 
A 1 385 SER 385 494 494 SER SER A . n 
A 1 386 TYR 386 495 495 TYR TYR A . n 
A 1 387 ASN 387 496 496 ASN ASN A . n 
A 1 388 ARG 388 497 497 ARG ARG A . n 
A 1 389 ARG 389 498 498 ARG ARG A . n 
A 1 390 GLY 390 499 499 GLY GLY A . n 
A 1 391 ASP 391 500 500 ASP ASP A . n 
A 1 392 LEU 392 501 501 LEU LEU A . n 
A 1 393 ALA 393 502 502 ALA ALA A . n 
A 1 394 ILE 394 503 503 ILE ILE A . n 
A 1 395 HIS 395 504 504 HIS HIS A . n 
A 1 396 LEU 396 505 505 LEU LEU A . n 
A 1 397 VAL 397 506 506 VAL VAL A . n 
A 1 398 SER 398 507 507 SER SER A . n 
A 1 399 PRO 399 508 508 PRO PRO A . n 
A 1 400 MET 400 509 509 MET MET A . n 
A 1 401 GLY 401 510 510 GLY GLY A . n 
A 1 402 THR 402 511 511 THR THR A . n 
A 1 403 ARG 403 512 512 ARG ARG A . n 
A 1 404 SER 404 513 513 SER SER A . n 
A 1 405 THR 405 514 514 THR THR A . n 
A 1 406 LEU 406 515 515 LEU LEU A . n 
A 1 407 LEU 407 516 516 LEU LEU A . n 
A 1 408 ALA 408 517 517 ALA ALA A . n 
A 1 409 ALA 409 518 518 ALA ALA A . n 
A 1 410 ARG 410 519 519 ARG ARG A . n 
A 1 411 PRO 411 520 520 PRO PRO A . n 
A 1 412 HIS 412 521 521 HIS HIS A . n 
A 1 413 ASP 413 522 522 ASP ASP A . n 
A 1 414 TYR 414 523 523 TYR TYR A . n 
A 1 415 SER 415 524 524 SER SER A . n 
A 1 416 ALA 416 525 525 ALA ALA A . n 
A 1 417 ASP 417 526 526 ASP ASP A . n 
A 1 418 GLY 418 527 527 GLY GLY A . n 
A 1 419 PHE 419 528 528 PHE PHE A . n 
A 1 420 ASN 420 529 529 ASN ASN A . n 
A 1 421 ASP 421 530 530 ASP ASP A . n 
A 1 422 TRP 422 531 531 TRP TRP A . n 
A 1 423 ALA 423 532 532 ALA ALA A . n 
A 1 424 PHE 424 533 533 PHE PHE A . n 
A 1 425 MET 425 534 534 MET MET A . n 
A 1 426 THR 426 535 535 THR THR A . n 
A 1 427 THR 427 536 536 THR THR A . n 
A 1 428 HIS 428 537 537 HIS HIS A . n 
A 1 429 SER 429 538 538 SER SER A . n 
A 1 430 TRP 430 539 539 TRP TRP A . n 
A 1 431 ASP 431 540 540 ASP ASP A . n 
A 1 432 GLU 432 541 541 GLU GLU A . n 
A 1 433 ASP 433 542 542 ASP ASP A . n 
A 1 434 PRO 434 543 543 PRO PRO A . n 
A 1 435 SER 435 544 544 SER SER A . n 
A 1 436 GLY 436 545 545 GLY GLY A . n 
A 1 437 GLU 437 546 546 GLU GLU A . n 
A 1 438 TRP 438 547 547 TRP TRP A . n 
A 1 439 VAL 439 548 548 VAL VAL A . n 
A 1 440 LEU 440 549 549 LEU LEU A . n 
A 1 441 GLU 441 550 550 GLU GLU A . n 
A 1 442 ILE 442 551 551 ILE ILE A . n 
A 1 443 GLU 443 552 552 GLU GLU A . n 
A 1 444 ASN 444 553 553 ASN ASN A . n 
A 1 445 THR 445 554 554 THR THR A . n 
A 1 446 SER 446 555 555 SER SER A . n 
A 1 447 GLU 447 556 556 GLU GLU A . n 
A 1 448 ALA 448 557 557 ALA ALA A . n 
A 1 449 ASN 449 558 558 ASN ASN A . n 
A 1 450 ASN 450 559 559 ASN ASN A . n 
A 1 451 TYR 451 560 560 TYR TYR A . n 
A 1 452 GLY 452 561 561 GLY GLY A . n 
A 1 453 THR 453 562 562 THR THR A . n 
A 1 454 LEU 454 563 563 LEU LEU A . n 
A 1 455 THR 455 564 564 THR THR A . n 
A 1 456 LYS 456 565 565 LYS LYS A . n 
A 1 457 PHE 457 566 566 PHE PHE A . n 
A 1 458 THR 458 567 567 THR THR A . n 
A 1 459 LEU 459 568 568 LEU LEU A . n 
A 1 460 VAL 460 569 569 VAL VAL A . n 
A 1 461 LEU 461 570 570 LEU LEU A . n 
A 1 462 TYR 462 571 571 TYR TYR A . n 
A 1 463 GLY 463 572 572 GLY GLY A . n 
A 1 464 THR 464 573 573 THR THR A . n 
A 1 465 ALA 465 574 574 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1   601  1   CA  CA  A . 
C 2 CA  1   602  2   CA  CA  A . 
D 2 CA  1   603  3   CA  CA  A . 
E 2 CA  1   604  4   CA  CA  A . 
F 3 PO4 1   605  1   PO4 PO4 A . 
G 3 PO4 1   606  2   PO4 PO4 A . 
H 4 EDO 1   607  1   EDO EDO A . 
I 5 HOH 1   701  55  HOH HOH A . 
I 5 HOH 2   702  320 HOH HOH A . 
I 5 HOH 3   703  323 HOH HOH A . 
I 5 HOH 4   704  304 HOH HOH A . 
I 5 HOH 5   705  255 HOH HOH A . 
I 5 HOH 6   706  275 HOH HOH A . 
I 5 HOH 7   707  364 HOH HOH A . 
I 5 HOH 8   708  264 HOH HOH A . 
I 5 HOH 9   709  347 HOH HOH A . 
I 5 HOH 10  710  280 HOH HOH A . 
I 5 HOH 11  711  405 HOH HOH A . 
I 5 HOH 12  712  356 HOH HOH A . 
I 5 HOH 13  713  252 HOH HOH A . 
I 5 HOH 14  714  277 HOH HOH A . 
I 5 HOH 15  715  21  HOH HOH A . 
I 5 HOH 16  716  217 HOH HOH A . 
I 5 HOH 17  717  66  HOH HOH A . 
I 5 HOH 18  718  46  HOH HOH A . 
I 5 HOH 19  719  381 HOH HOH A . 
I 5 HOH 20  720  151 HOH HOH A . 
I 5 HOH 21  721  279 HOH HOH A . 
I 5 HOH 22  722  60  HOH HOH A . 
I 5 HOH 23  723  18  HOH HOH A . 
I 5 HOH 24  724  250 HOH HOH A . 
I 5 HOH 25  725  74  HOH HOH A . 
I 5 HOH 26  726  162 HOH HOH A . 
I 5 HOH 27  727  147 HOH HOH A . 
I 5 HOH 28  728  127 HOH HOH A . 
I 5 HOH 29  729  33  HOH HOH A . 
I 5 HOH 30  730  331 HOH HOH A . 
I 5 HOH 31  731  222 HOH HOH A . 
I 5 HOH 32  732  100 HOH HOH A . 
I 5 HOH 33  733  203 HOH HOH A . 
I 5 HOH 34  734  351 HOH HOH A . 
I 5 HOH 35  735  228 HOH HOH A . 
I 5 HOH 36  736  315 HOH HOH A . 
I 5 HOH 37  737  91  HOH HOH A . 
I 5 HOH 38  738  346 HOH HOH A . 
I 5 HOH 39  739  89  HOH HOH A . 
I 5 HOH 40  740  254 HOH HOH A . 
I 5 HOH 41  741  120 HOH HOH A . 
I 5 HOH 42  742  406 HOH HOH A . 
I 5 HOH 43  743  273 HOH HOH A . 
I 5 HOH 44  744  130 HOH HOH A . 
I 5 HOH 45  745  317 HOH HOH A . 
I 5 HOH 46  746  233 HOH HOH A . 
I 5 HOH 47  747  236 HOH HOH A . 
I 5 HOH 48  748  105 HOH HOH A . 
I 5 HOH 49  749  85  HOH HOH A . 
I 5 HOH 50  750  231 HOH HOH A . 
I 5 HOH 51  751  70  HOH HOH A . 
I 5 HOH 52  752  314 HOH HOH A . 
I 5 HOH 53  753  382 HOH HOH A . 
I 5 HOH 54  754  29  HOH HOH A . 
I 5 HOH 55  755  211 HOH HOH A . 
I 5 HOH 56  756  161 HOH HOH A . 
I 5 HOH 57  757  376 HOH HOH A . 
I 5 HOH 58  758  24  HOH HOH A . 
I 5 HOH 59  759  363 HOH HOH A . 
I 5 HOH 60  760  160 HOH HOH A . 
I 5 HOH 61  761  157 HOH HOH A . 
I 5 HOH 62  762  341 HOH HOH A . 
I 5 HOH 63  763  232 HOH HOH A . 
I 5 HOH 64  764  214 HOH HOH A . 
I 5 HOH 65  765  6   HOH HOH A . 
I 5 HOH 66  766  359 HOH HOH A . 
I 5 HOH 67  767  362 HOH HOH A . 
I 5 HOH 68  768  53  HOH HOH A . 
I 5 HOH 69  769  337 HOH HOH A . 
I 5 HOH 70  770  128 HOH HOH A . 
I 5 HOH 71  771  133 HOH HOH A . 
I 5 HOH 72  772  375 HOH HOH A . 
I 5 HOH 73  773  19  HOH HOH A . 
I 5 HOH 74  774  136 HOH HOH A . 
I 5 HOH 75  775  27  HOH HOH A . 
I 5 HOH 76  776  226 HOH HOH A . 
I 5 HOH 77  777  2   HOH HOH A . 
I 5 HOH 78  778  125 HOH HOH A . 
I 5 HOH 79  779  51  HOH HOH A . 
I 5 HOH 80  780  26  HOH HOH A . 
I 5 HOH 81  781  373 HOH HOH A . 
I 5 HOH 82  782  338 HOH HOH A . 
I 5 HOH 83  783  350 HOH HOH A . 
I 5 HOH 84  784  303 HOH HOH A . 
I 5 HOH 85  785  97  HOH HOH A . 
I 5 HOH 86  786  32  HOH HOH A . 
I 5 HOH 87  787  249 HOH HOH A . 
I 5 HOH 88  788  20  HOH HOH A . 
I 5 HOH 89  789  150 HOH HOH A . 
I 5 HOH 90  790  153 HOH HOH A . 
I 5 HOH 91  791  354 HOH HOH A . 
I 5 HOH 92  792  42  HOH HOH A . 
I 5 HOH 93  793  195 HOH HOH A . 
I 5 HOH 94  794  215 HOH HOH A . 
I 5 HOH 95  795  79  HOH HOH A . 
I 5 HOH 96  796  384 HOH HOH A . 
I 5 HOH 97  797  93  HOH HOH A . 
I 5 HOH 98  798  14  HOH HOH A . 
I 5 HOH 99  799  243 HOH HOH A . 
I 5 HOH 100 800  54  HOH HOH A . 
I 5 HOH 101 801  212 HOH HOH A . 
I 5 HOH 102 802  321 HOH HOH A . 
I 5 HOH 103 803  196 HOH HOH A . 
I 5 HOH 104 804  8   HOH HOH A . 
I 5 HOH 105 805  17  HOH HOH A . 
I 5 HOH 106 806  48  HOH HOH A . 
I 5 HOH 107 807  165 HOH HOH A . 
I 5 HOH 108 808  367 HOH HOH A . 
I 5 HOH 109 809  306 HOH HOH A . 
I 5 HOH 110 810  38  HOH HOH A . 
I 5 HOH 111 811  313 HOH HOH A . 
I 5 HOH 112 812  154 HOH HOH A . 
I 5 HOH 113 813  268 HOH HOH A . 
I 5 HOH 114 814  13  HOH HOH A . 
I 5 HOH 115 815  137 HOH HOH A . 
I 5 HOH 116 816  39  HOH HOH A . 
I 5 HOH 117 817  71  HOH HOH A . 
I 5 HOH 118 818  209 HOH HOH A . 
I 5 HOH 119 819  392 HOH HOH A . 
I 5 HOH 120 820  305 HOH HOH A . 
I 5 HOH 121 821  333 HOH HOH A . 
I 5 HOH 122 822  322 HOH HOH A . 
I 5 HOH 123 823  45  HOH HOH A . 
I 5 HOH 124 824  11  HOH HOH A . 
I 5 HOH 125 825  221 HOH HOH A . 
I 5 HOH 126 826  138 HOH HOH A . 
I 5 HOH 127 827  116 HOH HOH A . 
I 5 HOH 128 828  110 HOH HOH A . 
I 5 HOH 129 829  190 HOH HOH A . 
I 5 HOH 130 830  146 HOH HOH A . 
I 5 HOH 131 831  37  HOH HOH A . 
I 5 HOH 132 832  10  HOH HOH A . 
I 5 HOH 133 833  12  HOH HOH A . 
I 5 HOH 134 834  72  HOH HOH A . 
I 5 HOH 135 835  358 HOH HOH A . 
I 5 HOH 136 836  240 HOH HOH A . 
I 5 HOH 137 837  76  HOH HOH A . 
I 5 HOH 138 838  310 HOH HOH A . 
I 5 HOH 139 839  57  HOH HOH A . 
I 5 HOH 140 840  312 HOH HOH A . 
I 5 HOH 141 841  101 HOH HOH A . 
I 5 HOH 142 842  238 HOH HOH A . 
I 5 HOH 143 843  83  HOH HOH A . 
I 5 HOH 144 844  361 HOH HOH A . 
I 5 HOH 145 845  168 HOH HOH A . 
I 5 HOH 146 846  175 HOH HOH A . 
I 5 HOH 147 847  31  HOH HOH A . 
I 5 HOH 148 848  15  HOH HOH A . 
I 5 HOH 149 849  191 HOH HOH A . 
I 5 HOH 150 850  16  HOH HOH A . 
I 5 HOH 151 851  95  HOH HOH A . 
I 5 HOH 152 852  206 HOH HOH A . 
I 5 HOH 153 853  144 HOH HOH A . 
I 5 HOH 154 854  35  HOH HOH A . 
I 5 HOH 155 855  78  HOH HOH A . 
I 5 HOH 156 856  73  HOH HOH A . 
I 5 HOH 157 857  131 HOH HOH A . 
I 5 HOH 158 858  117 HOH HOH A . 
I 5 HOH 159 859  118 HOH HOH A . 
I 5 HOH 160 860  184 HOH HOH A . 
I 5 HOH 161 861  9   HOH HOH A . 
I 5 HOH 162 862  23  HOH HOH A . 
I 5 HOH 163 863  119 HOH HOH A . 
I 5 HOH 164 864  257 HOH HOH A . 
I 5 HOH 165 865  266 HOH HOH A . 
I 5 HOH 166 866  352 HOH HOH A . 
I 5 HOH 167 867  88  HOH HOH A . 
I 5 HOH 168 868  44  HOH HOH A . 
I 5 HOH 169 869  216 HOH HOH A . 
I 5 HOH 170 870  210 HOH HOH A . 
I 5 HOH 171 871  102 HOH HOH A . 
I 5 HOH 172 872  201 HOH HOH A . 
I 5 HOH 173 873  4   HOH HOH A . 
I 5 HOH 174 874  113 HOH HOH A . 
I 5 HOH 175 875  281 HOH HOH A . 
I 5 HOH 176 876  227 HOH HOH A . 
I 5 HOH 177 877  65  HOH HOH A . 
I 5 HOH 178 878  141 HOH HOH A . 
I 5 HOH 179 879  67  HOH HOH A . 
I 5 HOH 180 880  94  HOH HOH A . 
I 5 HOH 181 881  408 HOH HOH A . 
I 5 HOH 182 882  399 HOH HOH A . 
I 5 HOH 183 883  181 HOH HOH A . 
I 5 HOH 184 884  28  HOH HOH A . 
I 5 HOH 185 885  340 HOH HOH A . 
I 5 HOH 186 886  166 HOH HOH A . 
I 5 HOH 187 887  180 HOH HOH A . 
I 5 HOH 188 888  229 HOH HOH A . 
I 5 HOH 189 889  86  HOH HOH A . 
I 5 HOH 190 890  247 HOH HOH A . 
I 5 HOH 191 891  158 HOH HOH A . 
I 5 HOH 192 892  379 HOH HOH A . 
I 5 HOH 193 893  256 HOH HOH A . 
I 5 HOH 194 894  52  HOH HOH A . 
I 5 HOH 195 895  106 HOH HOH A . 
I 5 HOH 196 896  50  HOH HOH A . 
I 5 HOH 197 897  30  HOH HOH A . 
I 5 HOH 198 898  142 HOH HOH A . 
I 5 HOH 199 899  182 HOH HOH A . 
I 5 HOH 200 900  22  HOH HOH A . 
I 5 HOH 201 901  82  HOH HOH A . 
I 5 HOH 202 902  149 HOH HOH A . 
I 5 HOH 203 903  115 HOH HOH A . 
I 5 HOH 204 904  69  HOH HOH A . 
I 5 HOH 205 905  335 HOH HOH A . 
I 5 HOH 206 906  63  HOH HOH A . 
I 5 HOH 207 907  49  HOH HOH A . 
I 5 HOH 208 908  84  HOH HOH A . 
I 5 HOH 209 909  40  HOH HOH A . 
I 5 HOH 210 910  213 HOH HOH A . 
I 5 HOH 211 911  169 HOH HOH A . 
I 5 HOH 212 912  99  HOH HOH A . 
I 5 HOH 213 913  183 HOH HOH A . 
I 5 HOH 214 914  171 HOH HOH A . 
I 5 HOH 215 915  159 HOH HOH A . 
I 5 HOH 216 916  148 HOH HOH A . 
I 5 HOH 217 917  43  HOH HOH A . 
I 5 HOH 218 918  349 HOH HOH A . 
I 5 HOH 219 919  75  HOH HOH A . 
I 5 HOH 220 920  385 HOH HOH A . 
I 5 HOH 221 921  327 HOH HOH A . 
I 5 HOH 222 922  77  HOH HOH A . 
I 5 HOH 223 923  197 HOH HOH A . 
I 5 HOH 224 924  248 HOH HOH A . 
I 5 HOH 225 925  1   HOH HOH A . 
I 5 HOH 226 926  124 HOH HOH A . 
I 5 HOH 227 927  241 HOH HOH A . 
I 5 HOH 228 928  47  HOH HOH A . 
I 5 HOH 229 929  353 HOH HOH A . 
I 5 HOH 230 930  96  HOH HOH A . 
I 5 HOH 231 931  292 HOH HOH A . 
I 5 HOH 232 932  34  HOH HOH A . 
I 5 HOH 233 933  121 HOH HOH A . 
I 5 HOH 234 934  139 HOH HOH A . 
I 5 HOH 235 935  293 HOH HOH A . 
I 5 HOH 236 936  207 HOH HOH A . 
I 5 HOH 237 937  64  HOH HOH A . 
I 5 HOH 238 938  272 HOH HOH A . 
I 5 HOH 239 939  122 HOH HOH A . 
I 5 HOH 240 940  186 HOH HOH A . 
I 5 HOH 241 941  276 HOH HOH A . 
I 5 HOH 242 942  81  HOH HOH A . 
I 5 HOH 243 943  308 HOH HOH A . 
I 5 HOH 244 944  134 HOH HOH A . 
I 5 HOH 245 945  129 HOH HOH A . 
I 5 HOH 246 946  328 HOH HOH A . 
I 5 HOH 247 947  185 HOH HOH A . 
I 5 HOH 248 948  291 HOH HOH A . 
I 5 HOH 249 949  284 HOH HOH A . 
I 5 HOH 250 950  111 HOH HOH A . 
I 5 HOH 251 951  98  HOH HOH A . 
I 5 HOH 252 952  316 HOH HOH A . 
I 5 HOH 253 953  282 HOH HOH A . 
I 5 HOH 254 954  87  HOH HOH A . 
I 5 HOH 255 955  326 HOH HOH A . 
I 5 HOH 256 956  265 HOH HOH A . 
I 5 HOH 257 957  193 HOH HOH A . 
I 5 HOH 258 958  25  HOH HOH A . 
I 5 HOH 259 959  61  HOH HOH A . 
I 5 HOH 260 960  294 HOH HOH A . 
I 5 HOH 261 961  403 HOH HOH A . 
I 5 HOH 262 962  36  HOH HOH A . 
I 5 HOH 263 963  5   HOH HOH A . 
I 5 HOH 264 964  380 HOH HOH A . 
I 5 HOH 265 965  202 HOH HOH A . 
I 5 HOH 266 966  198 HOH HOH A . 
I 5 HOH 267 967  59  HOH HOH A . 
I 5 HOH 268 968  383 HOH HOH A . 
I 5 HOH 269 969  287 HOH HOH A . 
I 5 HOH 270 970  290 HOH HOH A . 
I 5 HOH 271 971  112 HOH HOH A . 
I 5 HOH 272 972  167 HOH HOH A . 
I 5 HOH 273 973  199 HOH HOH A . 
I 5 HOH 274 974  107 HOH HOH A . 
I 5 HOH 275 975  58  HOH HOH A . 
I 5 HOH 276 976  172 HOH HOH A . 
I 5 HOH 277 977  143 HOH HOH A . 
I 5 HOH 278 978  374 HOH HOH A . 
I 5 HOH 279 979  41  HOH HOH A . 
I 5 HOH 280 980  132 HOH HOH A . 
I 5 HOH 281 981  108 HOH HOH A . 
I 5 HOH 282 982  92  HOH HOH A . 
I 5 HOH 283 983  289 HOH HOH A . 
I 5 HOH 284 984  56  HOH HOH A . 
I 5 HOH 285 985  230 HOH HOH A . 
I 5 HOH 286 986  267 HOH HOH A . 
I 5 HOH 287 987  114 HOH HOH A . 
I 5 HOH 288 988  163 HOH HOH A . 
I 5 HOH 289 989  260 HOH HOH A . 
I 5 HOH 290 990  372 HOH HOH A . 
I 5 HOH 291 991  270 HOH HOH A . 
I 5 HOH 292 992  140 HOH HOH A . 
I 5 HOH 293 993  174 HOH HOH A . 
I 5 HOH 294 994  378 HOH HOH A . 
I 5 HOH 295 995  135 HOH HOH A . 
I 5 HOH 296 996  104 HOH HOH A . 
I 5 HOH 297 997  109 HOH HOH A . 
I 5 HOH 298 998  219 HOH HOH A . 
I 5 HOH 299 999  258 HOH HOH A . 
I 5 HOH 300 1000 68  HOH HOH A . 
I 5 HOH 301 1001 3   HOH HOH A . 
I 5 HOH 302 1002 176 HOH HOH A . 
I 5 HOH 303 1003 62  HOH HOH A . 
I 5 HOH 304 1004 200 HOH HOH A . 
I 5 HOH 305 1005 152 HOH HOH A . 
I 5 HOH 306 1006 234 HOH HOH A . 
I 5 HOH 307 1007 246 HOH HOH A . 
I 5 HOH 308 1008 377 HOH HOH A . 
I 5 HOH 309 1009 262 HOH HOH A . 
I 5 HOH 310 1010 274 HOH HOH A . 
I 5 HOH 311 1011 278 HOH HOH A . 
I 5 HOH 312 1012 155 HOH HOH A . 
I 5 HOH 313 1013 319 HOH HOH A . 
I 5 HOH 314 1014 369 HOH HOH A . 
I 5 HOH 315 1015 259 HOH HOH A . 
I 5 HOH 316 1016 324 HOH HOH A . 
I 5 HOH 317 1017 396 HOH HOH A . 
I 5 HOH 318 1018 192 HOH HOH A . 
I 5 HOH 319 1019 103 HOH HOH A . 
I 5 HOH 320 1020 404 HOH HOH A . 
I 5 HOH 321 1021 295 HOH HOH A . 
I 5 HOH 322 1022 395 HOH HOH A . 
I 5 HOH 323 1023 393 HOH HOH A . 
I 5 HOH 324 1024 156 HOH HOH A . 
I 5 HOH 325 1025 225 HOH HOH A . 
I 5 HOH 326 1026 388 HOH HOH A . 
I 5 HOH 327 1027 263 HOH HOH A . 
I 5 HOH 328 1028 123 HOH HOH A . 
I 5 HOH 329 1029 334 HOH HOH A . 
I 5 HOH 330 1030 300 HOH HOH A . 
I 5 HOH 331 1031 90  HOH HOH A . 
I 5 HOH 332 1032 244 HOH HOH A . 
I 5 HOH 333 1033 368 HOH HOH A . 
I 5 HOH 334 1034 126 HOH HOH A . 
I 5 HOH 335 1035 189 HOH HOH A . 
I 5 HOH 336 1036 397 HOH HOH A . 
I 5 HOH 337 1037 360 HOH HOH A . 
I 5 HOH 338 1038 7   HOH HOH A . 
I 5 HOH 339 1039 389 HOH HOH A . 
I 5 HOH 340 1040 296 HOH HOH A . 
I 5 HOH 341 1041 80  HOH HOH A . 
I 5 HOH 342 1042 205 HOH HOH A . 
I 5 HOH 343 1043 208 HOH HOH A . 
I 5 HOH 344 1044 298 HOH HOH A . 
I 5 HOH 345 1045 309 HOH HOH A . 
I 5 HOH 346 1046 239 HOH HOH A . 
I 5 HOH 347 1047 188 HOH HOH A . 
I 5 HOH 348 1048 398 HOH HOH A . 
I 5 HOH 349 1049 336 HOH HOH A . 
I 5 HOH 350 1050 366 HOH HOH A . 
I 5 HOH 351 1051 170 HOH HOH A . 
I 5 HOH 352 1052 269 HOH HOH A . 
I 5 HOH 353 1053 251 HOH HOH A . 
I 5 HOH 354 1054 318 HOH HOH A . 
I 5 HOH 355 1055 297 HOH HOH A . 
I 5 HOH 356 1056 325 HOH HOH A . 
I 5 HOH 357 1057 407 HOH HOH A . 
I 5 HOH 358 1058 386 HOH HOH A . 
I 5 HOH 359 1059 253 HOH HOH A . 
I 5 HOH 360 1060 283 HOH HOH A . 
I 5 HOH 361 1061 302 HOH HOH A . 
I 5 HOH 362 1062 299 HOH HOH A . 
I 5 HOH 363 1063 164 HOH HOH A . 
I 5 HOH 364 1064 365 HOH HOH A . 
I 5 HOH 365 1065 194 HOH HOH A . 
I 5 HOH 366 1066 177 HOH HOH A . 
I 5 HOH 367 1067 387 HOH HOH A . 
I 5 HOH 368 1068 285 HOH HOH A . 
I 5 HOH 369 1069 204 HOH HOH A . 
I 5 HOH 370 1070 286 HOH HOH A . 
I 5 HOH 371 1071 311 HOH HOH A . 
I 5 HOH 372 1072 394 HOH HOH A . 
I 5 HOH 373 1073 223 HOH HOH A . 
I 5 HOH 374 1074 307 HOH HOH A . 
I 5 HOH 375 1075 343 HOH HOH A . 
I 5 HOH 376 1076 242 HOH HOH A . 
I 5 HOH 377 1077 348 HOH HOH A . 
I 5 HOH 378 1078 261 HOH HOH A . 
I 5 HOH 379 1079 271 HOH HOH A . 
I 5 HOH 380 1080 371 HOH HOH A . 
I 5 HOH 381 1081 370 HOH HOH A . 
I 5 HOH 382 1082 342 HOH HOH A . 
I 5 HOH 383 1083 400 HOH HOH A . 
I 5 HOH 384 1084 357 HOH HOH A . 
I 5 HOH 385 1085 173 HOH HOH A . 
I 5 HOH 386 1086 339 HOH HOH A . 
I 5 HOH 387 1087 237 HOH HOH A . 
I 5 HOH 388 1088 178 HOH HOH A . 
I 5 HOH 389 1089 401 HOH HOH A . 
I 5 HOH 390 1090 344 HOH HOH A . 
I 5 HOH 391 1091 391 HOH HOH A . 
I 5 HOH 392 1092 224 HOH HOH A . 
I 5 HOH 393 1093 332 HOH HOH A . 
I 5 HOH 394 1094 179 HOH HOH A . 
I 5 HOH 395 1095 301 HOH HOH A . 
I 5 HOH 396 1096 218 HOH HOH A . 
I 5 HOH 397 1097 235 HOH HOH A . 
I 5 HOH 398 1098 355 HOH HOH A . 
I 5 HOH 399 1099 345 HOH HOH A . 
I 5 HOH 400 1100 220 HOH HOH A . 
I 5 HOH 401 1101 288 HOH HOH A . 
I 5 HOH 402 1102 145 HOH HOH A . 
I 5 HOH 403 1103 390 HOH HOH A . 
I 5 HOH 404 1104 329 HOH HOH A . 
I 5 HOH 405 1105 330 HOH HOH A . 
I 5 HOH 406 1106 245 HOH HOH A . 
I 5 HOH 407 1107 187 HOH HOH A . 
I 5 HOH 408 1108 402 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 6   ? A ASP 115  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD1 ? A ASP 53  ? A ASP 162  ? 1_555 153.9 ? 
2  OD2 ? A ASP 6   ? A ASP 115  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD2 ? A ASP 53  ? A ASP 162  ? 1_555 153.6 ? 
3  OD1 ? A ASP 53  ? A ASP 162  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD2 ? A ASP 53  ? A ASP 162  ? 1_555 52.2  ? 
4  OD2 ? A ASP 6   ? A ASP 115  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A VAL 96  ? A VAL 205  ? 1_555 92.5  ? 
5  OD1 ? A ASP 53  ? A ASP 162  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A VAL 96  ? A VAL 205  ? 1_555 84.6  ? 
6  OD2 ? A ASP 53  ? A ASP 162  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A VAL 96  ? A VAL 205  ? 1_555 95.9  ? 
7  OD2 ? A ASP 6   ? A ASP 115  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD1 ? A ASN 99  ? A ASN 208  ? 1_555 77.0  ? 
8  OD1 ? A ASP 53  ? A ASP 162  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD1 ? A ASN 99  ? A ASN 208  ? 1_555 77.0  ? 
9  OD2 ? A ASP 53  ? A ASP 162  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD1 ? A ASN 99  ? A ASN 208  ? 1_555 127.8 ? 
10 O   ? A VAL 96  ? A VAL 205  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 OD1 ? A ASN 99  ? A ASN 208  ? 1_555 89.9  ? 
11 OD2 ? A ASP 6   ? A ASP 115  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A VAL 101 ? A VAL 210  ? 1_555 93.4  ? 
12 OD1 ? A ASP 53  ? A ASP 162  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A VAL 101 ? A VAL 210  ? 1_555 90.6  ? 
13 OD2 ? A ASP 53  ? A ASP 162  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A VAL 101 ? A VAL 210  ? 1_555 78.1  ? 
14 O   ? A VAL 96  ? A VAL 205  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A VAL 101 ? A VAL 210  ? 1_555 173.9 ? 
15 OD1 ? A ASN 99  ? A ASN 208  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A VAL 101 ? A VAL 210  ? 1_555 92.7  ? 
16 OD2 ? A ASP 6   ? A ASP 115  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A GLY 103 ? A GLY 212  ? 1_555 83.4  ? 
17 OD1 ? A ASP 53  ? A ASP 162  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A GLY 103 ? A GLY 212  ? 1_555 122.3 ? 
18 OD2 ? A ASP 53  ? A ASP 162  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A GLY 103 ? A GLY 212  ? 1_555 71.9  ? 
19 O   ? A VAL 96  ? A VAL 205  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A GLY 103 ? A GLY 212  ? 1_555 88.3  ? 
20 OD1 ? A ASN 99  ? A ASN 208  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A GLY 103 ? A GLY 212  ? 1_555 160.3 ? 
21 O   ? A VAL 101 ? A VAL 210  ? 1_555 CA ? B CA . ? A CA 601 ? 1_555 O   ? A GLY 103 ? A GLY 212  ? 1_555 91.1  ? 
22 OD2 ? A ASP 65  ? A ASP 174  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 OD1 ? A ASP 70  ? A ASP 179  ? 1_555 81.7  ? 
23 OD2 ? A ASP 65  ? A ASP 174  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 OD2 ? A ASP 70  ? A ASP 179  ? 1_555 110.0 ? 
24 OD1 ? A ASP 70  ? A ASP 179  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 OD2 ? A ASP 70  ? A ASP 179  ? 1_555 48.6  ? 
25 OD2 ? A ASP 65  ? A ASP 174  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A ASP 72  ? A ASP 181  ? 1_555 89.8  ? 
26 OD1 ? A ASP 70  ? A ASP 179  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A ASP 72  ? A ASP 181  ? 1_555 118.4 ? 
27 OD2 ? A ASP 70  ? A ASP 179  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? A ASP 72  ? A ASP 181  ? 1_555 79.4  ? 
28 OD2 ? A ASP 65  ? A ASP 174  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 1047 ? 1_555 164.4 ? 
29 OD1 ? A ASP 70  ? A ASP 179  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 1047 ? 1_555 106.3 ? 
30 OD2 ? A ASP 70  ? A ASP 179  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 1047 ? 1_555 84.9  ? 
31 O   ? A ASP 72  ? A ASP 181  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 1047 ? 1_555 97.7  ? 
32 OD2 ? A ASP 65  ? A ASP 174  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 745  ? 1_555 86.4  ? 
33 OD1 ? A ASP 70  ? A ASP 179  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 745  ? 1_555 154.4 ? 
34 OD2 ? A ASP 70  ? A ASP 179  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 745  ? 1_555 156.4 ? 
35 O   ? A ASP 72  ? A ASP 181  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 745  ? 1_555 84.0  ? 
36 O   ? I HOH .   ? A HOH 1047 ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 745  ? 1_555 80.8  ? 
37 OD2 ? A ASP 65  ? A ASP 174  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 864  ? 1_555 91.1  ? 
38 OD1 ? A ASP 70  ? A ASP 179  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 864  ? 1_555 66.9  ? 
39 OD2 ? A ASP 70  ? A ASP 179  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 864  ? 1_555 105.1 ? 
40 O   ? A ASP 72  ? A ASP 181  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 864  ? 1_555 174.8 ? 
41 O   ? I HOH .   ? A HOH 1047 ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 864  ? 1_555 80.2  ? 
42 O   ? I HOH .   ? A HOH 745  ? 1_555 CA ? C CA . ? A CA 602 ? 1_555 O   ? I HOH .   ? A HOH 864  ? 1_555 90.9  ? 
43 OD1 ? A ASP 149 ? A ASP 258  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 OD2 ? A ASP 192 ? A ASP 301  ? 1_555 99.5  ? 
44 OD1 ? A ASP 149 ? A ASP 258  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 OE1 ? A GLU 222 ? A GLU 331  ? 1_555 130.8 ? 
45 OD2 ? A ASP 192 ? A ASP 301  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 OE1 ? A GLU 222 ? A GLU 331  ? 1_555 82.7  ? 
46 OD1 ? A ASP 149 ? A ASP 258  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 OE2 ? A GLU 222 ? A GLU 331  ? 1_555 77.3  ? 
47 OD2 ? A ASP 192 ? A ASP 301  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 OE2 ? A GLU 222 ? A GLU 331  ? 1_555 89.4  ? 
48 OE1 ? A GLU 222 ? A GLU 331  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 OE2 ? A GLU 222 ? A GLU 331  ? 1_555 53.5  ? 
49 OD1 ? A ASP 149 ? A ASP 258  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 925  ? 1_555 74.9  ? 
50 OD2 ? A ASP 192 ? A ASP 301  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 925  ? 1_555 94.8  ? 
51 OE1 ? A GLU 222 ? A GLU 331  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 925  ? 1_555 154.2 ? 
52 OE2 ? A GLU 222 ? A GLU 331  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 925  ? 1_555 152.3 ? 
53 OD1 ? A ASP 149 ? A ASP 258  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 1001 ? 1_555 148.8 ? 
54 OD2 ? A ASP 192 ? A ASP 301  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 1001 ? 1_555 77.6  ? 
55 OE1 ? A GLU 222 ? A GLU 331  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 1001 ? 1_555 80.1  ? 
56 OE2 ? A GLU 222 ? A GLU 331  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 1001 ? 1_555 133.2 ? 
57 O   ? I HOH .   ? A HOH 925  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 1001 ? 1_555 74.4  ? 
58 OD1 ? A ASP 149 ? A ASP 258  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 777  ? 1_555 94.2  ? 
59 OD2 ? A ASP 192 ? A ASP 301  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 777  ? 1_555 165.8 ? 
60 OE1 ? A GLU 222 ? A GLU 331  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 777  ? 1_555 85.7  ? 
61 OE2 ? A GLU 222 ? A GLU 331  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 777  ? 1_555 90.2  ? 
62 O   ? I HOH .   ? A HOH 925  ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 777  ? 1_555 92.1  ? 
63 O   ? I HOH .   ? A HOH 1001 ? 1_555 CA ? E CA . ? A CA 604 ? 1_555 O   ? I HOH .   ? A HOH 777  ? 1_555 92.4  ? 
64 O   ? A THR 200 ? A THR 309  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? A SER 202 ? A SER 311  ? 1_555 99.1  ? 
65 O   ? A THR 200 ? A THR 309  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? A THR 205 ? A THR 314  ? 1_555 163.1 ? 
66 O   ? A SER 202 ? A SER 311  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? A THR 205 ? A THR 314  ? 1_555 87.7  ? 
67 O   ? A THR 200 ? A THR 309  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OG1 ? A THR 205 ? A THR 314  ? 1_555 86.6  ? 
68 O   ? A SER 202 ? A SER 311  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OG1 ? A THR 205 ? A THR 314  ? 1_555 81.9  ? 
69 O   ? A THR 205 ? A THR 314  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OG1 ? A THR 205 ? A THR 314  ? 1_555 78.9  ? 
70 O   ? A THR 200 ? A THR 309  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OG  ? A SER 207 ? A SER 316  ? 1_555 67.8  ? 
71 O   ? A SER 202 ? A SER 311  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OG  ? A SER 207 ? A SER 316  ? 1_555 163.5 ? 
72 O   ? A THR 205 ? A THR 314  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OG  ? A SER 207 ? A SER 316  ? 1_555 102.4 ? 
73 OG1 ? A THR 205 ? A THR 314  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 OG  ? A SER 207 ? A SER 316  ? 1_555 87.1  ? 
74 O   ? A THR 200 ? A THR 309  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? I HOH .   ? A HOH 788  ? 1_555 112.8 ? 
75 O   ? A SER 202 ? A SER 311  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? I HOH .   ? A HOH 788  ? 1_555 115.6 ? 
76 O   ? A THR 205 ? A THR 314  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? I HOH .   ? A HOH 788  ? 1_555 77.4  ? 
77 OG1 ? A THR 205 ? A THR 314  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? I HOH .   ? A HOH 788  ? 1_555 149.7 ? 
78 OG  ? A SER 207 ? A SER 316  ? 1_555 CA ? D CA . ? A CA 603 ? 1_555 O   ? I HOH .   ? A HOH 788  ? 1_555 79.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-05-04 
2 'Structure model' 1 1 2019-04-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' citation_author       
3 2 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.country'                         
2 2 'Structure model' '_citation.journal_abbrev'                  
3 2 'Structure model' '_citation.journal_id_ASTM'                 
4 2 'Structure model' '_citation.journal_id_CSD'                  
5 2 'Structure model' '_citation.journal_id_ISSN'                 
6 2 'Structure model' '_citation.pdbx_database_id_DOI'            
7 2 'Structure model' '_citation.title'                           
8 2 'Structure model' '_citation.year'                            
9 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH2 A ARG 193  ? B O2 A PO4 606  ? ? 1.95 
2 1 O   A HOH 1045 ? ? O  A HOH 1073 ? ? 2.05 
3 1 O   A HOH 757  ? ? O  A HOH 808  ? ? 2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 127 ? ? -140.72 54.69   
2  1 GLN A 129 ? ? 78.07   -20.11  
3  1 ASP A 153 ? ? -160.98 -137.46 
4  1 ALA A 203 ? ? -148.36 23.26   
5  1 CYS A 211 ? ? 45.13   -130.37 
6  1 CYS A 211 ? ? 48.36   -132.37 
7  1 ALA A 216 ? ? -112.40 70.90   
8  1 MET A 226 ? ? -143.34 -10.21  
9  1 ASN A 243 ? ? 33.95   58.70   
10 1 SER A 253 ? ? -141.30 24.35   
11 1 SER A 342 ? ? -148.93 -153.58 
12 1 GLN A 350 ? ? -121.85 -161.50 
13 1 GLU A 485 ? ? -109.16 -104.23 
14 1 ASP A 540 ? ? 74.69   -5.11   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 111 ? CG  ? A GLN 2   CG  
2  1 Y 1 A GLN 111 ? CD  ? A GLN 2   CD  
3  1 Y 1 A GLN 111 ? OE1 ? A GLN 2   OE1 
4  1 Y 1 A GLN 111 ? NE2 ? A GLN 2   NE2 
5  1 Y 1 A VAL 127 ? CG1 ? A VAL 18  CG1 
6  1 Y 1 A VAL 127 ? CG2 ? A VAL 18  CG2 
7  1 Y 1 A GLN 129 ? CG  ? A GLN 20  CG  
8  1 Y 1 A GLN 129 ? CD  ? A GLN 20  CD  
9  1 Y 1 A GLN 129 ? OE1 ? A GLN 20  OE1 
10 1 Y 1 A GLN 129 ? NE2 ? A GLN 20  NE2 
11 1 Y 1 A ARG 130 ? CZ  ? A ARG 21  CZ  
12 1 Y 1 A ARG 130 ? NH1 ? A ARG 21  NH1 
13 1 Y 1 A ARG 130 ? NH2 ? A ARG 21  NH2 
14 1 Y 1 A LYS 349 ? CE  ? A LYS 240 CE  
15 1 Y 1 A LYS 349 ? NZ  ? A LYS 240 NZ  
16 1 Y 1 A LYS 386 ? CD  ? A LYS 277 CD  
17 1 Y 1 A LYS 386 ? CE  ? A LYS 277 CE  
18 1 Y 1 A LYS 386 ? NZ  ? A LYS 277 NZ  
19 1 Y 1 A HIS 405 ? CG  ? A HIS 296 CG  
20 1 Y 1 A HIS 405 ? ND1 ? A HIS 296 ND1 
21 1 Y 1 A HIS 405 ? CD2 ? A HIS 296 CD2 
22 1 Y 1 A HIS 405 ? CE1 ? A HIS 296 CE1 
23 1 Y 1 A HIS 405 ? NE2 ? A HIS 296 NE2 
24 1 Y 1 A ARG 483 ? CD  ? A ARG 374 CD  
25 1 Y 1 A ARG 483 ? NE  ? A ARG 374 NE  
26 1 Y 1 A ARG 483 ? CZ  ? A ARG 374 CZ  
27 1 Y 1 A ARG 483 ? NH1 ? A ARG 374 NH1 
28 1 Y 1 A ARG 483 ? NH2 ? A ARG 374 NH2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION'   CA  
3 'PHOSPHATE ION' PO4 
4 1,2-ETHANEDIOL  EDO 
5 water           HOH 
#