data_4Z2C
# 
_entry.id   4Z2C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4Z2C         
WWPDB D_1000207379 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'Quinolone(Trovafloxacin)-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'             4KOE unspecified 
PDB 'Quinolone-stabilized cleavage complex of topoisomerase IV from Klebsiella pneumoniae'                  4PXP unspecified 
PDB 'Quinolone(Clinafloxacin)-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'             3RAD unspecified 
PDB 'Quinolone(Levofloxacin)-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'              3RAE unspecified 
PDB 'Quinazolinedione-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'                     3RAF unspecified 
PDB 'Detailed structural insight into the DNA cleavage complex of type IIA topoisomerases (re-sealed form)' 3KSB unspecified 
PDB 'Detailed structural insight into the DNA cleavage complex of type IIA topoisomerases (cleaved form)'   3KSA unspecified 
PDB 'A three-gate structure of topoisomerase IV from Streptococcus pneumoniae'                              4I3H unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4Z2C 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Laponogov, I.'   1 
'Veselkov, D.A.'  2 
'Pan, X.-S.'      3 
'Selvarajah, J.'  4 
'Crevel, I.M.-T.' 5 
'Fisher, L.M.'    6 
'Sanderson, M.R.' 7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Structural studies of the drug-stabilized cleavage complexes of topoisomerase IV and gyrase from Streptococcus pneumoniae' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Laponogov, I.'   1 
primary 'Veselkov, D.A.'  2 
primary 'Pan, X.-S.'      3 
primary 'Selvarajah, J.'  4 
primary 'Crevel, I.M.-T.' 5 
primary 'Fisher, L.M.'    6 
primary 'Sanderson, M.R.' 7 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4Z2C 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     92.030 
_cell.length_a_esd                 ? 
_cell.length_b                     94.950 
_cell.length_b_esd                 ? 
_cell.length_c                     274.290 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4Z2C 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA gyrase subunit A' 56747.258 2 5.99.1.3 ? ? ? 
2 polymer     man 'DNA gyrase subunit B' 30286.211 2 5.99.1.3 ? ? ? 
3 polymer     syn 'Symmetrized E-site DNA' 4589.994  2 ?        ? ? ? 
4 polymer     syn 'Symmetrized E-site DNA' 5821.813  2 ?        ? ? ? 
5 non-polymer syn 
'1-cyclopropyl-6-fluoro-8-methoxy-7-[(4aS,7aS)-octahydro-6H-pyrrolo[3,4-b]pyridin-6-yl]-4-oxo-1,4-dihydroquinoline-3-carboxylic acid' 
401.431   2 ?        ? ? ? 
6 non-polymer syn 'MAGNESIUM ION' 24.305    2 ?        ? ? ? 
7 water       nat water 18.015    9 ?        ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MQDKNLVNVNLTKEMKASFIDYAMSVIVARALPDVRDGLKPVHRRILYGMNELGVTPDKPHKKSARITGDVMGKYHPHGD
SSIYEAMVRMAQWWSYRYMLVDGHGNFGSMDGDSAAAQRYTEARMSKIALEMLRDINKNTVDFVDNYDANEREPLVLPAR
FPNLLVNGATGIAVGMATNIPPHNLGETIDAVKLVMDNPEVTTKDLMEVLPGPDFPTGALVMGKSGIHKAYETGKGSIVL
RSRTEIETTKTGRERIVVTEFPYMVNKTKVHEHIVRLVQEKRIEGITAVRDESNREGVRFVIEVKRDASANVILNNLFKM
TQMQTNFGFNMLAIQNGIPKILSLRQILDAYIEHQKEVVVRRTRFDKEKAEARAHILEGLLIALDHIDEVIRIIRASETD
AEAQAELMSKFKLSERQSQAILDMRLRRLTGLERDKIQSEYDDLLALIADLADILAKPERVSQIIKDELDEVKRKFSDKR
RTELMVGQILSLEHHHHHH
;
;MQDKNLVNVNLTKEMKASFIDYAMSVIVARALPDVRDGLKPVHRRILYGMNELGVTPDKPHKKSARITGDVMGKYHPHGD
SSIYEAMVRMAQWWSYRYMLVDGHGNFGSMDGDSAAAQRYTEARMSKIALEMLRDINKNTVDFVDNYDANEREPLVLPAR
FPNLLVNGATGIAVGMATNIPPHNLGETIDAVKLVMDNPEVTTKDLMEVLPGPDFPTGALVMGKSGIHKAYETGKGSIVL
RSRTEIETTKTGRERIVVTEFPYMVNKTKVHEHIVRLVQEKRIEGITAVRDESNREGVRFVIEVKRDASANVILNNLFKM
TQMQTNFGFNMLAIQNGIPKILSLRQILDAYIEHQKEVVVRRTRFDKEKAEARAHILEGLLIALDHIDEVIRIIRASETD
AEAQAELMSKFKLSERQSQAILDMRLRRLTGLERDKIQSEYDDLLALIADLADILAKPERVSQIIKDELDEVKRKFSDKR
RTELMVGQILSLEHHHHHH
;
A,B ? 
2 'polypeptide(L)'        no no 
;MGHHHHHHHHHHSSGHIDDDDKHMKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKI
LNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQ
PPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEAD
KIFDMLMGDRVEPRREFIEENAVYSTLDV
;
;MGHHHHHHHHHHSSGHIDDDDKHMKSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKI
LNVEKASMDKILANEEIRSLFTAMGTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQ
PPIYGVKVGSEIKEYIQPGADQEIKLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEAD
KIFDMLMGDRVEPRREFIEENAVYSTLDV
;
C,D ? 
3 polydeoxyribonucleotide no no '(DC)(DG)(DT)(DA)(DT)(DT)(DA)(DC)(DG)(DT)(DT)(DG)(DT)(DA)(DT)' CGTATTACGTTGTAT E,G ? 
4 polydeoxyribonucleotide no no '(DG)(DA)(DT)(DC)(DA)(DT)(DA)(DC)(DA)(DA)(DC)(DG)(DT)(DA)(DA)(DT)(DA)(DC)(DG)' GATCATACAACGTAATACG 
F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLN n 
1 3   ASP n 
1 4   LYS n 
1 5   ASN n 
1 6   LEU n 
1 7   VAL n 
1 8   ASN n 
1 9   VAL n 
1 10  ASN n 
1 11  LEU n 
1 12  THR n 
1 13  LYS n 
1 14  GLU n 
1 15  MET n 
1 16  LYS n 
1 17  ALA n 
1 18  SER n 
1 19  PHE n 
1 20  ILE n 
1 21  ASP n 
1 22  TYR n 
1 23  ALA n 
1 24  MET n 
1 25  SER n 
1 26  VAL n 
1 27  ILE n 
1 28  VAL n 
1 29  ALA n 
1 30  ARG n 
1 31  ALA n 
1 32  LEU n 
1 33  PRO n 
1 34  ASP n 
1 35  VAL n 
1 36  ARG n 
1 37  ASP n 
1 38  GLY n 
1 39  LEU n 
1 40  LYS n 
1 41  PRO n 
1 42  VAL n 
1 43  HIS n 
1 44  ARG n 
1 45  ARG n 
1 46  ILE n 
1 47  LEU n 
1 48  TYR n 
1 49  GLY n 
1 50  MET n 
1 51  ASN n 
1 52  GLU n 
1 53  LEU n 
1 54  GLY n 
1 55  VAL n 
1 56  THR n 
1 57  PRO n 
1 58  ASP n 
1 59  LYS n 
1 60  PRO n 
1 61  HIS n 
1 62  LYS n 
1 63  LYS n 
1 64  SER n 
1 65  ALA n 
1 66  ARG n 
1 67  ILE n 
1 68  THR n 
1 69  GLY n 
1 70  ASP n 
1 71  VAL n 
1 72  MET n 
1 73  GLY n 
1 74  LYS n 
1 75  TYR n 
1 76  HIS n 
1 77  PRO n 
1 78  HIS n 
1 79  GLY n 
1 80  ASP n 
1 81  SER n 
1 82  SER n 
1 83  ILE n 
1 84  TYR n 
1 85  GLU n 
1 86  ALA n 
1 87  MET n 
1 88  VAL n 
1 89  ARG n 
1 90  MET n 
1 91  ALA n 
1 92  GLN n 
1 93  TRP n 
1 94  TRP n 
1 95  SER n 
1 96  TYR n 
1 97  ARG n 
1 98  TYR n 
1 99  MET n 
1 100 LEU n 
1 101 VAL n 
1 102 ASP n 
1 103 GLY n 
1 104 HIS n 
1 105 GLY n 
1 106 ASN n 
1 107 PHE n 
1 108 GLY n 
1 109 SER n 
1 110 MET n 
1 111 ASP n 
1 112 GLY n 
1 113 ASP n 
1 114 SER n 
1 115 ALA n 
1 116 ALA n 
1 117 ALA n 
1 118 GLN n 
1 119 ARG n 
1 120 TYR n 
1 121 THR n 
1 122 GLU n 
1 123 ALA n 
1 124 ARG n 
1 125 MET n 
1 126 SER n 
1 127 LYS n 
1 128 ILE n 
1 129 ALA n 
1 130 LEU n 
1 131 GLU n 
1 132 MET n 
1 133 LEU n 
1 134 ARG n 
1 135 ASP n 
1 136 ILE n 
1 137 ASN n 
1 138 LYS n 
1 139 ASN n 
1 140 THR n 
1 141 VAL n 
1 142 ASP n 
1 143 PHE n 
1 144 VAL n 
1 145 ASP n 
1 146 ASN n 
1 147 TYR n 
1 148 ASP n 
1 149 ALA n 
1 150 ASN n 
1 151 GLU n 
1 152 ARG n 
1 153 GLU n 
1 154 PRO n 
1 155 LEU n 
1 156 VAL n 
1 157 LEU n 
1 158 PRO n 
1 159 ALA n 
1 160 ARG n 
1 161 PHE n 
1 162 PRO n 
1 163 ASN n 
1 164 LEU n 
1 165 LEU n 
1 166 VAL n 
1 167 ASN n 
1 168 GLY n 
1 169 ALA n 
1 170 THR n 
1 171 GLY n 
1 172 ILE n 
1 173 ALA n 
1 174 VAL n 
1 175 GLY n 
1 176 MET n 
1 177 ALA n 
1 178 THR n 
1 179 ASN n 
1 180 ILE n 
1 181 PRO n 
1 182 PRO n 
1 183 HIS n 
1 184 ASN n 
1 185 LEU n 
1 186 GLY n 
1 187 GLU n 
1 188 THR n 
1 189 ILE n 
1 190 ASP n 
1 191 ALA n 
1 192 VAL n 
1 193 LYS n 
1 194 LEU n 
1 195 VAL n 
1 196 MET n 
1 197 ASP n 
1 198 ASN n 
1 199 PRO n 
1 200 GLU n 
1 201 VAL n 
1 202 THR n 
1 203 THR n 
1 204 LYS n 
1 205 ASP n 
1 206 LEU n 
1 207 MET n 
1 208 GLU n 
1 209 VAL n 
1 210 LEU n 
1 211 PRO n 
1 212 GLY n 
1 213 PRO n 
1 214 ASP n 
1 215 PHE n 
1 216 PRO n 
1 217 THR n 
1 218 GLY n 
1 219 ALA n 
1 220 LEU n 
1 221 VAL n 
1 222 MET n 
1 223 GLY n 
1 224 LYS n 
1 225 SER n 
1 226 GLY n 
1 227 ILE n 
1 228 HIS n 
1 229 LYS n 
1 230 ALA n 
1 231 TYR n 
1 232 GLU n 
1 233 THR n 
1 234 GLY n 
1 235 LYS n 
1 236 GLY n 
1 237 SER n 
1 238 ILE n 
1 239 VAL n 
1 240 LEU n 
1 241 ARG n 
1 242 SER n 
1 243 ARG n 
1 244 THR n 
1 245 GLU n 
1 246 ILE n 
1 247 GLU n 
1 248 THR n 
1 249 THR n 
1 250 LYS n 
1 251 THR n 
1 252 GLY n 
1 253 ARG n 
1 254 GLU n 
1 255 ARG n 
1 256 ILE n 
1 257 VAL n 
1 258 VAL n 
1 259 THR n 
1 260 GLU n 
1 261 PHE n 
1 262 PRO n 
1 263 TYR n 
1 264 MET n 
1 265 VAL n 
1 266 ASN n 
1 267 LYS n 
1 268 THR n 
1 269 LYS n 
1 270 VAL n 
1 271 HIS n 
1 272 GLU n 
1 273 HIS n 
1 274 ILE n 
1 275 VAL n 
1 276 ARG n 
1 277 LEU n 
1 278 VAL n 
1 279 GLN n 
1 280 GLU n 
1 281 LYS n 
1 282 ARG n 
1 283 ILE n 
1 284 GLU n 
1 285 GLY n 
1 286 ILE n 
1 287 THR n 
1 288 ALA n 
1 289 VAL n 
1 290 ARG n 
1 291 ASP n 
1 292 GLU n 
1 293 SER n 
1 294 ASN n 
1 295 ARG n 
1 296 GLU n 
1 297 GLY n 
1 298 VAL n 
1 299 ARG n 
1 300 PHE n 
1 301 VAL n 
1 302 ILE n 
1 303 GLU n 
1 304 VAL n 
1 305 LYS n 
1 306 ARG n 
1 307 ASP n 
1 308 ALA n 
1 309 SER n 
1 310 ALA n 
1 311 ASN n 
1 312 VAL n 
1 313 ILE n 
1 314 LEU n 
1 315 ASN n 
1 316 ASN n 
1 317 LEU n 
1 318 PHE n 
1 319 LYS n 
1 320 MET n 
1 321 THR n 
1 322 GLN n 
1 323 MET n 
1 324 GLN n 
1 325 THR n 
1 326 ASN n 
1 327 PHE n 
1 328 GLY n 
1 329 PHE n 
1 330 ASN n 
1 331 MET n 
1 332 LEU n 
1 333 ALA n 
1 334 ILE n 
1 335 GLN n 
1 336 ASN n 
1 337 GLY n 
1 338 ILE n 
1 339 PRO n 
1 340 LYS n 
1 341 ILE n 
1 342 LEU n 
1 343 SER n 
1 344 LEU n 
1 345 ARG n 
1 346 GLN n 
1 347 ILE n 
1 348 LEU n 
1 349 ASP n 
1 350 ALA n 
1 351 TYR n 
1 352 ILE n 
1 353 GLU n 
1 354 HIS n 
1 355 GLN n 
1 356 LYS n 
1 357 GLU n 
1 358 VAL n 
1 359 VAL n 
1 360 VAL n 
1 361 ARG n 
1 362 ARG n 
1 363 THR n 
1 364 ARG n 
1 365 PHE n 
1 366 ASP n 
1 367 LYS n 
1 368 GLU n 
1 369 LYS n 
1 370 ALA n 
1 371 GLU n 
1 372 ALA n 
1 373 ARG n 
1 374 ALA n 
1 375 HIS n 
1 376 ILE n 
1 377 LEU n 
1 378 GLU n 
1 379 GLY n 
1 380 LEU n 
1 381 LEU n 
1 382 ILE n 
1 383 ALA n 
1 384 LEU n 
1 385 ASP n 
1 386 HIS n 
1 387 ILE n 
1 388 ASP n 
1 389 GLU n 
1 390 VAL n 
1 391 ILE n 
1 392 ARG n 
1 393 ILE n 
1 394 ILE n 
1 395 ARG n 
1 396 ALA n 
1 397 SER n 
1 398 GLU n 
1 399 THR n 
1 400 ASP n 
1 401 ALA n 
1 402 GLU n 
1 403 ALA n 
1 404 GLN n 
1 405 ALA n 
1 406 GLU n 
1 407 LEU n 
1 408 MET n 
1 409 SER n 
1 410 LYS n 
1 411 PHE n 
1 412 LYS n 
1 413 LEU n 
1 414 SER n 
1 415 GLU n 
1 416 ARG n 
1 417 GLN n 
1 418 SER n 
1 419 GLN n 
1 420 ALA n 
1 421 ILE n 
1 422 LEU n 
1 423 ASP n 
1 424 MET n 
1 425 ARG n 
1 426 LEU n 
1 427 ARG n 
1 428 ARG n 
1 429 LEU n 
1 430 THR n 
1 431 GLY n 
1 432 LEU n 
1 433 GLU n 
1 434 ARG n 
1 435 ASP n 
1 436 LYS n 
1 437 ILE n 
1 438 GLN n 
1 439 SER n 
1 440 GLU n 
1 441 TYR n 
1 442 ASP n 
1 443 ASP n 
1 444 LEU n 
1 445 LEU n 
1 446 ALA n 
1 447 LEU n 
1 448 ILE n 
1 449 ALA n 
1 450 ASP n 
1 451 LEU n 
1 452 ALA n 
1 453 ASP n 
1 454 ILE n 
1 455 LEU n 
1 456 ALA n 
1 457 LYS n 
1 458 PRO n 
1 459 GLU n 
1 460 ARG n 
1 461 VAL n 
1 462 SER n 
1 463 GLN n 
1 464 ILE n 
1 465 ILE n 
1 466 LYS n 
1 467 ASP n 
1 468 GLU n 
1 469 LEU n 
1 470 ASP n 
1 471 GLU n 
1 472 VAL n 
1 473 LYS n 
1 474 ARG n 
1 475 LYS n 
1 476 PHE n 
1 477 SER n 
1 478 ASP n 
1 479 LYS n 
1 480 ARG n 
1 481 ARG n 
1 482 THR n 
1 483 GLU n 
1 484 LEU n 
1 485 MET n 
1 486 VAL n 
1 487 GLY n 
1 488 GLN n 
1 489 ILE n 
1 490 LEU n 
1 491 SER n 
1 492 LEU n 
1 493 GLU n 
1 494 HIS n 
1 495 HIS n 
1 496 HIS n 
1 497 HIS n 
1 498 HIS n 
1 499 HIS n 
2 1   MET n 
2 2   GLY n 
2 3   HIS n 
2 4   HIS n 
2 5   HIS n 
2 6   HIS n 
2 7   HIS n 
2 8   HIS n 
2 9   HIS n 
2 10  HIS n 
2 11  HIS n 
2 12  HIS n 
2 13  SER n 
2 14  SER n 
2 15  GLY n 
2 16  HIS n 
2 17  ILE n 
2 18  ASP n 
2 19  ASP n 
2 20  ASP n 
2 21  ASP n 
2 22  LYS n 
2 23  HIS n 
2 24  MET n 
2 25  LYS n 
2 26  SER n 
2 27  GLY n 
2 28  LEU n 
2 29  GLU n 
2 30  ILE n 
2 31  SER n 
2 32  ASN n 
2 33  LEU n 
2 34  PRO n 
2 35  GLY n 
2 36  LYS n 
2 37  LEU n 
2 38  ALA n 
2 39  ASP n 
2 40  CYS n 
2 41  SER n 
2 42  SER n 
2 43  ASN n 
2 44  ASN n 
2 45  PRO n 
2 46  ALA n 
2 47  GLU n 
2 48  THR n 
2 49  GLU n 
2 50  LEU n 
2 51  PHE n 
2 52  ILE n 
2 53  VAL n 
2 54  GLU n 
2 55  GLY n 
2 56  ASP n 
2 57  SER n 
2 58  ALA n 
2 59  GLY n 
2 60  GLY n 
2 61  SER n 
2 62  ALA n 
2 63  LYS n 
2 64  SER n 
2 65  GLY n 
2 66  ARG n 
2 67  ASN n 
2 68  ARG n 
2 69  GLU n 
2 70  PHE n 
2 71  GLN n 
2 72  ALA n 
2 73  ILE n 
2 74  LEU n 
2 75  PRO n 
2 76  ILE n 
2 77  ARG n 
2 78  GLY n 
2 79  LYS n 
2 80  ILE n 
2 81  LEU n 
2 82  ASN n 
2 83  VAL n 
2 84  GLU n 
2 85  LYS n 
2 86  ALA n 
2 87  SER n 
2 88  MET n 
2 89  ASP n 
2 90  LYS n 
2 91  ILE n 
2 92  LEU n 
2 93  ALA n 
2 94  ASN n 
2 95  GLU n 
2 96  GLU n 
2 97  ILE n 
2 98  ARG n 
2 99  SER n 
2 100 LEU n 
2 101 PHE n 
2 102 THR n 
2 103 ALA n 
2 104 MET n 
2 105 GLY n 
2 106 THR n 
2 107 GLY n 
2 108 PHE n 
2 109 GLY n 
2 110 ALA n 
2 111 GLU n 
2 112 PHE n 
2 113 ASP n 
2 114 VAL n 
2 115 SER n 
2 116 LYS n 
2 117 ALA n 
2 118 ARG n 
2 119 TYR n 
2 120 GLN n 
2 121 LYS n 
2 122 LEU n 
2 123 VAL n 
2 124 LEU n 
2 125 MET n 
2 126 THR n 
2 127 ASP n 
2 128 ALA n 
2 129 ASP n 
2 130 VAL n 
2 131 ASP n 
2 132 GLY n 
2 133 ALA n 
2 134 HIS n 
2 135 ILE n 
2 136 ARG n 
2 137 THR n 
2 138 LEU n 
2 139 LEU n 
2 140 LEU n 
2 141 THR n 
2 142 LEU n 
2 143 ILE n 
2 144 TYR n 
2 145 ARG n 
2 146 TYR n 
2 147 MET n 
2 148 LYS n 
2 149 PRO n 
2 150 ILE n 
2 151 LEU n 
2 152 GLU n 
2 153 ALA n 
2 154 GLY n 
2 155 TYR n 
2 156 VAL n 
2 157 TYR n 
2 158 ILE n 
2 159 ALA n 
2 160 GLN n 
2 161 PRO n 
2 162 PRO n 
2 163 ILE n 
2 164 TYR n 
2 165 GLY n 
2 166 VAL n 
2 167 LYS n 
2 168 VAL n 
2 169 GLY n 
2 170 SER n 
2 171 GLU n 
2 172 ILE n 
2 173 LYS n 
2 174 GLU n 
2 175 TYR n 
2 176 ILE n 
2 177 GLN n 
2 178 PRO n 
2 179 GLY n 
2 180 ALA n 
2 181 ASP n 
2 182 GLN n 
2 183 GLU n 
2 184 ILE n 
2 185 LYS n 
2 186 LEU n 
2 187 GLN n 
2 188 GLU n 
2 189 ALA n 
2 190 LEU n 
2 191 ALA n 
2 192 ARG n 
2 193 TYR n 
2 194 SER n 
2 195 GLU n 
2 196 GLY n 
2 197 ARG n 
2 198 THR n 
2 199 LYS n 
2 200 PRO n 
2 201 THR n 
2 202 ILE n 
2 203 GLN n 
2 204 ARG n 
2 205 TYR n 
2 206 LYS n 
2 207 GLY n 
2 208 LEU n 
2 209 GLY n 
2 210 GLU n 
2 211 MET n 
2 212 ASP n 
2 213 ASP n 
2 214 HIS n 
2 215 GLN n 
2 216 LEU n 
2 217 TRP n 
2 218 GLU n 
2 219 THR n 
2 220 THR n 
2 221 MET n 
2 222 ASP n 
2 223 PRO n 
2 224 GLU n 
2 225 HIS n 
2 226 ARG n 
2 227 LEU n 
2 228 MET n 
2 229 ALA n 
2 230 ARG n 
2 231 VAL n 
2 232 SER n 
2 233 VAL n 
2 234 ASP n 
2 235 ASP n 
2 236 ALA n 
2 237 ALA n 
2 238 GLU n 
2 239 ALA n 
2 240 ASP n 
2 241 LYS n 
2 242 ILE n 
2 243 PHE n 
2 244 ASP n 
2 245 MET n 
2 246 LEU n 
2 247 MET n 
2 248 GLY n 
2 249 ASP n 
2 250 ARG n 
2 251 VAL n 
2 252 GLU n 
2 253 PRO n 
2 254 ARG n 
2 255 ARG n 
2 256 GLU n 
2 257 PHE n 
2 258 ILE n 
2 259 GLU n 
2 260 GLU n 
2 261 ASN n 
2 262 ALA n 
2 263 VAL n 
2 264 TYR n 
2 265 SER n 
2 266 THR n 
2 267 LEU n 
2 268 ASP n 
2 269 VAL n 
3 1   DC  n 
3 2   DG  n 
3 3   DT  n 
3 4   DA  n 
3 5   DT  n 
3 6   DT  n 
3 7   DA  n 
3 8   DC  n 
3 9   DG  n 
3 10  DT  n 
3 11  DT  n 
3 12  DG  n 
3 13  DT  n 
3 14  DA  n 
3 15  DT  n 
4 1   DG  n 
4 2   DA  n 
4 3   DT  n 
4 4   DC  n 
4 5   DA  n 
4 6   DT  n 
4 7   DA  n 
4 8   DC  n 
4 9   DA  n 
4 10  DA  n 
4 11  DC  n 
4 12  DG  n 
4 13  DT  n 
4 14  DA  n 
4 15  DA  n 
4 16  DT  n 
4 17  DA  n 
4 18  DC  n 
4 19  DG  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 499 ? ? 'gyrA, BM52_0349'             ? ? ? ? ? ? 'Streptococcus pneumoniae' 1313 ? ? ? ? ? ? ? 
? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 269 ? ? 'gyrB, BM52_1967, DJ38_04430' ? ? ? ? ? ? 'Streptococcus pneumoniae' 1313 ? ? ? ? ? ? ? 
? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 15 'Escherichia coli' ? 562 ? 
4 1 sample 1 19 'Escherichia coli' ? 562 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q9R867_STREE Q9R867 ? 1 
;MQDKNLVNVNLTKEMKASFIDYAMSVIVARALPDVRDGLKPVHRRILYGMNELGVTPDKPHKKSARITGDVMGKYHPHGD
SSIYEAMVRMAQWWSYRYMLVDGHGNFGSMDGDSAAAQRYTEARMSKIALEMLRDINKNTVDFVDNYDANEREPLVLPAR
FPNLLVNGATGIAVGMATNIPPHNLGETIDAVKLVMDNPEVTTKDLMEVLPGPDFPTGALVMGKSGIHKAYETGKGSIVL
RSRTEIETTKTGRERIVVTEFPYMVNKTKVHEHIVRLVQEKRIEGITAVRDESNREGVRFVIEVKRDASANVILNNLFKM
TQMQTNFGFNMLAIQNGIPKILSLRQILDAYIEHQKEVVVRRTRFDKEKAEARAHILEGLLIALDHIDEVIRIIRASETD
AEAQAELMSKFKLSERQSQAILDMRLRRLTGLERDKIQSEYDDLLALIADLADILAKPERVSQIIKDELDEVKRKFSDKR
RTELMVGQILSLE
;
1   
2 UNP Q59957_STREE Q59957 ? 2 
;KSGLEISNLPGKLADCSSNNPAETELFIVEGDSAGGSAKSGRNREFQAILPIRGKILNVEKASMDKILANEEIRSLFTAM
GTGFGAEFDVSKARYQKLVLMTDADVDGAHIRTLLLTLIYRYMKPILEAGYVYIAQPPIYGVKVGSEIKEYIQPGADQEI
KLQEALARYSEGRTKPTIQRYKGLGEMDDHQLWETTMDPEHRLMARVSVDDAAEADKIFDMLMGDRVEPRREFIEENAVY
STLDV
;
404 
3 PDB 4Z2C         4Z2C   ? 3 ? 1   
4 PDB 4Z2C         4Z2C   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4Z2C A 1  ? 493 ? Q9R867 1   ? 493 ? 1   493 
2 2 4Z2C C 25 ? 269 ? Q59957 404 ? 648 ? 404 648 
3 1 4Z2C B 1  ? 493 ? Q9R867 1   ? 493 ? 1   493 
4 2 4Z2C D 25 ? 269 ? Q59957 404 ? 648 ? 404 648 
5 3 4Z2C E 1  ? 15  ? 4Z2C   1   ? 15  ? 1   15  
6 4 4Z2C F 1  ? 19  ? 4Z2C   1   ? 19  ? 1   19  
7 4 4Z2C H 1  ? 19  ? 4Z2C   1   ? 19  ? 1   19  
8 3 4Z2C G 1  ? 15  ? 4Z2C   1   ? 15  ? 1   15  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4Z2C HIS A 494 ? UNP Q9R867 ? ? 'expression tag'        494 1  
1 4Z2C HIS A 495 ? UNP Q9R867 ? ? 'expression tag'        495 2  
1 4Z2C HIS A 496 ? UNP Q9R867 ? ? 'expression tag'        496 3  
1 4Z2C HIS A 497 ? UNP Q9R867 ? ? 'expression tag'        497 4  
1 4Z2C HIS A 498 ? UNP Q9R867 ? ? 'expression tag'        498 5  
1 4Z2C HIS A 499 ? UNP Q9R867 ? ? 'expression tag'        499 6  
2 4Z2C MET C 1   ? UNP Q59957 ? ? 'initiating methionine' 380 7  
2 4Z2C GLY C 2   ? UNP Q59957 ? ? 'expression tag'        381 8  
2 4Z2C HIS C 3   ? UNP Q59957 ? ? 'expression tag'        382 9  
2 4Z2C HIS C 4   ? UNP Q59957 ? ? 'expression tag'        383 10 
2 4Z2C HIS C 5   ? UNP Q59957 ? ? 'expression tag'        384 11 
2 4Z2C HIS C 6   ? UNP Q59957 ? ? 'expression tag'        385 12 
2 4Z2C HIS C 7   ? UNP Q59957 ? ? 'expression tag'        386 13 
2 4Z2C HIS C 8   ? UNP Q59957 ? ? 'expression tag'        387 14 
2 4Z2C HIS C 9   ? UNP Q59957 ? ? 'expression tag'        388 15 
2 4Z2C HIS C 10  ? UNP Q59957 ? ? 'expression tag'        389 16 
2 4Z2C HIS C 11  ? UNP Q59957 ? ? 'expression tag'        390 17 
2 4Z2C HIS C 12  ? UNP Q59957 ? ? 'expression tag'        391 18 
2 4Z2C SER C 13  ? UNP Q59957 ? ? 'expression tag'        392 19 
2 4Z2C SER C 14  ? UNP Q59957 ? ? 'expression tag'        393 20 
2 4Z2C GLY C 15  ? UNP Q59957 ? ? 'expression tag'        394 21 
2 4Z2C HIS C 16  ? UNP Q59957 ? ? 'expression tag'        395 22 
2 4Z2C ILE C 17  ? UNP Q59957 ? ? 'expression tag'        396 23 
2 4Z2C ASP C 18  ? UNP Q59957 ? ? 'expression tag'        397 24 
2 4Z2C ASP C 19  ? UNP Q59957 ? ? 'expression tag'        398 25 
2 4Z2C ASP C 20  ? UNP Q59957 ? ? 'expression tag'        399 26 
2 4Z2C ASP C 21  ? UNP Q59957 ? ? 'expression tag'        400 27 
2 4Z2C LYS C 22  ? UNP Q59957 ? ? 'expression tag'        401 28 
2 4Z2C HIS C 23  ? UNP Q59957 ? ? 'expression tag'        402 29 
2 4Z2C MET C 24  ? UNP Q59957 ? ? 'expression tag'        403 30 
3 4Z2C HIS B 494 ? UNP Q9R867 ? ? 'expression tag'        494 31 
3 4Z2C HIS B 495 ? UNP Q9R867 ? ? 'expression tag'        495 32 
3 4Z2C HIS B 496 ? UNP Q9R867 ? ? 'expression tag'        496 33 
3 4Z2C HIS B 497 ? UNP Q9R867 ? ? 'expression tag'        497 34 
3 4Z2C HIS B 498 ? UNP Q9R867 ? ? 'expression tag'        498 35 
3 4Z2C HIS B 499 ? UNP Q9R867 ? ? 'expression tag'        499 36 
4 4Z2C MET D 1   ? UNP Q59957 ? ? 'initiating methionine' 380 37 
4 4Z2C GLY D 2   ? UNP Q59957 ? ? 'expression tag'        381 38 
4 4Z2C HIS D 3   ? UNP Q59957 ? ? 'expression tag'        382 39 
4 4Z2C HIS D 4   ? UNP Q59957 ? ? 'expression tag'        383 40 
4 4Z2C HIS D 5   ? UNP Q59957 ? ? 'expression tag'        384 41 
4 4Z2C HIS D 6   ? UNP Q59957 ? ? 'expression tag'        385 42 
4 4Z2C HIS D 7   ? UNP Q59957 ? ? 'expression tag'        386 43 
4 4Z2C HIS D 8   ? UNP Q59957 ? ? 'expression tag'        387 44 
4 4Z2C HIS D 9   ? UNP Q59957 ? ? 'expression tag'        388 45 
4 4Z2C HIS D 10  ? UNP Q59957 ? ? 'expression tag'        389 46 
4 4Z2C HIS D 11  ? UNP Q59957 ? ? 'expression tag'        390 47 
4 4Z2C HIS D 12  ? UNP Q59957 ? ? 'expression tag'        391 48 
4 4Z2C SER D 13  ? UNP Q59957 ? ? 'expression tag'        392 49 
4 4Z2C SER D 14  ? UNP Q59957 ? ? 'expression tag'        393 50 
4 4Z2C GLY D 15  ? UNP Q59957 ? ? 'expression tag'        394 51 
4 4Z2C HIS D 16  ? UNP Q59957 ? ? 'expression tag'        395 52 
4 4Z2C ILE D 17  ? UNP Q59957 ? ? 'expression tag'        396 53 
4 4Z2C ASP D 18  ? UNP Q59957 ? ? 'expression tag'        397 54 
4 4Z2C ASP D 19  ? UNP Q59957 ? ? 'expression tag'        398 55 
4 4Z2C ASP D 20  ? UNP Q59957 ? ? 'expression tag'        399 56 
4 4Z2C ASP D 21  ? UNP Q59957 ? ? 'expression tag'        400 57 
4 4Z2C LYS D 22  ? UNP Q59957 ? ? 'expression tag'        401 58 
4 4Z2C HIS D 23  ? UNP Q59957 ? ? 'expression tag'        402 59 
4 4Z2C MET D 24  ? UNP Q59957 ? ? 'expression tag'        403 60 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?            'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?            'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?            'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?            'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ?            'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?            'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ?            'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?            'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ?            'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE ?            'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?            'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?            'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ?            'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?            'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?            'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?            'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?            'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?            'C5 H11 N O2 S'   149.211 
MFX non-polymer         . 
'1-cyclopropyl-6-fluoro-8-methoxy-7-[(4aS,7aS)-octahydro-6H-pyrrolo[3,4-b]pyridin-6-yl]-4-oxo-1,4-dihydroquinoline-3-carboxylic acid' 
moxifloxacin 'C21 H24 F N3 O4' 401.431 
MG  non-polymer         . 'MAGNESIUM ION' ?            'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE ?            'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?            'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ?            'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ?            'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?            'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?            'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?            'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4Z2C 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.91 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.59 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            297 
_exptl_crystal_grow.temp_details    incubator 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '5-10% PEG 8000, 10-20% Ethylene glycol, 0.1M Imidazole/MES buffer system, 0.1M Amino Acids' 
_exptl_crystal_grow.pdbx_pH_range   6.0-7.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-04-24 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4Z2C 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.03 
_reflns.d_resolution_low                 78.7 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       47637 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.84 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.49 
_reflns.pdbx_Rmerge_I_obs                0.067 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.6582 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.03 
_reflns_shell.d_res_low                   3.11 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.16 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.80 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.66 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.75 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4Z2C 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.190 
_refine.ls_d_res_low                             64.245 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     40857 
_refine.ls_number_reflns_R_free                  1961 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.81 
_refine.ls_percent_reflns_R_free                 4.80 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2255 
_refine.ls_R_factor_R_free                       0.2679 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2233 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '3RAF, 4I3H' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.28 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.41 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9702 
_refine_hist.pdbx_number_atoms_nucleic_acid   810 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             9 
_refine_hist.number_atoms_total               10581 
_refine_hist.d_res_high                       3.190 
_refine_hist.d_res_low                        64.245 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 10848 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.717  ? 14930 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 16.404 ? 3838  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.045  ? 1745  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 1824  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.1900 3.2698  . . 143 2735 100.00 . . . 0.3636 . 0.2778 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2698 3.3582  . . 156 2688 100.00 . . . 0.3769 . 0.2693 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3582 3.4570  . . 128 2745 100.00 . . . 0.3064 . 0.2519 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4570 3.5686  . . 128 2772 100.00 . . . 0.3545 . 0.2521 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5686 3.6961  . . 141 2741 100.00 . . . 0.3009 . 0.2345 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6961 3.8441  . . 152 2726 100.00 . . . 0.3079 . 0.2225 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8441 4.0190  . . 147 2734 100.00 . . . 0.2398 . 0.2058 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0190 4.2308  . . 129 2774 100.00 . . . 0.2403 . 0.1952 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2308 4.4959  . . 133 2770 100.00 . . . 0.2431 . 0.1825 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4959 4.8429  . . 138 2784 100.00 . . . 0.2195 . 0.1831 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8429 5.3300  . . 116 2813 100.00 . . . 0.2502 . 0.1943 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.3300 6.1008  . . 159 2788 100.00 . . . 0.2914 . 0.2473 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.1008 7.6843  . . 125 2874 100.00 . . . 0.2554 . 0.2483 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.6843 64.2580 . . 166 2952 99.00  . . . 0.2464 . 0.2354 . . . . . . . . . . 
# 
_struct.entry_id                     4Z2C 
_struct.title                        'Quinolone(Moxifloxacin)-DNA cleavage complex of gyrase from S. pneumoniae' 
_struct.pdbx_descriptor              'GyrA59 from S. pneumoniae, GyrB30 from S. pneumoniae/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4Z2C 
_struct_keywords.text            'Gyrase, Cleavage complex, DNA, quinolone, isomerase' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 3 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 7 ? 
N N N 7 ? 
O N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LEU A 11  ? ARG A 30  ? LEU A 11  ARG A 30  1 ? 20 
HELX_P HELX_P2  AA2 LYS A 40  ? GLY A 54  ? LYS A 40  GLY A 54  1 ? 15 
HELX_P HELX_P3  AA3 SER A 64  ? TYR A 75  ? SER A 64  TYR A 75  1 ? 12 
HELX_P HELX_P4  AA4 GLY A 79  ? MET A 90  ? GLY A 79  MET A 90  1 ? 12 
HELX_P HELX_P5  AA5 ILE A 128 ? ARG A 134 ? ILE A 128 ARG A 134 1 ? 7  
HELX_P HELX_P6  AA6 PRO A 162 ? GLY A 168 ? PRO A 162 GLY A 168 1 ? 7  
HELX_P HELX_P7  AA7 ASN A 184 ? ASN A 198 ? ASN A 184 ASN A 198 1 ? 15 
HELX_P HELX_P8  AA8 THR A 202 ? GLU A 208 ? THR A 202 GLU A 208 1 ? 7  
HELX_P HELX_P9  AA9 LYS A 224 ? GLY A 234 ? LYS A 224 GLY A 234 1 ? 11 
HELX_P HELX_P10 AB1 ASN A 266 ? GLN A 279 ? ASN A 266 GLN A 279 1 ? 14 
HELX_P HELX_P11 AB2 SER A 309 ? THR A 321 ? SER A 309 THR A 321 1 ? 13 
HELX_P HELX_P12 AB3 SER A 343 ? HIS A 386 ? SER A 343 HIS A 386 1 ? 44 
HELX_P HELX_P13 AB4 HIS A 386 ? ALA A 396 ? HIS A 386 ALA A 396 1 ? 11 
HELX_P HELX_P14 AB5 THR A 399 ? LYS A 412 ? THR A 399 LYS A 412 1 ? 14 
HELX_P HELX_P15 AB6 SER A 414 ? ASP A 423 ? SER A 414 ASP A 423 1 ? 10 
HELX_P HELX_P16 AB7 ARG A 425 ? THR A 430 ? ARG A 425 THR A 430 5 ? 6  
HELX_P HELX_P17 AB8 LEU A 432 ? LYS A 457 ? LEU A 432 LYS A 457 1 ? 26 
HELX_P HELX_P18 AB9 LYS A 457 ? SER A 477 ? LYS A 457 SER A 477 1 ? 21 
HELX_P HELX_P19 AC1 GLY B 55  ? SER B 64  ? GLY C 434 SER C 443 1 ? 10 
HELX_P HELX_P20 AC2 ASN B 82  ? ALA B 86  ? ASN C 461 ALA C 465 5 ? 5  
HELX_P HELX_P21 AC3 SER B 87  ? LEU B 92  ? SER C 466 LEU C 471 1 ? 6  
HELX_P HELX_P22 AC4 ASN B 94  ? GLY B 105 ? ASN C 473 GLY C 484 1 ? 12 
HELX_P HELX_P23 AC5 ASP B 113 ? ALA B 117 ? ASP C 492 ALA C 496 5 ? 5  
HELX_P HELX_P24 AC6 ASP B 129 ? MET B 147 ? ASP C 508 MET C 526 1 ? 19 
HELX_P HELX_P25 AC7 MET B 147 ? GLY B 154 ? MET C 526 GLY C 533 1 ? 8  
HELX_P HELX_P26 AC8 ASP B 212 ? MET B 221 ? ASP C 591 MET C 600 1 ? 10 
HELX_P HELX_P27 AC9 ASP B 235 ? MET B 247 ? ASP C 614 MET C 626 1 ? 13 
HELX_P HELX_P28 AD1 ARG B 250 ? ASN B 261 ? ARG C 629 ASN C 640 1 ? 12 
HELX_P HELX_P29 AD2 LEU C 11  ? VAL C 28  ? LEU B 11  VAL B 28  1 ? 18 
HELX_P HELX_P30 AD3 LYS C 40  ? GLY C 54  ? LYS B 40  GLY B 54  1 ? 15 
HELX_P HELX_P31 AD4 SER C 64  ? TYR C 75  ? SER B 64  TYR B 75  1 ? 12 
HELX_P HELX_P32 AD5 GLY C 79  ? MET C 90  ? GLY B 79  MET B 90  1 ? 12 
HELX_P HELX_P33 AD6 ILE C 128 ? LEU C 133 ? ILE B 128 LEU B 133 1 ? 6  
HELX_P HELX_P34 AD7 ASP C 135 ? ASN C 139 ? ASP B 135 ASN B 139 5 ? 5  
HELX_P HELX_P35 AD8 PRO C 162 ? GLY C 168 ? PRO B 162 GLY B 168 1 ? 7  
HELX_P HELX_P36 AD9 ASN C 184 ? ASN C 198 ? ASN B 184 ASN B 198 1 ? 15 
HELX_P HELX_P37 AE1 THR C 202 ? LEU C 210 ? THR B 202 LEU B 210 1 ? 9  
HELX_P HELX_P38 AE2 LYS C 224 ? GLY C 234 ? LYS B 224 GLY B 234 1 ? 11 
HELX_P HELX_P39 AE3 ASN C 266 ? GLN C 279 ? ASN B 266 GLN B 279 1 ? 14 
HELX_P HELX_P40 AE4 ALA C 310 ? THR C 321 ? ALA B 310 THR B 321 1 ? 12 
HELX_P HELX_P41 AE5 SER C 343 ? HIS C 386 ? SER B 343 HIS B 386 1 ? 44 
HELX_P HELX_P42 AE6 HIS C 386 ? SER C 397 ? HIS B 386 SER B 397 1 ? 12 
HELX_P HELX_P43 AE7 THR C 399 ? PHE C 411 ? THR B 399 PHE B 411 1 ? 13 
HELX_P HELX_P44 AE8 SER C 414 ? ASP C 423 ? SER B 414 ASP B 423 1 ? 10 
HELX_P HELX_P45 AE9 ARG C 425 ? LEU C 429 ? ARG B 425 LEU B 429 5 ? 5  
HELX_P HELX_P46 AF1 GLY C 431 ? LYS C 457 ? GLY B 431 LYS B 457 1 ? 27 
HELX_P HELX_P47 AF2 LYS C 457 ? SER C 477 ? LYS B 457 SER B 477 1 ? 21 
HELX_P HELX_P48 AF3 GLU D 54  ? GLY D 65  ? GLU D 433 GLY D 444 1 ? 12 
HELX_P HELX_P49 AF4 SER D 87  ? LEU D 92  ? SER D 466 LEU D 471 1 ? 6  
HELX_P HELX_P50 AF5 ASN D 94  ? GLY D 105 ? ASN D 473 GLY D 484 1 ? 12 
HELX_P HELX_P51 AF6 ASP D 113 ? ALA D 117 ? ASP D 492 ALA D 496 5 ? 5  
HELX_P HELX_P52 AF7 ASP D 129 ? MET D 147 ? ASP D 508 MET D 526 1 ? 19 
HELX_P HELX_P53 AF8 MET D 147 ? GLU D 152 ? MET D 526 GLU D 531 1 ? 6  
HELX_P HELX_P54 AF9 ASP D 212 ? THR D 220 ? ASP D 591 THR D 599 1 ? 9  
HELX_P HELX_P55 AG1 ASP D 235 ? MET D 247 ? ASP D 614 MET D 626 1 ? 13 
HELX_P HELX_P56 AG2 VAL D 251 ? ASN D 261 ? VAL D 630 ASN D 640 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? I MFX .  O02 ? ? ? 1_555 L MG .  MG ? ? F MFX 101 G MG 101 1_555 ? ? ? ? ? ? ?            2.018 ? 
metalc2  metalc ? ? I MFX .  O   ? ? ? 1_555 L MG .  MG ? ? F MFX 101 G MG 101 1_555 ? ? ? ? ? ? ?            2.016 ? 
metalc3  metalc ? ? J MFX .  O02 ? ? ? 1_555 K MG .  MG ? ? H MFX 101 H MG 102 1_555 ? ? ? ? ? ? ?            2.019 ? 
metalc4  metalc ? ? J MFX .  O   ? ? ? 1_555 K MG .  MG ? ? H MFX 101 H MG 102 1_555 ? ? ? ? ? ? ?            2.016 ? 
hydrog1  hydrog ? ? E DA  7  N1  ? ? ? 1_555 F DT 13 N3 ? ? E DA  7   F DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? E DA  7  N6  ? ? ? 1_555 F DT 13 O4 ? ? E DA  7   F DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? E DC  8  N3  ? ? ? 1_555 F DG 12 N1 ? ? E DC  8   F DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? E DC  8  N4  ? ? ? 1_555 F DG 12 O6 ? ? E DC  8   F DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? E DC  8  O2  ? ? ? 1_555 F DG 12 N2 ? ? E DC  8   F DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? E DG  9  N1  ? ? ? 1_555 F DC 11 N3 ? ? E DG  9   F DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? E DG  9  N2  ? ? ? 1_555 F DC 11 O2 ? ? E DG  9   F DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? E DG  9  O6  ? ? ? 1_555 F DC 11 N4 ? ? E DG  9   F DC 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? E DT  10 N3  ? ? ? 1_555 F DA 10 N1 ? ? E DT  10  F DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? E DT  10 O4  ? ? ? 1_555 F DA 10 N6 ? ? E DT  10  F DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? E DT  11 N3  ? ? ? 1_555 F DA 9  N1 ? ? E DT  11  F DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? E DT  11 O4  ? ? ? 1_555 F DA 9  N6 ? ? E DT  11  F DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? E DG  12 N1  ? ? ? 1_555 F DC 8  N3 ? ? E DG  12  F DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? E DG  12 N2  ? ? ? 1_555 F DC 8  O2 ? ? E DG  12  F DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? E DG  12 O6  ? ? ? 1_555 F DC 8  N4 ? ? E DG  12  F DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? E DT  13 N3  ? ? ? 1_555 F DA 7  N1 ? ? E DT  13  F DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? E DT  13 O4  ? ? ? 1_555 F DA 7  N6 ? ? E DT  13  F DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? E DA  14 N1  ? ? ? 1_555 F DT 6  N3 ? ? E DA  14  F DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? E DA  14 N6  ? ? ? 1_555 F DT 6  O4 ? ? E DA  14  F DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? E DT  15 N3  ? ? ? 1_555 F DA 5  N1 ? ? E DT  15  F DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? E DT  15 O4  ? ? ? 1_555 F DA 5  N6 ? ? E DT  15  F DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? F DG  1  N1  ? ? ? 1_555 G DC 4  N3 ? ? F DG  1   H DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? F DG  1  N2  ? ? ? 1_555 G DC 4  O2 ? ? F DG  1   H DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? F DG  1  O6  ? ? ? 1_555 G DC 4  N4 ? ? F DG  1   H DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? F DA  2  N1  ? ? ? 1_555 G DT 3  N3 ? ? F DA  2   H DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? F DA  2  N6  ? ? ? 1_555 G DT 3  O4 ? ? F DA  2   H DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? F DT  3  N3  ? ? ? 1_555 G DA 2  N1 ? ? F DT  3   H DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? F DT  3  O4  ? ? ? 1_555 G DA 2  N6 ? ? F DT  3   H DA 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? F DC  4  N3  ? ? ? 1_555 G DG 1  N1 ? ? F DC  4   H DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? F DC  4  N4  ? ? ? 1_555 G DG 1  O6 ? ? F DC  4   H DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? F DC  4  O2  ? ? ? 1_555 G DG 1  N2 ? ? F DC  4   H DG 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? G DA  5  N1  ? ? ? 1_555 H DT 15 N3 ? ? H DA  5   G DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? G DA  5  N6  ? ? ? 1_555 H DT 15 O4 ? ? H DA  5   G DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? G DT  6  N3  ? ? ? 1_555 H DA 14 N1 ? ? H DT  6   G DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? G DT  6  O4  ? ? ? 1_555 H DA 14 N6 ? ? H DT  6   G DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? G DA  7  N1  ? ? ? 1_555 H DT 13 N3 ? ? H DA  7   G DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? G DA  7  N6  ? ? ? 1_555 H DT 13 O4 ? ? H DA  7   G DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? G DC  8  N3  ? ? ? 1_555 H DG 12 N1 ? ? H DC  8   G DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? G DC  8  N4  ? ? ? 1_555 H DG 12 O6 ? ? H DC  8   G DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? G DC  8  O2  ? ? ? 1_555 H DG 12 N2 ? ? H DC  8   G DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? G DA  9  N1  ? ? ? 1_555 H DT 11 N3 ? ? H DA  9   G DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? G DA  9  N6  ? ? ? 1_555 H DT 11 O4 ? ? H DA  9   G DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? G DA  10 N1  ? ? ? 1_555 H DT 10 N3 ? ? H DA  10  G DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? G DA  10 N6  ? ? ? 1_555 H DT 10 O4 ? ? H DA  10  G DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? G DC  11 N3  ? ? ? 1_555 H DG 9  N1 ? ? H DC  11  G DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? G DC  11 N4  ? ? ? 1_555 H DG 9  O6 ? ? H DC  11  G DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? G DC  11 O2  ? ? ? 1_555 H DG 9  N2 ? ? H DC  11  G DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 170 A . ? THR 170 A GLY 171 A ? GLY 171 A 1 0.44  
2 THR 170 C . ? THR 170 B GLY 171 C ? GLY 171 B 1 -1.95 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 6 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA8 3 4 ? parallel      
AA8 4 5 ? anti-parallel 
AA8 5 6 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 6   ? ASN A 10  ? LEU A 6   ASN A 10  
AA1 2 MET D 228 ? SER D 232 ? MET D 607 SER D 611 
AA1 3 VAL D 156 ? ALA D 159 ? VAL D 535 ALA D 538 
AA1 4 LYS D 121 ? MET D 125 ? LYS D 500 MET D 504 
AA1 5 GLU D 49  ? VAL D 53  ? GLU D 428 VAL D 432 
AA1 6 GLN D 71  ? PRO D 75  ? GLN D 450 PRO D 454 
AA2 1 LYS A 62  ? LYS A 63  ? LYS A 62  LYS A 63  
AA2 2 GLU A 122 ? MET A 125 ? GLU A 122 MET A 125 
AA2 3 VAL A 101 ? HIS A 104 ? VAL A 101 HIS A 104 
AA3 1 PHE A 143 ? ASP A 145 ? PHE A 143 ASP A 145 
AA3 2 ARG A 152 ? PRO A 154 ? ARG A 152 PRO A 154 
AA4 1 ALA A 169 ? ILE A 172 ? ALA A 169 ILE A 172 
AA4 2 ALA A 177 ? ILE A 180 ? ALA A 177 ILE A 180 
AA5 1 GLN A 324 ? ASN A 330 ? GLN A 324 ASN A 330 
AA5 2 LYS A 235 ? ARG A 241 ? LYS A 235 ARG A 241 
AA5 3 LEU A 220 ? MET A 222 ? LEU A 220 MET A 222 
AA5 4 GLU A 483 ? MET A 485 ? GLU A 483 MET A 485 
AA6 1 ARG A 243 ? THR A 248 ? ARG A 243 THR A 248 
AA6 2 GLU A 254 ? GLU A 260 ? GLU A 254 GLU A 260 
AA6 3 PHE A 300 ? VAL A 304 ? PHE A 300 VAL A 304 
AA6 4 ILE A 286 ? ASP A 291 ? ILE A 286 ASP A 291 
AA7 1 LEU A 332 ? GLN A 335 ? LEU A 332 GLN A 335 
AA7 2 ILE A 338 ? ILE A 341 ? ILE A 338 ILE A 341 
AA8 1 GLN B 71  ? ILE B 76  ? GLN C 450 ILE C 455 
AA8 2 GLU B 49  ? GLU B 54  ? GLU C 428 GLU C 433 
AA8 3 LEU B 122 ? MET B 125 ? LEU C 501 MET C 504 
AA8 4 VAL B 156 ? ALA B 159 ? VAL C 535 ALA C 538 
AA8 5 LEU B 227 ? SER B 232 ? LEU C 606 SER C 611 
AA8 6 ASN C 5   ? ASN C 10  ? ASN B 5   ASN B 10  
AA9 1 LYS C 62  ? LYS C 63  ? LYS B 62  LYS B 63  
AA9 2 GLU C 122 ? MET C 125 ? GLU B 122 MET B 125 
AA9 3 VAL C 101 ? HIS C 104 ? VAL B 101 HIS B 104 
AB1 1 PHE C 143 ? ASP C 145 ? PHE B 143 ASP B 145 
AB1 2 ARG C 152 ? PRO C 154 ? ARG B 152 PRO B 154 
AB2 1 ALA C 169 ? ILE C 172 ? ALA B 169 ILE B 172 
AB2 2 ALA C 177 ? ILE C 180 ? ALA B 177 ILE B 180 
AB3 1 GLN C 324 ? ASN C 330 ? GLN B 324 ASN B 330 
AB3 2 LYS C 235 ? ARG C 241 ? LYS B 235 ARG B 241 
AB3 3 LEU C 220 ? MET C 222 ? LEU B 220 MET B 222 
AB3 4 GLU C 483 ? MET C 485 ? GLU B 483 MET B 485 
AB4 1 ARG C 243 ? THR C 248 ? ARG B 243 THR B 248 
AB4 2 GLU C 254 ? GLU C 260 ? GLU B 254 GLU B 260 
AB4 3 VAL C 301 ? VAL C 304 ? VAL B 301 VAL B 304 
AB4 4 ILE C 286 ? ARG C 290 ? ILE B 286 ARG B 290 
AB5 1 LEU C 332 ? GLN C 335 ? LEU B 332 GLN B 335 
AB5 2 ILE C 338 ? ILE C 341 ? ILE B 338 ILE B 341 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 9   ? N VAL A 9   O SER D 232 ? O SER D 611 
AA1 2 3 O ALA D 229 ? O ALA D 608 N ILE D 158 ? N ILE D 537 
AA1 3 4 O TYR D 157 ? O TYR D 536 N LEU D 124 ? N LEU D 503 
AA1 4 5 O VAL D 123 ? O VAL D 502 N ILE D 52  ? N ILE D 431 
AA1 5 6 N GLU D 49  ? N GLU D 428 O ALA D 72  ? O ALA D 451 
AA2 1 2 N LYS A 62  ? N LYS A 62  O ALA A 123 ? O ALA A 123 
AA2 2 3 O ARG A 124 ? O ARG A 124 N ASP A 102 ? N ASP A 102 
AA3 1 2 N VAL A 144 ? N VAL A 144 O GLU A 153 ? O GLU A 153 
AA4 1 2 N GLY A 171 ? N GLY A 171 O THR A 178 ? O THR A 178 
AA5 1 2 O THR A 325 ? O THR A 325 N LEU A 240 ? N LEU A 240 
AA5 2 3 O ARG A 241 ? O ARG A 241 N LEU A 220 ? N LEU A 220 
AA5 3 4 N VAL A 221 ? N VAL A 221 O MET A 485 ? O MET A 485 
AA6 1 2 N GLU A 247 ? N GLU A 247 O ARG A 255 ? O ARG A 255 
AA6 2 3 N VAL A 258 ? N VAL A 258 O PHE A 300 ? O PHE A 300 
AA6 3 4 O GLU A 303 ? O GLU A 303 N THR A 287 ? N THR A 287 
AA7 1 2 N GLN A 335 ? N GLN A 335 O ILE A 338 ? O ILE A 338 
AA8 1 2 O ALA B 72  ? O ALA C 451 N PHE B 51  ? N PHE C 430 
AA8 2 3 N ILE B 52  ? N ILE C 431 O VAL B 123 ? O VAL C 502 
AA8 3 4 N LEU B 122 ? N LEU C 501 O TYR B 157 ? O TYR C 536 
AA8 4 5 N VAL B 156 ? N VAL C 535 O VAL B 231 ? O VAL C 610 
AA8 5 6 N ARG B 230 ? N ARG C 609 O VAL C 9   ? O VAL B 9   
AA9 1 2 N LYS C 62  ? N LYS B 62  O ALA C 123 ? O ALA B 123 
AA9 2 3 O GLU C 122 ? O GLU B 122 N HIS C 104 ? N HIS B 104 
AB1 1 2 N VAL C 144 ? N VAL B 144 O GLU C 153 ? O GLU B 153 
AB2 1 2 N GLY C 171 ? N GLY B 171 O THR C 178 ? O THR B 178 
AB3 1 2 O THR C 325 ? O THR B 325 N LEU C 240 ? N LEU B 240 
AB3 2 3 O ARG C 241 ? O ARG B 241 N LEU C 220 ? N LEU B 220 
AB3 3 4 N VAL C 221 ? N VAL B 221 O MET C 485 ? O MET B 485 
AB4 1 2 N ARG C 243 ? N ARG B 243 O THR C 259 ? O THR B 259 
AB4 2 3 N ILE C 256 ? N ILE B 256 O ILE C 302 ? O ILE B 302 
AB4 3 4 O GLU C 303 ? O GLU B 303 N ALA C 288 ? N ALA B 288 
AB5 1 2 N GLN C 335 ? N GLN B 335 O ILE C 338 ? O ILE B 338 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software F MFX 101 ? 7 'binding site for residue MFX F 101' 
AC2 Software H MFX 101 ? 8 'binding site for residue MFX H 101' 
AC3 Software H MG  102 ? 1 'binding site for residue MG H 102'  
AC4 Software G MG  101 ? 2 'binding site for residue MG G 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 SER C 81 ? SER B 81  . ? 1_555 ? 
2  AC1 7 GLU B 96 ? GLU C 475 . ? 1_555 ? 
3  AC1 7 DG  F 1  ? DG  F 1   . ? 1_555 ? 
4  AC1 7 DT  H 15 ? DT  G 15  . ? 1_555 ? 
5  AC1 7 MG  L .  ? MG  G 101 . ? 1_555 ? 
6  AC1 7 DC  G 4  ? DC  H 4   . ? 1_555 ? 
7  AC1 7 DA  G 5  ? DA  H 5   . ? 1_555 ? 
8  AC2 8 SER A 81 ? SER A 81  . ? 1_555 ? 
9  AC2 8 ARG D 77 ? ARG D 456 . ? 1_555 ? 
10 AC2 8 GLU D 96 ? GLU D 475 . ? 1_555 ? 
11 AC2 8 DT  E 15 ? DT  E 15  . ? 1_555 ? 
12 AC2 8 DC  F 4  ? DC  F 4   . ? 1_555 ? 
13 AC2 8 DA  F 5  ? DA  F 5   . ? 1_555 ? 
14 AC2 8 DG  G 1  ? DG  H 1   . ? 1_555 ? 
15 AC2 8 MG  K .  ? MG  H 102 . ? 1_555 ? 
16 AC3 1 MFX J .  ? MFX H 101 . ? 1_555 ? 
17 AC4 2 MFX I .  ? MFX F 101 . ? 1_555 ? 
18 AC4 2 DT  H 15 ? DT  G 15  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4Z2C 
_atom_sites.fract_transf_matrix[1][1]   0.010866 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010532 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003646 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLN A 1 2   ? 70.844  34.266  298.283 1.00 173.33 ? 2   GLN A N     1 
ATOM   2     C  CA    . GLN A 1 2   ? 70.521  32.978  298.881 1.00 174.88 ? 2   GLN A CA    1 
ATOM   3     C  C     . GLN A 1 2   ? 70.381  31.916  297.794 1.00 177.18 ? 2   GLN A C     1 
ATOM   4     O  O     . GLN A 1 2   ? 71.055  31.980  296.767 1.00 178.26 ? 2   GLN A O     1 
ATOM   5     C  CB    . GLN A 1 2   ? 69.231  33.077  299.700 1.00 179.78 ? 2   GLN A CB    1 
ATOM   6     C  CG    . GLN A 1 2   ? 69.169  32.138  300.896 1.00 179.01 ? 2   GLN A CG    1 
ATOM   7     C  CD    . GLN A 1 2   ? 67.747  31.816  301.308 1.00 181.22 ? 2   GLN A CD    1 
ATOM   8     O  OE1   . GLN A 1 2   ? 66.798  32.447  300.846 1.00 184.96 ? 2   GLN A OE1   1 
ATOM   9     N  NE2   . GLN A 1 2   ? 67.592  30.823  302.176 1.00 177.40 ? 2   GLN A NE2   1 
ATOM   10    N  N     . ASP A 1 3   ? 69.497  30.948  298.019 1.00 178.19 ? 3   ASP A N     1 
ATOM   11    C  CA    . ASP A 1 3   ? 69.312  29.837  297.092 1.00 174.88 ? 3   ASP A CA    1 
ATOM   12    C  C     . ASP A 1 3   ? 68.158  30.070  296.124 1.00 172.66 ? 3   ASP A C     1 
ATOM   13    O  O     . ASP A 1 3   ? 67.715  31.202  295.921 1.00 178.30 ? 3   ASP A O     1 
ATOM   14    C  CB    . ASP A 1 3   ? 69.068  28.536  297.859 1.00 169.77 ? 3   ASP A CB    1 
ATOM   15    C  CG    . ASP A 1 3   ? 70.275  28.091  298.658 1.00 158.81 ? 3   ASP A CG    1 
ATOM   16    O  OD1   . ASP A 1 3   ? 71.206  28.902  298.836 1.00 152.09 ? 3   ASP A OD1   1 
ATOM   17    O  OD2   . ASP A 1 3   ? 70.291  26.929  299.117 1.00 156.46 ? 3   ASP A OD2   1 
ATOM   18    N  N     . LYS A 1 4   ? 67.679  28.980  295.533 1.00 166.87 ? 4   LYS A N     1 
ATOM   19    C  CA    . LYS A 1 4   ? 66.570  29.032  294.590 1.00 165.55 ? 4   LYS A CA    1 
ATOM   20    C  C     . LYS A 1 4   ? 65.614  27.865  294.816 1.00 167.54 ? 4   LYS A C     1 
ATOM   21    O  O     . LYS A 1 4   ? 64.450  28.063  295.160 1.00 166.21 ? 4   LYS A O     1 
ATOM   22    C  CB    . LYS A 1 4   ? 67.089  29.019  293.151 1.00 161.81 ? 4   LYS A CB    1 
ATOM   23    N  N     . ASN A 1 5   ? 66.115  26.649  294.622 1.00 165.87 ? 5   ASN A N     1 
ATOM   24    C  CA    . ASN A 1 5   ? 65.316  25.446  294.827 1.00 161.99 ? 5   ASN A CA    1 
ATOM   25    C  C     . ASN A 1 5   ? 65.410  24.951  296.266 1.00 166.76 ? 5   ASN A C     1 
ATOM   26    O  O     . ASN A 1 5   ? 66.353  24.249  296.630 1.00 168.43 ? 5   ASN A O     1 
ATOM   27    C  CB    . ASN A 1 5   ? 65.751  24.344  293.859 1.00 150.10 ? 5   ASN A CB    1 
ATOM   28    N  N     . LEU A 1 6   ? 64.427  25.324  297.079 1.00 166.08 ? 6   LEU A N     1 
ATOM   29    C  CA    . LEU A 1 6   ? 64.435  24.983  298.497 1.00 150.03 ? 6   LEU A CA    1 
ATOM   30    C  C     . LEU A 1 6   ? 63.269  24.084  298.893 1.00 144.44 ? 6   LEU A C     1 
ATOM   31    O  O     . LEU A 1 6   ? 62.125  24.532  298.981 1.00 150.70 ? 6   LEU A O     1 
ATOM   32    C  CB    . LEU A 1 6   ? 64.432  26.252  299.351 1.00 144.90 ? 6   LEU A CB    1 
ATOM   33    C  CG    . LEU A 1 6   ? 65.685  27.121  299.251 1.00 141.70 ? 6   LEU A CG    1 
ATOM   34    C  CD1   . LEU A 1 6   ? 65.626  28.271  300.239 1.00 147.99 ? 6   LEU A CD1   1 
ATOM   35    C  CD2   . LEU A 1 6   ? 66.910  26.270  299.499 1.00 138.51 ? 6   LEU A CD2   1 
ATOM   36    N  N     . VAL A 1 7   ? 63.569  22.812  299.132 1.00 136.14 ? 7   VAL A N     1 
ATOM   37    C  CA    . VAL A 1 7   ? 62.568  21.868  299.608 1.00 136.36 ? 7   VAL A CA    1 
ATOM   38    C  C     . VAL A 1 7   ? 62.343  22.072  301.101 1.00 135.95 ? 7   VAL A C     1 
ATOM   39    O  O     . VAL A 1 7   ? 63.035  22.865  301.740 1.00 130.31 ? 7   VAL A O     1 
ATOM   40    C  CB    . VAL A 1 7   ? 62.989  20.410  299.344 1.00 111.48 ? 7   VAL A CB    1 
ATOM   41    N  N     . ASN A 1 8   ? 61.371  21.356  301.655 1.00 137.61 ? 8   ASN A N     1 
ATOM   42    C  CA    . ASN A 1 8   ? 61.056  21.478  303.072 1.00 142.29 ? 8   ASN A CA    1 
ATOM   43    C  C     . ASN A 1 8   ? 61.021  20.122  303.766 1.00 148.78 ? 8   ASN A C     1 
ATOM   44    O  O     . ASN A 1 8   ? 60.366  19.190  303.298 1.00 158.28 ? 8   ASN A O     1 
ATOM   45    C  CB    . ASN A 1 8   ? 59.726  22.210  303.262 1.00 144.77 ? 8   ASN A CB    1 
ATOM   46    C  CG    . ASN A 1 8   ? 59.457  22.559  304.709 1.00 144.82 ? 8   ASN A CG    1 
ATOM   47    O  OD1   . ASN A 1 8   ? 59.790  23.651  305.167 1.00 143.40 ? 8   ASN A OD1   1 
ATOM   48    N  ND2   . ASN A 1 8   ? 58.850  21.633  305.439 1.00 144.63 ? 8   ASN A ND2   1 
ATOM   49    N  N     . VAL A 1 9   ? 61.730  20.017  304.885 1.00 145.46 ? 9   VAL A N     1 
ATOM   50    C  CA    . VAL A 1 9   ? 61.816  18.762  305.619 1.00 139.39 ? 9   VAL A CA    1 
ATOM   51    C  C     . VAL A 1 9   ? 61.268  18.901  307.035 1.00 148.21 ? 9   VAL A C     1 
ATOM   52    O  O     . VAL A 1 9   ? 61.672  19.792  307.784 1.00 149.27 ? 9   VAL A O     1 
ATOM   53    C  CB    . VAL A 1 9   ? 63.268  18.250  305.690 1.00 123.13 ? 9   VAL A CB    1 
ATOM   54    N  N     . ASN A 1 10  ? 60.340  18.020  307.393 1.00 151.73 ? 10  ASN A N     1 
ATOM   55    C  CA    . ASN A 1 10  ? 59.829  17.962  308.756 1.00 152.11 ? 10  ASN A CA    1 
ATOM   56    C  C     . ASN A 1 10  ? 60.832  17.247  309.654 1.00 150.48 ? 10  ASN A C     1 
ATOM   57    O  O     . ASN A 1 10  ? 61.407  16.233  309.261 1.00 146.83 ? 10  ASN A O     1 
ATOM   58    C  CB    . ASN A 1 10  ? 58.473  17.254  308.796 1.00 128.31 ? 10  ASN A CB    1 
ATOM   59    N  N     . LEU A 1 11  ? 61.043  17.785  310.853 1.00 143.37 ? 11  LEU A N     1 
ATOM   60    C  CA    . LEU A 1 11  ? 62.066  17.276  311.763 1.00 134.03 ? 11  LEU A CA    1 
ATOM   61    C  C     . LEU A 1 11  ? 61.898  15.791  312.076 1.00 139.20 ? 11  LEU A C     1 
ATOM   62    O  O     . LEU A 1 11  ? 62.818  14.998  311.869 1.00 143.08 ? 11  LEU A O     1 
ATOM   63    C  CB    . LEU A 1 11  ? 62.076  18.081  313.063 1.00 121.38 ? 11  LEU A CB    1 
ATOM   64    C  CG    . LEU A 1 11  ? 63.426  18.649  313.509 1.00 113.61 ? 11  LEU A CG    1 
ATOM   65    C  CD1   . LEU A 1 11  ? 63.368  19.077  314.965 1.00 102.27 ? 11  LEU A CD1   1 
ATOM   66    C  CD2   . LEU A 1 11  ? 64.553  17.651  313.280 1.00 109.93 ? 11  LEU A CD2   1 
ATOM   67    N  N     . THR A 1 12  ? 60.720  15.427  312.572 1.00 139.29 ? 12  THR A N     1 
ATOM   68    C  CA    . THR A 1 12  ? 60.422  14.048  312.946 1.00 135.02 ? 12  THR A CA    1 
ATOM   69    C  C     . THR A 1 12  ? 60.604  13.084  311.777 1.00 130.39 ? 12  THR A C     1 
ATOM   70    O  O     . THR A 1 12  ? 61.060  11.953  311.959 1.00 124.88 ? 12  THR A O     1 
ATOM   71    C  CB    . THR A 1 12  ? 58.983  13.912  313.483 1.00 101.70 ? 12  THR A CB    1 
ATOM   72    N  N     . LYS A 1 13  ? 60.251  13.545  310.580 1.00 131.17 ? 13  LYS A N     1 
ATOM   73    C  CA    . LYS A 1 13  ? 60.353  12.729  309.375 1.00 130.06 ? 13  LYS A CA    1 
ATOM   74    C  C     . LYS A 1 13  ? 61.799  12.348  309.075 1.00 121.88 ? 13  LYS A C     1 
ATOM   75    O  O     . LYS A 1 13  ? 62.137  11.164  308.994 1.00 117.40 ? 13  LYS A O     1 
ATOM   76    C  CB    . LYS A 1 13  ? 59.751  13.470  308.180 1.00 138.57 ? 13  LYS A CB    1 
ATOM   77    N  N     . GLU A 1 14  ? 62.645  13.362  308.913 1.00 119.35 ? 14  GLU A N     1 
ATOM   78    C  CA    . GLU A 1 14  ? 64.055  13.154  308.601 1.00 126.11 ? 14  GLU A CA    1 
ATOM   79    C  C     . GLU A 1 14  ? 64.761  12.413  309.731 1.00 121.70 ? 14  GLU A C     1 
ATOM   80    O  O     . GLU A 1 14  ? 65.644  11.589  309.484 1.00 125.90 ? 14  GLU A O     1 
ATOM   81    C  CB    . GLU A 1 14  ? 64.750  14.490  308.324 1.00 135.33 ? 14  GLU A CB    1 
ATOM   82    C  CG    . GLU A 1 14  ? 66.178  14.358  307.811 1.00 109.89 ? 14  GLU A CG    1 
ATOM   83    N  N     . MET A 1 15  ? 64.365  12.708  310.968 1.00 112.46 ? 15  MET A N     1 
ATOM   84    C  CA    . MET A 1 15  ? 64.909  12.016  312.134 1.00 97.86  ? 15  MET A CA    1 
ATOM   85    C  C     . MET A 1 15  ? 64.627  10.519  312.056 1.00 99.98  ? 15  MET A C     1 
ATOM   86    O  O     . MET A 1 15  ? 65.548  9.702   312.123 1.00 108.39 ? 15  MET A O     1 
ATOM   87    C  CB    . MET A 1 15  ? 64.335  12.594  313.433 1.00 92.41  ? 15  MET A CB    1 
ATOM   88    C  CG    . MET A 1 15  ? 65.014  13.868  313.916 1.00 95.05  ? 15  MET A CG    1 
ATOM   89    S  SD    . MET A 1 15  ? 66.769  13.626  314.262 1.00 121.43 ? 15  MET A SD    1 
ATOM   90    C  CE    . MET A 1 15  ? 66.693  12.255  315.409 1.00 111.09 ? 15  MET A CE    1 
ATOM   91    N  N     . LYS A 1 16  ? 63.350  10.171  311.910 1.00 97.86  ? 16  LYS A N     1 
ATOM   92    C  CA    . LYS A 1 16  ? 62.931  8.777   311.806 1.00 103.79 ? 16  LYS A CA    1 
ATOM   93    C  C     . LYS A 1 16  ? 63.608  8.070   310.633 1.00 113.01 ? 16  LYS A C     1 
ATOM   94    O  O     . LYS A 1 16  ? 64.053  6.927   310.758 1.00 103.80 ? 16  LYS A O     1 
ATOM   95    C  CB    . LYS A 1 16  ? 61.410  8.689   311.660 1.00 93.89  ? 16  LYS A CB    1 
ATOM   96    N  N     . ALA A 1 17  ? 63.691  8.762   309.500 1.00 122.98 ? 17  ALA A N     1 
ATOM   97    C  CA    . ALA A 1 17  ? 64.291  8.199   308.297 1.00 124.10 ? 17  ALA A CA    1 
ATOM   98    C  C     . ALA A 1 17  ? 65.768  7.877   308.498 1.00 127.50 ? 17  ALA A C     1 
ATOM   99    O  O     . ALA A 1 17  ? 66.188  6.723   308.363 1.00 135.70 ? 17  ALA A O     1 
ATOM   100   C  CB    . ALA A 1 17  ? 64.109  9.146   307.125 1.00 120.96 ? 17  ALA A CB    1 
ATOM   101   N  N     . SER A 1 18  ? 66.547  8.905   308.824 1.00 120.95 ? 18  SER A N     1 
ATOM   102   C  CA    . SER A 1 18  ? 67.982  8.749   309.041 1.00 116.35 ? 18  SER A CA    1 
ATOM   103   C  C     . SER A 1 18  ? 68.279  7.719   310.124 1.00 118.07 ? 18  SER A C     1 
ATOM   104   O  O     . SER A 1 18  ? 69.195  6.898   309.989 1.00 119.46 ? 18  SER A O     1 
ATOM   105   C  CB    . SER A 1 18  ? 68.617  10.091  309.407 1.00 112.73 ? 18  SER A CB    1 
ATOM   106   O  OG    . SER A 1 18  ? 68.399  11.055  308.391 1.00 124.27 ? 18  SER A OG    1 
ATOM   107   N  N     . PHE A 1 19  ? 67.495  7.755   311.197 1.00 121.86 ? 19  PHE A N     1 
ATOM   108   C  CA    . PHE A 1 19  ? 67.713  6.822   312.293 1.00 121.26 ? 19  PHE A CA    1 
ATOM   109   C  C     . PHE A 1 19  ? 67.419  5.384   311.886 1.00 117.64 ? 19  PHE A C     1 
ATOM   110   O  O     . PHE A 1 19  ? 68.162  4.483   312.252 1.00 115.97 ? 19  PHE A O     1 
ATOM   111   C  CB    . PHE A 1 19  ? 66.913  7.187   313.543 1.00 124.03 ? 19  PHE A CB    1 
ATOM   112   C  CG    . PHE A 1 19  ? 67.249  6.332   314.727 1.00 119.31 ? 19  PHE A CG    1 
ATOM   113   C  CD1   . PHE A 1 19  ? 66.451  5.255   315.071 1.00 112.80 ? 19  PHE A CD1   1 
ATOM   114   C  CD2   . PHE A 1 19  ? 68.382  6.591   315.478 1.00 115.04 ? 19  PHE A CD2   1 
ATOM   115   C  CE1   . PHE A 1 19  ? 66.770  4.461   316.152 1.00 113.68 ? 19  PHE A CE1   1 
ATOM   116   C  CE2   . PHE A 1 19  ? 68.705  5.801   316.558 1.00 112.13 ? 19  PHE A CE2   1 
ATOM   117   C  CZ    . PHE A 1 19  ? 67.899  4.735   316.894 1.00 118.10 ? 19  PHE A CZ    1 
ATOM   118   N  N     . ILE A 1 20  ? 66.338  5.171   311.142 1.00 112.39 ? 20  ILE A N     1 
ATOM   119   C  CA    . ILE A 1 20  ? 66.021  3.836   310.640 1.00 110.00 ? 20  ILE A CA    1 
ATOM   120   C  C     . ILE A 1 20  ? 67.152  3.350   309.739 1.00 108.01 ? 20  ILE A C     1 
ATOM   121   O  O     . ILE A 1 20  ? 67.563  2.186   309.805 1.00 107.23 ? 20  ILE A O     1 
ATOM   122   C  CB    . ILE A 1 20  ? 64.695  3.820   309.856 1.00 86.33  ? 20  ILE A CB    1 
ATOM   123   N  N     . ASP A 1 21  ? 67.655  4.266   308.914 1.00 103.28 ? 21  ASP A N     1 
ATOM   124   C  CA    . ASP A 1 21  ? 68.785  4.000   308.032 1.00 102.87 ? 21  ASP A CA    1 
ATOM   125   C  C     . ASP A 1 21  ? 69.983  3.467   308.814 1.00 93.32  ? 21  ASP A C     1 
ATOM   126   O  O     . ASP A 1 21  ? 70.391  2.308   308.644 1.00 86.73  ? 21  ASP A O     1 
ATOM   127   C  CB    . ASP A 1 21  ? 69.186  5.284   307.297 1.00 120.31 ? 21  ASP A CB    1 
ATOM   128   C  CG    . ASP A 1 21  ? 69.182  5.123   305.791 1.00 141.08 ? 21  ASP A CG    1 
ATOM   129   O  OD1   . ASP A 1 21  ? 70.278  5.048   305.195 1.00 143.40 ? 21  ASP A OD1   1 
ATOM   130   O  OD2   . ASP A 1 21  ? 68.082  5.074   305.203 1.00 154.01 ? 21  ASP A OD2   1 
ATOM   131   N  N     . TYR A 1 22  ? 70.542  4.319   309.672 1.00 100.01 ? 22  TYR A N     1 
ATOM   132   C  CA    . TYR A 1 22  ? 71.726  3.952   310.450 1.00 100.22 ? 22  TYR A CA    1 
ATOM   133   C  C     . TYR A 1 22  ? 71.508  2.693   311.286 1.00 99.72  ? 22  TYR A C     1 
ATOM   134   O  O     . TYR A 1 22  ? 72.369  1.809   311.322 1.00 97.06  ? 22  TYR A O     1 
ATOM   135   C  CB    . TYR A 1 22  ? 72.172  5.108   311.346 1.00 96.47  ? 22  TYR A CB    1 
ATOM   136   C  CG    . TYR A 1 22  ? 73.307  4.753   312.284 1.00 96.63  ? 22  TYR A CG    1 
ATOM   137   C  CD1   . TYR A 1 22  ? 74.614  4.646   311.821 1.00 99.76  ? 22  TYR A CD1   1 
ATOM   138   C  CD2   . TYR A 1 22  ? 73.071  4.526   313.635 1.00 95.87  ? 22  TYR A CD2   1 
ATOM   139   C  CE1   . TYR A 1 22  ? 75.651  4.325   312.676 1.00 105.97 ? 22  TYR A CE1   1 
ATOM   140   C  CE2   . TYR A 1 22  ? 74.106  4.202   314.499 1.00 98.43  ? 22  TYR A CE2   1 
ATOM   141   C  CZ    . TYR A 1 22  ? 75.393  4.104   314.013 1.00 109.02 ? 22  TYR A CZ    1 
ATOM   142   O  OH    . TYR A 1 22  ? 76.426  3.782   314.864 1.00 113.52 ? 22  TYR A OH    1 
ATOM   143   N  N     . ALA A 1 23  ? 70.353  2.621   311.944 1.00 94.12  ? 23  ALA A N     1 
ATOM   144   C  CA    . ALA A 1 23  ? 69.989  1.466   312.757 1.00 87.58  ? 23  ALA A CA    1 
ATOM   145   C  C     . ALA A 1 23  ? 70.068  0.183   311.950 1.00 97.11  ? 23  ALA A C     1 
ATOM   146   O  O     . ALA A 1 23  ? 70.846  -0.702  312.282 1.00 99.30  ? 23  ALA A O     1 
ATOM   147   C  CB    . ALA A 1 23  ? 68.596  1.633   313.347 1.00 81.92  ? 23  ALA A CB    1 
ATOM   148   N  N     . MET A 1 24  ? 69.276  0.093   310.884 1.00 100.81 ? 24  MET A N     1 
ATOM   149   C  CA    . MET A 1 24  ? 69.263  -1.108  310.049 1.00 93.83  ? 24  MET A CA    1 
ATOM   150   C  C     . MET A 1 24  ? 70.652  -1.441  309.509 1.00 91.49  ? 24  MET A C     1 
ATOM   151   O  O     . MET A 1 24  ? 71.045  -2.613  309.470 1.00 85.67  ? 24  MET A O     1 
ATOM   152   C  CB    . MET A 1 24  ? 68.267  -0.971  308.897 1.00 101.51 ? 24  MET A CB    1 
ATOM   153   C  CG    . MET A 1 24  ? 66.812  -1.075  309.316 1.00 105.56 ? 24  MET A CG    1 
ATOM   154   S  SD    . MET A 1 24  ? 65.708  -1.223  307.901 1.00 188.95 ? 24  MET A SD    1 
ATOM   155   N  N     . SER A 1 25  ? 71.390  -0.408  309.103 1.00 94.48  ? 25  SER A N     1 
ATOM   156   C  CA    . SER A 1 25  ? 72.745  -0.605  308.596 1.00 89.45  ? 25  SER A CA    1 
ATOM   157   C  C     . SER A 1 25  ? 73.657  -1.259  309.632 1.00 99.19  ? 25  SER A C     1 
ATOM   158   O  O     . SER A 1 25  ? 74.443  -2.148  309.302 1.00 103.01 ? 25  SER A O     1 
ATOM   159   C  CB    . SER A 1 25  ? 73.349  0.720   308.134 1.00 77.21  ? 25  SER A CB    1 
ATOM   160   N  N     . VAL A 1 26  ? 73.546  -0.818  310.883 1.00 104.56 ? 26  VAL A N     1 
ATOM   161   C  CA    . VAL A 1 26  ? 74.356  -1.372  311.968 1.00 101.98 ? 26  VAL A CA    1 
ATOM   162   C  C     . VAL A 1 26  ? 73.914  -2.786  312.342 1.00 98.49  ? 26  VAL A C     1 
ATOM   163   O  O     . VAL A 1 26  ? 74.741  -3.675  312.545 1.00 107.57 ? 26  VAL A O     1 
ATOM   164   C  CB    . VAL A 1 26  ? 74.299  -0.475  313.225 1.00 97.93  ? 26  VAL A CB    1 
ATOM   165   C  CG1   . VAL A 1 26  ? 74.885  -1.196  314.436 1.00 102.09 ? 26  VAL A CG1   1 
ATOM   166   C  CG2   . VAL A 1 26  ? 75.021  0.839   312.973 1.00 88.08  ? 26  VAL A CG2   1 
ATOM   167   N  N     . ILE A 1 27  ? 72.603  -2.983  312.425 1.00 85.55  ? 27  ILE A N     1 
ATOM   168   C  CA    . ILE A 1 27  ? 72.030  -4.264  312.815 1.00 86.58  ? 27  ILE A CA    1 
ATOM   169   C  C     . ILE A 1 27  ? 72.372  -5.365  311.822 1.00 103.61 ? 27  ILE A C     1 
ATOM   170   O  O     . ILE A 1 27  ? 72.905  -6.407  312.201 1.00 105.64 ? 27  ILE A O     1 
ATOM   171   C  CB    . ILE A 1 27  ? 70.493  -4.176  312.930 1.00 86.11  ? 27  ILE A CB    1 
ATOM   172   C  CG1   . ILE A 1 27  ? 70.088  -3.164  314.006 1.00 84.68  ? 27  ILE A CG1   1 
ATOM   173   C  CG2   . ILE A 1 27  ? 69.898  -5.550  313.219 1.00 93.44  ? 27  ILE A CG2   1 
ATOM   174   C  CD1   . ILE A 1 27  ? 68.681  -2.631  313.830 1.00 91.26  ? 27  ILE A CD1   1 
ATOM   175   N  N     . VAL A 1 28  ? 72.068  -5.124  310.551 1.00 107.10 ? 28  VAL A N     1 
ATOM   176   C  CA    . VAL A 1 28  ? 72.184  -6.164  309.533 1.00 105.31 ? 28  VAL A CA    1 
ATOM   177   C  C     . VAL A 1 28  ? 73.554  -6.250  308.861 1.00 99.36  ? 28  VAL A C     1 
ATOM   178   O  O     . VAL A 1 28  ? 73.825  -7.198  308.122 1.00 102.29 ? 28  VAL A O     1 
ATOM   179   C  CB    . VAL A 1 28  ? 71.100  -6.005  308.442 1.00 75.41  ? 28  VAL A CB    1 
ATOM   180   N  N     . ALA A 1 29  ? 74.424  -5.278  309.113 1.00 86.73  ? 29  ALA A N     1 
ATOM   181   C  CA    . ALA A 1 29  ? 75.694  -5.243  308.393 1.00 81.09  ? 29  ALA A CA    1 
ATOM   182   C  C     . ALA A 1 29  ? 76.855  -4.586  309.135 1.00 93.22  ? 29  ALA A C     1 
ATOM   183   O  O     . ALA A 1 29  ? 77.631  -3.847  308.528 1.00 85.56  ? 29  ALA A O     1 
ATOM   184   C  CB    . ALA A 1 29  ? 75.506  -4.581  307.037 1.00 82.45  ? 29  ALA A CB    1 
ATOM   185   N  N     . ARG A 1 30  ? 76.980  -4.858  310.431 1.00 102.70 ? 30  ARG A N     1 
ATOM   186   C  CA    . ARG A 1 30  ? 78.118  -4.363  311.207 1.00 98.88  ? 30  ARG A CA    1 
ATOM   187   C  C     . ARG A 1 30  ? 78.253  -5.030  312.570 1.00 99.26  ? 30  ARG A C     1 
ATOM   188   O  O     . ARG A 1 30  ? 79.317  -5.541  312.918 1.00 106.91 ? 30  ARG A O     1 
ATOM   189   C  CB    . ARG A 1 30  ? 78.028  -2.848  311.402 1.00 96.98  ? 30  ARG A CB    1 
ATOM   190   C  CG    . ARG A 1 30  ? 79.178  -2.267  312.209 1.00 92.15  ? 30  ARG A CG    1 
ATOM   191   C  CD    . ARG A 1 30  ? 78.986  -0.779  312.447 1.00 106.12 ? 30  ARG A CD    1 
ATOM   192   N  NE    . ARG A 1 30  ? 79.247  0.013   311.248 1.00 113.99 ? 30  ARG A NE    1 
ATOM   193   C  CZ    . ARG A 1 30  ? 78.961  1.306   311.135 1.00 106.24 ? 30  ARG A CZ    1 
ATOM   194   N  NH1   . ARG A 1 30  ? 78.395  1.949   312.148 1.00 115.75 ? 30  ARG A NH1   1 
ATOM   195   N  NH2   . ARG A 1 30  ? 79.234  1.955   310.010 1.00 84.01  ? 30  ARG A NH2   1 
ATOM   196   N  N     . ALA A 1 31  ? 77.172  -5.017  313.341 1.00 98.30  ? 31  ALA A N     1 
ATOM   197   C  CA    . ALA A 1 31  ? 77.234  -5.418  314.741 1.00 101.35 ? 31  ALA A CA    1 
ATOM   198   C  C     . ALA A 1 31  ? 76.892  -6.884  314.994 1.00 104.28 ? 31  ALA A C     1 
ATOM   199   O  O     . ALA A 1 31  ? 77.426  -7.500  315.918 1.00 103.67 ? 31  ALA A O     1 
ATOM   200   C  CB    . ALA A 1 31  ? 76.341  -4.524  315.571 1.00 106.06 ? 31  ALA A CB    1 
ATOM   201   N  N     . LEU A 1 32  ? 75.991  -7.436  314.190 1.00 105.27 ? 32  LEU A N     1 
ATOM   202   C  CA    . LEU A 1 32  ? 75.503  -8.789  314.429 1.00 99.15  ? 32  LEU A CA    1 
ATOM   203   C  C     . LEU A 1 32  ? 75.898  -9.734  313.300 1.00 102.23 ? 32  LEU A C     1 
ATOM   204   O  O     . LEU A 1 32  ? 75.868  -9.357  312.127 1.00 104.97 ? 32  LEU A O     1 
ATOM   205   C  CB    . LEU A 1 32  ? 73.987  -8.779  314.626 1.00 100.13 ? 32  LEU A CB    1 
ATOM   206   C  CG    . LEU A 1 32  ? 73.479  -7.737  315.630 1.00 98.36  ? 32  LEU A CG    1 
ATOM   207   C  CD1   . LEU A 1 32  ? 71.957  -7.760  315.727 1.00 96.85  ? 32  LEU A CD1   1 
ATOM   208   C  CD2   . LEU A 1 32  ? 74.118  -7.931  316.999 1.00 95.31  ? 32  LEU A CD2   1 
ATOM   209   N  N     . PRO A 1 33  ? 76.278  -10.970 313.656 1.00 92.52  ? 33  PRO A N     1 
ATOM   210   C  CA    . PRO A 1 33  ? 76.730  -11.957 312.673 1.00 99.13  ? 33  PRO A CA    1 
ATOM   211   C  C     . PRO A 1 33  ? 75.591  -12.769 312.068 1.00 104.93 ? 33  PRO A C     1 
ATOM   212   O  O     . PRO A 1 33  ? 74.580  -13.022 312.726 1.00 108.49 ? 33  PRO A O     1 
ATOM   213   C  CB    . PRO A 1 33  ? 77.615  -12.878 313.508 1.00 100.10 ? 33  PRO A CB    1 
ATOM   214   C  CG    . PRO A 1 33  ? 76.974  -12.863 314.852 1.00 92.33  ? 33  PRO A CG    1 
ATOM   215   C  CD    . PRO A 1 33  ? 76.430  -11.465 315.037 1.00 84.57  ? 33  PRO A CD    1 
ATOM   216   N  N     . ASP A 1 34  ? 75.765  -13.175 310.816 1.00 109.01 ? 34  ASP A N     1 
ATOM   217   C  CA    . ASP A 1 34  ? 74.837  -14.090 310.170 1.00 106.03 ? 34  ASP A CA    1 
ATOM   218   C  C     . ASP A 1 34  ? 74.945  -15.459 310.833 1.00 96.34  ? 34  ASP A C     1 
ATOM   219   O  O     . ASP A 1 34  ? 76.043  -15.981 311.019 1.00 91.66  ? 34  ASP A O     1 
ATOM   220   C  CB    . ASP A 1 34  ? 75.143  -14.189 308.673 1.00 108.64 ? 34  ASP A CB    1 
ATOM   221   C  CG    . ASP A 1 34  ? 74.449  -15.360 308.012 1.00 103.41 ? 34  ASP A CG    1 
ATOM   222   O  OD1   . ASP A 1 34  ? 73.267  -15.220 307.631 1.00 95.17  ? 34  ASP A OD1   1 
ATOM   223   O  OD2   . ASP A 1 34  ? 75.088  -16.422 307.871 1.00 101.52 ? 34  ASP A OD2   1 
ATOM   224   N  N     . VAL A 1 35  ? 73.801  -16.035 311.186 1.00 92.56  ? 35  VAL A N     1 
ATOM   225   C  CA    . VAL A 1 35  ? 73.757  -17.271 311.965 1.00 93.75  ? 35  VAL A CA    1 
ATOM   226   C  C     . VAL A 1 35  ? 74.475  -18.452 311.298 1.00 95.46  ? 35  VAL A C     1 
ATOM   227   O  O     . VAL A 1 35  ? 75.063  -19.296 311.978 1.00 95.61  ? 35  VAL A O     1 
ATOM   228   C  CB    . VAL A 1 35  ? 72.295  -17.659 312.316 1.00 91.42  ? 35  VAL A CB    1 
ATOM   229   C  CG1   . VAL A 1 35  ? 71.472  -17.883 311.051 1.00 85.41  ? 35  VAL A CG1   1 
ATOM   230   C  CG2   . VAL A 1 35  ? 72.259  -18.885 313.216 1.00 95.70  ? 35  VAL A CG2   1 
ATOM   231   N  N     . ARG A 1 36  ? 74.450  -18.491 309.969 1.00 93.19  ? 36  ARG A N     1 
ATOM   232   C  CA    . ARG A 1 36  ? 74.992  -19.624 309.221 1.00 83.87  ? 36  ARG A CA    1 
ATOM   233   C  C     . ARG A 1 36  ? 76.502  -19.801 309.386 1.00 76.16  ? 36  ARG A C     1 
ATOM   234   O  O     . ARG A 1 36  ? 76.973  -20.903 309.666 1.00 79.93  ? 36  ARG A O     1 
ATOM   235   C  CB    . ARG A 1 36  ? 74.623  -19.513 307.741 1.00 91.19  ? 36  ARG A CB    1 
ATOM   236   C  CG    . ARG A 1 36  ? 73.133  -19.347 307.493 1.00 99.14  ? 36  ARG A CG    1 
ATOM   237   C  CD    . ARG A 1 36  ? 72.831  -19.198 306.013 1.00 103.93 ? 36  ARG A CD    1 
ATOM   238   N  NE    . ARG A 1 36  ? 73.410  -17.980 305.454 1.00 96.76  ? 36  ARG A NE    1 
ATOM   239   C  CZ    . ARG A 1 36  ? 72.765  -17.161 304.630 1.00 100.42 ? 36  ARG A CZ    1 
ATOM   240   N  NH1   . ARG A 1 36  ? 71.515  -17.428 304.271 1.00 103.40 ? 36  ARG A NH1   1 
ATOM   241   N  NH2   . ARG A 1 36  ? 73.367  -16.074 304.163 1.00 101.37 ? 36  ARG A NH2   1 
ATOM   242   N  N     . ASP A 1 37  ? 77.257  -18.720 309.215 1.00 73.66  ? 37  ASP A N     1 
ATOM   243   C  CA    . ASP A 1 37  ? 78.711  -18.792 309.332 1.00 81.62  ? 37  ASP A CA    1 
ATOM   244   C  C     . ASP A 1 37  ? 79.228  -18.075 310.577 1.00 95.87  ? 37  ASP A C     1 
ATOM   245   O  O     . ASP A 1 37  ? 80.425  -18.094 310.858 1.00 95.77  ? 37  ASP A O     1 
ATOM   246   C  CB    . ASP A 1 37  ? 79.391  -18.240 308.076 1.00 84.56  ? 37  ASP A CB    1 
ATOM   247   C  CG    . ASP A 1 37  ? 79.103  -16.771 307.855 1.00 98.11  ? 37  ASP A CG    1 
ATOM   248   O  OD1   . ASP A 1 37  ? 77.987  -16.324 308.194 1.00 103.35 ? 37  ASP A OD1   1 
ATOM   249   O  OD2   . ASP A 1 37  ? 79.997  -16.068 307.341 1.00 101.04 ? 37  ASP A OD2   1 
ATOM   250   N  N     . GLY A 1 38  ? 78.320  -17.447 311.318 1.00 96.31  ? 38  GLY A N     1 
ATOM   251   C  CA    . GLY A 1 38  ? 78.668  -16.760 312.550 1.00 93.74  ? 38  GLY A CA    1 
ATOM   252   C  C     . GLY A 1 38  ? 79.689  -15.655 312.361 1.00 96.90  ? 38  GLY A C     1 
ATOM   253   O  O     . GLY A 1 38  ? 80.537  -15.429 313.225 1.00 110.48 ? 38  GLY A O     1 
ATOM   254   N  N     . LEU A 1 39  ? 79.611  -14.963 311.229 1.00 86.54  ? 39  LEU A N     1 
ATOM   255   C  CA    . LEU A 1 39  ? 80.569  -13.907 310.918 1.00 87.29  ? 39  LEU A CA    1 
ATOM   256   C  C     . LEU A 1 39  ? 79.921  -12.547 310.686 1.00 97.83  ? 39  LEU A C     1 
ATOM   257   O  O     . LEU A 1 39  ? 78.802  -12.453 310.183 1.00 105.47 ? 39  LEU A O     1 
ATOM   258   C  CB    . LEU A 1 39  ? 81.412  -14.284 309.697 1.00 83.53  ? 39  LEU A CB    1 
ATOM   259   C  CG    . LEU A 1 39  ? 82.527  -15.311 309.890 1.00 78.13  ? 39  LEU A CG    1 
ATOM   260   C  CD1   . LEU A 1 39  ? 83.349  -15.433 308.619 1.00 74.09  ? 39  LEU A CD1   1 
ATOM   261   C  CD2   . LEU A 1 39  ? 83.407  -14.925 311.065 1.00 69.50  ? 39  LEU A CD2   1 
ATOM   262   N  N     . LYS A 1 40  ? 80.644  -11.499 311.067 1.00 100.06 ? 40  LYS A N     1 
ATOM   263   C  CA    . LYS A 1 40  ? 80.283  -10.132 310.728 1.00 93.96  ? 40  LYS A CA    1 
ATOM   264   C  C     . LYS A 1 40  ? 80.923  -9.808  309.381 1.00 98.15  ? 40  LYS A C     1 
ATOM   265   O  O     . LYS A 1 40  ? 81.876  -10.479 308.978 1.00 102.07 ? 40  LYS A O     1 
ATOM   266   C  CB    . LYS A 1 40  ? 80.800  -9.171  311.798 1.00 100.54 ? 40  LYS A CB    1 
ATOM   267   C  CG    . LYS A 1 40  ? 80.301  -9.471  313.199 1.00 99.43  ? 40  LYS A CG    1 
ATOM   268   C  CD    . LYS A 1 40  ? 80.912  -8.512  314.199 1.00 90.21  ? 40  LYS A CD    1 
ATOM   269   C  CE    . LYS A 1 40  ? 80.393  -8.762  315.598 1.00 84.39  ? 40  LYS A CE    1 
ATOM   270   N  NZ    . LYS A 1 40  ? 80.942  -7.766  316.557 1.00 88.97  ? 40  LYS A NZ    1 
ATOM   271   N  N     . PRO A 1 41  ? 80.398  -8.790  308.675 1.00 97.59  ? 41  PRO A N     1 
ATOM   272   C  CA    . PRO A 1 41  ? 80.946  -8.379  307.376 1.00 99.75  ? 41  PRO A CA    1 
ATOM   273   C  C     . PRO A 1 41  ? 82.462  -8.170  307.369 1.00 96.28  ? 41  PRO A C     1 
ATOM   274   O  O     . PRO A 1 41  ? 83.119  -8.597  306.422 1.00 91.00  ? 41  PRO A O     1 
ATOM   275   C  CB    . PRO A 1 41  ? 80.230  -7.056  307.106 1.00 88.20  ? 41  PRO A CB    1 
ATOM   276   C  CG    . PRO A 1 41  ? 78.899  -7.234  307.759 1.00 81.67  ? 41  PRO A CG    1 
ATOM   277   C  CD    . PRO A 1 41  ? 79.160  -8.055  308.999 1.00 89.61  ? 41  PRO A CD    1 
ATOM   278   N  N     . VAL A 1 42  ? 83.009  -7.543  308.405 1.00 92.90  ? 42  VAL A N     1 
ATOM   279   C  CA    . VAL A 1 42  ? 84.440  -7.249  308.429 1.00 97.85  ? 42  VAL A CA    1 
ATOM   280   C  C     . VAL A 1 42  ? 85.299  -8.517  308.496 1.00 99.55  ? 42  VAL A C     1 
ATOM   281   O  O     . VAL A 1 42  ? 86.282  -8.646  307.767 1.00 108.60 ? 42  VAL A O     1 
ATOM   282   C  CB    . VAL A 1 42  ? 84.814  -6.254  309.559 1.00 83.95  ? 42  VAL A CB    1 
ATOM   283   C  CG1   . VAL A 1 42  ? 84.356  -6.769  310.918 1.00 93.21  ? 42  VAL A CG1   1 
ATOM   284   C  CG2   . VAL A 1 42  ? 86.310  -5.971  309.551 1.00 81.75  ? 42  VAL A CG2   1 
ATOM   285   N  N     . HIS A 1 43  ? 84.909  -9.463  309.345 1.00 90.60  ? 43  HIS A N     1 
ATOM   286   C  CA    . HIS A 1 43  ? 85.652  -10.710 309.495 1.00 92.29  ? 43  HIS A CA    1 
ATOM   287   C  C     . HIS A 1 43  ? 85.536  -11.568 308.240 1.00 91.11  ? 43  HIS A C     1 
ATOM   288   O  O     . HIS A 1 43  ? 86.512  -12.187 307.799 1.00 91.63  ? 43  HIS A O     1 
ATOM   289   C  CB    . HIS A 1 43  ? 85.144  -11.494 310.707 1.00 101.42 ? 43  HIS A CB    1 
ATOM   290   C  CG    . HIS A 1 43  ? 85.047  -10.679 311.958 1.00 97.90  ? 43  HIS A CG    1 
ATOM   291   N  ND1   . HIS A 1 43  ? 86.140  -10.075 312.541 1.00 102.90 ? 43  HIS A ND1   1 
ATOM   292   C  CD2   . HIS A 1 43  ? 83.986  -10.375 312.742 1.00 93.45  ? 43  HIS A CD2   1 
ATOM   293   C  CE1   . HIS A 1 43  ? 85.756  -9.431  313.628 1.00 106.15 ? 43  HIS A CE1   1 
ATOM   294   N  NE2   . HIS A 1 43  ? 84.453  -9.598  313.773 1.00 107.58 ? 43  HIS A NE2   1 
ATOM   295   N  N     . ARG A 1 44  ? 84.334  -11.603 307.672 1.00 87.61  ? 44  ARG A N     1 
ATOM   296   C  CA    . ARG A 1 44  ? 84.077  -12.347 306.445 1.00 79.12  ? 44  ARG A CA    1 
ATOM   297   C  C     . ARG A 1 44  ? 84.920  -11.777 305.309 1.00 75.24  ? 44  ARG A C     1 
ATOM   298   O  O     . ARG A 1 44  ? 85.463  -12.520 304.490 1.00 82.08  ? 44  ARG A O     1 
ATOM   299   C  CB    . ARG A 1 44  ? 82.589  -12.291 306.084 1.00 67.01  ? 44  ARG A CB    1 
ATOM   300   C  CG    . ARG A 1 44  ? 82.177  -13.270 304.992 1.00 70.84  ? 44  ARG A CG    1 
ATOM   301   C  CD    . ARG A 1 44  ? 80.701  -13.147 304.637 1.00 75.47  ? 44  ARG A CD    1 
ATOM   302   N  NE    . ARG A 1 44  ? 79.816  -13.428 305.764 1.00 81.96  ? 44  ARG A NE    1 
ATOM   303   C  CZ    . ARG A 1 44  ? 79.141  -12.500 306.434 1.00 89.04  ? 44  ARG A CZ    1 
ATOM   304   N  NH1   . ARG A 1 44  ? 79.244  -11.225 306.088 1.00 96.08  ? 44  ARG A NH1   1 
ATOM   305   N  NH2   . ARG A 1 44  ? 78.360  -12.847 307.449 1.00 82.23  ? 44  ARG A NH2   1 
ATOM   306   N  N     . ARG A 1 45  ? 85.034  -10.453 305.275 1.00 66.39  ? 45  ARG A N     1 
ATOM   307   C  CA    . ARG A 1 45  ? 85.808  -9.780  304.237 1.00 71.82  ? 45  ARG A CA    1 
ATOM   308   C  C     . ARG A 1 45  ? 87.314  -9.932  304.438 1.00 76.76  ? 45  ARG A C     1 
ATOM   309   O  O     . ARG A 1 45  ? 88.079  -9.928  303.475 1.00 85.20  ? 45  ARG A O     1 
ATOM   310   C  CB    . ARG A 1 45  ? 85.418  -8.303  304.147 1.00 70.06  ? 45  ARG A CB    1 
ATOM   311   C  CG    . ARG A 1 45  ? 84.058  -8.086  303.500 1.00 74.72  ? 45  ARG A CG    1 
ATOM   312   C  CD    . ARG A 1 45  ? 83.529  -6.683  303.737 1.00 80.23  ? 45  ARG A CD    1 
ATOM   313   N  NE    . ARG A 1 45  ? 82.171  -6.535  303.221 1.00 87.47  ? 45  ARG A NE    1 
ATOM   314   C  CZ    . ARG A 1 45  ? 81.426  -5.443  303.364 1.00 94.27  ? 45  ARG A CZ    1 
ATOM   315   N  NH1   . ARG A 1 45  ? 81.904  -4.390  304.012 1.00 98.88  ? 45  ARG A NH1   1 
ATOM   316   N  NH2   . ARG A 1 45  ? 80.200  -5.405  302.861 1.00 94.07  ? 45  ARG A NH2   1 
ATOM   317   N  N     . ILE A 1 46  ? 87.742  -10.061 305.690 1.00 77.49  ? 46  ILE A N     1 
ATOM   318   C  CA    . ILE A 1 46  ? 89.152  -10.302 305.973 1.00 85.96  ? 46  ILE A CA    1 
ATOM   319   C  C     . ILE A 1 46  ? 89.521  -11.726 305.565 1.00 92.77  ? 46  ILE A C     1 
ATOM   320   O  O     . ILE A 1 46  ? 90.574  -11.955 304.968 1.00 98.00  ? 46  ILE A O     1 
ATOM   321   C  CB    . ILE A 1 46  ? 89.498  -10.055 307.458 1.00 82.24  ? 46  ILE A CB    1 
ATOM   322   C  CG1   . ILE A 1 46  ? 89.414  -8.562  307.777 1.00 81.72  ? 46  ILE A CG1   1 
ATOM   323   C  CG2   . ILE A 1 46  ? 90.896  -10.562 307.780 1.00 80.44  ? 46  ILE A CG2   1 
ATOM   324   C  CD1   . ILE A 1 46  ? 89.717  -8.225  309.221 1.00 79.09  ? 46  ILE A CD1   1 
ATOM   325   N  N     . LEU A 1 47  ? 88.645  -12.678 305.874 1.00 89.25  ? 47  LEU A N     1 
ATOM   326   C  CA    . LEU A 1 47  ? 88.874  -14.070 305.493 1.00 90.60  ? 47  LEU A CA    1 
ATOM   327   C  C     . LEU A 1 47  ? 88.851  -14.280 303.980 1.00 97.20  ? 47  LEU A C     1 
ATOM   328   O  O     . LEU A 1 47  ? 89.759  -14.898 303.419 1.00 94.74  ? 47  LEU A O     1 
ATOM   329   C  CB    . LEU A 1 47  ? 87.862  -14.994 306.170 1.00 90.39  ? 47  LEU A CB    1 
ATOM   330   C  CG    . LEU A 1 47  ? 88.162  -15.357 307.625 1.00 88.87  ? 47  LEU A CG    1 
ATOM   331   C  CD1   . LEU A 1 47  ? 87.069  -16.247 308.194 1.00 84.95  ? 47  LEU A CD1   1 
ATOM   332   C  CD2   . LEU A 1 47  ? 89.522  -16.033 307.733 1.00 87.29  ? 47  LEU A CD2   1 
ATOM   333   N  N     . TYR A 1 48  ? 87.811  -13.772 303.324 1.00 96.89  ? 48  TYR A N     1 
ATOM   334   C  CA    . TYR A 1 48  ? 87.703  -13.898 301.872 1.00 84.41  ? 48  TYR A CA    1 
ATOM   335   C  C     . TYR A 1 48  ? 88.828  -13.141 301.176 1.00 89.27  ? 48  TYR A C     1 
ATOM   336   O  O     . TYR A 1 48  ? 89.393  -13.614 300.192 1.00 96.16  ? 48  TYR A O     1 
ATOM   337   C  CB    . TYR A 1 48  ? 86.345  -13.400 301.381 1.00 76.79  ? 48  TYR A CB    1 
ATOM   338   C  CG    . TYR A 1 48  ? 86.212  -13.402 299.875 1.00 92.35  ? 48  TYR A CG    1 
ATOM   339   C  CD1   . TYR A 1 48  ? 86.149  -12.212 299.160 1.00 97.79  ? 48  TYR A CD1   1 
ATOM   340   C  CD2   . TYR A 1 48  ? 86.168  -14.594 299.166 1.00 108.98 ? 48  TYR A CD2   1 
ATOM   341   C  CE1   . TYR A 1 48  ? 86.032  -12.214 297.780 1.00 109.01 ? 48  TYR A CE1   1 
ATOM   342   C  CE2   . TYR A 1 48  ? 86.053  -14.605 297.791 1.00 111.69 ? 48  TYR A CE2   1 
ATOM   343   C  CZ    . TYR A 1 48  ? 85.985  -13.414 297.102 1.00 108.92 ? 48  TYR A CZ    1 
ATOM   344   O  OH    . TYR A 1 48  ? 85.869  -13.427 295.731 1.00 105.14 ? 48  TYR A OH    1 
ATOM   345   N  N     . GLY A 1 49  ? 89.144  -11.961 301.698 1.00 88.36  ? 49  GLY A N     1 
ATOM   346   C  CA    . GLY A 1 49  ? 90.232  -11.158 301.174 1.00 85.75  ? 49  GLY A CA    1 
ATOM   347   C  C     . GLY A 1 49  ? 91.556  -11.888 301.279 1.00 87.63  ? 49  GLY A C     1 
ATOM   348   O  O     . GLY A 1 49  ? 92.384  -11.828 300.370 1.00 88.33  ? 49  GLY A O     1 
ATOM   349   N  N     . MET A 1 50  ? 91.752  -12.582 302.395 1.00 85.63  ? 50  MET A N     1 
ATOM   350   C  CA    . MET A 1 50  ? 92.952  -13.383 302.597 1.00 90.71  ? 50  MET A CA    1 
ATOM   351   C  C     . MET A 1 50  ? 92.970  -14.572 301.648 1.00 89.56  ? 50  MET A C     1 
ATOM   352   O  O     . MET A 1 50  ? 94.030  -14.989 301.183 1.00 91.47  ? 50  MET A O     1 
ATOM   353   C  CB    . MET A 1 50  ? 93.044  -13.865 304.046 1.00 94.36  ? 50  MET A CB    1 
ATOM   354   C  CG    . MET A 1 50  ? 93.696  -12.872 304.993 1.00 83.78  ? 50  MET A CG    1 
ATOM   355   S  SD    . MET A 1 50  ? 93.789  -13.491 306.685 1.00 99.54  ? 50  MET A SD    1 
ATOM   356   C  CE    . MET A 1 50  ? 94.855  -12.260 307.428 1.00 131.35 ? 50  MET A CE    1 
ATOM   357   N  N     . ASN A 1 51  ? 91.794  -15.120 301.361 1.00 82.32  ? 51  ASN A N     1 
ATOM   358   C  CA    . ASN A 1 51  ? 91.697  -16.241 300.433 1.00 82.20  ? 51  ASN A CA    1 
ATOM   359   C  C     . ASN A 1 51  ? 92.100  -15.823 299.025 1.00 83.14  ? 51  ASN A C     1 
ATOM   360   O  O     . ASN A 1 51  ? 92.898  -16.490 298.369 1.00 83.13  ? 51  ASN A O     1 
ATOM   361   C  CB    . ASN A 1 51  ? 90.283  -16.819 300.424 1.00 85.24  ? 51  ASN A CB    1 
ATOM   362   C  CG    . ASN A 1 51  ? 90.213  -18.174 299.747 1.00 91.25  ? 51  ASN A CG    1 
ATOM   363   O  OD1   . ASN A 1 51  ? 91.101  -19.009 299.914 1.00 82.44  ? 51  ASN A OD1   1 
ATOM   364   N  ND2   . ASN A 1 51  ? 89.162  -18.395 298.970 1.00 103.80 ? 51  ASN A ND2   1 
ATOM   365   N  N     . GLU A 1 52  ? 91.546  -14.706 298.568 1.00 89.31  ? 52  GLU A N     1 
ATOM   366   C  CA    . GLU A 1 52  ? 91.876  -14.173 297.252 1.00 90.60  ? 52  GLU A CA    1 
ATOM   367   C  C     . GLU A 1 52  ? 93.320  -13.687 297.186 1.00 100.61 ? 52  GLU A C     1 
ATOM   368   O  O     . GLU A 1 52  ? 93.920  -13.639 296.112 1.00 117.74 ? 52  GLU A O     1 
ATOM   369   C  CB    . GLU A 1 52  ? 90.923  -13.039 296.878 1.00 93.33  ? 52  GLU A CB    1 
ATOM   370   C  CG    . GLU A 1 52  ? 89.467  -13.462 296.813 1.00 103.22 ? 52  GLU A CG    1 
ATOM   371   C  CD    . GLU A 1 52  ? 89.219  -14.539 295.775 1.00 120.81 ? 52  GLU A CD    1 
ATOM   372   O  OE1   . GLU A 1 52  ? 89.626  -14.350 294.609 1.00 129.38 ? 52  GLU A OE1   1 
ATOM   373   O  OE2   . GLU A 1 52  ? 88.620  -15.576 296.127 1.00 125.96 ? 52  GLU A OE2   1 
ATOM   374   N  N     . LEU A 1 53  ? 93.872  -13.325 298.338 1.00 88.80  ? 53  LEU A N     1 
ATOM   375   C  CA    . LEU A 1 53  ? 95.259  -12.893 298.417 1.00 85.77  ? 53  LEU A CA    1 
ATOM   376   C  C     . LEU A 1 53  ? 96.185  -14.088 298.268 1.00 90.54  ? 53  LEU A C     1 
ATOM   377   O  O     . LEU A 1 53  ? 97.348  -13.944 297.900 1.00 91.23  ? 53  LEU A O     1 
ATOM   378   C  CB    . LEU A 1 53  ? 95.531  -12.210 299.755 1.00 87.79  ? 53  LEU A CB    1 
ATOM   379   C  CG    . LEU A 1 53  ? 96.156  -10.817 299.698 1.00 93.20  ? 53  LEU A CG    1 
ATOM   380   C  CD1   . LEU A 1 53  ? 97.282  -10.766 298.676 1.00 85.97  ? 53  LEU A CD1   1 
ATOM   381   C  CD2   . LEU A 1 53  ? 95.092  -9.799  299.373 1.00 106.25 ? 53  LEU A CD2   1 
ATOM   382   N  N     . GLY A 1 54  ? 95.663  -15.271 298.567 1.00 90.73  ? 54  GLY A N     1 
ATOM   383   C  CA    . GLY A 1 54  ? 96.448  -16.484 298.487 1.00 99.16  ? 54  GLY A CA    1 
ATOM   384   C  C     . GLY A 1 54  ? 97.317  -16.698 299.711 1.00 111.26 ? 54  GLY A C     1 
ATOM   385   O  O     . GLY A 1 54  ? 98.294  -17.440 299.657 1.00 124.11 ? 54  GLY A O     1 
ATOM   386   N  N     . VAL A 1 55  ? 96.971  -16.040 300.814 1.00 104.76 ? 55  VAL A N     1 
ATOM   387   C  CA    . VAL A 1 55  ? 97.658  -16.284 302.080 1.00 101.86 ? 55  VAL A CA    1 
ATOM   388   C  C     . VAL A 1 55  ? 96.974  -17.411 302.852 1.00 107.02 ? 55  VAL A C     1 
ATOM   389   O  O     . VAL A 1 55  ? 96.595  -17.254 304.013 1.00 109.58 ? 55  VAL A O     1 
ATOM   390   C  CB    . VAL A 1 55  ? 97.773  -15.013 302.952 1.00 98.06  ? 55  VAL A CB    1 
ATOM   391   C  CG1   . VAL A 1 55  ? 99.035  -14.249 302.599 1.00 102.02 ? 55  VAL A CG1   1 
ATOM   392   C  CG2   . VAL A 1 55  ? 96.547  -14.134 302.791 1.00 97.53  ? 55  VAL A CG2   1 
ATOM   393   N  N     . THR A 1 56  ? 96.818  -18.546 302.178 1.00 106.27 ? 56  THR A N     1 
ATOM   394   C  CA    . THR A 1 56  ? 96.275  -19.756 302.777 1.00 104.03 ? 56  THR A CA    1 
ATOM   395   C  C     . THR A 1 56  ? 97.340  -20.372 303.687 1.00 102.81 ? 56  THR A C     1 
ATOM   396   O  O     . THR A 1 56  ? 98.506  -19.991 303.598 1.00 95.98  ? 56  THR A O     1 
ATOM   397   C  CB    . THR A 1 56  ? 95.863  -20.758 301.679 1.00 105.54 ? 56  THR A CB    1 
ATOM   398   O  OG1   . THR A 1 56  ? 97.030  -21.231 300.996 1.00 103.70 ? 56  THR A OG1   1 
ATOM   399   C  CG2   . THR A 1 56  ? 94.925  -20.096 300.680 1.00 115.29 ? 56  THR A CG2   1 
ATOM   400   N  N     . PRO A 1 57  ? 96.943  -21.304 304.580 1.00 100.41 ? 57  PRO A N     1 
ATOM   401   C  CA    . PRO A 1 57  ? 97.878  -21.982 305.486 1.00 98.56  ? 57  PRO A CA    1 
ATOM   402   C  C     . PRO A 1 57  ? 99.201  -22.411 304.849 1.00 109.09 ? 57  PRO A C     1 
ATOM   403   O  O     . PRO A 1 57  ? 100.257 -22.177 305.438 1.00 110.65 ? 57  PRO A O     1 
ATOM   404   C  CB    . PRO A 1 57  ? 97.085  -23.212 305.920 1.00 99.39  ? 57  PRO A CB    1 
ATOM   405   C  CG    . PRO A 1 57  ? 95.691  -22.726 305.966 1.00 98.25  ? 57  PRO A CG    1 
ATOM   406   C  CD    . PRO A 1 57  ? 95.548  -21.671 304.893 1.00 93.87  ? 57  PRO A CD    1 
ATOM   407   N  N     . ASP A 1 58  ? 99.140  -23.022 303.670 1.00 116.26 ? 58  ASP A N     1 
ATOM   408   C  CA    . ASP A 1 58  ? 100.344 -23.505 302.995 1.00 117.88 ? 58  ASP A CA    1 
ATOM   409   C  C     . ASP A 1 58  ? 101.262 -22.369 302.549 1.00 124.02 ? 58  ASP A C     1 
ATOM   410   O  O     . ASP A 1 58  ? 102.452 -22.365 302.865 1.00 131.61 ? 58  ASP A O     1 
ATOM   411   C  CB    . ASP A 1 58  ? 99.976  -24.391 301.802 1.00 118.18 ? 58  ASP A CB    1 
ATOM   412   C  CG    . ASP A 1 58  ? 98.837  -23.822 300.982 1.00 124.19 ? 58  ASP A CG    1 
ATOM   413   O  OD1   . ASP A 1 58  ? 97.890  -23.272 301.581 1.00 116.50 ? 58  ASP A OD1   1 
ATOM   414   O  OD2   . ASP A 1 58  ? 98.886  -23.925 299.737 1.00 132.18 ? 58  ASP A OD2   1 
ATOM   415   N  N     . LYS A 1 59  ? 100.704 -21.412 301.813 1.00 123.14 ? 59  LYS A N     1 
ATOM   416   C  CA    . LYS A 1 59  ? 101.466 -20.266 301.321 1.00 116.81 ? 59  LYS A CA    1 
ATOM   417   C  C     . LYS A 1 59  ? 101.955 -19.382 302.470 1.00 113.78 ? 59  LYS A C     1 
ATOM   418   O  O     . LYS A 1 59  ? 101.288 -19.275 303.499 1.00 108.48 ? 59  LYS A O     1 
ATOM   419   C  CB    . LYS A 1 59  ? 100.617 -19.453 300.341 1.00 108.80 ? 59  LYS A CB    1 
ATOM   420   N  N     . PRO A 1 60  ? 103.128 -18.746 302.298 1.00 115.07 ? 60  PRO A N     1 
ATOM   421   C  CA    . PRO A 1 60  ? 103.744 -17.936 303.356 1.00 117.53 ? 60  PRO A CA    1 
ATOM   422   C  C     . PRO A 1 60  ? 102.931 -16.700 303.736 1.00 119.02 ? 60  PRO A C     1 
ATOM   423   O  O     . PRO A 1 60  ? 101.943 -16.375 303.075 1.00 120.07 ? 60  PRO A O     1 
ATOM   424   C  CB    . PRO A 1 60  ? 105.084 -17.514 302.740 1.00 114.61 ? 60  PRO A CB    1 
ATOM   425   C  CG    . PRO A 1 60  ? 104.870 -17.595 301.273 1.00 109.39 ? 60  PRO A CG    1 
ATOM   426   C  CD    . PRO A 1 60  ? 103.949 -18.761 301.074 1.00 113.90 ? 60  PRO A CD    1 
ATOM   427   N  N     . HIS A 1 61  ? 103.358 -16.022 304.799 1.00 113.72 ? 61  HIS A N     1 
ATOM   428   C  CA    . HIS A 1 61  ? 102.672 -14.832 305.290 1.00 110.39 ? 61  HIS A CA    1 
ATOM   429   C  C     . HIS A 1 61  ? 102.845 -13.652 304.342 1.00 112.51 ? 61  HIS A C     1 
ATOM   430   O  O     . HIS A 1 61  ? 103.756 -13.633 303.511 1.00 121.73 ? 61  HIS A O     1 
ATOM   431   C  CB    . HIS A 1 61  ? 103.197 -14.441 306.674 1.00 117.60 ? 61  HIS A CB    1 
ATOM   432   C  CG    . HIS A 1 61  ? 102.980 -15.483 307.726 1.00 120.81 ? 61  HIS A CG    1 
ATOM   433   N  ND1   . HIS A 1 61  ? 101.804 -15.592 308.435 1.00 119.63 ? 61  HIS A ND1   1 
ATOM   434   C  CD2   . HIS A 1 61  ? 103.796 -16.456 308.198 1.00 119.96 ? 61  HIS A CD2   1 
ATOM   435   C  CE1   . HIS A 1 61  ? 101.901 -16.591 309.294 1.00 121.00 ? 61  HIS A CE1   1 
ATOM   436   N  NE2   . HIS A 1 61  ? 103.100 -17.133 309.170 1.00 119.97 ? 61  HIS A NE2   1 
ATOM   437   N  N     . LYS A 1 62  ? 101.963 -12.667 304.476 1.00 108.56 ? 62  LYS A N     1 
ATOM   438   C  CA    . LYS A 1 62  ? 102.103 -11.407 303.763 1.00 103.49 ? 62  LYS A CA    1 
ATOM   439   C  C     . LYS A 1 62  ? 101.888 -10.259 304.739 1.00 97.45  ? 62  LYS A C     1 
ATOM   440   O  O     . LYS A 1 62  ? 101.139 -10.393 305.707 1.00 86.68  ? 62  LYS A O     1 
ATOM   441   C  CB    . LYS A 1 62  ? 101.105 -11.321 302.607 1.00 91.59  ? 62  LYS A CB    1 
ATOM   442   N  N     . LYS A 1 63  ? 102.554 -9.137  304.480 1.00 95.78  ? 63  LYS A N     1 
ATOM   443   C  CA    . LYS A 1 63  ? 102.475 -7.957  305.340 1.00 94.54  ? 63  LYS A CA    1 
ATOM   444   C  C     . LYS A 1 63  ? 101.027 -7.553  305.615 1.00 90.73  ? 63  LYS A C     1 
ATOM   445   O  O     . LYS A 1 63  ? 100.191 -7.553  304.709 1.00 94.58  ? 63  LYS A O     1 
ATOM   446   C  CB    . LYS A 1 63  ? 103.240 -6.789  304.713 1.00 98.68  ? 63  LYS A CB    1 
ATOM   447   C  CG    . LYS A 1 63  ? 104.024 -5.949  305.705 1.00 103.94 ? 63  LYS A CG    1 
ATOM   448   C  CD    . LYS A 1 63  ? 105.348 -6.603  306.063 1.00 107.07 ? 63  LYS A CD    1 
ATOM   449   C  CE    . LYS A 1 63  ? 106.195 -5.691  306.935 1.00 108.47 ? 63  LYS A CE    1 
ATOM   450   N  NZ    . LYS A 1 63  ? 107.567 -6.231  307.139 1.00 112.08 ? 63  LYS A NZ    1 
ATOM   451   N  N     . SER A 1 64  ? 100.746 -7.217  306.871 1.00 94.14  ? 64  SER A N     1 
ATOM   452   C  CA    . SER A 1 64  ? 99.390  -6.907  307.308 1.00 95.23  ? 64  SER A CA    1 
ATOM   453   C  C     . SER A 1 64  ? 98.776  -5.743  306.532 1.00 97.53  ? 64  SER A C     1 
ATOM   454   O  O     . SER A 1 64  ? 97.588  -5.766  306.202 1.00 88.69  ? 64  SER A O     1 
ATOM   455   C  CB    . SER A 1 64  ? 99.372  -6.603  308.809 1.00 76.91  ? 64  SER A CB    1 
ATOM   456   N  N     . ALA A 1 65  ? 99.593  -4.736  306.236 1.00 99.45  ? 65  ALA A N     1 
ATOM   457   C  CA    . ALA A 1 65  ? 99.133  -3.554  305.519 1.00 102.82 ? 65  ALA A CA    1 
ATOM   458   C  C     . ALA A 1 65  ? 98.646  -3.894  304.113 1.00 104.79 ? 65  ALA A C     1 
ATOM   459   O  O     . ALA A 1 65  ? 97.795  -3.200  303.560 1.00 112.75 ? 65  ALA A O     1 
ATOM   460   C  CB    . ALA A 1 65  ? 100.231 -2.512  305.463 1.00 108.22 ? 65  ALA A CB    1 
ATOM   461   N  N     . ARG A 1 66  ? 99.197  -4.957  303.537 1.00 100.64 ? 66  ARG A N     1 
ATOM   462   C  CA    . ARG A 1 66  ? 98.774  -5.412  302.218 1.00 94.37  ? 66  ARG A CA    1 
ATOM   463   C  C     . ARG A 1 66  ? 97.392  -6.051  302.290 1.00 97.69  ? 66  ARG A C     1 
ATOM   464   O  O     . ARG A 1 66  ? 96.510  -5.753  301.478 1.00 106.91 ? 66  ARG A O     1 
ATOM   465   C  CB    . ARG A 1 66  ? 99.789  -6.400  301.635 1.00 89.51  ? 66  ARG A CB    1 
ATOM   466   C  CG    . ARG A 1 66  ? 100.577 -5.854  300.456 1.00 102.86 ? 66  ARG A CG    1 
ATOM   467   C  CD    . ARG A 1 66  ? 100.066 -6.408  299.135 1.00 109.43 ? 66  ARG A CD    1 
ATOM   468   N  NE    . ARG A 1 66  ? 100.840 -7.566  298.693 1.00 116.62 ? 66  ARG A NE    1 
ATOM   469   C  CZ    . ARG A 1 66  ? 100.517 -8.331  297.654 1.00 126.47 ? 66  ARG A CZ    1 
ATOM   470   N  NH1   . ARG A 1 66  ? 99.425  -8.069  296.948 1.00 129.15 ? 66  ARG A NH1   1 
ATOM   471   N  NH2   . ARG A 1 66  ? 101.283 -9.363  297.325 1.00 133.57 ? 66  ARG A NH2   1 
ATOM   472   N  N     . ILE A 1 67  ? 97.216  -6.924  303.276 1.00 99.85  ? 67  ILE A N     1 
ATOM   473   C  CA    . ILE A 1 67  ? 95.946  -7.594  303.511 1.00 96.18  ? 67  ILE A CA    1 
ATOM   474   C  C     . ILE A 1 67  ? 94.842  -6.577  303.789 1.00 92.55  ? 67  ILE A C     1 
ATOM   475   O  O     . ILE A 1 67  ? 93.767  -6.637  303.192 1.00 99.21  ? 67  ILE A O     1 
ATOM   476   C  CB    . ILE A 1 67  ? 96.054  -8.567  304.696 1.00 88.10  ? 67  ILE A CB    1 
ATOM   477   C  CG1   . ILE A 1 67  ? 97.231  -9.523  304.486 1.00 90.82  ? 67  ILE A CG1   1 
ATOM   478   C  CG2   . ILE A 1 67  ? 94.757  -9.341  304.865 1.00 77.83  ? 67  ILE A CG2   1 
ATOM   479   C  CD1   . ILE A 1 67  ? 97.747  -10.158 305.758 1.00 91.73  ? 67  ILE A CD1   1 
ATOM   480   N  N     . THR A 1 68  ? 95.122  -5.635  304.685 1.00 88.80  ? 68  THR A N     1 
ATOM   481   C  CA    . THR A 1 68  ? 94.152  -4.603  305.042 1.00 95.25  ? 68  THR A CA    1 
ATOM   482   C  C     . THR A 1 68  ? 93.906  -3.642  303.882 1.00 103.58 ? 68  THR A C     1 
ATOM   483   O  O     . THR A 1 68  ? 92.798  -3.130  303.715 1.00 104.27 ? 68  THR A O     1 
ATOM   484   C  CB    . THR A 1 68  ? 94.606  -3.795  306.269 1.00 97.33  ? 68  THR A CB    1 
ATOM   485   O  OG1   . THR A 1 68  ? 95.840  -3.129  305.974 1.00 108.56 ? 68  THR A OG1   1 
ATOM   486   C  CG2   . THR A 1 68  ? 94.794  -4.701  307.475 1.00 94.21  ? 68  THR A CG2   1 
ATOM   487   N  N     . GLY A 1 69  ? 94.946  -3.394  303.091 1.00 107.75 ? 69  GLY A N     1 
ATOM   488   C  CA    . GLY A 1 69  ? 94.822  -2.546  301.919 1.00 109.99 ? 69  GLY A CA    1 
ATOM   489   C  C     . GLY A 1 69  ? 93.885  -3.156  300.896 1.00 105.85 ? 69  GLY A C     1 
ATOM   490   O  O     . GLY A 1 69  ? 93.041  -2.467  300.316 1.00 104.91 ? 69  GLY A O     1 
ATOM   491   N  N     . ASP A 1 70  ? 94.028  -4.460  300.685 1.00 95.78  ? 70  ASP A N     1 
ATOM   492   C  CA    . ASP A 1 70  ? 93.170  -5.177  299.754 1.00 91.97  ? 70  ASP A CA    1 
ATOM   493   C  C     . ASP A 1 70  ? 91.739  -5.313  300.270 1.00 96.00  ? 70  ASP A C     1 
ATOM   494   O  O     . ASP A 1 70  ? 90.784  -5.133  299.517 1.00 106.21 ? 70  ASP A O     1 
ATOM   495   C  CB    . ASP A 1 70  ? 93.745  -6.557  299.448 1.00 100.77 ? 70  ASP A CB    1 
ATOM   496   C  CG    . ASP A 1 70  ? 94.614  -6.564  298.210 1.00 114.44 ? 70  ASP A CG    1 
ATOM   497   O  OD1   . ASP A 1 70  ? 94.372  -7.414  297.328 1.00 122.13 ? 70  ASP A OD1   1 
ATOM   498   O  OD2   . ASP A 1 70  ? 95.539  -5.729  298.118 1.00 117.23 ? 70  ASP A OD2   1 
ATOM   499   N  N     . VAL A 1 71  ? 91.596  -5.643  301.550 1.00 89.52  ? 71  VAL A N     1 
ATOM   500   C  CA    . VAL A 1 71  ? 90.278  -5.773  302.165 1.00 85.68  ? 71  VAL A CA    1 
ATOM   501   C  C     . VAL A 1 71  ? 89.526  -4.450  302.093 1.00 87.61  ? 71  VAL A C     1 
ATOM   502   O  O     . VAL A 1 71  ? 88.345  -4.412  301.742 1.00 92.06  ? 71  VAL A O     1 
ATOM   503   C  CB    . VAL A 1 71  ? 90.371  -6.248  303.634 1.00 84.29  ? 71  VAL A CB    1 
ATOM   504   C  CG1   . VAL A 1 71  ? 89.029  -6.094  304.336 1.00 76.14  ? 71  VAL A CG1   1 
ATOM   505   C  CG2   . VAL A 1 71  ? 90.836  -7.693  303.696 1.00 87.96  ? 71  VAL A CG2   1 
ATOM   506   N  N     . MET A 1 72  ? 90.221  -3.364  302.414 1.00 78.87  ? 72  MET A N     1 
ATOM   507   C  CA    . MET A 1 72  ? 89.635  -2.033  302.329 1.00 84.44  ? 72  MET A CA    1 
ATOM   508   C  C     . MET A 1 72  ? 89.268  -1.664  300.895 1.00 95.59  ? 72  MET A C     1 
ATOM   509   O  O     . MET A 1 72  ? 88.136  -1.261  300.621 1.00 101.72 ? 72  MET A O     1 
ATOM   510   C  CB    . MET A 1 72  ? 90.590  -0.986  302.906 1.00 88.27  ? 72  MET A CB    1 
ATOM   511   C  CG    . MET A 1 72  ? 90.491  0.375   302.237 1.00 92.59  ? 72  MET A CG    1 
ATOM   512   S  SD    . MET A 1 72  ? 90.054  1.711   303.359 1.00 188.80 ? 72  MET A SD    1 
ATOM   513   C  CE    . MET A 1 72  ? 91.492  1.756   304.425 1.00 73.02  ? 72  MET A CE    1 
ATOM   514   N  N     . GLY A 1 73  ? 90.228  -1.804  299.984 1.00 99.18  ? 73  GLY A N     1 
ATOM   515   C  CA    . GLY A 1 73  ? 90.040  -1.371  298.611 1.00 101.20 ? 73  GLY A CA    1 
ATOM   516   C  C     . GLY A 1 73  ? 88.978  -2.149  297.860 1.00 100.91 ? 73  GLY A C     1 
ATOM   517   O  O     . GLY A 1 73  ? 88.249  -1.589  297.044 1.00 114.87 ? 73  GLY A O     1 
ATOM   518   N  N     . LYS A 1 74  ? 88.881  -3.442  298.147 1.00 88.62  ? 74  LYS A N     1 
ATOM   519   C  CA    . LYS A 1 74  ? 87.993  -4.318  297.396 1.00 91.96  ? 74  LYS A CA    1 
ATOM   520   C  C     . LYS A 1 74  ? 86.653  -4.586  298.073 1.00 101.63 ? 74  LYS A C     1 
ATOM   521   O  O     . LYS A 1 74  ? 85.622  -4.635  297.403 1.00 112.94 ? 74  LYS A O     1 
ATOM   522   C  CB    . LYS A 1 74  ? 88.690  -5.643  297.072 1.00 89.20  ? 74  LYS A CB    1 
ATOM   523   C  CG    . LYS A 1 74  ? 89.881  -5.499  296.137 1.00 96.90  ? 74  LYS A CG    1 
ATOM   524   C  CD    . LYS A 1 74  ? 90.158  -6.789  295.378 1.00 98.27  ? 74  LYS A CD    1 
ATOM   525   C  CE    . LYS A 1 74  ? 90.781  -7.848  296.268 1.00 111.50 ? 74  LYS A CE    1 
ATOM   526   N  NZ    . LYS A 1 74  ? 91.042  -9.103  295.511 1.00 118.62 ? 74  LYS A NZ    1 
ATOM   527   N  N     . TYR A 1 75  ? 86.659  -4.758  299.391 1.00 100.88 ? 75  TYR A N     1 
ATOM   528   C  CA    . TYR A 1 75  ? 85.463  -5.255  300.070 1.00 99.19  ? 75  TYR A CA    1 
ATOM   529   C  C     . TYR A 1 75  ? 84.925  -4.379  301.205 1.00 109.02 ? 75  TYR A C     1 
ATOM   530   O  O     . TYR A 1 75  ? 83.733  -4.075  301.239 1.00 118.27 ? 75  TYR A O     1 
ATOM   531   C  CB    . TYR A 1 75  ? 85.699  -6.677  300.579 1.00 92.02  ? 75  TYR A CB    1 
ATOM   532   C  CG    . TYR A 1 75  ? 86.423  -7.560  299.589 1.00 94.22  ? 75  TYR A CG    1 
ATOM   533   C  CD1   . TYR A 1 75  ? 87.747  -7.928  299.797 1.00 97.11  ? 75  TYR A CD1   1 
ATOM   534   C  CD2   . TYR A 1 75  ? 85.789  -8.017  298.442 1.00 87.42  ? 75  TYR A CD2   1 
ATOM   535   C  CE1   . TYR A 1 75  ? 88.415  -8.731  298.894 1.00 92.88  ? 75  TYR A CE1   1 
ATOM   536   C  CE2   . TYR A 1 75  ? 86.450  -8.821  297.532 1.00 87.63  ? 75  TYR A CE2   1 
ATOM   537   C  CZ    . TYR A 1 75  ? 87.763  -9.175  297.763 1.00 90.83  ? 75  TYR A CZ    1 
ATOM   538   O  OH    . TYR A 1 75  ? 88.424  -9.978  296.861 1.00 96.53  ? 75  TYR A OH    1 
ATOM   539   N  N     . HIS A 1 76  ? 85.792  -3.982  302.132 1.00 104.01 ? 76  HIS A N     1 
ATOM   540   C  CA    . HIS A 1 76  ? 85.345  -3.292  303.342 1.00 94.49  ? 76  HIS A CA    1 
ATOM   541   C  C     . HIS A 1 76  ? 85.606  -1.785  303.296 1.00 93.47  ? 76  HIS A C     1 
ATOM   542   O  O     . HIS A 1 76  ? 86.735  -1.339  303.498 1.00 97.07  ? 76  HIS A O     1 
ATOM   543   C  CB    . HIS A 1 76  ? 86.011  -3.908  304.577 1.00 94.76  ? 76  HIS A CB    1 
ATOM   544   C  CG    . HIS A 1 76  ? 85.301  -3.604  305.861 1.00 92.08  ? 76  HIS A CG    1 
ATOM   545   N  ND1   . HIS A 1 76  ? 83.998  -3.978  306.094 1.00 83.83  ? 76  HIS A ND1   1 
ATOM   546   C  CD2   . HIS A 1 76  ? 85.721  -2.970  306.982 1.00 90.39  ? 76  HIS A CD2   1 
ATOM   547   C  CE1   . HIS A 1 76  ? 83.639  -3.583  307.305 1.00 86.24  ? 76  HIS A CE1   1 
ATOM   548   N  NE2   . HIS A 1 76  ? 84.665  -2.971  307.863 1.00 93.83  ? 76  HIS A NE2   1 
ATOM   549   N  N     . PRO A 1 77  ? 84.551  -0.995  303.043 1.00 87.90  ? 77  PRO A N     1 
ATOM   550   C  CA    . PRO A 1 77  ? 84.663  0.454   302.846 1.00 85.03  ? 77  PRO A CA    1 
ATOM   551   C  C     . PRO A 1 77  ? 84.686  1.244   304.153 1.00 85.17  ? 77  PRO A C     1 
ATOM   552   O  O     . PRO A 1 77  ? 83.824  2.099   304.364 1.00 86.98  ? 77  PRO A O     1 
ATOM   553   C  CB    . PRO A 1 77  ? 83.389  0.782   302.070 1.00 79.89  ? 77  PRO A CB    1 
ATOM   554   C  CG    . PRO A 1 77  ? 82.393  -0.198  302.586 1.00 82.89  ? 77  PRO A CG    1 
ATOM   555   C  CD    . PRO A 1 77  ? 83.160  -1.461  302.901 1.00 82.03  ? 77  PRO A CD    1 
ATOM   556   N  N     . HIS A 1 78  ? 85.660  0.967   305.016 1.00 83.78  ? 78  HIS A N     1 
ATOM   557   C  CA    . HIS A 1 78  ? 85.801  1.708   306.266 1.00 85.19  ? 78  HIS A CA    1 
ATOM   558   C  C     . HIS A 1 78  ? 87.268  1.939   306.613 1.00 90.40  ? 78  HIS A C     1 
ATOM   559   O  O     . HIS A 1 78  ? 88.137  1.856   305.749 1.00 96.37  ? 78  HIS A O     1 
ATOM   560   C  CB    . HIS A 1 78  ? 85.090  0.988   307.412 1.00 74.23  ? 78  HIS A CB    1 
ATOM   561   C  CG    . HIS A 1 78  ? 83.635  0.744   307.157 1.00 73.21  ? 78  HIS A CG    1 
ATOM   562   N  ND1   . HIS A 1 78  ? 83.153  -0.462  306.699 1.00 84.83  ? 78  HIS A ND1   1 
ATOM   563   C  CD2   . HIS A 1 78  ? 82.559  1.558   307.279 1.00 74.99  ? 78  HIS A CD2   1 
ATOM   564   C  CE1   . HIS A 1 78  ? 81.841  -0.385  306.558 1.00 91.90  ? 78  HIS A CE1   1 
ATOM   565   N  NE2   . HIS A 1 78  ? 81.456  0.830   306.903 1.00 89.00  ? 78  HIS A NE2   1 
ATOM   566   N  N     . GLY A 1 79  ? 87.535  2.229   307.881 1.00 86.95  ? 79  GLY A N     1 
ATOM   567   C  CA    . GLY A 1 79  ? 88.882  2.537   308.321 1.00 98.71  ? 79  GLY A CA    1 
ATOM   568   C  C     . GLY A 1 79  ? 89.840  1.365   308.235 1.00 113.51 ? 79  GLY A C     1 
ATOM   569   O  O     . GLY A 1 79  ? 89.456  0.213   308.440 1.00 114.17 ? 79  GLY A O     1 
ATOM   570   N  N     . ASP A 1 80  ? 91.095  1.673   307.924 1.00 126.71 ? 80  ASP A N     1 
ATOM   571   C  CA    . ASP A 1 80  ? 92.164  0.685   307.893 1.00 132.24 ? 80  ASP A CA    1 
ATOM   572   C  C     . ASP A 1 80  ? 92.330  0.114   309.296 1.00 126.83 ? 80  ASP A C     1 
ATOM   573   O  O     . ASP A 1 80  ? 92.552  -1.090  309.483 1.00 131.56 ? 80  ASP A O     1 
ATOM   574   C  CB    . ASP A 1 80  ? 93.464  1.359   307.449 1.00 138.54 ? 80  ASP A CB    1 
ATOM   575   C  CG    . ASP A 1 80  ? 94.374  0.425   306.682 1.00 142.84 ? 80  ASP A CG    1 
ATOM   576   O  OD1   . ASP A 1 80  ? 94.387  -0.781  306.998 1.00 139.57 ? 80  ASP A OD1   1 
ATOM   577   O  OD2   . ASP A 1 80  ? 95.075  0.897   305.762 1.00 147.35 ? 80  ASP A OD2   1 
ATOM   578   N  N     . SER A 1 81  ? 92.202  1.002   310.278 1.00 114.36 ? 81  SER A N     1 
ATOM   579   C  CA    . SER A 1 81  ? 92.342  0.656   311.685 1.00 101.69 ? 81  SER A CA    1 
ATOM   580   C  C     . SER A 1 81  ? 91.342  -0.403  312.127 1.00 98.18  ? 81  SER A C     1 
ATOM   581   O  O     . SER A 1 81  ? 91.696  -1.325  312.851 1.00 104.72 ? 81  SER A O     1 
ATOM   582   C  CB    . SER A 1 81  ? 92.183  1.907   312.551 1.00 96.01  ? 81  SER A CB    1 
ATOM   583   N  N     . SER A 1 82  ? 90.094  -0.261  311.696 1.00 95.34  ? 82  SER A N     1 
ATOM   584   C  CA    . SER A 1 82  ? 89.040  -1.198  312.074 1.00 99.33  ? 82  SER A CA    1 
ATOM   585   C  C     . SER A 1 82  ? 89.347  -2.599  311.560 1.00 105.68 ? 82  SER A C     1 
ATOM   586   O  O     . SER A 1 82  ? 89.246  -3.584  312.296 1.00 110.77 ? 82  SER A O     1 
ATOM   587   C  CB    . SER A 1 82  ? 87.686  -0.726  311.537 1.00 100.10 ? 82  SER A CB    1 
ATOM   588   N  N     . ILE A 1 83  ? 89.734  -2.673  310.292 1.00 107.99 ? 83  ILE A N     1 
ATOM   589   C  CA    . ILE A 1 83  ? 90.082  -3.937  309.655 1.00 106.35 ? 83  ILE A CA    1 
ATOM   590   C  C     . ILE A 1 83  ? 91.282  -4.592  310.331 1.00 106.33 ? 83  ILE A C     1 
ATOM   591   O  O     . ILE A 1 83  ? 91.219  -5.759  310.730 1.00 112.50 ? 83  ILE A O     1 
ATOM   592   C  CB    . ILE A 1 83  ? 90.392  -3.738  308.163 1.00 91.83  ? 83  ILE A CB    1 
ATOM   593   C  CG1   . ILE A 1 83  ? 89.163  -3.187  307.438 1.00 91.56  ? 83  ILE A CG1   1 
ATOM   594   C  CG2   . ILE A 1 83  ? 90.850  -5.047  307.536 1.00 87.74  ? 83  ILE A CG2   1 
ATOM   595   C  CD1   . ILE A 1 83  ? 89.418  -2.827  305.994 1.00 99.51  ? 83  ILE A CD1   1 
ATOM   596   N  N     . TYR A 1 84  ? 92.373  -3.840  310.461 1.00 92.33  ? 84  TYR A N     1 
ATOM   597   C  CA    . TYR A 1 84  ? 93.580  -4.379  311.083 1.00 87.15  ? 84  TYR A CA    1 
ATOM   598   C  C     . TYR A 1 84  ? 93.322  -4.842  312.515 1.00 90.56  ? 84  TYR A C     1 
ATOM   599   O  O     . TYR A 1 84  ? 93.833  -5.875  312.944 1.00 88.97  ? 84  TYR A O     1 
ATOM   600   C  CB    . TYR A 1 84  ? 94.722  -3.364  311.049 1.00 81.97  ? 84  TYR A CB    1 
ATOM   601   C  CG    . TYR A 1 84  ? 95.995  -3.868  311.695 1.00 92.90  ? 84  TYR A CG    1 
ATOM   602   C  CD1   . TYR A 1 84  ? 96.650  -4.992  311.205 1.00 99.24  ? 84  TYR A CD1   1 
ATOM   603   C  CD2   . TYR A 1 84  ? 96.545  -3.216  312.790 1.00 94.91  ? 84  TYR A CD2   1 
ATOM   604   C  CE1   . TYR A 1 84  ? 97.817  -5.453  311.794 1.00 97.30  ? 84  TYR A CE1   1 
ATOM   605   C  CE2   . TYR A 1 84  ? 97.709  -3.669  313.380 1.00 89.47  ? 84  TYR A CE2   1 
ATOM   606   C  CZ    . TYR A 1 84  ? 98.340  -4.785  312.880 1.00 89.68  ? 84  TYR A CZ    1 
ATOM   607   O  OH    . TYR A 1 84  ? 99.499  -5.236  313.468 1.00 96.34  ? 84  TYR A OH    1 
ATOM   608   N  N     . GLU A 1 85  ? 92.515  -4.075  313.240 1.00 95.83  ? 85  GLU A N     1 
ATOM   609   C  CA    . GLU A 1 85  ? 92.139  -4.422  314.606 1.00 91.57  ? 85  GLU A CA    1 
ATOM   610   C  C     . GLU A 1 85  ? 91.346  -5.719  314.636 1.00 91.33  ? 85  GLU A C     1 
ATOM   611   O  O     . GLU A 1 85  ? 91.588  -6.582  315.480 1.00 99.78  ? 85  GLU A O     1 
ATOM   612   C  CB    . GLU A 1 85  ? 91.318  -3.297  315.247 1.00 75.06  ? 85  GLU A CB    1 
ATOM   613   N  N     . ALA A 1 86  ? 90.399  -5.847  313.712 1.00 78.68  ? 86  ALA A N     1 
ATOM   614   C  CA    . ALA A 1 86  ? 89.578  -7.049  313.620 1.00 86.44  ? 86  ALA A CA    1 
ATOM   615   C  C     . ALA A 1 86  ? 90.448  -8.274  313.365 1.00 90.02  ? 86  ALA A C     1 
ATOM   616   O  O     . ALA A 1 86  ? 90.308  -9.297  314.039 1.00 86.91  ? 86  ALA A O     1 
ATOM   617   C  CB    . ALA A 1 86  ? 88.535  -6.897  312.523 1.00 84.52  ? 86  ALA A CB    1 
ATOM   618   N  N     . MET A 1 87  ? 91.356  -8.153  312.397 1.00 92.84  ? 87  MET A N     1 
ATOM   619   C  CA    . MET A 1 87  ? 92.270  -9.241  312.048 1.00 91.46  ? 87  MET A CA    1 
ATOM   620   C  C     . MET A 1 87  ? 93.148  -9.644  313.230 1.00 94.54  ? 87  MET A C     1 
ATOM   621   O  O     . MET A 1 87  ? 93.238  -10.829 313.584 1.00 103.89 ? 87  MET A O     1 
ATOM   622   C  CB    . MET A 1 87  ? 93.150  -8.840  310.863 1.00 92.81  ? 87  MET A CB    1 
ATOM   623   C  CG    . MET A 1 87  ? 94.096  -9.940  310.397 1.00 95.48  ? 87  MET A CG    1 
ATOM   624   S  SD    . MET A 1 87  ? 95.449  -9.287  309.407 1.00 79.33  ? 87  MET A SD    1 
ATOM   625   C  CE    . MET A 1 87  ? 94.535  -8.223  308.298 1.00 108.88 ? 87  MET A CE    1 
ATOM   626   N  N     . VAL A 1 88  ? 93.796  -8.647  313.831 1.00 95.32  ? 88  VAL A N     1 
ATOM   627   C  CA    . VAL A 1 88  ? 94.627  -8.856  315.013 1.00 92.77  ? 88  VAL A CA    1 
ATOM   628   C  C     . VAL A 1 88  ? 93.844  -9.584  316.100 1.00 88.98  ? 88  VAL A C     1 
ATOM   629   O  O     . VAL A 1 88  ? 94.359  -10.504 316.738 1.00 87.89  ? 88  VAL A O     1 
ATOM   630   C  CB    . VAL A 1 88  ? 95.169  -7.516  315.565 1.00 88.99  ? 88  VAL A CB    1 
ATOM   631   C  CG1   . VAL A 1 88  ? 95.612  -7.670  317.013 1.00 84.29  ? 88  VAL A CG1   1 
ATOM   632   C  CG2   . VAL A 1 88  ? 96.313  -7.007  314.701 1.00 98.64  ? 88  VAL A CG2   1 
ATOM   633   N  N     . ARG A 1 89  ? 92.591  -9.184  316.287 1.00 83.67  ? 89  ARG A N     1 
ATOM   634   C  CA    . ARG A 1 89  ? 91.739  -9.831  317.271 1.00 79.01  ? 89  ARG A CA    1 
ATOM   635   C  C     . ARG A 1 89  ? 91.476  -11.289 316.912 1.00 84.60  ? 89  ARG A C     1 
ATOM   636   O  O     . ARG A 1 89  ? 91.540  -12.164 317.772 1.00 92.17  ? 89  ARG A O     1 
ATOM   637   C  CB    . ARG A 1 89  ? 90.418  -9.080  317.451 1.00 76.51  ? 89  ARG A CB    1 
ATOM   638   C  CG    . ARG A 1 89  ? 89.539  -9.688  318.532 1.00 77.47  ? 89  ARG A CG    1 
ATOM   639   C  CD    . ARG A 1 89  ? 88.298  -8.860  318.806 1.00 86.65  ? 89  ARG A CD    1 
ATOM   640   N  NE    . ARG A 1 89  ? 87.459  -9.498  319.815 1.00 101.48 ? 89  ARG A NE    1 
ATOM   641   C  CZ    . ARG A 1 89  ? 86.472  -10.345 319.537 1.00 123.20 ? 89  ARG A CZ    1 
ATOM   642   N  NH1   . ARG A 1 89  ? 86.197  -10.654 318.277 1.00 134.88 ? 89  ARG A NH1   1 
ATOM   643   N  NH2   . ARG A 1 89  ? 85.759  -10.881 320.518 1.00 124.34 ? 89  ARG A NH2   1 
ATOM   644   N  N     . MET A 1 90  ? 91.200  -11.561 315.640 1.00 95.13  ? 90  MET A N     1 
ATOM   645   C  CA    . MET A 1 90  ? 90.980  -12.946 315.227 1.00 98.73  ? 90  MET A CA    1 
ATOM   646   C  C     . MET A 1 90  ? 92.291  -13.709 315.049 1.00 96.10  ? 90  MET A C     1 
ATOM   647   O  O     . MET A 1 90  ? 92.303  -14.840 314.561 1.00 99.12  ? 90  MET A O     1 
ATOM   648   C  CB    . MET A 1 90  ? 90.068  -13.055 313.993 1.00 87.72  ? 90  MET A CB    1 
ATOM   649   C  CG    . MET A 1 90  ? 90.524  -12.289 312.768 1.00 87.82  ? 90  MET A CG    1 
ATOM   650   S  SD    . MET A 1 90  ? 89.163  -12.035 311.603 1.00 97.00  ? 90  MET A SD    1 
ATOM   651   C  CE    . MET A 1 90  ? 89.660  -13.075 310.232 1.00 134.71 ? 90  MET A CE    1 
ATOM   652   N  N     . ALA A 1 91  ? 93.391  -13.081 315.454 1.00 87.74  ? 91  ALA A N     1 
ATOM   653   C  CA    . ALA A 1 91  ? 94.676  -13.769 315.529 1.00 87.00  ? 91  ALA A CA    1 
ATOM   654   C  C     . ALA A 1 91  ? 95.065  -14.121 316.969 1.00 88.12  ? 91  ALA A C     1 
ATOM   655   O  O     . ALA A 1 91  ? 96.051  -14.822 317.194 1.00 81.18  ? 91  ALA A O     1 
ATOM   656   C  CB    . ALA A 1 91  ? 95.763  -12.932 314.879 1.00 89.94  ? 91  ALA A CB    1 
ATOM   657   N  N     . GLN A 1 92  ? 94.291  -13.642 317.939 1.00 95.99  ? 92  GLN A N     1 
ATOM   658   C  CA    . GLN A 1 92  ? 94.624  -13.832 319.354 1.00 88.87  ? 92  GLN A CA    1 
ATOM   659   C  C     . GLN A 1 92  ? 93.931  -15.041 319.989 1.00 95.11  ? 92  GLN A C     1 
ATOM   660   O  O     . GLN A 1 92  ? 92.711  -15.176 319.917 1.00 94.61  ? 92  GLN A O     1 
ATOM   661   C  CB    . GLN A 1 92  ? 94.300  -12.564 320.146 1.00 71.59  ? 92  GLN A CB    1 
ATOM   662   C  CG    . GLN A 1 92  ? 95.187  -11.378 319.792 1.00 77.49  ? 92  GLN A CG    1 
ATOM   663   C  CD    . GLN A 1 92  ? 94.616  -10.057 320.270 1.00 83.93  ? 92  GLN A CD    1 
ATOM   664   O  OE1   . GLN A 1 92  ? 93.431  -9.958  320.586 1.00 86.82  ? 92  GLN A OE1   1 
ATOM   665   N  NE2   . GLN A 1 92  ? 95.458  -9.032  320.321 1.00 80.75  ? 92  GLN A NE2   1 
ATOM   666   N  N     . TRP A 1 93  ? 94.720  -15.908 320.620 1.00 99.00  ? 93  TRP A N     1 
ATOM   667   C  CA    . TRP A 1 93  ? 94.206  -17.144 321.209 1.00 96.55  ? 93  TRP A CA    1 
ATOM   668   C  C     . TRP A 1 93  ? 93.267  -16.892 322.384 1.00 95.70  ? 93  TRP A C     1 
ATOM   669   O  O     . TRP A 1 93  ? 92.343  -17.666 322.629 1.00 92.33  ? 93  TRP A O     1 
ATOM   670   C  CB    . TRP A 1 93  ? 95.359  -18.055 321.650 1.00 90.35  ? 93  TRP A CB    1 
ATOM   671   C  CG    . TRP A 1 93  ? 96.101  -17.566 322.859 1.00 99.73  ? 93  TRP A CG    1 
ATOM   672   C  CD1   . TRP A 1 93  ? 97.229  -16.799 322.876 1.00 109.09 ? 93  TRP A CD1   1 
ATOM   673   C  CD2   . TRP A 1 93  ? 95.764  -17.814 324.230 1.00 96.69  ? 93  TRP A CD2   1 
ATOM   674   N  NE1   . TRP A 1 93  ? 97.617  -16.554 324.172 1.00 99.58  ? 93  TRP A NE1   1 
ATOM   675   C  CE2   . TRP A 1 93  ? 96.733  -17.166 325.022 1.00 91.40  ? 93  TRP A CE2   1 
ATOM   676   C  CE3   . TRP A 1 93  ? 94.737  -18.520 324.863 1.00 92.58  ? 93  TRP A CE3   1 
ATOM   677   C  CZ2   . TRP A 1 93  ? 96.705  -17.204 326.414 1.00 76.15  ? 93  TRP A CZ2   1 
ATOM   678   C  CZ3   . TRP A 1 93  ? 94.710  -18.556 326.245 1.00 72.98  ? 93  TRP A CZ3   1 
ATOM   679   C  CH2   . TRP A 1 93  ? 95.689  -17.902 327.006 1.00 70.66  ? 93  TRP A CH2   1 
ATOM   680   N  N     . TRP A 1 94  ? 93.508  -15.808 323.111 1.00 89.64  ? 94  TRP A N     1 
ATOM   681   C  CA    . TRP A 1 94  ? 92.701  -15.491 324.284 1.00 90.97  ? 94  TRP A CA    1 
ATOM   682   C  C     . TRP A 1 94  ? 91.454  -14.691 323.916 1.00 97.14  ? 94  TRP A C     1 
ATOM   683   O  O     . TRP A 1 94  ? 90.659  -14.328 324.785 1.00 106.62 ? 94  TRP A O     1 
ATOM   684   C  CB    . TRP A 1 94  ? 93.531  -14.717 325.307 1.00 92.22  ? 94  TRP A CB    1 
ATOM   685   C  CG    . TRP A 1 94  ? 93.894  -13.335 324.861 1.00 90.11  ? 94  TRP A CG    1 
ATOM   686   C  CD1   . TRP A 1 94  ? 93.168  -12.196 325.048 1.00 97.64  ? 94  TRP A CD1   1 
ATOM   687   C  CD2   . TRP A 1 94  ? 95.079  -12.945 324.157 1.00 90.25  ? 94  TRP A CD2   1 
ATOM   688   N  NE1   . TRP A 1 94  ? 93.826  -11.120 324.502 1.00 102.58 ? 94  TRP A NE1   1 
ATOM   689   C  CE2   . TRP A 1 94  ? 94.998  -11.553 323.952 1.00 91.16  ? 94  TRP A CE2   1 
ATOM   690   C  CE3   . TRP A 1 94  ? 96.194  -13.638 323.684 1.00 83.08  ? 94  TRP A CE3   1 
ATOM   691   C  CZ2   . TRP A 1 94  ? 95.997  -10.845 323.289 1.00 76.59  ? 94  TRP A CZ2   1 
ATOM   692   C  CZ3   . TRP A 1 94  ? 97.183  -12.931 323.028 1.00 85.29  ? 94  TRP A CZ3   1 
ATOM   693   C  CH2   . TRP A 1 94  ? 97.079  -11.549 322.838 1.00 81.94  ? 94  TRP A CH2   1 
ATOM   694   N  N     . SER A 1 95  ? 91.295  -14.409 322.626 1.00 97.33  ? 95  SER A N     1 
ATOM   695   C  CA    . SER A 1 95  ? 90.135  -13.673 322.137 1.00 86.67  ? 95  SER A CA    1 
ATOM   696   C  C     . SER A 1 95  ? 89.278  -14.581 321.265 1.00 93.67  ? 95  SER A C     1 
ATOM   697   O  O     . SER A 1 95  ? 88.050  -14.529 321.307 1.00 98.66  ? 95  SER A O     1 
ATOM   698   C  CB    . SER A 1 95  ? 90.578  -12.440 321.349 1.00 71.90  ? 95  SER A CB    1 
ATOM   699   N  N     . TYR A 1 96  ? 89.941  -15.413 320.472 1.00 90.37  ? 96  TYR A N     1 
ATOM   700   C  CA    . TYR A 1 96  ? 89.247  -16.385 319.643 1.00 87.20  ? 96  TYR A CA    1 
ATOM   701   C  C     . TYR A 1 96  ? 89.537  -17.797 320.132 1.00 86.95  ? 96  TYR A C     1 
ATOM   702   O  O     . TYR A 1 96  ? 90.693  -18.214 320.201 1.00 94.03  ? 96  TYR A O     1 
ATOM   703   C  CB    . TYR A 1 96  ? 89.640  -16.222 318.172 1.00 91.18  ? 96  TYR A CB    1 
ATOM   704   C  CG    . TYR A 1 96  ? 88.769  -15.241 317.415 1.00 97.10  ? 96  TYR A CG    1 
ATOM   705   C  CD1   . TYR A 1 96  ? 88.767  -13.889 317.735 1.00 99.42  ? 96  TYR A CD1   1 
ATOM   706   C  CD2   . TYR A 1 96  ? 87.946  -15.670 316.381 1.00 86.40  ? 96  TYR A CD2   1 
ATOM   707   C  CE1   . TYR A 1 96  ? 87.970  -12.994 317.047 1.00 98.56  ? 96  TYR A CE1   1 
ATOM   708   C  CE2   . TYR A 1 96  ? 87.147  -14.781 315.687 1.00 79.91  ? 96  TYR A CE2   1 
ATOM   709   C  CZ    . TYR A 1 96  ? 87.163  -13.445 316.024 1.00 92.88  ? 96  TYR A CZ    1 
ATOM   710   O  OH    . TYR A 1 96  ? 86.371  -12.556 315.335 1.00 107.31 ? 96  TYR A OH    1 
ATOM   711   N  N     . ARG A 1 97  ? 88.475  -18.513 320.490 1.00 81.72  ? 97  ARG A N     1 
ATOM   712   C  CA    . ARG A 1 97  ? 88.578  -19.883 320.981 1.00 87.54  ? 97  ARG A CA    1 
ATOM   713   C  C     . ARG A 1 97  ? 89.319  -20.757 319.979 1.00 93.07  ? 97  ARG A C     1 
ATOM   714   O  O     . ARG A 1 97  ? 90.138  -21.595 320.352 1.00 86.78  ? 97  ARG A O     1 
ATOM   715   C  CB    . ARG A 1 97  ? 87.180  -20.446 321.247 1.00 86.59  ? 97  ARG A CB    1 
ATOM   716   C  CG    . ARG A 1 97  ? 87.162  -21.824 321.872 1.00 84.65  ? 97  ARG A CG    1 
ATOM   717   C  CD    . ARG A 1 97  ? 87.977  -21.865 323.150 1.00 79.98  ? 97  ARG A CD    1 
ATOM   718   N  NE    . ARG A 1 97  ? 87.933  -23.184 323.768 1.00 87.15  ? 97  ARG A NE    1 
ATOM   719   C  CZ    . ARG A 1 97  ? 88.761  -24.176 323.464 1.00 94.66  ? 97  ARG A CZ    1 
ATOM   720   N  NH1   . ARG A 1 97  ? 89.701  -24.000 322.546 1.00 90.94  ? 97  ARG A NH1   1 
ATOM   721   N  NH2   . ARG A 1 97  ? 88.651  -25.346 324.078 1.00 99.42  ? 97  ARG A NH2   1 
ATOM   722   N  N     . TYR A 1 98  ? 89.019  -20.553 318.702 1.00 95.80  ? 98  TYR A N     1 
ATOM   723   C  CA    . TYR A 1 98  ? 89.772  -21.181 317.627 1.00 85.12  ? 98  TYR A CA    1 
ATOM   724   C  C     . TYR A 1 98  ? 90.153  -20.115 316.606 1.00 88.94  ? 98  TYR A C     1 
ATOM   725   O  O     . TYR A 1 98  ? 89.340  -19.711 315.775 1.00 86.62  ? 98  TYR A O     1 
ATOM   726   C  CB    . TYR A 1 98  ? 88.970  -22.313 316.982 1.00 73.29  ? 98  TYR A CB    1 
ATOM   727   C  CG    . TYR A 1 98  ? 88.674  -23.466 317.917 1.00 78.34  ? 98  TYR A CG    1 
ATOM   728   C  CD1   . TYR A 1 98  ? 87.585  -23.426 318.776 1.00 85.65  ? 98  TYR A CD1   1 
ATOM   729   C  CD2   . TYR A 1 98  ? 89.484  -24.593 317.943 1.00 91.72  ? 98  TYR A CD2   1 
ATOM   730   C  CE1   . TYR A 1 98  ? 87.304  -24.478 319.632 1.00 94.52  ? 98  TYR A CE1   1 
ATOM   731   C  CE2   . TYR A 1 98  ? 89.214  -25.652 318.799 1.00 100.59 ? 98  TYR A CE2   1 
ATOM   732   C  CZ    . TYR A 1 98  ? 88.121  -25.586 319.642 1.00 99.60  ? 98  TYR A CZ    1 
ATOM   733   O  OH    . TYR A 1 98  ? 87.838  -26.628 320.497 1.00 96.72  ? 98  TYR A OH    1 
ATOM   734   N  N     . MET A 1 99  ? 91.399  -19.661 316.698 1.00 85.58  ? 99  MET A N     1 
ATOM   735   C  CA    . MET A 1 99  ? 91.913  -18.561 315.890 1.00 87.90  ? 99  MET A CA    1 
ATOM   736   C  C     . MET A 1 99  ? 91.748  -18.798 314.391 1.00 88.91  ? 99  MET A C     1 
ATOM   737   O  O     . MET A 1 99  ? 91.995  -19.898 313.893 1.00 93.21  ? 99  MET A O     1 
ATOM   738   C  CB    . MET A 1 99  ? 93.385  -18.318 316.225 1.00 83.75  ? 99  MET A CB    1 
ATOM   739   C  CG    . MET A 1 99  ? 93.668  -18.178 317.714 1.00 71.48  ? 99  MET A CG    1 
ATOM   740   S  SD    . MET A 1 99  ? 94.855  -19.388 318.336 1.00 94.58  ? 99  MET A SD    1 
ATOM   741   C  CE    . MET A 1 99  ? 93.834  -20.856 318.477 1.00 106.34 ? 99  MET A CE    1 
ATOM   742   N  N     . LEU A 1 100 ? 91.328  -17.755 313.684 1.00 84.64  ? 100 LEU A N     1 
ATOM   743   C  CA    . LEU A 1 100 ? 91.104  -17.834 312.250 1.00 83.47  ? 100 LEU A CA    1 
ATOM   744   C  C     . LEU A 1 100 ? 92.281  -17.233 311.485 1.00 89.64  ? 100 LEU A C     1 
ATOM   745   O  O     . LEU A 1 100 ? 92.291  -17.221 310.252 1.00 100.10 ? 100 LEU A O     1 
ATOM   746   C  CB    . LEU A 1 100 ? 89.805  -17.118 311.878 1.00 74.58  ? 100 LEU A CB    1 
ATOM   747   C  CG    . LEU A 1 100 ? 88.548  -17.589 312.608 1.00 74.00  ? 100 LEU A CG    1 
ATOM   748   C  CD1   . LEU A 1 100 ? 87.374  -16.690 312.273 1.00 82.77  ? 100 LEU A CD1   1 
ATOM   749   C  CD2   . LEU A 1 100 ? 88.232  -19.021 312.234 1.00 75.60  ? 100 LEU A CD2   1 
ATOM   750   N  N     . VAL A 1 101 ? 93.275  -16.738 312.218 1.00 78.95  ? 101 VAL A N     1 
ATOM   751   C  CA    . VAL A 1 101 ? 94.426  -16.083 311.606 1.00 70.23  ? 101 VAL A CA    1 
ATOM   752   C  C     . VAL A 1 101 ? 95.736  -16.460 312.288 1.00 80.77  ? 101 VAL A C     1 
ATOM   753   O  O     . VAL A 1 101 ? 95.832  -16.437 313.518 1.00 105.48 ? 101 VAL A O     1 
ATOM   754   C  CB    . VAL A 1 101 ? 94.281  -14.547 311.654 1.00 70.29  ? 101 VAL A CB    1 
ATOM   755   C  CG1   . VAL A 1 101 ? 95.571  -13.869 311.211 1.00 64.07  ? 101 VAL A CG1   1 
ATOM   756   C  CG2   . VAL A 1 101 ? 93.115  -14.095 310.796 1.00 64.99  ? 101 VAL A CG2   1 
ATOM   757   N  N     . ASP A 1 102 ? 96.737  -16.815 311.487 1.00 85.35  ? 102 ASP A N     1 
ATOM   758   C  CA    . ASP A 1 102 ? 98.095  -16.986 311.987 1.00 100.44 ? 102 ASP A CA    1 
ATOM   759   C  C     . ASP A 1 102 ? 98.874  -15.701 311.744 1.00 95.91  ? 102 ASP A C     1 
ATOM   760   O  O     . ASP A 1 102 ? 98.862  -15.164 310.638 1.00 101.27 ? 102 ASP A O     1 
ATOM   761   C  CB    . ASP A 1 102 ? 98.790  -18.155 311.288 1.00 117.42 ? 102 ASP A CB    1 
ATOM   762   C  CG    . ASP A 1 102 ? 98.210  -19.498 311.681 1.00 136.48 ? 102 ASP A CG    1 
ATOM   763   O  OD1   . ASP A 1 102 ? 97.579  -19.581 312.755 1.00 139.70 ? 102 ASP A OD1   1 
ATOM   764   O  OD2   . ASP A 1 102 ? 98.387  -20.471 310.916 1.00 147.77 ? 102 ASP A OD2   1 
ATOM   765   N  N     . GLY A 1 103 ? 99.547  -15.210 312.779 1.00 86.40  ? 103 GLY A N     1 
ATOM   766   C  CA    . GLY A 1 103 ? 100.291 -13.967 312.681 1.00 73.66  ? 103 GLY A CA    1 
ATOM   767   C  C     . GLY A 1 103 ? 101.760 -14.113 313.029 1.00 79.74  ? 103 GLY A C     1 
ATOM   768   O  O     . GLY A 1 103 ? 102.183 -15.134 313.570 1.00 95.07  ? 103 GLY A O     1 
ATOM   769   N  N     . HIS A 1 104 ? 102.539 -13.085 312.706 1.00 77.87  ? 104 HIS A N     1 
ATOM   770   C  CA    . HIS A 1 104 ? 103.964 -13.062 313.019 1.00 90.10  ? 104 HIS A CA    1 
ATOM   771   C  C     . HIS A 1 104 ? 104.370 -11.686 313.527 1.00 105.56 ? 104 HIS A C     1 
ATOM   772   O  O     . HIS A 1 104 ? 104.116 -10.671 312.877 1.00 104.96 ? 104 HIS A O     1 
ATOM   773   C  CB    . HIS A 1 104 ? 104.800 -13.436 311.794 1.00 83.01  ? 104 HIS A CB    1 
ATOM   774   C  CG    . HIS A 1 104 ? 104.646 -14.863 311.369 1.00 78.32  ? 104 HIS A CG    1 
ATOM   775   N  N     . GLY A 1 105 ? 105.001 -11.661 314.695 1.00 110.70 ? 105 GLY A N     1 
ATOM   776   C  CA    . GLY A 1 105 ? 105.407 -10.417 315.319 1.00 101.66 ? 105 GLY A CA    1 
ATOM   777   C  C     . GLY A 1 105 ? 104.473 -10.046 316.453 1.00 87.39  ? 105 GLY A C     1 
ATOM   778   O  O     . GLY A 1 105 ? 103.626 -10.841 316.855 1.00 80.91  ? 105 GLY A O     1 
ATOM   779   N  N     . ASN A 1 106 ? 104.629 -8.832  316.969 1.00 85.20  ? 106 ASN A N     1 
ATOM   780   C  CA    . ASN A 1 106 ? 103.818 -8.358  318.084 1.00 87.54  ? 106 ASN A CA    1 
ATOM   781   C  C     . ASN A 1 106 ? 102.347 -8.226  317.702 1.00 83.07  ? 106 ASN A C     1 
ATOM   782   O  O     . ASN A 1 106 ? 101.952 -7.280  317.022 1.00 85.80  ? 106 ASN A O     1 
ATOM   783   C  CB    . ASN A 1 106 ? 104.367 -7.028  318.606 1.00 94.41  ? 106 ASN A CB    1 
ATOM   784   C  CG    . ASN A 1 106 ? 103.608 -6.510  319.814 1.00 108.12 ? 106 ASN A CG    1 
ATOM   785   O  OD1   . ASN A 1 106 ? 102.840 -7.237  320.444 1.00 120.40 ? 106 ASN A OD1   1 
ATOM   786   N  ND2   . ASN A 1 106 ? 103.829 -5.245  320.148 1.00 106.27 ? 106 ASN A ND2   1 
ATOM   787   N  N     . PHE A 1 107 ? 101.545 -9.188  318.146 1.00 82.95  ? 107 PHE A N     1 
ATOM   788   C  CA    . PHE A 1 107 ? 100.113 -9.195  317.863 1.00 86.17  ? 107 PHE A CA    1 
ATOM   789   C  C     . PHE A 1 107 ? 99.289  -8.897  319.111 1.00 95.56  ? 107 PHE A C     1 
ATOM   790   O  O     . PHE A 1 107 ? 98.083  -9.142  319.145 1.00 88.57  ? 107 PHE A O     1 
ATOM   791   C  CB    . PHE A 1 107 ? 99.695  -10.539 317.268 1.00 82.39  ? 107 PHE A CB    1 
ATOM   792   C  CG    . PHE A 1 107 ? 99.523  -10.512 315.776 1.00 91.84  ? 107 PHE A CG    1 
ATOM   793   C  CD1   . PHE A 1 107 ? 100.617 -10.612 314.933 1.00 101.74 ? 107 PHE A CD1   1 
ATOM   794   C  CD2   . PHE A 1 107 ? 98.263  -10.384 315.219 1.00 94.15  ? 107 PHE A CD2   1 
ATOM   795   C  CE1   . PHE A 1 107 ? 100.455 -10.583 313.559 1.00 105.29 ? 107 PHE A CE1   1 
ATOM   796   C  CE2   . PHE A 1 107 ? 98.093  -10.356 313.849 1.00 100.48 ? 107 PHE A CE2   1 
ATOM   797   C  CZ    . PHE A 1 107 ? 99.191  -10.457 313.017 1.00 106.43 ? 107 PHE A CZ    1 
ATOM   798   N  N     . GLY A 1 108 ? 99.949  -8.365  320.134 1.00 99.45  ? 108 GLY A N     1 
ATOM   799   C  CA    . GLY A 1 108 ? 99.279  -7.988  321.363 1.00 96.76  ? 108 GLY A CA    1 
ATOM   800   C  C     . GLY A 1 108 ? 99.462  -9.004  322.470 1.00 103.54 ? 108 GLY A C     1 
ATOM   801   O  O     . GLY A 1 108 ? 99.929  -10.118 322.229 1.00 101.63 ? 108 GLY A O     1 
ATOM   802   N  N     . SER A 1 109 ? 99.091  -8.615  323.688 1.00 106.83 ? 109 SER A N     1 
ATOM   803   C  CA    . SER A 1 109 ? 99.184  -9.497  324.846 1.00 102.41 ? 109 SER A CA    1 
ATOM   804   C  C     . SER A 1 109 ? 97.886  -9.483  325.643 1.00 97.91  ? 109 SER A C     1 
ATOM   805   O  O     . SER A 1 109 ? 97.030  -8.622  325.440 1.00 94.95  ? 109 SER A O     1 
ATOM   806   C  CB    . SER A 1 109 ? 100.344 -9.082  325.750 1.00 110.26 ? 109 SER A CB    1 
ATOM   807   O  OG    . SER A 1 109 ? 100.098 -7.822  326.352 1.00 111.69 ? 109 SER A OG    1 
ATOM   808   N  N     . MET A 1 110 ? 97.753  -10.440 326.556 1.00 104.07 ? 110 MET A N     1 
ATOM   809   C  CA    . MET A 1 110 ? 96.572  -10.539 327.403 1.00 108.11 ? 110 MET A CA    1 
ATOM   810   C  C     . MET A 1 110 ? 96.498  -9.362  328.367 1.00 108.94 ? 110 MET A C     1 
ATOM   811   O  O     . MET A 1 110 ? 95.427  -9.028  328.871 1.00 111.37 ? 110 MET A O     1 
ATOM   812   C  CB    . MET A 1 110 ? 96.598  -11.839 328.205 1.00 107.11 ? 110 MET A CB    1 
ATOM   813   C  CG    . MET A 1 110 ? 97.316  -12.989 327.524 1.00 105.01 ? 110 MET A CG    1 
ATOM   814   S  SD    . MET A 1 110 ? 97.289  -14.471 328.547 1.00 137.61 ? 110 MET A SD    1 
ATOM   815   C  CE    . MET A 1 110 ? 95.524  -14.700 328.750 1.00 93.71  ? 110 MET A CE    1 
ATOM   816   N  N     . ASP A 1 111 ? 97.644  -8.738  328.625 1.00 103.79 ? 111 ASP A N     1 
ATOM   817   C  CA    . ASP A 1 111 ? 97.716  -7.614  329.553 1.00 103.24 ? 111 ASP A CA    1 
ATOM   818   C  C     . ASP A 1 111 ? 97.052  -6.365  328.983 1.00 112.49 ? 111 ASP A C     1 
ATOM   819   O  O     . ASP A 1 111 ? 96.891  -5.363  329.681 1.00 116.44 ? 111 ASP A O     1 
ATOM   820   C  CB    . ASP A 1 111 ? 99.170  -7.314  329.925 1.00 106.84 ? 111 ASP A CB    1 
ATOM   821   C  CG    . ASP A 1 111 ? 99.877  -8.512  330.526 1.00 119.75 ? 111 ASP A CG    1 
ATOM   822   O  OD1   . ASP A 1 111 ? 99.181  -9.445  330.978 1.00 117.16 ? 111 ASP A OD1   1 
ATOM   823   O  OD2   . ASP A 1 111 ? 101.126 -8.520  330.550 1.00 131.87 ? 111 ASP A OD2   1 
ATOM   824   N  N     . GLY A 1 112 ? 96.672  -6.427  327.711 1.00 120.70 ? 112 GLY A N     1 
ATOM   825   C  CA    . GLY A 1 112 ? 95.977  -5.328  327.071 1.00 123.91 ? 112 GLY A CA    1 
ATOM   826   C  C     . GLY A 1 112 ? 96.855  -4.546  326.116 1.00 130.67 ? 112 GLY A C     1 
ATOM   827   O  O     . GLY A 1 112 ? 96.402  -3.584  325.495 1.00 138.86 ? 112 GLY A O     1 
ATOM   828   N  N     . ASP A 1 113 ? 98.115  -4.955  326.003 1.00 127.62 ? 113 ASP A N     1 
ATOM   829   C  CA    . ASP A 1 113 ? 99.045  -4.307  325.086 1.00 123.13 ? 113 ASP A CA    1 
ATOM   830   C  C     . ASP A 1 113 ? 98.586  -4.478  323.640 1.00 119.78 ? 113 ASP A C     1 
ATOM   831   O  O     . ASP A 1 113 ? 98.239  -5.580  323.211 1.00 125.47 ? 113 ASP A O     1 
ATOM   832   C  CB    . ASP A 1 113 ? 100.462 -4.857  325.271 1.00 115.26 ? 113 ASP A CB    1 
ATOM   833   N  N     . SER A 1 114 ? 98.574  -3.376  322.898 1.00 112.92 ? 114 SER A N     1 
ATOM   834   C  CA    . SER A 1 114 ? 98.130  -3.390  321.510 1.00 108.64 ? 114 SER A CA    1 
ATOM   835   C  C     . SER A 1 114 ? 99.130  -4.118  320.621 1.00 107.57 ? 114 SER A C     1 
ATOM   836   O  O     . SER A 1 114 ? 100.279 -4.335  321.008 1.00 108.79 ? 114 SER A O     1 
ATOM   837   C  CB    . SER A 1 114 ? 97.921  -1.961  321.000 1.00 102.42 ? 114 SER A CB    1 
ATOM   838   N  N     . ALA A 1 115 ? 98.681  -4.496  319.428 1.00 103.38 ? 115 ALA A N     1 
ATOM   839   C  CA    . ALA A 1 115 ? 99.551  -5.123  318.442 1.00 96.69  ? 115 ALA A CA    1 
ATOM   840   C  C     . ALA A 1 115 ? 100.506 -4.096  317.856 1.00 95.45  ? 115 ALA A C     1 
ATOM   841   O  O     . ALA A 1 115 ? 100.292 -2.890  317.984 1.00 99.71  ? 115 ALA A O     1 
ATOM   842   C  CB    . ALA A 1 115 ? 98.725  -5.758  317.337 1.00 65.46  ? 115 ALA A CB    1 
ATOM   843   N  N     . ALA A 1 116 ? 101.559 -4.581  317.207 1.00 91.22  ? 116 ALA A N     1 
ATOM   844   C  CA    . ALA A 1 116 ? 102.517 -3.704  316.549 1.00 96.39  ? 116 ALA A CA    1 
ATOM   845   C  C     . ALA A 1 116 ? 101.877 -3.046  315.336 1.00 115.06 ? 116 ALA A C     1 
ATOM   846   O  O     . ALA A 1 116 ? 100.803 -3.454  314.894 1.00 118.60 ? 116 ALA A O     1 
ATOM   847   C  CB    . ALA A 1 116 ? 103.753 -4.485  316.137 1.00 84.08  ? 116 ALA A CB    1 
ATOM   848   N  N     . ALA A 1 117 ? 102.538 -2.027  314.799 1.00 118.43 ? 117 ALA A N     1 
ATOM   849   C  CA    . ALA A 1 117 ? 102.054 -1.362  313.596 1.00 111.37 ? 117 ALA A CA    1 
ATOM   850   C  C     . ALA A 1 117 ? 102.053 -2.330  312.416 1.00 108.09 ? 117 ALA A C     1 
ATOM   851   O  O     . ALA A 1 117 ? 102.817 -3.295  312.394 1.00 99.13  ? 117 ALA A O     1 
ATOM   852   C  CB    . ALA A 1 117 ? 102.898 -0.139  313.291 1.00 111.91 ? 117 ALA A CB    1 
ATOM   853   N  N     . GLN A 1 118 ? 101.196 -2.063  311.435 1.00 107.55 ? 118 GLN A N     1 
ATOM   854   C  CA    . GLN A 1 118 ? 100.991 -2.973  310.311 1.00 105.32 ? 118 GLN A CA    1 
ATOM   855   C  C     . GLN A 1 118 ? 102.239 -3.156  309.449 1.00 98.11  ? 118 GLN A C     1 
ATOM   856   O  O     . GLN A 1 118 ? 102.317 -4.085  308.649 1.00 92.33  ? 118 GLN A O     1 
ATOM   857   C  CB    . GLN A 1 118 ? 99.828  -2.490  309.444 1.00 107.00 ? 118 GLN A CB    1 
ATOM   858   C  CG    . GLN A 1 118 ? 98.634  -2.002  310.236 1.00 110.78 ? 118 GLN A CG    1 
ATOM   859   C  CD    . GLN A 1 118 ? 97.441  -1.691  309.360 1.00 113.48 ? 118 GLN A CD    1 
ATOM   860   O  OE1   . GLN A 1 118 ? 97.312  -2.226  308.260 1.00 118.15 ? 118 GLN A OE1   1 
ATOM   861   N  NE2   . GLN A 1 118 ? 96.562  -0.820  309.843 1.00 111.32 ? 118 GLN A NE2   1 
ATOM   862   N  N     . ARG A 1 119 ? 103.210 -2.266  309.620 1.00 97.19  ? 119 ARG A N     1 
ATOM   863   C  CA    A ARG A 1 119 ? 104.441 -2.326  308.838 0.57 98.48  ? 119 ARG A CA    1 
ATOM   864   C  CA    B ARG A 1 119 ? 104.444 -2.305  308.849 0.43 97.02  ? 119 ARG A CA    1 
ATOM   865   C  C     . ARG A 1 119 ? 105.483 -3.228  309.487 1.00 107.32 ? 119 ARG A C     1 
ATOM   866   O  O     . ARG A 1 119 ? 106.645 -3.248  309.072 1.00 115.78 ? 119 ARG A O     1 
ATOM   867   C  CB    A ARG A 1 119 ? 105.023 -0.928  308.611 0.57 93.93  ? 119 ARG A CB    1 
ATOM   868   C  CB    B ARG A 1 119 ? 105.009 -0.888  308.682 0.43 91.12  ? 119 ARG A CB    1 
ATOM   869   C  CG    A ARG A 1 119 ? 105.638 -0.282  309.837 0.57 88.91  ? 119 ARG A CG    1 
ATOM   870   C  CG    B ARG A 1 119 ? 104.510 0.118   309.717 0.43 85.90  ? 119 ARG A CG    1 
ATOM   871   C  CD    A ARG A 1 119 ? 106.399 0.973   309.451 0.57 95.19  ? 119 ARG A CD    1 
ATOM   872   C  CD    B ARG A 1 119 ? 103.241 0.833   309.256 0.43 82.48  ? 119 ARG A CD    1 
ATOM   873   N  NE    A ARG A 1 119 ? 107.772 0.960   309.942 0.57 101.69 ? 119 ARG A NE    1 
ATOM   874   N  NE    B ARG A 1 119 ? 102.528 1.454   310.368 0.43 89.06  ? 119 ARG A NE    1 
ATOM   875   C  CZ    A ARG A 1 119 ? 108.772 0.318   309.344 0.57 108.86 ? 119 ARG A CZ    1 
ATOM   876   C  CZ    B ARG A 1 119 ? 101.210 1.614   310.412 0.43 99.34  ? 119 ARG A CZ    1 
ATOM   877   N  NH1   A ARG A 1 119 ? 108.556 -0.370  308.228 0.57 113.68 ? 119 ARG A NH1   1 
ATOM   878   N  NH1   B ARG A 1 119 ? 100.457 1.197   309.405 0.43 102.39 ? 119 ARG A NH1   1 
ATOM   879   N  NH2   A ARG A 1 119 ? 109.992 0.360   309.861 0.57 106.34 ? 119 ARG A NH2   1 
ATOM   880   N  NH2   B ARG A 1 119 ? 100.642 2.188   311.465 0.43 105.32 ? 119 ARG A NH2   1 
ATOM   881   N  N     . TYR A 1 120 ? 105.062 -3.983  310.500 1.00 107.25 ? 120 TYR A N     1 
ATOM   882   C  CA    . TYR A 1 120 ? 105.948 -4.913  311.191 1.00 102.17 ? 120 TYR A CA    1 
ATOM   883   C  C     . TYR A 1 120 ? 105.349 -6.315  311.189 1.00 109.02 ? 120 TYR A C     1 
ATOM   884   O  O     . TYR A 1 120 ? 106.066 -7.310  311.067 1.00 124.76 ? 120 TYR A O     1 
ATOM   885   C  CB    . TYR A 1 120 ? 106.185 -4.464  312.633 1.00 88.55  ? 120 TYR A CB    1 
ATOM   886   C  CG    . TYR A 1 120 ? 106.760 -3.074  312.767 1.00 86.85  ? 120 TYR A CG    1 
ATOM   887   C  CD1   . TYR A 1 120 ? 108.121 -2.846  312.605 1.00 85.35  ? 120 TYR A CD1   1 
ATOM   888   C  CD2   . TYR A 1 120 ? 105.944 -1.991  313.060 1.00 84.69  ? 120 TYR A CD2   1 
ATOM   889   C  CE1   . TYR A 1 120 ? 108.651 -1.576  312.726 1.00 87.31  ? 120 TYR A CE1   1 
ATOM   890   C  CE2   . TYR A 1 120 ? 106.466 -0.715  313.185 1.00 84.67  ? 120 TYR A CE2   1 
ATOM   891   C  CZ    . TYR A 1 120 ? 107.818 -0.514  313.017 1.00 91.36  ? 120 TYR A CZ    1 
ATOM   892   O  OH    . TYR A 1 120 ? 108.338 0.754   313.140 1.00 103.26 ? 120 TYR A OH    1 
ATOM   893   N  N     . THR A 1 121 ? 104.028 -6.385  311.320 1.00 91.42  ? 121 THR A N     1 
ATOM   894   C  CA    . THR A 1 121 ? 103.338 -7.664  311.415 1.00 88.66  ? 121 THR A CA    1 
ATOM   895   C  C     . THR A 1 121 ? 102.869 -8.190  310.061 1.00 98.70  ? 121 THR A C     1 
ATOM   896   O  O     . THR A 1 121 ? 102.428 -7.428  309.201 1.00 109.05 ? 121 THR A O     1 
ATOM   897   C  CB    . THR A 1 121 ? 102.117 -7.566  312.342 1.00 89.27  ? 121 THR A CB    1 
ATOM   898   O  OG1   . THR A 1 121 ? 101.119 -6.731  311.741 1.00 91.41  ? 121 THR A OG1   1 
ATOM   899   C  CG2   . THR A 1 121 ? 102.517 -6.982  313.688 1.00 101.45 ? 121 THR A CG2   1 
ATOM   900   N  N     . GLU A 1 122 ? 102.974 -9.502  309.879 1.00 94.45  ? 122 GLU A N     1 
ATOM   901   C  CA    . GLU A 1 122 ? 102.410 -10.162 308.710 1.00 100.75 ? 122 GLU A CA    1 
ATOM   902   C  C     . GLU A 1 122 ? 101.435 -11.247 309.165 1.00 94.83  ? 122 GLU A C     1 
ATOM   903   O  O     . GLU A 1 122 ? 101.433 -11.626 310.335 1.00 95.92  ? 122 GLU A O     1 
ATOM   904   C  CB    . GLU A 1 122 ? 103.514 -10.730 307.814 1.00 114.01 ? 122 GLU A CB    1 
ATOM   905   C  CG    . GLU A 1 122 ? 104.541 -11.586 308.532 1.00 128.26 ? 122 GLU A CG    1 
ATOM   906   C  CD    . GLU A 1 122 ? 105.724 -11.923 307.644 1.00 141.69 ? 122 GLU A CD    1 
ATOM   907   O  OE1   . GLU A 1 122 ? 106.404 -12.936 307.913 1.00 148.57 ? 122 GLU A OE1   1 
ATOM   908   O  OE2   . GLU A 1 122 ? 105.974 -11.170 306.678 1.00 140.07 ? 122 GLU A OE2   1 
ATOM   909   N  N     . ALA A 1 123 ? 100.593 -11.730 308.256 1.00 86.57  ? 123 ALA A N     1 
ATOM   910   C  CA    . ALA A 1 123 ? 99.553  -12.673 308.645 1.00 76.24  ? 123 ALA A CA    1 
ATOM   911   C  C     . ALA A 1 123 ? 99.106  -13.588 307.516 1.00 87.23  ? 123 ALA A C     1 
ATOM   912   O  O     . ALA A 1 123 ? 99.496  -13.413 306.361 1.00 102.66 ? 123 ALA A O     1 
ATOM   913   C  CB    . ALA A 1 123 ? 98.353  -11.928 309.219 1.00 68.06  ? 123 ALA A CB    1 
ATOM   914   N  N     . ARG A 1 124 ? 98.277  -14.564 307.874 1.00 91.08  ? 124 ARG A N     1 
ATOM   915   C  CA    . ARG A 1 124 ? 97.670  -15.478 306.916 1.00 98.68  ? 124 ARG A CA    1 
ATOM   916   C  C     . ARG A 1 124 ? 96.527  -16.226 307.583 1.00 101.87 ? 124 ARG A C     1 
ATOM   917   O  O     . ARG A 1 124 ? 96.216  -15.997 308.752 1.00 100.42 ? 124 ARG A O     1 
ATOM   918   C  CB    . ARG A 1 124 ? 98.697  -16.474 306.374 1.00 99.05  ? 124 ARG A CB    1 
ATOM   919   C  CG    . ARG A 1 124 ? 99.203  -17.478 307.402 1.00 109.15 ? 124 ARG A CG    1 
ATOM   920   C  CD    . ARG A 1 124 ? 100.196 -18.452 306.784 1.00 121.09 ? 124 ARG A CD    1 
ATOM   921   N  NE    . ARG A 1 124 ? 100.890 -19.238 307.802 1.00 126.08 ? 124 ARG A NE    1 
ATOM   922   C  CZ    . ARG A 1 124 ? 101.830 -20.141 307.542 1.00 128.19 ? 124 ARG A CZ    1 
ATOM   923   N  NH1   . ARG A 1 124 ? 102.191 -20.379 306.290 1.00 128.27 ? 124 ARG A NH1   1 
ATOM   924   N  NH2   . ARG A 1 124 ? 102.407 -20.805 308.534 1.00 133.49 ? 124 ARG A NH2   1 
ATOM   925   N  N     . MET A 1 125 ? 95.907  -17.128 306.832 1.00 102.35 ? 125 MET A N     1 
ATOM   926   C  CA    . MET A 1 125 ? 94.819  -17.937 307.358 1.00 91.40  ? 125 MET A CA    1 
ATOM   927   C  C     . MET A 1 125 ? 95.350  -19.022 308.281 1.00 89.33  ? 125 MET A C     1 
ATOM   928   O  O     . MET A 1 125 ? 96.437  -19.560 308.067 1.00 84.83  ? 125 MET A O     1 
ATOM   929   C  CB    . MET A 1 125 ? 94.041  -18.588 306.216 1.00 91.50  ? 125 MET A CB    1 
ATOM   930   C  CG    . MET A 1 125 ? 93.180  -17.630 305.419 1.00 96.17  ? 125 MET A CG    1 
ATOM   931   S  SD    . MET A 1 125 ? 92.717  -18.340 303.833 1.00 126.94 ? 125 MET A SD    1 
ATOM   932   C  CE    . MET A 1 125 ? 92.279  -20.008 304.323 1.00 84.89  ? 125 MET A CE    1 
ATOM   933   N  N     . SER A 1 126 ? 94.582  -19.336 309.316 1.00 94.45  ? 126 SER A N     1 
ATOM   934   C  CA    . SER A 1 126 ? 94.874  -20.492 310.148 1.00 91.03  ? 126 SER A CA    1 
ATOM   935   C  C     . SER A 1 126 ? 94.355  -21.727 309.429 1.00 88.74  ? 126 SER A C     1 
ATOM   936   O  O     . SER A 1 126 ? 93.507  -21.624 308.541 1.00 94.80  ? 126 SER A O     1 
ATOM   937   C  CB    . SER A 1 126 ? 94.214  -20.355 311.518 1.00 91.67  ? 126 SER A CB    1 
ATOM   938   O  OG    . SER A 1 126 ? 92.804  -20.392 311.402 1.00 89.34  ? 126 SER A OG    1 
ATOM   939   N  N     . LYS A 1 127 ? 94.862  -22.892 309.813 1.00 87.05  ? 127 LYS A N     1 
ATOM   940   C  CA    . LYS A 1 127 ? 94.491  -24.142 309.160 1.00 86.10  ? 127 LYS A CA    1 
ATOM   941   C  C     . LYS A 1 127 ? 92.997  -24.438 309.285 1.00 93.75  ? 127 LYS A C     1 
ATOM   942   O  O     . LYS A 1 127 ? 92.433  -25.168 308.469 1.00 109.30 ? 127 LYS A O     1 
ATOM   943   C  CB    . LYS A 1 127 ? 95.311  -25.304 309.728 1.00 69.23  ? 127 LYS A CB    1 
ATOM   944   N  N     . ILE A 1 128 ? 92.358  -23.862 310.298 1.00 82.41  ? 128 ILE A N     1 
ATOM   945   C  CA    . ILE A 1 128 ? 90.940  -24.108 310.545 1.00 79.49  ? 128 ILE A CA    1 
ATOM   946   C  C     . ILE A 1 128 ? 90.042  -23.153 309.749 1.00 95.74  ? 128 ILE A C     1 
ATOM   947   O  O     . ILE A 1 128 ? 88.905  -23.489 309.420 1.00 103.14 ? 128 ILE A O     1 
ATOM   948   C  CB    . ILE A 1 128 ? 90.607  -24.040 312.058 1.00 87.43  ? 128 ILE A CB    1 
ATOM   949   C  CG1   . ILE A 1 128 ? 89.203  -24.587 312.334 1.00 95.20  ? 128 ILE A CG1   1 
ATOM   950   C  CG2   . ILE A 1 128 ? 90.762  -22.621 312.585 1.00 75.75  ? 128 ILE A CG2   1 
ATOM   951   C  CD1   . ILE A 1 128 ? 88.766  -24.458 313.778 1.00 90.19  ? 128 ILE A CD1   1 
ATOM   952   N  N     . ALA A 1 129 ? 90.557  -21.968 309.427 1.00 97.62  ? 129 ALA A N     1 
ATOM   953   C  CA    . ALA A 1 129 ? 89.799  -21.001 308.630 1.00 98.96  ? 129 ALA A CA    1 
ATOM   954   C  C     . ALA A 1 129 ? 89.619  -21.502 307.199 1.00 104.72 ? 129 ALA A C     1 
ATOM   955   O  O     . ALA A 1 129 ? 88.692  -21.097 306.483 1.00 108.89 ? 129 ALA A O     1 
ATOM   956   C  CB    . ALA A 1 129 ? 90.485  -19.644 308.639 1.00 95.61  ? 129 ALA A CB    1 
ATOM   957   N  N     . LEU A 1 130 ? 90.517  -22.391 306.789 1.00 100.54 ? 130 LEU A N     1 
ATOM   958   C  CA    . LEU A 1 130 ? 90.422  -23.026 305.487 1.00 99.04  ? 130 LEU A CA    1 
ATOM   959   C  C     . LEU A 1 130 ? 89.121  -23.817 305.400 1.00 95.32  ? 130 LEU A C     1 
ATOM   960   O  O     . LEU A 1 130 ? 88.558  -23.987 304.318 1.00 101.32 ? 130 LEU A O     1 
ATOM   961   C  CB    . LEU A 1 130 ? 91.631  -23.932 305.249 1.00 105.99 ? 130 LEU A CB    1 
ATOM   962   C  CG    . LEU A 1 130 ? 91.808  -24.503 303.843 1.00 116.75 ? 130 LEU A CG    1 
ATOM   963   C  CD1   . LEU A 1 130 ? 91.608  -23.416 302.802 1.00 117.30 ? 130 LEU A CD1   1 
ATOM   964   C  CD2   . LEU A 1 130 ? 93.188  -25.130 303.703 1.00 126.70 ? 130 LEU A CD2   1 
ATOM   965   N  N     . GLU A 1 131 ? 88.644  -24.287 306.550 1.00 83.51  ? 131 GLU A N     1 
ATOM   966   C  CA    . GLU A 1 131 ? 87.354  -24.960 306.624 1.00 79.18  ? 131 GLU A CA    1 
ATOM   967   C  C     . GLU A 1 131 ? 86.226  -23.943 306.508 1.00 82.94  ? 131 GLU A C     1 
ATOM   968   O  O     . GLU A 1 131 ? 85.159  -24.249 305.977 1.00 89.26  ? 131 GLU A O     1 
ATOM   969   C  CB    . GLU A 1 131 ? 87.223  -25.746 307.929 1.00 76.85  ? 131 GLU A CB    1 
ATOM   970   C  CG    . GLU A 1 131 ? 88.333  -26.758 308.159 1.00 84.41  ? 131 GLU A CG    1 
ATOM   971   C  CD    . GLU A 1 131 ? 88.350  -27.843 307.105 1.00 95.29  ? 131 GLU A CD    1 
ATOM   972   O  OE1   . GLU A 1 131 ? 87.268  -28.166 306.570 1.00 98.49  ? 131 GLU A OE1   1 
ATOM   973   O  OE2   . GLU A 1 131 ? 89.444  -28.367 306.806 1.00 100.80 ? 131 GLU A OE2   1 
ATOM   974   N  N     . MET A 1 132 ? 86.462  -22.733 307.009 1.00 79.97  ? 132 MET A N     1 
ATOM   975   C  CA    . MET A 1 132 ? 85.499  -21.646 306.844 1.00 85.76  ? 132 MET A CA    1 
ATOM   976   C  C     . MET A 1 132 ? 85.384  -21.280 305.373 1.00 89.77  ? 132 MET A C     1 
ATOM   977   O  O     . MET A 1 132 ? 84.347  -20.788 304.927 1.00 96.29  ? 132 MET A O     1 
ATOM   978   C  CB    . MET A 1 132 ? 85.913  -20.407 307.644 1.00 81.23  ? 132 MET A CB    1 
ATOM   979   C  CG    . MET A 1 132 ? 85.677  -20.498 309.135 1.00 79.88  ? 132 MET A CG    1 
ATOM   980   S  SD    . MET A 1 132 ? 83.929  -20.584 309.555 1.00 97.15  ? 132 MET A SD    1 
ATOM   981   C  CE    . MET A 1 132 ? 83.324  -19.084 308.788 1.00 106.76 ? 132 MET A CE    1 
ATOM   982   N  N     . LEU A 1 133 ? 86.454  -21.519 304.620 1.00 87.54  ? 133 LEU A N     1 
ATOM   983   C  CA    . LEU A 1 133 ? 86.465  -21.155 303.203 1.00 88.39  ? 133 LEU A CA    1 
ATOM   984   C  C     . LEU A 1 133 ? 86.397  -22.344 302.237 1.00 91.04  ? 133 LEU A C     1 
ATOM   985   O  O     . LEU A 1 133 ? 86.333  -22.150 301.023 1.00 81.73  ? 133 LEU A O     1 
ATOM   986   C  CB    . LEU A 1 133 ? 87.685  -20.288 302.889 1.00 85.52  ? 133 LEU A CB    1 
ATOM   987   C  CG    . LEU A 1 133 ? 87.695  -18.921 303.568 1.00 90.74  ? 133 LEU A CG    1 
ATOM   988   C  CD1   . LEU A 1 133 ? 89.107  -18.379 303.645 1.00 93.50  ? 133 LEU A CD1   1 
ATOM   989   C  CD2   . LEU A 1 133 ? 86.793  -17.955 302.820 1.00 99.28  ? 133 LEU A CD2   1 
ATOM   990   N  N     . ARG A 1 134 ? 86.400  -23.560 302.777 1.00 95.84  ? 134 ARG A N     1 
ATOM   991   C  CA    . ARG A 1 134 ? 86.460  -24.771 301.960 1.00 91.49  ? 134 ARG A CA    1 
ATOM   992   C  C     . ARG A 1 134 ? 85.326  -24.870 300.941 1.00 95.64  ? 134 ARG A C     1 
ATOM   993   O  O     . ARG A 1 134 ? 84.161  -24.657 301.272 1.00 95.35  ? 134 ARG A O     1 
ATOM   994   C  CB    . ARG A 1 134 ? 86.480  -26.015 302.851 1.00 95.77  ? 134 ARG A CB    1 
ATOM   995   C  CG    . ARG A 1 134 ? 86.835  -27.303 302.125 1.00 103.40 ? 134 ARG A CG    1 
ATOM   996   C  CD    . ARG A 1 134 ? 87.187  -28.400 303.120 1.00 100.89 ? 134 ARG A CD    1 
ATOM   997   N  NE    . ARG A 1 134 ? 88.491  -28.990 302.835 1.00 104.10 ? 134 ARG A NE    1 
ATOM   998   C  CZ    . ARG A 1 134 ? 89.652  -28.444 303.182 1.00 104.87 ? 134 ARG A CZ    1 
ATOM   999   N  NH1   . ARG A 1 134 ? 89.678  -27.284 303.823 1.00 104.80 ? 134 ARG A NH1   1 
ATOM   1000  N  NH2   . ARG A 1 134 ? 90.791  -29.054 302.884 1.00 106.50 ? 134 ARG A NH2   1 
ATOM   1001  N  N     . ASP A 1 135 ? 85.692  -25.194 299.703 1.00 101.55 ? 135 ASP A N     1 
ATOM   1002  C  CA    . ASP A 1 135 ? 84.749  -25.336 298.593 1.00 103.72 ? 135 ASP A CA    1 
ATOM   1003  C  C     . ASP A 1 135 ? 84.008  -24.038 298.266 1.00 96.73  ? 135 ASP A C     1 
ATOM   1004  O  O     . ASP A 1 135 ? 82.832  -24.062 297.900 1.00 85.85  ? 135 ASP A O     1 
ATOM   1005  C  CB    . ASP A 1 135 ? 83.765  -26.486 298.844 1.00 117.02 ? 135 ASP A CB    1 
ATOM   1006  C  CG    . ASP A 1 135 ? 84.445  -27.841 298.867 1.00 122.49 ? 135 ASP A CG    1 
ATOM   1007  O  OD1   . ASP A 1 135 ? 85.289  -28.096 297.983 1.00 126.79 ? 135 ASP A OD1   1 
ATOM   1008  O  OD2   . ASP A 1 135 ? 84.142  -28.646 299.773 1.00 119.03 ? 135 ASP A OD2   1 
ATOM   1009  N  N     . ILE A 1 136 ? 84.708  -22.913 298.391 1.00 94.00  ? 136 ILE A N     1 
ATOM   1010  C  CA    . ILE A 1 136 ? 84.148  -21.606 298.054 1.00 78.94  ? 136 ILE A CA    1 
ATOM   1011  C  C     . ILE A 1 136 ? 83.991  -21.459 296.541 1.00 87.36  ? 136 ILE A C     1 
ATOM   1012  O  O     . ILE A 1 136 ? 83.125  -20.721 296.064 1.00 96.27  ? 136 ILE A O     1 
ATOM   1013  C  CB    . ILE A 1 136 ? 85.027  -20.452 298.605 1.00 84.64  ? 136 ILE A CB    1 
ATOM   1014  C  CG1   . ILE A 1 136 ? 84.369  -19.088 298.364 1.00 85.15  ? 136 ILE A CG1   1 
ATOM   1015  C  CG2   . ILE A 1 136 ? 86.423  -20.496 298.001 1.00 84.21  ? 136 ILE A CG2   1 
ATOM   1016  C  CD1   . ILE A 1 136 ? 83.085  -18.872 299.145 1.00 87.57  ? 136 ILE A CD1   1 
ATOM   1017  N  N     . ASN A 1 137 ? 84.818  -22.183 295.791 1.00 94.16  ? 137 ASN A N     1 
ATOM   1018  C  CA    . ASN A 1 137 ? 84.826  -22.084 294.335 1.00 103.64 ? 137 ASN A CA    1 
ATOM   1019  C  C     . ASN A 1 137 ? 84.019  -23.169 293.625 1.00 109.57 ? 137 ASN A C     1 
ATOM   1020  O  O     . ASN A 1 137 ? 84.385  -23.610 292.534 1.00 124.31 ? 137 ASN A O     1 
ATOM   1021  C  CB    . ASN A 1 137 ? 86.262  -22.077 293.804 1.00 108.02 ? 137 ASN A CB    1 
ATOM   1022  C  CG    . ASN A 1 137 ? 87.026  -20.832 294.208 1.00 118.40 ? 137 ASN A CG    1 
ATOM   1023  O  OD1   . ASN A 1 137 ? 86.435  -19.835 294.616 1.00 113.28 ? 137 ASN A OD1   1 
ATOM   1024  N  ND2   . ASN A 1 137 ? 88.345  -20.877 294.074 1.00 127.85 ? 137 ASN A ND2   1 
ATOM   1025  N  N     . LYS A 1 138 ? 82.920  -23.592 294.239 1.00 96.46  ? 138 LYS A N     1 
ATOM   1026  C  CA    . LYS A 1 138 ? 82.050  -24.589 293.629 1.00 85.11  ? 138 LYS A CA    1 
ATOM   1027  C  C     . LYS A 1 138 ? 80.589  -24.168 293.743 1.00 93.98  ? 138 LYS A C     1 
ATOM   1028  O  O     . LYS A 1 138 ? 79.695  -25.009 293.844 1.00 97.57  ? 138 LYS A O     1 
ATOM   1029  C  CB    . LYS A 1 138 ? 82.271  -25.965 294.265 1.00 77.29  ? 138 LYS A CB    1 
ATOM   1030  C  CG    . LYS A 1 138 ? 83.679  -26.513 294.075 1.00 75.01  ? 138 LYS A CG    1 
ATOM   1031  C  CD    . LYS A 1 138 ? 83.750  -28.004 294.348 1.00 75.40  ? 138 LYS A CD    1 
ATOM   1032  C  CE    . LYS A 1 138 ? 85.149  -28.539 294.058 1.00 87.76  ? 138 LYS A CE    1 
ATOM   1033  N  NZ    . LYS A 1 138 ? 85.193  -30.029 294.043 1.00 101.11 ? 138 LYS A NZ    1 
ATOM   1034  N  N     . ASN A 1 139 ? 80.366  -22.855 293.724 1.00 96.18  ? 139 ASN A N     1 
ATOM   1035  C  CA    . ASN A 1 139 ? 79.033  -22.267 293.842 1.00 94.35  ? 139 ASN A CA    1 
ATOM   1036  C  C     . ASN A 1 139 ? 78.235  -22.805 295.030 1.00 102.04 ? 139 ASN A C     1 
ATOM   1037  O  O     . ASN A 1 139 ? 77.042  -23.084 294.919 1.00 106.43 ? 139 ASN A O     1 
ATOM   1038  C  CB    . ASN A 1 139 ? 78.246  -22.428 292.537 1.00 83.00  ? 139 ASN A CB    1 
ATOM   1039  C  CG    . ASN A 1 139 ? 77.062  -21.480 292.448 1.00 97.93  ? 139 ASN A CG    1 
ATOM   1040  O  OD1   . ASN A 1 139 ? 75.906  -21.906 292.461 1.00 106.24 ? 139 ASN A OD1   1 
ATOM   1041  N  ND2   . ASN A 1 139 ? 77.347  -20.184 292.374 1.00 104.89 ? 139 ASN A ND2   1 
ATOM   1042  N  N     . THR A 1 140 ? 78.910  -22.954 296.166 1.00 100.20 ? 140 THR A N     1 
ATOM   1043  C  CA    . THR A 1 140 ? 78.266  -23.377 297.405 1.00 93.13  ? 140 THR A CA    1 
ATOM   1044  C  C     . THR A 1 140 ? 77.708  -22.164 298.133 1.00 88.29  ? 140 THR A C     1 
ATOM   1045  O  O     . THR A 1 140 ? 77.032  -22.290 299.155 1.00 91.02  ? 140 THR A O     1 
ATOM   1046  C  CB    . THR A 1 140 ? 79.265  -24.079 298.340 1.00 95.72  ? 140 THR A CB    1 
ATOM   1047  O  OG1   . THR A 1 140 ? 80.416  -23.244 298.522 1.00 98.99  ? 140 THR A OG1   1 
ATOM   1048  C  CG2   . THR A 1 140 ? 79.702  -25.406 297.755 1.00 95.62  ? 140 THR A CG2   1 
ATOM   1049  N  N     . VAL A 1 141 ? 77.995  -20.988 297.589 1.00 92.94  ? 141 VAL A N     1 
ATOM   1050  C  CA    . VAL A 1 141 ? 77.701  -19.741 298.268 1.00 83.85  ? 141 VAL A CA    1 
ATOM   1051  C  C     . VAL A 1 141 ? 77.404  -18.617 297.274 1.00 92.71  ? 141 VAL A C     1 
ATOM   1052  O  O     . VAL A 1 141 ? 78.056  -18.504 296.237 1.00 106.45 ? 141 VAL A O     1 
ATOM   1053  C  CB    . VAL A 1 141 ? 78.873  -19.358 299.199 1.00 87.53  ? 141 VAL A CB    1 
ATOM   1054  C  CG1   . VAL A 1 141 ? 79.212  -17.879 299.088 1.00 94.19  ? 141 VAL A CG1   1 
ATOM   1055  C  CG2   . VAL A 1 141 ? 78.562  -19.757 300.633 1.00 92.77  ? 141 VAL A CG2   1 
ATOM   1056  N  N     . ASP A 1 142 ? 76.404  -17.799 297.593 1.00 90.38  ? 142 ASP A N     1 
ATOM   1057  C  CA    . ASP A 1 142 ? 76.020  -16.672 296.746 1.00 98.26  ? 142 ASP A CA    1 
ATOM   1058  C  C     . ASP A 1 142 ? 77.022  -15.523 296.804 1.00 98.60  ? 142 ASP A C     1 
ATOM   1059  O  O     . ASP A 1 142 ? 77.750  -15.366 297.781 1.00 111.03 ? 142 ASP A O     1 
ATOM   1060  C  CB    . ASP A 1 142 ? 74.636  -16.158 297.140 1.00 104.84 ? 142 ASP A CB    1 
ATOM   1061  C  CG    . ASP A 1 142 ? 73.529  -17.120 296.767 1.00 117.32 ? 142 ASP A CG    1 
ATOM   1062  O  OD1   . ASP A 1 142 ? 73.829  -18.302 296.498 1.00 116.84 ? 142 ASP A OD1   1 
ATOM   1063  O  OD2   . ASP A 1 142 ? 72.356  -16.691 296.746 1.00 125.68 ? 142 ASP A OD2   1 
ATOM   1064  N  N     . PHE A 1 143 ? 77.046  -14.715 295.750 1.00 89.03  ? 143 PHE A N     1 
ATOM   1065  C  CA    . PHE A 1 143 ? 77.920  -13.550 295.693 1.00 77.69  ? 143 PHE A CA    1 
ATOM   1066  C  C     . PHE A 1 143 ? 77.127  -12.296 295.352 1.00 76.97  ? 143 PHE A C     1 
ATOM   1067  O  O     . PHE A 1 143 ? 76.018  -12.376 294.825 1.00 81.55  ? 143 PHE A O     1 
ATOM   1068  C  CB    . PHE A 1 143 ? 79.025  -13.756 294.656 1.00 70.44  ? 143 PHE A CB    1 
ATOM   1069  C  CG    . PHE A 1 143 ? 80.219  -14.502 295.177 1.00 75.49  ? 143 PHE A CG    1 
ATOM   1070  C  CD1   . PHE A 1 143 ? 80.110  -15.819 295.591 1.00 77.56  ? 143 PHE A CD1   1 
ATOM   1071  C  CD2   . PHE A 1 143 ? 81.458  -13.886 295.237 1.00 83.46  ? 143 PHE A CD2   1 
ATOM   1072  C  CE1   . PHE A 1 143 ? 81.212  -16.504 296.065 1.00 88.91  ? 143 PHE A CE1   1 
ATOM   1073  C  CE2   . PHE A 1 143 ? 82.562  -14.565 295.708 1.00 89.69  ? 143 PHE A CE2   1 
ATOM   1074  C  CZ    . PHE A 1 143 ? 82.439  -15.875 296.123 1.00 90.07  ? 143 PHE A CZ    1 
ATOM   1075  N  N     . VAL A 1 144 ? 77.703  -11.140 295.664 1.00 84.17  ? 144 VAL A N     1 
ATOM   1076  C  CA    . VAL A 1 144 ? 77.090  -9.851  295.357 1.00 93.32  ? 144 VAL A CA    1 
ATOM   1077  C  C     . VAL A 1 144 ? 78.163  -8.850  294.945 1.00 104.00 ? 144 VAL A C     1 
ATOM   1078  O  O     . VAL A 1 144 ? 79.356  -9.116  295.086 1.00 111.51 ? 144 VAL A O     1 
ATOM   1079  C  CB    . VAL A 1 144 ? 76.316  -9.272  296.562 1.00 88.77  ? 144 VAL A CB    1 
ATOM   1080  C  CG1   . VAL A 1 144 ? 74.980  -9.981  296.739 1.00 90.44  ? 144 VAL A CG1   1 
ATOM   1081  C  CG2   . VAL A 1 144 ? 77.160  -9.346  297.832 1.00 74.61  ? 144 VAL A CG2   1 
ATOM   1082  N  N     . ASP A 1 145 ? 77.734  -7.698  294.441 1.00 104.96 ? 145 ASP A N     1 
ATOM   1083  C  CA    . ASP A 1 145 ? 78.664  -6.642  294.058 1.00 109.21 ? 145 ASP A CA    1 
ATOM   1084  C  C     . ASP A 1 145 ? 79.256  -5.972  295.293 1.00 95.98  ? 145 ASP A C     1 
ATOM   1085  O  O     . ASP A 1 145 ? 78.574  -5.813  296.307 1.00 99.57  ? 145 ASP A O     1 
ATOM   1086  C  CB    . ASP A 1 145 ? 77.964  -5.590  293.193 1.00 120.60 ? 145 ASP A CB    1 
ATOM   1087  C  CG    . ASP A 1 145 ? 77.472  -6.151  291.874 1.00 131.76 ? 145 ASP A CG    1 
ATOM   1088  O  OD1   . ASP A 1 145 ? 78.307  -6.351  290.969 1.00 126.14 ? 145 ASP A OD1   1 
ATOM   1089  O  OD2   . ASP A 1 145 ? 76.251  -6.384  291.738 1.00 144.25 ? 145 ASP A OD2   1 
ATOM   1090  N  N     . ASN A 1 146 ? 80.523  -5.580  295.208 1.00 89.28  ? 146 ASN A N     1 
ATOM   1091  C  CA    . ASN A 1 146 ? 81.134  -4.799  296.271 1.00 94.94  ? 146 ASN A CA    1 
ATOM   1092  C  C     . ASN A 1 146 ? 80.596  -3.373  296.233 1.00 100.74 ? 146 ASN A C     1 
ATOM   1093  O  O     . ASN A 1 146 ? 79.840  -3.020  295.330 1.00 85.87  ? 146 ASN A O     1 
ATOM   1094  C  CB    . ASN A 1 146 ? 82.659  -4.800  296.149 1.00 98.13  ? 146 ASN A CB    1 
ATOM   1095  C  CG    . ASN A 1 146 ? 83.149  -4.020  294.947 1.00 110.42 ? 146 ASN A CG    1 
ATOM   1096  O  OD1   . ASN A 1 146 ? 82.544  -4.063  293.878 1.00 117.31 ? 146 ASN A OD1   1 
ATOM   1097  N  ND2   . ASN A 1 146 ? 84.250  -3.298  295.117 1.00 110.70 ? 146 ASN A ND2   1 
ATOM   1098  N  N     . TYR A 1 147 ? 80.985  -2.556  297.208 1.00 106.56 ? 147 TYR A N     1 
ATOM   1099  C  CA    . TYR A 1 147 ? 80.490  -1.185  297.297 1.00 96.76  ? 147 TYR A CA    1 
ATOM   1100  C  C     . TYR A 1 147 ? 80.853  -0.361  296.062 1.00 113.45 ? 147 TYR A C     1 
ATOM   1101  O  O     . TYR A 1 147 ? 80.086  0.503   295.632 1.00 117.84 ? 147 TYR A O     1 
ATOM   1102  C  CB    . TYR A 1 147 ? 81.005  -0.503  298.567 1.00 82.74  ? 147 TYR A CB    1 
ATOM   1103  C  CG    . TYR A 1 147 ? 82.507  -0.323  298.610 1.00 87.01  ? 147 TYR A CG    1 
ATOM   1104  C  CD1   . TYR A 1 147 ? 83.097  0.870   298.210 1.00 91.71  ? 147 TYR A CD1   1 
ATOM   1105  C  CD2   . TYR A 1 147 ? 83.335  -1.348  299.046 1.00 92.19  ? 147 TYR A CD2   1 
ATOM   1106  C  CE1   . TYR A 1 147 ? 84.466  1.037   298.245 1.00 94.19  ? 147 TYR A CE1   1 
ATOM   1107  C  CE2   . TYR A 1 147 ? 84.707  -1.191  299.085 1.00 94.58  ? 147 TYR A CE2   1 
ATOM   1108  C  CZ    . TYR A 1 147 ? 85.268  0.005   298.684 1.00 97.47  ? 147 TYR A CZ    1 
ATOM   1109  O  OH    . TYR A 1 147 ? 86.634  0.172   298.719 1.00 102.37 ? 147 TYR A OH    1 
ATOM   1110  N  N     . ASP A 1 148 ? 82.022  -0.638  295.492 1.00 120.41 ? 148 ASP A N     1 
ATOM   1111  C  CA    . ASP A 1 148 ? 82.489  0.074   294.309 1.00 120.96 ? 148 ASP A CA    1 
ATOM   1112  C  C     . ASP A 1 148 ? 81.863  -0.499  293.041 1.00 121.18 ? 148 ASP A C     1 
ATOM   1113  O  O     . ASP A 1 148 ? 82.025  0.056   291.953 1.00 124.08 ? 148 ASP A O     1 
ATOM   1114  C  CB    . ASP A 1 148 ? 84.015  0.007   294.214 1.00 127.59 ? 148 ASP A CB    1 
ATOM   1115  C  CG    . ASP A 1 148 ? 84.654  1.379   294.087 1.00 142.42 ? 148 ASP A CG    1 
ATOM   1116  O  OD1   . ASP A 1 148 ? 85.513  1.556   293.196 1.00 145.51 ? 148 ASP A OD1   1 
ATOM   1117  O  OD2   . ASP A 1 148 ? 84.309  2.277   294.885 1.00 148.70 ? 148 ASP A OD2   1 
ATOM   1118  N  N     . ALA A 1 149 ? 81.156  -1.616  293.198 1.00 120.26 ? 149 ALA A N     1 
ATOM   1119  C  CA    . ALA A 1 149 ? 80.491  -2.309  292.095 1.00 112.00 ? 149 ALA A CA    1 
ATOM   1120  C  C     . ALA A 1 149 ? 81.450  -2.723  290.978 1.00 116.10 ? 149 ALA A C     1 
ATOM   1121  O  O     . ALA A 1 149 ? 81.079  -2.736  289.806 1.00 129.55 ? 149 ALA A O     1 
ATOM   1122  C  CB    . ALA A 1 149 ? 79.336  -1.472  291.542 1.00 105.09 ? 149 ALA A CB    1 
ATOM   1123  N  N     . ASN A 1 150 ? 82.682  -3.062  291.351 1.00 109.15 ? 150 ASN A N     1 
ATOM   1124  C  CA    . ASN A 1 150 ? 83.665  -3.571  290.397 1.00 117.85 ? 150 ASN A CA    1 
ATOM   1125  C  C     . ASN A 1 150 ? 84.445  -4.765  290.947 1.00 108.82 ? 150 ASN A C     1 
ATOM   1126  O  O     . ASN A 1 150 ? 85.493  -5.139  290.419 1.00 111.21 ? 150 ASN A O     1 
ATOM   1127  C  CB    . ASN A 1 150 ? 84.614  -2.459  289.939 1.00 125.31 ? 150 ASN A CB    1 
ATOM   1128  C  CG    . ASN A 1 150 ? 85.450  -1.897  291.070 1.00 118.09 ? 150 ASN A CG    1 
ATOM   1129  O  OD1   . ASN A 1 150 ? 85.197  -2.170  292.241 1.00 124.11 ? 150 ASN A OD1   1 
ATOM   1130  N  ND2   . ASN A 1 150 ? 86.453  -1.099  290.722 1.00 111.88 ? 150 ASN A ND2   1 
ATOM   1131  N  N     . GLU A 1 151 ? 83.925  -5.344  292.025 1.00 97.15  ? 151 GLU A N     1 
ATOM   1132  C  CA    . GLU A 1 151 ? 84.425  -6.606  292.565 1.00 88.78  ? 151 GLU A CA    1 
ATOM   1133  C  C     . GLU A 1 151 ? 83.222  -7.404  293.057 1.00 91.08  ? 151 GLU A C     1 
ATOM   1134  O  O     . GLU A 1 151 ? 82.107  -6.885  293.091 1.00 93.53  ? 151 GLU A O     1 
ATOM   1135  C  CB    . GLU A 1 151 ? 85.405  -6.369  293.718 1.00 86.84  ? 151 GLU A CB    1 
ATOM   1136  C  CG    . GLU A 1 151 ? 86.712  -5.681  293.328 1.00 96.11  ? 151 GLU A CG    1 
ATOM   1137  C  CD    . GLU A 1 151 ? 87.677  -6.604  292.606 1.00 102.84 ? 151 GLU A CD    1 
ATOM   1138  O  OE1   . GLU A 1 151 ? 87.423  -7.827  292.573 1.00 102.74 ? 151 GLU A OE1   1 
ATOM   1139  O  OE2   . GLU A 1 151 ? 88.692  -6.107  292.074 1.00 109.58 ? 151 GLU A OE2   1 
ATOM   1140  N  N     . ARG A 1 152 ? 83.436  -8.659  293.437 1.00 95.41  ? 152 ARG A N     1 
ATOM   1141  C  CA    . ARG A 1 152 ? 82.349  -9.459  294.003 1.00 100.02 ? 152 ARG A CA    1 
ATOM   1142  C  C     . ARG A 1 152 ? 82.738  -10.142 295.315 1.00 108.52 ? 152 ARG A C     1 
ATOM   1143  O  O     . ARG A 1 152 ? 83.879  -10.563 295.493 1.00 121.03 ? 152 ARG A O     1 
ATOM   1144  C  CB    . ARG A 1 152 ? 81.815  -10.472 292.985 1.00 85.06  ? 152 ARG A CB    1 
ATOM   1145  C  CG    . ARG A 1 152 ? 81.074  -9.827  291.825 1.00 74.69  ? 152 ARG A CG    1 
ATOM   1146  C  CD    . ARG A 1 152 ? 80.308  -10.839 290.989 1.00 89.38  ? 152 ARG A CD    1 
ATOM   1147  N  NE    . ARG A 1 152 ? 79.081  -11.306 291.631 1.00 83.68  ? 152 ARG A NE    1 
ATOM   1148  C  CZ    . ARG A 1 152 ? 77.956  -10.601 291.703 1.00 91.76  ? 152 ARG A CZ    1 
ATOM   1149  N  NH1   . ARG A 1 152 ? 77.899  -9.385  291.183 1.00 105.92 ? 152 ARG A NH1   1 
ATOM   1150  N  NH2   . ARG A 1 152 ? 76.889  -11.109 292.301 1.00 95.83  ? 152 ARG A NH2   1 
ATOM   1151  N  N     . GLU A 1 153 ? 81.783  -10.237 296.234 1.00 94.06  ? 153 GLU A N     1 
ATOM   1152  C  CA    . GLU A 1 153 ? 82.048  -10.811 297.548 1.00 96.91  ? 153 GLU A CA    1 
ATOM   1153  C  C     . GLU A 1 153 ? 80.961  -11.799 297.967 1.00 90.06  ? 153 GLU A C     1 
ATOM   1154  O  O     . GLU A 1 153 ? 79.797  -11.636 297.603 1.00 88.81  ? 153 GLU A O     1 
ATOM   1155  C  CB    . GLU A 1 153 ? 82.177  -9.701  298.594 1.00 111.47 ? 153 GLU A CB    1 
ATOM   1156  C  CG    . GLU A 1 153 ? 80.931  -8.850  298.752 1.00 120.48 ? 153 GLU A CG    1 
ATOM   1157  C  CD    . GLU A 1 153 ? 80.982  -7.960  299.975 1.00 120.19 ? 153 GLU A CD    1 
ATOM   1158  O  OE1   . GLU A 1 153 ? 80.049  -7.151  300.164 1.00 118.78 ? 153 GLU A OE1   1 
ATOM   1159  O  OE2   . GLU A 1 153 ? 81.954  -8.072  300.750 1.00 119.63 ? 153 GLU A OE2   1 
ATOM   1160  N  N     . PRO A 1 154 ? 81.344  -12.834 298.732 1.00 81.37  ? 154 PRO A N     1 
ATOM   1161  C  CA    . PRO A 1 154 ? 80.400  -13.824 299.263 1.00 77.69  ? 154 PRO A CA    1 
ATOM   1162  C  C     . PRO A 1 154 ? 79.497  -13.236 300.346 1.00 80.36  ? 154 PRO A C     1 
ATOM   1163  O  O     . PRO A 1 154 ? 79.978  -12.535 301.238 1.00 88.76  ? 154 PRO A O     1 
ATOM   1164  C  CB    . PRO A 1 154 ? 81.319  -14.889 299.870 1.00 73.49  ? 154 PRO A CB    1 
ATOM   1165  C  CG    . PRO A 1 154 ? 82.579  -14.165 300.186 1.00 72.23  ? 154 PRO A CG    1 
ATOM   1166  C  CD    . PRO A 1 154 ? 82.736  -13.147 299.100 1.00 76.13  ? 154 PRO A CD    1 
ATOM   1167  N  N     . LEU A 1 155 ? 78.200  -13.518 300.259 1.00 76.19  ? 155 LEU A N     1 
ATOM   1168  C  CA    . LEU A 1 155 ? 77.241  -13.069 301.262 1.00 78.08  ? 155 LEU A CA    1 
ATOM   1169  C  C     . LEU A 1 155 ? 77.459  -13.815 302.569 1.00 89.52  ? 155 LEU A C     1 
ATOM   1170  O  O     . LEU A 1 155 ? 77.484  -13.220 303.646 1.00 103.41 ? 155 LEU A O     1 
ATOM   1171  C  CB    . LEU A 1 155 ? 75.813  -13.297 300.766 1.00 81.16  ? 155 LEU A CB    1 
ATOM   1172  C  CG    . LEU A 1 155 ? 75.320  -12.357 299.668 1.00 87.88  ? 155 LEU A CG    1 
ATOM   1173  C  CD1   . LEU A 1 155 ? 74.098  -12.936 298.982 1.00 91.05  ? 155 LEU A CD1   1 
ATOM   1174  C  CD2   . LEU A 1 155 ? 75.003  -10.991 300.256 1.00 93.26  ? 155 LEU A CD2   1 
ATOM   1175  N  N     . VAL A 1 156 ? 77.616  -15.128 302.459 1.00 85.39  ? 156 VAL A N     1 
ATOM   1176  C  CA    . VAL A 1 156 ? 77.888  -15.976 303.607 1.00 81.81  ? 156 VAL A CA    1 
ATOM   1177  C  C     . VAL A 1 156 ? 79.045  -16.889 303.215 1.00 88.64  ? 156 VAL A C     1 
ATOM   1178  O  O     . VAL A 1 156 ? 79.344  -17.030 302.038 1.00 96.53  ? 156 VAL A O     1 
ATOM   1179  C  CB    . VAL A 1 156 ? 76.638  -16.802 303.984 1.00 77.17  ? 156 VAL A CB    1 
ATOM   1180  C  CG1   . VAL A 1 156 ? 76.322  -17.817 302.898 1.00 70.10  ? 156 VAL A CG1   1 
ATOM   1181  C  CG2   . VAL A 1 156 ? 76.810  -17.481 305.332 1.00 91.87  ? 156 VAL A CG2   1 
ATOM   1182  N  N     . LEU A 1 157 ? 79.725  -17.477 304.192 1.00 80.96  ? 157 LEU A N     1 
ATOM   1183  C  CA    . LEU A 1 157 ? 80.794  -18.425 303.898 1.00 75.33  ? 157 LEU A CA    1 
ATOM   1184  C  C     . LEU A 1 157 ? 80.282  -19.851 304.056 1.00 90.92  ? 157 LEU A C     1 
ATOM   1185  O  O     . LEU A 1 157 ? 79.256  -20.068 304.700 1.00 100.87 ? 157 LEU A O     1 
ATOM   1186  C  CB    . LEU A 1 157 ? 82.003  -18.170 304.801 1.00 66.02  ? 157 LEU A CB    1 
ATOM   1187  C  CG    . LEU A 1 157 ? 82.857  -16.958 304.416 1.00 75.11  ? 157 LEU A CG    1 
ATOM   1188  C  CD1   . LEU A 1 157 ? 84.124  -16.896 305.255 1.00 77.74  ? 157 LEU A CD1   1 
ATOM   1189  C  CD2   . LEU A 1 157 ? 83.192  -17.005 302.937 1.00 85.58  ? 157 LEU A CD2   1 
ATOM   1190  N  N     . PRO A 1 158 ? 80.978  -20.827 303.449 1.00 91.87  ? 158 PRO A N     1 
ATOM   1191  C  CA    . PRO A 1 158 ? 80.597  -22.232 303.629 1.00 93.72  ? 158 PRO A CA    1 
ATOM   1192  C  C     . PRO A 1 158 ? 80.572  -22.621 305.104 1.00 102.52 ? 158 PRO A C     1 
ATOM   1193  O  O     . PRO A 1 158 ? 79.598  -23.222 305.560 1.00 103.76 ? 158 PRO A O     1 
ATOM   1194  C  CB    . PRO A 1 158 ? 81.711  -22.986 302.904 1.00 92.10  ? 158 PRO A CB    1 
ATOM   1195  C  CG    . PRO A 1 158 ? 82.168  -22.041 301.851 1.00 98.54  ? 158 PRO A CG    1 
ATOM   1196  C  CD    . PRO A 1 158 ? 82.054  -20.671 302.454 1.00 95.48  ? 158 PRO A CD    1 
ATOM   1197  N  N     . ALA A 1 159 ? 81.632  -22.264 305.827 1.00 103.23 ? 159 ALA A N     1 
ATOM   1198  C  CA    . ALA A 1 159 ? 81.744  -22.530 307.259 1.00 100.42 ? 159 ALA A CA    1 
ATOM   1199  C  C     . ALA A 1 159 ? 81.535  -24.004 307.586 1.00 104.49 ? 159 ALA A C     1 
ATOM   1200  O  O     . ALA A 1 159 ? 80.443  -24.410 307.984 1.00 114.00 ? 159 ALA A O     1 
ATOM   1201  C  CB    . ALA A 1 159 ? 80.768  -21.663 308.044 1.00 101.39 ? 159 ALA A CB    1 
ATOM   1202  N  N     . ARG A 1 160 ? 82.587  -24.800 307.424 1.00 100.18 ? 160 ARG A N     1 
ATOM   1203  C  CA    . ARG A 1 160 ? 82.479  -26.244 307.621 1.00 100.29 ? 160 ARG A CA    1 
ATOM   1204  C  C     . ARG A 1 160 ? 82.662  -26.663 309.080 1.00 108.12 ? 160 ARG A C     1 
ATOM   1205  O  O     . ARG A 1 160 ? 82.834  -27.845 309.377 1.00 112.00 ? 160 ARG A O     1 
ATOM   1206  C  CB    . ARG A 1 160 ? 83.441  -26.997 306.701 1.00 103.46 ? 160 ARG A CB    1 
ATOM   1207  C  CG    . ARG A 1 160 ? 83.264  -26.651 305.227 1.00 105.78 ? 160 ARG A CG    1 
ATOM   1208  C  CD    . ARG A 1 160 ? 81.803  -26.709 304.804 1.00 101.28 ? 160 ARG A CD    1 
ATOM   1209  N  NE    . ARG A 1 160 ? 81.275  -28.070 304.824 1.00 97.90  ? 160 ARG A NE    1 
ATOM   1210  C  CZ    . ARG A 1 160 ? 81.334  -28.904 303.791 1.00 105.52 ? 160 ARG A CZ    1 
ATOM   1211  N  NH1   . ARG A 1 160 ? 81.896  -28.515 302.653 1.00 117.27 ? 160 ARG A NH1   1 
ATOM   1212  N  NH2   . ARG A 1 160 ? 80.833  -30.127 303.892 1.00 101.09 ? 160 ARG A NH2   1 
ATOM   1213  N  N     . PHE A 1 161 ? 82.628  -25.685 309.981 1.00 104.83 ? 161 PHE A N     1 
ATOM   1214  C  CA    . PHE A 1 161 ? 82.505  -25.953 311.411 1.00 93.07  ? 161 PHE A CA    1 
ATOM   1215  C  C     . PHE A 1 161 ? 81.612  -24.882 312.033 1.00 91.72  ? 161 PHE A C     1 
ATOM   1216  O  O     . PHE A 1 161 ? 81.699  -23.714 311.657 1.00 99.24  ? 161 PHE A O     1 
ATOM   1217  C  CB    . PHE A 1 161 ? 83.876  -26.033 312.100 1.00 95.85  ? 161 PHE A CB    1 
ATOM   1218  C  CG    . PHE A 1 161 ? 84.571  -24.708 312.255 1.00 104.21 ? 161 PHE A CG    1 
ATOM   1219  C  CD1   . PHE A 1 161 ? 85.439  -24.249 311.281 1.00 103.28 ? 161 PHE A CD1   1 
ATOM   1220  C  CD2   . PHE A 1 161 ? 84.377  -23.936 313.389 1.00 103.42 ? 161 PHE A CD2   1 
ATOM   1221  C  CE1   . PHE A 1 161 ? 86.089  -23.039 311.427 1.00 97.94  ? 161 PHE A CE1   1 
ATOM   1222  C  CE2   . PHE A 1 161 ? 85.020  -22.722 313.540 1.00 95.48  ? 161 PHE A CE2   1 
ATOM   1223  C  CZ    . PHE A 1 161 ? 85.879  -22.273 312.557 1.00 90.86  ? 161 PHE A CZ    1 
ATOM   1224  N  N     . PRO A 1 162 ? 80.743  -25.280 312.978 1.00 89.35  ? 162 PRO A N     1 
ATOM   1225  C  CA    . PRO A 1 162 ? 79.765  -24.367 313.586 1.00 85.25  ? 162 PRO A CA    1 
ATOM   1226  C  C     . PRO A 1 162 ? 80.434  -23.198 314.304 1.00 95.67  ? 162 PRO A C     1 
ATOM   1227  O  O     . PRO A 1 162 ? 80.523  -23.191 315.530 1.00 109.73 ? 162 PRO A O     1 
ATOM   1228  C  CB    . PRO A 1 162 ? 79.023  -25.263 314.584 1.00 70.58  ? 162 PRO A CB    1 
ATOM   1229  C  CG    . PRO A 1 162 ? 79.948  -26.399 314.850 1.00 76.46  ? 162 PRO A CG    1 
ATOM   1230  C  CD    . PRO A 1 162 ? 80.676  -26.629 313.564 1.00 85.65  ? 162 PRO A CD    1 
ATOM   1231  N  N     . ASN A 1 163 ? 80.880  -22.212 313.529 1.00 93.34  ? 163 ASN A N     1 
ATOM   1232  C  CA    . ASN A 1 163 ? 81.703  -21.121 314.044 1.00 88.20  ? 163 ASN A CA    1 
ATOM   1233  C  C     . ASN A 1 163 ? 80.991  -20.191 315.022 1.00 96.86  ? 163 ASN A C     1 
ATOM   1234  O  O     . ASN A 1 163 ? 81.629  -19.594 315.889 1.00 108.03 ? 163 ASN A O     1 
ATOM   1235  C  CB    . ASN A 1 163 ? 82.277  -20.302 312.887 1.00 87.58  ? 163 ASN A CB    1 
ATOM   1236  C  CG    . ASN A 1 163 ? 83.252  -19.242 313.354 1.00 97.98  ? 163 ASN A CG    1 
ATOM   1237  O  OD1   . ASN A 1 163 ? 84.085  -19.491 314.224 1.00 99.75  ? 163 ASN A OD1   1 
ATOM   1238  N  ND2   . ASN A 1 163 ? 83.143  -18.046 312.788 1.00 105.19 ? 163 ASN A ND2   1 
ATOM   1239  N  N     . LEU A 1 164 ? 79.677  -20.061 314.874 1.00 86.23  ? 164 LEU A N     1 
ATOM   1240  C  CA    . LEU A 1 164 ? 78.898  -19.180 315.737 1.00 77.41  ? 164 LEU A CA    1 
ATOM   1241  C  C     . LEU A 1 164 ? 79.006  -19.612 317.195 1.00 99.37  ? 164 LEU A C     1 
ATOM   1242  O  O     . LEU A 1 164 ? 79.442  -18.840 318.046 1.00 111.81 ? 164 LEU A O     1 
ATOM   1243  C  CB    . LEU A 1 164 ? 77.431  -19.160 315.307 1.00 69.37  ? 164 LEU A CB    1 
ATOM   1244  C  CG    . LEU A 1 164 ? 76.618  -17.873 315.509 1.00 74.17  ? 164 LEU A CG    1 
ATOM   1245  C  CD1   . LEU A 1 164 ? 75.215  -18.204 315.996 1.00 69.78  ? 164 LEU A CD1   1 
ATOM   1246  C  CD2   . LEU A 1 164 ? 77.298  -16.872 316.441 1.00 62.57  ? 164 LEU A CD2   1 
ATOM   1247  N  N     . LEU A 1 165 ? 78.603  -20.845 317.478 1.00 101.30 ? 165 LEU A N     1 
ATOM   1248  C  CA    . LEU A 1 165 ? 78.639  -21.364 318.840 1.00 102.58 ? 165 LEU A CA    1 
ATOM   1249  C  C     . LEU A 1 165 ? 80.067  -21.587 319.320 1.00 102.63 ? 165 LEU A C     1 
ATOM   1250  O  O     . LEU A 1 165 ? 80.405  -21.286 320.464 1.00 110.70 ? 165 LEU A O     1 
ATOM   1251  C  CB    . LEU A 1 165 ? 77.851  -22.671 318.931 1.00 100.32 ? 165 LEU A CB    1 
ATOM   1252  C  CG    . LEU A 1 165 ? 76.334  -22.546 318.793 1.00 100.32 ? 165 LEU A CG    1 
ATOM   1253  C  CD1   . LEU A 1 165 ? 75.698  -23.913 318.629 1.00 100.67 ? 165 LEU A CD1   1 
ATOM   1254  C  CD2   . LEU A 1 165 ? 75.760  -21.827 320.003 1.00 101.16 ? 165 LEU A CD2   1 
ATOM   1255  N  N     . VAL A 1 166 ? 80.901  -22.112 318.430 1.00 87.36  ? 166 VAL A N     1 
ATOM   1256  C  CA    . VAL A 1 166 ? 82.275  -22.467 318.760 1.00 82.65  ? 166 VAL A CA    1 
ATOM   1257  C  C     . VAL A 1 166 ? 83.140  -21.257 319.130 1.00 94.02  ? 166 VAL A C     1 
ATOM   1258  O  O     . VAL A 1 166 ? 83.882  -21.295 320.113 1.00 104.67 ? 166 VAL A O     1 
ATOM   1259  C  CB    . VAL A 1 166 ? 82.920  -23.270 317.607 1.00 77.08  ? 166 VAL A CB    1 
ATOM   1260  C  CG1   . VAL A 1 166 ? 84.426  -23.165 317.645 1.00 69.18  ? 166 VAL A CG1   1 
ATOM   1261  C  CG2   . VAL A 1 166 ? 82.465  -24.727 317.650 1.00 75.54  ? 166 VAL A CG2   1 
ATOM   1262  N  N     . ASN A 1 167 ? 83.038  -20.182 318.352 1.00 95.08  ? 167 ASN A N     1 
ATOM   1263  C  CA    . ASN A 1 167 ? 83.833  -18.978 318.612 1.00 88.06  ? 167 ASN A CA    1 
ATOM   1264  C  C     . ASN A 1 167 ? 83.094  -17.874 319.372 1.00 88.91  ? 167 ASN A C     1 
ATOM   1265  O  O     . ASN A 1 167 ? 83.718  -16.938 319.871 1.00 90.41  ? 167 ASN A O     1 
ATOM   1266  C  CB    . ASN A 1 167 ? 84.418  -18.416 317.315 1.00 78.35  ? 167 ASN A CB    1 
ATOM   1267  C  CG    . ASN A 1 167 ? 85.813  -18.939 317.028 1.00 89.78  ? 167 ASN A CG    1 
ATOM   1268  O  OD1   . ASN A 1 167 ? 86.563  -19.278 317.944 1.00 99.26  ? 167 ASN A OD1   1 
ATOM   1269  N  ND2   . ASN A 1 167 ? 86.168  -19.004 315.747 1.00 99.14  ? 167 ASN A ND2   1 
ATOM   1270  N  N     . GLY A 1 168 ? 81.771  -17.982 319.460 1.00 89.35  ? 168 GLY A N     1 
ATOM   1271  C  CA    . GLY A 1 168 ? 80.972  -16.980 320.145 1.00 93.75  ? 168 GLY A CA    1 
ATOM   1272  C  C     . GLY A 1 168 ? 80.800  -15.714 319.324 1.00 104.58 ? 168 GLY A C     1 
ATOM   1273  O  O     . GLY A 1 168 ? 81.308  -15.623 318.207 1.00 116.93 ? 168 GLY A O     1 
ATOM   1274  N  N     . ALA A 1 169 ? 80.093  -14.730 319.875 1.00 103.89 ? 169 ALA A N     1 
ATOM   1275  C  CA    . ALA A 1 169 ? 79.826  -13.489 319.146 1.00 109.35 ? 169 ALA A CA    1 
ATOM   1276  C  C     . ALA A 1 169 ? 79.497  -12.305 320.057 1.00 105.15 ? 169 ALA A C     1 
ATOM   1277  O  O     . ALA A 1 169 ? 78.913  -12.477 321.127 1.00 102.14 ? 169 ALA A O     1 
ATOM   1278  C  CB    . ALA A 1 169 ? 78.704  -13.704 318.133 1.00 121.31 ? 169 ALA A CB    1 
ATOM   1279  N  N     . THR A 1 170 ? 79.871  -11.106 319.608 1.00 107.59 ? 170 THR A N     1 
ATOM   1280  C  CA    . THR A 1 170 ? 79.619  -9.859  320.334 1.00 106.54 ? 170 THR A CA    1 
ATOM   1281  C  C     . THR A 1 170 ? 79.904  -8.654  319.427 1.00 112.03 ? 170 THR A C     1 
ATOM   1282  O  O     . THR A 1 170 ? 80.884  -8.664  318.680 1.00 128.71 ? 170 THR A O     1 
ATOM   1283  C  CB    . THR A 1 170 ? 80.492  -9.762  321.607 1.00 103.29 ? 170 THR A CB    1 
ATOM   1284  O  OG1   . THR A 1 170 ? 80.492  -8.415  322.098 1.00 117.48 ? 170 THR A OG1   1 
ATOM   1285  C  CG2   . THR A 1 170 ? 81.919  -10.186 321.306 1.00 94.82  ? 170 THR A CG2   1 
ATOM   1286  N  N     . GLY A 1 171 ? 79.063  -7.620  319.488 1.00 98.12  ? 171 GLY A N     1 
ATOM   1287  C  CA    . GLY A 1 171 ? 77.915  -7.596  320.375 1.00 87.81  ? 171 GLY A CA    1 
ATOM   1288  C  C     . GLY A 1 171 ? 76.953  -6.431  320.198 1.00 88.02  ? 171 GLY A C     1 
ATOM   1289  O  O     . GLY A 1 171 ? 75.768  -6.639  319.937 1.00 99.44  ? 171 GLY A O     1 
ATOM   1290  N  N     . ILE A 1 172 ? 77.459  -5.207  320.323 1.00 81.05  ? 172 ILE A N     1 
ATOM   1291  C  CA    . ILE A 1 172 ? 76.606  -4.021  320.453 1.00 81.34  ? 172 ILE A CA    1 
ATOM   1292  C  C     . ILE A 1 172 ? 76.058  -3.469  319.137 1.00 91.69  ? 172 ILE A C     1 
ATOM   1293  O  O     . ILE A 1 172 ? 76.817  -3.039  318.270 1.00 103.14 ? 172 ILE A O     1 
ATOM   1294  C  CB    . ILE A 1 172 ? 77.353  -2.885  321.179 1.00 75.75  ? 172 ILE A CB    1 
ATOM   1295  C  CG1   . ILE A 1 172 ? 78.182  -3.452  322.332 1.00 77.14  ? 172 ILE A CG1   1 
ATOM   1296  C  CG2   . ILE A 1 172 ? 76.375  -1.821  321.668 1.00 83.25  ? 172 ILE A CG2   1 
ATOM   1297  C  CD1   . ILE A 1 172 ? 79.028  -2.422  323.040 1.00 80.67  ? 172 ILE A CD1   1 
ATOM   1298  N  N     . ALA A 1 173 ? 74.732  -3.454  319.015 1.00 85.20  ? 173 ALA A N     1 
ATOM   1299  C  CA    . ALA A 1 173 ? 74.065  -2.902  317.838 1.00 77.58  ? 173 ALA A CA    1 
ATOM   1300  C  C     . ALA A 1 173 ? 73.307  -1.621  318.174 1.00 93.26  ? 173 ALA A C     1 
ATOM   1301  O  O     . ALA A 1 173 ? 73.801  -0.776  318.919 1.00 106.21 ? 173 ALA A O     1 
ATOM   1302  C  CB    . ALA A 1 173 ? 73.123  -3.929  317.236 1.00 72.89  ? 173 ALA A CB    1 
ATOM   1303  N  N     . VAL A 1 174 ? 72.109  -1.479  317.611 1.00 87.98  ? 174 VAL A N     1 
ATOM   1304  C  CA    . VAL A 1 174 ? 71.227  -0.362  317.941 1.00 100.81 ? 174 VAL A CA    1 
ATOM   1305  C  C     . VAL A 1 174 ? 69.837  -0.887  318.284 1.00 105.86 ? 174 VAL A C     1 
ATOM   1306  O  O     . VAL A 1 174 ? 69.105  -1.354  317.410 1.00 107.31 ? 174 VAL A O     1 
ATOM   1307  C  CB    . VAL A 1 174 ? 71.114  0.657   316.787 1.00 102.54 ? 174 VAL A CB    1 
ATOM   1308  C  CG1   . VAL A 1 174 ? 70.094  1.735   317.133 1.00 80.02  ? 174 VAL A CG1   1 
ATOM   1309  C  CG2   . VAL A 1 174 ? 72.470  1.282   316.489 1.00 99.45  ? 174 VAL A CG2   1 
ATOM   1310  N  N     . GLY A 1 175 ? 69.480  -0.812  319.561 1.00 105.89 ? 175 GLY A N     1 
ATOM   1311  C  CA    . GLY A 1 175 ? 68.224  -1.365  320.031 1.00 107.77 ? 175 GLY A CA    1 
ATOM   1312  C  C     . GLY A 1 175 ? 68.393  -2.820  320.419 1.00 105.13 ? 175 GLY A C     1 
ATOM   1313  O  O     . GLY A 1 175 ? 67.487  -3.433  320.985 1.00 104.73 ? 175 GLY A O     1 
ATOM   1314  N  N     . MET A 1 176 ? 69.564  -3.371  320.112 1.00 102.12 ? 176 MET A N     1 
ATOM   1315  C  CA    . MET A 1 176 ? 69.879  -4.760  320.417 1.00 112.28 ? 176 MET A CA    1 
ATOM   1316  C  C     . MET A 1 176 ? 71.352  -4.924  320.764 1.00 116.12 ? 176 MET A C     1 
ATOM   1317  O  O     . MET A 1 176 ? 72.151  -4.009  320.566 1.00 122.71 ? 176 MET A O     1 
ATOM   1318  C  CB    . MET A 1 176 ? 69.543  -5.659  319.225 1.00 123.88 ? 176 MET A CB    1 
ATOM   1319  C  CG    . MET A 1 176 ? 68.067  -5.952  319.054 1.00 136.04 ? 176 MET A CG    1 
ATOM   1320  S  SD    . MET A 1 176 ? 67.705  -6.510  317.382 1.00 160.80 ? 176 MET A SD    1 
ATOM   1321  C  CE    . MET A 1 176 ? 68.236  -5.078  316.456 1.00 75.60  ? 176 MET A CE    1 
ATOM   1322  N  N     . ALA A 1 177 ? 71.699  -6.099  321.279 1.00 112.29 ? 177 ALA A N     1 
ATOM   1323  C  CA    . ALA A 1 177 ? 73.083  -6.448  321.576 1.00 108.39 ? 177 ALA A CA    1 
ATOM   1324  C  C     . ALA A 1 177 ? 73.192  -7.955  321.747 1.00 103.73 ? 177 ALA A C     1 
ATOM   1325  O  O     . ALA A 1 177 ? 72.446  -8.547  322.523 1.00 116.10 ? 177 ALA A O     1 
ATOM   1326  C  CB    . ALA A 1 177 ? 73.557  -5.741  322.832 1.00 122.54 ? 177 ALA A CB    1 
ATOM   1327  N  N     . THR A 1 178 ? 74.115  -8.578  321.022 1.00 93.67  ? 178 THR A N     1 
ATOM   1328  C  CA    . THR A 1 178 ? 74.278  -10.025 321.109 1.00 95.88  ? 178 THR A CA    1 
ATOM   1329  C  C     . THR A 1 178 ? 75.414  -10.410 322.051 1.00 93.67  ? 178 THR A C     1 
ATOM   1330  O  O     . THR A 1 178 ? 76.391  -9.676  322.200 1.00 96.36  ? 178 THR A O     1 
ATOM   1331  C  CB    . THR A 1 178 ? 74.509  -10.668 319.719 1.00 96.14  ? 178 THR A CB    1 
ATOM   1332  O  OG1   . THR A 1 178 ? 74.402  -12.094 319.823 1.00 96.03  ? 178 THR A OG1   1 
ATOM   1333  C  CG2   . THR A 1 178 ? 75.880  -10.304 319.166 1.00 84.60  ? 178 THR A CG2   1 
ATOM   1334  N  N     . ASN A 1 179 ? 75.266  -11.558 322.702 1.00 95.43  ? 179 ASN A N     1 
ATOM   1335  C  CA    . ASN A 1 179 ? 76.326  -12.102 323.540 1.00 96.48  ? 179 ASN A CA    1 
ATOM   1336  C  C     . ASN A 1 179 ? 76.280  -13.624 323.558 1.00 94.18  ? 179 ASN A C     1 
ATOM   1337  O  O     . ASN A 1 179 ? 75.376  -14.226 324.138 1.00 97.59  ? 179 ASN A O     1 
ATOM   1338  C  CB    . ASN A 1 179 ? 76.252  -11.547 324.962 1.00 90.36  ? 179 ASN A CB    1 
ATOM   1339  C  CG    . ASN A 1 179 ? 77.594  -11.591 325.670 1.00 95.61  ? 179 ASN A CG    1 
ATOM   1340  O  OD1   . ASN A 1 179 ? 78.488  -12.344 325.283 1.00 96.69  ? 179 ASN A OD1   1 
ATOM   1341  N  ND2   . ASN A 1 179 ? 77.743  -10.776 326.709 1.00 115.76 ? 179 ASN A ND2   1 
ATOM   1342  N  N     . ILE A 1 180 ? 77.260  -14.233 322.901 1.00 91.93  ? 180 ILE A N     1 
ATOM   1343  C  CA    . ILE A 1 180 ? 77.354  -15.681 322.808 1.00 99.46  ? 180 ILE A CA    1 
ATOM   1344  C  C     . ILE A 1 180 ? 78.758  -16.106 323.213 1.00 107.18 ? 180 ILE A C     1 
ATOM   1345  O  O     . ILE A 1 180 ? 79.743  -15.546 322.732 1.00 119.35 ? 180 ILE A O     1 
ATOM   1346  C  CB    . ILE A 1 180 ? 77.059  -16.167 321.375 1.00 93.69  ? 180 ILE A CB    1 
ATOM   1347  C  CG1   . ILE A 1 180 ? 75.633  -15.784 320.966 1.00 87.53  ? 180 ILE A CG1   1 
ATOM   1348  C  CG2   . ILE A 1 180 ? 77.264  -17.668 321.259 1.00 91.31  ? 180 ILE A CG2   1 
ATOM   1349  C  CD1   . ILE A 1 180 ? 75.299  -16.069 319.513 1.00 78.02  ? 180 ILE A CD1   1 
ATOM   1350  N  N     . PRO A 1 181 ? 78.857  -17.085 324.122 1.00 95.01  ? 181 PRO A N     1 
ATOM   1351  C  CA    . PRO A 1 181 ? 80.170  -17.547 324.573 1.00 85.14  ? 181 PRO A CA    1 
ATOM   1352  C  C     . PRO A 1 181 ? 80.754  -18.541 323.586 1.00 82.16  ? 181 PRO A C     1 
ATOM   1353  O  O     . PRO A 1 181 ? 79.998  -19.164 322.841 1.00 91.08  ? 181 PRO A O     1 
ATOM   1354  C  CB    . PRO A 1 181 ? 79.846  -18.259 325.881 1.00 90.44  ? 181 PRO A CB    1 
ATOM   1355  C  CG    . PRO A 1 181 ? 78.486  -18.798 325.656 1.00 90.43  ? 181 PRO A CG    1 
ATOM   1356  C  CD    . PRO A 1 181 ? 77.761  -17.776 324.824 1.00 91.62  ? 181 PRO A CD    1 
ATOM   1357  N  N     . PRO A 1 182 ? 82.087  -18.685 323.572 1.00 83.32  ? 182 PRO A N     1 
ATOM   1358  C  CA    . PRO A 1 182 ? 82.723  -19.713 322.744 1.00 87.46  ? 182 PRO A CA    1 
ATOM   1359  C  C     . PRO A 1 182 ? 82.369  -21.111 323.244 1.00 94.79  ? 182 PRO A C     1 
ATOM   1360  O  O     . PRO A 1 182 ? 81.983  -21.272 324.402 1.00 98.34  ? 182 PRO A O     1 
ATOM   1361  C  CB    . PRO A 1 182 ? 84.218  -19.450 322.947 1.00 87.73  ? 182 PRO A CB    1 
ATOM   1362  C  CG    . PRO A 1 182 ? 84.306  -18.029 323.419 1.00 85.97  ? 182 PRO A CG    1 
ATOM   1363  C  CD    . PRO A 1 182 ? 83.078  -17.829 324.247 1.00 86.39  ? 182 PRO A CD    1 
ATOM   1364  N  N     . HIS A 1 183 ? 82.499  -22.110 322.380 1.00 91.13  ? 183 HIS A N     1 
ATOM   1365  C  CA    . HIS A 1 183 ? 82.246  -23.490 322.776 1.00 93.84  ? 183 HIS A CA    1 
ATOM   1366  C  C     . HIS A 1 183 ? 83.354  -24.399 322.267 1.00 101.05 ? 183 HIS A C     1 
ATOM   1367  O  O     . HIS A 1 183 ? 84.126  -24.015 321.387 1.00 112.41 ? 183 HIS A O     1 
ATOM   1368  C  CB    . HIS A 1 183 ? 80.893  -23.968 322.245 1.00 98.31  ? 183 HIS A CB    1 
ATOM   1369  C  CG    . HIS A 1 183 ? 79.720  -23.330 322.920 1.00 104.05 ? 183 HIS A CG    1 
ATOM   1370  N  ND1   . HIS A 1 183 ? 79.414  -21.994 322.778 1.00 101.83 ? 183 HIS A ND1   1 
ATOM   1371  C  CD2   . HIS A 1 183 ? 78.776  -23.847 323.741 1.00 109.83 ? 183 HIS A CD2   1 
ATOM   1372  C  CE1   . HIS A 1 183 ? 78.331  -21.715 323.484 1.00 105.64 ? 183 HIS A CE1   1 
ATOM   1373  N  NE2   . HIS A 1 183 ? 77.925  -22.822 324.077 1.00 111.38 ? 183 HIS A NE2   1 
ATOM   1374  N  N     . ASN A 1 184 ? 83.435  -25.602 322.825 1.00 102.31 ? 184 ASN A N     1 
ATOM   1375  C  CA    . ASN A 1 184 ? 84.390  -26.595 322.346 1.00 104.75 ? 184 ASN A CA    1 
ATOM   1376  C  C     . ASN A 1 184 ? 83.983  -27.136 320.978 1.00 102.60 ? 184 ASN A C     1 
ATOM   1377  O  O     . ASN A 1 184 ? 82.802  -27.373 320.725 1.00 103.79 ? 184 ASN A O     1 
ATOM   1378  C  CB    . ASN A 1 184 ? 84.529  -27.740 323.349 1.00 108.82 ? 184 ASN A CB    1 
ATOM   1379  C  CG    . ASN A 1 184 ? 85.488  -28.817 322.876 1.00 110.67 ? 184 ASN A CG    1 
ATOM   1380  O  OD1   . ASN A 1 184 ? 85.078  -29.810 322.276 1.00 113.70 ? 184 ASN A OD1   1 
ATOM   1381  N  ND2   . ASN A 1 184 ? 86.774  -28.624 323.143 1.00 109.42 ? 184 ASN A ND2   1 
ATOM   1382  N  N     . LEU A 1 185 ? 84.965  -27.327 320.102 1.00 97.85  ? 185 LEU A N     1 
ATOM   1383  C  CA    . LEU A 1 185 ? 84.711  -27.800 318.744 1.00 94.43  ? 185 LEU A CA    1 
ATOM   1384  C  C     . LEU A 1 185 ? 84.016  -29.160 318.748 1.00 98.73  ? 185 LEU A C     1 
ATOM   1385  O  O     . LEU A 1 185 ? 82.873  -29.293 318.290 1.00 102.35 ? 185 LEU A O     1 
ATOM   1386  C  CB    . LEU A 1 185 ? 86.027  -27.903 317.969 1.00 86.36  ? 185 LEU A CB    1 
ATOM   1387  C  CG    . LEU A 1 185 ? 86.072  -27.350 316.542 1.00 84.84  ? 185 LEU A CG    1 
ATOM   1388  C  CD1   . LEU A 1 185 ? 87.306  -27.869 315.815 1.00 87.08  ? 185 LEU A CD1   1 
ATOM   1389  C  CD2   . LEU A 1 185 ? 84.803  -27.683 315.768 1.00 80.48  ? 185 LEU A CD2   1 
ATOM   1390  N  N     . GLY A 1 186 ? 84.720  -30.159 319.273 1.00 93.68  ? 186 GLY A N     1 
ATOM   1391  C  CA    . GLY A 1 186 ? 84.234  -31.526 319.302 1.00 87.99  ? 186 GLY A CA    1 
ATOM   1392  C  C     . GLY A 1 186 ? 82.855  -31.671 319.914 1.00 95.17  ? 186 GLY A C     1 
ATOM   1393  O  O     . GLY A 1 186 ? 82.032  -32.436 319.417 1.00 102.11 ? 186 GLY A O     1 
ATOM   1394  N  N     . GLU A 1 187 ? 82.598  -30.926 320.984 1.00 98.92  ? 187 GLU A N     1 
ATOM   1395  C  CA    . GLU A 1 187 ? 81.309  -30.985 321.664 1.00 101.66 ? 187 GLU A CA    1 
ATOM   1396  C  C     . GLU A 1 187 ? 80.183  -30.420 320.801 1.00 108.82 ? 187 GLU A C     1 
ATOM   1397  O  O     . GLU A 1 187 ? 79.119  -31.028 320.684 1.00 122.34 ? 187 GLU A O     1 
ATOM   1398  C  CB    . GLU A 1 187 ? 81.371  -30.246 323.001 1.00 96.55  ? 187 GLU A CB    1 
ATOM   1399  C  CG    . GLU A 1 187 ? 82.309  -30.876 324.016 1.00 104.55 ? 187 GLU A CG    1 
ATOM   1400  C  CD    . GLU A 1 187 ? 82.287  -30.159 325.351 1.00 112.14 ? 187 GLU A CD    1 
ATOM   1401  O  OE1   . GLU A 1 187 ? 81.754  -29.031 325.412 1.00 118.03 ? 187 GLU A OE1   1 
ATOM   1402  O  OE2   . GLU A 1 187 ? 82.799  -30.724 326.340 1.00 106.68 ? 187 GLU A OE2   1 
ATOM   1403  N  N     . THR A 1 188 ? 80.425  -29.257 320.203 1.00 98.57  ? 188 THR A N     1 
ATOM   1404  C  CA    . THR A 1 188 ? 79.440  -28.613 319.342 1.00 97.20  ? 188 THR A CA    1 
ATOM   1405  C  C     . THR A 1 188 ? 79.132  -29.496 318.137 1.00 104.29 ? 188 THR A C     1 
ATOM   1406  O  O     . THR A 1 188 ? 77.982  -29.595 317.701 1.00 114.42 ? 188 THR A O     1 
ATOM   1407  C  CB    . THR A 1 188 ? 79.929  -27.235 318.858 1.00 94.29  ? 188 THR A CB    1 
ATOM   1408  O  OG1   . THR A 1 188 ? 80.493  -26.511 319.959 1.00 95.10  ? 188 THR A OG1   1 
ATOM   1409  C  CG2   . THR A 1 188 ? 78.779  -26.437 318.265 1.00 94.20  ? 188 THR A CG2   1 
ATOM   1410  N  N     . ILE A 1 189 ? 80.165  -30.145 317.610 1.00 98.72  ? 189 ILE A N     1 
ATOM   1411  C  CA    . ILE A 1 189 ? 79.988  -31.068 316.492 1.00 96.59  ? 189 ILE A CA    1 
ATOM   1412  C  C     . ILE A 1 189 ? 79.190  -32.301 316.917 1.00 100.22 ? 189 ILE A C     1 
ATOM   1413  O  O     . ILE A 1 189 ? 78.333  -32.782 316.171 1.00 99.42  ? 189 ILE A O     1 
ATOM   1414  C  CB    . ILE A 1 189 ? 81.344  -31.477 315.875 1.00 95.93  ? 189 ILE A CB    1 
ATOM   1415  C  CG1   . ILE A 1 189 ? 81.925  -30.316 315.068 1.00 79.99  ? 189 ILE A CG1   1 
ATOM   1416  C  CG2   . ILE A 1 189 ? 81.194  -32.706 314.991 1.00 107.74 ? 189 ILE A CG2   1 
ATOM   1417  C  CD1   . ILE A 1 189 ? 83.185  -30.669 314.316 1.00 73.74  ? 189 ILE A CD1   1 
ATOM   1418  N  N     . ASP A 1 190 ? 79.465  -32.801 318.120 1.00 101.87 ? 190 ASP A N     1 
ATOM   1419  C  CA    . ASP A 1 190 ? 78.717  -33.930 318.663 1.00 104.52 ? 190 ASP A CA    1 
ATOM   1420  C  C     . ASP A 1 190 ? 77.244  -33.571 318.814 1.00 105.95 ? 190 ASP A C     1 
ATOM   1421  O  O     . ASP A 1 190 ? 76.367  -34.394 318.557 1.00 110.26 ? 190 ASP A O     1 
ATOM   1422  C  CB    . ASP A 1 190 ? 79.289  -34.369 320.012 1.00 111.20 ? 190 ASP A CB    1 
ATOM   1423  C  CG    . ASP A 1 190 ? 80.672  -34.980 319.890 1.00 126.09 ? 190 ASP A CG    1 
ATOM   1424  O  OD1   . ASP A 1 190 ? 80.994  -35.519 318.809 1.00 134.73 ? 190 ASP A OD1   1 
ATOM   1425  O  OD2   . ASP A 1 190 ? 81.439  -34.918 320.875 1.00 122.63 ? 190 ASP A OD2   1 
ATOM   1426  N  N     . ALA A 1 191 ? 76.980  -32.335 319.228 1.00 103.79 ? 191 ALA A N     1 
ATOM   1427  C  CA    . ALA A 1 191 ? 75.614  -31.847 319.373 1.00 109.45 ? 191 ALA A CA    1 
ATOM   1428  C  C     . ALA A 1 191 ? 74.933  -31.723 318.014 1.00 114.00 ? 191 ALA A C     1 
ATOM   1429  O  O     . ALA A 1 191 ? 73.754  -32.053 317.869 1.00 115.42 ? 191 ALA A O     1 
ATOM   1430  C  CB    . ALA A 1 191 ? 75.604  -30.511 320.098 1.00 107.16 ? 191 ALA A CB    1 
ATOM   1431  N  N     . VAL A 1 192 ? 75.683  -31.243 317.025 1.00 111.00 ? 192 VAL A N     1 
ATOM   1432  C  CA    . VAL A 1 192 ? 75.173  -31.105 315.664 1.00 100.50 ? 192 VAL A CA    1 
ATOM   1433  C  C     . VAL A 1 192 ? 74.776  -32.462 315.084 1.00 95.55  ? 192 VAL A C     1 
ATOM   1434  O  O     . VAL A 1 192 ? 73.676  -32.622 314.547 1.00 101.11 ? 192 VAL A O     1 
ATOM   1435  C  CB    . VAL A 1 192 ? 76.209  -30.440 314.738 1.00 91.01  ? 192 VAL A CB    1 
ATOM   1436  N  N     . LYS A 1 193 ? 75.677  -33.433 315.201 1.00 86.68  ? 193 LYS A N     1 
ATOM   1437  C  CA    . LYS A 1 193 ? 75.415  -34.792 314.741 1.00 92.22  ? 193 LYS A CA    1 
ATOM   1438  C  C     . LYS A 1 193 ? 74.245  -35.402 315.507 1.00 101.49 ? 193 LYS A C     1 
ATOM   1439  O  O     . LYS A 1 193 ? 73.432  -36.140 314.944 1.00 102.69 ? 193 LYS A O     1 
ATOM   1440  C  CB    . LYS A 1 193 ? 76.664  -35.661 314.910 1.00 91.53  ? 193 LYS A CB    1 
ATOM   1441  C  CG    . LYS A 1 193 ? 77.821  -35.294 313.996 1.00 99.19  ? 193 LYS A CG    1 
ATOM   1442  C  CD    . LYS A 1 193 ? 79.090  -36.037 314.383 1.00 103.36 ? 193 LYS A CD    1 
ATOM   1443  C  CE    . LYS A 1 193 ? 78.856  -37.537 314.454 1.00 115.10 ? 193 LYS A CE    1 
ATOM   1444  N  NZ    . LYS A 1 193 ? 80.065  -38.274 314.919 1.00 119.54 ? 193 LYS A NZ    1 
ATOM   1445  N  N     . LEU A 1 194 ? 74.172  -35.083 316.796 1.00 109.13 ? 194 LEU A N     1 
ATOM   1446  C  CA    . LEU A 1 194 ? 73.116  -35.591 317.660 1.00 113.91 ? 194 LEU A CA    1 
ATOM   1447  C  C     . LEU A 1 194 ? 71.760  -35.124 317.153 1.00 113.40 ? 194 LEU A C     1 
ATOM   1448  O  O     . LEU A 1 194 ? 70.850  -35.931 316.950 1.00 118.56 ? 194 LEU A O     1 
ATOM   1449  C  CB    . LEU A 1 194 ? 73.319  -35.108 319.097 1.00 111.09 ? 194 LEU A CB    1 
ATOM   1450  C  CG    . LEU A 1 194 ? 72.524  -35.842 320.178 1.00 103.01 ? 194 LEU A CG    1 
ATOM   1451  C  CD1   . LEU A 1 194 ? 73.248  -37.118 320.572 1.00 99.78  ? 194 LEU A CD1   1 
ATOM   1452  C  CD2   . LEU A 1 194 ? 72.278  -34.956 321.393 1.00 107.25 ? 194 LEU A CD2   1 
ATOM   1453  N  N     . VAL A 1 195 ? 71.640  -33.816 316.940 1.00 108.38 ? 195 VAL A N     1 
ATOM   1454  C  CA    . VAL A 1 195 ? 70.414  -33.227 316.418 1.00 106.81 ? 195 VAL A CA    1 
ATOM   1455  C  C     . VAL A 1 195 ? 70.099  -33.759 315.024 1.00 113.94 ? 195 VAL A C     1 
ATOM   1456  O  O     . VAL A 1 195 ? 68.933  -33.920 314.666 1.00 121.74 ? 195 VAL A O     1 
ATOM   1457  C  CB    . VAL A 1 195 ? 70.501  -31.691 316.365 1.00 76.59  ? 195 VAL A CB    1 
ATOM   1458  N  N     . MET A 1 196 ? 71.141  -34.023 314.240 1.00 112.95 ? 196 MET A N     1 
ATOM   1459  C  CA    . MET A 1 196 ? 70.958  -34.593 312.908 1.00 109.30 ? 196 MET A CA    1 
ATOM   1460  C  C     . MET A 1 196 ? 70.335  -35.983 312.968 1.00 110.87 ? 196 MET A C     1 
ATOM   1461  O  O     . MET A 1 196 ? 69.465  -36.316 312.163 1.00 119.38 ? 196 MET A O     1 
ATOM   1462  C  CB    . MET A 1 196 ? 72.285  -34.653 312.149 1.00 108.05 ? 196 MET A CB    1 
ATOM   1463  C  CG    . MET A 1 196 ? 72.722  -33.335 311.535 1.00 109.54 ? 196 MET A CG    1 
ATOM   1464  S  SD    . MET A 1 196 ? 74.168  -33.518 310.480 1.00 95.11  ? 196 MET A SD    1 
ATOM   1465  C  CE    . MET A 1 196 ? 73.534  -34.659 309.254 1.00 178.61 ? 196 MET A CE    1 
ATOM   1466  N  N     . ASP A 1 197 ? 70.784  -36.793 313.921 1.00 109.06 ? 197 ASP A N     1 
ATOM   1467  C  CA    . ASP A 1 197 ? 70.272  -38.154 314.051 1.00 116.77 ? 197 ASP A CA    1 
ATOM   1468  C  C     . ASP A 1 197 ? 68.909  -38.197 314.737 1.00 120.19 ? 197 ASP A C     1 
ATOM   1469  O  O     . ASP A 1 197 ? 67.910  -38.568 314.120 1.00 123.28 ? 197 ASP A O     1 
ATOM   1470  C  CB    . ASP A 1 197 ? 71.279  -39.047 314.775 1.00 127.86 ? 197 ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1 197 ? 72.541  -39.275 313.963 1.00 132.44 ? 197 ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1 197 ? 72.507  -39.047 312.736 1.00 135.30 ? 197 ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1 197 ? 73.563  -39.686 314.550 1.00 134.79 ? 197 ASP A OD2   1 
ATOM   1474  N  N     . ASN A 1 198 ? 68.872  -37.817 316.010 1.00 122.40 ? 198 ASN A N     1 
ATOM   1475  C  CA    . ASN A 1 198 ? 67.621  -37.764 316.757 1.00 125.46 ? 198 ASN A CA    1 
ATOM   1476  C  C     . ASN A 1 198 ? 67.065  -36.344 316.808 1.00 131.62 ? 198 ASN A C     1 
ATOM   1477  O  O     . ASN A 1 198 ? 67.539  -35.515 317.586 1.00 139.48 ? 198 ASN A O     1 
ATOM   1478  C  CB    . ASN A 1 198 ? 67.818  -38.307 318.172 1.00 120.63 ? 198 ASN A CB    1 
ATOM   1479  N  N     . PRO A 1 199 ? 66.050  -36.061 315.976 1.00 122.02 ? 199 PRO A N     1 
ATOM   1480  C  CA    . PRO A 1 199 ? 65.493  -34.712 315.836 1.00 112.72 ? 199 PRO A CA    1 
ATOM   1481  C  C     . PRO A 1 199 ? 64.508  -34.363 316.945 1.00 119.25 ? 199 PRO A C     1 
ATOM   1482  O  O     . PRO A 1 199 ? 64.146  -33.196 317.096 1.00 109.89 ? 199 PRO A O     1 
ATOM   1483  C  CB    . PRO A 1 199 ? 64.761  -34.789 314.499 1.00 110.15 ? 199 PRO A CB    1 
ATOM   1484  C  CG    . PRO A 1 199 ? 64.292  -36.200 314.433 1.00 115.29 ? 199 PRO A CG    1 
ATOM   1485  C  CD    . PRO A 1 199 ? 65.350  -37.033 315.116 1.00 115.49 ? 199 PRO A CD    1 
ATOM   1486  N  N     . GLU A 1 200 ? 64.078  -35.365 317.705 1.00 132.01 ? 200 GLU A N     1 
ATOM   1487  C  CA    . GLU A 1 200 ? 63.167  -35.149 318.823 1.00 132.21 ? 200 GLU A CA    1 
ATOM   1488  C  C     . GLU A 1 200 ? 63.949  -35.026 320.128 1.00 130.80 ? 200 GLU A C     1 
ATOM   1489  O  O     . GLU A 1 200 ? 63.418  -35.276 321.210 1.00 133.26 ? 200 GLU A O     1 
ATOM   1490  C  CB    . GLU A 1 200 ? 62.152  -36.289 318.915 1.00 126.68 ? 200 GLU A CB    1 
ATOM   1491  N  N     . VAL A 1 201 ? 65.216  -34.641 320.013 1.00 125.64 ? 201 VAL A N     1 
ATOM   1492  C  CA    . VAL A 1 201 ? 66.088  -34.512 321.171 1.00 122.94 ? 201 VAL A CA    1 
ATOM   1493  C  C     . VAL A 1 201 ? 65.716  -33.293 322.004 1.00 130.86 ? 201 VAL A C     1 
ATOM   1494  O  O     . VAL A 1 201 ? 65.427  -32.223 321.466 1.00 134.38 ? 201 VAL A O     1 
ATOM   1495  C  CB    . VAL A 1 201 ? 67.571  -34.409 320.757 1.00 106.79 ? 201 VAL A CB    1 
ATOM   1496  N  N     . THR A 1 202 ? 65.716  -33.463 323.322 1.00 133.38 ? 202 THR A N     1 
ATOM   1497  C  CA    . THR A 1 202 ? 65.435  -32.361 324.228 1.00 135.26 ? 202 THR A CA    1 
ATOM   1498  C  C     . THR A 1 202 ? 66.713  -31.579 324.497 1.00 133.34 ? 202 THR A C     1 
ATOM   1499  O  O     . THR A 1 202 ? 67.799  -31.991 324.086 1.00 131.48 ? 202 THR A O     1 
ATOM   1500  C  CB    . THR A 1 202 ? 64.859  -32.861 325.563 1.00 139.60 ? 202 THR A CB    1 
ATOM   1501  O  OG1   . THR A 1 202 ? 65.900  -33.467 326.339 1.00 140.76 ? 202 THR A OG1   1 
ATOM   1502  C  CG2   . THR A 1 202 ? 63.755  -33.878 325.318 1.00 145.62 ? 202 THR A CG2   1 
ATOM   1503  N  N     . THR A 1 203 ? 66.580  -30.451 325.185 1.00 132.52 ? 203 THR A N     1 
ATOM   1504  C  CA    . THR A 1 203 ? 67.730  -29.614 325.507 1.00 126.72 ? 203 THR A CA    1 
ATOM   1505  C  C     . THR A 1 203 ? 68.699  -30.346 326.436 1.00 126.62 ? 203 THR A C     1 
ATOM   1506  O  O     . THR A 1 203 ? 69.913  -30.205 326.309 1.00 121.66 ? 203 THR A O     1 
ATOM   1507  C  CB    . THR A 1 203 ? 67.291  -28.265 326.120 1.00 123.23 ? 203 THR A CB    1 
ATOM   1508  O  OG1   . THR A 1 203 ? 66.591  -27.500 325.130 1.00 123.90 ? 203 THR A OG1   1 
ATOM   1509  C  CG2   . THR A 1 203 ? 68.494  -27.464 326.599 1.00 113.72 ? 203 THR A CG2   1 
ATOM   1510  N  N     . LYS A 1 204 ? 68.155  -31.143 327.353 1.00 129.22 ? 204 LYS A N     1 
ATOM   1511  C  CA    . LYS A 1 204 ? 68.968  -31.936 328.273 1.00 126.56 ? 204 LYS A CA    1 
ATOM   1512  C  C     . LYS A 1 204 ? 69.847  -32.931 327.516 1.00 131.99 ? 204 LYS A C     1 
ATOM   1513  O  O     . LYS A 1 204 ? 71.045  -33.065 327.796 1.00 141.97 ? 204 LYS A O     1 
ATOM   1514  C  CB    . LYS A 1 204 ? 68.073  -32.679 329.268 1.00 110.50 ? 204 LYS A CB    1 
ATOM   1515  N  N     . ASP A 1 205 ? 69.237  -33.621 326.555 1.00 121.17 ? 205 ASP A N     1 
ATOM   1516  C  CA    . ASP A 1 205 ? 69.951  -34.547 325.683 1.00 124.52 ? 205 ASP A CA    1 
ATOM   1517  C  C     . ASP A 1 205 ? 71.108  -33.844 324.983 1.00 117.76 ? 205 ASP A C     1 
ATOM   1518  O  O     . ASP A 1 205 ? 72.187  -34.413 324.820 1.00 115.84 ? 205 ASP A O     1 
ATOM   1519  C  CB    . ASP A 1 205 ? 69.002  -35.139 324.639 1.00 136.37 ? 205 ASP A CB    1 
ATOM   1520  C  CG    . ASP A 1 205 ? 67.911  -35.991 325.257 1.00 149.05 ? 205 ASP A CG    1 
ATOM   1521  O  OD1   . ASP A 1 205 ? 68.101  -37.221 325.355 1.00 154.92 ? 205 ASP A OD1   1 
ATOM   1522  O  OD2   . ASP A 1 205 ? 66.861  -35.433 325.641 1.00 154.84 ? 205 ASP A OD2   1 
ATOM   1523  N  N     . LEU A 1 206 ? 70.874  -32.604 324.569 1.00 110.74 ? 206 LEU A N     1 
ATOM   1524  C  CA    . LEU A 1 206 ? 71.909  -31.807 323.924 1.00 105.17 ? 206 LEU A CA    1 
ATOM   1525  C  C     . LEU A 1 206 ? 73.012  -31.439 324.908 1.00 110.22 ? 206 LEU A C     1 
ATOM   1526  O  O     . LEU A 1 206 ? 74.188  -31.401 324.550 1.00 116.87 ? 206 LEU A O     1 
ATOM   1527  C  CB    . LEU A 1 206 ? 71.314  -30.542 323.303 1.00 103.47 ? 206 LEU A CB    1 
ATOM   1528  C  CG    . LEU A 1 206 ? 70.795  -30.665 321.871 1.00 109.87 ? 206 LEU A CG    1 
ATOM   1529  C  CD1   . LEU A 1 206 ? 70.296  -29.320 321.365 1.00 110.26 ? 206 LEU A CD1   1 
ATOM   1530  C  CD2   . LEU A 1 206 ? 71.883  -31.216 320.963 1.00 117.84 ? 206 LEU A CD2   1 
ATOM   1531  N  N     . MET A 1 207 ? 72.629  -31.179 326.153 1.00 110.11 ? 207 MET A N     1 
ATOM   1532  C  CA    . MET A 1 207 ? 73.590  -30.806 327.184 1.00 115.22 ? 207 MET A CA    1 
ATOM   1533  C  C     . MET A 1 207 ? 74.420  -32.008 327.620 1.00 120.13 ? 207 MET A C     1 
ATOM   1534  O  O     . MET A 1 207 ? 75.488  -31.852 328.212 1.00 119.10 ? 207 MET A O     1 
ATOM   1535  C  CB    . MET A 1 207 ? 72.887  -30.166 328.383 1.00 114.65 ? 207 MET A CB    1 
ATOM   1536  C  CG    . MET A 1 207 ? 72.193  -28.853 328.057 1.00 114.00 ? 207 MET A CG    1 
ATOM   1537  S  SD    . MET A 1 207 ? 71.735  -27.904 329.520 1.00 134.22 ? 207 MET A SD    1 
ATOM   1538  C  CE    . MET A 1 207 ? 73.350  -27.572 330.218 1.00 87.83  ? 207 MET A CE    1 
ATOM   1539  N  N     . GLU A 1 208 ? 73.924  -33.206 327.319 1.00 121.39 ? 208 GLU A N     1 
ATOM   1540  C  CA    . GLU A 1 208 ? 74.667  -34.434 327.594 1.00 111.55 ? 208 GLU A CA    1 
ATOM   1541  C  C     . GLU A 1 208 ? 75.948  -34.522 326.762 1.00 102.75 ? 208 GLU A C     1 
ATOM   1542  O  O     . GLU A 1 208 ? 76.868  -35.270 327.097 1.00 101.43 ? 208 GLU A O     1 
ATOM   1543  C  CB    . GLU A 1 208 ? 73.787  -35.661 327.343 1.00 87.81  ? 208 GLU A CB    1 
ATOM   1544  N  N     . VAL A 1 209 ? 76.003  -33.757 325.676 1.00 102.19 ? 209 VAL A N     1 
ATOM   1545  C  CA    . VAL A 1 209 ? 77.197  -33.701 324.837 1.00 102.32 ? 209 VAL A CA    1 
ATOM   1546  C  C     . VAL A 1 209 ? 77.730  -32.273 324.716 1.00 102.55 ? 209 VAL A C     1 
ATOM   1547  O  O     . VAL A 1 209 ? 78.907  -32.059 324.426 1.00 102.04 ? 209 VAL A O     1 
ATOM   1548  C  CB    . VAL A 1 209 ? 76.939  -34.283 323.437 1.00 106.19 ? 209 VAL A CB    1 
ATOM   1549  C  CG1   . VAL A 1 209 ? 77.080  -35.798 323.462 1.00 112.19 ? 209 VAL A CG1   1 
ATOM   1550  C  CG2   . VAL A 1 209 ? 75.566  -33.870 322.931 1.00 109.63 ? 209 VAL A CG2   1 
ATOM   1551  N  N     . LEU A 1 210 ? 76.850  -31.301 324.932 1.00 97.56  ? 210 LEU A N     1 
ATOM   1552  C  CA    . LEU A 1 210 ? 77.250  -29.900 325.017 1.00 95.38  ? 210 LEU A CA    1 
ATOM   1553  C  C     . LEU A 1 210 ? 76.978  -29.389 326.426 1.00 111.95 ? 210 LEU A C     1 
ATOM   1554  O  O     . LEU A 1 210 ? 75.975  -28.715 326.660 1.00 119.60 ? 210 LEU A O     1 
ATOM   1555  C  CB    . LEU A 1 210 ? 76.488  -29.052 323.998 1.00 89.21  ? 210 LEU A CB    1 
ATOM   1556  C  CG    . LEU A 1 210 ? 77.321  -28.216 323.020 1.00 81.72  ? 210 LEU A CG    1 
ATOM   1557  C  CD1   . LEU A 1 210 ? 76.510  -27.039 322.495 1.00 71.26  ? 210 LEU A CD1   1 
ATOM   1558  C  CD2   . LEU A 1 210 ? 78.615  -27.739 323.664 1.00 77.54  ? 210 LEU A CD2   1 
ATOM   1559  N  N     . PRO A 1 211 ? 77.878  -29.711 327.370 1.00 110.91 ? 211 PRO A N     1 
ATOM   1560  C  CA    . PRO A 1 211 ? 77.679  -29.395 328.789 1.00 102.98 ? 211 PRO A CA    1 
ATOM   1561  C  C     . PRO A 1 211 ? 77.504  -27.902 329.017 1.00 101.59 ? 211 PRO A C     1 
ATOM   1562  O  O     . PRO A 1 211 ? 76.686  -27.497 329.841 1.00 107.71 ? 211 PRO A O     1 
ATOM   1563  C  CB    . PRO A 1 211 ? 78.981  -29.872 329.442 1.00 107.44 ? 211 PRO A CB    1 
ATOM   1564  C  CG    . PRO A 1 211 ? 79.566  -30.842 328.481 1.00 111.73 ? 211 PRO A CG    1 
ATOM   1565  C  CD    . PRO A 1 211 ? 79.190  -30.332 327.128 1.00 111.74 ? 211 PRO A CD    1 
ATOM   1566  N  N     . GLY A 1 212 ? 78.270  -27.096 328.289 1.00 98.88  ? 212 GLY A N     1 
ATOM   1567  C  CA    . GLY A 1 212 ? 78.191  -25.653 328.414 1.00 101.41 ? 212 GLY A CA    1 
ATOM   1568  C  C     . GLY A 1 212 ? 79.348  -24.955 327.728 1.00 94.81  ? 212 GLY A C     1 
ATOM   1569  O  O     . GLY A 1 212 ? 80.101  -25.584 326.982 1.00 98.09  ? 212 GLY A O     1 
ATOM   1570  N  N     . PRO A 1 213 ? 79.495  -23.646 327.980 1.00 88.99  ? 213 PRO A N     1 
ATOM   1571  C  CA    . PRO A 1 213 ? 80.535  -22.811 327.370 1.00 88.20  ? 213 PRO A CA    1 
ATOM   1572  C  C     . PRO A 1 213 ? 81.939  -23.325 327.653 1.00 93.84  ? 213 PRO A C     1 
ATOM   1573  O  O     . PRO A 1 213 ? 82.185  -23.897 328.714 1.00 105.60 ? 213 PRO A O     1 
ATOM   1574  C  CB    . PRO A 1 213 ? 80.344  -21.457 328.061 1.00 81.29  ? 213 PRO A CB    1 
ATOM   1575  C  CG    . PRO A 1 213 ? 78.935  -21.447 328.490 1.00 86.57  ? 213 PRO A CG    1 
ATOM   1576  C  CD    . PRO A 1 213 ? 78.603  -22.863 328.851 1.00 91.24  ? 213 PRO A CD    1 
ATOM   1577  N  N     . ASP A 1 214 ? 82.843  -23.122 326.702 1.00 86.53  ? 214 ASP A N     1 
ATOM   1578  C  CA    . ASP A 1 214 ? 84.248  -23.452 326.889 1.00 91.55  ? 214 ASP A CA    1 
ATOM   1579  C  C     . ASP A 1 214 ? 85.092  -22.251 326.484 1.00 89.41  ? 214 ASP A C     1 
ATOM   1580  O  O     . ASP A 1 214 ? 85.426  -22.079 325.311 1.00 85.92  ? 214 ASP A O     1 
ATOM   1581  C  CB    . ASP A 1 214 ? 84.636  -24.684 326.069 1.00 106.52 ? 214 ASP A CB    1 
ATOM   1582  C  CG    . ASP A 1 214 ? 86.042  -25.166 326.371 1.00 114.10 ? 214 ASP A CG    1 
ATOM   1583  O  OD1   . ASP A 1 214 ? 86.578  -24.797 327.436 1.00 117.60 ? 214 ASP A OD1   1 
ATOM   1584  O  OD2   . ASP A 1 214 ? 86.608  -25.918 325.548 1.00 115.77 ? 214 ASP A OD2   1 
ATOM   1585  N  N     . PHE A 1 215 ? 85.425  -21.418 327.464 1.00 90.66  ? 215 PHE A N     1 
ATOM   1586  C  CA    . PHE A 1 215 ? 86.142  -20.174 327.211 1.00 87.54  ? 215 PHE A CA    1 
ATOM   1587  C  C     . PHE A 1 215 ? 87.621  -20.415 326.917 1.00 88.55  ? 215 PHE A C     1 
ATOM   1588  O  O     . PHE A 1 215 ? 88.217  -21.354 327.443 1.00 95.85  ? 215 PHE A O     1 
ATOM   1589  C  CB    . PHE A 1 215 ? 85.964  -19.217 328.393 1.00 91.74  ? 215 PHE A CB    1 
ATOM   1590  C  CG    . PHE A 1 215 ? 84.529  -18.889 328.687 1.00 90.59  ? 215 PHE A CG    1 
ATOM   1591  C  CD1   . PHE A 1 215 ? 83.871  -17.903 327.972 1.00 93.28  ? 215 PHE A CD1   1 
ATOM   1592  C  CD2   . PHE A 1 215 ? 83.836  -19.572 329.671 1.00 91.46  ? 215 PHE A CD2   1 
ATOM   1593  C  CE1   . PHE A 1 215 ? 82.549  -17.601 328.236 1.00 95.49  ? 215 PHE A CE1   1 
ATOM   1594  C  CE2   . PHE A 1 215 ? 82.514  -19.274 329.940 1.00 92.98  ? 215 PHE A CE2   1 
ATOM   1595  C  CZ    . PHE A 1 215 ? 81.870  -18.289 329.223 1.00 94.52  ? 215 PHE A CZ    1 
ATOM   1596  N  N     . PRO A 1 216 ? 88.215  -19.564 326.064 1.00 91.34  ? 216 PRO A N     1 
ATOM   1597  C  CA    . PRO A 1 216 ? 89.607  -19.722 325.626 1.00 92.58  ? 216 PRO A CA    1 
ATOM   1598  C  C     . PRO A 1 216 ? 90.614  -19.691 326.775 1.00 83.24  ? 216 PRO A C     1 
ATOM   1599  O  O     . PRO A 1 216 ? 91.659  -20.336 326.683 1.00 85.24  ? 216 PRO A O     1 
ATOM   1600  C  CB    . PRO A 1 216 ? 89.818  -18.525 324.688 1.00 91.58  ? 216 PRO A CB    1 
ATOM   1601  C  CG    . PRO A 1 216 ? 88.759  -17.541 325.068 1.00 92.39  ? 216 PRO A CG    1 
ATOM   1602  C  CD    . PRO A 1 216 ? 87.584  -18.380 325.457 1.00 93.13  ? 216 PRO A CD    1 
ATOM   1603  N  N     . THR A 1 217 ? 90.306  -18.956 327.838 1.00 86.53  ? 217 THR A N     1 
ATOM   1604  C  CA    . THR A 1 217 ? 91.205  -18.881 328.985 1.00 97.95  ? 217 THR A CA    1 
ATOM   1605  C  C     . THR A 1 217 ? 90.926  -20.017 329.968 1.00 98.93  ? 217 THR A C     1 
ATOM   1606  O  O     . THR A 1 217 ? 91.810  -20.429 330.719 1.00 97.89  ? 217 THR A O     1 
ATOM   1607  C  CB    . THR A 1 217 ? 91.069  -17.541 329.730 1.00 97.10  ? 217 THR A CB    1 
ATOM   1608  O  OG1   . THR A 1 217 ? 89.888  -17.557 330.542 1.00 104.93 ? 217 THR A OG1   1 
ATOM   1609  C  CG2   . THR A 1 217 ? 90.998  -16.381 328.742 1.00 82.50  ? 217 THR A CG2   1 
ATOM   1610  N  N     . GLY A 1 218 ? 89.693  -20.518 329.956 1.00 94.38  ? 218 GLY A N     1 
ATOM   1611  C  CA    . GLY A 1 218 ? 89.307  -21.618 330.821 1.00 95.62  ? 218 GLY A CA    1 
ATOM   1612  C  C     . GLY A 1 218 ? 88.459  -21.181 332.000 1.00 104.95 ? 218 GLY A C     1 
ATOM   1613  O  O     . GLY A 1 218 ? 87.252  -20.971 331.864 1.00 102.71 ? 218 GLY A O     1 
ATOM   1614  N  N     . ALA A 1 219 ? 89.098  -21.054 333.161 1.00 109.56 ? 219 ALA A N     1 
ATOM   1615  C  CA    . ALA A 1 219 ? 88.429  -20.649 334.396 1.00 111.38 ? 219 ALA A CA    1 
ATOM   1616  C  C     . ALA A 1 219 ? 87.292  -21.590 334.805 1.00 115.87 ? 219 ALA A C     1 
ATOM   1617  O  O     . ALA A 1 219 ? 87.194  -22.715 334.317 1.00 114.07 ? 219 ALA A O     1 
ATOM   1618  C  CB    . ALA A 1 219 ? 87.938  -19.204 334.300 1.00 110.97 ? 219 ALA A CB    1 
ATOM   1619  N  N     . LEU A 1 220 ? 86.444  -21.116 335.713 1.00 113.97 ? 220 LEU A N     1 
ATOM   1620  C  CA    . LEU A 1 220 ? 85.385  -21.931 336.303 1.00 100.72 ? 220 LEU A CA    1 
ATOM   1621  C  C     . LEU A 1 220 ? 84.013  -21.309 336.061 1.00 102.29 ? 220 LEU A C     1 
ATOM   1622  O  O     . LEU A 1 220 ? 83.887  -20.090 335.927 1.00 111.06 ? 220 LEU A O     1 
ATOM   1623  C  CB    . LEU A 1 220 ? 85.609  -22.084 337.811 1.00 95.49  ? 220 LEU A CB    1 
ATOM   1624  C  CG    . LEU A 1 220 ? 86.553  -23.160 338.358 1.00 98.29  ? 220 LEU A CG    1 
ATOM   1625  C  CD1   . LEU A 1 220 ? 87.943  -23.054 337.772 1.00 85.43  ? 220 LEU A CD1   1 
ATOM   1626  C  CD2   . LEU A 1 220 ? 86.623  -23.060 339.871 1.00 120.01 ? 220 LEU A CD2   1 
ATOM   1627  N  N     . VAL A 1 221 ? 82.988  -22.156 336.017 1.00 96.56  ? 221 VAL A N     1 
ATOM   1628  C  CA    . VAL A 1 221 ? 81.612  -21.698 335.859 1.00 104.63 ? 221 VAL A CA    1 
ATOM   1629  C  C     . VAL A 1 221 ? 80.745  -22.125 337.045 1.00 117.43 ? 221 VAL A C     1 
ATOM   1630  O  O     . VAL A 1 221 ? 80.738  -23.293 337.440 1.00 121.28 ? 221 VAL A O     1 
ATOM   1631  C  CB    . VAL A 1 221 ? 80.984  -22.220 334.551 1.00 79.31  ? 221 VAL A CB    1 
ATOM   1632  N  N     . MET A 1 222 ? 80.028  -21.160 337.613 1.00 120.23 ? 222 MET A N     1 
ATOM   1633  C  CA    . MET A 1 222 ? 79.087  -21.407 338.696 1.00 120.65 ? 222 MET A CA    1 
ATOM   1634  C  C     . MET A 1 222 ? 77.662  -21.187 338.195 1.00 135.01 ? 222 MET A C     1 
ATOM   1635  O  O     . MET A 1 222 ? 77.352  -20.148 337.597 1.00 145.62 ? 222 MET A O     1 
ATOM   1636  C  CB    . MET A 1 222 ? 79.377  -20.473 339.872 1.00 115.78 ? 222 MET A CB    1 
ATOM   1637  C  CG    . MET A 1 222 ? 80.851  -20.345 340.200 1.00 112.20 ? 222 MET A CG    1 
ATOM   1638  S  SD    . MET A 1 222 ? 81.582  -21.890 340.763 1.00 172.31 ? 222 MET A SD    1 
ATOM   1639  C  CE    . MET A 1 222 ? 83.318  -21.465 340.693 1.00 88.47  ? 222 MET A CE    1 
ATOM   1640  N  N     . GLY A 1 223 ? 76.802  -22.171 338.440 1.00 135.02 ? 223 GLY A N     1 
ATOM   1641  C  CA    . GLY A 1 223 ? 75.409  -22.095 338.039 1.00 142.34 ? 223 GLY A CA    1 
ATOM   1642  C  C     . GLY A 1 223 ? 75.157  -22.637 336.645 1.00 141.68 ? 223 GLY A C     1 
ATOM   1643  O  O     . GLY A 1 223 ? 75.308  -21.925 335.655 1.00 137.70 ? 223 GLY A O     1 
ATOM   1644  N  N     . LYS A 1 224 ? 74.766  -23.906 336.570 1.00 136.76 ? 224 LYS A N     1 
ATOM   1645  C  CA    . LYS A 1 224 ? 74.461  -24.545 335.294 1.00 121.18 ? 224 LYS A CA    1 
ATOM   1646  C  C     . LYS A 1 224 ? 73.014  -24.273 334.886 1.00 129.15 ? 224 LYS A C     1 
ATOM   1647  O  O     . LYS A 1 224 ? 72.631  -24.459 333.726 1.00 130.58 ? 224 LYS A O     1 
ATOM   1648  C  CB    . LYS A 1 224 ? 74.716  -26.051 335.378 1.00 107.58 ? 224 LYS A CB    1 
ATOM   1649  N  N     . SER A 1 225 ? 72.215  -23.832 335.854 1.00 136.32 ? 225 SER A N     1 
ATOM   1650  C  CA    . SER A 1 225 ? 70.823  -23.472 335.611 1.00 136.63 ? 225 SER A CA    1 
ATOM   1651  C  C     . SER A 1 225 ? 70.746  -22.369 334.568 1.00 137.74 ? 225 SER A C     1 
ATOM   1652  O  O     . SER A 1 225 ? 69.880  -22.385 333.690 1.00 139.35 ? 225 SER A O     1 
ATOM   1653  C  CB    . SER A 1 225 ? 70.151  -23.017 336.907 1.00 131.06 ? 225 SER A CB    1 
ATOM   1654  N  N     . GLY A 1 226 ? 71.666  -21.414 334.669 1.00 137.52 ? 226 GLY A N     1 
ATOM   1655  C  CA    . GLY A 1 226 ? 71.771  -20.347 333.693 1.00 135.24 ? 226 GLY A CA    1 
ATOM   1656  C  C     . GLY A 1 226 ? 72.117  -20.893 332.323 1.00 121.70 ? 226 GLY A C     1 
ATOM   1657  O  O     . GLY A 1 226 ? 71.628  -20.398 331.311 1.00 116.84 ? 226 GLY A O     1 
ATOM   1658  N  N     . ILE A 1 227 ? 72.960  -21.922 332.293 1.00 113.94 ? 227 ILE A N     1 
ATOM   1659  C  CA    . ILE A 1 227 ? 73.345  -22.561 331.040 1.00 109.16 ? 227 ILE A CA    1 
ATOM   1660  C  C     . ILE A 1 227 ? 72.145  -23.222 330.367 1.00 108.96 ? 227 ILE A C     1 
ATOM   1661  O  O     . ILE A 1 227 ? 71.915  -23.033 329.171 1.00 112.51 ? 227 ILE A O     1 
ATOM   1662  C  CB    . ILE A 1 227 ? 74.464  -23.606 331.240 1.00 107.12 ? 227 ILE A CB    1 
ATOM   1663  C  CG1   . ILE A 1 227 ? 75.688  -22.964 331.897 1.00 102.81 ? 227 ILE A CG1   1 
ATOM   1664  C  CG2   . ILE A 1 227 ? 74.849  -24.235 329.913 1.00 107.47 ? 227 ILE A CG2   1 
ATOM   1665  C  CD1   . ILE A 1 227 ? 76.874  -23.898 332.019 1.00 103.60 ? 227 ILE A CD1   1 
ATOM   1666  N  N     . HIS A 1 228 ? 71.378  -23.990 331.135 1.00 104.36 ? 228 HIS A N     1 
ATOM   1667  C  CA    . HIS A 1 228 ? 70.187  -24.639 330.594 1.00 99.88  ? 228 HIS A CA    1 
ATOM   1668  C  C     . HIS A 1 228 ? 69.154  -23.621 330.125 1.00 112.92 ? 228 HIS A C     1 
ATOM   1669  O  O     . HIS A 1 228 ? 68.596  -23.748 329.032 1.00 120.54 ? 228 HIS A O     1 
ATOM   1670  C  CB    . HIS A 1 228 ? 69.552  -25.575 331.620 1.00 98.39  ? 228 HIS A CB    1 
ATOM   1671  C  CG    . HIS A 1 228 ? 68.263  -26.181 331.160 1.00 104.41 ? 228 HIS A CG    1 
ATOM   1672  N  ND1   . HIS A 1 228 ? 67.042  -25.572 331.355 1.00 113.68 ? 228 HIS A ND1   1 
ATOM   1673  C  CD2   . HIS A 1 228 ? 68.005  -27.338 330.506 1.00 110.58 ? 228 HIS A CD2   1 
ATOM   1674  C  CE1   . HIS A 1 228 ? 66.087  -26.330 330.846 1.00 123.76 ? 228 HIS A CE1   1 
ATOM   1675  N  NE2   . HIS A 1 228 ? 66.645  -27.408 330.326 1.00 120.43 ? 228 HIS A NE2   1 
ATOM   1676  N  N     . LYS A 1 229 ? 68.892  -22.624 330.965 1.00 124.04 ? 229 LYS A N     1 
ATOM   1677  C  CA    . LYS A 1 229 ? 67.927  -21.581 330.637 1.00 128.91 ? 229 LYS A CA    1 
ATOM   1678  C  C     . LYS A 1 229 ? 68.339  -20.876 329.352 1.00 118.65 ? 229 LYS A C     1 
ATOM   1679  O  O     . LYS A 1 229 ? 67.503  -20.551 328.510 1.00 122.06 ? 229 LYS A O     1 
ATOM   1680  C  CB    . LYS A 1 229 ? 67.831  -20.565 331.777 1.00 130.48 ? 229 LYS A CB    1 
ATOM   1681  C  CG    . LYS A 1 229 ? 66.689  -19.572 331.621 1.00 127.56 ? 229 LYS A CG    1 
ATOM   1682  C  CD    . LYS A 1 229 ? 66.857  -18.381 332.550 1.00 128.79 ? 229 LYS A CD    1 
ATOM   1683  C  CE    . LYS A 1 229 ? 67.053  -18.822 333.990 1.00 133.91 ? 229 LYS A CE    1 
ATOM   1684  N  NZ    . LYS A 1 229 ? 67.278  -17.660 334.894 1.00 137.14 ? 229 LYS A NZ    1 
ATOM   1685  N  N     . ALA A 1 230 ? 69.641  -20.656 329.209 1.00 104.21 ? 230 ALA A N     1 
ATOM   1686  C  CA    . ALA A 1 230 ? 70.191  -19.998 328.033 1.00 92.46  ? 230 ALA A CA    1 
ATOM   1687  C  C     . ALA A 1 230 ? 70.040  -20.854 326.781 1.00 100.31 ? 230 ALA A C     1 
ATOM   1688  O  O     . ALA A 1 230 ? 69.673  -20.354 325.719 1.00 105.76 ? 230 ALA A O     1 
ATOM   1689  C  CB    . ALA A 1 230 ? 71.646  -19.666 328.258 1.00 86.61  ? 230 ALA A CB    1 
ATOM   1690  N  N     . TYR A 1 231 ? 70.332  -22.144 326.907 1.00 103.61 ? 231 TYR A N     1 
ATOM   1691  C  CA    . TYR A 1 231 ? 70.250  -23.048 325.766 1.00 106.04 ? 231 TYR A CA    1 
ATOM   1692  C  C     . TYR A 1 231 ? 68.805  -23.341 325.379 1.00 113.08 ? 231 TYR A C     1 
ATOM   1693  O  O     . TYR A 1 231 ? 68.534  -23.794 324.266 1.00 123.49 ? 231 TYR A O     1 
ATOM   1694  C  CB    . TYR A 1 231 ? 71.001  -24.352 326.045 1.00 105.45 ? 231 TYR A CB    1 
ATOM   1695  C  CG    . TYR A 1 231 ? 72.506  -24.212 325.996 1.00 102.36 ? 231 TYR A CG    1 
ATOM   1696  C  CD1   . TYR A 1 231 ? 73.103  -23.033 325.567 1.00 90.49  ? 231 TYR A CD1   1 
ATOM   1697  C  CD2   . TYR A 1 231 ? 73.331  -25.264 326.370 1.00 108.84 ? 231 TYR A CD2   1 
ATOM   1698  C  CE1   . TYR A 1 231 ? 74.477  -22.904 325.521 1.00 90.53  ? 231 TYR A CE1   1 
ATOM   1699  C  CE2   . TYR A 1 231 ? 74.707  -25.145 326.325 1.00 107.68 ? 231 TYR A CE2   1 
ATOM   1700  C  CZ    . TYR A 1 231 ? 75.273  -23.963 325.900 1.00 102.61 ? 231 TYR A CZ    1 
ATOM   1701  O  OH    . TYR A 1 231 ? 76.642  -23.840 325.854 1.00 107.02 ? 231 TYR A OH    1 
ATOM   1702  N  N     . GLU A 1 232 ? 67.880  -23.074 326.295 1.00 109.23 ? 232 GLU A N     1 
ATOM   1703  C  CA    . GLU A 1 232 ? 66.467  -23.324 326.037 1.00 116.39 ? 232 GLU A CA    1 
ATOM   1704  C  C     . GLU A 1 232 ? 65.719  -22.067 325.598 1.00 119.27 ? 232 GLU A C     1 
ATOM   1705  O  O     . GLU A 1 232 ? 64.657  -22.157 324.984 1.00 124.65 ? 232 GLU A O     1 
ATOM   1706  C  CB    . GLU A 1 232 ? 65.795  -23.929 327.272 1.00 114.27 ? 232 GLU A CB    1 
ATOM   1707  N  N     . THR A 1 233 ? 66.270  -20.896 325.908 1.00 110.72 ? 233 THR A N     1 
ATOM   1708  C  CA    . THR A 1 233 ? 65.573  -19.642 325.629 1.00 105.83 ? 233 THR A CA    1 
ATOM   1709  C  C     . THR A 1 233 ? 66.383  -18.665 324.779 1.00 101.77 ? 233 THR A C     1 
ATOM   1710  O  O     . THR A 1 233 ? 65.818  -17.886 324.012 1.00 111.19 ? 233 THR A O     1 
ATOM   1711  C  CB    . THR A 1 233 ? 65.153  -18.929 326.929 1.00 110.67 ? 233 THR A CB    1 
ATOM   1712  O  OG1   . THR A 1 233 ? 66.320  -18.582 327.686 1.00 115.65 ? 233 THR A OG1   1 
ATOM   1713  C  CG2   . THR A 1 233 ? 64.257  -19.829 327.766 1.00 112.95 ? 233 THR A CG2   1 
ATOM   1714  N  N     . GLY A 1 234 ? 67.703  -18.706 324.920 1.00 91.36  ? 234 GLY A N     1 
ATOM   1715  C  CA    . GLY A 1 234 ? 68.568  -17.770 324.225 1.00 91.19  ? 234 GLY A CA    1 
ATOM   1716  C  C     . GLY A 1 234 ? 69.049  -16.671 325.150 1.00 104.90 ? 234 GLY A C     1 
ATOM   1717  O  O     . GLY A 1 234 ? 69.997  -15.950 324.843 1.00 102.28 ? 234 GLY A O     1 
ATOM   1718  N  N     . LYS A 1 235 ? 68.378  -16.542 326.288 1.00 110.79 ? 235 LYS A N     1 
ATOM   1719  C  CA    . LYS A 1 235 ? 68.771  -15.587 327.316 1.00 106.68 ? 235 LYS A CA    1 
ATOM   1720  C  C     . LYS A 1 235 ? 69.092  -16.308 328.616 1.00 108.38 ? 235 LYS A C     1 
ATOM   1721  O  O     . LYS A 1 235 ? 68.439  -17.293 328.961 1.00 109.64 ? 235 LYS A O     1 
ATOM   1722  C  CB    . LYS A 1 235 ? 67.663  -14.565 327.566 1.00 110.77 ? 235 LYS A CB    1 
ATOM   1723  C  CG    . LYS A 1 235 ? 67.436  -13.574 326.441 1.00 114.06 ? 235 LYS A CG    1 
ATOM   1724  C  CD    . LYS A 1 235 ? 66.335  -12.594 326.818 1.00 120.06 ? 235 LYS A CD    1 
ATOM   1725  C  CE    . LYS A 1 235 ? 66.102  -11.562 325.730 1.00 117.84 ? 235 LYS A CE    1 
ATOM   1726  N  NZ    . LYS A 1 235 ? 67.293  -10.694 325.526 1.00 116.10 ? 235 LYS A NZ    1 
ATOM   1727  N  N     . GLY A 1 236 ? 70.091  -15.817 329.343 1.00 107.91 ? 236 GLY A N     1 
ATOM   1728  C  CA    . GLY A 1 236 ? 70.411  -16.400 330.636 1.00 101.00 ? 236 GLY A CA    1 
ATOM   1729  C  C     . GLY A 1 236 ? 71.686  -15.887 331.269 1.00 98.16  ? 236 GLY A C     1 
ATOM   1730  O  O     . GLY A 1 236 ? 72.564  -15.390 330.584 1.00 85.69  ? 236 GLY A O     1 
ATOM   1731  N  N     . SER A 1 237 ? 71.794  -16.014 332.587 1.00 104.75 ? 237 SER A N     1 
ATOM   1732  C  CA    . SER A 1 237 ? 72.970  -15.522 333.298 1.00 98.82  ? 237 SER A CA    1 
ATOM   1733  C  C     . SER A 1 237 ? 73.730  -16.641 334.004 1.00 102.89 ? 237 SER A C     1 
ATOM   1734  O  O     . SER A 1 237 ? 73.130  -17.491 334.662 1.00 108.29 ? 237 SER A O     1 
ATOM   1735  C  CB    . SER A 1 237 ? 72.572  -14.438 334.303 1.00 89.70  ? 237 SER A CB    1 
ATOM   1736  N  N     . ILE A 1 238 ? 75.053  -16.638 333.857 1.00 100.76 ? 238 ILE A N     1 
ATOM   1737  C  CA    . ILE A 1 238 ? 75.906  -17.603 334.550 1.00 108.27 ? 238 ILE A CA    1 
ATOM   1738  C  C     . ILE A 1 238 ? 77.046  -16.886 335.267 1.00 114.71 ? 238 ILE A C     1 
ATOM   1739  O  O     . ILE A 1 238 ? 77.337  -15.724 334.975 1.00 121.82 ? 238 ILE A O     1 
ATOM   1740  C  CB    . ILE A 1 238 ? 76.509  -18.643 333.583 1.00 101.87 ? 238 ILE A CB    1 
ATOM   1741  C  CG1   . ILE A 1 238 ? 77.542  -17.987 332.667 1.00 89.09  ? 238 ILE A CG1   1 
ATOM   1742  C  CG2   . ILE A 1 238 ? 75.417  -19.333 332.771 1.00 103.83 ? 238 ILE A CG2   1 
ATOM   1743  C  CD1   . ILE A 1 238 ? 78.271  -18.967 331.784 1.00 95.96  ? 238 ILE A CD1   1 
ATOM   1744  N  N     . VAL A 1 239 ? 77.692  -17.573 336.205 1.00 104.65 ? 239 VAL A N     1 
ATOM   1745  C  CA    . VAL A 1 239 ? 78.792  -16.960 336.944 1.00 97.94  ? 239 VAL A CA    1 
ATOM   1746  C  C     . VAL A 1 239 ? 80.138  -17.510 336.473 1.00 101.95 ? 239 VAL A C     1 
ATOM   1747  O  O     . VAL A 1 239 ? 80.261  -18.694 336.181 1.00 105.11 ? 239 VAL A O     1 
ATOM   1748  C  CB    . VAL A 1 239 ? 78.635  -17.155 338.470 1.00 84.46  ? 239 VAL A CB    1 
ATOM   1749  C  CG1   . VAL A 1 239 ? 79.669  -16.331 339.223 1.00 84.90  ? 239 VAL A CG1   1 
ATOM   1750  C  CG2   . VAL A 1 239 ? 77.230  -16.768 338.912 1.00 91.17  ? 239 VAL A CG2   1 
ATOM   1751  N  N     . LEU A 1 240 ? 81.134  -16.637 336.375 1.00 79.44  ? 240 LEU A N     1 
ATOM   1752  C  CA    . LEU A 1 240 ? 82.484  -17.040 336.002 1.00 102.68 ? 240 LEU A CA    1 
ATOM   1753  C  C     . LEU A 1 240 ? 83.461  -16.706 337.126 1.00 106.69 ? 240 LEU A C     1 
ATOM   1754  O  O     . LEU A 1 240 ? 83.501  -15.574 337.603 1.00 111.93 ? 240 LEU A O     1 
ATOM   1755  C  CB    . LEU A 1 240 ? 82.922  -16.333 334.715 1.00 87.61  ? 240 LEU A CB    1 
ATOM   1756  C  CG    . LEU A 1 240 ? 81.992  -16.411 333.504 1.00 94.51  ? 240 LEU A CG    1 
ATOM   1757  C  CD1   . LEU A 1 240 ? 82.636  -15.736 332.297 1.00 93.48  ? 240 LEU A CD1   1 
ATOM   1758  C  CD2   . LEU A 1 240 ? 81.612  -17.854 333.180 1.00 100.62 ? 240 LEU A CD2   1 
ATOM   1759  N  N     . ARG A 1 241 ? 84.241  -17.693 337.552 1.00 111.92 ? 241 ARG A N     1 
ATOM   1760  C  CA    . ARG A 1 241 ? 85.225  -17.473 338.609 1.00 109.75 ? 241 ARG A CA    1 
ATOM   1761  C  C     . ARG A 1 241 ? 86.626  -17.858 338.152 1.00 104.74 ? 241 ARG A C     1 
ATOM   1762  O  O     . ARG A 1 241 ? 86.801  -18.807 337.396 1.00 105.91 ? 241 ARG A O     1 
ATOM   1763  C  CB    . ARG A 1 241 ? 84.851  -18.248 339.878 1.00 110.59 ? 241 ARG A CB    1 
ATOM   1764  C  CG    . ARG A 1 241 ? 85.930  -18.235 340.954 1.00 111.58 ? 241 ARG A CG    1 
ATOM   1765  C  CD    . ARG A 1 241 ? 85.498  -18.990 342.193 1.00 116.08 ? 241 ARG A CD    1 
ATOM   1766  N  NE    . ARG A 1 241 ? 84.382  -18.331 342.860 1.00 111.47 ? 241 ARG A NE    1 
ATOM   1767  C  CZ    . ARG A 1 241 ? 83.651  -18.891 343.817 1.00 109.75 ? 241 ARG A CZ    1 
ATOM   1768  N  NH1   . ARG A 1 241 ? 83.914  -20.129 344.216 1.00 109.02 ? 241 ARG A NH1   1 
ATOM   1769  N  NH2   . ARG A 1 241 ? 82.654  -18.215 344.370 1.00 97.53  ? 241 ARG A NH2   1 
ATOM   1770  N  N     . SER A 1 242 ? 87.619  -17.103 338.604 1.00 96.65  ? 242 SER A N     1 
ATOM   1771  C  CA    . SER A 1 242 ? 89.006  -17.400 338.283 1.00 95.91  ? 242 SER A CA    1 
ATOM   1772  C  C     . SER A 1 242 ? 89.471  -18.727 338.880 1.00 99.15  ? 242 SER A C     1 
ATOM   1773  O  O     . SER A 1 242 ? 89.233  -19.000 340.057 1.00 113.79 ? 242 SER A O     1 
ATOM   1774  C  CB    . SER A 1 242 ? 89.912  -16.271 338.778 1.00 97.52  ? 242 SER A CB    1 
ATOM   1775  O  OG    . SER A 1 242 ? 89.543  -15.030 338.204 1.00 103.37 ? 242 SER A OG    1 
ATOM   1776  N  N     . ARG A 1 243 ? 90.128  -19.552 338.067 1.00 99.41  ? 243 ARG A N     1 
ATOM   1777  C  CA    . ARG A 1 243 ? 90.792  -20.740 338.590 1.00 102.62 ? 243 ARG A CA    1 
ATOM   1778  C  C     . ARG A 1 243 ? 91.981  -20.315 339.434 1.00 99.02  ? 243 ARG A C     1 
ATOM   1779  O  O     . ARG A 1 243 ? 92.945  -19.716 338.928 1.00 91.79  ? 243 ARG A O     1 
ATOM   1780  C  CB    . ARG A 1 243 ? 91.245  -21.689 337.480 1.00 104.11 ? 243 ARG A CB    1 
ATOM   1781  C  CG    . ARG A 1 243 ? 92.282  -22.705 337.952 1.00 104.03 ? 243 ARG A CG    1 
ATOM   1782  C  CD    . ARG A 1 243 ? 92.421  -23.887 337.002 1.00 116.72 ? 243 ARG A CD    1 
ATOM   1783  N  NE    . ARG A 1 243 ? 91.507  -24.971 337.350 1.00 125.73 ? 243 ARG A NE    1 
ATOM   1784  C  CZ    . ARG A 1 243 ? 90.390  -25.251 336.687 1.00 129.29 ? 243 ARG A CZ    1 
ATOM   1785  N  NH1   . ARG A 1 243 ? 90.044  -24.529 335.631 1.00 125.22 ? 243 ARG A NH1   1 
ATOM   1786  N  NH2   . ARG A 1 243 ? 89.620  -26.257 337.079 1.00 133.92 ? 243 ARG A NH2   1 
ATOM   1787  N  N     . THR A 1 244 ? 91.891  -20.633 340.722 1.00 109.00 ? 244 THR A N     1 
ATOM   1788  C  CA    . THR A 1 244 ? 92.869  -20.223 341.714 1.00 112.53 ? 244 THR A CA    1 
ATOM   1789  C  C     . THR A 1 244 ? 93.269  -21.404 342.589 1.00 117.12 ? 244 THR A C     1 
ATOM   1790  O  O     . THR A 1 244 ? 92.650  -22.468 342.538 1.00 120.17 ? 244 THR A O     1 
ATOM   1791  C  CB    . THR A 1 244 ? 92.294  -19.124 342.626 1.00 107.82 ? 244 THR A CB    1 
ATOM   1792  O  OG1   . THR A 1 244 ? 91.008  -19.532 343.109 1.00 102.74 ? 244 THR A OG1   1 
ATOM   1793  C  CG2   . THR A 1 244 ? 92.141  -17.821 341.865 1.00 107.46 ? 244 THR A CG2   1 
ATOM   1794  N  N     . GLU A 1 245 ? 94.309  -21.206 343.392 1.00 118.98 ? 245 GLU A N     1 
ATOM   1795  C  CA    . GLU A 1 245 ? 94.757  -22.214 344.346 1.00 123.36 ? 245 GLU A CA    1 
ATOM   1796  C  C     . GLU A 1 245 ? 95.556  -21.544 345.456 1.00 118.76 ? 245 GLU A C     1 
ATOM   1797  O  O     . GLU A 1 245 ? 96.159  -20.489 345.249 1.00 119.19 ? 245 GLU A O     1 
ATOM   1798  C  CB    . GLU A 1 245 ? 95.597  -23.291 343.654 1.00 127.29 ? 245 GLU A CB    1 
ATOM   1799  C  CG    . GLU A 1 245 ? 96.952  -22.812 343.156 1.00 129.59 ? 245 GLU A CG    1 
ATOM   1800  C  CD    . GLU A 1 245 ? 97.723  -23.898 342.434 1.00 142.19 ? 245 GLU A CD    1 
ATOM   1801  O  OE1   . GLU A 1 245 ? 98.864  -24.195 342.847 1.00 146.85 ? 245 GLU A OE1   1 
ATOM   1802  O  OE2   . GLU A 1 245 ? 97.188  -24.451 341.450 1.00 147.05 ? 245 GLU A OE2   1 
ATOM   1803  N  N     . ILE A 1 246 ? 95.552  -22.152 346.636 1.00 113.33 ? 246 ILE A N     1 
ATOM   1804  C  CA    . ILE A 1 246 ? 96.257  -21.583 347.776 1.00 107.79 ? 246 ILE A CA    1 
ATOM   1805  C  C     . ILE A 1 246 ? 97.558  -22.329 348.031 1.00 102.44 ? 246 ILE A C     1 
ATOM   1806  O  O     . ILE A 1 246 ? 97.556  -23.539 348.256 1.00 98.56  ? 246 ILE A O     1 
ATOM   1807  C  CB    . ILE A 1 246 ? 95.398  -21.613 349.055 1.00 108.20 ? 246 ILE A CB    1 
ATOM   1808  C  CG1   . ILE A 1 246 ? 94.000  -21.058 348.776 1.00 111.75 ? 246 ILE A CG1   1 
ATOM   1809  C  CG2   . ILE A 1 246 ? 96.077  -20.830 350.167 1.00 105.17 ? 246 ILE A CG2   1 
ATOM   1810  C  CD1   . ILE A 1 246 ? 93.995  -19.643 348.238 1.00 113.32 ? 246 ILE A CD1   1 
ATOM   1811  N  N     . GLU A 1 247 ? 98.667  -21.600 347.995 1.00 98.37  ? 247 GLU A N     1 
ATOM   1812  C  CA    . GLU A 1 247 ? 99.971  -22.184 348.269 1.00 110.97 ? 247 GLU A CA    1 
ATOM   1813  C  C     . GLU A 1 247 ? 100.516 -21.736 349.620 1.00 125.71 ? 247 GLU A C     1 
ATOM   1814  O  O     . GLU A 1 247 ? 99.904  -20.932 350.321 1.00 129.21 ? 247 GLU A O     1 
ATOM   1815  C  CB    . GLU A 1 247 ? 100.970 -21.810 347.176 1.00 107.49 ? 247 GLU A CB    1 
ATOM   1816  C  CG    . GLU A 1 247 ? 100.732 -22.492 345.841 1.00 118.39 ? 247 GLU A CG    1 
ATOM   1817  C  CD    . GLU A 1 247 ? 101.877 -22.270 344.877 1.00 121.16 ? 247 GLU A CD    1 
ATOM   1818  O  OE1   . GLU A 1 247 ? 102.918 -21.735 345.310 1.00 126.68 ? 247 GLU A OE1   1 
ATOM   1819  O  OE2   . GLU A 1 247 ? 101.739 -22.628 343.689 1.00 109.67 ? 247 GLU A OE2   1 
ATOM   1820  N  N     . THR A 1 248 ? 101.676 -22.272 349.977 1.00 125.37 ? 248 THR A N     1 
ATOM   1821  C  CA    . THR A 1 248 ? 102.370 -21.854 351.181 1.00 124.28 ? 248 THR A CA    1 
ATOM   1822  C  C     . THR A 1 248 ? 103.794 -21.459 350.831 1.00 122.45 ? 248 THR A C     1 
ATOM   1823  O  O     . THR A 1 248 ? 104.529 -22.237 350.224 1.00 124.49 ? 248 THR A O     1 
ATOM   1824  C  CB    . THR A 1 248 ? 102.404 -22.970 352.237 1.00 129.07 ? 248 THR A CB    1 
ATOM   1825  O  OG1   . THR A 1 248 ? 101.068 -23.389 352.537 1.00 132.30 ? 248 THR A OG1   1 
ATOM   1826  C  CG2   . THR A 1 248 ? 103.075 -22.471 353.508 1.00 125.23 ? 248 THR A CG2   1 
ATOM   1827  N  N     . THR A 1 249 ? 104.177 -20.246 351.209 1.00 122.33 ? 249 THR A N     1 
ATOM   1828  C  CA    . THR A 1 249 ? 105.527 -19.762 350.957 1.00 105.46 ? 249 THR A CA    1 
ATOM   1829  C  C     . THR A 1 249 ? 106.548 -20.615 351.702 1.00 110.59 ? 249 THR A C     1 
ATOM   1830  O  O     . THR A 1 249 ? 106.191 -21.440 352.545 1.00 114.02 ? 249 THR A O     1 
ATOM   1831  C  CB    . THR A 1 249 ? 105.691 -18.296 351.401 1.00 104.73 ? 249 THR A CB    1 
ATOM   1832  O  OG1   . THR A 1 249 ? 105.872 -18.241 352.821 1.00 116.80 ? 249 THR A OG1   1 
ATOM   1833  C  CG2   . THR A 1 249 ? 104.466 -17.481 351.016 1.00 100.88 ? 249 THR A CG2   1 
ATOM   1834  N  N     . LYS A 1 250 ? 107.826 -20.407 351.399 1.00 116.82 ? 250 LYS A N     1 
ATOM   1835  C  CA    . LYS A 1 250 ? 108.894 -21.086 352.125 1.00 125.11 ? 250 LYS A CA    1 
ATOM   1836  C  C     . LYS A 1 250 ? 109.069 -20.437 353.494 1.00 134.31 ? 250 LYS A C     1 
ATOM   1837  O  O     . LYS A 1 250 ? 109.913 -20.850 354.290 1.00 132.23 ? 250 LYS A O     1 
ATOM   1838  C  CB    . LYS A 1 250 ? 110.203 -21.030 351.336 1.00 121.05 ? 250 LYS A CB    1 
ATOM   1839  N  N     . THR A 1 251 ? 108.255 -19.419 353.757 1.00 135.17 ? 251 THR A N     1 
ATOM   1840  C  CA    . THR A 1 251 ? 108.312 -18.679 355.009 1.00 131.98 ? 251 THR A CA    1 
ATOM   1841  C  C     . THR A 1 251 ? 107.123 -19.001 355.912 1.00 143.62 ? 251 THR A C     1 
ATOM   1842  O  O     . THR A 1 251 ? 107.070 -18.553 357.055 1.00 156.32 ? 251 THR A O     1 
ATOM   1843  C  CB    . THR A 1 251 ? 108.370 -17.163 354.759 1.00 125.78 ? 251 THR A CB    1 
ATOM   1844  O  OG1   . THR A 1 251 ? 107.066 -16.678 354.418 1.00 125.38 ? 251 THR A OG1   1 
ATOM   1845  C  CG2   . THR A 1 251 ? 109.340 -16.849 353.629 1.00 132.75 ? 251 THR A CG2   1 
ATOM   1846  N  N     . GLY A 1 252 ? 106.163 -19.760 355.391 1.00 139.29 ? 252 GLY A N     1 
ATOM   1847  C  CA    . GLY A 1 252 ? 105.105 -20.311 356.218 1.00 138.22 ? 252 GLY A CA    1 
ATOM   1848  C  C     . GLY A 1 252 ? 103.720 -19.693 356.131 1.00 130.79 ? 252 GLY A C     1 
ATOM   1849  O  O     . GLY A 1 252 ? 102.775 -20.225 356.713 1.00 128.81 ? 252 GLY A O     1 
ATOM   1850  N  N     . ARG A 1 253 ? 103.579 -18.580 355.419 1.00 115.17 ? 253 ARG A N     1 
ATOM   1851  C  CA    . ARG A 1 253 ? 102.274 -17.928 355.318 1.00 118.94 ? 253 ARG A CA    1 
ATOM   1852  C  C     . ARG A 1 253 ? 101.545 -18.217 354.007 1.00 112.88 ? 253 ARG A C     1 
ATOM   1853  O  O     . ARG A 1 253 ? 102.151 -18.666 353.034 1.00 116.85 ? 253 ARG A O     1 
ATOM   1854  C  CB    . ARG A 1 253 ? 102.382 -16.421 355.575 1.00 111.37 ? 253 ARG A CB    1 
ATOM   1855  C  CG    . ARG A 1 253 ? 103.692 -15.789 355.143 1.00 125.38 ? 253 ARG A CG    1 
ATOM   1856  C  CD    . ARG A 1 253 ? 103.797 -14.367 355.672 1.00 127.16 ? 253 ARG A CD    1 
ATOM   1857  N  NE    . ARG A 1 253 ? 104.977 -13.677 355.164 1.00 132.67 ? 253 ARG A NE    1 
ATOM   1858  C  CZ    . ARG A 1 253 ? 105.019 -13.046 353.995 1.00 145.74 ? 253 ARG A CZ    1 
ATOM   1859  N  NH1   . ARG A 1 253 ? 103.945 -13.020 353.216 1.00 140.46 ? 253 ARG A NH1   1 
ATOM   1860  N  NH2   . ARG A 1 253 ? 106.135 -12.446 353.603 1.00 157.98 ? 253 ARG A NH2   1 
ATOM   1861  N  N     . GLU A 1 254 ? 100.241 -17.956 353.997 1.00 121.15 ? 254 GLU A N     1 
ATOM   1862  C  CA    . GLU A 1 254 ? 99.389  -18.297 352.860 1.00 124.96 ? 254 GLU A CA    1 
ATOM   1863  C  C     . GLU A 1 254 ? 99.702  -17.494 351.601 1.00 116.13 ? 254 GLU A C     1 
ATOM   1864  O  O     . GLU A 1 254 ? 100.211 -16.375 351.669 1.00 120.92 ? 254 GLU A O     1 
ATOM   1865  C  CB    . GLU A 1 254 ? 97.912  -18.140 353.230 1.00 126.53 ? 254 GLU A CB    1 
ATOM   1866  C  CG    . GLU A 1 254 ? 97.371  -19.262 354.103 1.00 129.49 ? 254 GLU A CG    1 
ATOM   1867  C  CD    . GLU A 1 254 ? 95.899  -19.097 354.426 1.00 137.41 ? 254 GLU A CD    1 
ATOM   1868  O  OE1   . GLU A 1 254 ? 95.514  -18.019 354.926 1.00 140.66 ? 254 GLU A OE1   1 
ATOM   1869  O  OE2   . GLU A 1 254 ? 95.124  -20.044 354.171 1.00 143.51 ? 254 GLU A OE2   1 
ATOM   1870  N  N     . ARG A 1 255 ? 99.390  -18.083 350.452 1.00 115.83 ? 255 ARG A N     1 
ATOM   1871  C  CA    . ARG A 1 255 ? 99.628  -17.445 349.164 1.00 122.55 ? 255 ARG A CA    1 
ATOM   1872  C  C     . ARG A 1 255 ? 98.512  -17.780 348.186 1.00 121.21 ? 255 ARG A C     1 
ATOM   1873  O  O     . ARG A 1 255 ? 98.221  -18.949 347.944 1.00 131.05 ? 255 ARG A O     1 
ATOM   1874  C  CB    . ARG A 1 255 ? 100.961 -17.909 348.580 1.00 119.84 ? 255 ARG A CB    1 
ATOM   1875  C  CG    . ARG A 1 255 ? 101.260 -17.323 347.213 1.00 100.30 ? 255 ARG A CG    1 
ATOM   1876  C  CD    . ARG A 1 255 ? 102.197 -18.212 346.416 1.00 100.85 ? 255 ARG A CD    1 
ATOM   1877  N  NE    . ARG A 1 255 ? 103.424 -18.530 347.139 1.00 105.32 ? 255 ARG A NE    1 
ATOM   1878  C  CZ    . ARG A 1 255 ? 104.447 -17.693 347.274 1.00 105.26 ? 255 ARG A CZ    1 
ATOM   1879  N  NH1   . ARG A 1 255 ? 104.393 -16.482 346.738 1.00 102.25 ? 255 ARG A NH1   1 
ATOM   1880  N  NH2   . ARG A 1 255 ? 105.525 -18.063 347.948 1.00 96.93  ? 255 ARG A NH2   1 
ATOM   1881  N  N     . ILE A 1 256 ? 97.888  -16.753 347.621 1.00 105.45 ? 256 ILE A N     1 
ATOM   1882  C  CA    . ILE A 1 256 ? 96.847  -16.965 346.623 1.00 103.04 ? 256 ILE A CA    1 
ATOM   1883  C  C     . ILE A 1 256 ? 97.432  -16.957 345.215 1.00 107.01 ? 256 ILE A C     1 
ATOM   1884  O  O     . ILE A 1 256 ? 98.118  -16.015 344.828 1.00 102.04 ? 256 ILE A O     1 
ATOM   1885  C  CB    . ILE A 1 256 ? 95.743  -15.903 346.722 1.00 98.40  ? 256 ILE A CB    1 
ATOM   1886  C  CG1   . ILE A 1 256 ? 95.001  -16.034 348.054 1.00 112.05 ? 256 ILE A CG1   1 
ATOM   1887  C  CG2   . ILE A 1 256 ? 94.768  -16.042 345.565 1.00 96.10  ? 256 ILE A CG2   1 
ATOM   1888  C  CD1   . ILE A 1 256 ? 93.851  -15.063 348.207 1.00 123.75 ? 256 ILE A CD1   1 
ATOM   1889  N  N     . VAL A 1 257 ? 97.162  -18.011 344.452 1.00 112.58 ? 257 VAL A N     1 
ATOM   1890  C  CA    . VAL A 1 257 ? 97.696  -18.115 343.101 1.00 115.10 ? 257 VAL A CA    1 
ATOM   1891  C  C     . VAL A 1 257 ? 96.587  -18.191 342.064 1.00 116.46 ? 257 VAL A C     1 
ATOM   1892  O  O     . VAL A 1 257 ? 95.955  -19.235 341.896 1.00 116.84 ? 257 VAL A O     1 
ATOM   1893  C  CB    . VAL A 1 257 ? 98.603  -19.349 342.942 1.00 117.53 ? 257 VAL A CB    1 
ATOM   1894  C  CG1   . VAL A 1 257 ? 99.284  -19.332 341.581 1.00 110.07 ? 257 VAL A CG1   1 
ATOM   1895  C  CG2   . VAL A 1 257 ? 99.634  -19.395 344.055 1.00 126.63 ? 257 VAL A CG2   1 
ATOM   1896  N  N     . VAL A 1 258 ? 96.350  -17.080 341.373 1.00 116.19 ? 258 VAL A N     1 
ATOM   1897  C  CA    . VAL A 1 258 ? 95.372  -17.062 340.296 1.00 107.53 ? 258 VAL A CA    1 
ATOM   1898  C  C     . VAL A 1 258 ? 96.029  -17.555 339.014 1.00 103.05 ? 258 VAL A C     1 
ATOM   1899  O  O     . VAL A 1 258 ? 96.985  -16.949 338.524 1.00 112.48 ? 258 VAL A O     1 
ATOM   1900  C  CB    . VAL A 1 258 ? 94.793  -15.654 340.058 1.00 105.61 ? 258 VAL A CB    1 
ATOM   1901  C  CG1   . VAL A 1 258 ? 93.576  -15.740 339.151 1.00 98.97  ? 258 VAL A CG1   1 
ATOM   1902  C  CG2   . VAL A 1 258 ? 94.425  -14.990 341.379 1.00 109.50 ? 258 VAL A CG2   1 
ATOM   1903  N  N     . THR A 1 259 ? 95.521  -18.659 338.479 1.00 102.65 ? 259 THR A N     1 
ATOM   1904  C  CA    . THR A 1 259 ? 96.099  -19.250 337.280 1.00 109.93 ? 259 THR A CA    1 
ATOM   1905  C  C     . THR A 1 259 ? 95.232  -19.035 336.042 1.00 112.95 ? 259 THR A C     1 
ATOM   1906  O  O     . THR A 1 259 ? 95.748  -19.003 334.924 1.00 110.46 ? 259 THR A O     1 
ATOM   1907  C  CB    . THR A 1 259 ? 96.380  -20.752 337.463 1.00 110.74 ? 259 THR A CB    1 
ATOM   1908  O  OG1   . THR A 1 259 ? 95.191  -21.412 337.914 1.00 119.41 ? 259 THR A OG1   1 
ATOM   1909  C  CG2   . THR A 1 259 ? 97.487  -20.966 338.483 1.00 106.62 ? 259 THR A CG2   1 
ATOM   1910  N  N     . GLU A 1 260 ? 93.921  -18.895 336.229 1.00 114.97 ? 260 GLU A N     1 
ATOM   1911  C  CA    . GLU A 1 260 ? 93.053  -18.623 335.081 1.00 89.26  ? 260 GLU A CA    1 
ATOM   1912  C  C     . GLU A 1 260 ? 92.047  -17.507 335.352 1.00 88.58  ? 260 GLU A C     1 
ATOM   1913  O  O     . GLU A 1 260 ? 91.269  -17.595 336.287 1.00 124.38 ? 260 GLU A O     1 
ATOM   1914  C  CB    . GLU A 1 260 ? 92.318  -19.893 334.638 1.00 106.02 ? 260 GLU A CB    1 
ATOM   1915  C  CG    . GLU A 1 260 ? 93.232  -21.027 334.204 1.00 110.16 ? 260 GLU A CG    1 
ATOM   1916  C  CD    . GLU A 1 260 ? 92.469  -22.217 333.661 1.00 121.11 ? 260 GLU A CD    1 
ATOM   1917  O  OE1   . GLU A 1 260 ? 91.236  -22.108 333.495 1.00 122.73 ? 260 GLU A OE1   1 
ATOM   1918  O  OE2   . GLU A 1 260 ? 93.102  -23.262 333.399 1.00 129.47 ? 260 GLU A OE2   1 
ATOM   1919  N  N     . PHE A 1 261 ? 92.062  -16.464 334.529 1.00 116.24 ? 261 PHE A N     1 
ATOM   1920  C  CA    . PHE A 1 261 ? 91.107  -15.367 334.670 1.00 90.04  ? 261 PHE A CA    1 
ATOM   1921  C  C     . PHE A 1 261 ? 89.918  -15.577 333.730 1.00 98.10  ? 261 PHE A C     1 
ATOM   1922  O  O     . PHE A 1 261 ? 90.041  -16.278 332.727 1.00 100.57 ? 261 PHE A O     1 
ATOM   1923  C  CB    . PHE A 1 261 ? 91.789  -14.022 334.398 1.00 118.40 ? 261 PHE A CB    1 
ATOM   1924  C  CG    . PHE A 1 261 ? 92.750  -13.601 335.474 1.00 111.98 ? 261 PHE A CG    1 
ATOM   1925  C  CD1   . PHE A 1 261 ? 94.041  -14.105 335.504 1.00 112.50 ? 261 PHE A CD1   1 
ATOM   1926  C  CD2   . PHE A 1 261 ? 92.366  -12.700 336.455 1.00 111.97 ? 261 PHE A CD2   1 
ATOM   1927  C  CE1   . PHE A 1 261 ? 94.929  -13.721 336.493 1.00 114.24 ? 261 PHE A CE1   1 
ATOM   1928  C  CE2   . PHE A 1 261 ? 93.250  -12.312 337.445 1.00 115.56 ? 261 PHE A CE2   1 
ATOM   1929  C  CZ    . PHE A 1 261 ? 94.533  -12.822 337.463 1.00 116.96 ? 261 PHE A CZ    1 
ATOM   1930  N  N     . PRO A 1 262 ? 88.759  -14.977 334.054 1.00 92.95  ? 262 PRO A N     1 
ATOM   1931  C  CA    . PRO A 1 262 ? 87.557  -15.165 333.232 1.00 95.93  ? 262 PRO A CA    1 
ATOM   1932  C  C     . PRO A 1 262 ? 87.653  -14.546 331.837 1.00 112.56 ? 262 PRO A C     1 
ATOM   1933  O  O     . PRO A 1 262 ? 88.641  -13.893 331.499 1.00 100.14 ? 262 PRO A O     1 
ATOM   1934  C  CB    . PRO A 1 262 ? 86.464  -14.453 334.040 1.00 126.38 ? 262 PRO A CB    1 
ATOM   1935  C  CG    . PRO A 1 262 ? 86.987  -14.396 335.433 1.00 123.08 ? 262 PRO A CG    1 
ATOM   1936  C  CD    . PRO A 1 262 ? 88.462  -14.217 335.280 1.00 90.88  ? 262 PRO A CD    1 
ATOM   1937  N  N     . TYR A 1 263 ? 86.605  -14.757 331.047 1.00 111.02 ? 263 TYR A N     1 
ATOM   1938  C  CA    . TYR A 1 263 ? 86.529  -14.278 329.672 1.00 113.65 ? 263 TYR A CA    1 
ATOM   1939  C  C     . TYR A 1 263 ? 86.564  -12.754 329.620 1.00 122.58 ? 263 TYR A C     1 
ATOM   1940  O  O     . TYR A 1 263 ? 85.871  -12.085 330.388 1.00 124.98 ? 263 TYR A O     1 
ATOM   1941  C  CB    . TYR A 1 263 ? 85.242  -14.804 329.026 1.00 114.20 ? 263 TYR A CB    1 
ATOM   1942  C  CG    . TYR A 1 263 ? 85.146  -14.628 327.527 1.00 117.36 ? 263 TYR A CG    1 
ATOM   1943  C  CD1   . TYR A 1 263 ? 86.146  -15.096 326.686 1.00 134.49 ? 263 TYR A CD1   1 
ATOM   1944  C  CD2   . TYR A 1 263 ? 84.031  -14.033 326.950 1.00 121.70 ? 263 TYR A CD2   1 
ATOM   1945  C  CE1   . TYR A 1 263 ? 86.052  -14.950 325.309 1.00 125.72 ? 263 TYR A CE1   1 
ATOM   1946  C  CE2   . TYR A 1 263 ? 83.927  -13.883 325.579 1.00 170.08 ? 263 TYR A CE2   1 
ATOM   1947  C  CZ    . TYR A 1 263 ? 84.939  -14.343 324.763 1.00 164.93 ? 263 TYR A CZ    1 
ATOM   1948  O  OH    . TYR A 1 263 ? 84.829  -14.189 323.400 1.00 167.13 ? 263 TYR A OH    1 
ATOM   1949  N  N     . MET A 1 264 ? 87.378  -12.220 328.712 1.00 132.15 ? 264 MET A N     1 
ATOM   1950  C  CA    . MET A 1 264 ? 87.490  -10.776 328.500 1.00 133.02 ? 264 MET A CA    1 
ATOM   1951  C  C     . MET A 1 264 ? 87.850  -9.995  329.768 1.00 133.27 ? 264 MET A C     1 
ATOM   1952  O  O     . MET A 1 264 ? 87.272  -8.946  330.045 1.00 141.81 ? 264 MET A O     1 
ATOM   1953  C  CB    . MET A 1 264 ? 86.205  -10.220 327.875 1.00 122.63 ? 264 MET A CB    1 
ATOM   1954  C  CG    . MET A 1 264 ? 85.905  -10.759 326.485 1.00 124.89 ? 264 MET A CG    1 
ATOM   1955  S  SD    . MET A 1 264 ? 84.455  -10.006 325.733 1.00 165.67 ? 264 MET A SD    1 
ATOM   1956  C  CE    . MET A 1 264 ? 83.165  -10.555 326.852 1.00 141.77 ? 264 MET A CE    1 
ATOM   1957  N  N     . VAL A 1 265 ? 88.806  -10.516 330.532 1.00 119.34 ? 265 VAL A N     1 
ATOM   1958  C  CA    . VAL A 1 265 ? 89.263  -9.854  331.751 1.00 119.28 ? 265 VAL A CA    1 
ATOM   1959  C  C     . VAL A 1 265 ? 90.771  -9.643  331.731 1.00 117.75 ? 265 VAL A C     1 
ATOM   1960  O  O     . VAL A 1 265 ? 91.541  -10.590 331.582 1.00 117.91 ? 265 VAL A O     1 
ATOM   1961  C  CB    . VAL A 1 265 ? 88.874  -10.646 333.017 1.00 116.99 ? 265 VAL A CB    1 
ATOM   1962  C  CG1   . VAL A 1 265 ? 89.602  -10.101 334.242 1.00 95.01  ? 265 VAL A CG1   1 
ATOM   1963  C  CG2   . VAL A 1 265 ? 87.367  -10.617 333.219 1.00 112.99 ? 265 VAL A CG2   1 
ATOM   1964  N  N     . ASN A 1 266 ? 91.182  -8.389  331.881 1.00 110.30 ? 266 ASN A N     1 
ATOM   1965  C  CA    . ASN A 1 266 ? 92.591  -8.017  331.842 1.00 112.63 ? 266 ASN A CA    1 
ATOM   1966  C  C     . ASN A 1 266 ? 93.319  -8.278  333.165 1.00 114.78 ? 266 ASN A C     1 
ATOM   1967  O  O     . ASN A 1 266 ? 92.902  -7.797  334.218 1.00 114.45 ? 266 ASN A O     1 
ATOM   1968  C  CB    . ASN A 1 266 ? 92.724  -6.544  331.442 1.00 107.52 ? 266 ASN A CB    1 
ATOM   1969  C  CG    . ASN A 1 266 ? 94.119  -6.187  330.969 1.00 124.97 ? 266 ASN A CG    1 
ATOM   1970  O  OD1   . ASN A 1 266 ? 95.112  -6.729  331.453 1.00 123.76 ? 266 ASN A OD1   1 
ATOM   1971  N  ND2   . ASN A 1 266 ? 94.199  -5.268  330.014 1.00 115.68 ? 266 ASN A ND2   1 
ATOM   1972  N  N     . LYS A 1 267 ? 94.408  -9.039  333.094 1.00 117.35 ? 267 LYS A N     1 
ATOM   1973  C  CA    . LYS A 1 267 ? 95.249  -9.321  334.256 1.00 116.57 ? 267 LYS A CA    1 
ATOM   1974  C  C     . LYS A 1 267 ? 95.762  -8.042  334.908 1.00 122.50 ? 267 LYS A C     1 
ATOM   1975  O  O     . LYS A 1 267 ? 95.630  -7.849  336.119 1.00 113.20 ? 267 LYS A O     1 
ATOM   1976  C  CB    . LYS A 1 267 ? 96.444  -10.181 333.842 1.00 117.93 ? 267 LYS A CB    1 
ATOM   1977  C  CG    . LYS A 1 267 ? 96.226  -11.675 333.980 1.00 118.71 ? 267 LYS A CG    1 
ATOM   1978  C  CD    . LYS A 1 267 ? 97.345  -12.475 333.323 1.00 118.35 ? 267 LYS A CD    1 
ATOM   1979  C  CE    . LYS A 1 267 ? 98.725  -11.973 333.723 1.00 110.85 ? 267 LYS A CE    1 
ATOM   1980  N  NZ    . LYS A 1 267 ? 99.310  -11.045 332.710 1.00 107.60 ? 267 LYS A NZ    1 
ATOM   1981  N  N     . THR A 1 268 ? 96.352  -7.177  334.088 1.00 130.60 ? 268 THR A N     1 
ATOM   1982  C  CA    . THR A 1 268 ? 96.932  -5.925  334.558 1.00 129.22 ? 268 THR A CA    1 
ATOM   1983  C  C     . THR A 1 268 ? 95.890  -5.032  335.224 1.00 130.74 ? 268 THR A C     1 
ATOM   1984  O  O     . THR A 1 268 ? 96.155  -4.425  336.264 1.00 132.67 ? 268 THR A O     1 
ATOM   1985  C  CB    . THR A 1 268 ? 97.615  -5.160  333.403 1.00 130.36 ? 268 THR A CB    1 
ATOM   1986  O  OG1   . THR A 1 268 ? 98.665  -5.964  332.851 1.00 133.83 ? 268 THR A OG1   1 
ATOM   1987  C  CG2   . THR A 1 268 ? 98.199  -3.847  333.894 1.00 135.15 ? 268 THR A CG2   1 
ATOM   1988  N  N     . LYS A 1 269 ? 94.705  -4.963  334.624 1.00 129.33 ? 269 LYS A N     1 
ATOM   1989  C  CA    . LYS A 1 269 ? 93.608  -4.171  335.170 1.00 127.66 ? 269 LYS A CA    1 
ATOM   1990  C  C     . LYS A 1 269 ? 93.197  -4.691  336.542 1.00 122.57 ? 269 LYS A C     1 
ATOM   1991  O  O     . LYS A 1 269 ? 92.871  -3.915  337.443 1.00 127.35 ? 269 LYS A O     1 
ATOM   1992  C  CB    . LYS A 1 269 ? 92.409  -4.186  334.221 1.00 127.90 ? 269 LYS A CB    1 
ATOM   1993  N  N     . VAL A 1 270 ? 93.214  -6.011  336.693 1.00 115.14 ? 270 VAL A N     1 
ATOM   1994  C  CA    . VAL A 1 270 ? 92.930  -6.643  337.977 1.00 106.90 ? 270 VAL A CA    1 
ATOM   1995  C  C     . VAL A 1 270 ? 94.015  -6.293  338.995 1.00 109.26 ? 270 VAL A C     1 
ATOM   1996  O  O     . VAL A 1 270 ? 93.719  -6.021  340.157 1.00 105.30 ? 270 VAL A O     1 
ATOM   1997  C  CB    . VAL A 1 270 ? 92.805  -8.177  337.840 1.00 95.60  ? 270 VAL A CB    1 
ATOM   1998  C  CG1   . VAL A 1 270 ? 92.728  -8.834  339.201 1.00 85.83  ? 270 VAL A CG1   1 
ATOM   1999  C  CG2   . VAL A 1 270 ? 91.577  -8.531  337.016 1.00 95.63  ? 270 VAL A CG2   1 
ATOM   2000  N  N     . HIS A 1 271 ? 95.268  -6.290  338.548 1.00 115.33 ? 271 HIS A N     1 
ATOM   2001  C  CA    . HIS A 1 271 ? 96.393  -5.929  339.412 1.00 114.63 ? 271 HIS A CA    1 
ATOM   2002  C  C     . HIS A 1 271 ? 96.224  -4.505  339.941 1.00 113.72 ? 271 HIS A C     1 
ATOM   2003  O  O     . HIS A 1 271 ? 96.324  -4.258  341.148 1.00 117.38 ? 271 HIS A O     1 
ATOM   2004  C  CB    . HIS A 1 271 ? 97.714  -6.063  338.648 1.00 117.30 ? 271 HIS A CB    1 
ATOM   2005  C  CG    . HIS A 1 271 ? 98.931  -5.847  339.490 1.00 113.70 ? 271 HIS A CG    1 
ATOM   2006  N  ND1   . HIS A 1 271 ? 98.879  -5.729  340.863 1.00 118.13 ? 271 HIS A ND1   1 
ATOM   2007  C  CD2   . HIS A 1 271 ? 100.238 -5.728  339.154 1.00 121.56 ? 271 HIS A CD2   1 
ATOM   2008  C  CE1   . HIS A 1 271 ? 100.097 -5.546  341.334 1.00 124.39 ? 271 HIS A CE1   1 
ATOM   2009  N  NE2   . HIS A 1 271 ? 100.942 -5.542  340.317 1.00 126.51 ? 271 HIS A NE2   1 
ATOM   2010  N  N     . GLU A 1 272 ? 95.952  -3.578  339.027 1.00 116.61 ? 272 GLU A N     1 
ATOM   2011  C  CA    . GLU A 1 272 ? 95.757  -2.173  339.370 1.00 116.88 ? 272 GLU A CA    1 
ATOM   2012  C  C     . GLU A 1 272 ? 94.567  -1.974  340.304 1.00 124.34 ? 272 GLU A C     1 
ATOM   2013  O  O     . GLU A 1 272 ? 94.664  -1.253  341.299 1.00 133.58 ? 272 GLU A O     1 
ATOM   2014  C  CB    . GLU A 1 272 ? 95.565  -1.341  338.102 1.00 108.29 ? 272 GLU A CB    1 
ATOM   2015  N  N     . HIS A 1 273 ? 93.448  -2.614  339.975 1.00 118.74 ? 273 HIS A N     1 
ATOM   2016  C  CA    . HIS A 1 273 ? 92.240  -2.524  340.790 1.00 114.15 ? 273 HIS A CA    1 
ATOM   2017  C  C     . HIS A 1 273 ? 92.512  -3.014  342.209 1.00 107.08 ? 273 HIS A C     1 
ATOM   2018  O  O     . HIS A 1 273 ? 92.116  -2.377  343.185 1.00 108.04 ? 273 HIS A O     1 
ATOM   2019  C  CB    . HIS A 1 273 ? 91.116  -3.340  340.149 1.00 114.27 ? 273 HIS A CB    1 
ATOM   2020  C  CG    . HIS A 1 273 ? 89.784  -3.166  340.810 1.00 118.09 ? 273 HIS A CG    1 
ATOM   2021  N  ND1   . HIS A 1 273 ? 89.485  -2.092  341.619 1.00 123.25 ? 273 HIS A ND1   1 
ATOM   2022  C  CD2   . HIS A 1 273 ? 88.668  -3.933  340.775 1.00 122.68 ? 273 HIS A CD2   1 
ATOM   2023  C  CE1   . HIS A 1 273 ? 88.243  -2.205  342.057 1.00 127.52 ? 273 HIS A CE1   1 
ATOM   2024  N  NE2   . HIS A 1 273 ? 87.726  -3.313  341.559 1.00 129.74 ? 273 HIS A NE2   1 
ATOM   2025  N  N     . ILE A 1 274 ? 93.200  -4.147  342.309 1.00 107.78 ? 274 ILE A N     1 
ATOM   2026  C  CA    . ILE A 1 274 ? 93.562  -4.731  343.597 1.00 107.69 ? 274 ILE A CA    1 
ATOM   2027  C  C     . ILE A 1 274 ? 94.467  -3.806  344.403 1.00 116.47 ? 274 ILE A C     1 
ATOM   2028  O  O     . ILE A 1 274 ? 94.247  -3.601  345.596 1.00 111.88 ? 274 ILE A O     1 
ATOM   2029  C  CB    . ILE A 1 274 ? 94.252  -6.103  343.424 1.00 99.84  ? 274 ILE A CB    1 
ATOM   2030  C  CG1   . ILE A 1 274 ? 93.219  -7.176  343.084 1.00 98.46  ? 274 ILE A CG1   1 
ATOM   2031  C  CG2   . ILE A 1 274 ? 95.015  -6.499  344.681 1.00 94.99  ? 274 ILE A CG2   1 
ATOM   2032  C  CD1   . ILE A 1 274 ? 93.818  -8.548  342.906 1.00 99.29  ? 274 ILE A CD1   1 
ATOM   2033  N  N     . VAL A 1 275 ? 95.481  -3.245  343.749 1.00 121.74 ? 275 VAL A N     1 
ATOM   2034  C  CA    . VAL A 1 275 ? 96.388  -2.314  344.417 1.00 118.98 ? 275 VAL A CA    1 
ATOM   2035  C  C     . VAL A 1 275 ? 95.626  -1.101  344.952 1.00 122.53 ? 275 VAL A C     1 
ATOM   2036  O  O     . VAL A 1 275 ? 95.800  -0.704  346.109 1.00 121.01 ? 275 VAL A O     1 
ATOM   2037  C  CB    . VAL A 1 275 ? 97.524  -1.849  343.480 1.00 113.91 ? 275 VAL A CB    1 
ATOM   2038  C  CG1   . VAL A 1 275 ? 98.249  -0.649  344.070 1.00 117.43 ? 275 VAL A CG1   1 
ATOM   2039  C  CG2   . VAL A 1 275 ? 98.498  -2.991  343.215 1.00 106.53 ? 275 VAL A CG2   1 
ATOM   2040  N  N     . ARG A 1 276 ? 94.770  -0.531  344.107 1.00 124.13 ? 276 ARG A N     1 
ATOM   2041  C  CA    . ARG A 1 276 ? 93.953  0.615   344.491 1.00 123.06 ? 276 ARG A CA    1 
ATOM   2042  C  C     . ARG A 1 276 ? 93.011  0.274   345.643 1.00 126.76 ? 276 ARG A C     1 
ATOM   2043  O  O     . ARG A 1 276 ? 92.692  1.127   346.467 1.00 133.92 ? 276 ARG A O     1 
ATOM   2044  C  CB    . ARG A 1 276 ? 93.151  1.131   343.294 1.00 119.89 ? 276 ARG A CB    1 
ATOM   2045  N  N     . LEU A 1 277 ? 92.566  -0.978  345.693 1.00 123.86 ? 277 LEU A N     1 
ATOM   2046  C  CA    . LEU A 1 277 ? 91.706  -1.437  346.780 1.00 119.29 ? 277 LEU A CA    1 
ATOM   2047  C  C     . LEU A 1 277 ? 92.489  -1.666  348.069 1.00 121.26 ? 277 LEU A C     1 
ATOM   2048  O  O     . LEU A 1 277 ? 91.933  -1.579  349.164 1.00 120.21 ? 277 LEU A O     1 
ATOM   2049  C  CB    . LEU A 1 277 ? 90.972  -2.720  346.387 1.00 109.70 ? 277 LEU A CB    1 
ATOM   2050  C  CG    . LEU A 1 277 ? 89.719  -2.560  345.527 1.00 110.09 ? 277 LEU A CG    1 
ATOM   2051  C  CD1   . LEU A 1 277 ? 89.086  -3.914  345.245 1.00 110.64 ? 277 LEU A CD1   1 
ATOM   2052  C  CD2   . LEU A 1 277 ? 88.728  -1.631  346.210 1.00 114.53 ? 277 LEU A CD2   1 
ATOM   2053  N  N     . VAL A 1 278 ? 93.778  -1.959  347.931 1.00 123.34 ? 278 VAL A N     1 
ATOM   2054  C  CA    . VAL A 1 278 ? 94.626  -2.265  349.079 1.00 122.60 ? 278 VAL A CA    1 
ATOM   2055  C  C     . VAL A 1 278 ? 95.157  -1.002  349.745 1.00 129.39 ? 278 VAL A C     1 
ATOM   2056  O  O     . VAL A 1 278 ? 95.153  -0.893  350.969 1.00 133.27 ? 278 VAL A O     1 
ATOM   2057  C  CB    . VAL A 1 278 ? 95.812  -3.165  348.688 1.00 111.44 ? 278 VAL A CB    1 
ATOM   2058  N  N     . GLN A 1 279 ? 95.606  -0.046  348.937 1.00 133.88 ? 279 GLN A N     1 
ATOM   2059  C  CA    . GLN A 1 279 ? 96.111  1.223   349.461 1.00 138.22 ? 279 GLN A CA    1 
ATOM   2060  C  C     . GLN A 1 279 ? 94.967  2.176   349.802 1.00 138.75 ? 279 GLN A C     1 
ATOM   2061  O  O     . GLN A 1 279 ? 95.137  3.396   349.813 1.00 145.87 ? 279 GLN A O     1 
ATOM   2062  C  CB    . GLN A 1 279 ? 97.068  1.877   348.461 1.00 138.52 ? 279 GLN A CB    1 
ATOM   2063  N  N     . GLU A 1 280 ? 93.802  1.601   350.082 1.00 132.83 ? 280 GLU A N     1 
ATOM   2064  C  CA    . GLU A 1 280 ? 92.602  2.357   350.401 1.00 138.23 ? 280 GLU A CA    1 
ATOM   2065  C  C     . GLU A 1 280 ? 91.938  1.714   351.613 1.00 137.86 ? 280 GLU A C     1 
ATOM   2066  O  O     . GLU A 1 280 ? 90.929  2.204   352.124 1.00 133.69 ? 280 GLU A O     1 
ATOM   2067  C  CB    . GLU A 1 280 ? 91.649  2.343   349.205 1.00 149.22 ? 280 GLU A CB    1 
ATOM   2068  C  CG    . GLU A 1 280 ? 90.507  3.342   349.271 1.00 163.07 ? 280 GLU A CG    1 
ATOM   2069  C  CD    . GLU A 1 280 ? 89.540  3.186   348.114 1.00 170.98 ? 280 GLU A CD    1 
ATOM   2070  O  OE1   . GLU A 1 280 ? 89.758  3.825   347.063 1.00 174.78 ? 280 GLU A OE1   1 
ATOM   2071  O  OE2   . GLU A 1 280 ? 88.563  2.420   348.254 1.00 171.35 ? 280 GLU A OE2   1 
ATOM   2072  N  N     . LYS A 1 281 ? 92.522  0.605   352.061 1.00 142.90 ? 281 LYS A N     1 
ATOM   2073  C  CA    . LYS A 1 281 ? 92.038  -0.147  353.219 1.00 144.42 ? 281 LYS A CA    1 
ATOM   2074  C  C     . LYS A 1 281 ? 90.620  -0.692  353.034 1.00 142.18 ? 281 LYS A C     1 
ATOM   2075  O  O     . LYS A 1 281 ? 89.923  -0.979  354.006 1.00 147.75 ? 281 LYS A O     1 
ATOM   2076  C  CB    . LYS A 1 281 ? 92.140  0.688   354.501 1.00 144.70 ? 281 LYS A CB    1 
ATOM   2077  N  N     . ARG A 1 282 ? 90.201  -0.840  351.781 1.00 136.34 ? 282 ARG A N     1 
ATOM   2078  C  CA    . ARG A 1 282 ? 88.907  -1.441  351.486 1.00 133.34 ? 282 ARG A CA    1 
ATOM   2079  C  C     . ARG A 1 282 ? 89.067  -2.958  351.450 1.00 124.61 ? 282 ARG A C     1 
ATOM   2080  O  O     . ARG A 1 282 ? 88.089  -3.706  351.440 1.00 122.83 ? 282 ARG A O     1 
ATOM   2081  C  CB    . ARG A 1 282 ? 88.353  -0.910  350.162 1.00 131.94 ? 282 ARG A CB    1 
ATOM   2082  C  CG    . ARG A 1 282 ? 86.849  -1.061  350.013 1.00 133.68 ? 282 ARG A CG    1 
ATOM   2083  C  CD    . ARG A 1 282 ? 86.337  -0.299  348.800 1.00 136.19 ? 282 ARG A CD    1 
ATOM   2084  N  N     . ILE A 1 283 ? 90.323  -3.395  351.432 1.00 118.34 ? 283 ILE A N     1 
ATOM   2085  C  CA    . ILE A 1 283 ? 90.680  -4.802  351.551 1.00 110.41 ? 283 ILE A CA    1 
ATOM   2086  C  C     . ILE A 1 283 ? 91.946  -4.894  352.397 1.00 109.40 ? 283 ILE A C     1 
ATOM   2087  O  O     . ILE A 1 283 ? 92.878  -4.113  352.213 1.00 104.94 ? 283 ILE A O     1 
ATOM   2088  C  CB    . ILE A 1 283 ? 90.927  -5.445  350.175 1.00 98.35  ? 283 ILE A CB    1 
ATOM   2089  N  N     . GLU A 1 284 ? 91.975  -5.838  353.331 1.00 109.79 ? 284 GLU A N     1 
ATOM   2090  C  CA    . GLU A 1 284 ? 93.085  -5.926  354.275 1.00 114.41 ? 284 GLU A CA    1 
ATOM   2091  C  C     . GLU A 1 284 ? 93.635  -7.343  354.431 1.00 110.96 ? 284 GLU A C     1 
ATOM   2092  O  O     . GLU A 1 284 ? 92.906  -8.326  354.299 1.00 112.88 ? 284 GLU A O     1 
ATOM   2093  C  CB    . GLU A 1 284 ? 92.667  -5.372  355.642 1.00 126.20 ? 284 GLU A CB    1 
ATOM   2094  N  N     . GLY A 1 285 ? 94.932  -7.430  354.712 1.00 104.23 ? 285 GLY A N     1 
ATOM   2095  C  CA    . GLY A 1 285 ? 95.592  -8.704  354.929 1.00 105.08 ? 285 GLY A CA    1 
ATOM   2096  C  C     . GLY A 1 285 ? 96.589  -9.053  353.841 1.00 114.26 ? 285 GLY A C     1 
ATOM   2097  O  O     . GLY A 1 285 ? 97.244  -10.092 353.899 1.00 123.00 ? 285 GLY A O     1 
ATOM   2098  N  N     . ILE A 1 286 ? 96.709  -8.181  352.845 1.00 114.65 ? 286 ILE A N     1 
ATOM   2099  C  CA    . ILE A 1 286 ? 97.582  -8.448  351.706 1.00 116.38 ? 286 ILE A CA    1 
ATOM   2100  C  C     . ILE A 1 286 ? 99.025  -8.006  351.944 1.00 117.27 ? 286 ILE A C     1 
ATOM   2101  O  O     . ILE A 1 286 ? 99.291  -6.842  352.248 1.00 120.32 ? 286 ILE A O     1 
ATOM   2102  C  CB    . ILE A 1 286 ? 97.045  -7.797  350.414 1.00 111.87 ? 286 ILE A CB    1 
ATOM   2103  C  CG1   . ILE A 1 286 ? 95.720  -8.445  350.009 1.00 107.77 ? 286 ILE A CG1   1 
ATOM   2104  C  CG2   . ILE A 1 286 ? 98.063  -7.919  349.290 1.00 107.08 ? 286 ILE A CG2   1 
ATOM   2105  C  CD1   . ILE A 1 286 ? 95.189  -7.974  348.672 1.00 87.45  ? 286 ILE A CD1   1 
ATOM   2106  N  N     . THR A 1 287 ? 99.949  -8.952  351.804 1.00 111.75 ? 287 THR A N     1 
ATOM   2107  C  CA    . THR A 1 287 ? 101.374 -8.676  351.942 1.00 108.29 ? 287 THR A CA    1 
ATOM   2108  C  C     . THR A 1 287 ? 101.989 -8.236  350.614 1.00 106.27 ? 287 THR A C     1 
ATOM   2109  O  O     . THR A 1 287 ? 102.770 -7.284  350.573 1.00 107.60 ? 287 THR A O     1 
ATOM   2110  C  CB    . THR A 1 287 ? 102.135 -9.901  352.508 1.00 112.81 ? 287 THR A CB    1 
ATOM   2111  O  OG1   . THR A 1 287 ? 102.156 -9.829  353.939 1.00 118.14 ? 287 THR A OG1   1 
ATOM   2112  C  CG2   . THR A 1 287 ? 103.571 -9.949  351.991 1.00 112.19 ? 287 THR A CG2   1 
ATOM   2113  N  N     . ALA A 1 288 ? 101.626 -8.917  349.528 1.00 113.02 ? 288 ALA A N     1 
ATOM   2114  C  CA    . ALA A 1 288 ? 102.196 -8.593  348.219 1.00 109.91 ? 288 ALA A CA    1 
ATOM   2115  C  C     . ALA A 1 288 ? 101.275 -8.937  347.053 1.00 109.67 ? 288 ALA A C     1 
ATOM   2116  O  O     . ALA A 1 288 ? 100.332 -9.709  347.205 1.00 111.86 ? 288 ALA A O     1 
ATOM   2117  C  CB    . ALA A 1 288 ? 103.542 -9.280  348.046 1.00 113.43 ? 288 ALA A CB    1 
ATOM   2118  N  N     . VAL A 1 289 ? 101.545 -8.338  345.894 1.00 115.75 ? 289 VAL A N     1 
ATOM   2119  C  CA    . VAL A 1 289 ? 100.828 -8.660  344.660 1.00 110.63 ? 289 VAL A CA    1 
ATOM   2120  C  C     . VAL A 1 289 ? 101.796 -8.718  343.477 1.00 105.69 ? 289 VAL A C     1 
ATOM   2121  O  O     . VAL A 1 289 ? 102.028 -7.712  342.804 1.00 112.80 ? 289 VAL A O     1 
ATOM   2122  C  CB    . VAL A 1 289 ? 99.722  -7.629  344.333 1.00 105.23 ? 289 VAL A CB    1 
ATOM   2123  C  CG1   . VAL A 1 289 ? 98.847  -8.147  343.205 1.00 108.94 ? 289 VAL A CG1   1 
ATOM   2124  C  CG2   . VAL A 1 289 ? 98.869  -7.331  345.551 1.00 97.68  ? 289 VAL A CG2   1 
ATOM   2125  N  N     . ARG A 1 290 ? 102.358 -9.896  343.227 1.00 102.15 ? 290 ARG A N     1 
ATOM   2126  C  CA    . ARG A 1 290 ? 103.284 -10.077 342.115 1.00 113.49 ? 290 ARG A CA    1 
ATOM   2127  C  C     . ARG A 1 290 ? 102.584 -10.670 340.897 1.00 119.81 ? 290 ARG A C     1 
ATOM   2128  O  O     . ARG A 1 290 ? 101.677 -11.489 341.027 1.00 121.64 ? 290 ARG A O     1 
ATOM   2129  C  CB    . ARG A 1 290 ? 104.438 -10.996 342.520 1.00 116.88 ? 290 ARG A CB    1 
ATOM   2130  C  CG    . ARG A 1 290 ? 105.320 -10.462 343.634 1.00 119.86 ? 290 ARG A CG    1 
ATOM   2131  C  CD    . ARG A 1 290 ? 106.425 -11.452 343.970 1.00 114.74 ? 290 ARG A CD    1 
ATOM   2132  N  N     . ASP A 1 291 ? 103.012 -10.253 339.712 1.00 119.43 ? 291 ASP A N     1 
ATOM   2133  C  CA    . ASP A 1 291 ? 102.557 -10.880 338.480 1.00 116.82 ? 291 ASP A CA    1 
ATOM   2134  C  C     . ASP A 1 291 ? 103.683 -11.763 337.961 1.00 114.66 ? 291 ASP A C     1 
ATOM   2135  O  O     . ASP A 1 291 ? 104.664 -11.271 337.404 1.00 108.87 ? 291 ASP A O     1 
ATOM   2136  C  CB    . ASP A 1 291 ? 102.181 -9.828  337.439 1.00 123.95 ? 291 ASP A CB    1 
ATOM   2137  C  CG    . ASP A 1 291 ? 101.311 -10.390 336.329 1.00 130.41 ? 291 ASP A CG    1 
ATOM   2138  O  OD1   . ASP A 1 291 ? 100.654 -9.589  335.633 1.00 144.11 ? 291 ASP A OD1   1 
ATOM   2139  O  OD2   . ASP A 1 291 ? 101.276 -11.626 336.156 1.00 118.22 ? 291 ASP A OD2   1 
ATOM   2140  N  N     . GLU A 1 292 ? 103.541 -13.071 338.148 1.00 114.28 ? 292 GLU A N     1 
ATOM   2141  C  CA    . GLU A 1 292 ? 104.608 -14.006 337.806 1.00 113.61 ? 292 GLU A CA    1 
ATOM   2142  C  C     . GLU A 1 292 ? 104.355 -14.768 336.512 1.00 113.24 ? 292 GLU A C     1 
ATOM   2143  O  O     . GLU A 1 292 ? 104.994 -15.787 336.253 1.00 109.22 ? 292 GLU A O     1 
ATOM   2144  C  CB    . GLU A 1 292 ? 104.827 -15.003 338.941 1.00 121.21 ? 292 GLU A CB    1 
ATOM   2145  C  CG    . GLU A 1 292 ? 105.343 -14.388 340.224 1.00 124.80 ? 292 GLU A CG    1 
ATOM   2146  C  CD    . GLU A 1 292 ? 105.859 -15.436 341.187 1.00 131.06 ? 292 GLU A CD    1 
ATOM   2147  O  OE1   . GLU A 1 292 ? 106.059 -16.593 340.755 1.00 123.73 ? 292 GLU A OE1   1 
ATOM   2148  O  OE2   . GLU A 1 292 ? 106.063 -15.107 342.374 1.00 144.10 ? 292 GLU A OE2   1 
ATOM   2149  N  N     . SER A 1 293 ? 103.424 -14.277 335.701 1.00 119.16 ? 293 SER A N     1 
ATOM   2150  C  CA    . SER A 1 293 ? 103.086 -14.937 334.445 1.00 114.66 ? 293 SER A CA    1 
ATOM   2151  C  C     . SER A 1 293 ? 104.263 -14.924 333.477 1.00 110.98 ? 293 SER A C     1 
ATOM   2152  O  O     . SER A 1 293 ? 104.760 -13.863 333.104 1.00 114.02 ? 293 SER A O     1 
ATOM   2153  C  CB    . SER A 1 293 ? 101.867 -14.274 333.803 1.00 97.34  ? 293 SER A CB    1 
ATOM   2154  O  OG    . SER A 1 293 ? 100.731 -14.368 334.645 1.00 111.64 ? 293 SER A OG    1 
ATOM   2155  N  N     . ASN A 1 294 ? 104.709 -16.110 333.077 1.00 111.73 ? 294 ASN A N     1 
ATOM   2156  C  CA    . ASN A 1 294 ? 105.759 -16.236 332.076 1.00 117.69 ? 294 ASN A CA    1 
ATOM   2157  C  C     . ASN A 1 294 ? 105.166 -16.713 330.760 1.00 120.88 ? 294 ASN A C     1 
ATOM   2158  O  O     . ASN A 1 294 ? 104.052 -17.235 330.733 1.00 115.00 ? 294 ASN A O     1 
ATOM   2159  C  CB    . ASN A 1 294 ? 106.839 -17.210 332.549 1.00 109.33 ? 294 ASN A CB    1 
ATOM   2160  N  N     . ARG A 1 295 ? 105.911 -16.553 329.671 1.00 130.89 ? 295 ARG A N     1 
ATOM   2161  C  CA    . ARG A 1 295 ? 105.428 -16.943 328.347 1.00 136.31 ? 295 ARG A CA    1 
ATOM   2162  C  C     . ARG A 1 295 ? 105.257 -18.458 328.215 1.00 136.55 ? 295 ARG A C     1 
ATOM   2163  O  O     . ARG A 1 295 ? 105.788 -19.077 327.293 1.00 151.01 ? 295 ARG A O     1 
ATOM   2164  C  CB    . ARG A 1 295 ? 106.367 -16.416 327.261 1.00 138.45 ? 295 ARG A CB    1 
ATOM   2165  N  N     . GLU A 1 296 ? 104.498 -19.036 329.142 1.00 121.30 ? 296 GLU A N     1 
ATOM   2166  C  CA    . GLU A 1 296 ? 104.256 -20.470 329.189 1.00 122.49 ? 296 GLU A CA    1 
ATOM   2167  C  C     . GLU A 1 296 ? 103.196 -20.786 330.242 1.00 124.11 ? 296 GLU A C     1 
ATOM   2168  O  O     . GLU A 1 296 ? 102.928 -21.950 330.536 1.00 134.84 ? 296 GLU A O     1 
ATOM   2169  C  CB    . GLU A 1 296 ? 105.550 -21.224 329.506 1.00 123.88 ? 296 GLU A CB    1 
ATOM   2170  N  N     . GLY A 1 297 ? 102.600 -19.742 330.811 1.00 112.36 ? 297 GLY A N     1 
ATOM   2171  C  CA    . GLY A 1 297 ? 101.573 -19.914 331.823 1.00 109.06 ? 297 GLY A CA    1 
ATOM   2172  C  C     . GLY A 1 297 ? 101.248 -18.651 332.599 1.00 110.76 ? 297 GLY A C     1 
ATOM   2173  O  O     . GLY A 1 297 ? 102.069 -17.741 332.704 1.00 112.06 ? 297 GLY A O     1 
ATOM   2174  N  N     . VAL A 1 298 ? 100.039 -18.600 333.148 1.00 103.37 ? 298 VAL A N     1 
ATOM   2175  C  CA    . VAL A 1 298 ? 99.597  -17.450 333.923 1.00 100.42 ? 298 VAL A CA    1 
ATOM   2176  C  C     . VAL A 1 298 ? 99.752  -17.716 335.414 1.00 110.16 ? 298 VAL A C     1 
ATOM   2177  O  O     . VAL A 1 298 ? 99.246  -18.713 335.930 1.00 107.49 ? 298 VAL A O     1 
ATOM   2178  C  CB    . VAL A 1 298 ? 98.122  -17.107 333.633 1.00 103.73 ? 298 VAL A CB    1 
ATOM   2179  C  CG1   . VAL A 1 298 ? 97.649  -15.973 334.536 1.00 90.91  ? 298 VAL A CG1   1 
ATOM   2180  C  CG2   . VAL A 1 298 ? 97.932  -16.751 332.166 1.00 111.99 ? 298 VAL A CG2   1 
ATOM   2181  N  N     . ARG A 1 299 ? 100.458 -16.824 336.102 1.00 117.98 ? 299 ARG A N     1 
ATOM   2182  C  CA    . ARG A 1 299 ? 100.625 -16.932 337.547 1.00 109.35 ? 299 ARG A CA    1 
ATOM   2183  C  C     . ARG A 1 299 ? 100.487 -15.574 338.225 1.00 104.26 ? 299 ARG A C     1 
ATOM   2184  O  O     . ARG A 1 299 ? 101.418 -14.767 338.226 1.00 111.32 ? 299 ARG A O     1 
ATOM   2185  C  CB    . ARG A 1 299 ? 101.974 -17.563 337.898 1.00 89.58  ? 299 ARG A CB    1 
ATOM   2186  C  CG    . ARG A 1 299 ? 102.135 -17.859 339.381 1.00 95.99  ? 299 ARG A CG    1 
ATOM   2187  C  CD    . ARG A 1 299 ? 103.223 -18.886 339.633 1.00 99.16  ? 299 ARG A CD    1 
ATOM   2188  N  NE    . ARG A 1 299 ? 102.983 -19.620 340.873 1.00 106.02 ? 299 ARG A NE    1 
ATOM   2189  C  CZ    . ARG A 1 299 ? 103.504 -19.294 342.051 1.00 120.30 ? 299 ARG A CZ    1 
ATOM   2190  N  NH1   . ARG A 1 299 ? 104.307 -18.244 342.157 1.00 130.08 ? 299 ARG A NH1   1 
ATOM   2191  N  NH2   . ARG A 1 299 ? 103.225 -20.021 343.124 1.00 123.30 ? 299 ARG A NH2   1 
ATOM   2192  N  N     . PHE A 1 300 ? 99.313  -15.327 338.797 1.00 98.97  ? 300 PHE A N     1 
ATOM   2193  C  CA    . PHE A 1 300 ? 99.065  -14.090 339.524 1.00 98.76  ? 300 PHE A CA    1 
ATOM   2194  C  C     . PHE A 1 300 ? 99.082  -14.363 341.022 1.00 98.82  ? 300 PHE A C     1 
ATOM   2195  O  O     . PHE A 1 300 ? 98.219  -15.069 341.548 1.00 99.16  ? 300 PHE A O     1 
ATOM   2196  C  CB    . PHE A 1 300 ? 97.734  -13.469 339.097 1.00 104.90 ? 300 PHE A CB    1 
ATOM   2197  C  CG    . PHE A 1 300 ? 97.589  -12.025 339.478 1.00 110.04 ? 300 PHE A CG    1 
ATOM   2198  C  CD1   . PHE A 1 300 ? 98.392  -11.058 338.896 1.00 108.24 ? 300 PHE A CD1   1 
ATOM   2199  C  CD2   . PHE A 1 300 ? 96.643  -11.633 340.411 1.00 107.89 ? 300 PHE A CD2   1 
ATOM   2200  C  CE1   . PHE A 1 300 ? 98.259  -9.727  339.243 1.00 101.84 ? 300 PHE A CE1   1 
ATOM   2201  C  CE2   . PHE A 1 300 ? 96.505  -10.304 340.761 1.00 101.68 ? 300 PHE A CE2   1 
ATOM   2202  C  CZ    . PHE A 1 300 ? 97.314  -9.350  340.175 1.00 97.63  ? 300 PHE A CZ    1 
ATOM   2203  N  N     . VAL A 1 301 ? 100.075 -13.802 341.702 1.00 109.09 ? 301 VAL A N     1 
ATOM   2204  C  CA    . VAL A 1 301 ? 100.298 -14.087 343.113 1.00 113.34 ? 301 VAL A CA    1 
ATOM   2205  C  C     . VAL A 1 301 ? 99.860  -12.950 344.033 1.00 104.22 ? 301 VAL A C     1 
ATOM   2206  O  O     . VAL A 1 301 ? 100.318 -11.817 343.901 1.00 101.23 ? 301 VAL A O     1 
ATOM   2207  C  CB    . VAL A 1 301 ? 101.781 -14.395 343.386 1.00 120.53 ? 301 VAL A CB    1 
ATOM   2208  C  CG1   . VAL A 1 301 ? 102.014 -14.594 344.870 1.00 129.94 ? 301 VAL A CG1   1 
ATOM   2209  C  CG2   . VAL A 1 301 ? 102.222 -15.621 342.604 1.00 126.08 ? 301 VAL A CG2   1 
ATOM   2210  N  N     . ILE A 1 302 ? 98.964  -13.268 344.962 1.00 100.08 ? 302 ILE A N     1 
ATOM   2211  C  CA    . ILE A 1 302 ? 98.589  -12.356 346.033 1.00 97.42  ? 302 ILE A CA    1 
ATOM   2212  C  C     . ILE A 1 302 ? 99.019  -12.971 347.363 1.00 91.94  ? 302 ILE A C     1 
ATOM   2213  O  O     . ILE A 1 302 ? 98.370  -13.884 347.877 1.00 93.22  ? 302 ILE A O     1 
ATOM   2214  C  CB    . ILE A 1 302 ? 97.071  -12.083 346.045 1.00 92.47  ? 302 ILE A CB    1 
ATOM   2215  N  N     . GLU A 1 303 ? 100.133 -12.486 347.902 1.00 93.11  ? 303 GLU A N     1 
ATOM   2216  C  CA    . GLU A 1 303 ? 100.671 -13.013 349.152 1.00 102.70 ? 303 GLU A CA    1 
ATOM   2217  C  C     . GLU A 1 303 ? 100.033 -12.368 350.374 1.00 103.38 ? 303 GLU A C     1 
ATOM   2218  O  O     . GLU A 1 303 ? 99.928  -11.140 350.468 1.00 110.80 ? 303 GLU A O     1 
ATOM   2219  C  CB    . GLU A 1 303 ? 102.192 -12.864 349.203 1.00 108.70 ? 303 GLU A CB    1 
ATOM   2220  C  CG    . GLU A 1 303 ? 102.932 -13.905 348.383 1.00 111.38 ? 303 GLU A CG    1 
ATOM   2221  C  CD    . GLU A 1 303 ? 104.421 -13.911 348.660 1.00 122.11 ? 303 GLU A CD    1 
ATOM   2222  O  OE1   . GLU A 1 303 ? 104.864 -13.149 349.545 1.00 136.47 ? 303 GLU A OE1   1 
ATOM   2223  O  OE2   . GLU A 1 303 ? 105.149 -14.678 347.995 1.00 113.91 ? 303 GLU A OE2   1 
ATOM   2224  N  N     . VAL A 1 304 ? 99.627  -13.224 351.309 1.00 99.86  ? 304 VAL A N     1 
ATOM   2225  C  CA    . VAL A 1 304 ? 98.919  -12.820 352.516 1.00 118.73 ? 304 VAL A CA    1 
ATOM   2226  C  C     . VAL A 1 304 ? 99.862  -12.790 353.716 1.00 132.90 ? 304 VAL A C     1 
ATOM   2227  O  O     . VAL A 1 304 ? 100.777 -13.605 353.816 1.00 140.07 ? 304 VAL A O     1 
ATOM   2228  C  CB    . VAL A 1 304 ? 97.775  -13.808 352.818 1.00 124.82 ? 304 VAL A CB    1 
ATOM   2229  C  CG1   . VAL A 1 304 ? 96.910  -13.310 353.967 1.00 130.09 ? 304 VAL A CG1   1 
ATOM   2230  C  CG2   . VAL A 1 304 ? 96.936  -14.036 351.569 1.00 118.38 ? 304 VAL A CG2   1 
ATOM   2231  N  N     . LYS A 1 305 ? 99.642  -11.841 354.620 1.00 134.11 ? 305 LYS A N     1 
ATOM   2232  C  CA    . LYS A 1 305 ? 100.388 -11.785 355.869 1.00 140.37 ? 305 LYS A CA    1 
ATOM   2233  C  C     . LYS A 1 305 ? 99.919  -12.885 356.816 1.00 145.77 ? 305 LYS A C     1 
ATOM   2234  O  O     . LYS A 1 305 ? 98.841  -13.453 356.634 1.00 147.45 ? 305 LYS A O     1 
ATOM   2235  C  CB    . LYS A 1 305 ? 100.204 -10.421 356.538 1.00 138.37 ? 305 LYS A CB    1 
ATOM   2236  C  CG    . LYS A 1 305 ? 98.775  -10.146 356.987 1.00 137.70 ? 305 LYS A CG    1 
ATOM   2237  C  CD    . LYS A 1 305 ? 98.612  -8.731  357.525 1.00 142.11 ? 305 LYS A CD    1 
ATOM   2238  C  CE    . LYS A 1 305 ? 98.870  -7.696  356.440 1.00 142.84 ? 305 LYS A CE    1 
ATOM   2239  N  NZ    . LYS A 1 305 ? 98.648  -6.306  356.927 1.00 146.19 ? 305 LYS A NZ    1 
ATOM   2240  N  N     . ARG A 1 306 ? 100.730 -13.182 357.827 1.00 143.12 ? 306 ARG A N     1 
ATOM   2241  C  CA    . ARG A 1 306 ? 100.337 -14.127 358.866 1.00 138.17 ? 306 ARG A CA    1 
ATOM   2242  C  C     . ARG A 1 306 ? 99.201  -13.532 359.689 1.00 146.63 ? 306 ARG A C     1 
ATOM   2243  O  O     . ARG A 1 306 ? 98.983  -12.319 359.664 1.00 148.81 ? 306 ARG A O     1 
ATOM   2244  C  CB    . ARG A 1 306 ? 101.526 -14.466 359.766 1.00 133.35 ? 306 ARG A CB    1 
ATOM   2245  N  N     . ASP A 1 307 ? 98.484  -14.390 360.410 1.00 153.83 ? 307 ASP A N     1 
ATOM   2246  C  CA    . ASP A 1 307 ? 97.317  -13.983 361.195 1.00 157.74 ? 307 ASP A CA    1 
ATOM   2247  C  C     . ASP A 1 307 ? 96.243  -13.336 360.325 1.00 151.83 ? 307 ASP A C     1 
ATOM   2248  O  O     . ASP A 1 307 ? 95.538  -12.427 360.763 1.00 155.99 ? 307 ASP A O     1 
ATOM   2249  C  CB    . ASP A 1 307 ? 97.717  -13.051 362.342 1.00 161.28 ? 307 ASP A CB    1 
ATOM   2250  N  N     . ALA A 1 308 ? 96.133  -13.813 359.089 1.00 140.83 ? 308 ALA A N     1 
ATOM   2251  C  CA    . ALA A 1 308 ? 95.110  -13.347 358.159 1.00 129.99 ? 308 ALA A CA    1 
ATOM   2252  C  C     . ALA A 1 308 ? 94.695  -14.492 357.241 1.00 126.29 ? 308 ALA A C     1 
ATOM   2253  O  O     . ALA A 1 308 ? 95.542  -15.226 356.734 1.00 136.05 ? 308 ALA A O     1 
ATOM   2254  C  CB    . ALA A 1 308 ? 95.622  -12.167 357.349 1.00 111.91 ? 308 ALA A CB    1 
ATOM   2255  N  N     . SER A 1 309 ? 93.391  -14.646 357.035 1.00 123.49 ? 309 SER A N     1 
ATOM   2256  C  CA    . SER A 1 309 ? 92.868  -15.751 356.238 1.00 132.97 ? 309 SER A CA    1 
ATOM   2257  C  C     . SER A 1 309 ? 92.918  -15.444 354.747 1.00 133.54 ? 309 SER A C     1 
ATOM   2258  O  O     . SER A 1 309 ? 92.469  -14.387 354.307 1.00 135.85 ? 309 SER A O     1 
ATOM   2259  C  CB    . SER A 1 309 ? 91.431  -16.074 356.654 1.00 115.07 ? 309 SER A CB    1 
ATOM   2260  N  N     . ALA A 1 310 ? 93.464  -16.376 353.973 1.00 131.84 ? 310 ALA A N     1 
ATOM   2261  C  CA    . ALA A 1 310 ? 93.547  -16.213 352.528 1.00 137.37 ? 310 ALA A CA    1 
ATOM   2262  C  C     . ALA A 1 310 ? 92.195  -16.470 351.876 1.00 138.55 ? 310 ALA A C     1 
ATOM   2263  O  O     . ALA A 1 310 ? 91.957  -16.051 350.746 1.00 135.34 ? 310 ALA A O     1 
ATOM   2264  C  CB    . ALA A 1 310 ? 94.601  -17.137 351.946 1.00 141.41 ? 310 ALA A CB    1 
ATOM   2265  N  N     . ASN A 1 311 ? 91.314  -17.163 352.592 1.00 139.80 ? 311 ASN A N     1 
ATOM   2266  C  CA    . ASN A 1 311 ? 89.971  -17.438 352.092 1.00 136.92 ? 311 ASN A CA    1 
ATOM   2267  C  C     . ASN A 1 311 ? 89.088  -16.193 352.100 1.00 133.24 ? 311 ASN A C     1 
ATOM   2268  O  O     . ASN A 1 311 ? 88.370  -15.924 351.135 1.00 142.99 ? 311 ASN A O     1 
ATOM   2269  C  CB    . ASN A 1 311 ? 89.314  -18.569 352.889 1.00 146.94 ? 311 ASN A CB    1 
ATOM   2270  C  CG    . ASN A 1 311 ? 89.986  -19.911 352.659 1.00 158.58 ? 311 ASN A CG    1 
ATOM   2271  O  OD1   . ASN A 1 311 ? 89.869  -20.497 351.584 1.00 159.21 ? 311 ASN A OD1   1 
ATOM   2272  N  ND2   . ASN A 1 311 ? 90.686  -20.407 353.671 1.00 164.83 ? 311 ASN A ND2   1 
ATOM   2273  N  N     . VAL A 1 312 ? 89.149  -15.439 353.194 1.00 124.96 ? 312 VAL A N     1 
ATOM   2274  C  CA    . VAL A 1 312 ? 88.398  -14.194 353.315 1.00 119.60 ? 312 VAL A CA    1 
ATOM   2275  C  C     . VAL A 1 312 ? 88.855  -13.200 352.249 1.00 129.29 ? 312 VAL A C     1 
ATOM   2276  O  O     . VAL A 1 312 ? 88.034  -12.566 351.577 1.00 142.40 ? 312 VAL A O     1 
ATOM   2277  C  CB    . VAL A 1 312 ? 88.569  -13.569 354.714 1.00 114.11 ? 312 VAL A CB    1 
ATOM   2278  C  CG1   . VAL A 1 312 ? 87.743  -12.299 354.840 1.00 110.88 ? 312 VAL A CG1   1 
ATOM   2279  C  CG2   . VAL A 1 312 ? 88.181  -14.572 355.793 1.00 120.41 ? 312 VAL A CG2   1 
ATOM   2280  N  N     . ILE A 1 313 ? 90.172  -13.076 352.100 1.00 124.56 ? 313 ILE A N     1 
ATOM   2281  C  CA    . ILE A 1 313 ? 90.765  -12.242 351.058 1.00 117.59 ? 313 ILE A CA    1 
ATOM   2282  C  C     . ILE A 1 313 ? 90.323  -12.702 349.671 1.00 111.79 ? 313 ILE A C     1 
ATOM   2283  O  O     . ILE A 1 313 ? 89.961  -11.882 348.824 1.00 115.04 ? 313 ILE A O     1 
ATOM   2284  C  CB    . ILE A 1 313 ? 92.309  -12.253 351.135 1.00 112.69 ? 313 ILE A CB    1 
ATOM   2285  C  CG1   . ILE A 1 313 ? 92.785  -11.494 352.374 1.00 110.59 ? 313 ILE A CG1   1 
ATOM   2286  C  CG2   . ILE A 1 313 ? 92.924  -11.646 349.880 1.00 104.61 ? 313 ILE A CG2   1 
ATOM   2287  C  CD1   . ILE A 1 313 ? 94.282  -11.285 352.422 1.00 112.19 ? 313 ILE A CD1   1 
ATOM   2288  N  N     . LEU A 1 314 ? 90.341  -14.016 349.455 1.00 104.94 ? 314 LEU A N     1 
ATOM   2289  C  CA    . LEU A 1 314 ? 89.959  -14.597 348.171 1.00 107.93 ? 314 LEU A CA    1 
ATOM   2290  C  C     . LEU A 1 314 ? 88.522  -14.244 347.800 1.00 114.04 ? 314 LEU A C     1 
ATOM   2291  O  O     . LEU A 1 314 ? 88.261  -13.726 346.711 1.00 115.13 ? 314 LEU A O     1 
ATOM   2292  C  CB    . LEU A 1 314 ? 90.121  -16.117 348.202 1.00 103.99 ? 314 LEU A CB    1 
ATOM   2293  C  CG    . LEU A 1 314 ? 89.933  -16.857 346.876 1.00 96.45  ? 314 LEU A CG    1 
ATOM   2294  C  CD1   . LEU A 1 314 ? 91.124  -16.627 345.959 1.00 89.54  ? 314 LEU A CD1   1 
ATOM   2295  C  CD2   . LEU A 1 314 ? 89.708  -18.344 347.105 1.00 107.84 ? 314 LEU A CD2   1 
ATOM   2296  N  N     . ASN A 1 315 ? 87.593  -14.526 348.711 1.00 109.50 ? 315 ASN A N     1 
ATOM   2297  C  CA    . ASN A 1 315 ? 86.184  -14.228 348.476 1.00 112.53 ? 315 ASN A CA    1 
ATOM   2298  C  C     . ASN A 1 315 ? 85.918  -12.731 348.331 1.00 118.40 ? 315 ASN A C     1 
ATOM   2299  O  O     . ASN A 1 315 ? 85.076  -12.319 347.528 1.00 128.84 ? 315 ASN A O     1 
ATOM   2300  C  CB    . ASN A 1 315 ? 85.302  -14.835 349.570 1.00 114.82 ? 315 ASN A CB    1 
ATOM   2301  C  CG    . ASN A 1 315 ? 85.256  -16.352 349.505 1.00 124.35 ? 315 ASN A CG    1 
ATOM   2302  O  OD1   . ASN A 1 315 ? 86.266  -17.004 349.247 1.00 125.61 ? 315 ASN A OD1   1 
ATOM   2303  N  ND2   . ASN A 1 315 ? 84.076  -16.919 349.729 1.00 131.98 ? 315 ASN A ND2   1 
ATOM   2304  N  N     . ASN A 1 316 ? 86.639  -11.922 349.103 1.00 114.49 ? 316 ASN A N     1 
ATOM   2305  C  CA    . ASN A 1 316 ? 86.550  -10.472 348.960 1.00 117.54 ? 316 ASN A CA    1 
ATOM   2306  C  C     . ASN A 1 316 ? 87.033  -10.005 347.591 1.00 121.07 ? 316 ASN A C     1 
ATOM   2307  O  O     . ASN A 1 316 ? 86.541  -9.013  347.056 1.00 129.89 ? 316 ASN A O     1 
ATOM   2308  C  CB    . ASN A 1 316 ? 87.330  -9.757  350.065 1.00 116.72 ? 316 ASN A CB    1 
ATOM   2309  C  CG    . ASN A 1 316 ? 86.504  -9.544  351.317 1.00 120.70 ? 316 ASN A CG    1 
ATOM   2310  O  OD1   . ASN A 1 316 ? 85.694  -8.621  351.390 1.00 123.01 ? 316 ASN A OD1   1 
ATOM   2311  N  ND2   . ASN A 1 316 ? 86.709  -10.396 352.314 1.00 124.41 ? 316 ASN A ND2   1 
ATOM   2312  N  N     . LEU A 1 317 ? 88.002  -10.721 347.028 1.00 112.15 ? 317 LEU A N     1 
ATOM   2313  C  CA    . LEU A 1 317 ? 88.480  -10.420 345.685 1.00 101.18 ? 317 LEU A CA    1 
ATOM   2314  C  C     . LEU A 1 317 ? 87.445  -10.844 344.651 1.00 108.44 ? 317 LEU A C     1 
ATOM   2315  O  O     . LEU A 1 317 ? 87.220  -10.149 343.660 1.00 120.49 ? 317 LEU A O     1 
ATOM   2316  C  CB    . LEU A 1 317 ? 89.816  -11.112 345.413 1.00 92.98  ? 317 LEU A CB    1 
ATOM   2317  C  CG    . LEU A 1 317 ? 91.036  -10.573 346.161 1.00 84.82  ? 317 LEU A CG    1 
ATOM   2318  C  CD1   . LEU A 1 317 ? 92.293  -11.339 345.780 1.00 83.51  ? 317 LEU A CD1   1 
ATOM   2319  C  CD2   . LEU A 1 317 ? 91.204  -9.090  345.882 1.00 85.11  ? 317 LEU A CD2   1 
ATOM   2320  N  N     . PHE A 1 318 ? 86.811  -11.988 344.894 1.00 102.54 ? 318 PHE A N     1 
ATOM   2321  C  CA    . PHE A 1 318 ? 85.753  -12.478 344.019 1.00 88.85  ? 318 PHE A CA    1 
ATOM   2322  C  C     . PHE A 1 318 ? 84.547  -11.545 344.029 1.00 120.43 ? 318 PHE A C     1 
ATOM   2323  O  O     . PHE A 1 318 ? 83.796  -11.471 343.057 1.00 129.01 ? 318 PHE A O     1 
ATOM   2324  C  CB    . PHE A 1 318 ? 85.325  -13.890 344.426 1.00 110.87 ? 318 PHE A CB    1 
ATOM   2325  C  CG    . PHE A 1 318 ? 86.334  -14.951 344.089 1.00 108.96 ? 318 PHE A CG    1 
ATOM   2326  C  CD1   . PHE A 1 318 ? 86.403  -16.123 344.826 1.00 112.27 ? 318 PHE A CD1   1 
ATOM   2327  C  CD2   . PHE A 1 318 ? 87.209  -14.779 343.031 1.00 105.95 ? 318 PHE A CD2   1 
ATOM   2328  C  CE1   . PHE A 1 318 ? 87.330  -17.100 344.515 1.00 116.94 ? 318 PHE A CE1   1 
ATOM   2329  C  CE2   . PHE A 1 318 ? 88.138  -15.752 342.714 1.00 107.37 ? 318 PHE A CE2   1 
ATOM   2330  C  CZ    . PHE A 1 318 ? 88.198  -16.914 343.457 1.00 115.54 ? 318 PHE A CZ    1 
ATOM   2331  N  N     . LYS A 1 319 ? 84.370  -10.828 345.134 1.00 118.68 ? 319 LYS A N     1 
ATOM   2332  C  CA    . LYS A 1 319 ? 83.230  -9.931  345.291 1.00 125.07 ? 319 LYS A CA    1 
ATOM   2333  C  C     . LYS A 1 319 ? 83.514  -8.519  344.781 1.00 129.82 ? 319 LYS A C     1 
ATOM   2334  O  O     . LYS A 1 319 ? 82.647  -7.885  344.180 1.00 139.42 ? 319 LYS A O     1 
ATOM   2335  C  CB    . LYS A 1 319 ? 82.798  -9.872  346.757 1.00 97.46  ? 319 LYS A CB    1 
ATOM   2336  N  N     . MET A 1 320 ? 84.730  -8.032  345.018 1.00 126.29 ? 320 MET A N     1 
ATOM   2337  C  CA    . MET A 1 320 ? 85.061  -6.639  344.727 1.00 131.04 ? 320 MET A CA    1 
ATOM   2338  C  C     . MET A 1 320 ? 85.790  -6.421  343.400 1.00 133.67 ? 320 MET A C     1 
ATOM   2339  O  O     . MET A 1 320 ? 85.808  -5.308  342.878 1.00 138.32 ? 320 MET A O     1 
ATOM   2340  C  CB    . MET A 1 320 ? 85.871  -6.032  345.875 1.00 129.46 ? 320 MET A CB    1 
ATOM   2341  C  CG    . MET A 1 320 ? 85.106  -5.910  347.180 1.00 128.15 ? 320 MET A CG    1 
ATOM   2342  S  SD    . MET A 1 320 ? 86.061  -5.087  348.471 1.00 147.23 ? 320 MET A SD    1 
ATOM   2343  C  CE    . MET A 1 320 ? 87.453  -6.202  348.629 1.00 136.58 ? 320 MET A CE    1 
ATOM   2344  N  N     . THR A 1 321 ? 86.396  -7.474  342.860 1.00 130.58 ? 321 THR A N     1 
ATOM   2345  C  CA    . THR A 1 321 ? 87.143  -7.347  341.612 1.00 127.43 ? 321 THR A CA    1 
ATOM   2346  C  C     . THR A 1 321 ? 86.560  -8.219  340.503 1.00 132.45 ? 321 THR A C     1 
ATOM   2347  O  O     . THR A 1 321 ? 85.606  -8.964  340.721 1.00 136.73 ? 321 THR A O     1 
ATOM   2348  C  CB    . THR A 1 321 ? 88.633  -7.697  341.802 1.00 124.09 ? 321 THR A CB    1 
ATOM   2349  O  OG1   . THR A 1 321 ? 88.782  -9.115  341.946 1.00 119.81 ? 321 THR A OG1   1 
ATOM   2350  C  CG2   . THR A 1 321 ? 89.196  -6.998  343.032 1.00 126.23 ? 321 THR A CG2   1 
ATOM   2351  N  N     . GLN A 1 322 ? 87.143  -8.118  339.311 1.00 128.47 ? 322 GLN A N     1 
ATOM   2352  C  CA    . GLN A 1 322 ? 86.715  -8.924  338.168 1.00 115.18 ? 322 GLN A CA    1 
ATOM   2353  C  C     . GLN A 1 322 ? 87.361  -10.310 338.172 1.00 108.33 ? 322 GLN A C     1 
ATOM   2354  O  O     . GLN A 1 322 ? 87.449  -10.970 337.137 1.00 105.69 ? 322 GLN A O     1 
ATOM   2355  C  CB    . GLN A 1 322 ? 87.002  -8.204  336.846 1.00 107.65 ? 322 GLN A CB    1 
ATOM   2356  C  CG    . GLN A 1 322 ? 85.938  -7.188  336.439 1.00 104.54 ? 322 GLN A CG    1 
ATOM   2357  C  CD    . GLN A 1 322 ? 86.138  -6.673  335.025 1.00 111.80 ? 322 GLN A CD    1 
ATOM   2358  O  OE1   . GLN A 1 322 ? 87.259  -6.377  334.613 1.00 113.98 ? 322 GLN A OE1   1 
ATOM   2359  N  NE2   . GLN A 1 322 ? 85.048  -6.567  334.273 1.00 119.70 ? 322 GLN A NE2   1 
ATOM   2360  N  N     . MET A 1 323 ? 87.811  -10.746 339.344 1.00 106.80 ? 323 MET A N     1 
ATOM   2361  C  CA    . MET A 1 323 ? 88.331  -12.096 339.506 1.00 86.04  ? 323 MET A CA    1 
ATOM   2362  C  C     . MET A 1 323 ? 87.150  -13.056 339.415 1.00 95.92  ? 323 MET A C     1 
ATOM   2363  O  O     . MET A 1 323 ? 87.309  -14.241 339.127 1.00 91.23  ? 323 MET A O     1 
ATOM   2364  C  CB    . MET A 1 323 ? 89.048  -12.229 340.850 1.00 114.02 ? 323 MET A CB    1 
ATOM   2365  C  CG    . MET A 1 323 ? 90.086  -13.335 340.907 1.00 123.07 ? 323 MET A CG    1 
ATOM   2366  S  SD    . MET A 1 323 ? 91.272  -13.089 342.241 1.00 134.93 ? 323 MET A SD    1 
ATOM   2367  C  CE    . MET A 1 323 ? 91.919  -11.477 341.803 1.00 83.61  ? 323 MET A CE    1 
ATOM   2368  N  N     . GLN A 1 324 ? 85.961  -12.518 339.665 1.00 88.69  ? 324 GLN A N     1 
ATOM   2369  C  CA    . GLN A 1 324 ? 84.714  -13.234 339.450 1.00 109.65 ? 324 GLN A CA    1 
ATOM   2370  C  C     . GLN A 1 324 ? 83.699  -12.300 338.808 1.00 117.48 ? 324 GLN A C     1 
ATOM   2371  O  O     . GLN A 1 324 ? 83.357  -11.263 339.376 1.00 118.69 ? 324 GLN A O     1 
ATOM   2372  C  CB    . GLN A 1 324 ? 84.158  -13.774 340.766 1.00 107.94 ? 324 GLN A CB    1 
ATOM   2373  C  CG    . GLN A 1 324 ? 82.716  -14.249 340.666 1.00 112.72 ? 324 GLN A CG    1 
ATOM   2374  C  CD    . GLN A 1 324 ? 82.236  -14.930 341.931 1.00 119.99 ? 324 GLN A CD    1 
ATOM   2375  O  OE1   . GLN A 1 324 ? 82.842  -15.894 342.398 1.00 124.88 ? 324 GLN A OE1   1 
ATOM   2376  N  NE2   . GLN A 1 324 ? 81.144  -14.429 342.495 1.00 122.82 ? 324 GLN A NE2   1 
ATOM   2377  N  N     . THR A 1 325 ? 83.221  -12.669 337.624 1.00 107.38 ? 325 THR A N     1 
ATOM   2378  C  CA    . THR A 1 325 ? 82.275  -11.836 336.887 1.00 103.23 ? 325 THR A CA    1 
ATOM   2379  C  C     . THR A 1 325 ? 81.032  -12.617 336.472 1.00 104.81 ? 325 THR A C     1 
ATOM   2380  O  O     . THR A 1 325 ? 80.893  -13.796 336.789 1.00 113.78 ? 325 THR A O     1 
ATOM   2381  C  CB    . THR A 1 325 ? 82.920  -11.237 335.625 1.00 97.83  ? 325 THR A CB    1 
ATOM   2382  O  OG1   . THR A 1 325 ? 83.340  -12.293 334.752 1.00 92.28  ? 325 THR A OG1   1 
ATOM   2383  C  CG2   . THR A 1 325 ? 84.120  -10.385 335.992 1.00 106.75 ? 325 THR A CG2   1 
ATOM   2384  N  N     . ASN A 1 326 ? 80.125  -11.950 335.767 1.00 101.97 ? 326 ASN A N     1 
ATOM   2385  C  CA    . ASN A 1 326 ? 78.926  -12.600 335.251 1.00 104.07 ? 326 ASN A CA    1 
ATOM   2386  C  C     . ASN A 1 326 ? 78.945  -12.657 333.730 1.00 120.57 ? 326 ASN A C     1 
ATOM   2387  O  O     . ASN A 1 326 ? 79.563  -11.816 333.079 1.00 131.59 ? 326 ASN A O     1 
ATOM   2388  C  CB    . ASN A 1 326 ? 77.664  -11.873 335.721 1.00 101.11 ? 326 ASN A CB    1 
ATOM   2389  C  CG    . ASN A 1 326 ? 77.420  -12.026 337.206 1.00 114.05 ? 326 ASN A CG    1 
ATOM   2390  O  OD1   . ASN A 1 326 ? 77.825  -13.016 337.814 1.00 129.76 ? 326 ASN A OD1   1 
ATOM   2391  N  ND2   . ASN A 1 326 ? 76.746  -11.047 337.799 1.00 119.55 ? 326 ASN A ND2   1 
ATOM   2392  N  N     . PHE A 1 327 ? 78.274  -13.657 333.167 1.00 117.92 ? 327 PHE A N     1 
ATOM   2393  C  CA    . PHE A 1 327 ? 78.102  -13.739 331.721 1.00 101.09 ? 327 PHE A CA    1 
ATOM   2394  C  C     . PHE A 1 327 ? 76.622  -13.796 331.374 1.00 102.70 ? 327 PHE A C     1 
ATOM   2395  O  O     . PHE A 1 327 ? 75.882  -14.633 331.896 1.00 108.72 ? 327 PHE A O     1 
ATOM   2396  C  CB    . PHE A 1 327 ? 78.833  -14.950 331.137 1.00 95.56  ? 327 PHE A CB    1 
ATOM   2397  C  CG    . PHE A 1 327 ? 78.829  -14.990 329.633 1.00 99.45  ? 327 PHE A CG    1 
ATOM   2398  C  CD1   . PHE A 1 327 ? 79.839  -14.378 328.908 1.00 100.10 ? 327 PHE A CD1   1 
ATOM   2399  C  CD2   . PHE A 1 327 ? 77.810  -15.629 328.944 1.00 103.92 ? 327 PHE A CD2   1 
ATOM   2400  C  CE1   . PHE A 1 327 ? 79.836  -14.407 327.526 1.00 99.79  ? 327 PHE A CE1   1 
ATOM   2401  C  CE2   . PHE A 1 327 ? 77.800  -15.659 327.565 1.00 103.10 ? 327 PHE A CE2   1 
ATOM   2402  C  CZ    . PHE A 1 327 ? 78.815  -15.048 326.855 1.00 105.81 ? 327 PHE A CZ    1 
ATOM   2403  N  N     . GLY A 1 328 ? 76.201  -12.901 330.488 1.00 101.81 ? 328 GLY A N     1 
ATOM   2404  C  CA    . GLY A 1 328 ? 74.810  -12.809 330.092 1.00 101.78 ? 328 GLY A CA    1 
ATOM   2405  C  C     . GLY A 1 328 ? 74.547  -13.258 328.668 1.00 103.38 ? 328 GLY A C     1 
ATOM   2406  O  O     . GLY A 1 328 ? 74.587  -12.456 327.736 1.00 118.71 ? 328 GLY A O     1 
ATOM   2407  N  N     . PHE A 1 329 ? 74.300  -14.555 328.511 1.00 91.87  ? 329 PHE A N     1 
ATOM   2408  C  CA    . PHE A 1 329 ? 73.777  -15.127 327.279 1.00 91.87  ? 329 PHE A CA    1 
ATOM   2409  C  C     . PHE A 1 329 ? 72.641  -14.293 326.715 1.00 105.65 ? 329 PHE A C     1 
ATOM   2410  O  O     . PHE A 1 329 ? 71.547  -14.257 327.284 1.00 108.31 ? 329 PHE A O     1 
ATOM   2411  C  CB    . PHE A 1 329 ? 73.209  -16.517 327.548 1.00 101.25 ? 329 PHE A CB    1 
ATOM   2412  C  CG    . PHE A 1 329 ? 74.243  -17.583 327.735 1.00 109.67 ? 329 PHE A CG    1 
ATOM   2413  C  CD1   . PHE A 1 329 ? 74.508  -18.489 326.723 1.00 104.38 ? 329 PHE A CD1   1 
ATOM   2414  C  CD2   . PHE A 1 329 ? 74.925  -17.704 328.934 1.00 120.61 ? 329 PHE A CD2   1 
ATOM   2415  C  CE1   . PHE A 1 329 ? 75.439  -19.485 326.899 1.00 104.45 ? 329 PHE A CE1   1 
ATOM   2416  C  CE2   . PHE A 1 329 ? 75.865  -18.696 329.111 1.00 119.20 ? 329 PHE A CE2   1 
ATOM   2417  C  CZ    . PHE A 1 329 ? 76.122  -19.586 328.090 1.00 110.69 ? 329 PHE A CZ    1 
ATOM   2418  N  N     . ASN A 1 330 ? 72.911  -13.619 325.603 1.00 110.37 ? 330 ASN A N     1 
ATOM   2419  C  CA    . ASN A 1 330 ? 71.865  -13.011 324.797 1.00 108.64 ? 330 ASN A CA    1 
ATOM   2420  C  C     . ASN A 1 330 ? 72.067  -13.472 323.364 1.00 105.43 ? 330 ASN A C     1 
ATOM   2421  O  O     . ASN A 1 330 ? 72.441  -12.686 322.493 1.00 111.72 ? 330 ASN A O     1 
ATOM   2422  C  CB    . ASN A 1 330 ? 71.912  -11.484 324.888 1.00 114.11 ? 330 ASN A CB    1 
ATOM   2423  C  CG    . ASN A 1 330 ? 70.722  -10.823 324.212 1.00 117.29 ? 330 ASN A CG    1 
ATOM   2424  O  OD1   . ASN A 1 330 ? 69.699  -11.462 323.967 1.00 109.71 ? 330 ASN A OD1   1 
ATOM   2425  N  ND2   . ASN A 1 330 ? 70.850  -9.536  323.912 1.00 122.54 ? 330 ASN A ND2   1 
ATOM   2426  N  N     . MET A 1 331 ? 71.843  -14.763 323.137 1.00 105.51 ? 331 MET A N     1 
ATOM   2427  C  CA    . MET A 1 331 ? 72.115  -15.384 321.844 1.00 104.12 ? 331 MET A CA    1 
ATOM   2428  C  C     . MET A 1 331 ? 71.261  -14.782 320.733 1.00 102.02 ? 331 MET A C     1 
ATOM   2429  O  O     . MET A 1 331 ? 70.143  -15.224 320.475 1.00 110.32 ? 331 MET A O     1 
ATOM   2430  C  CB    . MET A 1 331 ? 71.933  -16.901 321.928 1.00 100.57 ? 331 MET A CB    1 
ATOM   2431  C  CG    . MET A 1 331 ? 72.824  -17.557 322.975 1.00 98.11  ? 331 MET A CG    1 
ATOM   2432  S  SD    . MET A 1 331 ? 73.075  -19.327 322.727 1.00 113.03 ? 331 MET A SD    1 
ATOM   2433  C  CE    . MET A 1 331 ? 71.398  -19.935 322.863 1.00 149.62 ? 331 MET A CE    1 
ATOM   2434  N  N     . LEU A 1 332 ? 71.811  -13.763 320.084 1.00 96.07  ? 332 LEU A N     1 
ATOM   2435  C  CA    . LEU A 1 332 ? 71.114  -13.024 319.043 1.00 100.00 ? 332 LEU A CA    1 
ATOM   2436  C  C     . LEU A 1 332 ? 71.920  -13.057 317.754 1.00 97.29  ? 332 LEU A C     1 
ATOM   2437  O  O     . LEU A 1 332 ? 73.114  -12.766 317.756 1.00 97.71  ? 332 LEU A O     1 
ATOM   2438  C  CB    . LEU A 1 332 ? 70.914  -11.576 319.491 1.00 105.06 ? 332 LEU A CB    1 
ATOM   2439  C  CG    . LEU A 1 332 ? 70.571  -10.530 318.431 1.00 106.36 ? 332 LEU A CG    1 
ATOM   2440  C  CD1   . LEU A 1 332 ? 69.146  -10.703 317.945 1.00 107.98 ? 332 LEU A CD1   1 
ATOM   2441  C  CD2   . LEU A 1 332 ? 70.792  -9.128  318.977 1.00 109.55 ? 332 LEU A CD2   1 
ATOM   2442  N  N     . ALA A 1 333 ? 71.268  -13.410 316.652 1.00 95.60  ? 333 ALA A N     1 
ATOM   2443  C  CA    . ALA A 1 333 ? 71.957  -13.480 315.369 1.00 95.99  ? 333 ALA A CA    1 
ATOM   2444  C  C     . ALA A 1 333 ? 71.022  -13.162 314.212 1.00 101.26 ? 333 ALA A C     1 
ATOM   2445  O  O     . ALA A 1 333 ? 69.803  -13.259 314.341 1.00 97.59  ? 333 ALA A O     1 
ATOM   2446  C  CB    . ALA A 1 333 ? 72.596  -14.847 315.177 1.00 96.91  ? 333 ALA A CB    1 
ATOM   2447  N  N     . ILE A 1 334 ? 71.600  -12.785 313.077 1.00 101.86 ? 334 ILE A N     1 
ATOM   2448  C  CA    . ILE A 1 334 ? 70.807  -12.464 311.898 1.00 93.66  ? 334 ILE A CA    1 
ATOM   2449  C  C     . ILE A 1 334 ? 70.444  -13.728 311.126 1.00 93.37  ? 334 ILE A C     1 
ATOM   2450  O  O     . ILE A 1 334 ? 71.318  -14.484 310.705 1.00 93.77  ? 334 ILE A O     1 
ATOM   2451  C  CB    . ILE A 1 334 ? 71.548  -11.493 310.958 1.00 90.71  ? 334 ILE A CB    1 
ATOM   2452  C  CG1   . ILE A 1 334 ? 72.142  -10.325 311.746 1.00 102.53 ? 334 ILE A CG1   1 
ATOM   2453  C  CG2   . ILE A 1 334 ? 70.609  -10.981 309.882 1.00 91.81  ? 334 ILE A CG2   1 
ATOM   2454  C  CD1   . ILE A 1 334 ? 71.111  -9.485  312.470 1.00 108.10 ? 334 ILE A CD1   1 
ATOM   2455  N  N     . GLN A 1 335 ? 69.146  -13.946 310.945 1.00 91.95  ? 335 GLN A N     1 
ATOM   2456  C  CA    . GLN A 1 335 ? 68.647  -15.102 310.212 1.00 92.19  ? 335 GLN A CA    1 
ATOM   2457  C  C     . GLN A 1 335 ? 67.542  -14.653 309.272 1.00 96.95  ? 335 GLN A C     1 
ATOM   2458  O  O     . GLN A 1 335 ? 66.609  -13.970 309.694 1.00 102.57 ? 335 GLN A O     1 
ATOM   2459  C  CB    . GLN A 1 335 ? 68.103  -16.152 311.179 1.00 95.55  ? 335 GLN A CB    1 
ATOM   2460  C  CG    . GLN A 1 335 ? 67.533  -17.392 310.504 1.00 95.98  ? 335 GLN A CG    1 
ATOM   2461  C  CD    . GLN A 1 335 ? 66.853  -18.324 311.488 1.00 101.97 ? 335 GLN A CD    1 
ATOM   2462  O  OE1   . GLN A 1 335 ? 65.861  -17.962 312.120 1.00 104.48 ? 335 GLN A OE1   1 
ATOM   2463  N  NE2   . GLN A 1 335 ? 67.389  -19.530 311.628 1.00 103.87 ? 335 GLN A NE2   1 
ATOM   2464  N  N     . ASN A 1 336 ? 67.652  -15.040 308.004 1.00 97.72  ? 336 ASN A N     1 
ATOM   2465  C  CA    . ASN A 1 336 ? 66.714  -14.610 306.969 1.00 106.83 ? 336 ASN A CA    1 
ATOM   2466  C  C     . ASN A 1 336 ? 66.628  -13.092 306.849 1.00 111.60 ? 336 ASN A C     1 
ATOM   2467  O  O     . ASN A 1 336 ? 65.565  -12.543 306.559 1.00 117.63 ? 336 ASN A O     1 
ATOM   2468  C  CB    . ASN A 1 336 ? 65.320  -15.200 307.202 1.00 115.03 ? 336 ASN A CB    1 
ATOM   2469  C  CG    . ASN A 1 336 ? 65.300  -16.712 307.101 1.00 124.12 ? 336 ASN A CG    1 
ATOM   2470  O  OD1   . ASN A 1 336 ? 66.073  -17.306 306.351 1.00 129.84 ? 336 ASN A OD1   1 
ATOM   2471  N  ND2   . ASN A 1 336 ? 64.409  -17.343 307.855 1.00 125.19 ? 336 ASN A ND2   1 
ATOM   2472  N  N     . GLY A 1 337 ? 67.750  -12.419 307.088 1.00 107.33 ? 337 GLY A N     1 
ATOM   2473  C  CA    . GLY A 1 337 ? 67.824  -10.978 306.938 1.00 103.72 ? 337 GLY A CA    1 
ATOM   2474  C  C     . GLY A 1 337 ? 67.273  -10.192 308.113 1.00 112.63 ? 337 GLY A C     1 
ATOM   2475  O  O     . GLY A 1 337 ? 67.244  -8.962  308.079 1.00 122.11 ? 337 GLY A O     1 
ATOM   2476  N  N     . ILE A 1 338 ? 66.827  -10.892 309.152 1.00 112.70 ? 338 ILE A N     1 
ATOM   2477  C  CA    . ILE A 1 338 ? 66.299  -10.231 310.344 1.00 102.16 ? 338 ILE A CA    1 
ATOM   2478  C  C     . ILE A 1 338 ? 67.034  -10.700 311.600 1.00 99.81  ? 338 ILE A C     1 
ATOM   2479  O  O     . ILE A 1 338 ? 67.524  -11.830 311.651 1.00 99.16  ? 338 ILE A O     1 
ATOM   2480  C  CB    . ILE A 1 338 ? 64.772  -10.466 310.509 1.00 105.20 ? 338 ILE A CB    1 
ATOM   2481  C  CG1   . ILE A 1 338 ? 64.479  -11.895 310.972 1.00 110.10 ? 338 ILE A CG1   1 
ATOM   2482  C  CG2   . ILE A 1 338 ? 64.026  -10.152 309.216 1.00 107.06 ? 338 ILE A CG2   1 
ATOM   2483  C  CD1   . ILE A 1 338 ? 63.012  -12.154 311.242 1.00 114.65 ? 338 ILE A CD1   1 
ATOM   2484  N  N     . PRO A 1 339 ? 67.134  -9.822  312.613 1.00 109.36 ? 339 PRO A N     1 
ATOM   2485  C  CA    . PRO A 1 339 ? 67.743  -10.206 313.892 1.00 101.69 ? 339 PRO A CA    1 
ATOM   2486  C  C     . PRO A 1 339 ? 66.793  -11.054 314.734 1.00 97.49  ? 339 PRO A C     1 
ATOM   2487  O  O     . PRO A 1 339 ? 65.615  -10.720 314.873 1.00 97.28  ? 339 PRO A O     1 
ATOM   2488  C  CB    . PRO A 1 339 ? 68.000  -8.859  314.572 1.00 90.98  ? 339 PRO A CB    1 
ATOM   2489  C  CG    . PRO A 1 339 ? 66.972  -7.954  313.999 1.00 93.52  ? 339 PRO A CG    1 
ATOM   2490  C  CD    . PRO A 1 339 ? 66.795  -8.388  312.573 1.00 108.81 ? 339 PRO A CD    1 
ATOM   2491  N  N     . LYS A 1 340 ? 67.306  -12.150 315.282 1.00 95.71  ? 340 LYS A N     1 
ATOM   2492  C  CA    . LYS A 1 340 ? 66.490  -13.061 316.074 1.00 107.48 ? 340 LYS A CA    1 
ATOM   2493  C  C     . LYS A 1 340 ? 67.232  -13.573 317.306 1.00 110.77 ? 340 LYS A C     1 
ATOM   2494  O  O     . LYS A 1 340 ? 68.441  -13.819 317.266 1.00 105.67 ? 340 LYS A O     1 
ATOM   2495  C  CB    . LYS A 1 340 ? 66.028  -14.251 315.226 1.00 103.00 ? 340 LYS A CB    1 
ATOM   2496  C  CG    . LYS A 1 340 ? 65.090  -13.891 314.082 1.00 106.11 ? 340 LYS A CG    1 
ATOM   2497  C  CD    . LYS A 1 340 ? 64.706  -15.124 313.282 1.00 106.86 ? 340 LYS A CD    1 
ATOM   2498  N  N     . ILE A 1 341 ? 66.494  -13.727 318.400 1.00 107.51 ? 341 ILE A N     1 
ATOM   2499  C  CA    . ILE A 1 341 ? 67.031  -14.333 319.610 1.00 101.54 ? 341 ILE A CA    1 
ATOM   2500  C  C     . ILE A 1 341 ? 66.773  -15.834 319.565 1.00 103.08 ? 341 ILE A C     1 
ATOM   2501  O  O     . ILE A 1 341 ? 65.630  -16.283 319.646 1.00 102.14 ? 341 ILE A O     1 
ATOM   2502  C  CB    . ILE A 1 341 ? 66.408  -13.719 320.875 1.00 98.60  ? 341 ILE A CB    1 
ATOM   2503  C  CG1   . ILE A 1 341 ? 66.592  -12.200 320.849 1.00 107.03 ? 341 ILE A CG1   1 
ATOM   2504  C  CG2   . ILE A 1 341 ? 67.017  -14.340 322.122 1.00 94.58  ? 341 ILE A CG2   1 
ATOM   2505  C  CD1   . ILE A 1 341 ? 66.675  -11.553 322.215 1.00 110.56 ? 341 ILE A CD1   1 
ATOM   2506  N  N     . LEU A 1 342 ? 67.844  -16.609 319.439 1.00 105.94 ? 342 LEU A N     1 
ATOM   2507  C  CA    . LEU A 1 342 ? 67.721  -18.029 319.144 1.00 108.68 ? 342 LEU A CA    1 
ATOM   2508  C  C     . LEU A 1 342 ? 68.092  -18.934 320.311 1.00 112.32 ? 342 LEU A C     1 
ATOM   2509  O  O     . LEU A 1 342 ? 68.969  -18.614 321.111 1.00 113.63 ? 342 LEU A O     1 
ATOM   2510  C  CB    . LEU A 1 342 ? 68.583  -18.386 317.931 1.00 103.75 ? 342 LEU A CB    1 
ATOM   2511  C  CG    . LEU A 1 342 ? 68.329  -17.570 316.663 1.00 108.12 ? 342 LEU A CG    1 
ATOM   2512  C  CD1   . LEU A 1 342 ? 69.260  -18.009 315.542 1.00 104.70 ? 342 LEU A CD1   1 
ATOM   2513  C  CD2   . LEU A 1 342 ? 66.875  -17.694 316.236 1.00 117.79 ? 342 LEU A CD2   1 
ATOM   2514  N  N     . SER A 1 343 ? 67.411  -20.072 320.394 1.00 104.68 ? 343 SER A N     1 
ATOM   2515  C  CA    . SER A 1 343 ? 67.791  -21.128 321.319 1.00 105.54 ? 343 SER A CA    1 
ATOM   2516  C  C     . SER A 1 343 ? 68.938  -21.908 320.694 1.00 115.84 ? 343 SER A C     1 
ATOM   2517  O  O     . SER A 1 343 ? 69.302  -21.666 319.543 1.00 131.45 ? 343 SER A O     1 
ATOM   2518  C  CB    . SER A 1 343 ? 66.608  -22.059 321.592 1.00 109.20 ? 343 SER A CB    1 
ATOM   2519  O  OG    . SER A 1 343 ? 66.228  -22.755 320.418 1.00 102.89 ? 343 SER A OG    1 
ATOM   2520  N  N     . LEU A 1 344 ? 69.508  -22.837 321.452 1.00 115.84 ? 344 LEU A N     1 
ATOM   2521  C  CA    . LEU A 1 344 ? 70.607  -23.658 320.958 1.00 114.99 ? 344 LEU A CA    1 
ATOM   2522  C  C     . LEU A 1 344 ? 70.162  -24.496 319.761 1.00 112.28 ? 344 LEU A C     1 
ATOM   2523  O  O     . LEU A 1 344 ? 70.854  -24.564 318.740 1.00 112.72 ? 344 LEU A O     1 
ATOM   2524  C  CB    . LEU A 1 344 ? 71.124  -24.573 322.070 1.00 110.20 ? 344 LEU A CB    1 
ATOM   2525  C  CG    . LEU A 1 344 ? 72.335  -25.449 321.744 1.00 105.70 ? 344 LEU A CG    1 
ATOM   2526  C  CD1   . LEU A 1 344 ? 73.566  -24.592 321.496 1.00 93.60  ? 344 LEU A CD1   1 
ATOM   2527  C  CD2   . LEU A 1 344 ? 72.585  -26.450 322.861 1.00 112.20 ? 344 LEU A CD2   1 
ATOM   2528  N  N     . ARG A 1 345 ? 68.997  -25.122 319.901 1.00 104.73 ? 345 ARG A N     1 
ATOM   2529  C  CA    . ARG A 1 345 ? 68.439  -25.991 318.872 1.00 111.16 ? 345 ARG A CA    1 
ATOM   2530  C  C     . ARG A 1 345 ? 68.189  -25.246 317.563 1.00 118.36 ? 345 ARG A C     1 
ATOM   2531  O  O     . ARG A 1 345 ? 68.403  -25.791 316.482 1.00 129.37 ? 345 ARG A O     1 
ATOM   2532  C  CB    . ARG A 1 345 ? 67.142  -26.630 319.372 1.00 116.10 ? 345 ARG A CB    1 
ATOM   2533  C  CG    . ARG A 1 345 ? 66.457  -27.533 318.363 1.00 105.83 ? 345 ARG A CG    1 
ATOM   2534  C  CD    . ARG A 1 345 ? 67.333  -28.720 317.996 1.00 105.18 ? 345 ARG A CD    1 
ATOM   2535  N  NE    . ARG A 1 345 ? 66.694  -29.582 317.005 1.00 116.25 ? 345 ARG A NE    1 
ATOM   2536  C  CZ    . ARG A 1 345 ? 65.895  -30.600 317.306 1.00 123.53 ? 345 ARG A CZ    1 
ATOM   2537  N  NH1   . ARG A 1 345 ? 65.633  -30.889 318.573 1.00 129.51 ? 345 ARG A NH1   1 
ATOM   2538  N  NH2   . ARG A 1 345 ? 65.357  -31.332 316.339 1.00 122.05 ? 345 ARG A NH2   1 
ATOM   2539  N  N     . GLN A 1 346 ? 67.738  -24.000 317.666 1.00 111.44 ? 346 GLN A N     1 
ATOM   2540  C  CA    . GLN A 1 346 ? 67.471  -23.182 316.487 1.00 105.38 ? 346 GLN A CA    1 
ATOM   2541  C  C     . GLN A 1 346 ? 68.761  -22.846 315.737 1.00 109.26 ? 346 GLN A C     1 
ATOM   2542  O  O     . GLN A 1 346 ? 68.809  -22.903 314.504 1.00 120.24 ? 346 GLN A O     1 
ATOM   2543  C  CB    . GLN A 1 346 ? 66.721  -21.905 316.879 1.00 103.60 ? 346 GLN A CB    1 
ATOM   2544  C  CG    . GLN A 1 346 ? 65.301  -22.157 317.371 1.00 111.83 ? 346 GLN A CG    1 
ATOM   2545  C  CD    . GLN A 1 346 ? 64.662  -20.927 317.988 1.00 121.11 ? 346 GLN A CD    1 
ATOM   2546  O  OE1   . GLN A 1 346 ? 65.315  -19.902 318.178 1.00 132.74 ? 346 GLN A OE1   1 
ATOM   2547  N  NE2   . GLN A 1 346 ? 63.376  -21.026 318.305 1.00 121.07 ? 346 GLN A NE2   1 
ATOM   2548  N  N     . ILE A 1 347 ? 69.803  -22.503 316.489 1.00 94.67  ? 347 ILE A N     1 
ATOM   2549  C  CA    . ILE A 1 347 ? 71.113  -22.218 315.914 1.00 91.74  ? 347 ILE A CA    1 
ATOM   2550  C  C     . ILE A 1 347 ? 71.686  -23.458 315.226 1.00 103.55 ? 347 ILE A C     1 
ATOM   2551  O  O     . ILE A 1 347 ? 72.138  -23.395 314.073 1.00 112.34 ? 347 ILE A O     1 
ATOM   2552  C  CB    . ILE A 1 347 ? 72.099  -21.723 316.989 1.00 87.45  ? 347 ILE A CB    1 
ATOM   2553  C  CG1   . ILE A 1 347 ? 71.642  -20.374 317.549 1.00 95.52  ? 347 ILE A CG1   1 
ATOM   2554  C  CG2   . ILE A 1 347 ? 73.503  -21.612 316.419 1.00 92.12  ? 347 ILE A CG2   1 
ATOM   2555  C  CD1   . ILE A 1 347 ? 72.584  -19.782 318.580 1.00 98.71  ? 347 ILE A CD1   1 
ATOM   2556  N  N     . LEU A 1 348 ? 71.658  -24.581 315.939 1.00 106.01 ? 348 LEU A N     1 
ATOM   2557  C  CA    . LEU A 1 348 ? 72.114  -25.855 315.390 1.00 103.08 ? 348 LEU A CA    1 
ATOM   2558  C  C     . LEU A 1 348 ? 71.372  -26.197 314.096 1.00 102.30 ? 348 LEU A C     1 
ATOM   2559  O  O     . LEU A 1 348 ? 71.987  -26.580 313.102 1.00 104.20 ? 348 LEU A O     1 
ATOM   2560  C  CB    . LEU A 1 348 ? 71.947  -26.979 316.419 1.00 92.78  ? 348 LEU A CB    1 
ATOM   2561  C  CG    . LEU A 1 348 ? 72.862  -26.945 317.646 1.00 89.09  ? 348 LEU A CG    1 
ATOM   2562  C  CD1   . LEU A 1 348 ? 72.507  -28.063 318.614 1.00 104.60 ? 348 LEU A CD1   1 
ATOM   2563  C  CD2   . LEU A 1 348 ? 74.321  -27.047 317.233 1.00 79.10  ? 348 LEU A CD2   1 
ATOM   2564  N  N     . ASP A 1 349 ? 70.051  -26.038 314.118 1.00 93.05  ? 349 ASP A N     1 
ATOM   2565  C  CA    . ASP A 1 349 ? 69.215  -26.290 312.948 1.00 93.56  ? 349 ASP A CA    1 
ATOM   2566  C  C     . ASP A 1 349 ? 69.605  -25.406 311.768 1.00 96.33  ? 349 ASP A C     1 
ATOM   2567  O  O     . ASP A 1 349 ? 69.726  -25.885 310.635 1.00 102.49 ? 349 ASP A O     1 
ATOM   2568  C  CB    . ASP A 1 349 ? 67.736  -26.080 313.284 1.00 96.91  ? 349 ASP A CB    1 
ATOM   2569  C  CG    . ASP A 1 349 ? 67.144  -27.234 314.064 1.00 105.90 ? 349 ASP A CG    1 
ATOM   2570  O  OD1   . ASP A 1 349 ? 67.754  -28.324 314.071 1.00 110.81 ? 349 ASP A OD1   1 
ATOM   2571  O  OD2   . ASP A 1 349 ? 66.064  -27.052 314.662 1.00 112.28 ? 349 ASP A OD2   1 
ATOM   2572  N  N     . ALA A 1 350 ? 69.792  -24.117 312.041 1.00 87.98  ? 350 ALA A N     1 
ATOM   2573  C  CA    . ALA A 1 350 ? 70.230  -23.177 311.020 1.00 84.37  ? 350 ALA A CA    1 
ATOM   2574  C  C     . ALA A 1 350 ? 71.535  -23.651 310.387 1.00 83.30  ? 350 ALA A C     1 
ATOM   2575  O  O     . ALA A 1 350 ? 71.673  -23.690 309.152 1.00 97.11  ? 350 ALA A O     1 
ATOM   2576  C  CB    . ALA A 1 350 ? 70.399  -21.790 311.618 1.00 88.53  ? 350 ALA A CB    1 
ATOM   2577  N  N     . TYR A 1 351 ? 72.484  -24.031 311.238 1.00 83.50  ? 351 TYR A N     1 
ATOM   2578  C  CA    . TYR A 1 351 ? 73.778  -24.506 310.756 1.00 98.13  ? 351 TYR A CA    1 
ATOM   2579  C  C     . TYR A 1 351 ? 73.659  -25.759 309.888 1.00 102.31 ? 351 TYR A C     1 
ATOM   2580  O  O     . TYR A 1 351 ? 74.294  -25.850 308.836 1.00 110.85 ? 351 TYR A O     1 
ATOM   2581  C  CB    . TYR A 1 351 ? 74.743  -24.767 311.916 1.00 99.18  ? 351 TYR A CB    1 
ATOM   2582  C  CG    . TYR A 1 351 ? 76.080  -25.291 311.450 1.00 98.10  ? 351 TYR A CG    1 
ATOM   2583  C  CD1   . TYR A 1 351 ? 76.999  -24.449 310.839 1.00 101.54 ? 351 TYR A CD1   1 
ATOM   2584  C  CD2   . TYR A 1 351 ? 76.417  -26.629 311.606 1.00 98.00  ? 351 TYR A CD2   1 
ATOM   2585  C  CE1   . TYR A 1 351 ? 78.219  -24.920 310.401 1.00 99.27  ? 351 TYR A CE1   1 
ATOM   2586  C  CE2   . TYR A 1 351 ? 77.638  -27.111 311.171 1.00 102.03 ? 351 TYR A CE2   1 
ATOM   2587  C  CZ    . TYR A 1 351 ? 78.534  -26.251 310.569 1.00 101.52 ? 351 TYR A CZ    1 
ATOM   2588  O  OH    . TYR A 1 351 ? 79.748  -26.720 310.132 1.00 103.39 ? 351 TYR A OH    1 
ATOM   2589  N  N     . ILE A 1 352 ? 72.846  -26.716 310.328 1.00 93.32  ? 352 ILE A N     1 
ATOM   2590  C  CA    . ILE A 1 352 ? 72.661  -27.961 309.586 1.00 95.70  ? 352 ILE A CA    1 
ATOM   2591  C  C     . ILE A 1 352 ? 72.013  -27.706 308.226 1.00 102.03 ? 352 ILE A C     1 
ATOM   2592  O  O     . ILE A 1 352 ? 72.401  -28.307 307.221 1.00 107.44 ? 352 ILE A O     1 
ATOM   2593  C  CB    . ILE A 1 352 ? 71.817  -28.976 310.384 1.00 99.35  ? 352 ILE A CB    1 
ATOM   2594  C  CG1   . ILE A 1 352 ? 72.500  -29.313 311.711 1.00 112.54 ? 352 ILE A CG1   1 
ATOM   2595  C  CG2   . ILE A 1 352 ? 71.610  -30.250 309.582 1.00 92.53  ? 352 ILE A CG2   1 
ATOM   2596  C  CD1   . ILE A 1 352 ? 71.628  -30.096 312.663 1.00 113.99 ? 352 ILE A CD1   1 
ATOM   2597  N  N     . GLU A 1 353 ? 71.034  -26.806 308.199 1.00 102.32 ? 353 GLU A N     1 
ATOM   2598  C  CA    . GLU A 1 353 ? 70.365  -26.439 306.955 1.00 100.21 ? 353 GLU A CA    1 
ATOM   2599  C  C     . GLU A 1 353 ? 71.352  -25.805 305.978 1.00 102.60 ? 353 GLU A C     1 
ATOM   2600  O  O     . GLU A 1 353 ? 71.454  -26.221 304.812 1.00 104.91 ? 353 GLU A O     1 
ATOM   2601  C  CB    . GLU A 1 353 ? 69.214  -25.473 307.235 1.00 96.37  ? 353 GLU A CB    1 
ATOM   2602  N  N     . HIS A 1 354 ? 72.078  -24.801 306.465 1.00 100.47 ? 354 HIS A N     1 
ATOM   2603  C  CA    . HIS A 1 354 ? 73.095  -24.128 305.662 1.00 107.20 ? 354 HIS A CA    1 
ATOM   2604  C  C     . HIS A 1 354 ? 74.100  -25.133 305.105 1.00 110.78 ? 354 HIS A C     1 
ATOM   2605  O  O     . HIS A 1 354 ? 74.507  -25.056 303.940 1.00 121.59 ? 354 HIS A O     1 
ATOM   2606  C  CB    . HIS A 1 354 ? 73.807  -23.072 306.508 1.00 107.39 ? 354 HIS A CB    1 
ATOM   2607  C  CG    . HIS A 1 354 ? 74.991  -22.453 305.836 1.00 97.47  ? 354 HIS A CG    1 
ATOM   2608  N  ND1   . HIS A 1 354 ? 74.876  -21.607 304.754 1.00 92.47  ? 354 HIS A ND1   1 
ATOM   2609  C  CD2   . HIS A 1 354 ? 76.316  -22.553 306.097 1.00 91.75  ? 354 HIS A CD2   1 
ATOM   2610  C  CE1   . HIS A 1 354 ? 76.079  -21.214 304.376 1.00 91.32  ? 354 HIS A CE1   1 
ATOM   2611  N  NE2   . HIS A 1 354 ? 76.970  -21.774 305.175 1.00 87.56  ? 354 HIS A NE2   1 
ATOM   2612  N  N     . GLN A 1 355 ? 74.475  -26.090 305.947 1.00 103.95 ? 355 GLN A N     1 
ATOM   2613  C  CA    . GLN A 1 355 ? 75.421  -27.135 305.576 1.00 102.80 ? 355 GLN A CA    1 
ATOM   2614  C  C     . GLN A 1 355 ? 74.877  -28.031 304.463 1.00 102.65 ? 355 GLN A C     1 
ATOM   2615  O  O     . GLN A 1 355 ? 75.596  -28.363 303.518 1.00 102.36 ? 355 GLN A O     1 
ATOM   2616  C  CB    . GLN A 1 355 ? 75.782  -27.977 306.805 1.00 102.08 ? 355 GLN A CB    1 
ATOM   2617  C  CG    . GLN A 1 355 ? 77.218  -28.472 306.825 1.00 104.28 ? 355 GLN A CG    1 
ATOM   2618  C  CD    . GLN A 1 355 ? 78.225  -27.359 307.069 1.00 97.95  ? 355 GLN A CD    1 
ATOM   2619  O  OE1   . GLN A 1 355 ? 79.424  -27.537 306.856 1.00 101.37 ? 355 GLN A OE1   1 
ATOM   2620  N  NE2   . GLN A 1 355 ? 77.741  -26.207 307.522 1.00 87.33  ? 355 GLN A NE2   1 
ATOM   2621  N  N     . LYS A 1 356 ? 73.609  -28.419 304.582 1.00 106.75 ? 356 LYS A N     1 
ATOM   2622  C  CA    . LYS A 1 356 ? 72.953  -29.219 303.552 1.00 100.14 ? 356 LYS A CA    1 
ATOM   2623  C  C     . LYS A 1 356 ? 72.949  -28.466 302.228 1.00 102.92 ? 356 LYS A C     1 
ATOM   2624  O  O     . LYS A 1 356 ? 73.252  -29.040 301.173 1.00 104.25 ? 356 LYS A O     1 
ATOM   2625  C  CB    . LYS A 1 356 ? 71.521  -29.574 303.958 1.00 83.73  ? 356 LYS A CB    1 
ATOM   2626  C  CG    . LYS A 1 356 ? 71.416  -30.555 305.114 1.00 89.17  ? 356 LYS A CG    1 
ATOM   2627  C  CD    . LYS A 1 356 ? 69.966  -30.886 305.428 1.00 102.16 ? 356 LYS A CD    1 
ATOM   2628  C  CE    . LYS A 1 356 ? 69.860  -31.896 306.562 1.00 107.05 ? 356 LYS A CE    1 
ATOM   2629  N  NZ    . LYS A 1 356 ? 68.439  -32.218 306.875 1.00 117.45 ? 356 LYS A NZ    1 
ATOM   2630  N  N     . GLU A 1 357 ? 72.615  -27.178 302.291 1.00 92.22  ? 357 GLU A N     1 
ATOM   2631  C  CA    . GLU A 1 357 ? 72.649  -26.341 301.099 1.00 85.38  ? 357 GLU A CA    1 
ATOM   2632  C  C     . GLU A 1 357 ? 74.031  -26.360 300.456 1.00 86.80  ? 357 GLU A C     1 
ATOM   2633  O  O     . GLU A 1 357 ? 74.164  -26.597 299.251 1.00 107.22 ? 357 GLU A O     1 
ATOM   2634  C  CB    . GLU A 1 357 ? 72.255  -24.903 301.425 1.00 66.91  ? 357 GLU A CB    1 
ATOM   2635  C  CG    . GLU A 1 357 ? 72.223  -23.997 300.201 1.00 92.59  ? 357 GLU A CG    1 
ATOM   2636  C  CD    . GLU A 1 357 ? 72.233  -22.525 300.555 1.00 113.91 ? 357 GLU A CD    1 
ATOM   2637  O  OE1   . GLU A 1 357 ? 71.146  -21.913 300.578 1.00 120.08 ? 357 GLU A OE1   1 
ATOM   2638  O  OE2   . GLU A 1 357 ? 73.329  -21.977 300.802 1.00 121.66 ? 357 GLU A OE2   1 
ATOM   2639  N  N     . VAL A 1 358 ? 75.055  -26.119 301.268 1.00 78.35  ? 358 VAL A N     1 
ATOM   2640  C  CA    . VAL A 1 358 ? 76.432  -26.120 300.782 1.00 87.71  ? 358 VAL A CA    1 
ATOM   2641  C  C     . VAL A 1 358 ? 76.800  -27.434 300.092 1.00 96.98  ? 358 VAL A C     1 
ATOM   2642  O  O     . VAL A 1 358 ? 77.257  -27.432 298.947 1.00 104.77 ? 358 VAL A O     1 
ATOM   2643  C  CB    . VAL A 1 358 ? 77.431  -25.832 301.921 1.00 90.07  ? 358 VAL A CB    1 
ATOM   2644  C  CG1   . VAL A 1 358 ? 78.855  -26.163 301.484 1.00 79.52  ? 358 VAL A CG1   1 
ATOM   2645  C  CG2   . VAL A 1 358 ? 77.311  -24.378 302.378 1.00 94.30  ? 358 VAL A CG2   1 
ATOM   2646  N  N     . VAL A 1 359 ? 76.590  -28.551 300.785 1.00 98.90  ? 359 VAL A N     1 
ATOM   2647  C  CA    . VAL A 1 359 ? 76.934  -29.868 300.244 1.00 104.26 ? 359 VAL A CA    1 
ATOM   2648  C  C     . VAL A 1 359 ? 76.199  -30.186 298.937 1.00 102.24 ? 359 VAL A C     1 
ATOM   2649  O  O     . VAL A 1 359 ? 76.821  -30.603 297.949 1.00 95.57  ? 359 VAL A O     1 
ATOM   2650  C  CB    . VAL A 1 359 ? 76.691  -30.993 301.279 1.00 100.63 ? 359 VAL A CB    1 
ATOM   2651  C  CG1   . VAL A 1 359 ? 76.808  -32.361 300.623 1.00 96.30  ? 359 VAL A CG1   1 
ATOM   2652  C  CG2   . VAL A 1 359 ? 77.671  -30.863 302.440 1.00 95.91  ? 359 VAL A CG2   1 
ATOM   2653  N  N     . VAL A 1 360 ? 74.883  -29.982 298.933 1.00 103.02 ? 360 VAL A N     1 
ATOM   2654  C  CA    . VAL A 1 360 ? 74.084  -30.210 297.729 1.00 99.46  ? 360 VAL A CA    1 
ATOM   2655  C  C     . VAL A 1 360 ? 74.586  -29.363 296.557 1.00 96.27  ? 360 VAL A C     1 
ATOM   2656  O  O     . VAL A 1 360 ? 74.795  -29.876 295.451 1.00 101.95 ? 360 VAL A O     1 
ATOM   2657  C  CB    . VAL A 1 360 ? 72.588  -29.935 297.983 1.00 90.52  ? 360 VAL A CB    1 
ATOM   2658  C  CG1   . VAL A 1 360 ? 71.849  -29.709 296.673 1.00 77.69  ? 360 VAL A CG1   1 
ATOM   2659  C  CG2   . VAL A 1 360 ? 71.969  -31.084 298.771 1.00 91.45  ? 360 VAL A CG2   1 
ATOM   2660  N  N     . ARG A 1 361 ? 74.789  -28.072 296.815 1.00 84.03  ? 361 ARG A N     1 
ATOM   2661  C  CA    . ARG A 1 361 ? 75.342  -27.160 295.818 1.00 88.80  ? 361 ARG A CA    1 
ATOM   2662  C  C     . ARG A 1 361 ? 76.660  -27.678 295.241 1.00 90.44  ? 361 ARG A C     1 
ATOM   2663  O  O     . ARG A 1 361 ? 76.838  -27.732 294.021 1.00 96.43  ? 361 ARG A O     1 
ATOM   2664  C  CB    . ARG A 1 361 ? 75.557  -25.769 296.425 1.00 84.47  ? 361 ARG A CB    1 
ATOM   2665  C  CG    . ARG A 1 361 ? 74.331  -24.865 296.411 1.00 78.73  ? 361 ARG A CG    1 
ATOM   2666  C  CD    . ARG A 1 361 ? 74.594  -23.578 297.181 1.00 83.55  ? 361 ARG A CD    1 
ATOM   2667  N  NE    . ARG A 1 361 ? 73.579  -22.563 296.922 1.00 89.44  ? 361 ARG A NE    1 
ATOM   2668  C  CZ    . ARG A 1 361 ? 73.808  -21.432 296.260 1.00 108.28 ? 361 ARG A CZ    1 
ATOM   2669  N  NH1   . ARG A 1 361 ? 75.023  -21.162 295.798 1.00 71.21  ? 361 ARG A NH1   1 
ATOM   2670  N  NH2   . ARG A 1 361 ? 72.823  -20.565 296.067 1.00 129.61 ? 361 ARG A NH2   1 
ATOM   2671  N  N     . ARG A 1 362 ? 77.573  -28.062 296.129 1.00 88.94  ? 362 ARG A N     1 
ATOM   2672  C  CA    . ARG A 1 362 ? 78.875  -28.585 295.728 1.00 95.83  ? 362 ARG A CA    1 
ATOM   2673  C  C     . ARG A 1 362 ? 78.729  -29.801 294.815 1.00 98.37  ? 362 ARG A C     1 
ATOM   2674  O  O     . ARG A 1 362 ? 79.358  -29.877 293.755 1.00 89.92  ? 362 ARG A O     1 
ATOM   2675  C  CB    . ARG A 1 362 ? 79.708  -28.952 296.959 1.00 91.19  ? 362 ARG A CB    1 
ATOM   2676  C  CG    . ARG A 1 362 ? 81.096  -29.465 296.626 1.00 87.72  ? 362 ARG A CG    1 
ATOM   2677  C  CD    . ARG A 1 362 ? 81.846  -29.889 297.878 1.00 91.35  ? 362 ARG A CD    1 
ATOM   2678  N  NE    . ARG A 1 362 ? 81.211  -31.017 298.553 1.00 98.41  ? 362 ARG A NE    1 
ATOM   2679  C  CZ    . ARG A 1 362 ? 81.671  -31.577 299.668 1.00 93.32  ? 362 ARG A CZ    1 
ATOM   2680  N  NH1   . ARG A 1 362 ? 82.774  -31.116 300.240 1.00 86.71  ? 362 ARG A NH1   1 
ATOM   2681  N  NH2   . ARG A 1 362 ? 81.027  -32.601 300.211 1.00 91.38  ? 362 ARG A NH2   1 
ATOM   2682  N  N     . THR A 1 363 ? 77.885  -30.742 295.231 1.00 105.62 ? 363 THR A N     1 
ATOM   2683  C  CA    . THR A 1 363 ? 77.650  -31.956 294.456 1.00 103.37 ? 363 THR A CA    1 
ATOM   2684  C  C     . THR A 1 363 ? 77.097  -31.637 293.067 1.00 102.60 ? 363 THR A C     1 
ATOM   2685  O  O     . THR A 1 363 ? 77.528  -32.220 292.071 1.00 111.57 ? 363 THR A O     1 
ATOM   2686  C  CB    . THR A 1 363 ? 76.694  -32.915 295.192 1.00 98.20  ? 363 THR A CB    1 
ATOM   2687  O  OG1   . THR A 1 363 ? 77.227  -33.217 296.488 1.00 99.48  ? 363 THR A OG1   1 
ATOM   2688  C  CG2   . THR A 1 363 ? 76.521  -34.206 294.410 1.00 93.34  ? 363 THR A CG2   1 
ATOM   2689  N  N     . ARG A 1 364 ? 76.153  -30.702 293.004 1.00 96.41  ? 364 ARG A N     1 
ATOM   2690  C  CA    . ARG A 1 364 ? 75.603  -30.259 291.724 1.00 90.83  ? 364 ARG A CA    1 
ATOM   2691  C  C     . ARG A 1 364 ? 76.691  -29.676 290.821 1.00 88.42  ? 364 ARG A C     1 
ATOM   2692  O  O     . ARG A 1 364 ? 76.772  -30.007 289.634 1.00 97.58  ? 364 ARG A O     1 
ATOM   2693  C  CB    . ARG A 1 364 ? 74.489  -29.231 291.940 1.00 68.76  ? 364 ARG A CB    1 
ATOM   2694  C  CG    . ARG A 1 364 ? 73.256  -29.777 292.639 1.00 83.92  ? 364 ARG A CG    1 
ATOM   2695  C  CD    . ARG A 1 364 ? 72.282  -28.664 292.998 1.00 94.08  ? 364 ARG A CD    1 
ATOM   2696  N  NE    . ARG A 1 364 ? 71.839  -27.915 291.825 1.00 108.92 ? 364 ARG A NE    1 
ATOM   2697  C  CZ    . ARG A 1 364 ? 70.779  -28.235 291.091 1.00 118.14 ? 364 ARG A CZ    1 
ATOM   2698  N  NH1   . ARG A 1 364 ? 70.048  -29.296 291.406 1.00 125.02 ? 364 ARG A NH1   1 
ATOM   2699  N  NH2   . ARG A 1 364 ? 70.450  -27.496 290.041 1.00 115.76 ? 364 ARG A NH2   1 
ATOM   2700  N  N     . PHE A 1 365 ? 77.522  -28.809 291.395 1.00 81.11  ? 365 PHE A N     1 
ATOM   2701  C  CA    . PHE A 1 365 ? 78.648  -28.207 290.677 1.00 81.62  ? 365 PHE A CA    1 
ATOM   2702  C  C     . PHE A 1 365 ? 79.554  -29.278 290.072 1.00 94.57  ? 365 PHE A C     1 
ATOM   2703  O  O     . PHE A 1 365 ? 79.814  -29.293 288.856 1.00 113.16 ? 365 PHE A O     1 
ATOM   2704  C  CB    . PHE A 1 365 ? 79.450  -27.329 291.641 1.00 80.60  ? 365 PHE A CB    1 
ATOM   2705  C  CG    . PHE A 1 365 ? 80.629  -26.634 291.014 1.00 80.64  ? 365 PHE A CG    1 
ATOM   2706  C  CD1   . PHE A 1 365 ? 80.483  -25.383 290.440 1.00 80.05  ? 365 PHE A CD1   1 
ATOM   2707  C  CD2   . PHE A 1 365 ? 81.887  -27.216 291.030 1.00 82.31  ? 365 PHE A CD2   1 
ATOM   2708  C  CE1   . PHE A 1 365 ? 81.564  -24.731 289.877 1.00 78.50  ? 365 PHE A CE1   1 
ATOM   2709  C  CE2   . PHE A 1 365 ? 82.973  -26.571 290.467 1.00 82.33  ? 365 PHE A CE2   1 
ATOM   2710  C  CZ    . PHE A 1 365 ? 82.811  -25.325 289.890 1.00 79.51  ? 365 PHE A CZ    1 
ATOM   2711  N  N     . ASP A 1 366 ? 80.026  -30.176 290.933 1.00 92.06  ? 366 ASP A N     1 
ATOM   2712  C  CA    . ASP A 1 366 ? 80.898  -31.267 290.513 1.00 102.20 ? 366 ASP A CA    1 
ATOM   2713  C  C     . ASP A 1 366 ? 80.259  -32.114 289.417 1.00 106.75 ? 366 ASP A C     1 
ATOM   2714  O  O     . ASP A 1 366 ? 80.930  -32.513 288.463 1.00 106.15 ? 366 ASP A O     1 
ATOM   2715  C  CB    . ASP A 1 366 ? 81.275  -32.144 291.708 1.00 107.45 ? 366 ASP A CB    1 
ATOM   2716  C  CG    . ASP A 1 366 ? 82.201  -31.440 292.676 1.00 106.88 ? 366 ASP A CG    1 
ATOM   2717  O  OD1   . ASP A 1 366 ? 82.827  -30.434 292.277 1.00 109.41 ? 366 ASP A OD1   1 
ATOM   2718  O  OD2   . ASP A 1 366 ? 82.307  -31.896 293.834 1.00 100.69 ? 366 ASP A OD2   1 
ATOM   2719  N  N     . LYS A 1 367 ? 78.961  -32.372 289.550 1.00 104.22 ? 367 LYS A N     1 
ATOM   2720  C  CA    . LYS A 1 367 ? 78.237  -33.141 288.545 1.00 99.48  ? 367 LYS A CA    1 
ATOM   2721  C  C     . LYS A 1 367 ? 78.253  -32.439 287.193 1.00 102.52 ? 367 LYS A C     1 
ATOM   2722  O  O     . LYS A 1 367 ? 78.602  -33.046 286.177 1.00 110.91 ? 367 LYS A O     1 
ATOM   2723  C  CB    . LYS A 1 367 ? 76.792  -33.392 288.977 1.00 93.27  ? 367 LYS A CB    1 
ATOM   2724  C  CG    . LYS A 1 367 ? 75.998  -34.219 287.978 1.00 94.10  ? 367 LYS A CG    1 
ATOM   2725  C  CD    . LYS A 1 367 ? 74.574  -34.448 288.453 1.00 98.21  ? 367 LYS A CD    1 
ATOM   2726  C  CE    . LYS A 1 367 ? 73.783  -35.284 287.459 1.00 89.02  ? 367 LYS A CE    1 
ATOM   2727  N  N     . GLU A 1 368 ? 77.875  -31.163 287.189 1.00 99.60  ? 368 GLU A N     1 
ATOM   2728  C  CA    . GLU A 1 368 ? 77.873  -30.366 285.964 1.00 102.68 ? 368 GLU A CA    1 
ATOM   2729  C  C     . GLU A 1 368 ? 79.239  -30.377 285.282 1.00 104.19 ? 368 GLU A C     1 
ATOM   2730  O  O     . GLU A 1 368 ? 79.352  -30.651 284.078 1.00 116.15 ? 368 GLU A O     1 
ATOM   2731  C  CB    . GLU A 1 368 ? 77.453  -28.925 286.267 1.00 87.88  ? 368 GLU A CB    1 
ATOM   2732  N  N     . LYS A 1 369 ? 80.276  -30.091 286.063 1.00 90.90  ? 369 LYS A N     1 
ATOM   2733  C  CA    . LYS A 1 369 ? 81.636  -30.052 285.533 1.00 94.44  ? 369 LYS A CA    1 
ATOM   2734  C  C     . LYS A 1 369 ? 82.046  -31.396 284.928 1.00 107.13 ? 369 LYS A C     1 
ATOM   2735  O  O     . LYS A 1 369 ? 82.526  -31.462 283.786 1.00 117.26 ? 369 LYS A O     1 
ATOM   2736  C  CB    . LYS A 1 369 ? 82.622  -29.636 286.628 1.00 91.44  ? 369 LYS A CB    1 
ATOM   2737  C  CG    . LYS A 1 369 ? 84.028  -29.363 286.131 1.00 98.51  ? 369 LYS A CG    1 
ATOM   2738  C  CD    . LYS A 1 369 ? 84.918  -28.852 287.253 1.00 107.07 ? 369 LYS A CD    1 
ATOM   2739  C  CE    . LYS A 1 369 ? 86.264  -28.404 286.714 1.00 108.38 ? 369 LYS A CE    1 
ATOM   2740  N  N     . ALA A 1 370 ? 81.842  -32.462 285.700 1.00 105.59 ? 370 ALA A N     1 
ATOM   2741  C  CA    . ALA A 1 370 ? 82.176  -33.815 285.264 1.00 105.34 ? 370 ALA A CA    1 
ATOM   2742  C  C     . ALA A 1 370 ? 81.477  -34.178 283.957 1.00 106.13 ? 370 ALA A C     1 
ATOM   2743  O  O     . ALA A 1 370 ? 82.096  -34.721 283.041 1.00 114.43 ? 370 ALA A O     1 
ATOM   2744  C  CB    . ALA A 1 370 ? 81.820  -34.819 286.348 1.00 102.78 ? 370 ALA A CB    1 
ATOM   2745  N  N     . GLU A 1 371 ? 80.186  -33.871 283.874 1.00 91.36  ? 371 GLU A N     1 
ATOM   2746  C  CA    . GLU A 1 371 ? 79.411  -34.162 282.673 1.00 90.28  ? 371 GLU A CA    1 
ATOM   2747  C  C     . GLU A 1 371 ? 79.902  -33.370 281.463 1.00 90.80  ? 371 GLU A C     1 
ATOM   2748  O  O     . GLU A 1 371 ? 80.002  -33.913 280.357 1.00 97.83  ? 371 GLU A O     1 
ATOM   2749  C  CB    . GLU A 1 371 ? 77.921  -33.916 282.920 1.00 75.30  ? 371 GLU A CB    1 
ATOM   2750  C  CG    . GLU A 1 371 ? 77.286  -34.940 283.849 1.00 98.33  ? 371 GLU A CG    1 
ATOM   2751  C  CD    . GLU A 1 371 ? 75.830  -34.651 284.140 1.00 111.90 ? 371 GLU A CD    1 
ATOM   2752  O  OE1   . GLU A 1 371 ? 75.098  -35.603 284.477 1.00 117.75 ? 371 GLU A OE1   1 
ATOM   2753  O  OE2   . GLU A 1 371 ? 75.419  -33.476 284.044 1.00 119.73 ? 371 GLU A OE2   1 
ATOM   2754  N  N     . ALA A 1 372 ? 80.215  -32.094 281.672 1.00 81.99  ? 372 ALA A N     1 
ATOM   2755  C  CA    . ALA A 1 372 ? 80.770  -31.274 280.595 1.00 88.43  ? 372 ALA A CA    1 
ATOM   2756  C  C     . ALA A 1 372 ? 82.077  -31.866 280.054 1.00 96.15  ? 372 ALA A C     1 
ATOM   2757  O  O     . ALA A 1 372 ? 82.233  -32.098 278.839 1.00 96.44  ? 372 ALA A O     1 
ATOM   2758  C  CB    . ALA A 1 372 ? 80.995  -29.853 281.079 1.00 75.10  ? 372 ALA A CB    1 
ATOM   2759  N  N     . ARG A 1 373 ? 83.007  -32.120 280.972 1.00 96.00  ? 373 ARG A N     1 
ATOM   2760  C  CA    . ARG A 1 373 ? 84.297  -32.703 280.616 1.00 94.75  ? 373 ARG A CA    1 
ATOM   2761  C  C     . ARG A 1 373 ? 84.122  -34.042 279.901 1.00 106.57 ? 373 ARG A C     1 
ATOM   2762  O  O     . ARG A 1 373 ? 84.873  -34.364 278.981 1.00 112.07 ? 373 ARG A O     1 
ATOM   2763  C  CB    . ARG A 1 373 ? 85.174  -32.872 281.859 1.00 80.61  ? 373 ARG A CB    1 
ATOM   2764  C  CG    . ARG A 1 373 ? 86.526  -33.510 281.588 1.00 84.84  ? 373 ARG A CG    1 
ATOM   2765  C  CD    . ARG A 1 373 ? 87.356  -32.689 280.615 1.00 91.82  ? 373 ARG A CD    1 
ATOM   2766  N  NE    . ARG A 1 373 ? 88.641  -33.323 280.329 1.00 95.56  ? 373 ARG A NE    1 
ATOM   2767  C  CZ    . ARG A 1 373 ? 89.568  -32.804 279.531 1.00 101.05 ? 373 ARG A CZ    1 
ATOM   2768  N  NH1   . ARG A 1 373 ? 89.356  -31.639 278.937 1.00 110.78 ? 373 ARG A NH1   1 
ATOM   2769  N  NH2   . ARG A 1 373 ? 90.707  -33.451 279.327 1.00 100.29 ? 373 ARG A NH2   1 
ATOM   2770  N  N     . ALA A 1 374 ? 83.122  -34.812 280.323 1.00 107.58 ? 374 ALA A N     1 
ATOM   2771  C  CA    . ALA A 1 374 ? 82.827  -36.099 279.698 1.00 107.86 ? 374 ALA A CA    1 
ATOM   2772  C  C     . ALA A 1 374 ? 82.335  -35.921 278.263 1.00 102.55 ? 374 ALA A C     1 
ATOM   2773  O  O     . ALA A 1 374 ? 82.727  -36.669 277.369 1.00 104.54 ? 374 ALA A O     1 
ATOM   2774  C  CB    . ALA A 1 374 ? 81.807  -36.869 280.524 1.00 112.68 ? 374 ALA A CB    1 
ATOM   2775  N  N     . HIS A 1 375 ? 81.469  -34.932 278.058 1.00 91.15  ? 375 HIS A N     1 
ATOM   2776  C  CA    . HIS A 1 375 ? 80.961  -34.585 276.732 1.00 89.65  ? 375 HIS A CA    1 
ATOM   2777  C  C     . HIS A 1 375 ? 82.122  -34.253 275.789 1.00 93.01  ? 375 HIS A C     1 
ATOM   2778  O  O     . HIS A 1 375 ? 82.297  -34.878 274.712 1.00 104.73 ? 375 HIS A O     1 
ATOM   2779  C  CB    . HIS A 1 375 ? 80.019  -33.385 276.868 1.00 87.81  ? 375 HIS A CB    1 
ATOM   2780  C  CG    . HIS A 1 375 ? 79.364  -32.966 275.589 1.00 96.97  ? 375 HIS A CG    1 
ATOM   2781  N  ND1   . HIS A 1 375 ? 78.134  -33.442 275.189 1.00 105.30 ? 375 HIS A ND1   1 
ATOM   2782  C  CD2   . HIS A 1 375 ? 79.757  -32.091 274.633 1.00 97.45  ? 375 HIS A CD2   1 
ATOM   2783  C  CE1   . HIS A 1 375 ? 77.804  -32.889 274.035 1.00 108.60 ? 375 HIS A CE1   1 
ATOM   2784  N  NE2   . HIS A 1 375 ? 78.773  -32.067 273.676 1.00 101.64 ? 375 HIS A NE2   1 
ATOM   2785  N  N     . ILE A 1 376 ? 82.927  -33.279 276.214 1.00 91.83  ? 376 ILE A N     1 
ATOM   2786  C  CA    . ILE A 1 376 ? 84.102  -32.883 275.438 1.00 88.98  ? 376 ILE A CA    1 
ATOM   2787  C  C     . ILE A 1 376 ? 84.999  -34.092 275.160 1.00 96.21  ? 376 ILE A C     1 
ATOM   2788  O  O     . ILE A 1 376 ? 85.526  -34.249 274.057 1.00 103.64 ? 376 ILE A O     1 
ATOM   2789  C  CB    . ILE A 1 376 ? 84.902  -31.760 276.139 1.00 79.21  ? 376 ILE A CB    1 
ATOM   2790  C  CG1   . ILE A 1 376 ? 84.365  -30.388 275.729 1.00 73.71  ? 376 ILE A CG1   1 
ATOM   2791  C  CG2   . ILE A 1 376 ? 86.376  -31.839 275.790 1.00 75.46  ? 376 ILE A CG2   1 
ATOM   2792  C  CD1   . ILE A 1 376 ? 82.974  -30.077 276.245 1.00 152.72 ? 376 ILE A CD1   1 
ATOM   2793  N  N     . LEU A 1 377 ? 85.134  -34.961 276.156 1.00 93.18  ? 377 LEU A N     1 
ATOM   2794  C  CA    . LEU A 1 377 ? 85.944  -36.169 276.027 1.00 97.44  ? 377 LEU A CA    1 
ATOM   2795  C  C     . LEU A 1 377 ? 85.401  -37.126 274.967 1.00 98.55  ? 377 LEU A C     1 
ATOM   2796  O  O     . LEU A 1 377 ? 86.173  -37.768 274.255 1.00 92.82  ? 377 LEU A O     1 
ATOM   2797  C  CB    . LEU A 1 377 ? 86.058  -36.884 277.374 1.00 92.05  ? 377 LEU A CB    1 
ATOM   2798  C  CG    . LEU A 1 377 ? 87.480  -36.987 277.924 1.00 90.26  ? 377 LEU A CG    1 
ATOM   2799  C  CD1   . LEU A 1 377 ? 88.148  -35.620 277.933 1.00 80.40  ? 377 LEU A CD1   1 
ATOM   2800  C  CD2   . LEU A 1 377 ? 87.480  -37.593 279.315 1.00 96.28  ? 377 LEU A CD2   1 
ATOM   2801  N  N     . GLU A 1 378 ? 84.077  -37.219 274.871 1.00 94.80  ? 378 GLU A N     1 
ATOM   2802  C  CA    . GLU A 1 378 ? 83.437  -38.025 273.838 1.00 91.86  ? 378 GLU A CA    1 
ATOM   2803  C  C     . GLU A 1 378 ? 83.779  -37.449 272.476 1.00 100.12 ? 378 GLU A C     1 
ATOM   2804  O  O     . GLU A 1 378 ? 84.166  -38.185 271.549 1.00 92.33  ? 378 GLU A O     1 
ATOM   2805  C  CB    . GLU A 1 378 ? 81.919  -38.037 274.019 1.00 89.22  ? 378 GLU A CB    1 
ATOM   2806  C  CG    . GLU A 1 378 ? 81.440  -38.756 275.268 1.00 98.97  ? 378 GLU A CG    1 
ATOM   2807  C  CD    . GLU A 1 378 ? 79.957  -38.566 275.512 1.00 110.92 ? 378 GLU A CD    1 
ATOM   2808  O  OE1   . GLU A 1 378 ? 79.287  -37.956 274.652 1.00 117.29 ? 378 GLU A OE1   1 
ATOM   2809  O  OE2   . GLU A 1 378 ? 79.459  -39.023 276.564 1.00 110.72 ? 378 GLU A OE2   1 
ATOM   2810  N  N     . GLY A 1 379 ? 83.638  -36.128 272.360 1.00 106.54 ? 379 GLY A N     1 
ATOM   2811  C  CA    . GLY A 1 379 ? 84.018  -35.453 271.128 1.00 102.89 ? 379 GLY A CA    1 
ATOM   2812  C  C     . GLY A 1 379 ? 85.441  -35.787 270.705 1.00 102.12 ? 379 GLY A C     1 
ATOM   2813  O  O     . GLY A 1 379 ? 85.699  -36.201 269.565 1.00 99.80  ? 379 GLY A O     1 
ATOM   2814  N  N     . LEU A 1 380 ? 86.366  -35.628 271.648 1.00 105.94 ? 380 LEU A N     1 
ATOM   2815  C  CA    . LEU A 1 380 ? 87.778  -35.913 271.418 1.00 106.84 ? 380 LEU A CA    1 
ATOM   2816  C  C     . LEU A 1 380 ? 88.015  -37.375 271.048 1.00 109.60 ? 380 LEU A C     1 
ATOM   2817  O  O     . LEU A 1 380 ? 88.923  -37.684 270.282 1.00 102.08 ? 380 LEU A O     1 
ATOM   2818  C  CB    . LEU A 1 380 ? 88.610  -35.549 272.650 1.00 100.59 ? 380 LEU A CB    1 
ATOM   2819  C  CG    . LEU A 1 380 ? 88.632  -34.076 273.054 1.00 105.10 ? 380 LEU A CG    1 
ATOM   2820  C  CD1   . LEU A 1 380 ? 89.536  -33.867 274.257 1.00 106.92 ? 380 LEU A CD1   1 
ATOM   2821  C  CD2   . LEU A 1 380 ? 89.080  -33.213 271.888 1.00 106.56 ? 380 LEU A CD2   1 
ATOM   2822  N  N     . LEU A 1 381 ? 87.201  -38.271 271.598 1.00 110.21 ? 381 LEU A N     1 
ATOM   2823  C  CA    . LEU A 1 381 ? 87.316  -39.690 271.287 1.00 106.15 ? 381 LEU A CA    1 
ATOM   2824  C  C     . LEU A 1 381 ? 86.933  -39.957 269.840 1.00 109.92 ? 381 LEU A C     1 
ATOM   2825  O  O     . LEU A 1 381 ? 87.666  -40.630 269.104 1.00 108.33 ? 381 LEU A O     1 
ATOM   2826  C  CB    . LEU A 1 381 ? 86.446  -40.523 272.230 1.00 107.09 ? 381 LEU A CB    1 
ATOM   2827  C  CG    . LEU A 1 381 ? 87.178  -41.359 273.282 1.00 100.98 ? 381 LEU A CG    1 
ATOM   2828  C  CD1   . LEU A 1 381 ? 88.675  -41.081 273.270 1.00 88.50  ? 381 LEU A CD1   1 
ATOM   2829  C  CD2   . LEU A 1 381 ? 86.600  -41.101 274.662 1.00 102.71 ? 381 LEU A CD2   1 
ATOM   2830  N  N     . ILE A 1 382 ? 85.785  -39.421 269.434 1.00 116.44 ? 382 ILE A N     1 
ATOM   2831  C  CA    . ILE A 1 382 ? 85.347  -39.567 268.050 1.00 115.05 ? 382 ILE A CA    1 
ATOM   2832  C  C     . ILE A 1 382 ? 86.383  -38.989 267.084 1.00 110.74 ? 382 ILE A C     1 
ATOM   2833  O  O     . ILE A 1 382 ? 86.734  -39.621 266.079 1.00 115.18 ? 382 ILE A O     1 
ATOM   2834  C  CB    . ILE A 1 382 ? 83.985  -38.897 267.811 1.00 113.52 ? 382 ILE A CB    1 
ATOM   2835  C  CG1   . ILE A 1 382 ? 82.935  -39.478 268.761 1.00 121.72 ? 382 ILE A CG1   1 
ATOM   2836  C  CG2   . ILE A 1 382 ? 83.555  -39.081 266.367 1.00 110.33 ? 382 ILE A CG2   1 
ATOM   2837  C  CD1   . ILE A 1 382 ? 81.536  -38.957 268.522 1.00 124.38 ? 382 ILE A CD1   1 
ATOM   2838  N  N     . ALA A 1 383 ? 86.882  -37.795 267.399 1.00 110.83 ? 383 ALA A N     1 
ATOM   2839  C  CA    . ALA A 1 383 ? 87.908  -37.162 266.572 1.00 107.16 ? 383 ALA A CA    1 
ATOM   2840  C  C     . ALA A 1 383 ? 89.163  -38.028 266.453 1.00 100.62 ? 383 ALA A C     1 
ATOM   2841  O  O     . ALA A 1 383 ? 89.631  -38.327 265.349 1.00 96.93  ? 383 ALA A O     1 
ATOM   2842  C  CB    . ALA A 1 383 ? 88.262  -35.791 267.125 1.00 83.19  ? 383 ALA A CB    1 
ATOM   2843  N  N     . LEU A 1 384 ? 89.689  -38.436 267.603 1.00 106.25 ? 384 LEU A N     1 
ATOM   2844  C  CA    . LEU A 1 384 ? 90.910  -39.233 267.675 1.00 109.30 ? 384 LEU A CA    1 
ATOM   2845  C  C     . LEU A 1 384 ? 90.728  -40.625 267.078 1.00 115.19 ? 384 LEU A C     1 
ATOM   2846  O  O     . LEU A 1 384 ? 91.703  -41.338 266.845 1.00 118.58 ? 384 LEU A O     1 
ATOM   2847  C  CB    . LEU A 1 384 ? 91.397  -39.338 269.122 1.00 108.34 ? 384 LEU A CB    1 
ATOM   2848  C  CG    . LEU A 1 384 ? 92.700  -38.609 269.446 1.00 105.27 ? 384 LEU A CG    1 
ATOM   2849  C  CD1   . LEU A 1 384 ? 92.801  -38.348 270.936 1.00 99.98  ? 384 LEU A CD1   1 
ATOM   2850  C  CD2   . LEU A 1 384 ? 93.890  -39.425 268.969 1.00 114.71 ? 384 LEU A CD2   1 
ATOM   2851  N  N     . ASP A 1 385 ? 89.480  -41.016 266.845 1.00 121.01 ? 385 ASP A N     1 
ATOM   2852  C  CA    . ASP A 1 385 ? 89.206  -42.226 266.077 1.00 128.76 ? 385 ASP A CA    1 
ATOM   2853  C  C     . ASP A 1 385 ? 89.268  -41.924 264.583 1.00 124.50 ? 385 ASP A C     1 
ATOM   2854  O  O     . ASP A 1 385 ? 90.003  -42.575 263.837 1.00 120.29 ? 385 ASP A O     1 
ATOM   2855  C  CB    . ASP A 1 385 ? 87.838  -42.806 266.440 1.00 135.68 ? 385 ASP A CB    1 
ATOM   2856  C  CG    . ASP A 1 385 ? 87.821  -43.450 267.812 1.00 137.57 ? 385 ASP A CG    1 
ATOM   2857  O  OD1   . ASP A 1 385 ? 88.874  -43.967 268.240 1.00 136.38 ? 385 ASP A OD1   1 
ATOM   2858  O  OD2   . ASP A 1 385 ? 86.754  -43.440 268.462 1.00 135.32 ? 385 ASP A OD2   1 
ATOM   2859  N  N     . HIS A 1 386 ? 88.502  -40.926 264.154 1.00 121.95 ? 386 HIS A N     1 
ATOM   2860  C  CA    . HIS A 1 386 ? 88.435  -40.576 262.740 1.00 112.18 ? 386 HIS A CA    1 
ATOM   2861  C  C     . HIS A 1 386 ? 89.351  -39.392 262.406 1.00 109.60 ? 386 HIS A C     1 
ATOM   2862  O  O     . HIS A 1 386 ? 88.932  -38.427 261.752 1.00 114.30 ? 386 HIS A O     1 
ATOM   2863  C  CB    . HIS A 1 386 ? 86.989  -40.272 262.345 1.00 116.85 ? 386 HIS A CB    1 
ATOM   2864  C  CG    . HIS A 1 386 ? 86.029  -41.378 262.662 1.00 131.38 ? 386 HIS A CG    1 
ATOM   2865  N  ND1   . HIS A 1 386 ? 84.659  -41.206 262.631 1.00 145.01 ? 386 HIS A ND1   1 
ATOM   2866  C  CD2   . HIS A 1 386 ? 86.234  -42.668 263.014 1.00 138.38 ? 386 HIS A CD2   1 
ATOM   2867  C  CE1   . HIS A 1 386 ? 84.067  -42.341 262.950 1.00 149.29 ? 386 HIS A CE1   1 
ATOM   2868  N  NE2   . HIS A 1 386 ? 85.000  -43.247 263.189 1.00 148.13 ? 386 HIS A NE2   1 
ATOM   2869  N  N     . ILE A 1 387 ? 90.603  -39.483 262.853 1.00 105.54 ? 387 ILE A N     1 
ATOM   2870  C  CA    . ILE A 1 387 ? 91.586  -38.410 262.687 1.00 114.69 ? 387 ILE A CA    1 
ATOM   2871  C  C     . ILE A 1 387 ? 91.830  -38.017 261.233 1.00 117.23 ? 387 ILE A C     1 
ATOM   2872  O  O     . ILE A 1 387 ? 91.929  -36.833 260.919 1.00 124.52 ? 387 ILE A O     1 
ATOM   2873  C  CB    . ILE A 1 387 ? 92.947  -38.770 263.325 1.00 112.23 ? 387 ILE A CB    1 
ATOM   2874  C  CG1   . ILE A 1 387 ? 92.820  -40.006 264.218 1.00 131.88 ? 387 ILE A CG1   1 
ATOM   2875  C  CG2   . ILE A 1 387 ? 93.500  -37.587 264.105 1.00 89.26  ? 387 ILE A CG2   1 
ATOM   2876  C  CD1   . ILE A 1 387 ? 94.124  -40.428 264.868 1.00 137.64 ? 387 ILE A CD1   1 
ATOM   2877  N  N     . ASP A 1 388 ? 91.938  -39.007 260.353 1.00 120.94 ? 388 ASP A N     1 
ATOM   2878  C  CA    . ASP A 1 388 ? 92.180  -38.741 258.939 1.00 127.50 ? 388 ASP A CA    1 
ATOM   2879  C  C     . ASP A 1 388 ? 91.054  -37.909 258.334 1.00 126.72 ? 388 ASP A C     1 
ATOM   2880  O  O     . ASP A 1 388 ? 91.299  -36.869 257.714 1.00 117.69 ? 388 ASP A O     1 
ATOM   2881  C  CB    . ASP A 1 388 ? 92.347  -40.050 258.165 1.00 135.51 ? 388 ASP A CB    1 
ATOM   2882  C  CG    . ASP A 1 388 ? 93.658  -40.748 258.473 1.00 131.70 ? 388 ASP A CG    1 
ATOM   2883  O  OD1   . ASP A 1 388 ? 94.598  -40.074 258.946 1.00 125.11 ? 388 ASP A OD1   1 
ATOM   2884  O  OD2   . ASP A 1 388 ? 93.750  -41.972 258.233 1.00 131.30 ? 388 ASP A OD2   1 
ATOM   2885  N  N     . GLU A 1 389 ? 89.823  -38.374 258.526 1.00 132.08 ? 389 GLU A N     1 
ATOM   2886  C  CA    . GLU A 1 389 ? 88.645  -37.672 258.033 1.00 129.91 ? 389 GLU A CA    1 
ATOM   2887  C  C     . GLU A 1 389 ? 88.569  -36.265 258.615 1.00 128.73 ? 389 GLU A C     1 
ATOM   2888  O  O     . GLU A 1 389 ? 88.306  -35.303 257.895 1.00 131.43 ? 389 GLU A O     1 
ATOM   2889  C  CB    . GLU A 1 389 ? 87.372  -38.453 258.369 1.00 125.66 ? 389 GLU A CB    1 
ATOM   2890  N  N     . VAL A 1 390 ? 88.809  -36.152 259.919 1.00 122.52 ? 390 VAL A N     1 
ATOM   2891  C  CA    . VAL A 1 390 ? 88.794  -34.853 260.589 1.00 115.35 ? 390 VAL A CA    1 
ATOM   2892  C  C     . VAL A 1 390 ? 89.784  -33.864 259.966 1.00 117.90 ? 390 VAL A C     1 
ATOM   2893  O  O     . VAL A 1 390 ? 89.413  -32.757 259.568 1.00 120.92 ? 390 VAL A O     1 
ATOM   2894  C  CB    . VAL A 1 390 ? 89.104  -34.994 262.094 1.00 98.04  ? 390 VAL A CB    1 
ATOM   2895  N  N     . ILE A 1 391 ? 91.042  -34.283 259.889 1.00 114.67 ? 391 ILE A N     1 
ATOM   2896  C  CA    . ILE A 1 391 ? 92.119  -33.470 259.340 1.00 115.28 ? 391 ILE A CA    1 
ATOM   2897  C  C     . ILE A 1 391 ? 91.836  -33.098 257.886 1.00 114.50 ? 391 ILE A C     1 
ATOM   2898  O  O     . ILE A 1 391 ? 92.180  -32.006 257.432 1.00 101.47 ? 391 ILE A O     1 
ATOM   2899  C  CB    . ILE A 1 391 ? 93.472  -34.210 259.456 1.00 113.83 ? 391 ILE A CB    1 
ATOM   2900  C  CG1   . ILE A 1 391 ? 93.872  -34.347 260.925 1.00 105.97 ? 391 ILE A CG1   1 
ATOM   2901  C  CG2   . ILE A 1 391 ? 94.563  -33.492 258.682 1.00 112.82 ? 391 ILE A CG2   1 
ATOM   2902  C  CD1   . ILE A 1 391 ? 95.098  -35.201 261.144 1.00 104.68 ? 391 ILE A CD1   1 
ATOM   2903  N  N     . ARG A 1 392 ? 91.191  -34.010 257.165 1.00 120.51 ? 392 ARG A N     1 
ATOM   2904  C  CA    . ARG A 1 392 ? 90.791  -33.753 255.786 1.00 122.42 ? 392 ARG A CA    1 
ATOM   2905  C  C     . ARG A 1 392 ? 89.741  -32.646 255.710 1.00 124.88 ? 392 ARG A C     1 
ATOM   2906  O  O     . ARG A 1 392 ? 89.860  -31.712 254.910 1.00 127.32 ? 392 ARG A O     1 
ATOM   2907  C  CB    . ARG A 1 392 ? 90.243  -35.032 255.169 1.00 121.01 ? 392 ARG A CB    1 
ATOM   2908  C  CG    . ARG A 1 392 ? 89.758  -34.896 253.743 1.00 117.22 ? 392 ARG A CG    1 
ATOM   2909  C  CD    . ARG A 1 392 ? 89.102  -36.193 253.324 1.00 124.73 ? 392 ARG A CD    1 
ATOM   2910  N  NE    . ARG A 1 392 ? 89.704  -37.318 254.033 1.00 132.83 ? 392 ARG A NE    1 
ATOM   2911  C  CZ    . ARG A 1 392 ? 89.165  -38.529 254.113 1.00 146.22 ? 392 ARG A CZ    1 
ATOM   2912  N  NH1   . ARG A 1 392 ? 89.787  -39.488 254.784 1.00 142.54 ? 392 ARG A NH1   1 
ATOM   2913  N  NH2   . ARG A 1 392 ? 88.001  -38.781 253.525 1.00 153.78 ? 392 ARG A NH2   1 
ATOM   2914  N  N     . ILE A 1 393 ? 88.712  -32.762 256.546 1.00 120.99 ? 393 ILE A N     1 
ATOM   2915  C  CA    . ILE A 1 393 ? 87.650  -31.762 256.610 1.00 117.89 ? 393 ILE A CA    1 
ATOM   2916  C  C     . ILE A 1 393 ? 88.224  -30.395 256.974 1.00 117.59 ? 393 ILE A C     1 
ATOM   2917  O  O     . ILE A 1 393 ? 87.815  -29.371 256.426 1.00 118.99 ? 393 ILE A O     1 
ATOM   2918  C  CB    . ILE A 1 393 ? 86.564  -32.162 257.636 1.00 111.33 ? 393 ILE A CB    1 
ATOM   2919  C  CG1   . ILE A 1 393 ? 85.872  -33.460 257.213 1.00 108.67 ? 393 ILE A CG1   1 
ATOM   2920  C  CG2   . ILE A 1 393 ? 85.529  -31.061 257.789 1.00 113.46 ? 393 ILE A CG2   1 
ATOM   2921  C  CD1   . ILE A 1 393 ? 84.810  -33.934 258.189 1.00 97.41  ? 393 ILE A CD1   1 
ATOM   2922  N  N     . ILE A 1 394 ? 89.187  -30.392 257.891 1.00 111.96 ? 394 ILE A N     1 
ATOM   2923  C  CA    . ILE A 1 394 ? 89.829  -29.159 258.336 1.00 117.90 ? 394 ILE A CA    1 
ATOM   2924  C  C     . ILE A 1 394 ? 90.673  -28.516 257.234 1.00 123.70 ? 394 ILE A C     1 
ATOM   2925  O  O     . ILE A 1 394 ? 90.549  -27.321 256.964 1.00 126.24 ? 394 ILE A O     1 
ATOM   2926  C  CB    . ILE A 1 394 ? 90.718  -29.403 259.574 1.00 108.59 ? 394 ILE A CB    1 
ATOM   2927  N  N     . ARG A 1 395 ? 91.532  -29.315 256.606 1.00 122.44 ? 395 ARG A N     1 
ATOM   2928  C  CA    . ARG A 1 395 ? 92.403  -28.833 255.539 1.00 124.56 ? 395 ARG A CA    1 
ATOM   2929  C  C     . ARG A 1 395 ? 91.600  -28.326 254.347 1.00 121.23 ? 395 ARG A C     1 
ATOM   2930  O  O     . ARG A 1 395 ? 91.978  -27.346 253.707 1.00 113.78 ? 395 ARG A O     1 
ATOM   2931  C  CB    . ARG A 1 395 ? 93.365  -29.929 255.080 1.00 129.05 ? 395 ARG A CB    1 
ATOM   2932  C  CG    . ARG A 1 395 ? 94.561  -30.147 255.993 1.00 129.84 ? 395 ARG A CG    1 
ATOM   2933  C  CD    . ARG A 1 395 ? 95.589  -31.051 255.333 1.00 134.27 ? 395 ARG A CD    1 
ATOM   2934  N  NE    . ARG A 1 395 ? 96.053  -30.509 254.058 1.00 133.93 ? 395 ARG A NE    1 
ATOM   2935  N  N     . ALA A 1 396 ? 90.490  -28.996 254.053 1.00 122.42 ? 396 ALA A N     1 
ATOM   2936  C  CA    . ALA A 1 396 ? 89.644  -28.598 252.933 1.00 118.03 ? 396 ALA A CA    1 
ATOM   2937  C  C     . ALA A 1 396 ? 88.722  -27.434 253.291 1.00 117.82 ? 396 ALA A C     1 
ATOM   2938  O  O     . ALA A 1 396 ? 87.790  -27.119 252.551 1.00 112.36 ? 396 ALA A O     1 
ATOM   2939  C  CB    . ALA A 1 396 ? 88.838  -29.785 252.428 1.00 120.51 ? 396 ALA A CB    1 
ATOM   2940  N  N     . SER A 1 397 ? 88.994  -26.796 254.425 1.00 125.68 ? 397 SER A N     1 
ATOM   2941  C  CA    . SER A 1 397 ? 88.190  -25.673 254.888 1.00 128.35 ? 397 SER A CA    1 
ATOM   2942  C  C     . SER A 1 397 ? 89.003  -24.381 254.935 1.00 135.80 ? 397 SER A C     1 
ATOM   2943  O  O     . SER A 1 397 ? 90.125  -24.360 255.442 1.00 128.40 ? 397 SER A O     1 
ATOM   2944  C  CB    . SER A 1 397 ? 87.603  -25.977 256.268 1.00 116.26 ? 397 SER A CB    1 
ATOM   2945  N  N     . GLU A 1 398 ? 88.432  -23.307 254.399 1.00 146.69 ? 398 GLU A N     1 
ATOM   2946  C  CA    . GLU A 1 398 ? 89.076  -21.998 254.434 1.00 149.51 ? 398 GLU A CA    1 
ATOM   2947  C  C     . GLU A 1 398 ? 88.805  -21.316 255.770 1.00 153.45 ? 398 GLU A C     1 
ATOM   2948  O  O     . GLU A 1 398 ? 89.728  -21.040 256.537 1.00 151.80 ? 398 GLU A O     1 
ATOM   2949  C  CB    . GLU A 1 398 ? 88.579  -21.120 253.283 1.00 147.39 ? 398 GLU A CB    1 
ATOM   2950  N  N     . THR A 1 399 ? 87.532  -21.049 256.042 1.00 155.00 ? 399 THR A N     1 
ATOM   2951  C  CA    . THR A 1 399 ? 87.124  -20.445 257.303 1.00 147.86 ? 399 THR A CA    1 
ATOM   2952  C  C     . THR A 1 399 ? 87.135  -21.502 258.401 1.00 147.36 ? 399 THR A C     1 
ATOM   2953  O  O     . THR A 1 399 ? 87.042  -22.697 258.119 1.00 145.43 ? 399 THR A O     1 
ATOM   2954  C  CB    . THR A 1 399 ? 85.706  -19.846 257.195 1.00 144.18 ? 399 THR A CB    1 
ATOM   2955  O  OG1   . THR A 1 399 ? 85.505  -19.317 255.878 1.00 147.54 ? 399 THR A OG1   1 
ATOM   2956  C  CG2   . THR A 1 399 ? 85.499  -18.741 258.224 1.00 145.33 ? 399 THR A CG2   1 
ATOM   2957  N  N     . ASP A 1 400 ? 87.259  -21.066 259.650 1.00 149.81 ? 400 ASP A N     1 
ATOM   2958  C  CA    . ASP A 1 400 ? 87.155  -21.981 260.779 1.00 142.90 ? 400 ASP A CA    1 
ATOM   2959  C  C     . ASP A 1 400 ? 85.691  -22.294 261.060 1.00 133.41 ? 400 ASP A C     1 
ATOM   2960  O  O     . ASP A 1 400 ? 85.361  -23.354 261.591 1.00 138.50 ? 400 ASP A O     1 
ATOM   2961  C  CB    . ASP A 1 400 ? 87.819  -21.388 262.021 1.00 146.14 ? 400 ASP A CB    1 
ATOM   2962  C  CG    . ASP A 1 400 ? 89.318  -21.604 262.040 1.00 153.34 ? 400 ASP A CG    1 
ATOM   2963  O  OD1   . ASP A 1 400 ? 89.768  -22.703 261.647 1.00 152.71 ? 400 ASP A OD1   1 
ATOM   2964  O  OD2   . ASP A 1 400 ? 90.047  -20.676 262.449 1.00 158.23 ? 400 ASP A OD2   1 
ATOM   2965  N  N     . ALA A 1 401 ? 84.818  -21.361 260.692 1.00 125.87 ? 401 ALA A N     1 
ATOM   2966  C  CA    . ALA A 1 401 ? 83.383  -21.529 260.883 1.00 128.31 ? 401 ALA A CA    1 
ATOM   2967  C  C     . ALA A 1 401 ? 82.846  -22.692 260.057 1.00 138.30 ? 401 ALA A C     1 
ATOM   2968  O  O     . ALA A 1 401 ? 82.045  -23.489 260.544 1.00 139.59 ? 401 ALA A O     1 
ATOM   2969  C  CB    . ALA A 1 401 ? 82.647  -20.245 260.533 1.00 132.04 ? 401 ALA A CB    1 
ATOM   2970  N  N     . GLU A 1 402 ? 83.289  -22.786 258.806 1.00 141.10 ? 402 GLU A N     1 
ATOM   2971  C  CA    . GLU A 1 402 ? 82.851  -23.866 257.930 1.00 139.50 ? 402 GLU A CA    1 
ATOM   2972  C  C     . GLU A 1 402 ? 83.485  -25.195 258.333 1.00 134.89 ? 402 GLU A C     1 
ATOM   2973  O  O     . GLU A 1 402 ? 82.895  -26.256 258.133 1.00 139.54 ? 402 GLU A O     1 
ATOM   2974  C  CB    . GLU A 1 402 ? 83.153  -23.546 256.463 1.00 143.41 ? 402 GLU A CB    1 
ATOM   2975  C  CG    . GLU A 1 402 ? 84.632  -23.455 256.125 1.00 140.09 ? 402 GLU A CG    1 
ATOM   2976  C  CD    . GLU A 1 402 ? 84.883  -23.406 254.633 1.00 142.18 ? 402 GLU A CD    1 
ATOM   2977  O  OE1   . GLU A 1 402 ? 83.905  -23.510 253.865 1.00 146.11 ? 402 GLU A OE1   1 
ATOM   2978  O  OE2   . GLU A 1 402 ? 86.055  -23.264 254.226 1.00 134.08 ? 402 GLU A OE2   1 
ATOM   2979  N  N     . ALA A 1 403 ? 84.685  -25.132 258.904 1.00 125.37 ? 403 ALA A N     1 
ATOM   2980  C  CA    . ALA A 1 403 ? 85.357  -26.328 259.398 1.00 114.27 ? 403 ALA A CA    1 
ATOM   2981  C  C     . ALA A 1 403 ? 84.572  -26.901 260.568 1.00 112.51 ? 403 ALA A C     1 
ATOM   2982  O  O     . ALA A 1 403 ? 84.289  -28.100 260.617 1.00 110.07 ? 403 ALA A O     1 
ATOM   2983  C  CB    . ALA A 1 403 ? 86.778  -26.004 259.821 1.00 102.15 ? 403 ALA A CB    1 
ATOM   2984  N  N     . GLN A 1 404 ? 84.219  -26.026 261.506 1.00 109.94 ? 404 GLN A N     1 
ATOM   2985  C  CA    . GLN A 1 404 ? 83.413  -26.406 262.659 1.00 103.62 ? 404 GLN A CA    1 
ATOM   2986  C  C     . GLN A 1 404 ? 82.053  -26.937 262.218 1.00 107.09 ? 404 GLN A C     1 
ATOM   2987  O  O     . GLN A 1 404 ? 81.597  -27.977 262.693 1.00 114.94 ? 404 GLN A O     1 
ATOM   2988  C  CB    . GLN A 1 404 ? 83.243  -25.210 263.597 1.00 105.89 ? 404 GLN A CB    1 
ATOM   2989  C  CG    . GLN A 1 404 ? 82.280  -25.437 264.749 1.00 116.56 ? 404 GLN A CG    1 
ATOM   2990  C  CD    . GLN A 1 404 ? 82.251  -24.272 265.720 1.00 119.68 ? 404 GLN A CD    1 
ATOM   2991  O  OE1   . GLN A 1 404 ? 83.294  -23.789 266.160 1.00 120.30 ? 404 GLN A OE1   1 
ATOM   2992  N  NE2   . GLN A 1 404 ? 81.052  -23.807 266.052 1.00 121.72 ? 404 GLN A NE2   1 
ATOM   2993  N  N     . ALA A 1 405 ? 81.420  -26.220 261.294 1.00 107.22 ? 405 ALA A N     1 
ATOM   2994  C  CA    . ALA A 1 405 ? 80.108  -26.602 260.783 1.00 115.92 ? 405 ALA A CA    1 
ATOM   2995  C  C     . ALA A 1 405 ? 80.129  -27.980 260.124 1.00 118.09 ? 405 ALA A C     1 
ATOM   2996  O  O     . ALA A 1 405 ? 79.215  -28.780 260.318 1.00 112.31 ? 405 ALA A O     1 
ATOM   2997  C  CB    . ALA A 1 405 ? 79.595  -25.556 259.806 1.00 122.35 ? 405 ALA A CB    1 
ATOM   2998  N  N     . GLU A 1 406 ? 81.174  -28.250 259.347 1.00 122.13 ? 406 GLU A N     1 
ATOM   2999  C  CA    . GLU A 1 406 ? 81.298  -29.532 258.658 1.00 130.33 ? 406 GLU A CA    1 
ATOM   3000  C  C     . GLU A 1 406 ? 81.686  -30.669 259.602 1.00 125.06 ? 406 GLU A C     1 
ATOM   3001  O  O     . GLU A 1 406 ? 81.294  -31.816 259.387 1.00 127.32 ? 406 GLU A O     1 
ATOM   3002  C  CB    . GLU A 1 406 ? 82.285  -29.435 257.492 1.00 134.92 ? 406 GLU A CB    1 
ATOM   3003  C  CG    . GLU A 1 406 ? 81.655  -28.949 256.194 1.00 147.08 ? 406 GLU A CG    1 
ATOM   3004  C  CD    . GLU A 1 406 ? 80.587  -29.896 255.680 1.00 153.71 ? 406 GLU A CD    1 
ATOM   3005  O  OE1   . GLU A 1 406 ? 80.861  -31.112 255.595 1.00 152.61 ? 406 GLU A OE1   1 
ATOM   3006  O  OE2   . GLU A 1 406 ? 79.473  -29.428 255.368 1.00 157.57 ? 406 GLU A OE2   1 
ATOM   3007  N  N     . LEU A 1 407 ? 82.452  -30.352 260.642 1.00 112.81 ? 407 LEU A N     1 
ATOM   3008  C  CA    . LEU A 1 407 ? 82.779  -31.345 261.661 1.00 110.28 ? 407 LEU A CA    1 
ATOM   3009  C  C     . LEU A 1 407 ? 81.513  -31.750 262.410 1.00 116.50 ? 407 LEU A C     1 
ATOM   3010  O  O     . LEU A 1 407 ? 81.251  -32.940 262.617 1.00 122.81 ? 407 LEU A O     1 
ATOM   3011  C  CB    . LEU A 1 407 ? 83.826  -30.804 262.634 1.00 108.96 ? 407 LEU A CB    1 
ATOM   3012  C  CG    . LEU A 1 407 ? 85.277  -30.787 262.148 1.00 113.87 ? 407 LEU A CG    1 
ATOM   3013  C  CD1   . LEU A 1 407 ? 86.182  -30.088 263.153 1.00 112.85 ? 407 LEU A CD1   1 
ATOM   3014  C  CD2   . LEU A 1 407 ? 85.763  -32.201 261.880 1.00 117.17 ? 407 LEU A CD2   1 
ATOM   3015  N  N     . MET A 1 408 ? 80.728  -30.748 262.800 1.00 115.23 ? 408 MET A N     1 
ATOM   3016  C  CA    . MET A 1 408 ? 79.452  -30.976 263.470 1.00 115.55 ? 408 MET A CA    1 
ATOM   3017  C  C     . MET A 1 408 ? 78.493  -31.767 262.590 1.00 128.60 ? 408 MET A C     1 
ATOM   3018  O  O     . MET A 1 408 ? 77.850  -32.710 263.050 1.00 130.07 ? 408 MET A O     1 
ATOM   3019  C  CB    . MET A 1 408 ? 78.806  -29.647 263.858 1.00 114.67 ? 408 MET A CB    1 
ATOM   3020  C  CG    . MET A 1 408 ? 79.545  -28.876 264.935 1.00 111.04 ? 408 MET A CG    1 
ATOM   3021  S  SD    . MET A 1 408 ? 78.779  -27.282 265.281 1.00 116.09 ? 408 MET A SD    1 
ATOM   3022  C  CE    . MET A 1 408 ? 77.128  -27.791 265.751 1.00 87.93  ? 408 MET A CE    1 
ATOM   3023  N  N     . SER A 1 409 ? 78.394  -31.370 261.326 1.00 137.08 ? 409 SER A N     1 
ATOM   3024  C  CA    . SER A 1 409 ? 77.492  -32.025 260.384 1.00 138.77 ? 409 SER A CA    1 
ATOM   3025  C  C     . SER A 1 409 ? 77.888  -33.480 260.152 1.00 129.48 ? 409 SER A C     1 
ATOM   3026  O  O     . SER A 1 409 ? 77.035  -34.368 260.133 1.00 119.08 ? 409 SER A O     1 
ATOM   3027  C  CB    . SER A 1 409 ? 77.464  -31.266 259.055 1.00 138.93 ? 409 SER A CB    1 
ATOM   3028  N  N     . LYS A 1 410 ? 79.186  -33.718 259.986 1.00 126.40 ? 410 LYS A N     1 
ATOM   3029  C  CA    . LYS A 1 410 ? 79.687  -35.060 259.704 1.00 123.51 ? 410 LYS A CA    1 
ATOM   3030  C  C     . LYS A 1 410 ? 79.614  -35.980 260.920 1.00 116.08 ? 410 LYS A C     1 
ATOM   3031  O  O     . LYS A 1 410 ? 78.907  -36.988 260.901 1.00 119.30 ? 410 LYS A O     1 
ATOM   3032  C  CB    . LYS A 1 410 ? 81.123  -35.003 259.177 1.00 117.89 ? 410 LYS A CB    1 
ATOM   3033  N  N     . PHE A 1 411 ? 80.339  -35.631 261.978 1.00 107.14 ? 411 PHE A N     1 
ATOM   3034  C  CA    . PHE A 1 411 ? 80.454  -36.526 263.126 1.00 104.11 ? 411 PHE A CA    1 
ATOM   3035  C  C     . PHE A 1 411 ? 79.310  -36.384 264.128 1.00 108.48 ? 411 PHE A C     1 
ATOM   3036  O  O     . PHE A 1 411 ? 79.363  -36.957 265.219 1.00 118.95 ? 411 PHE A O     1 
ATOM   3037  C  CB    . PHE A 1 411 ? 81.802  -36.335 263.822 1.00 99.61  ? 411 PHE A CB    1 
ATOM   3038  C  CG    . PHE A 1 411 ? 82.985  -36.612 262.939 1.00 101.65 ? 411 PHE A CG    1 
ATOM   3039  C  CD1   . PHE A 1 411 ? 83.855  -35.596 262.582 1.00 104.32 ? 411 PHE A CD1   1 
ATOM   3040  C  CD2   . PHE A 1 411 ? 83.222  -37.889 262.461 1.00 100.04 ? 411 PHE A CD2   1 
ATOM   3041  C  CE1   . PHE A 1 411 ? 84.944  -35.850 261.769 1.00 105.54 ? 411 PHE A CE1   1 
ATOM   3042  C  CE2   . PHE A 1 411 ? 84.307  -38.149 261.648 1.00 108.03 ? 411 PHE A CE2   1 
ATOM   3043  C  CZ    . PHE A 1 411 ? 85.170  -37.130 261.301 1.00 107.61 ? 411 PHE A CZ    1 
ATOM   3044  N  N     . LYS A 1 412 ? 78.282  -35.627 263.749 1.00 110.60 ? 412 LYS A N     1 
ATOM   3045  C  CA    . LYS A 1 412 ? 77.099  -35.425 264.585 1.00 110.38 ? 412 LYS A CA    1 
ATOM   3046  C  C     . LYS A 1 412 ? 77.460  -34.895 265.973 1.00 106.78 ? 412 LYS A C     1 
ATOM   3047  O  O     . LYS A 1 412 ? 77.102  -35.491 266.988 1.00 103.86 ? 412 LYS A O     1 
ATOM   3048  C  CB    . LYS A 1 412 ? 76.290  -36.720 264.700 1.00 101.89 ? 412 LYS A CB    1 
ATOM   3049  N  N     . LEU A 1 413 ? 78.170  -33.773 266.012 1.00 109.52 ? 413 LEU A N     1 
ATOM   3050  C  CA    . LEU A 1 413 ? 78.681  -33.248 267.269 1.00 105.43 ? 413 LEU A CA    1 
ATOM   3051  C  C     . LEU A 1 413 ? 78.091  -31.890 267.618 1.00 116.37 ? 413 LEU A C     1 
ATOM   3052  O  O     . LEU A 1 413 ? 77.403  -31.271 266.808 1.00 115.29 ? 413 LEU A O     1 
ATOM   3053  C  CB    . LEU A 1 413 ? 80.204  -33.146 267.213 1.00 98.93  ? 413 LEU A CB    1 
ATOM   3054  C  CG    . LEU A 1 413 ? 80.924  -34.436 266.826 1.00 102.66 ? 413 LEU A CG    1 
ATOM   3055  C  CD1   . LEU A 1 413 ? 82.397  -34.164 266.635 1.00 95.24  ? 413 LEU A CD1   1 
ATOM   3056  C  CD2   . LEU A 1 413 ? 80.707  -35.512 267.876 1.00 106.59 ? 413 LEU A CD2   1 
ATOM   3057  N  N     . SER A 1 414 ? 78.366  -31.439 268.837 1.00 122.31 ? 414 SER A N     1 
ATOM   3058  C  CA    . SER A 1 414 ? 77.923  -30.128 269.289 1.00 113.04 ? 414 SER A CA    1 
ATOM   3059  C  C     . SER A 1 414 ? 78.924  -29.067 268.859 1.00 108.38 ? 414 SER A C     1 
ATOM   3060  O  O     . SER A 1 414 ? 79.940  -29.377 268.237 1.00 109.33 ? 414 SER A O     1 
ATOM   3061  C  CB    . SER A 1 414 ? 77.761  -30.108 270.809 1.00 109.03 ? 414 SER A CB    1 
ATOM   3062  O  OG    . SER A 1 414 ? 79.007  -30.302 271.458 1.00 103.97 ? 414 SER A OG    1 
ATOM   3063  N  N     . GLU A 1 415 ? 78.633  -27.815 269.193 1.00 108.04 ? 415 GLU A N     1 
ATOM   3064  C  CA    . GLU A 1 415 ? 79.528  -26.710 268.876 1.00 103.73 ? 415 GLU A CA    1 
ATOM   3065  C  C     . GLU A 1 415 ? 80.747  -26.751 269.789 1.00 106.70 ? 415 GLU A C     1 
ATOM   3066  O  O     . GLU A 1 415 ? 81.877  -26.521 269.353 1.00 110.36 ? 415 GLU A O     1 
ATOM   3067  C  CB    . GLU A 1 415 ? 78.798  -25.375 269.023 1.00 98.65  ? 415 GLU A CB    1 
ATOM   3068  N  N     . ARG A 1 416 ? 80.502  -27.055 271.060 1.00 110.25 ? 416 ARG A N     1 
ATOM   3069  C  CA    . ARG A 1 416 ? 81.559  -27.131 272.062 1.00 112.48 ? 416 ARG A CA    1 
ATOM   3070  C  C     . ARG A 1 416 ? 82.553  -28.238 271.724 1.00 114.26 ? 416 ARG A C     1 
ATOM   3071  O  O     . ARG A 1 416 ? 83.768  -28.022 271.740 1.00 114.91 ? 416 ARG A O     1 
ATOM   3072  C  CB    . ARG A 1 416 ? 80.956  -27.368 273.449 1.00 103.46 ? 416 ARG A CB    1 
ATOM   3073  C  CG    . ARG A 1 416 ? 79.879  -26.366 273.838 1.00 99.92  ? 416 ARG A CG    1 
ATOM   3074  N  N     . GLN A 1 417 ? 82.026  -29.420 271.412 1.00 110.39 ? 417 GLN A N     1 
ATOM   3075  C  CA    . GLN A 1 417 ? 82.853  -30.561 271.026 1.00 103.36 ? 417 GLN A CA    1 
ATOM   3076  C  C     . GLN A 1 417 ? 83.711  -30.246 269.809 1.00 102.15 ? 417 GLN A C     1 
ATOM   3077  O  O     . GLN A 1 417 ? 84.910  -30.512 269.803 1.00 98.18  ? 417 GLN A O     1 
ATOM   3078  C  CB    . GLN A 1 417 ? 81.980  -31.784 270.744 1.00 96.32  ? 417 GLN A CB    1 
ATOM   3079  C  CG    . GLN A 1 417 ? 81.711  -32.655 271.960 1.00 93.42  ? 417 GLN A CG    1 
ATOM   3080  C  CD    . GLN A 1 417 ? 80.605  -33.665 271.717 1.00 80.38  ? 417 GLN A CD    1 
ATOM   3081  O  OE1   . GLN A 1 417 ? 79.766  -33.479 270.836 1.00 102.62 ? 417 GLN A OE1   1 
ATOM   3082  N  NE2   . GLN A 1 417 ? 80.598  -34.740 272.499 1.00 113.73 ? 417 GLN A NE2   1 
ATOM   3083  N  N     . SER A 1 418 ? 83.085  -29.681 268.782 1.00 101.93 ? 418 SER A N     1 
ATOM   3084  C  CA    . SER A 1 418 ? 83.781  -29.341 267.547 1.00 96.34  ? 418 SER A CA    1 
ATOM   3085  C  C     . SER A 1 418 ? 84.870  -28.303 267.789 1.00 91.51  ? 418 SER A C     1 
ATOM   3086  O  O     . SER A 1 418 ? 85.949  -28.375 267.198 1.00 101.01 ? 418 SER A O     1 
ATOM   3087  C  CB    . SER A 1 418 ? 82.794  -28.832 266.497 1.00 91.52  ? 418 SER A CB    1 
ATOM   3088  O  OG    . SER A 1 418 ? 82.056  -27.727 266.986 1.00 93.99  ? 418 SER A OG    1 
ATOM   3089  N  N     . GLN A 1 419 ? 84.584  -27.342 268.660 1.00 81.31  ? 419 GLN A N     1 
ATOM   3090  C  CA    . GLN A 1 419 ? 85.564  -26.319 269.002 1.00 91.43  ? 419 GLN A CA    1 
ATOM   3091  C  C     . GLN A 1 419 ? 86.740  -26.955 269.737 1.00 97.09  ? 419 GLN A C     1 
ATOM   3092  O  O     . GLN A 1 419 ? 87.895  -26.574 269.533 1.00 101.34 ? 419 GLN A O     1 
ATOM   3093  C  CB    . GLN A 1 419 ? 84.925  -25.218 269.853 1.00 94.84  ? 419 GLN A CB    1 
ATOM   3094  C  CG    . GLN A 1 419 ? 85.230  -23.805 269.381 1.00 88.43  ? 419 GLN A CG    1 
ATOM   3095  N  N     . ALA A 1 420 ? 86.435  -27.934 270.585 1.00 98.00  ? 420 ALA A N     1 
ATOM   3096  C  CA    . ALA A 1 420 ? 87.462  -28.675 271.310 1.00 93.54  ? 420 ALA A CA    1 
ATOM   3097  C  C     . ALA A 1 420 ? 88.349  -29.458 270.345 1.00 97.95  ? 420 ALA A C     1 
ATOM   3098  O  O     . ALA A 1 420 ? 89.567  -29.517 270.516 1.00 94.65  ? 420 ALA A O     1 
ATOM   3099  C  CB    . ALA A 1 420 ? 86.824  -29.610 272.327 1.00 71.61  ? 420 ALA A CB    1 
ATOM   3100  N  N     . ILE A 1 421 ? 87.731  -30.055 269.329 1.00 104.92 ? 421 ILE A N     1 
ATOM   3101  C  CA    . ILE A 1 421 ? 88.465  -30.798 268.311 1.00 101.89 ? 421 ILE A CA    1 
ATOM   3102  C  C     . ILE A 1 421 ? 89.377  -29.869 267.523 1.00 98.84  ? 421 ILE A C     1 
ATOM   3103  O  O     . ILE A 1 421 ? 90.543  -30.181 267.279 1.00 98.14  ? 421 ILE A O     1 
ATOM   3104  C  CB    . ILE A 1 421 ? 87.514  -31.504 267.332 1.00 93.65  ? 421 ILE A CB    1 
ATOM   3105  C  CG1   . ILE A 1 421 ? 86.686  -32.560 268.063 1.00 96.44  ? 421 ILE A CG1   1 
ATOM   3106  C  CG2   . ILE A 1 421 ? 88.299  -32.154 266.206 1.00 86.62  ? 421 ILE A CG2   1 
ATOM   3107  C  CD1   . ILE A 1 421 ? 85.724  -33.296 267.167 1.00 91.42  ? 421 ILE A CD1   1 
ATOM   3108  N  N     . LEU A 1 422 ? 88.835  -28.723 267.127 1.00 96.02  ? 422 LEU A N     1 
ATOM   3109  C  CA    . LEU A 1 422 ? 89.607  -27.713 266.416 1.00 97.37  ? 422 LEU A CA    1 
ATOM   3110  C  C     . LEU A 1 422 ? 90.737  -27.158 267.278 1.00 102.69 ? 422 LEU A C     1 
ATOM   3111  O  O     . LEU A 1 422 ? 91.746  -26.682 266.759 1.00 106.10 ? 422 LEU A O     1 
ATOM   3112  C  CB    . LEU A 1 422 ? 88.692  -26.579 265.948 1.00 97.43  ? 422 LEU A CB    1 
ATOM   3113  C  CG    . LEU A 1 422 ? 87.885  -26.844 264.676 1.00 93.04  ? 422 LEU A CG    1 
ATOM   3114  C  CD1   . LEU A 1 422 ? 86.774  -25.819 264.526 1.00 86.68  ? 422 LEU A CD1   1 
ATOM   3115  C  CD2   . LEU A 1 422 ? 88.799  -26.823 263.463 1.00 91.62  ? 422 LEU A CD2   1 
ATOM   3116  N  N     . ASP A 1 423 ? 90.568  -27.227 268.595 1.00 104.66 ? 423 ASP A N     1 
ATOM   3117  C  CA    . ASP A 1 423 ? 91.585  -26.727 269.516 1.00 107.83 ? 423 ASP A CA    1 
ATOM   3118  C  C     . ASP A 1 423 ? 92.602  -27.786 269.952 1.00 98.84  ? 423 ASP A C     1 
ATOM   3119  O  O     . ASP A 1 423 ? 93.451  -27.514 270.798 1.00 100.80 ? 423 ASP A O     1 
ATOM   3120  C  CB    . ASP A 1 423 ? 90.934  -26.093 270.748 1.00 118.93 ? 423 ASP A CB    1 
ATOM   3121  C  CG    . ASP A 1 423 ? 90.525  -24.651 270.517 1.00 128.66 ? 423 ASP A CG    1 
ATOM   3122  O  OD1   . ASP A 1 423 ? 91.165  -23.977 269.683 1.00 131.28 ? 423 ASP A OD1   1 
ATOM   3123  O  OD2   . ASP A 1 423 ? 89.568  -24.188 271.173 1.00 132.02 ? 423 ASP A OD2   1 
ATOM   3124  N  N     . MET A 1 424 ? 92.518  -28.983 269.380 1.00 89.13  ? 424 MET A N     1 
ATOM   3125  C  CA    . MET A 1 424 ? 93.429  -30.067 269.745 1.00 88.96  ? 424 MET A CA    1 
ATOM   3126  C  C     . MET A 1 424 ? 94.878  -29.792 269.342 1.00 100.18 ? 424 MET A C     1 
ATOM   3127  O  O     . MET A 1 424 ? 95.156  -29.422 268.203 1.00 113.98 ? 424 MET A O     1 
ATOM   3128  C  CB    . MET A 1 424 ? 92.970  -31.394 269.129 1.00 79.28  ? 424 MET A CB    1 
ATOM   3129  C  CG    . MET A 1 424 ? 91.711  -31.981 269.743 1.00 78.51  ? 424 MET A CG    1 
ATOM   3130  S  SD    . MET A 1 424 ? 91.457  -33.697 269.257 1.00 149.22 ? 424 MET A SD    1 
ATOM   3131  C  CE    . MET A 1 424 ? 92.894  -34.463 270.000 1.00 102.75 ? 424 MET A CE    1 
ATOM   3132  N  N     . ARG A 1 425 ? 95.799  -29.987 270.280 1.00 92.52  ? 425 ARG A N     1 
ATOM   3133  C  CA    . ARG A 1 425 ? 97.222  -29.954 269.971 1.00 95.74  ? 425 ARG A CA    1 
ATOM   3134  C  C     . ARG A 1 425 ? 97.578  -31.197 269.163 1.00 103.49 ? 425 ARG A C     1 
ATOM   3135  O  O     . ARG A 1 425 ? 96.949  -32.242 269.319 1.00 94.89  ? 425 ARG A O     1 
ATOM   3136  C  CB    . ARG A 1 425 ? 98.052  -29.913 271.255 1.00 101.91 ? 425 ARG A CB    1 
ATOM   3137  C  CG    . ARG A 1 425 ? 97.794  -28.703 272.144 1.00 120.91 ? 425 ARG A CG    1 
ATOM   3138  C  CD    . ARG A 1 425 ? 98.323  -27.427 271.514 1.00 131.19 ? 425 ARG A CD    1 
ATOM   3139  N  NE    . ARG A 1 425 ? 98.139  -26.271 272.389 1.00 139.33 ? 425 ARG A NE    1 
ATOM   3140  C  CZ    . ARG A 1 425 ? 98.996  -25.904 273.337 1.00 149.65 ? 425 ARG A CZ    1 
ATOM   3141  N  NH1   . ARG A 1 425 ? 100.103 -26.606 273.541 1.00 150.50 ? 425 ARG A NH1   1 
ATOM   3142  N  NH2   . ARG A 1 425 ? 98.744  -24.837 274.084 1.00 160.61 ? 425 ARG A NH2   1 
ATOM   3143  N  N     . LEU A 1 426 ? 98.583  -31.082 268.300 1.00 108.78 ? 426 LEU A N     1 
ATOM   3144  C  CA    . LEU A 1 426 ? 99.002  -32.205 267.464 1.00 99.66  ? 426 LEU A CA    1 
ATOM   3145  C  C     . LEU A 1 426 ? 99.545  -33.367 268.286 1.00 106.08 ? 426 LEU A C     1 
ATOM   3146  O  O     . LEU A 1 426 ? 99.414  -34.526 267.896 1.00 110.40 ? 426 LEU A O     1 
ATOM   3147  C  CB    . LEU A 1 426 ? 100.045 -31.763 266.435 1.00 87.54  ? 426 LEU A CB    1 
ATOM   3148  C  CG    . LEU A 1 426 ? 99.522  -31.060 265.181 1.00 88.41  ? 426 LEU A CG    1 
ATOM   3149  C  CD1   . LEU A 1 426 ? 100.677 -30.641 264.289 1.00 80.16  ? 426 LEU A CD1   1 
ATOM   3150  C  CD2   . LEU A 1 426 ? 98.562  -31.961 264.422 1.00 93.27  ? 426 LEU A CD2   1 
ATOM   3151  N  N     . ARG A 1 427 ? 100.152 -33.054 269.427 1.00 105.85 ? 427 ARG A N     1 
ATOM   3152  C  CA    . ARG A 1 427 ? 100.748 -34.075 270.287 1.00 103.48 ? 427 ARG A CA    1 
ATOM   3153  C  C     . ARG A 1 427 ? 99.698  -34.989 270.912 1.00 110.13 ? 427 ARG A C     1 
ATOM   3154  O  O     . ARG A 1 427 ? 100.030 -36.018 271.496 1.00 114.63 ? 427 ARG A O     1 
ATOM   3155  C  CB    . ARG A 1 427 ? 101.595 -33.423 271.380 1.00 100.40 ? 427 ARG A CB    1 
ATOM   3156  C  CG    . ARG A 1 427 ? 100.860 -32.362 272.181 1.00 99.89  ? 427 ARG A CG    1 
ATOM   3157  C  CD    . ARG A 1 427 ? 101.710 -31.846 273.335 1.00 100.19 ? 427 ARG A CD    1 
ATOM   3158  N  NE    . ARG A 1 427 ? 102.958 -31.244 272.876 1.00 105.71 ? 427 ARG A NE    1 
ATOM   3159  C  CZ    . ARG A 1 427 ? 104.153 -31.516 273.392 1.00 120.08 ? 427 ARG A CZ    1 
ATOM   3160  N  NH1   . ARG A 1 427 ? 104.269 -32.384 274.388 1.00 126.76 ? 427 ARG A NH1   1 
ATOM   3161  N  NH2   . ARG A 1 427 ? 105.237 -30.920 272.913 1.00 122.82 ? 427 ARG A NH2   1 
ATOM   3162  N  N     . ARG A 1 428 ? 98.432  -34.606 270.788 1.00 108.57 ? 428 ARG A N     1 
ATOM   3163  C  CA    . ARG A 1 428 ? 97.331  -35.409 271.307 1.00 113.41 ? 428 ARG A CA    1 
ATOM   3164  C  C     . ARG A 1 428 ? 96.887  -36.468 270.297 1.00 118.18 ? 428 ARG A C     1 
ATOM   3165  O  O     . ARG A 1 428 ? 95.881  -37.148 270.497 1.00 122.68 ? 428 ARG A O     1 
ATOM   3166  C  CB    . ARG A 1 428 ? 96.154  -34.511 271.691 1.00 115.35 ? 428 ARG A CB    1 
ATOM   3167  C  CG    . ARG A 1 428 ? 96.411  -33.649 272.919 1.00 125.00 ? 428 ARG A CG    1 
ATOM   3168  C  CD    . ARG A 1 428 ? 95.633  -34.153 274.123 1.00 124.86 ? 428 ARG A CD    1 
ATOM   3169  N  NE    . ARG A 1 428 ? 94.433  -33.357 274.363 1.00 124.84 ? 428 ARG A NE    1 
ATOM   3170  C  CZ    . ARG A 1 428 ? 93.506  -33.659 275.266 1.00 128.79 ? 428 ARG A CZ    1 
ATOM   3171  N  NH1   . ARG A 1 428 ? 93.635  -34.746 276.014 1.00 135.52 ? 428 ARG A NH1   1 
ATOM   3172  N  NH2   . ARG A 1 428 ? 92.448  -32.876 275.419 1.00 123.77 ? 428 ARG A NH2   1 
ATOM   3173  N  N     . LEU A 1 429 ? 97.647  -36.603 269.214 1.00 114.04 ? 429 LEU A N     1 
ATOM   3174  C  CA    . LEU A 1 429 ? 97.338  -37.580 268.176 1.00 109.77 ? 429 LEU A CA    1 
ATOM   3175  C  C     . LEU A 1 429 ? 98.281  -38.780 268.239 1.00 114.54 ? 429 LEU A C     1 
ATOM   3176  O  O     . LEU A 1 429 ? 98.332  -39.595 267.316 1.00 114.95 ? 429 LEU A O     1 
ATOM   3177  C  CB    . LEU A 1 429 ? 97.393  -36.927 266.792 1.00 98.59  ? 429 LEU A CB    1 
ATOM   3178  N  N     . THR A 1 430 ? 99.026  -38.886 269.334 1.00 118.79 ? 430 THR A N     1 
ATOM   3179  C  CA    . THR A 1 430 ? 99.926  -40.015 269.536 1.00 125.32 ? 430 THR A CA    1 
ATOM   3180  C  C     . THR A 1 430 ? 99.123  -41.279 269.818 1.00 136.76 ? 430 THR A C     1 
ATOM   3181  O  O     . THR A 1 430 ? 97.912  -41.222 270.031 1.00 135.25 ? 430 THR A O     1 
ATOM   3182  C  CB    . THR A 1 430 ? 100.901 -39.766 270.700 1.00 121.19 ? 430 THR A CB    1 
ATOM   3183  O  OG1   . THR A 1 430 ? 100.162 -39.560 271.910 1.00 124.12 ? 430 THR A OG1   1 
ATOM   3184  C  CG2   . THR A 1 430 ? 101.762 -38.541 270.422 1.00 113.42 ? 430 THR A CG2   1 
ATOM   3185  N  N     . GLY A 1 431 ? 99.803  -42.419 269.818 1.00 142.63 ? 431 GLY A N     1 
ATOM   3186  C  CA    . GLY A 1 431 ? 99.148  -43.692 270.055 1.00 136.61 ? 431 GLY A CA    1 
ATOM   3187  C  C     . GLY A 1 431 ? 98.704  -43.880 271.492 1.00 124.70 ? 431 GLY A C     1 
ATOM   3188  O  O     . GLY A 1 431 ? 97.693  -44.529 271.756 1.00 126.00 ? 431 GLY A O     1 
ATOM   3189  N  N     . LEU A 1 432 ? 99.458  -43.305 272.424 1.00 118.69 ? 432 LEU A N     1 
ATOM   3190  C  CA    . LEU A 1 432 ? 99.202  -43.506 273.848 1.00 119.48 ? 432 LEU A CA    1 
ATOM   3191  C  C     . LEU A 1 432 ? 98.233  -42.479 274.441 1.00 114.51 ? 432 LEU A C     1 
ATOM   3192  O  O     . LEU A 1 432 ? 97.892  -42.551 275.620 1.00 112.16 ? 432 LEU A O     1 
ATOM   3193  C  CB    . LEU A 1 432 ? 100.517 -43.498 274.631 1.00 116.18 ? 432 LEU A CB    1 
ATOM   3194  N  N     . GLU A 1 433 ? 97.786  -41.533 273.621 1.00 137.07 ? 433 GLU A N     1 
ATOM   3195  C  CA    . GLU A 1 433 ? 96.896  -40.475 274.090 1.00 127.25 ? 433 GLU A CA    1 
ATOM   3196  C  C     . GLU A 1 433 ? 95.449  -40.949 274.225 1.00 122.29 ? 433 GLU A C     1 
ATOM   3197  O  O     . GLU A 1 433 ? 94.770  -40.628 275.199 1.00 133.46 ? 433 GLU A O     1 
ATOM   3198  C  CB    . GLU A 1 433 ? 96.971  -39.263 273.158 1.00 129.61 ? 433 GLU A CB    1 
ATOM   3199  C  CG    . GLU A 1 433 ? 96.029  -38.130 273.536 1.00 128.88 ? 433 GLU A CG    1 
ATOM   3200  C  CD    . GLU A 1 433 ? 96.393  -37.482 274.857 1.00 133.53 ? 433 GLU A CD    1 
ATOM   3201  O  OE1   . GLU A 1 433 ? 97.602  -37.366 275.152 1.00 140.02 ? 433 GLU A OE1   1 
ATOM   3202  O  OE2   . GLU A 1 433 ? 95.470  -37.089 275.600 1.00 130.64 ? 433 GLU A OE2   1 
ATOM   3203  N  N     . ARG A 1 434 ? 94.993  -41.714 273.239 1.00 119.58 ? 434 ARG A N     1 
ATOM   3204  C  CA    . ARG A 1 434 ? 93.623  -42.228 273.193 1.00 120.46 ? 434 ARG A CA    1 
ATOM   3205  C  C     . ARG A 1 434 ? 93.203  -42.978 274.465 1.00 127.84 ? 434 ARG A C     1 
ATOM   3206  O  O     . ARG A 1 434 ? 92.151  -42.689 275.053 1.00 122.95 ? 434 ARG A O     1 
ATOM   3207  C  CB    . ARG A 1 434 ? 93.454  -43.127 271.959 1.00 121.22 ? 434 ARG A CB    1 
ATOM   3208  C  CG    . ARG A 1 434 ? 92.334  -44.150 272.048 1.00 125.87 ? 434 ARG A CG    1 
ATOM   3209  C  CD    . ARG A 1 434 ? 90.959  -43.506 272.000 1.00 130.17 ? 434 ARG A CD    1 
ATOM   3210  N  NE    . ARG A 1 434 ? 89.937  -44.393 272.549 1.00 132.17 ? 434 ARG A NE    1 
ATOM   3211  C  CZ    . ARG A 1 434 ? 88.902  -44.866 271.863 1.00 130.75 ? 434 ARG A CZ    1 
ATOM   3212  N  NH1   . ARG A 1 434 ? 88.734  -44.532 270.592 1.00 125.96 ? 434 ARG A NH1   1 
ATOM   3213  N  NH2   . ARG A 1 434 ? 88.029  -45.669 272.454 1.00 131.81 ? 434 ARG A NH2   1 
ATOM   3214  N  N     . ASP A 1 435 ? 94.033  -43.928 274.887 1.00 131.51 ? 435 ASP A N     1 
ATOM   3215  C  CA    . ASP A 1 435 ? 93.736  -44.767 276.046 1.00 127.47 ? 435 ASP A CA    1 
ATOM   3216  C  C     . ASP A 1 435 ? 93.565  -43.948 277.322 1.00 130.17 ? 435 ASP A C     1 
ATOM   3217  O  O     . ASP A 1 435 ? 92.681  -44.229 278.136 1.00 137.46 ? 435 ASP A O     1 
ATOM   3218  C  CB    . ASP A 1 435 ? 94.836  -45.813 276.240 1.00 125.71 ? 435 ASP A CB    1 
ATOM   3219  N  N     . LYS A 1 436 ? 94.418  -42.942 277.490 1.00 123.58 ? 436 LYS A N     1 
ATOM   3220  C  CA    . LYS A 1 436 ? 94.351  -42.050 278.641 1.00 125.22 ? 436 LYS A CA    1 
ATOM   3221  C  C     . LYS A 1 436 ? 92.992  -41.362 278.698 1.00 124.19 ? 436 LYS A C     1 
ATOM   3222  O  O     . LYS A 1 436 ? 92.321  -41.349 279.738 1.00 125.93 ? 436 LYS A O     1 
ATOM   3223  C  CB    . LYS A 1 436 ? 95.467  -41.007 278.557 1.00 125.62 ? 436 LYS A CB    1 
ATOM   3224  C  CG    . LYS A 1 436 ? 95.573  -40.100 279.772 1.00 135.53 ? 436 LYS A CG    1 
ATOM   3225  N  N     . ILE A 1 437 ? 92.591  -40.800 277.564 1.00 101.00 ? 437 ILE A N     1 
ATOM   3226  C  CA    . ILE A 1 437 ? 91.301  -40.138 277.441 1.00 131.14 ? 437 ILE A CA    1 
ATOM   3227  C  C     . ILE A 1 437 ? 90.165  -41.105 277.757 1.00 126.71 ? 437 ILE A C     1 
ATOM   3228  O  O     . ILE A 1 437 ? 89.191  -40.739 278.419 1.00 131.35 ? 437 ILE A O     1 
ATOM   3229  C  CB    . ILE A 1 437 ? 91.112  -39.539 276.032 1.00 138.02 ? 437 ILE A CB    1 
ATOM   3230  C  CG1   . ILE A 1 437 ? 92.222  -38.529 275.736 1.00 100.38 ? 437 ILE A CG1   1 
ATOM   3231  C  CG2   . ILE A 1 437 ? 89.756  -38.876 275.905 1.00 140.45 ? 437 ILE A CG2   1 
ATOM   3232  C  CD1   . ILE A 1 437 ? 91.997  -37.718 274.484 1.00 100.77 ? 437 ILE A CD1   1 
ATOM   3233  N  N     . GLN A 1 438 ? 90.301  -42.345 277.294 1.00 123.77 ? 438 GLN A N     1 
ATOM   3234  C  CA    . GLN A 1 438 ? 89.321  -43.384 277.613 1.00 125.58 ? 438 GLN A CA    1 
ATOM   3235  C  C     . GLN A 1 438 ? 89.189  -43.609 279.119 1.00 130.60 ? 438 GLN A C     1 
ATOM   3236  O  O     . GLN A 1 438 ? 88.080  -43.605 279.664 1.00 134.54 ? 438 GLN A O     1 
ATOM   3237  C  CB    . GLN A 1 438 ? 89.679  -44.700 276.919 1.00 130.35 ? 438 GLN A CB    1 
ATOM   3238  C  CG    . GLN A 1 438 ? 88.928  -44.946 275.622 1.00 131.44 ? 438 GLN A CG    1 
ATOM   3239  C  CD    . GLN A 1 438 ? 87.461  -45.268 275.845 1.00 130.94 ? 438 GLN A CD    1 
ATOM   3240  O  OE1   . GLN A 1 438 ? 86.640  -45.132 274.938 1.00 136.70 ? 438 GLN A OE1   1 
ATOM   3241  N  NE2   . GLN A 1 438 ? 87.127  -45.706 277.053 1.00 125.68 ? 438 GLN A NE2   1 
ATOM   3242  N  N     . SER A 1 439 ? 90.325  -43.803 279.785 1.00 129.89 ? 439 SER A N     1 
ATOM   3243  C  CA    . SER A 1 439 ? 90.344  -44.025 281.228 1.00 135.26 ? 439 SER A CA    1 
ATOM   3244  C  C     . SER A 1 439 ? 89.692  -42.862 281.970 1.00 125.90 ? 439 SER A C     1 
ATOM   3245  O  O     . SER A 1 439 ? 88.819  -43.065 282.828 1.00 132.07 ? 439 SER A O     1 
ATOM   3246  C  CB    . SER A 1 439 ? 91.779  -44.220 281.721 1.00 148.28 ? 439 SER A CB    1 
ATOM   3247  O  OG    . SER A 1 439 ? 92.518  -43.013 281.634 1.00 155.89 ? 439 SER A OG    1 
ATOM   3248  N  N     . GLU A 1 440 ? 90.117  -41.647 281.628 1.00 110.57 ? 440 GLU A N     1 
ATOM   3249  C  CA    . GLU A 1 440 ? 89.550  -40.446 282.228 1.00 100.26 ? 440 GLU A CA    1 
ATOM   3250  C  C     . GLU A 1 440 ? 88.036  -40.406 282.042 1.00 96.18  ? 440 GLU A C     1 
ATOM   3251  O  O     . GLU A 1 440 ? 87.296  -40.084 282.971 1.00 95.17  ? 440 GLU A O     1 
ATOM   3252  C  CB    . GLU A 1 440 ? 90.189  -39.192 281.631 1.00 103.69 ? 440 GLU A CB    1 
ATOM   3253  C  CG    . GLU A 1 440 ? 89.701  -37.895 282.254 1.00 118.61 ? 440 GLU A CG    1 
ATOM   3254  C  CD    . GLU A 1 440 ? 90.322  -36.666 281.622 1.00 140.35 ? 440 GLU A CD    1 
ATOM   3255  O  OE1   . GLU A 1 440 ? 89.950  -35.544 282.023 1.00 144.13 ? 440 GLU A OE1   1 
ATOM   3256  O  OE2   . GLU A 1 440 ? 91.180  -36.819 280.727 1.00 151.54 ? 440 GLU A OE2   1 
ATOM   3257  N  N     . TYR A 1 441 ? 87.585  -40.757 280.841 1.00 91.85  ? 441 TYR A N     1 
ATOM   3258  C  CA    . TYR A 1 441 ? 86.159  -40.787 280.531 1.00 92.79  ? 441 TYR A CA    1 
ATOM   3259  C  C     . TYR A 1 441 ? 85.403  -41.777 281.414 1.00 99.73  ? 441 TYR A C     1 
ATOM   3260  O  O     . TYR A 1 441 ? 84.355  -41.442 281.971 1.00 104.39 ? 441 TYR A O     1 
ATOM   3261  C  CB    . TYR A 1 441 ? 85.935  -41.116 279.053 1.00 96.10  ? 441 TYR A CB    1 
ATOM   3262  C  CG    . TYR A 1 441 ? 84.480  -41.170 278.649 1.00 84.64  ? 441 TYR A CG    1 
ATOM   3263  C  CD1   . TYR A 1 441 ? 83.691  -40.028 278.674 1.00 100.79 ? 441 TYR A CD1   1 
ATOM   3264  C  CD2   . TYR A 1 441 ? 83.901  -42.357 278.226 1.00 113.03 ? 441 TYR A CD2   1 
ATOM   3265  C  CE1   . TYR A 1 441 ? 82.360  -40.071 278.301 1.00 99.07  ? 441 TYR A CE1   1 
ATOM   3266  C  CE2   . TYR A 1 441 ? 82.570  -42.410 277.847 1.00 106.54 ? 441 TYR A CE2   1 
ATOM   3267  C  CZ    . TYR A 1 441 ? 81.806  -41.264 277.886 1.00 99.81  ? 441 TYR A CZ    1 
ATOM   3268  O  OH    . TYR A 1 441 ? 80.482  -41.315 277.513 1.00 104.15 ? 441 TYR A OH    1 
ATOM   3269  N  N     . ASP A 1 442 ? 85.936  -42.990 281.544 1.00 101.89 ? 442 ASP A N     1 
ATOM   3270  C  CA    . ASP A 1 442 ? 85.308  -44.008 282.385 1.00 109.77 ? 442 ASP A CA    1 
ATOM   3271  C  C     . ASP A 1 442 ? 85.207  -43.547 283.840 1.00 118.45 ? 442 ASP A C     1 
ATOM   3272  O  O     . ASP A 1 442 ? 84.138  -43.651 284.475 1.00 123.54 ? 442 ASP A O     1 
ATOM   3273  C  CB    . ASP A 1 442 ? 86.092  -45.318 282.311 1.00 117.13 ? 442 ASP A CB    1 
ATOM   3274  C  CG    . ASP A 1 442 ? 86.186  -45.863 280.902 1.00 115.73 ? 442 ASP A CG    1 
ATOM   3275  O  OD1   . ASP A 1 442 ? 85.238  -45.657 280.115 1.00 119.08 ? 442 ASP A OD1   1 
ATOM   3276  O  OD2   . ASP A 1 442 ? 87.213  -46.499 280.583 1.00 107.34 ? 442 ASP A OD2   1 
ATOM   3277  N  N     . ASP A 1 443 ? 86.323  -43.039 284.362 1.00 115.82 ? 443 ASP A N     1 
ATOM   3278  C  CA    . ASP A 1 443 ? 86.352  -42.503 285.718 1.00 120.80 ? 443 ASP A CA    1 
ATOM   3279  C  C     . ASP A 1 443 ? 85.280  -41.430 285.878 1.00 111.65 ? 443 ASP A C     1 
ATOM   3280  O  O     . ASP A 1 443 ? 84.587  -41.372 286.902 1.00 115.76 ? 443 ASP A O     1 
ATOM   3281  C  CB    . ASP A 1 443 ? 87.729  -41.920 286.046 1.00 131.61 ? 443 ASP A CB    1 
ATOM   3282  C  CG    . ASP A 1 443 ? 88.841  -42.945 285.925 1.00 137.36 ? 443 ASP A CG    1 
ATOM   3283  O  OD1   . ASP A 1 443 ? 88.530  -44.151 285.847 1.00 141.77 ? 443 ASP A OD1   1 
ATOM   3284  O  OD2   . ASP A 1 443 ? 90.025  -42.545 285.913 1.00 136.65 ? 443 ASP A OD2   1 
ATOM   3285  N  N     . LEU A 1 444 ? 85.141  -40.593 284.853 1.00 94.96  ? 444 LEU A N     1 
ATOM   3286  C  CA    . LEU A 1 444 ? 84.110  -39.565 284.840 1.00 90.45  ? 444 LEU A CA    1 
ATOM   3287  C  C     . LEU A 1 444 ? 82.713  -40.167 284.905 1.00 94.02  ? 444 LEU A C     1 
ATOM   3288  O  O     . LEU A 1 444 ? 81.843  -39.634 285.584 1.00 96.34  ? 444 LEU A O     1 
ATOM   3289  C  CB    . LEU A 1 444 ? 84.250  -38.663 283.612 1.00 89.40  ? 444 LEU A CB    1 
ATOM   3290  C  CG    . LEU A 1 444 ? 85.364  -37.617 283.687 1.00 87.27  ? 444 LEU A CG    1 
ATOM   3291  C  CD1   . LEU A 1 444 ? 85.463  -36.850 282.382 1.00 87.15  ? 444 LEU A CD1   1 
ATOM   3292  C  CD2   . LEU A 1 444 ? 85.129  -36.669 284.853 1.00 93.00  ? 444 LEU A CD2   1 
ATOM   3293  N  N     . LEU A 1 445 ? 82.497  -41.275 284.204 1.00 99.48  ? 445 LEU A N     1 
ATOM   3294  C  CA    . LEU A 1 445 ? 81.206  -41.960 284.267 1.00 102.53 ? 445 LEU A CA    1 
ATOM   3295  C  C     . LEU A 1 445 ? 80.907  -42.427 285.686 1.00 93.52  ? 445 LEU A C     1 
ATOM   3296  O  O     . LEU A 1 445 ? 79.810  -42.188 286.213 1.00 88.09  ? 445 LEU A O     1 
ATOM   3297  C  CB    . LEU A 1 445 ? 81.150  -43.147 283.303 1.00 107.71 ? 445 LEU A CB    1 
ATOM   3298  C  CG    . LEU A 1 445 ? 80.472  -42.878 281.959 1.00 100.99 ? 445 LEU A CG    1 
ATOM   3299  C  CD1   . LEU A 1 445 ? 79.066  -42.337 282.167 1.00 108.58 ? 445 LEU A CD1   1 
ATOM   3300  C  CD2   . LEU A 1 445 ? 81.298  -41.914 281.143 1.00 95.94  ? 445 LEU A CD2   1 
ATOM   3301  N  N     . ALA A 1 446 ? 81.889  -43.083 286.304 1.00 91.83  ? 446 ALA A N     1 
ATOM   3302  C  CA    . ALA A 1 446 ? 81.745  -43.514 287.698 1.00 94.69  ? 446 ALA A CA    1 
ATOM   3303  C  C     . ALA A 1 446 ? 81.371  -42.337 288.603 1.00 93.16  ? 446 ALA A C     1 
ATOM   3304  O  O     . ALA A 1 446 ? 80.370  -42.388 289.337 1.00 100.28 ? 446 ALA A O     1 
ATOM   3305  C  CB    . ALA A 1 446 ? 83.026  -44.175 288.189 1.00 87.17  ? 446 ALA A CB    1 
ATOM   3306  N  N     . LEU A 1 447 ? 82.169  -41.273 288.527 1.00 86.92  ? 447 LEU A N     1 
ATOM   3307  C  CA    . LEU A 1 447 ? 81.943  -40.077 289.336 1.00 83.45  ? 447 LEU A CA    1 
ATOM   3308  C  C     . LEU A 1 447 ? 80.546  -39.491 289.147 1.00 85.01  ? 447 LEU A C     1 
ATOM   3309  O  O     . LEU A 1 447 ? 79.866  -39.177 290.120 1.00 89.38  ? 447 LEU A O     1 
ATOM   3310  C  CB    . LEU A 1 447 ? 83.008  -39.017 289.047 1.00 85.67  ? 447 LEU A CB    1 
ATOM   3311  C  CG    . LEU A 1 447 ? 82.875  -37.693 289.804 1.00 87.04  ? 447 LEU A CG    1 
ATOM   3312  C  CD1   . LEU A 1 447 ? 82.807  -37.933 291.305 1.00 89.10  ? 447 LEU A CD1   1 
ATOM   3313  C  CD2   . LEU A 1 447 ? 84.030  -36.764 289.465 1.00 101.29 ? 447 LEU A CD2   1 
ATOM   3314  N  N     . ILE A 1 448 ? 80.122  -39.351 287.895 1.00 78.61  ? 448 ILE A N     1 
ATOM   3315  C  CA    . ILE A 1 448 ? 78.802  -38.811 287.586 1.00 89.02  ? 448 ILE A CA    1 
ATOM   3316  C  C     . ILE A 1 448 ? 77.703  -39.686 288.177 1.00 92.26  ? 448 ILE A C     1 
ATOM   3317  O  O     . ILE A 1 448 ? 76.732  -39.175 288.738 1.00 92.46  ? 448 ILE A O     1 
ATOM   3318  C  CB    . ILE A 1 448 ? 78.587  -38.659 286.065 1.00 86.54  ? 448 ILE A CB    1 
ATOM   3319  C  CG1   . ILE A 1 448 ? 79.522  -37.585 285.503 1.00 84.29  ? 448 ILE A CG1   1 
ATOM   3320  C  CG2   . ILE A 1 448 ? 77.133  -38.314 285.760 1.00 79.76  ? 448 ILE A CG2   1 
ATOM   3321  C  CD1   . ILE A 1 448 ? 79.676  -37.635 283.998 1.00 84.38  ? 448 ILE A CD1   1 
ATOM   3322  N  N     . ALA A 1 449 ? 77.863  -41.003 288.064 1.00 98.04  ? 449 ALA A N     1 
ATOM   3323  C  CA    . ALA A 1 449 ? 76.910  -41.927 288.677 1.00 99.02  ? 449 ALA A CA    1 
ATOM   3324  C  C     . ALA A 1 449 ? 76.810  -41.670 290.181 1.00 101.02 ? 449 ALA A C     1 
ATOM   3325  O  O     . ALA A 1 449 ? 75.706  -41.514 290.733 1.00 102.64 ? 449 ALA A O     1 
ATOM   3326  C  CB    . ALA A 1 449 ? 77.315  -43.365 288.407 1.00 108.80 ? 449 ALA A CB    1 
ATOM   3327  N  N     . ASP A 1 450 ? 77.971  -41.609 290.833 1.00 99.70  ? 450 ASP A N     1 
ATOM   3328  C  CA    . ASP A 1 450 ? 78.024  -41.360 292.271 1.00 94.25  ? 450 ASP A CA    1 
ATOM   3329  C  C     . ASP A 1 450 ? 77.314  -40.063 292.667 1.00 95.42  ? 450 ASP A C     1 
ATOM   3330  O  O     . ASP A 1 450 ? 76.444  -40.064 293.536 1.00 95.07  ? 450 ASP A O     1 
ATOM   3331  C  CB    . ASP A 1 450 ? 79.470  -41.332 292.771 1.00 98.25  ? 450 ASP A CB    1 
ATOM   3332  C  CG    . ASP A 1 450 ? 79.559  -41.277 294.287 1.00 102.54 ? 450 ASP A CG    1 
ATOM   3333  O  OD1   . ASP A 1 450 ? 78.791  -42.005 294.951 1.00 92.74  ? 450 ASP A OD1   1 
ATOM   3334  O  OD2   . ASP A 1 450 ? 80.392  -40.511 294.817 1.00 109.11 ? 450 ASP A OD2   1 
ATOM   3335  N  N     . LEU A 1 451 ? 77.699  -38.961 292.030 1.00 105.41 ? 451 LEU A N     1 
ATOM   3336  C  CA    . LEU A 1 451 ? 77.139  -37.646 292.341 1.00 101.10 ? 451 LEU A CA    1 
ATOM   3337  C  C     . LEU A 1 451 ? 75.635  -37.597 292.097 1.00 100.94 ? 451 LEU A C     1 
ATOM   3338  O  O     . LEU A 1 451 ? 74.890  -37.006 292.881 1.00 98.84  ? 451 LEU A O     1 
ATOM   3339  C  CB    . LEU A 1 451 ? 77.846  -36.556 291.531 1.00 91.76  ? 451 LEU A CB    1 
ATOM   3340  C  CG    . LEU A 1 451 ? 79.358  -36.451 291.747 1.00 98.16  ? 451 LEU A CG    1 
ATOM   3341  C  CD1   . LEU A 1 451 ? 79.966  -35.429 290.805 1.00 84.13  ? 451 LEU A CD1   1 
ATOM   3342  C  CD2   . LEU A 1 451 ? 79.669  -36.097 293.190 1.00 111.11 ? 451 LEU A CD2   1 
ATOM   3343  N  N     . ALA A 1 452 ? 75.195  -38.219 291.007 1.00 99.98  ? 452 ALA A N     1 
ATOM   3344  C  CA    . ALA A 1 452 ? 73.772  -38.317 290.710 1.00 96.00  ? 452 ALA A CA    1 
ATOM   3345  C  C     . ALA A 1 452 ? 73.048  -39.048 291.836 1.00 102.53 ? 452 ALA A C     1 
ATOM   3346  O  O     . ALA A 1 452 ? 71.973  -38.626 292.273 1.00 106.27 ? 452 ALA A O     1 
ATOM   3347  C  CB    . ALA A 1 452 ? 73.553  -39.028 289.388 1.00 95.85  ? 452 ALA A CB    1 
ATOM   3348  N  N     . ASP A 1 453 ? 73.648  -40.138 292.310 1.00 104.30 ? 453 ASP A N     1 
ATOM   3349  C  CA    . ASP A 1 453 ? 73.081  -40.873 293.437 1.00 99.66  ? 453 ASP A CA    1 
ATOM   3350  C  C     . ASP A 1 453 ? 72.985  -39.988 294.680 1.00 100.72 ? 453 ASP A C     1 
ATOM   3351  O  O     . ASP A 1 453 ? 71.972  -39.999 295.381 1.00 99.99  ? 453 ASP A O     1 
ATOM   3352  C  CB    . ASP A 1 453 ? 73.902  -42.125 293.750 1.00 96.54  ? 453 ASP A CB    1 
ATOM   3353  C  CG    . ASP A 1 453 ? 73.225  -43.024 294.768 1.00 103.90 ? 453 ASP A CG    1 
ATOM   3354  O  OD1   . ASP A 1 453 ? 71.988  -43.172 294.695 1.00 101.71 ? 453 ASP A OD1   1 
ATOM   3355  O  OD2   . ASP A 1 453 ? 73.925  -43.579 295.641 1.00 111.22 ? 453 ASP A OD2   1 
ATOM   3356  N  N     . ILE A 1 454 ? 74.045  -39.229 294.948 1.00 101.51 ? 454 ILE A N     1 
ATOM   3357  C  CA    . ILE A 1 454 ? 74.083  -38.332 296.101 1.00 96.07  ? 454 ILE A CA    1 
ATOM   3358  C  C     . ILE A 1 454 ? 72.975  -37.282 296.024 1.00 101.68 ? 454 ILE A C     1 
ATOM   3359  O  O     . ILE A 1 454 ? 72.332  -36.971 297.025 1.00 110.27 ? 454 ILE A O     1 
ATOM   3360  C  CB    . ILE A 1 454 ? 75.455  -37.632 296.231 1.00 92.41  ? 454 ILE A CB    1 
ATOM   3361  C  CG1   . ILE A 1 454 ? 76.564  -38.665 296.435 1.00 92.01  ? 454 ILE A CG1   1 
ATOM   3362  C  CG2   . ILE A 1 454 ? 75.449  -36.633 297.383 1.00 87.98  ? 454 ILE A CG2   1 
ATOM   3363  C  CD1   . ILE A 1 454 ? 77.950  -38.062 296.539 1.00 105.07 ? 454 ILE A CD1   1 
ATOM   3364  N  N     . LEU A 1 455 ? 72.749  -36.745 294.830 1.00 99.55  ? 455 LEU A N     1 
ATOM   3365  C  CA    . LEU A 1 455 ? 71.703  -35.748 294.633 1.00 96.17  ? 455 LEU A CA    1 
ATOM   3366  C  C     . LEU A 1 455 ? 70.313  -36.374 294.699 1.00 97.64  ? 455 LEU A C     1 
ATOM   3367  O  O     . LEU A 1 455 ? 69.332  -35.699 295.010 1.00 93.10  ? 455 LEU A O     1 
ATOM   3368  C  CB    . LEU A 1 455 ? 71.899  -35.019 293.300 1.00 93.93  ? 455 LEU A CB    1 
ATOM   3369  C  CG    . LEU A 1 455 ? 73.107  -34.086 293.239 1.00 94.42  ? 455 LEU A CG    1 
ATOM   3370  C  CD1   . LEU A 1 455 ? 73.233  -33.437 291.871 1.00 105.65 ? 455 LEU A CD1   1 
ATOM   3371  C  CD2   . LEU A 1 455 ? 72.990  -33.029 294.320 1.00 94.09  ? 455 LEU A CD2   1 
ATOM   3372  N  N     . ALA A 1 456 ? 70.233  -37.668 294.406 1.00 97.33  ? 456 ALA A N     1 
ATOM   3373  C  CA    . ALA A 1 456 ? 68.959  -38.377 294.469 1.00 106.03 ? 456 ALA A CA    1 
ATOM   3374  C  C     . ALA A 1 456 ? 68.576  -38.737 295.904 1.00 117.43 ? 456 ALA A C     1 
ATOM   3375  O  O     . ALA A 1 456 ? 67.395  -38.879 296.221 1.00 122.25 ? 456 ALA A O     1 
ATOM   3376  C  CB    . ALA A 1 456 ? 69.001  -39.626 293.600 1.00 107.64 ? 456 ALA A CB    1 
ATOM   3377  N  N     . LYS A 1 457 ? 69.577  -38.878 296.769 1.00 117.77 ? 457 LYS A N     1 
ATOM   3378  C  CA    . LYS A 1 457 ? 69.336  -39.300 298.146 1.00 111.12 ? 457 LYS A CA    1 
ATOM   3379  C  C     . LYS A 1 457 ? 69.819  -38.282 299.176 1.00 119.41 ? 457 LYS A C     1 
ATOM   3380  O  O     . LYS A 1 457 ? 71.008  -37.976 299.238 1.00 130.84 ? 457 LYS A O     1 
ATOM   3381  C  CB    . LYS A 1 457 ? 69.997  -40.655 298.412 1.00 95.06  ? 457 LYS A CB    1 
ATOM   3382  C  CG    . LYS A 1 457 ? 69.651  -41.727 297.397 1.00 90.05  ? 457 LYS A CG    1 
ATOM   3383  C  CD    . LYS A 1 457 ? 70.107  -43.099 297.868 1.00 102.84 ? 457 LYS A CD    1 
ATOM   3384  C  CE    . LYS A 1 457 ? 69.847  -44.159 296.811 1.00 112.79 ? 457 LYS A CE    1 
ATOM   3385  N  NZ    . LYS A 1 457 ? 68.449  -44.106 296.301 1.00 118.41 ? 457 LYS A NZ    1 
ATOM   3386  N  N     . PRO A 1 458 ? 68.890  -37.763 299.996 1.00 114.45 ? 458 PRO A N     1 
ATOM   3387  C  CA    . PRO A 1 458 ? 69.209  -36.827 301.082 1.00 108.62 ? 458 PRO A CA    1 
ATOM   3388  C  C     . PRO A 1 458 ? 70.064  -37.489 302.161 1.00 100.39 ? 458 PRO A C     1 
ATOM   3389  O  O     . PRO A 1 458 ? 70.909  -36.832 302.786 1.00 97.11  ? 458 PRO A O     1 
ATOM   3390  C  CB    . PRO A 1 458 ? 67.831  -36.477 301.658 1.00 106.66 ? 458 PRO A CB    1 
ATOM   3391  C  CG    . PRO A 1 458 ? 66.853  -36.818 300.572 1.00 111.19 ? 458 PRO A CG    1 
ATOM   3392  C  CD    . PRO A 1 458 ? 67.443  -38.009 299.890 1.00 112.00 ? 458 PRO A CD    1 
ATOM   3393  N  N     . GLU A 1 459 ? 69.834  -38.783 302.371 1.00 92.20  ? 459 GLU A N     1 
ATOM   3394  C  CA    . GLU A 1 459 ? 70.554  -39.554 303.378 1.00 91.66  ? 459 GLU A CA    1 
ATOM   3395  C  C     . GLU A 1 459 ? 72.061  -39.494 303.158 1.00 100.54 ? 459 GLU A C     1 
ATOM   3396  O  O     . GLU A 1 459 ? 72.835  -39.392 304.112 1.00 111.43 ? 459 GLU A O     1 
ATOM   3397  C  CB    . GLU A 1 459 ? 70.080  -41.009 303.371 1.00 87.88  ? 459 GLU A CB    1 
ATOM   3398  N  N     . ARG A 1 460 ? 72.472  -39.551 301.896 1.00 100.04 ? 460 ARG A N     1 
ATOM   3399  C  CA    . ARG A 1 460 ? 73.890  -39.486 301.560 1.00 101.02 ? 460 ARG A CA    1 
ATOM   3400  C  C     . ARG A 1 460 ? 74.465  -38.092 301.810 1.00 99.13  ? 460 ARG A C     1 
ATOM   3401  O  O     . ARG A 1 460 ? 75.626  -37.959 302.193 1.00 108.50 ? 460 ARG A O     1 
ATOM   3402  C  CB    . ARG A 1 460 ? 74.135  -39.921 300.113 1.00 99.84  ? 460 ARG A CB    1 
ATOM   3403  C  CG    . ARG A 1 460 ? 73.839  -41.392 299.842 1.00 95.23  ? 460 ARG A CG    1 
ATOM   3404  C  CD    . ARG A 1 460 ? 74.459  -41.837 298.527 1.00 104.43 ? 460 ARG A CD    1 
ATOM   3405  N  NE    . ARG A 1 460 ? 75.919  -41.791 298.567 1.00 109.61 ? 460 ARG A NE    1 
ATOM   3406  C  CZ    . ARG A 1 460 ? 76.704  -41.941 297.505 1.00 106.71 ? 460 ARG A CZ    1 
ATOM   3407  N  NH1   . ARG A 1 460 ? 76.171  -42.140 296.308 1.00 105.63 ? 460 ARG A NH1   1 
ATOM   3408  N  NH2   . ARG A 1 460 ? 78.022  -41.883 297.638 1.00 111.79 ? 460 ARG A NH2   1 
ATOM   3409  N  N     . VAL A 1 461 ? 73.654  -37.059 301.595 1.00 95.91  ? 461 VAL A N     1 
ATOM   3410  C  CA    . VAL A 1 461 ? 74.069  -35.690 301.897 1.00 99.23  ? 461 VAL A CA    1 
ATOM   3411  C  C     . VAL A 1 461 ? 74.318  -35.546 303.397 1.00 101.42 ? 461 VAL A C     1 
ATOM   3412  O  O     . VAL A 1 461 ? 75.389  -35.089 303.826 1.00 92.59  ? 461 VAL A O     1 
ATOM   3413  C  CB    . VAL A 1 461 ? 73.010  -34.661 301.455 1.00 94.02  ? 461 VAL A CB    1 
ATOM   3414  C  CG1   . VAL A 1 461 ? 73.406  -33.265 301.907 1.00 96.48  ? 461 VAL A CG1   1 
ATOM   3415  C  CG2   . VAL A 1 461 ? 72.831  -34.702 299.946 1.00 96.64  ? 461 VAL A CG2   1 
ATOM   3416  N  N     . SER A 1 462 ? 73.320  -35.947 304.183 1.00 107.05 ? 462 SER A N     1 
ATOM   3417  C  CA    . SER A 1 462 ? 73.425  -35.943 305.640 1.00 112.22 ? 462 SER A CA    1 
ATOM   3418  C  C     . SER A 1 462 ? 74.666  -36.695 306.117 1.00 112.66 ? 462 SER A C     1 
ATOM   3419  O  O     . SER A 1 462 ? 75.429  -36.205 306.960 1.00 113.85 ? 462 SER A O     1 
ATOM   3420  C  CB    . SER A 1 462 ? 72.171  -36.569 306.251 1.00 119.21 ? 462 SER A CB    1 
ATOM   3421  O  OG    . SER A 1 462 ? 72.431  -37.101 307.538 1.00 130.61 ? 462 SER A OG    1 
ATOM   3422  N  N     . GLN A 1 463 ? 74.859  -37.887 305.562 1.00 107.46 ? 463 GLN A N     1 
ATOM   3423  C  CA    . GLN A 1 463 ? 75.988  -38.734 305.917 1.00 104.21 ? 463 GLN A CA    1 
ATOM   3424  C  C     . GLN A 1 463 ? 77.321  -38.060 305.600 1.00 104.56 ? 463 GLN A C     1 
ATOM   3425  O  O     . GLN A 1 463 ? 78.246  -38.094 306.411 1.00 108.16 ? 463 GLN A O     1 
ATOM   3426  C  CB    . GLN A 1 463 ? 75.884  -40.080 305.199 1.00 102.74 ? 463 GLN A CB    1 
ATOM   3427  C  CG    . GLN A 1 463 ? 77.041  -41.026 305.469 1.00 111.83 ? 463 GLN A CG    1 
ATOM   3428  C  CD    . GLN A 1 463 ? 77.162  -41.410 306.932 1.00 119.74 ? 463 GLN A CD    1 
ATOM   3429  O  OE1   . GLN A 1 463 ? 76.171  -41.451 307.662 1.00 121.80 ? 463 GLN A OE1   1 
ATOM   3430  N  NE2   . GLN A 1 463 ? 78.384  -41.691 307.367 1.00 122.98 ? 463 GLN A NE2   1 
ATOM   3431  N  N     . ILE A 1 464 ? 77.410  -37.450 304.420 1.00 94.48  ? 464 ILE A N     1 
ATOM   3432  C  CA    . ILE A 1 464 ? 78.611  -36.722 304.012 1.00 93.96  ? 464 ILE A CA    1 
ATOM   3433  C  C     . ILE A 1 464 ? 78.914  -35.594 304.991 1.00 97.49  ? 464 ILE A C     1 
ATOM   3434  O  O     . ILE A 1 464 ? 80.065  -35.413 305.413 1.00 100.25 ? 464 ILE A O     1 
ATOM   3435  C  CB    . ILE A 1 464 ? 78.478  -36.146 302.584 1.00 80.23  ? 464 ILE A CB    1 
ATOM   3436  C  CG1   . ILE A 1 464 ? 78.563  -37.266 301.549 1.00 98.29  ? 464 ILE A CG1   1 
ATOM   3437  C  CG2   . ILE A 1 464 ? 79.573  -35.127 302.311 1.00 80.83  ? 464 ILE A CG2   1 
ATOM   3438  C  CD1   . ILE A 1 464 ? 78.187  -36.839 300.145 1.00 99.73  ? 464 ILE A CD1   1 
ATOM   3439  N  N     . ILE A 1 465 ? 77.876  -34.845 305.355 1.00 98.86  ? 465 ILE A N     1 
ATOM   3440  C  CA    . ILE A 1 465 ? 78.024  -33.782 306.345 1.00 106.94 ? 465 ILE A CA    1 
ATOM   3441  C  C     . ILE A 1 465 ? 78.583  -34.332 307.656 1.00 103.85 ? 465 ILE A C     1 
ATOM   3442  O  O     . ILE A 1 465 ? 79.542  -33.785 308.213 1.00 96.80  ? 465 ILE A O     1 
ATOM   3443  C  CB    . ILE A 1 465 ? 76.686  -33.075 306.625 1.00 104.51 ? 465 ILE A CB    1 
ATOM   3444  C  CG1   . ILE A 1 465 ? 76.180  -32.369 305.367 1.00 97.89  ? 465 ILE A CG1   1 
ATOM   3445  C  CG2   . ILE A 1 465 ? 76.842  -32.077 307.760 1.00 102.87 ? 465 ILE A CG2   1 
ATOM   3446  C  CD1   . ILE A 1 465 ? 74.906  -31.584 305.581 1.00 97.41  ? 465 ILE A CD1   1 
ATOM   3447  N  N     . LYS A 1 466 ? 77.987  -35.421 308.136 1.00 100.09 ? 466 LYS A N     1 
ATOM   3448  C  CA    . LYS A 1 466 ? 78.447  -36.051 309.371 1.00 98.94  ? 466 LYS A CA    1 
ATOM   3449  C  C     . LYS A 1 466 ? 79.917  -36.461 309.306 1.00 98.17  ? 466 LYS A C     1 
ATOM   3450  O  O     . LYS A 1 466 ? 80.694  -36.156 310.211 1.00 88.77  ? 466 LYS A O     1 
ATOM   3451  C  CB    . LYS A 1 466 ? 77.583  -37.261 309.724 1.00 100.66 ? 466 LYS A CB    1 
ATOM   3452  C  CG    . LYS A 1 466 ? 76.242  -36.903 310.340 1.00 100.03 ? 466 LYS A CG    1 
ATOM   3453  C  CD    . LYS A 1 466 ? 75.485  -38.152 310.759 1.00 97.44  ? 466 LYS A CD    1 
ATOM   3454  N  N     . ASP A 1 467 ? 80.293  -37.146 308.229 1.00 101.03 ? 467 ASP A N     1 
ATOM   3455  C  CA    . ASP A 1 467 ? 81.658  -37.638 308.066 1.00 100.25 ? 467 ASP A CA    1 
ATOM   3456  C  C     . ASP A 1 467 ? 82.675  -36.501 307.996 1.00 98.54  ? 467 ASP A C     1 
ATOM   3457  O  O     . ASP A 1 467 ? 83.708  -36.540 308.667 1.00 103.31 ? 467 ASP A O     1 
ATOM   3458  C  CB    . ASP A 1 467 ? 81.769  -38.540 306.834 1.00 109.37 ? 467 ASP A CB    1 
ATOM   3459  C  CG    . ASP A 1 467 ? 80.933  -39.800 306.958 1.00 122.31 ? 467 ASP A CG    1 
ATOM   3460  O  OD1   . ASP A 1 467 ? 80.515  -40.121 308.089 1.00 131.21 ? 467 ASP A OD1   1 
ATOM   3461  O  OD2   . ASP A 1 467 ? 80.698  -40.471 305.929 1.00 122.99 ? 467 ASP A OD2   1 
ATOM   3462  N  N     . GLU A 1 468 ? 82.381  -35.486 307.190 1.00 97.32  ? 468 GLU A N     1 
ATOM   3463  C  CA    . GLU A 1 468 ? 83.298  -34.358 307.052 1.00 103.31 ? 468 GLU A CA    1 
ATOM   3464  C  C     . GLU A 1 468 ? 83.422  -33.557 308.350 1.00 107.17 ? 468 GLU A C     1 
ATOM   3465  O  O     . GLU A 1 468 ? 84.511  -33.079 308.693 1.00 110.78 ? 468 GLU A O     1 
ATOM   3466  C  CB    . GLU A 1 468 ? 82.890  -33.467 305.878 1.00 109.62 ? 468 GLU A CB    1 
ATOM   3467  C  CG    . GLU A 1 468 ? 82.926  -34.190 304.541 1.00 118.68 ? 468 GLU A CG    1 
ATOM   3468  C  CD    . GLU A 1 468 ? 82.744  -33.261 303.360 1.00 121.07 ? 468 GLU A CD    1 
ATOM   3469  O  OE1   . GLU A 1 468 ? 82.619  -32.038 303.573 1.00 117.84 ? 468 GLU A OE1   1 
ATOM   3470  O  OE2   . GLU A 1 468 ? 82.730  -33.758 302.214 1.00 123.15 ? 468 GLU A OE2   1 
ATOM   3471  N  N     . LEU A 1 469 ? 82.308  -33.421 309.067 1.00 106.44 ? 469 LEU A N     1 
ATOM   3472  C  CA    . LEU A 1 469 ? 82.341  -32.842 310.406 1.00 93.20  ? 469 LEU A CA    1 
ATOM   3473  C  C     . LEU A 1 469 ? 83.286  -33.645 311.289 1.00 98.12  ? 469 LEU A C     1 
ATOM   3474  O  O     . LEU A 1 469 ? 84.136  -33.083 311.983 1.00 109.09 ? 469 LEU A O     1 
ATOM   3475  C  CB    . LEU A 1 469 ? 80.946  -32.834 311.031 1.00 85.20  ? 469 LEU A CB    1 
ATOM   3476  C  CG    . LEU A 1 469 ? 80.077  -31.594 310.822 1.00 78.87  ? 469 LEU A CG    1 
ATOM   3477  C  CD1   . LEU A 1 469 ? 78.753  -31.750 311.557 1.00 75.28  ? 469 LEU A CD1   1 
ATOM   3478  C  CD2   . LEU A 1 469 ? 80.805  -30.342 311.289 1.00 71.52  ? 469 LEU A CD2   1 
ATOM   3479  N  N     . ASP A 1 470 ? 83.127  -34.964 311.246 1.00 101.53 ? 470 ASP A N     1 
ATOM   3480  C  CA    . ASP A 1 470 ? 83.965  -35.876 312.014 1.00 102.33 ? 470 ASP A CA    1 
ATOM   3481  C  C     . ASP A 1 470 ? 85.442  -35.694 311.689 1.00 105.54 ? 470 ASP A C     1 
ATOM   3482  O  O     . ASP A 1 470 ? 86.294  -35.793 312.572 1.00 104.91 ? 470 ASP A O     1 
ATOM   3483  C  CB    . ASP A 1 470 ? 83.545  -37.330 311.775 1.00 110.92 ? 470 ASP A CB    1 
ATOM   3484  C  CG    . ASP A 1 470 ? 82.277  -37.701 312.519 1.00 126.68 ? 470 ASP A CG    1 
ATOM   3485  O  OD1   . ASP A 1 470 ? 82.036  -37.130 313.603 1.00 123.25 ? 470 ASP A OD1   1 
ATOM   3486  O  OD2   . ASP A 1 470 ? 81.525  -38.569 312.026 1.00 140.40 ? 470 ASP A OD2   1 
ATOM   3487  N  N     . GLU A 1 471 ? 85.742  -35.420 310.423 1.00 111.97 ? 471 GLU A N     1 
ATOM   3488  C  CA    . GLU A 1 471 ? 87.125  -35.203 310.009 1.00 112.04 ? 471 GLU A CA    1 
ATOM   3489  C  C     . GLU A 1 471 ? 87.660  -33.870 310.536 1.00 108.24 ? 471 GLU A C     1 
ATOM   3490  O  O     . GLU A 1 471 ? 88.790  -33.798 311.026 1.00 106.69 ? 471 GLU A O     1 
ATOM   3491  C  CB    . GLU A 1 471 ? 87.255  -35.289 308.486 1.00 101.72 ? 471 GLU A CB    1 
ATOM   3492  C  CG    . GLU A 1 471 ? 88.691  -35.245 307.971 1.00 108.61 ? 471 GLU A CG    1 
ATOM   3493  C  CD    . GLU A 1 471 ? 89.525  -36.433 308.422 1.00 127.44 ? 471 GLU A CD    1 
ATOM   3494  O  OE1   . GLU A 1 471 ? 90.768  -36.323 308.400 1.00 134.74 ? 471 GLU A OE1   1 
ATOM   3495  O  OE2   . GLU A 1 471 ? 88.946  -37.477 308.792 1.00 136.47 ? 471 GLU A OE2   1 
ATOM   3496  N  N     . VAL A 1 472 ? 86.843  -32.823 310.438 1.00 106.35 ? 472 VAL A N     1 
ATOM   3497  C  CA    . VAL A 1 472 ? 87.202  -31.515 310.988 1.00 99.62  ? 472 VAL A CA    1 
ATOM   3498  C  C     . VAL A 1 472 ? 87.522  -31.613 312.479 1.00 99.99  ? 472 VAL A C     1 
ATOM   3499  O  O     . VAL A 1 472 ? 88.561  -31.134 312.938 1.00 97.29  ? 472 VAL A O     1 
ATOM   3500  C  CB    . VAL A 1 472 ? 86.081  -30.471 310.757 1.00 93.57  ? 472 VAL A CB    1 
ATOM   3501  C  CG1   . VAL A 1 472 ? 86.229  -29.295 311.716 1.00 91.64  ? 472 VAL A CG1   1 
ATOM   3502  C  CG2   . VAL A 1 472 ? 86.086  -29.995 309.311 1.00 99.16  ? 472 VAL A CG2   1 
ATOM   3503  N  N     . LYS A 1 473 ? 86.625  -32.252 313.224 1.00 101.02 ? 473 LYS A N     1 
ATOM   3504  C  CA    . LYS A 1 473 ? 86.810  -32.473 314.654 1.00 94.29  ? 473 LYS A CA    1 
ATOM   3505  C  C     . LYS A 1 473 ? 88.061  -33.301 314.928 1.00 95.35  ? 473 LYS A C     1 
ATOM   3506  O  O     . LYS A 1 473 ? 88.821  -33.006 315.848 1.00 86.16  ? 473 LYS A O     1 
ATOM   3507  C  CB    . LYS A 1 473 ? 85.572  -33.159 315.239 1.00 81.50  ? 473 LYS A CB    1 
ATOM   3508  C  CG    . LYS A 1 473 ? 85.778  -33.865 316.574 1.00 85.15  ? 473 LYS A CG    1 
ATOM   3509  C  CD    . LYS A 1 473 ? 84.502  -34.589 316.992 1.00 94.70  ? 473 LYS A CD    1 
ATOM   3510  C  CE    . LYS A 1 473 ? 84.775  -35.658 318.036 1.00 104.91 ? 473 LYS A CE    1 
ATOM   3511  N  NZ    . LYS A 1 473 ? 83.546  -36.436 318.345 1.00 114.84 ? 473 LYS A NZ    1 
ATOM   3512  N  N     . ARG A 1 474 ? 88.271  -34.334 314.119 1.00 97.63  ? 474 ARG A N     1 
ATOM   3513  C  CA    . ARG A 1 474 ? 89.448  -35.188 314.250 1.00 93.78  ? 474 ARG A CA    1 
ATOM   3514  C  C     . ARG A 1 474 ? 90.729  -34.377 314.077 1.00 94.12  ? 474 ARG A C     1 
ATOM   3515  O  O     . ARG A 1 474 ? 91.740  -34.647 314.723 1.00 97.92  ? 474 ARG A O     1 
ATOM   3516  C  CB    . ARG A 1 474 ? 89.393  -36.325 313.222 1.00 97.32  ? 474 ARG A CB    1 
ATOM   3517  C  CG    . ARG A 1 474 ? 90.315  -37.506 313.514 1.00 110.07 ? 474 ARG A CG    1 
ATOM   3518  C  CD    . ARG A 1 474 ? 91.707  -37.320 312.920 1.00 115.43 ? 474 ARG A CD    1 
ATOM   3519  N  NE    . ARG A 1 474 ? 91.699  -37.325 311.461 1.00 122.06 ? 474 ARG A NE    1 
ATOM   3520  C  CZ    . ARG A 1 474 ? 92.777  -37.114 310.712 1.00 138.87 ? 474 ARG A CZ    1 
ATOM   3521  N  NH1   . ARG A 1 474 ? 93.949  -36.877 311.287 1.00 143.60 ? 474 ARG A NH1   1 
ATOM   3522  N  NH2   . ARG A 1 474 ? 92.687  -37.137 309.390 1.00 146.03 ? 474 ARG A NH2   1 
ATOM   3523  N  N     . LYS A 1 475 ? 90.672  -33.372 313.210 1.00 115.63 ? 475 LYS A N     1 
ATOM   3524  C  CA    . LYS A 1 475 ? 91.864  -32.609 312.852 1.00 109.50 ? 475 LYS A CA    1 
ATOM   3525  C  C     . LYS A 1 475 ? 92.125  -31.383 313.729 1.00 103.79 ? 475 LYS A C     1 
ATOM   3526  O  O     . LYS A 1 475 ? 93.265  -30.935 313.837 1.00 110.75 ? 475 LYS A O     1 
ATOM   3527  C  CB    . LYS A 1 475 ? 91.806  -32.185 311.381 1.00 106.77 ? 475 LYS A CB    1 
ATOM   3528  N  N     . PHE A 1 476 ? 91.084  -30.841 314.357 1.00 98.43  ? 476 PHE A N     1 
ATOM   3529  C  CA    . PHE A 1 476 ? 91.229  -29.548 315.028 1.00 100.80 ? 476 PHE A CA    1 
ATOM   3530  C  C     . PHE A 1 476 ? 90.744  -29.449 316.479 1.00 105.76 ? 476 PHE A C     1 
ATOM   3531  O  O     . PHE A 1 476 ? 91.024  -28.454 317.148 1.00 102.39 ? 476 PHE A O     1 
ATOM   3532  C  CB    . PHE A 1 476 ? 90.563  -28.444 314.198 1.00 95.80  ? 476 PHE A CB    1 
ATOM   3533  C  CG    . PHE A 1 476 ? 91.096  -28.332 312.796 1.00 92.26  ? 476 PHE A CG    1 
ATOM   3534  C  CD1   . PHE A 1 476 ? 92.372  -27.846 312.558 1.00 87.41  ? 476 PHE A CD1   1 
ATOM   3535  C  CD2   . PHE A 1 476 ? 90.315  -28.703 311.714 1.00 92.50  ? 476 PHE A CD2   1 
ATOM   3536  C  CE1   . PHE A 1 476 ? 92.863  -27.742 311.267 1.00 87.88  ? 476 PHE A CE1   1 
ATOM   3537  C  CE2   . PHE A 1 476 ? 90.797  -28.601 310.422 1.00 92.36  ? 476 PHE A CE2   1 
ATOM   3538  C  CZ    . PHE A 1 476 ? 92.073  -28.119 310.198 1.00 91.85  ? 476 PHE A CZ    1 
ATOM   3539  N  N     . SER A 1 477 ? 90.030  -30.459 316.967 1.00 106.23 ? 477 SER A N     1 
ATOM   3540  C  CA    . SER A 1 477 ? 89.369  -30.344 318.270 1.00 97.33  ? 477 SER A CA    1 
ATOM   3541  C  C     . SER A 1 477 ? 90.335  -30.172 319.439 1.00 102.91 ? 477 SER A C     1 
ATOM   3542  O  O     . SER A 1 477 ? 91.504  -30.546 319.359 1.00 98.31  ? 477 SER A O     1 
ATOM   3543  C  CB    . SER A 1 477 ? 88.435  -31.525 318.535 1.00 98.35  ? 477 SER A CB    1 
ATOM   3544  O  OG    . SER A 1 477 ? 87.564  -31.238 319.617 1.00 99.80  ? 477 SER A OG    1 
ATOM   3545  N  N     . ASP A 1 478 ? 89.822  -29.599 320.524 1.00 96.31  ? 478 ASP A N     1 
ATOM   3546  C  CA    . ASP A 1 478 ? 90.613  -29.297 321.711 1.00 90.06  ? 478 ASP A CA    1 
ATOM   3547  C  C     . ASP A 1 478 ? 90.183  -30.132 322.908 1.00 91.90  ? 478 ASP A C     1 
ATOM   3548  O  O     . ASP A 1 478 ? 89.116  -30.748 322.902 1.00 99.50  ? 478 ASP A O     1 
ATOM   3549  C  CB    . ASP A 1 478 ? 90.452  -27.820 322.075 1.00 69.41  ? 478 ASP A CB    1 
ATOM   3550  C  CG    . ASP A 1 478 ? 91.592  -26.963 321.570 1.00 112.85 ? 478 ASP A CG    1 
ATOM   3551  O  OD1   . ASP A 1 478 ? 92.700  -27.502 321.375 1.00 114.12 ? 478 ASP A OD1   1 
ATOM   3552  O  OD2   . ASP A 1 478 ? 91.384  -25.745 321.385 1.00 104.30 ? 478 ASP A OD2   1 
ATOM   3553  N  N     . LYS A 1 479 ? 91.024  -30.142 323.937 1.00 90.55  ? 479 LYS A N     1 
ATOM   3554  C  CA    . LYS A 1 479 ? 90.632  -30.646 325.244 1.00 96.74  ? 479 LYS A CA    1 
ATOM   3555  C  C     . LYS A 1 479 ? 89.910  -29.517 325.973 1.00 101.78 ? 479 LYS A C     1 
ATOM   3556  O  O     . LYS A 1 479 ? 90.252  -28.346 325.799 1.00 105.93 ? 479 LYS A O     1 
ATOM   3557  C  CB    . LYS A 1 479 ? 91.862  -31.092 326.038 1.00 82.65  ? 479 LYS A CB    1 
ATOM   3558  N  N     . ARG A 1 480 ? 88.903  -29.862 326.770 1.00 96.89  ? 480 ARG A N     1 
ATOM   3559  C  CA    . ARG A 1 480 ? 88.116  -28.859 327.485 1.00 94.04  ? 480 ARG A CA    1 
ATOM   3560  C  C     . ARG A 1 480 ? 88.987  -28.048 328.442 1.00 106.57 ? 480 ARG A C     1 
ATOM   3561  O  O     . ARG A 1 480 ? 89.917  -28.578 329.051 1.00 114.53 ? 480 ARG A O     1 
ATOM   3562  C  CB    . ARG A 1 480 ? 86.946  -29.512 328.231 1.00 93.90  ? 480 ARG A CB    1 
ATOM   3563  C  CG    . ARG A 1 480 ? 86.092  -28.534 329.025 1.00 90.11  ? 480 ARG A CG    1 
ATOM   3564  C  CD    . ARG A 1 480 ? 84.609  -28.850 328.914 1.00 76.44  ? 480 ARG A CD    1 
ATOM   3565  N  NE    . ARG A 1 480 ? 83.799  -27.684 329.254 1.00 92.56  ? 480 ARG A NE    1 
ATOM   3566  C  CZ    . ARG A 1 480 ? 82.607  -27.422 328.728 1.00 98.44  ? 480 ARG A CZ    1 
ATOM   3567  N  NH1   . ARG A 1 480 ? 82.079  -28.243 327.831 1.00 104.04 ? 480 ARG A NH1   1 
ATOM   3568  N  NH2   . ARG A 1 480 ? 81.944  -26.334 329.095 1.00 98.68  ? 480 ARG A NH2   1 
ATOM   3569  N  N     . ARG A 1 481 ? 88.685  -26.757 328.553 1.00 108.39 ? 481 ARG A N     1 
ATOM   3570  C  CA    . ARG A 1 481 ? 89.452  -25.844 329.394 1.00 112.24 ? 481 ARG A CA    1 
ATOM   3571  C  C     . ARG A 1 481 ? 88.619  -25.315 330.563 1.00 112.76 ? 481 ARG A C     1 
ATOM   3572  O  O     . ARG A 1 481 ? 89.109  -25.201 331.687 1.00 118.51 ? 481 ARG A O     1 
ATOM   3573  C  CB    . ARG A 1 481 ? 89.964  -24.669 328.560 1.00 105.45 ? 481 ARG A CB    1 
ATOM   3574  C  CG    . ARG A 1 481 ? 90.782  -25.068 327.342 1.00 96.11  ? 481 ARG A CG    1 
ATOM   3575  C  CD    . ARG A 1 481 ? 90.937  -23.892 326.392 1.00 96.72  ? 481 ARG A CD    1 
ATOM   3576  N  NE    . ARG A 1 481 ? 91.933  -24.148 325.355 1.00 97.65  ? 481 ARG A NE    1 
ATOM   3577  C  CZ    . ARG A 1 481 ? 92.217  -23.307 324.368 1.00 84.92  ? 481 ARG A CZ    1 
ATOM   3578  N  NH1   . ARG A 1 481 ? 91.576  -22.152 324.277 1.00 81.61  ? 481 ARG A NH1   1 
ATOM   3579  N  NH2   . ARG A 1 481 ? 93.139  -23.624 323.471 1.00 89.87  ? 481 ARG A NH2   1 
ATOM   3580  N  N     . THR A 1 482 ? 87.361  -24.988 330.290 1.00 102.73 ? 482 THR A N     1 
ATOM   3581  C  CA    . THR A 1 482 ? 86.480  -24.419 331.301 1.00 97.58  ? 482 THR A CA    1 
ATOM   3582  C  C     . THR A 1 482 ? 85.732  -25.501 332.070 1.00 105.86 ? 482 THR A C     1 
ATOM   3583  O  O     . THR A 1 482 ? 84.907  -26.220 331.506 1.00 108.72 ? 482 THR A O     1 
ATOM   3584  C  CB    . THR A 1 482 ? 85.466  -23.459 330.666 1.00 94.12  ? 482 THR A CB    1 
ATOM   3585  O  OG1   . THR A 1 482 ? 86.165  -22.402 329.999 1.00 95.89  ? 482 THR A OG1   1 
ATOM   3586  C  CG2   . THR A 1 482 ? 84.547  -22.871 331.727 1.00 93.27  ? 482 THR A CG2   1 
ATOM   3587  N  N     . GLU A 1 483 ? 86.028  -25.613 333.361 1.00 110.61 ? 483 GLU A N     1 
ATOM   3588  C  CA    . GLU A 1 483 ? 85.366  -26.592 334.213 1.00 105.07 ? 483 GLU A CA    1 
ATOM   3589  C  C     . GLU A 1 483 ? 84.007  -26.088 334.681 1.00 98.28  ? 483 GLU A C     1 
ATOM   3590  O  O     . GLU A 1 483 ? 83.901  -25.017 335.279 1.00 93.95  ? 483 GLU A O     1 
ATOM   3591  C  CB    . GLU A 1 483 ? 86.237  -26.944 335.419 1.00 109.49 ? 483 GLU A CB    1 
ATOM   3592  C  CG    . GLU A 1 483 ? 85.545  -27.865 336.415 1.00 121.88 ? 483 GLU A CG    1 
ATOM   3593  C  CD    . GLU A 1 483 ? 86.479  -28.385 337.487 1.00 133.44 ? 483 GLU A CD    1 
ATOM   3594  O  OE1   . GLU A 1 483 ? 86.231  -29.496 338.000 1.00 138.88 ? 483 GLU A OE1   1 
ATOM   3595  O  OE2   . GLU A 1 483 ? 87.457  -27.683 337.822 1.00 137.16 ? 483 GLU A OE2   1 
ATOM   3596  N  N     . LEU A 1 484 ? 82.971  -26.870 334.399 1.00 101.59 ? 484 LEU A N     1 
ATOM   3597  C  CA    . LEU A 1 484 ? 81.621  -26.540 334.829 1.00 106.17 ? 484 LEU A CA    1 
ATOM   3598  C  C     . LEU A 1 484 ? 81.329  -27.223 336.155 1.00 117.56 ? 484 LEU A C     1 
ATOM   3599  O  O     . LEU A 1 484 ? 81.467  -28.442 336.279 1.00 122.77 ? 484 LEU A O     1 
ATOM   3600  C  CB    . LEU A 1 484 ? 80.604  -26.985 333.780 1.00 99.77  ? 484 LEU A CB    1 
ATOM   3601  C  CG    . LEU A 1 484 ? 80.851  -26.519 332.344 1.00 98.09  ? 484 LEU A CG    1 
ATOM   3602  C  CD1   . LEU A 1 484 ? 79.711  -26.968 331.457 1.00 102.28 ? 484 LEU A CD1   1 
ATOM   3603  C  CD2   . LEU A 1 484 ? 81.034  -25.009 332.266 1.00 94.05  ? 484 LEU A CD2   1 
ATOM   3604  N  N     . MET A 1 485 ? 80.924  -26.438 337.147 1.00 118.17 ? 485 MET A N     1 
ATOM   3605  C  CA    . MET A 1 485 ? 80.676  -26.976 338.478 1.00 126.26 ? 485 MET A CA    1 
ATOM   3606  C  C     . MET A 1 485 ? 79.447  -26.360 339.137 1.00 121.38 ? 485 MET A C     1 
ATOM   3607  O  O     . MET A 1 485 ? 79.080  -25.220 338.855 1.00 115.77 ? 485 MET A O     1 
ATOM   3608  C  CB    . MET A 1 485 ? 81.905  -26.778 339.366 1.00 132.93 ? 485 MET A CB    1 
ATOM   3609  C  CG    . MET A 1 485 ? 82.394  -25.341 339.436 1.00 89.48  ? 485 MET A CG    1 
ATOM   3610  S  SD    . MET A 1 485 ? 83.781  -25.152 340.571 1.00 220.90 ? 485 MET A SD    1 
ATOM   3611  C  CE    . MET A 1 485 ? 84.937  -26.333 339.887 1.00 91.72  ? 485 MET A CE    1 
ATOM   3612  N  N     . VAL A 1 486 ? 78.815  -27.129 340.018 1.00 122.03 ? 486 VAL A N     1 
ATOM   3613  C  CA    . VAL A 1 486 ? 77.647  -26.661 340.755 1.00 115.20 ? 486 VAL A CA    1 
ATOM   3614  C  C     . VAL A 1 486 ? 78.044  -26.124 342.126 1.00 109.76 ? 486 VAL A C     1 
ATOM   3615  O  O     . VAL A 1 486 ? 77.922  -24.929 342.395 1.00 105.74 ? 486 VAL A O     1 
ATOM   3616  C  CB    . VAL A 1 486 ? 76.611  -27.787 340.935 1.00 115.93 ? 486 VAL A CB    1 
ATOM   3617  C  CG1   . VAL A 1 486 ? 75.872  -28.043 339.630 1.00 111.84 ? 486 VAL A CG1   1 
ATOM   3618  C  CG2   . VAL A 1 486 ? 77.289  -29.055 341.433 1.00 99.63  ? 486 VAL A CG2   1 
ATOM   3619  N  N     . LYS B 2 22  ? 115.958 -13.111 349.533 1.00 192.62 ? 401 LYS C N     1 
ATOM   3620  C  CA    . LYS B 2 22  ? 116.064 -12.107 348.480 1.00 192.48 ? 401 LYS C CA    1 
ATOM   3621  C  C     . LYS B 2 22  ? 115.002 -11.023 348.640 1.00 189.39 ? 401 LYS C C     1 
ATOM   3622  O  O     . LYS B 2 22  ? 113.878 -11.297 349.058 1.00 196.90 ? 401 LYS C O     1 
ATOM   3623  C  CB    . LYS B 2 22  ? 115.941 -12.763 347.104 1.00 188.80 ? 401 LYS C CB    1 
ATOM   3624  N  N     . HIS B 2 23  ? 115.368 -9.790  348.303 1.00 176.28 ? 402 HIS C N     1 
ATOM   3625  C  CA    . HIS B 2 23  ? 114.452 -8.662  348.416 1.00 168.52 ? 402 HIS C CA    1 
ATOM   3626  C  C     . HIS B 2 23  ? 113.765 -8.367  347.086 1.00 164.67 ? 402 HIS C C     1 
ATOM   3627  O  O     . HIS B 2 23  ? 114.423 -8.121  346.076 1.00 171.19 ? 402 HIS C O     1 
ATOM   3628  C  CB    . HIS B 2 23  ? 115.195 -7.421  348.913 1.00 167.21 ? 402 HIS C CB    1 
ATOM   3629  N  N     . MET B 2 24  ? 112.437 -8.397  347.094 1.00 154.55 ? 403 MET C N     1 
ATOM   3630  C  CA    . MET B 2 24  ? 111.660 -8.123  345.893 1.00 141.18 ? 403 MET C CA    1 
ATOM   3631  C  C     . MET B 2 24  ? 110.602 -7.063  346.167 1.00 134.44 ? 403 MET C C     1 
ATOM   3632  O  O     . MET B 2 24  ? 110.271 -6.788  347.321 1.00 134.75 ? 403 MET C O     1 
ATOM   3633  C  CB    . MET B 2 24  ? 111.000 -9.405  345.380 1.00 135.10 ? 403 MET C CB    1 
ATOM   3634  N  N     . LYS B 2 25  ? 110.079 -6.465  345.100 1.00 134.89 ? 404 LYS C N     1 
ATOM   3635  C  CA    . LYS B 2 25  ? 108.992 -5.500  345.221 1.00 134.51 ? 404 LYS C CA    1 
ATOM   3636  C  C     . LYS B 2 25  ? 107.743 -6.183  345.768 1.00 141.83 ? 404 LYS C C     1 
ATOM   3637  O  O     . LYS B 2 25  ? 107.608 -7.404  345.689 1.00 146.42 ? 404 LYS C O     1 
ATOM   3638  C  CB    . LYS B 2 25  ? 108.694 -4.851  343.869 1.00 120.31 ? 404 LYS C CB    1 
ATOM   3639  C  CG    . LYS B 2 25  ? 109.867 -4.079  343.284 1.00 114.59 ? 404 LYS C CG    1 
ATOM   3640  C  CD    . LYS B 2 25  ? 109.491 -3.393  341.981 1.00 121.07 ? 404 LYS C CD    1 
ATOM   3641  C  CE    . LYS B 2 25  ? 110.664 -2.610  341.407 1.00 105.68 ? 404 LYS C CE    1 
ATOM   3642  N  N     . SER B 2 26  ? 106.832 -5.398  346.330 1.00 139.60 ? 405 SER C N     1 
ATOM   3643  C  CA    . SER B 2 26  ? 105.646 -5.965  346.958 1.00 144.41 ? 405 SER C CA    1 
ATOM   3644  C  C     . SER B 2 26  ? 104.368 -5.421  346.346 1.00 152.17 ? 405 SER C C     1 
ATOM   3645  O  O     . SER B 2 26  ? 103.333 -5.376  347.011 1.00 153.41 ? 405 SER C O     1 
ATOM   3646  C  CB    . SER B 2 26  ? 105.651 -5.681  348.461 1.00 148.71 ? 405 SER C CB    1 
ATOM   3647  N  N     . GLY B 2 27  ? 104.435 -5.023  345.078 1.00 151.49 ? 406 GLY C N     1 
ATOM   3648  C  CA    . GLY B 2 27  ? 103.331 -4.315  344.460 1.00 148.41 ? 406 GLY C CA    1 
ATOM   3649  C  C     . GLY B 2 27  ? 103.079 -3.074  345.289 1.00 152.35 ? 406 GLY C C     1 
ATOM   3650  O  O     . GLY B 2 27  ? 104.026 -2.455  345.765 1.00 164.88 ? 406 GLY C O     1 
ATOM   3651  N  N     . LEU B 2 28  ? 101.812 -2.702  345.454 1.00 141.87 ? 407 LEU C N     1 
ATOM   3652  C  CA    . LEU B 2 28  ? 101.400 -1.693  346.440 1.00 132.56 ? 407 LEU C CA    1 
ATOM   3653  C  C     . LEU B 2 28  ? 102.094 -0.324  346.369 1.00 136.65 ? 407 LEU C C     1 
ATOM   3654  O  O     . LEU B 2 28  ? 101.481 0.697   346.678 1.00 130.33 ? 407 LEU C O     1 
ATOM   3655  C  CB    . LEU B 2 28  ? 101.531 -2.257  347.858 1.00 132.82 ? 407 LEU C CB    1 
ATOM   3656  C  CG    . LEU B 2 28  ? 100.828 -3.591  348.116 1.00 129.14 ? 407 LEU C CG    1 
ATOM   3657  C  CD1   . LEU B 2 28  ? 101.013 -4.030  349.561 1.00 128.21 ? 407 LEU C CD1   1 
ATOM   3658  C  CD2   . LEU B 2 28  ? 99.356  -3.488  347.768 1.00 125.44 ? 407 LEU C CD2   1 
ATOM   3659  N  N     . GLU B 2 29  ? 103.367 -0.313  345.983 1.00 147.66 ? 408 GLU C N     1 
ATOM   3660  C  CA    . GLU B 2 29  ? 104.184 0.898   345.985 1.00 151.83 ? 408 GLU C CA    1 
ATOM   3661  C  C     . GLU B 2 29  ? 103.646 1.987   345.058 1.00 157.29 ? 408 GLU C C     1 
ATOM   3662  O  O     . GLU B 2 29  ? 102.992 1.702   344.054 1.00 151.14 ? 408 GLU C O     1 
ATOM   3663  C  CB    . GLU B 2 29  ? 105.634 0.568   345.610 1.00 144.73 ? 408 GLU C CB    1 
ATOM   3664  C  CG    . GLU B 2 29  ? 106.332 -0.398  346.557 1.00 116.79 ? 408 GLU C CG    1 
ATOM   3665  N  N     . ILE B 2 30  ? 103.926 3.237   345.413 1.00 160.97 ? 409 ILE C N     1 
ATOM   3666  C  CA    . ILE B 2 30  ? 103.542 4.375   344.590 1.00 160.35 ? 409 ILE C CA    1 
ATOM   3667  C  C     . ILE B 2 30  ? 104.567 4.578   343.480 1.00 164.33 ? 409 ILE C C     1 
ATOM   3668  O  O     . ILE B 2 30  ? 104.206 4.792   342.323 1.00 163.07 ? 409 ILE C O     1 
ATOM   3669  C  CB    . ILE B 2 30  ? 103.431 5.663   345.425 1.00 156.39 ? 409 ILE C CB    1 
ATOM   3670  N  N     . SER B 2 31  ? 105.844 4.516   343.850 1.00 166.58 ? 410 SER C N     1 
ATOM   3671  C  CA    . SER B 2 31  ? 106.962 4.561   342.902 1.00 164.19 ? 410 SER C CA    1 
ATOM   3672  C  C     . SER B 2 31  ? 107.107 5.876   342.129 1.00 164.51 ? 410 SER C C     1 
ATOM   3673  O  O     . SER B 2 31  ? 108.168 6.501   342.163 1.00 168.73 ? 410 SER C O     1 
ATOM   3674  C  CB    . SER B 2 31  ? 106.901 3.376   341.930 1.00 158.42 ? 410 SER C CB    1 
ATOM   3675  N  N     . ASN B 2 32  ? 106.046 6.273   341.428 1.00 157.55 ? 411 ASN C N     1 
ATOM   3676  C  CA    . ASN B 2 32  ? 106.048 7.469   340.579 1.00 146.51 ? 411 ASN C CA    1 
ATOM   3677  C  C     . ASN B 2 32  ? 107.025 7.374   339.406 1.00 144.65 ? 411 ASN C C     1 
ATOM   3678  O  O     . ASN B 2 32  ? 107.567 8.379   338.949 1.00 143.42 ? 411 ASN C O     1 
ATOM   3679  C  CB    . ASN B 2 32  ? 106.290 8.743   341.395 1.00 140.23 ? 411 ASN C CB    1 
ATOM   3680  N  N     . LEU B 2 33  ? 107.239 6.151   338.933 1.00 140.84 ? 412 LEU C N     1 
ATOM   3681  C  CA    . LEU B 2 33  ? 108.014 5.901   337.725 1.00 136.66 ? 412 LEU C CA    1 
ATOM   3682  C  C     . LEU B 2 33  ? 107.120 6.161   336.505 1.00 144.07 ? 412 LEU C C     1 
ATOM   3683  O  O     . LEU B 2 33  ? 105.895 6.158   336.637 1.00 146.71 ? 412 LEU C O     1 
ATOM   3684  C  CB    . LEU B 2 33  ? 108.531 4.458   337.741 1.00 125.05 ? 412 LEU C CB    1 
ATOM   3685  N  N     . PRO B 2 34  ? 107.724 6.406   335.322 1.00 141.05 ? 413 PRO C N     1 
ATOM   3686  C  CA    . PRO B 2 34  ? 106.979 6.731   334.094 1.00 138.78 ? 413 PRO C CA    1 
ATOM   3687  C  C     . PRO B 2 34  ? 105.784 5.824   333.788 1.00 149.02 ? 413 PRO C C     1 
ATOM   3688  O  O     . PRO B 2 34  ? 105.739 4.674   334.227 1.00 149.96 ? 413 PRO C O     1 
ATOM   3689  C  CB    . PRO B 2 34  ? 108.040 6.583   333.002 1.00 122.36 ? 413 PRO C CB    1 
ATOM   3690  C  CG    . PRO B 2 34  ? 109.298 6.968   333.677 1.00 118.20 ? 413 PRO C CG    1 
ATOM   3691  C  CD    . PRO B 2 34  ? 109.181 6.469   335.097 1.00 133.89 ? 413 PRO C CD    1 
ATOM   3692  N  N     . GLY B 2 35  ? 104.827 6.362   333.035 1.00 153.53 ? 414 GLY C N     1 
ATOM   3693  C  CA    . GLY B 2 35  ? 103.629 5.636   332.652 1.00 148.01 ? 414 GLY C CA    1 
ATOM   3694  C  C     . GLY B 2 35  ? 103.938 4.418   331.805 1.00 133.24 ? 414 GLY C C     1 
ATOM   3695  O  O     . GLY B 2 35  ? 103.230 3.413   331.864 1.00 118.72 ? 414 GLY C O     1 
ATOM   3696  N  N     . LYS B 2 36  ? 104.996 4.512   331.007 1.00 131.41 ? 415 LYS C N     1 
ATOM   3697  C  CA    . LYS B 2 36  ? 105.513 3.353   330.294 1.00 121.99 ? 415 LYS C CA    1 
ATOM   3698  C  C     . LYS B 2 36  ? 106.289 2.492   331.283 1.00 131.19 ? 415 LYS C C     1 
ATOM   3699  O  O     . LYS B 2 36  ? 105.826 2.248   332.396 1.00 136.95 ? 415 LYS C O     1 
ATOM   3700  C  CB    . LYS B 2 36  ? 106.421 3.787   329.143 1.00 102.15 ? 415 LYS C CB    1 
ATOM   3701  N  N     . LEU B 2 37  ? 107.469 2.041   330.871 1.00 126.28 ? 416 LEU C N     1 
ATOM   3702  C  CA    . LEU B 2 37  ? 108.383 1.310   331.749 1.00 120.43 ? 416 LEU C CA    1 
ATOM   3703  C  C     . LEU B 2 37  ? 107.766 0.084   332.425 1.00 122.54 ? 416 LEU C C     1 
ATOM   3704  O  O     . LEU B 2 37  ? 107.175 0.182   333.502 1.00 134.81 ? 416 LEU C O     1 
ATOM   3705  C  CB    . LEU B 2 37  ? 108.995 2.242   332.800 1.00 108.63 ? 416 LEU C CB    1 
ATOM   3706  C  CG    . LEU B 2 37  ? 110.033 1.604   333.728 1.00 103.42 ? 416 LEU C CG    1 
ATOM   3707  C  CD1   . LEU B 2 37  ? 111.191 1.003   332.936 1.00 102.79 ? 416 LEU C CD1   1 
ATOM   3708  C  CD2   . LEU B 2 37  ? 110.539 2.614   334.747 1.00 104.12 ? 416 LEU C CD2   1 
ATOM   3709  N  N     . ALA B 2 38  ? 107.913 -1.072  331.788 1.00 110.87 ? 417 ALA C N     1 
ATOM   3710  C  CA    . ALA B 2 38  ? 107.507 -2.327  332.401 1.00 118.97 ? 417 ALA C CA    1 
ATOM   3711  C  C     . ALA B 2 38  ? 108.587 -2.780  333.376 1.00 123.93 ? 417 ALA C C     1 
ATOM   3712  O  O     . ALA B 2 38  ? 109.396 -3.651  333.058 1.00 130.59 ? 417 ALA C O     1 
ATOM   3713  C  CB    . ALA B 2 38  ? 107.266 -3.386  331.339 1.00 118.59 ? 417 ALA C CB    1 
ATOM   3714  N  N     . ASP B 2 39  ? 108.595 -2.176  334.560 1.00 115.04 ? 418 ASP C N     1 
ATOM   3715  C  CA    . ASP B 2 39  ? 109.632 -2.430  335.556 1.00 116.54 ? 418 ASP C CA    1 
ATOM   3716  C  C     . ASP B 2 39  ? 109.661 -3.895  335.987 1.00 111.63 ? 418 ASP C C     1 
ATOM   3717  O  O     . ASP B 2 39  ? 108.669 -4.611  335.855 1.00 111.93 ? 418 ASP C O     1 
ATOM   3718  C  CB    . ASP B 2 39  ? 109.427 -1.530  336.776 1.00 125.86 ? 418 ASP C CB    1 
ATOM   3719  C  CG    . ASP B 2 39  ? 110.717 -1.255  337.523 1.00 129.49 ? 418 ASP C CG    1 
ATOM   3720  O  OD1   . ASP B 2 39  ? 111.758 -1.840  337.155 1.00 125.48 ? 418 ASP C OD1   1 
ATOM   3721  O  OD2   . ASP B 2 39  ? 110.688 -0.456  338.483 1.00 132.84 ? 418 ASP C OD2   1 
ATOM   3722  N  N     . CYS B 2 40  ? 110.807 -4.332  336.498 1.00 110.60 ? 419 CYS C N     1 
ATOM   3723  C  CA    . CYS B 2 40  ? 110.972 -5.707  336.955 1.00 115.87 ? 419 CYS C CA    1 
ATOM   3724  C  C     . CYS B 2 40  ? 110.479 -5.875  338.388 1.00 113.84 ? 419 CYS C C     1 
ATOM   3725  O  O     . CYS B 2 40  ? 110.080 -4.906  339.033 1.00 106.77 ? 419 CYS C O     1 
ATOM   3726  C  CB    . CYS B 2 40  ? 112.437 -6.131  336.851 1.00 99.18  ? 419 CYS C CB    1 
ATOM   3727  S  SG    . CYS B 2 40  ? 113.584 -5.068  337.754 1.00 153.14 ? 419 CYS C SG    1 
ATOM   3728  N  N     . SER B 2 41  ? 110.515 -7.109  338.881 1.00 117.29 ? 420 SER C N     1 
ATOM   3729  C  CA    . SER B 2 41  ? 110.006 -7.420  340.213 1.00 125.99 ? 420 SER C CA    1 
ATOM   3730  C  C     . SER B 2 41  ? 111.110 -7.447  341.269 1.00 130.72 ? 420 SER C C     1 
ATOM   3731  O  O     . SER B 2 41  ? 110.872 -7.830  342.414 1.00 132.63 ? 420 SER C O     1 
ATOM   3732  C  CB    . SER B 2 41  ? 109.264 -8.758  340.200 1.00 106.30 ? 420 SER C CB    1 
ATOM   3733  N  N     . SER B 2 42  ? 112.314 -7.041  340.881 1.00 128.12 ? 421 SER C N     1 
ATOM   3734  C  CA    . SER B 2 42  ? 113.446 -7.033  341.802 1.00 132.20 ? 421 SER C CA    1 
ATOM   3735  C  C     . SER B 2 42  ? 113.797 -5.622  342.255 1.00 135.92 ? 421 SER C C     1 
ATOM   3736  O  O     . SER B 2 42  ? 113.224 -4.644  341.776 1.00 136.69 ? 421 SER C O     1 
ATOM   3737  C  CB    . SER B 2 42  ? 114.667 -7.693  341.158 1.00 130.77 ? 421 SER C CB    1 
ATOM   3738  O  OG    . SER B 2 42  ? 115.823 -7.526  341.961 1.00 133.47 ? 421 SER C OG    1 
ATOM   3739  N  N     . ASN B 2 43  ? 114.744 -5.531  343.184 1.00 138.61 ? 422 ASN C N     1 
ATOM   3740  C  CA    . ASN B 2 43  ? 115.219 -4.251  343.693 1.00 137.95 ? 422 ASN C CA    1 
ATOM   3741  C  C     . ASN B 2 43  ? 116.741 -4.205  343.756 1.00 135.80 ? 422 ASN C C     1 
ATOM   3742  O  O     . ASN B 2 43  ? 117.316 -3.275  344.314 1.00 134.26 ? 422 ASN C O     1 
ATOM   3743  C  CB    . ASN B 2 43  ? 114.631 -3.972  345.080 1.00 138.83 ? 422 ASN C CB    1 
ATOM   3744  C  CG    . ASN B 2 43  ? 113.167 -3.581  345.025 1.00 138.99 ? 422 ASN C CG    1 
ATOM   3745  O  OD1   . ASN B 2 43  ? 112.733 -2.900  344.098 1.00 125.88 ? 422 ASN C OD1   1 
ATOM   3746  N  ND2   . ASN B 2 43  ? 112.399 -4.010  346.019 1.00 146.16 ? 422 ASN C ND2   1 
ATOM   3747  N  N     . ASN B 2 44  ? 117.382 -5.217  343.181 1.00 133.27 ? 423 ASN C N     1 
ATOM   3748  C  CA    . ASN B 2 44  ? 118.834 -5.332  343.211 1.00 140.69 ? 423 ASN C CA    1 
ATOM   3749  C  C     . ASN B 2 44  ? 119.462 -4.709  341.972 1.00 140.33 ? 423 ASN C C     1 
ATOM   3750  O  O     . ASN B 2 44  ? 119.402 -5.287  340.890 1.00 140.59 ? 423 ASN C O     1 
ATOM   3751  C  CB    . ASN B 2 44  ? 119.236 -6.806  343.310 1.00 153.41 ? 423 ASN C CB    1 
ATOM   3752  C  CG    . ASN B 2 44  ? 120.697 -6.996  343.673 1.00 161.77 ? 423 ASN C CG    1 
ATOM   3753  O  OD1   . ASN B 2 44  ? 121.503 -6.070  343.581 1.00 164.72 ? 423 ASN C OD1   1 
ATOM   3754  N  ND2   . ASN B 2 44  ? 121.046 -8.208  344.086 1.00 162.75 ? 423 ASN C ND2   1 
ATOM   3755  N  N     . PRO B 2 45  ? 120.085 -3.530  342.129 1.00 142.55 ? 424 PRO C N     1 
ATOM   3756  C  CA    . PRO B 2 45  ? 120.713 -2.822  341.010 1.00 147.20 ? 424 PRO C CA    1 
ATOM   3757  C  C     . PRO B 2 45  ? 122.053 -3.444  340.628 1.00 155.69 ? 424 PRO C C     1 
ATOM   3758  O  O     . PRO B 2 45  ? 122.995 -2.722  340.306 1.00 160.16 ? 424 PRO C O     1 
ATOM   3759  C  CB    . PRO B 2 45  ? 120.933 -1.406  341.566 1.00 146.16 ? 424 PRO C CB    1 
ATOM   3760  C  CG    . PRO B 2 45  ? 120.194 -1.359  342.881 1.00 143.29 ? 424 PRO C CG    1 
ATOM   3761  C  CD    . PRO B 2 45  ? 120.193 -2.762  343.377 1.00 140.83 ? 424 PRO C CD    1 
ATOM   3762  N  N     . ALA B 2 46  ? 122.131 -4.770  340.676 1.00 156.88 ? 425 ALA C N     1 
ATOM   3763  C  CA    . ALA B 2 46  ? 123.331 -5.498  340.288 1.00 153.07 ? 425 ALA C CA    1 
ATOM   3764  C  C     . ALA B 2 46  ? 122.924 -6.823  339.655 1.00 149.59 ? 425 ALA C C     1 
ATOM   3765  O  O     . ALA B 2 46  ? 123.757 -7.696  339.405 1.00 149.16 ? 425 ALA C O     1 
ATOM   3766  C  CB    . ALA B 2 46  ? 124.224 -5.734  341.492 1.00 150.51 ? 425 ALA C CB    1 
ATOM   3767  N  N     . GLU B 2 47  ? 121.626 -6.961  339.402 1.00 145.54 ? 426 GLU C N     1 
ATOM   3768  C  CA    . GLU B 2 47  ? 121.082 -8.150  338.765 1.00 141.29 ? 426 GLU C CA    1 
ATOM   3769  C  C     . GLU B 2 47  ? 120.003 -7.745  337.766 1.00 131.96 ? 426 GLU C C     1 
ATOM   3770  O  O     . GLU B 2 47  ? 119.719 -8.469  336.812 1.00 124.26 ? 426 GLU C O     1 
ATOM   3771  C  CB    . GLU B 2 47  ? 120.504 -9.104  339.814 1.00 106.44 ? 426 GLU C CB    1 
ATOM   3772  N  N     . THR B 2 48  ? 119.412 -6.576  337.989 1.00 127.48 ? 427 THR C N     1 
ATOM   3773  C  CA    . THR B 2 48  ? 118.347 -6.080  337.130 1.00 125.56 ? 427 THR C CA    1 
ATOM   3774  C  C     . THR B 2 48  ? 118.915 -5.450  335.863 1.00 134.47 ? 427 THR C C     1 
ATOM   3775  O  O     . THR B 2 48  ? 120.096 -5.114  335.805 1.00 145.12 ? 427 THR C O     1 
ATOM   3776  C  CB    . THR B 2 48  ? 117.462 -5.051  337.858 1.00 126.50 ? 427 THR C CB    1 
ATOM   3777  O  OG1   . THR B 2 48  ? 118.254 -3.917  338.234 1.00 131.86 ? 427 THR C OG1   1 
ATOM   3778  C  CG2   . THR B 2 48  ? 116.843 -5.666  339.101 1.00 133.14 ? 427 THR C CG2   1 
ATOM   3779  N  N     . GLU B 2 49  ? 118.066 -5.299  334.850 1.00 128.93 ? 428 GLU C N     1 
ATOM   3780  C  CA    . GLU B 2 49  ? 118.472 -4.728  333.569 1.00 119.25 ? 428 GLU C CA    1 
ATOM   3781  C  C     . GLU B 2 49  ? 117.400 -3.777  333.043 1.00 116.26 ? 428 GLU C C     1 
ATOM   3782  O  O     . GLU B 2 49  ? 116.229 -3.894  333.404 1.00 115.52 ? 428 GLU C O     1 
ATOM   3783  C  CB    . GLU B 2 49  ? 118.729 -5.841  332.550 1.00 114.58 ? 428 GLU C CB    1 
ATOM   3784  C  CG    . GLU B 2 49  ? 119.887 -6.763  332.902 1.00 118.01 ? 428 GLU C CG    1 
ATOM   3785  C  CD    . GLU B 2 49  ? 119.846 -8.065  332.128 1.00 124.95 ? 428 GLU C CD    1 
ATOM   3786  O  OE1   . GLU B 2 49  ? 118.731 -8.557  331.856 1.00 118.36 ? 428 GLU C OE1   1 
ATOM   3787  O  OE2   . GLU B 2 49  ? 120.924 -8.596  331.789 1.00 137.22 ? 428 GLU C OE2   1 
ATOM   3788  N  N     . LEU B 2 50  ? 117.798 -2.838  332.189 1.00 115.28 ? 429 LEU C N     1 
ATOM   3789  C  CA    . LEU B 2 50  ? 116.844 -1.911  331.583 1.00 113.88 ? 429 LEU C CA    1 
ATOM   3790  C  C     . LEU B 2 50  ? 117.061 -1.836  330.079 1.00 114.28 ? 429 LEU C C     1 
ATOM   3791  O  O     . LEU B 2 50  ? 118.062 -1.290  329.617 1.00 125.26 ? 429 LEU C O     1 
ATOM   3792  C  CB    . LEU B 2 50  ? 116.982 -0.512  332.189 1.00 114.59 ? 429 LEU C CB    1 
ATOM   3793  C  CG    . LEU B 2 50  ? 115.709 0.323   332.392 1.00 109.96 ? 429 LEU C CG    1 
ATOM   3794  C  CD1   . LEU B 2 50  ? 116.035 1.812   332.370 1.00 109.71 ? 429 LEU C CD1   1 
ATOM   3795  C  CD2   . LEU B 2 50  ? 114.615 -0.005  331.380 1.00 102.45 ? 429 LEU C CD2   1 
ATOM   3796  N  N     . PHE B 2 51  ? 116.110 -2.374  329.322 1.00 112.69 ? 430 PHE C N     1 
ATOM   3797  C  CA    . PHE B 2 51  ? 116.180 -2.351  327.864 1.00 108.11 ? 430 PHE C CA    1 
ATOM   3798  C  C     . PHE B 2 51  ? 115.514 -1.106  327.285 1.00 106.40 ? 430 PHE C C     1 
ATOM   3799  O  O     . PHE B 2 51  ? 114.302 -0.929  327.399 1.00 102.67 ? 430 PHE C O     1 
ATOM   3800  C  CB    . PHE B 2 51  ? 115.517 -3.597  327.271 1.00 99.53  ? 430 PHE C CB    1 
ATOM   3801  C  CG    . PHE B 2 51  ? 116.259 -4.873  327.546 1.00 99.72  ? 430 PHE C CG    1 
ATOM   3802  C  CD1   . PHE B 2 51  ? 116.040 -5.580  328.716 1.00 104.12 ? 430 PHE C CD1   1 
ATOM   3803  C  CD2   . PHE B 2 51  ? 117.168 -5.372  326.628 1.00 99.75  ? 430 PHE C CD2   1 
ATOM   3804  C  CE1   . PHE B 2 51  ? 116.719 -6.758  328.968 1.00 109.47 ? 430 PHE C CE1   1 
ATOM   3805  C  CE2   . PHE B 2 51  ? 117.851 -6.549  326.874 1.00 107.29 ? 430 PHE C CE2   1 
ATOM   3806  C  CZ    . PHE B 2 51  ? 117.626 -7.243  328.046 1.00 112.30 ? 430 PHE C CZ    1 
ATOM   3807  N  N     . ILE B 2 52  ? 116.311 -0.244  326.663 1.00 101.89 ? 431 ILE C N     1 
ATOM   3808  C  CA    . ILE B 2 52  ? 115.763 0.887   325.924 1.00 104.01 ? 431 ILE C CA    1 
ATOM   3809  C  C     . ILE B 2 52  ? 115.321 0.406   324.541 1.00 108.32 ? 431 ILE C C     1 
ATOM   3810  O  O     . ILE B 2 52  ? 116.112 -0.169  323.792 1.00 108.97 ? 431 ILE C O     1 
ATOM   3811  C  CB    . ILE B 2 52  ? 116.777 2.038   325.802 1.00 104.55 ? 431 ILE C CB    1 
ATOM   3812  C  CG1   . ILE B 2 52  ? 117.160 2.554   327.192 1.00 114.35 ? 431 ILE C CG1   1 
ATOM   3813  C  CG2   . ILE B 2 52  ? 116.199 3.167   324.968 1.00 106.66 ? 431 ILE C CG2   1 
ATOM   3814  C  CD1   . ILE B 2 52  ? 118.120 3.727   327.174 1.00 124.76 ? 431 ILE C CD1   1 
ATOM   3815  N  N     . VAL B 2 53  ? 114.052 0.634   324.215 1.00 83.48  ? 432 VAL C N     1 
ATOM   3816  C  CA    . VAL B 2 53  ? 113.440 0.009   323.045 1.00 87.27  ? 432 VAL C CA    1 
ATOM   3817  C  C     . VAL B 2 53  ? 112.804 1.017   322.089 1.00 104.64 ? 432 VAL C C     1 
ATOM   3818  O  O     . VAL B 2 53  ? 112.109 1.933   322.520 1.00 104.30 ? 432 VAL C O     1 
ATOM   3819  C  CB    . VAL B 2 53  ? 112.389 -1.042  323.484 1.00 86.34  ? 432 VAL C CB    1 
ATOM   3820  C  CG1   . VAL B 2 53  ? 111.314 -1.232  322.429 1.00 88.18  ? 432 VAL C CG1   1 
ATOM   3821  C  CG2   . VAL B 2 53  ? 113.065 -2.360  323.817 1.00 92.42  ? 432 VAL C CG2   1 
ATOM   3822  N  N     . GLU B 2 54  ? 113.051 0.844   320.791 1.00 111.99 ? 433 GLU C N     1 
ATOM   3823  C  CA    . GLU B 2 54  ? 112.483 1.722   319.771 1.00 106.75 ? 433 GLU C CA    1 
ATOM   3824  C  C     . GLU B 2 54  ? 110.993 1.461   319.556 1.00 100.68 ? 433 GLU C C     1 
ATOM   3825  O  O     . GLU B 2 54  ? 110.612 0.525   318.855 1.00 109.62 ? 433 GLU C O     1 
ATOM   3826  C  CB    . GLU B 2 54  ? 113.235 1.560   318.447 1.00 106.74 ? 433 GLU C CB    1 
ATOM   3827  N  N     . GLY B 2 55  ? 110.154 2.293   320.165 1.00 91.11  ? 434 GLY C N     1 
ATOM   3828  C  CA    . GLY B 2 55  ? 108.716 2.212   319.971 1.00 95.82  ? 434 GLY C CA    1 
ATOM   3829  C  C     . GLY B 2 55  ? 108.022 1.093   320.725 1.00 98.55  ? 434 GLY C C     1 
ATOM   3830  O  O     . GLY B 2 55  ? 108.657 0.152   321.203 1.00 105.12 ? 434 GLY C O     1 
ATOM   3831  N  N     . ASP B 2 56  ? 106.700 1.196   320.821 1.00 100.84 ? 435 ASP C N     1 
ATOM   3832  C  CA    . ASP B 2 56  ? 105.902 0.203   321.529 1.00 110.49 ? 435 ASP C CA    1 
ATOM   3833  C  C     . ASP B 2 56  ? 105.612 -1.018  320.661 1.00 108.85 ? 435 ASP C C     1 
ATOM   3834  O  O     . ASP B 2 56  ? 105.045 -2.006  321.135 1.00 113.27 ? 435 ASP C O     1 
ATOM   3835  C  CB    . ASP B 2 56  ? 104.595 0.823   322.034 1.00 118.65 ? 435 ASP C CB    1 
ATOM   3836  C  CG    . ASP B 2 56  ? 104.796 1.689   323.264 1.00 125.52 ? 435 ASP C CG    1 
ATOM   3837  O  OD1   . ASP B 2 56  ? 105.088 2.894   323.106 1.00 122.28 ? 435 ASP C OD1   1 
ATOM   3838  O  OD2   . ASP B 2 56  ? 104.665 1.163   324.391 1.00 125.26 ? 435 ASP C OD2   1 
ATOM   3839  N  N     . SER B 2 57  ? 106.004 -0.945  319.391 1.00 114.09 ? 436 SER C N     1 
ATOM   3840  C  CA    . SER B 2 57  ? 105.876 -2.084  318.490 1.00 116.68 ? 436 SER C CA    1 
ATOM   3841  C  C     . SER B 2 57  ? 106.830 -3.180  318.938 1.00 113.15 ? 436 SER C C     1 
ATOM   3842  O  O     . SER B 2 57  ? 106.494 -4.366  318.912 1.00 111.88 ? 436 SER C O     1 
ATOM   3843  C  CB    . SER B 2 57  ? 106.180 -1.673  317.049 1.00 116.96 ? 436 SER C CB    1 
ATOM   3844  O  OG    . SER B 2 57  ? 105.247 -0.716  316.576 1.00 113.94 ? 436 SER C OG    1 
ATOM   3845  N  N     . ALA B 2 58  ? 108.027 -2.770  319.345 1.00 112.77 ? 437 ALA C N     1 
ATOM   3846  C  CA    . ALA B 2 58  ? 108.986 -3.680  319.951 1.00 115.99 ? 437 ALA C CA    1 
ATOM   3847  C  C     . ALA B 2 58  ? 108.766 -3.681  321.459 1.00 116.14 ? 437 ALA C C     1 
ATOM   3848  O  O     . ALA B 2 58  ? 109.157 -4.618  322.159 1.00 107.22 ? 437 ALA C O     1 
ATOM   3849  C  CB    . ALA B 2 58  ? 110.405 -3.256  319.616 1.00 112.71 ? 437 ALA C CB    1 
ATOM   3850  N  N     . GLY B 2 59  ? 108.130 -2.618  321.947 1.00 114.94 ? 438 GLY C N     1 
ATOM   3851  C  CA    . GLY B 2 59  ? 107.793 -2.495  323.353 1.00 99.50  ? 438 GLY C CA    1 
ATOM   3852  C  C     . GLY B 2 59  ? 106.918 -3.630  323.847 1.00 103.49 ? 438 GLY C C     1 
ATOM   3853  O  O     . GLY B 2 59  ? 107.140 -4.157  324.935 1.00 123.28 ? 438 GLY C O     1 
ATOM   3854  N  N     . GLY B 2 60  ? 105.925 -4.010  323.049 1.00 99.37  ? 439 GLY C N     1 
ATOM   3855  C  CA    . GLY B 2 60  ? 105.037 -5.098  323.416 1.00 104.26 ? 439 GLY C CA    1 
ATOM   3856  C  C     . GLY B 2 60  ? 105.755 -6.434  323.457 1.00 107.95 ? 439 GLY C C     1 
ATOM   3857  O  O     . GLY B 2 60  ? 105.584 -7.217  324.397 1.00 108.15 ? 439 GLY C O     1 
ATOM   3858  N  N     . SER B 2 61  ? 106.562 -6.690  322.430 1.00 110.69 ? 440 SER C N     1 
ATOM   3859  C  CA    . SER B 2 61  ? 107.333 -7.926  322.335 1.00 116.07 ? 440 SER C CA    1 
ATOM   3860  C  C     . SER B 2 61  ? 108.296 -8.071  323.505 1.00 117.27 ? 440 SER C C     1 
ATOM   3861  O  O     . SER B 2 61  ? 108.441 -9.153  324.070 1.00 119.02 ? 440 SER C O     1 
ATOM   3862  C  CB    . SER B 2 61  ? 108.112 -7.973  321.019 1.00 113.52 ? 440 SER C CB    1 
ATOM   3863  O  OG    . SER B 2 61  ? 107.242 -8.022  319.901 1.00 112.89 ? 440 SER C OG    1 
ATOM   3864  N  N     . ALA B 2 62  ? 108.958 -6.975  323.860 1.00 111.76 ? 441 ALA C N     1 
ATOM   3865  C  CA    . ALA B 2 62  ? 109.886 -6.987  324.982 1.00 111.72 ? 441 ALA C CA    1 
ATOM   3866  C  C     . ALA B 2 62  ? 109.137 -7.191  326.293 1.00 116.61 ? 441 ALA C C     1 
ATOM   3867  O  O     . ALA B 2 62  ? 109.471 -8.076  327.074 1.00 126.61 ? 441 ALA C O     1 
ATOM   3868  C  CB    . ALA B 2 62  ? 110.692 -5.700  325.021 1.00 113.34 ? 441 ALA C CB    1 
ATOM   3869  N  N     . LYS B 2 63  ? 108.110 -6.374  326.513 1.00 111.39 ? 442 LYS C N     1 
ATOM   3870  C  CA    . LYS B 2 63  ? 107.323 -6.414  327.742 1.00 106.48 ? 442 LYS C CA    1 
ATOM   3871  C  C     . LYS B 2 63  ? 106.701 -7.781  328.019 1.00 110.85 ? 442 LYS C C     1 
ATOM   3872  O  O     . LYS B 2 63  ? 106.669 -8.232  329.164 1.00 116.46 ? 442 LYS C O     1 
ATOM   3873  C  CB    . LYS B 2 63  ? 106.227 -5.346  327.708 1.00 87.25  ? 442 LYS C CB    1 
ATOM   3874  N  N     . SER B 2 64  ? 106.205 -8.437  326.975 1.00 118.86 ? 443 SER C N     1 
ATOM   3875  C  CA    . SER B 2 64  ? 105.557 -9.734  327.146 1.00 133.47 ? 443 SER C CA    1 
ATOM   3876  C  C     . SER B 2 64  ? 106.462 -10.894 326.732 1.00 146.10 ? 443 SER C C     1 
ATOM   3877  O  O     . SER B 2 64  ? 106.232 -11.541 325.710 1.00 150.49 ? 443 SER C O     1 
ATOM   3878  C  CB    . SER B 2 64  ? 104.231 -9.783  326.381 1.00 130.60 ? 443 SER C CB    1 
ATOM   3879  O  OG    . SER B 2 64  ? 103.271 -8.923  326.973 1.00 123.96 ? 443 SER C OG    1 
ATOM   3880  N  N     . GLY B 2 65  ? 107.488 -11.149 327.540 1.00 151.47 ? 444 GLY C N     1 
ATOM   3881  C  CA    . GLY B 2 65  ? 108.438 -12.217 327.280 1.00 153.06 ? 444 GLY C CA    1 
ATOM   3882  C  C     . GLY B 2 65  ? 109.849 -11.788 327.638 1.00 152.48 ? 444 GLY C C     1 
ATOM   3883  O  O     . GLY B 2 65  ? 110.758 -11.850 326.810 1.00 152.77 ? 444 GLY C O     1 
ATOM   3884  N  N     . ARG B 2 66  ? 110.033 -11.355 328.881 1.00 147.40 ? 445 ARG C N     1 
ATOM   3885  C  CA    . ARG B 2 66  ? 111.288 -10.742 329.289 1.00 135.99 ? 445 ARG C CA    1 
ATOM   3886  C  C     . ARG B 2 66  ? 111.802 -11.236 330.634 1.00 141.49 ? 445 ARG C C     1 
ATOM   3887  O  O     . ARG B 2 66  ? 112.792 -10.709 331.135 1.00 145.81 ? 445 ARG C O     1 
ATOM   3888  C  CB    . ARG B 2 66  ? 111.107 -9.228  329.380 1.00 121.21 ? 445 ARG C CB    1 
ATOM   3889  C  CG    . ARG B 2 66  ? 110.253 -8.792  330.566 1.00 118.73 ? 445 ARG C CG    1 
ATOM   3890  C  CD    . ARG B 2 66  ? 109.765 -7.364  330.409 1.00 110.68 ? 445 ARG C CD    1 
ATOM   3891  N  NE    . ARG B 2 66  ? 109.265 -6.810  331.666 1.00 99.22  ? 445 ARG C NE    1 
ATOM   3892  C  CZ    . ARG B 2 66  ? 108.020 -6.955  332.108 1.00 98.97  ? 445 ARG C CZ    1 
ATOM   3893  N  NH1   . ARG B 2 66  ? 107.137 -7.643  331.400 1.00 107.85 ? 445 ARG C NH1   1 
ATOM   3894  N  NH2   . ARG B 2 66  ? 107.660 -6.413  333.262 1.00 102.03 ? 445 ARG C NH2   1 
ATOM   3895  N  N     . ASN B 2 67  ? 111.140 -12.234 331.215 1.00 135.46 ? 446 ASN C N     1 
ATOM   3896  C  CA    . ASN B 2 67  ? 111.410 -12.622 332.597 1.00 134.72 ? 446 ASN C CA    1 
ATOM   3897  C  C     . ASN B 2 67  ? 111.243 -11.397 333.493 1.00 125.28 ? 446 ASN C C     1 
ATOM   3898  O  O     . ASN B 2 67  ? 112.214 -10.722 333.834 1.00 113.70 ? 446 ASN C O     1 
ATOM   3899  C  CB    . ASN B 2 67  ? 112.810 -13.234 332.744 1.00 130.87 ? 446 ASN C CB    1 
ATOM   3900  C  CG    . ASN B 2 67  ? 113.188 -13.497 334.192 1.00 129.61 ? 446 ASN C CG    1 
ATOM   3901  O  OD1   . ASN B 2 67  ? 112.333 -13.792 335.027 1.00 134.87 ? 446 ASN C OD1   1 
ATOM   3902  N  ND2   . ASN B 2 67  ? 114.476 -13.384 334.497 1.00 126.84 ? 446 ASN C ND2   1 
ATOM   3903  N  N     . ARG B 2 68  ? 109.999 -11.114 333.864 1.00 123.78 ? 447 ARG C N     1 
ATOM   3904  C  CA    . ARG B 2 68  ? 109.653 -9.863  334.532 1.00 121.34 ? 447 ARG C CA    1 
ATOM   3905  C  C     . ARG B 2 68  ? 110.137 -9.759  335.978 1.00 124.14 ? 447 ARG C C     1 
ATOM   3906  O  O     . ARG B 2 68  ? 109.653 -8.925  336.744 1.00 122.10 ? 447 ARG C O     1 
ATOM   3907  C  CB    . ARG B 2 68  ? 108.143 -9.631  334.456 1.00 97.96  ? 447 ARG C CB    1 
ATOM   3908  C  CG    . ARG B 2 68  ? 107.307 -10.859 334.779 1.00 99.49  ? 447 ARG C CG    1 
ATOM   3909  C  CD    . ARG B 2 68  ? 105.860 -10.630 334.381 1.00 119.94 ? 447 ARG C CD    1 
ATOM   3910  N  NE    . ARG B 2 68  ? 105.366 -9.357  334.894 1.00 127.65 ? 447 ARG C NE    1 
ATOM   3911  C  CZ    . ARG B 2 68  ? 104.186 -8.833  334.582 1.00 137.62 ? 447 ARG C CZ    1 
ATOM   3912  N  NH1   . ARG B 2 68  ? 103.372 -9.473  333.754 1.00 136.94 ? 447 ARG C NH1   1 
ATOM   3913  N  NH2   . ARG B 2 68  ? 103.821 -7.667  335.097 1.00 143.62 ? 447 ARG C NH2   1 
ATOM   3914  N  N     . GLU B 2 69  ? 111.094 -10.604 336.343 1.00 131.35 ? 448 GLU C N     1 
ATOM   3915  C  CA    . GLU B 2 69  ? 111.688 -10.555 337.669 1.00 134.14 ? 448 GLU C CA    1 
ATOM   3916  C  C     . GLU B 2 69  ? 112.883 -9.609  337.691 1.00 133.42 ? 448 GLU C C     1 
ATOM   3917  O  O     . GLU B 2 69  ? 113.098 -8.896  338.670 1.00 140.82 ? 448 GLU C O     1 
ATOM   3918  C  CB    . GLU B 2 69  ? 112.126 -11.953 338.110 1.00 138.01 ? 448 GLU C CB    1 
ATOM   3919  C  CG    . GLU B 2 69  ? 112.907 -11.974 339.417 1.00 146.02 ? 448 GLU C CG    1 
ATOM   3920  C  CD    . GLU B 2 69  ? 113.589 -13.303 339.668 1.00 154.14 ? 448 GLU C CD    1 
ATOM   3921  O  OE1   . GLU B 2 69  ? 114.588 -13.332 340.419 1.00 154.01 ? 448 GLU C OE1   1 
ATOM   3922  O  OE2   . GLU B 2 69  ? 113.126 -14.320 339.113 1.00 156.86 ? 448 GLU C OE2   1 
ATOM   3923  N  N     . PHE B 2 70  ? 113.653 -9.598  336.607 1.00 127.61 ? 449 PHE C N     1 
ATOM   3924  C  CA    . PHE B 2 70  ? 114.903 -8.843  336.580 1.00 122.90 ? 449 PHE C CA    1 
ATOM   3925  C  C     . PHE B 2 70  ? 115.078 -7.952  335.349 1.00 122.26 ? 449 PHE C C     1 
ATOM   3926  O  O     . PHE B 2 70  ? 116.086 -7.260  335.222 1.00 125.88 ? 449 PHE C O     1 
ATOM   3927  C  CB    . PHE B 2 70  ? 116.097 -9.793  336.700 1.00 116.77 ? 449 PHE C CB    1 
ATOM   3928  N  N     . GLN B 2 71  ? 114.108 -7.960  334.442 1.00 113.40 ? 450 GLN C N     1 
ATOM   3929  C  CA    . GLN B 2 71  ? 114.246 -7.179  333.215 1.00 100.37 ? 450 GLN C CA    1 
ATOM   3930  C  C     . GLN B 2 71  ? 113.135 -6.151  333.024 1.00 103.12 ? 450 GLN C C     1 
ATOM   3931  O  O     . GLN B 2 71  ? 111.955 -6.497  332.961 1.00 99.02  ? 450 GLN C O     1 
ATOM   3932  C  CB    . GLN B 2 71  ? 114.358 -8.099  331.994 1.00 97.21  ? 450 GLN C CB    1 
ATOM   3933  C  CG    . GLN B 2 71  ? 115.513 -9.086  332.087 1.00 102.89 ? 450 GLN C CG    1 
ATOM   3934  C  CD    . GLN B 2 71  ? 115.947 -9.637  330.740 1.00 100.41 ? 450 GLN C CD    1 
ATOM   3935  O  OE1   . GLN B 2 71  ? 115.131 -10.112 329.954 1.00 92.64  ? 450 GLN C OE1   1 
ATOM   3936  N  NE2   . GLN B 2 71  ? 117.246 -9.579  330.472 1.00 102.36 ? 450 GLN C NE2   1 
ATOM   3937  N  N     . ALA B 2 72  ? 113.531 -4.883  332.939 1.00 106.34 ? 451 ALA C N     1 
ATOM   3938  C  CA    . ALA B 2 72  ? 112.595 -3.786  332.718 1.00 111.08 ? 451 ALA C CA    1 
ATOM   3939  C  C     . ALA B 2 72  ? 112.681 -3.269  331.283 1.00 118.40 ? 451 ALA C C     1 
ATOM   3940  O  O     . ALA B 2 72  ? 113.722 -3.380  330.637 1.00 122.15 ? 451 ALA C O     1 
ATOM   3941  C  CB    . ALA B 2 72  ? 112.858 -2.660  333.706 1.00 112.91 ? 451 ALA C CB    1 
ATOM   3942  N  N     . ILE B 2 73  ? 111.584 -2.702  330.788 1.00 111.05 ? 452 ILE C N     1 
ATOM   3943  C  CA    . ILE B 2 73  ? 111.523 -2.232  329.406 1.00 91.96  ? 452 ILE C CA    1 
ATOM   3944  C  C     . ILE B 2 73  ? 111.084 -0.775  329.311 1.00 94.29  ? 452 ILE C C     1 
ATOM   3945  O  O     . ILE B 2 73  ? 110.001 -0.424  329.768 1.00 95.54  ? 452 ILE C O     1 
ATOM   3946  C  CB    . ILE B 2 73  ? 110.540 -3.075  328.570 1.00 94.11  ? 452 ILE C CB    1 
ATOM   3947  C  CG1   . ILE B 2 73  ? 110.896 -4.559  328.652 1.00 95.22  ? 452 ILE C CG1   1 
ATOM   3948  C  CG2   . ILE B 2 73  ? 110.524 -2.600  327.129 1.00 103.04 ? 452 ILE C CG2   1 
ATOM   3949  C  CD1   . ILE B 2 73  ? 112.295 -4.887  328.185 1.00 101.25 ? 452 ILE C CD1   1 
ATOM   3950  N  N     . LEU B 2 74  ? 111.917 0.068   328.704 1.00 98.82  ? 453 LEU C N     1 
ATOM   3951  C  CA    . LEU B 2 74  ? 111.577 1.477   328.519 1.00 103.08 ? 453 LEU C CA    1 
ATOM   3952  C  C     . LEU B 2 74  ? 111.543 1.835   327.035 1.00 105.00 ? 453 LEU C C     1 
ATOM   3953  O  O     . LEU B 2 74  ? 112.588 1.912   326.387 1.00 114.91 ? 453 LEU C O     1 
ATOM   3954  C  CB    . LEU B 2 74  ? 112.581 2.375   329.246 1.00 106.79 ? 453 LEU C CB    1 
ATOM   3955  C  CG    . LEU B 2 74  ? 112.131 3.749   329.761 1.00 105.19 ? 453 LEU C CG    1 
ATOM   3956  C  CD1   . LEU B 2 74  ? 113.122 4.827   329.343 1.00 108.47 ? 453 LEU C CD1   1 
ATOM   3957  C  CD2   . LEU B 2 74  ? 110.714 4.113   329.322 1.00 100.18 ? 453 LEU C CD2   1 
ATOM   3958  N  N     . PRO B 2 75  ? 110.333 2.045   326.492 1.00 102.78 ? 454 PRO C N     1 
ATOM   3959  C  CA    . PRO B 2 75  ? 110.141 2.482   325.106 1.00 96.29  ? 454 PRO C CA    1 
ATOM   3960  C  C     . PRO B 2 75  ? 110.458 3.961   324.909 1.00 105.47 ? 454 PRO C C     1 
ATOM   3961  O  O     . PRO B 2 75  ? 109.786 4.814   325.489 1.00 106.48 ? 454 PRO C O     1 
ATOM   3962  C  CB    . PRO B 2 75  ? 108.642 2.244   324.867 1.00 82.81  ? 454 PRO C CB    1 
ATOM   3963  C  CG    . PRO B 2 75  ? 108.213 1.295   325.941 1.00 111.84 ? 454 PRO C CG    1 
ATOM   3964  C  CD    . PRO B 2 75  ? 109.062 1.648   327.119 1.00 110.13 ? 454 PRO C CD    1 
ATOM   3965  N  N     . ILE B 2 76  ? 111.479 4.249   324.107 1.00 113.27 ? 455 ILE C N     1 
ATOM   3966  C  CA    . ILE B 2 76  ? 111.766 5.606   323.663 1.00 109.29 ? 455 ILE C CA    1 
ATOM   3967  C  C     . ILE B 2 76  ? 111.124 5.798   322.294 1.00 115.17 ? 455 ILE C C     1 
ATOM   3968  O  O     . ILE B 2 76  ? 111.395 5.042   321.362 1.00 112.44 ? 455 ILE C O     1 
ATOM   3969  C  CB    . ILE B 2 76  ? 113.281 5.866   323.565 1.00 87.14  ? 455 ILE C CB    1 
ATOM   3970  N  N     . ARG B 2 77  ? 110.265 6.805   322.178 1.00 119.09 ? 456 ARG C N     1 
ATOM   3971  C  CA    . ARG B 2 77  ? 109.498 7.015   320.954 1.00 112.38 ? 456 ARG C CA    1 
ATOM   3972  C  C     . ARG B 2 77  ? 110.183 7.973   319.980 1.00 114.16 ? 456 ARG C C     1 
ATOM   3973  O  O     . ARG B 2 77  ? 110.472 9.121   320.316 1.00 98.85  ? 456 ARG C O     1 
ATOM   3974  C  CB    . ARG B 2 77  ? 108.091 7.517   321.286 1.00 97.32  ? 456 ARG C CB    1 
ATOM   3975  N  N     . GLY B 2 78  ? 110.444 7.484   318.772 1.00 119.90 ? 457 GLY C N     1 
ATOM   3976  C  CA    . GLY B 2 78  ? 110.980 8.313   317.708 1.00 114.78 ? 457 GLY C CA    1 
ATOM   3977  C  C     . GLY B 2 78  ? 112.468 8.576   317.810 1.00 108.59 ? 457 GLY C C     1 
ATOM   3978  O  O     . GLY B 2 78  ? 113.192 7.860   318.502 1.00 105.24 ? 457 GLY C O     1 
ATOM   3979  N  N     . LYS B 2 79  ? 112.924 9.610   317.111 1.00 109.94 ? 458 LYS C N     1 
ATOM   3980  C  CA    . LYS B 2 79  ? 114.331 9.983   317.119 1.00 112.05 ? 458 LYS C CA    1 
ATOM   3981  C  C     . LYS B 2 79  ? 114.626 10.942  318.264 1.00 116.83 ? 458 LYS C C     1 
ATOM   3982  O  O     . LYS B 2 79  ? 114.217 12.103  318.230 1.00 108.20 ? 458 LYS C O     1 
ATOM   3983  C  CB    . LYS B 2 79  ? 114.722 10.617  315.781 1.00 103.18 ? 458 LYS C CB    1 
ATOM   3984  N  N     . ILE B 2 80  ? 115.333 10.446  319.277 1.00 119.93 ? 459 ILE C N     1 
ATOM   3985  C  CA    . ILE B 2 80  ? 115.685 11.257  320.439 1.00 114.28 ? 459 ILE C CA    1 
ATOM   3986  C  C     . ILE B 2 80  ? 116.509 12.473  320.032 1.00 119.84 ? 459 ILE C C     1 
ATOM   3987  O  O     . ILE B 2 80  ? 117.220 12.448  319.027 1.00 121.06 ? 459 ILE C O     1 
ATOM   3988  C  CB    . ILE B 2 80  ? 116.456 10.444  321.498 1.00 96.74  ? 459 ILE C CB    1 
ATOM   3989  N  N     . LEU B 2 81  ? 116.392 13.537  320.818 1.00 87.34  ? 460 LEU C N     1 
ATOM   3990  C  CA    . LEU B 2 81  ? 117.052 14.800  320.524 1.00 120.09 ? 460 LEU C CA    1 
ATOM   3991  C  C     . LEU B 2 81  ? 118.572 14.694  320.562 1.00 116.51 ? 460 LEU C C     1 
ATOM   3992  O  O     . LEU B 2 81  ? 119.146 14.132  321.493 1.00 104.45 ? 460 LEU C O     1 
ATOM   3993  C  CB    . LEU B 2 81  ? 116.581 15.882  321.500 1.00 89.88  ? 460 LEU C CB    1 
ATOM   3994  N  N     . ASN B 2 82  ? 119.216 15.228  319.532 1.00 114.46 ? 461 ASN C N     1 
ATOM   3995  C  CA    . ASN B 2 82  ? 120.667 15.329  319.509 1.00 119.81 ? 461 ASN C CA    1 
ATOM   3996  C  C     . ASN B 2 82  ? 121.096 16.496  320.385 1.00 125.08 ? 461 ASN C C     1 
ATOM   3997  O  O     . ASN B 2 82  ? 120.951 17.657  320.002 1.00 131.29 ? 461 ASN C O     1 
ATOM   3998  C  CB    . ASN B 2 82  ? 121.171 15.520  318.078 1.00 124.43 ? 461 ASN C CB    1 
ATOM   3999  C  CG    . ASN B 2 82  ? 122.684 15.507  317.982 1.00 127.38 ? 461 ASN C CG    1 
ATOM   4000  O  OD1   . ASN B 2 82  ? 123.379 15.191  318.947 1.00 124.02 ? 461 ASN C OD1   1 
ATOM   4001  N  ND2   . ASN B 2 82  ? 123.201 15.842  316.808 1.00 128.13 ? 461 ASN C ND2   1 
ATOM   4002  N  N     . VAL B 2 83  ? 121.618 16.177  321.565 1.00 121.49 ? 462 VAL C N     1 
ATOM   4003  C  CA    . VAL B 2 83  ? 121.970 17.183  322.562 1.00 116.46 ? 462 VAL C CA    1 
ATOM   4004  C  C     . VAL B 2 83  ? 123.056 18.149  322.087 1.00 115.09 ? 462 VAL C C     1 
ATOM   4005  O  O     . VAL B 2 83  ? 123.123 19.291  322.543 1.00 125.10 ? 462 VAL C O     1 
ATOM   4006  C  CB    . VAL B 2 83  ? 122.404 16.525  323.889 1.00 120.70 ? 462 VAL C CB    1 
ATOM   4007  C  CG1   . VAL B 2 83  ? 121.234 15.791  324.524 1.00 111.61 ? 462 VAL C CG1   1 
ATOM   4008  C  CG2   . VAL B 2 83  ? 123.571 15.575  323.658 1.00 125.38 ? 462 VAL C CG2   1 
ATOM   4009  N  N     . GLU B 2 84  ? 123.905 17.686  321.175 1.00 110.76 ? 463 GLU C N     1 
ATOM   4010  C  CA    . GLU B 2 84  ? 124.945 18.531  320.597 1.00 115.91 ? 463 GLU C CA    1 
ATOM   4011  C  C     . GLU B 2 84  ? 124.328 19.663  319.782 1.00 121.60 ? 463 GLU C C     1 
ATOM   4012  O  O     . GLU B 2 84  ? 124.863 20.770  319.732 1.00 119.39 ? 463 GLU C O     1 
ATOM   4013  C  CB    . GLU B 2 84  ? 125.881 17.699  319.719 1.00 117.66 ? 463 GLU C CB    1 
ATOM   4014  C  CG    . GLU B 2 84  ? 126.709 16.673  320.479 1.00 124.41 ? 463 GLU C CG    1 
ATOM   4015  C  CD    . GLU B 2 84  ? 128.102 17.172  320.815 1.00 142.06 ? 463 GLU C CD    1 
ATOM   4016  O  OE1   . GLU B 2 84  ? 128.565 18.132  320.165 1.00 146.10 ? 463 GLU C OE1   1 
ATOM   4017  O  OE2   . GLU B 2 84  ? 128.737 16.602  321.727 1.00 151.02 ? 463 GLU C OE2   1 
ATOM   4018  N  N     . LYS B 2 85  ? 123.196 19.374  319.147 1.00 131.19 ? 464 LYS C N     1 
ATOM   4019  C  CA    . LYS B 2 85  ? 122.489 20.361  318.340 1.00 127.75 ? 464 LYS C CA    1 
ATOM   4020  C  C     . LYS B 2 85  ? 121.205 20.804  319.034 1.00 134.51 ? 464 LYS C C     1 
ATOM   4021  O  O     . LYS B 2 85  ? 120.138 20.849  318.418 1.00 144.31 ? 464 LYS C O     1 
ATOM   4022  C  CB    . LYS B 2 85  ? 122.169 19.787  316.958 1.00 105.90 ? 464 LYS C CB    1 
ATOM   4023  N  N     . ALA B 2 86  ? 121.311 21.125  320.319 1.00 123.22 ? 465 ALA C N     1 
ATOM   4024  C  CA    . ALA B 2 86  ? 120.147 21.529  321.097 1.00 126.41 ? 465 ALA C CA    1 
ATOM   4025  C  C     . ALA B 2 86  ? 120.533 22.390  322.294 1.00 135.81 ? 465 ALA C C     1 
ATOM   4026  O  O     . ALA B 2 86  ? 121.613 22.236  322.863 1.00 140.76 ? 465 ALA C O     1 
ATOM   4027  C  CB    . ALA B 2 86  ? 119.370 20.306  321.558 1.00 127.07 ? 465 ALA C CB    1 
ATOM   4028  N  N     . SER B 2 87  ? 119.641 23.300  322.670 1.00 134.44 ? 466 SER C N     1 
ATOM   4029  C  CA    . SER B 2 87  ? 119.840 24.116  323.858 1.00 136.73 ? 466 SER C CA    1 
ATOM   4030  C  C     . SER B 2 87  ? 119.554 23.282  325.098 1.00 150.95 ? 466 SER C C     1 
ATOM   4031  O  O     . SER B 2 87  ? 118.772 22.335  325.047 1.00 151.21 ? 466 SER C O     1 
ATOM   4032  C  CB    . SER B 2 87  ? 118.923 25.341  323.826 1.00 128.30 ? 466 SER C CB    1 
ATOM   4033  N  N     . MET B 2 88  ? 120.191 23.636  326.210 1.00 158.32 ? 467 MET C N     1 
ATOM   4034  C  CA    . MET B 2 88  ? 119.971 22.937  327.472 1.00 156.30 ? 467 MET C CA    1 
ATOM   4035  C  C     . MET B 2 88  ? 118.540 23.161  327.944 1.00 152.07 ? 467 MET C C     1 
ATOM   4036  O  O     . MET B 2 88  ? 117.958 22.322  328.633 1.00 156.86 ? 467 MET C O     1 
ATOM   4037  C  CB    . MET B 2 88  ? 120.966 23.414  328.535 1.00 160.81 ? 467 MET C CB    1 
ATOM   4038  C  CG    . MET B 2 88  ? 120.959 22.590  329.814 1.00 107.54 ? 467 MET C CG    1 
ATOM   4039  N  N     . ASP B 2 89  ? 117.980 24.303  327.557 1.00 144.05 ? 468 ASP C N     1 
ATOM   4040  C  CA    . ASP B 2 89  ? 116.590 24.626  327.847 1.00 135.35 ? 468 ASP C CA    1 
ATOM   4041  C  C     . ASP B 2 89  ? 115.666 23.680  327.089 1.00 129.61 ? 468 ASP C C     1 
ATOM   4042  O  O     . ASP B 2 89  ? 114.549 23.402  327.525 1.00 122.39 ? 468 ASP C O     1 
ATOM   4043  C  CB    . ASP B 2 89  ? 116.290 26.076  327.463 1.00 127.32 ? 468 ASP C CB    1 
ATOM   4044  N  N     . LYS B 2 90  ? 116.144 23.186  325.951 1.00 133.72 ? 469 LYS C N     1 
ATOM   4045  C  CA    . LYS B 2 90  ? 115.393 22.221  325.159 1.00 136.53 ? 469 LYS C CA    1 
ATOM   4046  C  C     . LYS B 2 90  ? 115.610 20.810  325.700 1.00 129.43 ? 469 LYS C C     1 
ATOM   4047  O  O     . LYS B 2 90  ? 114.727 19.954  325.604 1.00 127.78 ? 469 LYS C O     1 
ATOM   4048  C  CB    . LYS B 2 90  ? 115.810 22.293  323.688 1.00 134.07 ? 469 LYS C CB    1 
ATOM   4049  N  N     . ILE B 2 91  ? 116.788 20.576  326.272 1.00 121.03 ? 470 ILE C N     1 
ATOM   4050  C  CA    . ILE B 2 91  ? 117.119 19.277  326.844 1.00 110.60 ? 470 ILE C CA    1 
ATOM   4051  C  C     . ILE B 2 91  ? 116.292 19.012  328.099 1.00 111.39 ? 470 ILE C C     1 
ATOM   4052  O  O     . ILE B 2 91  ? 115.682 17.950  328.243 1.00 116.83 ? 470 ILE C O     1 
ATOM   4053  C  CB    . ILE B 2 91  ? 118.613 19.185  327.196 1.00 116.32 ? 470 ILE C CB    1 
ATOM   4054  C  CG1   . ILE B 2 91  ? 119.473 19.339  325.938 1.00 122.68 ? 470 ILE C CG1   1 
ATOM   4055  C  CG2   . ILE B 2 91  ? 118.914 17.865  327.887 1.00 106.87 ? 470 ILE C CG2   1 
ATOM   4056  C  CD1   . ILE B 2 91  ? 120.959 19.392  326.215 1.00 125.78 ? 470 ILE C CD1   1 
ATOM   4057  N  N     . LEU B 2 92  ? 116.266 19.991  328.998 1.00 118.20 ? 471 LEU C N     1 
ATOM   4058  C  CA    . LEU B 2 92  ? 115.525 19.876  330.249 1.00 123.73 ? 471 LEU C CA    1 
ATOM   4059  C  C     . LEU B 2 92  ? 114.018 19.951  330.019 1.00 126.95 ? 471 LEU C C     1 
ATOM   4060  O  O     . LEU B 2 92  ? 113.228 19.731  330.938 1.00 131.67 ? 471 LEU C O     1 
ATOM   4061  C  CB    . LEU B 2 92  ? 115.968 20.962  331.237 1.00 116.40 ? 471 LEU C CB    1 
ATOM   4062  N  N     . ALA B 2 93  ? 113.621 20.258  328.788 1.00 122.86 ? 472 ALA C N     1 
ATOM   4063  C  CA    . ALA B 2 93  ? 112.207 20.343  328.444 1.00 122.46 ? 472 ALA C CA    1 
ATOM   4064  C  C     . ALA B 2 93  ? 111.705 19.022  327.871 1.00 121.03 ? 472 ALA C C     1 
ATOM   4065  O  O     . ALA B 2 93  ? 110.604 18.576  328.196 1.00 114.18 ? 472 ALA C O     1 
ATOM   4066  C  CB    . ALA B 2 93  ? 111.968 21.474  327.462 1.00 121.53 ? 472 ALA C CB    1 
ATOM   4067  N  N     . ASN B 2 94  ? 112.520 18.408  327.016 1.00 125.91 ? 473 ASN C N     1 
ATOM   4068  C  CA    . ASN B 2 94  ? 112.185 17.134  326.384 1.00 122.89 ? 473 ASN C CA    1 
ATOM   4069  C  C     . ASN B 2 94  ? 111.840 16.045  327.398 1.00 122.17 ? 473 ASN C C     1 
ATOM   4070  O  O     . ASN B 2 94  ? 112.584 15.813  328.349 1.00 128.79 ? 473 ASN C O     1 
ATOM   4071  C  CB    . ASN B 2 94  ? 113.329 16.675  325.477 1.00 119.89 ? 473 ASN C CB    1 
ATOM   4072  C  CG    . ASN B 2 94  ? 113.110 15.282  324.919 1.00 117.22 ? 473 ASN C CG    1 
ATOM   4073  O  OD1   . ASN B 2 94  ? 113.666 14.307  325.421 1.00 115.69 ? 473 ASN C OD1   1 
ATOM   4074  N  ND2   . ASN B 2 94  ? 112.291 15.182  323.880 1.00 113.61 ? 473 ASN C ND2   1 
ATOM   4075  N  N     . GLU B 2 95  ? 110.708 15.380  327.183 1.00 114.63 ? 474 GLU C N     1 
ATOM   4076  C  CA    . GLU B 2 95  ? 110.165 14.443  328.163 1.00 115.15 ? 474 GLU C CA    1 
ATOM   4077  C  C     . GLU B 2 95  ? 110.649 13.004  327.981 1.00 121.95 ? 474 GLU C C     1 
ATOM   4078  O  O     . GLU B 2 95  ? 110.459 12.168  328.865 1.00 131.83 ? 474 GLU C O     1 
ATOM   4079  C  CB    . GLU B 2 95  ? 108.634 14.485  328.148 1.00 108.02 ? 474 GLU C CB    1 
ATOM   4080  N  N     . GLU B 2 96  ? 111.265 12.711  326.839 1.00 117.91 ? 475 GLU C N     1 
ATOM   4081  C  CA    . GLU B 2 96  ? 111.807 11.377  326.594 1.00 117.27 ? 475 GLU C CA    1 
ATOM   4082  C  C     . GLU B 2 96  ? 113.069 11.146  327.421 1.00 118.79 ? 475 GLU C C     1 
ATOM   4083  O  O     . GLU B 2 96  ? 113.181 10.154  328.150 1.00 125.49 ? 475 GLU C O     1 
ATOM   4084  C  CB    . GLU B 2 96  ? 112.097 11.175  325.106 1.00 128.44 ? 475 GLU C CB    1 
ATOM   4085  C  CG    . GLU B 2 96  ? 110.853 11.096  324.233 1.00 136.70 ? 475 GLU C CG    1 
ATOM   4086  C  CD    . GLU B 2 96  ? 110.039 9.838   324.481 1.00 138.12 ? 475 GLU C CD    1 
ATOM   4087  O  OE1   . GLU B 2 96  ? 110.193 8.868   323.710 1.00 137.10 ? 475 GLU C OE1   1 
ATOM   4088  O  OE2   . GLU B 2 96  ? 109.246 9.818   325.446 1.00 138.84 ? 475 GLU C OE2   1 
ATOM   4089  N  N     . ILE B 2 97  ? 114.015 12.073  327.296 1.00 121.33 ? 476 ILE C N     1 
ATOM   4090  C  CA    . ILE B 2 97  ? 115.228 12.051  328.101 1.00 125.22 ? 476 ILE C CA    1 
ATOM   4091  C  C     . ILE B 2 97  ? 114.854 12.126  329.576 1.00 125.13 ? 476 ILE C C     1 
ATOM   4092  O  O     . ILE B 2 97  ? 115.451 11.448  330.410 1.00 122.13 ? 476 ILE C O     1 
ATOM   4093  C  CB    . ILE B 2 97  ? 116.164 13.224  327.752 1.00 117.16 ? 476 ILE C CB    1 
ATOM   4094  N  N     . ARG B 2 98  ? 113.850 12.942  329.883 1.00 124.84 ? 477 ARG C N     1 
ATOM   4095  C  CA    . ARG B 2 98  ? 113.350 13.075  331.245 1.00 133.46 ? 477 ARG C CA    1 
ATOM   4096  C  C     . ARG B 2 98  ? 112.837 11.736  331.769 1.00 130.14 ? 477 ARG C C     1 
ATOM   4097  O  O     . ARG B 2 98  ? 113.067 11.382  332.925 1.00 133.42 ? 477 ARG C O     1 
ATOM   4098  C  CB    . ARG B 2 98  ? 112.242 14.129  331.301 1.00 134.11 ? 477 ARG C CB    1 
ATOM   4099  C  CG    . ARG B 2 98  ? 111.711 14.402  332.700 1.00 136.02 ? 477 ARG C CG    1 
ATOM   4100  C  CD    . ARG B 2 98  ? 110.599 15.443  332.681 1.00 140.99 ? 477 ARG C CD    1 
ATOM   4101  N  NE    . ARG B 2 98  ? 111.043 16.714  332.116 1.00 145.46 ? 477 ARG C NE    1 
ATOM   4102  C  CZ    . ARG B 2 98  ? 110.284 17.803  332.035 1.00 147.07 ? 477 ARG C CZ    1 
ATOM   4103  N  NH1   . ARG B 2 98  ? 109.037 17.783  332.486 1.00 145.64 ? 477 ARG C NH1   1 
ATOM   4104  N  NH2   . ARG B 2 98  ? 110.773 18.914  331.503 1.00 148.48 ? 477 ARG C NH2   1 
ATOM   4105  N  N     . SER B 2 99  ? 112.150 10.994  330.905 1.00 121.19 ? 478 SER C N     1 
ATOM   4106  C  CA    . SER B 2 99  ? 111.608 9.691   331.274 1.00 117.19 ? 478 SER C CA    1 
ATOM   4107  C  C     . SER B 2 99  ? 112.730 8.687   331.500 1.00 115.91 ? 478 SER C C     1 
ATOM   4108  O  O     . SER B 2 99  ? 112.663 7.867   332.415 1.00 115.81 ? 478 SER C O     1 
ATOM   4109  C  CB    . SER B 2 99  ? 110.654 9.171   330.196 1.00 113.12 ? 478 SER C CB    1 
ATOM   4110  O  OG    . SER B 2 99  ? 111.371 8.714   329.063 1.00 112.57 ? 478 SER C OG    1 
ATOM   4111  N  N     . LEU B 2 100 ? 113.757 8.753   330.657 1.00 114.64 ? 479 LEU C N     1 
ATOM   4112  C  CA    . LEU B 2 100 ? 114.922 7.885   330.803 1.00 107.51 ? 479 LEU C CA    1 
ATOM   4113  C  C     . LEU B 2 100 ? 115.638 8.131   332.131 1.00 106.93 ? 479 LEU C C     1 
ATOM   4114  O  O     . LEU B 2 100 ? 115.916 7.191   332.884 1.00 115.76 ? 479 LEU C O     1 
ATOM   4115  C  CB    . LEU B 2 100 ? 115.890 8.081   329.634 1.00 97.49  ? 479 LEU C CB    1 
ATOM   4116  C  CG    . LEU B 2 100 ? 117.262 7.414   329.769 1.00 99.71  ? 479 LEU C CG    1 
ATOM   4117  C  CD1   . LEU B 2 100 ? 117.131 5.917   330.011 1.00 102.45 ? 479 LEU C CD1   1 
ATOM   4118  C  CD2   . LEU B 2 100 ? 118.108 7.685   328.540 1.00 101.50 ? 479 LEU C CD2   1 
ATOM   4119  N  N     . PHE B 2 101 ? 115.937 9.397   332.408 1.00 99.57  ? 480 PHE C N     1 
ATOM   4120  C  CA    . PHE B 2 101 ? 116.581 9.777   333.660 1.00 107.88 ? 480 PHE C CA    1 
ATOM   4121  C  C     . PHE B 2 101 ? 115.726 9.392   334.866 1.00 116.07 ? 480 PHE C C     1 
ATOM   4122  O  O     . PHE B 2 101 ? 116.252 8.977   335.897 1.00 120.72 ? 480 PHE C O     1 
ATOM   4123  C  CB    . PHE B 2 101 ? 116.871 11.280  333.688 1.00 110.47 ? 480 PHE C CB    1 
ATOM   4124  C  CG    . PHE B 2 101 ? 118.142 11.673  332.986 1.00 108.06 ? 480 PHE C CG    1 
ATOM   4125  C  CD1   . PHE B 2 101 ? 119.343 11.717  333.673 1.00 110.15 ? 480 PHE C CD1   1 
ATOM   4126  C  CD2   . PHE B 2 101 ? 118.134 12.019  331.645 1.00 112.03 ? 480 PHE C CD2   1 
ATOM   4127  C  CE1   . PHE B 2 101 ? 120.512 12.087  333.033 1.00 112.45 ? 480 PHE C CE1   1 
ATOM   4128  C  CE2   . PHE B 2 101 ? 119.300 12.389  330.999 1.00 116.51 ? 480 PHE C CE2   1 
ATOM   4129  C  CZ    . PHE B 2 101 ? 120.490 12.424  331.696 1.00 114.59 ? 480 PHE C CZ    1 
ATOM   4130  N  N     . THR B 2 102 ? 114.410 9.536   334.733 1.00 110.56 ? 481 THR C N     1 
ATOM   4131  C  CA    . THR B 2 102 ? 113.488 9.153   335.798 1.00 106.20 ? 481 THR C CA    1 
ATOM   4132  C  C     . THR B 2 102 ? 113.559 7.650   336.043 1.00 109.77 ? 481 THR C C     1 
ATOM   4133  O  O     . THR B 2 102 ? 113.543 7.192   337.187 1.00 113.89 ? 481 THR C O     1 
ATOM   4134  C  CB    . THR B 2 102 ? 112.034 9.546   335.464 1.00 105.89 ? 481 THR C CB    1 
ATOM   4135  O  OG1   . THR B 2 102 ? 111.960 10.956  335.221 1.00 115.07 ? 481 THR C OG1   1 
ATOM   4136  C  CG2   . THR B 2 102 ? 111.102 9.181   336.610 1.00 102.93 ? 481 THR C CG2   1 
ATOM   4137  N  N     . ALA B 2 103 ? 113.650 6.890   334.957 1.00 117.61 ? 482 ALA C N     1 
ATOM   4138  C  CA    . ALA B 2 103 ? 113.740 5.438   335.040 1.00 116.90 ? 482 ALA C CA    1 
ATOM   4139  C  C     . ALA B 2 103 ? 115.045 5.008   335.699 1.00 118.03 ? 482 ALA C C     1 
ATOM   4140  O  O     . ALA B 2 103 ? 115.080 4.025   336.438 1.00 127.17 ? 482 ALA C O     1 
ATOM   4141  C  CB    . ALA B 2 103 ? 113.612 4.819   333.660 1.00 109.00 ? 482 ALA C CB    1 
ATOM   4142  N  N     . MET B 2 104 ? 116.116 5.746   335.426 1.00 113.23 ? 483 MET C N     1 
ATOM   4143  C  CA    . MET B 2 104 ? 117.412 5.447   336.027 1.00 123.13 ? 483 MET C CA    1 
ATOM   4144  C  C     . MET B 2 104 ? 117.478 5.895   337.485 1.00 129.48 ? 483 MET C C     1 
ATOM   4145  O  O     . MET B 2 104 ? 118.162 5.278   338.302 1.00 125.92 ? 483 MET C O     1 
ATOM   4146  C  CB    . MET B 2 104 ? 118.541 6.092   335.222 1.00 130.81 ? 483 MET C CB    1 
ATOM   4147  C  CG    . MET B 2 104 ? 118.797 5.425   333.882 1.00 137.59 ? 483 MET C CG    1 
ATOM   4148  S  SD    . MET B 2 104 ? 119.298 3.703   334.070 1.00 123.82 ? 483 MET C SD    1 
ATOM   4149  C  CE    . MET B 2 104 ? 120.797 3.897   335.032 1.00 98.38  ? 483 MET C CE    1 
ATOM   4150  N  N     . GLY B 2 105 ? 116.761 6.969   337.805 1.00 133.52 ? 484 GLY C N     1 
ATOM   4151  C  CA    . GLY B 2 105 ? 116.753 7.515   339.151 1.00 131.95 ? 484 GLY C CA    1 
ATOM   4152  C  C     . GLY B 2 105 ? 118.131 7.964   339.602 1.00 130.60 ? 484 GLY C C     1 
ATOM   4153  O  O     . GLY B 2 105 ? 118.451 7.925   340.790 1.00 138.09 ? 484 GLY C O     1 
ATOM   4154  N  N     . THR B 2 106 ? 118.944 8.394   338.643 1.00 121.75 ? 485 THR C N     1 
ATOM   4155  C  CA    . THR B 2 106 ? 120.315 8.815   338.909 1.00 123.07 ? 485 THR C CA    1 
ATOM   4156  C  C     . THR B 2 106 ? 120.404 10.297  339.269 1.00 135.18 ? 485 THR C C     1 
ATOM   4157  O  O     . THR B 2 106 ? 121.102 10.679  340.209 1.00 137.61 ? 485 THR C O     1 
ATOM   4158  C  CB    . THR B 2 106 ? 121.227 8.512   337.696 1.00 122.18 ? 485 THR C CB    1 
ATOM   4159  O  OG1   . THR B 2 106 ? 121.734 7.176   337.802 1.00 118.14 ? 485 THR C OG1   1 
ATOM   4160  C  CG2   . THR B 2 106 ? 122.395 9.487   337.624 1.00 130.90 ? 485 THR C CG2   1 
ATOM   4161  N  N     . GLY B 2 107 ? 119.683 11.125  338.523 1.00 139.82 ? 486 GLY C N     1 
ATOM   4162  C  CA    . GLY B 2 107 ? 119.755 12.564  338.694 1.00 149.09 ? 486 GLY C CA    1 
ATOM   4163  C  C     . GLY B 2 107 ? 120.346 13.210  337.458 1.00 153.51 ? 486 GLY C C     1 
ATOM   4164  O  O     . GLY B 2 107 ? 120.867 12.519  336.581 1.00 149.93 ? 486 GLY C O     1 
ATOM   4165  N  N     . PHE B 2 108 ? 120.272 14.534  337.382 1.00 154.72 ? 487 PHE C N     1 
ATOM   4166  C  CA    . PHE B 2 108 ? 120.735 15.244  336.196 1.00 148.59 ? 487 PHE C CA    1 
ATOM   4167  C  C     . PHE B 2 108 ? 121.896 16.191  336.491 1.00 153.23 ? 487 PHE C C     1 
ATOM   4168  O  O     . PHE B 2 108 ? 121.781 17.094  337.321 1.00 153.16 ? 487 PHE C O     1 
ATOM   4169  C  CB    . PHE B 2 108 ? 119.580 16.010  335.546 1.00 146.77 ? 487 PHE C CB    1 
ATOM   4170  C  CG    . PHE B 2 108 ? 119.849 16.424  334.126 1.00 150.58 ? 487 PHE C CG    1 
ATOM   4171  C  CD1   . PHE B 2 108 ? 119.518 15.585  333.075 1.00 147.01 ? 487 PHE C CD1   1 
ATOM   4172  C  CD2   . PHE B 2 108 ? 120.435 17.647  333.842 1.00 150.68 ? 487 PHE C CD2   1 
ATOM   4173  C  CE1   . PHE B 2 108 ? 119.764 15.957  331.767 1.00 141.67 ? 487 PHE C CE1   1 
ATOM   4174  C  CE2   . PHE B 2 108 ? 120.685 18.025  332.535 1.00 149.83 ? 487 PHE C CE2   1 
ATOM   4175  C  CZ    . PHE B 2 108 ? 120.348 17.179  331.496 1.00 144.81 ? 487 PHE C CZ    1 
ATOM   4176  N  N     . GLY B 2 109 ? 123.012 15.969  335.801 1.00 158.24 ? 488 GLY C N     1 
ATOM   4177  C  CA    . GLY B 2 109 ? 124.177 16.833  335.891 1.00 159.08 ? 488 GLY C CA    1 
ATOM   4178  C  C     . GLY B 2 109 ? 124.715 17.035  337.294 1.00 157.01 ? 488 GLY C C     1 
ATOM   4179  O  O     . GLY B 2 109 ? 125.537 16.257  337.777 1.00 158.99 ? 488 GLY C O     1 
ATOM   4180  N  N     . ALA B 2 110 ? 124.244 18.093  337.947 1.00 158.07 ? 489 ALA C N     1 
ATOM   4181  C  CA    . ALA B 2 110 ? 124.693 18.438  339.291 1.00 162.27 ? 489 ALA C CA    1 
ATOM   4182  C  C     . ALA B 2 110 ? 123.900 17.693  340.361 1.00 161.69 ? 489 ALA C C     1 
ATOM   4183  O  O     . ALA B 2 110 ? 123.512 18.273  341.374 1.00 159.10 ? 489 ALA C O     1 
ATOM   4184  C  CB    . ALA B 2 110 ? 124.599 19.942  339.509 1.00 168.10 ? 489 ALA C CB    1 
ATOM   4185  N  N     . GLU B 2 111 ? 123.671 16.405  340.124 1.00 163.03 ? 490 GLU C N     1 
ATOM   4186  C  CA    . GLU B 2 111 ? 122.955 15.546  341.060 1.00 161.14 ? 490 GLU C CA    1 
ATOM   4187  C  C     . GLU B 2 111 ? 123.127 14.093  340.634 1.00 164.92 ? 490 GLU C C     1 
ATOM   4188  O  O     . GLU B 2 111 ? 122.539 13.186  341.222 1.00 168.37 ? 490 GLU C O     1 
ATOM   4189  C  CB    . GLU B 2 111 ? 121.469 15.909  341.104 1.00 157.76 ? 490 GLU C CB    1 
ATOM   4190  N  N     . PHE B 2 112 ? 123.943 13.886  339.605 1.00 161.77 ? 491 PHE C N     1 
ATOM   4191  C  CA    . PHE B 2 112 ? 124.167 12.559  339.040 1.00 148.80 ? 491 PHE C CA    1 
ATOM   4192  C  C     . PHE B 2 112 ? 124.940 11.651  339.994 1.00 141.99 ? 491 PHE C C     1 
ATOM   4193  O  O     . PHE B 2 112 ? 126.171 11.674  340.034 1.00 142.53 ? 491 PHE C O     1 
ATOM   4194  C  CB    . PHE B 2 112 ? 124.902 12.667  337.701 1.00 135.98 ? 491 PHE C CB    1 
ATOM   4195  N  N     . ASP B 2 113 ? 124.206 10.855  340.764 1.00 133.17 ? 492 ASP C N     1 
ATOM   4196  C  CA    . ASP B 2 113 ? 124.815 9.896   341.675 1.00 132.40 ? 492 ASP C CA    1 
ATOM   4197  C  C     . ASP B 2 113 ? 124.782 8.501   341.062 1.00 122.90 ? 492 ASP C C     1 
ATOM   4198  O  O     . ASP B 2 113 ? 123.717 7.900   340.931 1.00 113.06 ? 492 ASP C O     1 
ATOM   4199  C  CB    . ASP B 2 113 ? 124.090 9.903   343.022 1.00 129.29 ? 492 ASP C CB    1 
ATOM   4200  N  N     . VAL B 2 114 ? 125.949 7.996   340.674 1.00 120.06 ? 493 VAL C N     1 
ATOM   4201  C  CA    . VAL B 2 114 ? 126.042 6.673   340.067 1.00 121.18 ? 493 VAL C CA    1 
ATOM   4202  C  C     . VAL B 2 114 ? 125.739 5.580   341.085 1.00 129.05 ? 493 VAL C C     1 
ATOM   4203  O  O     . VAL B 2 114 ? 125.193 4.531   340.742 1.00 127.39 ? 493 VAL C O     1 
ATOM   4204  C  CB    . VAL B 2 114 ? 127.433 6.424   339.453 1.00 117.23 ? 493 VAL C CB    1 
ATOM   4205  N  N     . SER B 2 115 ? 126.086 5.839   342.342 1.00 135.22 ? 494 SER C N     1 
ATOM   4206  C  CA    . SER B 2 115 ? 125.868 4.879   343.420 1.00 134.23 ? 494 SER C CA    1 
ATOM   4207  C  C     . SER B 2 115 ? 124.431 4.918   343.935 1.00 142.12 ? 494 SER C C     1 
ATOM   4208  O  O     . SER B 2 115 ? 124.155 4.509   345.063 1.00 147.52 ? 494 SER C O     1 
ATOM   4209  C  CB    . SER B 2 115 ? 126.842 5.140   344.568 1.00 124.67 ? 494 SER C CB    1 
ATOM   4210  N  N     . LYS B 2 116 ? 123.520 5.415   343.105 1.00 136.28 ? 495 LYS C N     1 
ATOM   4211  C  CA    . LYS B 2 116 ? 122.109 5.474   343.455 1.00 132.70 ? 495 LYS C CA    1 
ATOM   4212  C  C     . LYS B 2 116 ? 121.247 5.183   342.234 1.00 132.83 ? 495 LYS C C     1 
ATOM   4213  O  O     . LYS B 2 116 ? 120.160 5.742   342.082 1.00 134.56 ? 495 LYS C O     1 
ATOM   4214  C  CB    . LYS B 2 116 ? 121.754 6.846   344.031 1.00 130.69 ? 495 LYS C CB    1 
ATOM   4215  N  N     . ALA B 2 117 ? 121.743 4.312   341.361 1.00 131.69 ? 496 ALA C N     1 
ATOM   4216  C  CA    . ALA B 2 117 ? 121.010 3.928   340.162 1.00 127.28 ? 496 ALA C CA    1 
ATOM   4217  C  C     . ALA B 2 117 ? 120.073 2.763   340.453 1.00 129.56 ? 496 ALA C C     1 
ATOM   4218  O  O     . ALA B 2 117 ? 120.162 2.128   341.502 1.00 143.06 ? 496 ALA C O     1 
ATOM   4219  C  CB    . ALA B 2 117 ? 121.972 3.571   339.039 1.00 117.85 ? 496 ALA C CB    1 
ATOM   4220  N  N     . ARG B 2 118 ? 119.176 2.485   339.516 1.00 119.81 ? 497 ARG C N     1 
ATOM   4221  C  CA    . ARG B 2 118 ? 118.194 1.423   339.692 1.00 116.93 ? 497 ARG C CA    1 
ATOM   4222  C  C     . ARG B 2 118 ? 118.556 0.195   338.865 1.00 117.95 ? 497 ARG C C     1 
ATOM   4223  O  O     . ARG B 2 118 ? 118.062 -0.904  339.115 1.00 115.75 ? 497 ARG C O     1 
ATOM   4224  C  CB    . ARG B 2 118 ? 116.796 1.928   339.329 1.00 102.25 ? 497 ARG C CB    1 
ATOM   4225  C  CG    . ARG B 2 118 ? 116.369 3.149   340.127 1.00 103.55 ? 497 ARG C CG    1 
ATOM   4226  C  CD    . ARG B 2 118 ? 114.949 3.581   339.793 1.00 127.69 ? 497 ARG C CD    1 
ATOM   4227  N  NE    . ARG B 2 118 ? 113.975 2.529   340.068 1.00 131.72 ? 497 ARG C NE    1 
ATOM   4228  C  CZ    . ARG B 2 118 ? 113.287 1.885   339.131 1.00 130.72 ? 497 ARG C CZ    1 
ATOM   4229  N  NH1   . ARG B 2 118 ? 113.459 2.188   337.853 1.00 135.69 ? 497 ARG C NH1   1 
ATOM   4230  N  NH2   . ARG B 2 118 ? 112.420 0.943   339.473 1.00 122.34 ? 497 ARG C NH2   1 
ATOM   4231  N  N     . TYR B 2 119 ? 119.420 0.392   337.875 1.00 121.91 ? 498 TYR C N     1 
ATOM   4232  C  CA    . TYR B 2 119 ? 119.896 -0.700  337.037 1.00 118.19 ? 498 TYR C CA    1 
ATOM   4233  C  C     . TYR B 2 119 ? 121.369 -0.485  336.708 1.00 120.92 ? 498 TYR C C     1 
ATOM   4234  O  O     . TYR B 2 119 ? 121.758 0.595   336.262 1.00 124.50 ? 498 TYR C O     1 
ATOM   4235  C  CB    . TYR B 2 119 ? 119.093 -0.782  335.734 1.00 111.51 ? 498 TYR C CB    1 
ATOM   4236  C  CG    . TYR B 2 119 ? 117.599 -0.580  335.886 1.00 110.72 ? 498 TYR C CG    1 
ATOM   4237  C  CD1   . TYR B 2 119 ? 117.041 0.689   335.802 1.00 113.01 ? 498 TYR C CD1   1 
ATOM   4238  C  CD2   . TYR B 2 119 ? 116.746 -1.657  336.096 1.00 111.10 ? 498 TYR C CD2   1 
ATOM   4239  C  CE1   . TYR B 2 119 ? 115.678 0.883   335.933 1.00 115.06 ? 498 TYR C CE1   1 
ATOM   4240  C  CE2   . TYR B 2 119 ? 115.379 -1.473  336.228 1.00 114.77 ? 498 TYR C CE2   1 
ATOM   4241  C  CZ    . TYR B 2 119 ? 114.852 -0.200  336.145 1.00 114.02 ? 498 TYR C CZ    1 
ATOM   4242  O  OH    . TYR B 2 119 ? 113.496 -0.006  336.276 1.00 108.27 ? 498 TYR C OH    1 
ATOM   4243  N  N     . GLN B 2 120 ? 122.186 -1.510  336.930 1.00 124.50 ? 499 GLN C N     1 
ATOM   4244  C  CA    . GLN B 2 120 ? 123.602 -1.438  336.582 1.00 128.27 ? 499 GLN C CA    1 
ATOM   4245  C  C     . GLN B 2 120 ? 123.857 -2.072  335.220 1.00 126.64 ? 499 GLN C C     1 
ATOM   4246  O  O     . GLN B 2 120 ? 125.004 -2.264  334.816 1.00 127.62 ? 499 GLN C O     1 
ATOM   4247  C  CB    . GLN B 2 120 ? 124.460 -2.123  337.645 1.00 132.91 ? 499 GLN C CB    1 
ATOM   4248  N  N     . LYS B 2 121 ? 122.780 -2.401  334.517 1.00 123.19 ? 500 LYS C N     1 
ATOM   4249  C  CA    . LYS B 2 121 ? 122.891 -2.977  333.184 1.00 119.60 ? 500 LYS C CA    1 
ATOM   4250  C  C     . LYS B 2 121 ? 121.862 -2.356  332.250 1.00 129.02 ? 500 LYS C C     1 
ATOM   4251  O  O     . LYS B 2 121 ? 120.721 -2.817  332.160 1.00 135.10 ? 500 LYS C O     1 
ATOM   4252  C  CB    . LYS B 2 121 ? 122.732 -4.498  333.236 1.00 115.22 ? 500 LYS C CB    1 
ATOM   4253  C  CG    . LYS B 2 121 ? 123.237 -5.209  331.991 1.00 117.22 ? 500 LYS C CG    1 
ATOM   4254  C  CD    . LYS B 2 121 ? 123.487 -6.685  332.253 1.00 97.61  ? 500 LYS C CD    1 
ATOM   4255  N  N     . LEU B 2 122 ? 122.275 -1.294  331.566 1.00 127.49 ? 501 LEU C N     1 
ATOM   4256  C  CA    . LEU B 2 122 ? 121.405 -0.582  330.639 1.00 114.79 ? 501 LEU C CA    1 
ATOM   4257  C  C     . LEU B 2 122 ? 121.655 -1.043  329.207 1.00 109.02 ? 501 LEU C C     1 
ATOM   4258  O  O     . LEU B 2 122 ? 122.651 -0.667  328.587 1.00 113.73 ? 501 LEU C O     1 
ATOM   4259  C  CB    . LEU B 2 122 ? 121.633 0.926   330.752 1.00 110.33 ? 501 LEU C CB    1 
ATOM   4260  C  CG    . LEU B 2 122 ? 120.749 1.816   329.879 1.00 106.41 ? 501 LEU C CG    1 
ATOM   4261  C  CD1   . LEU B 2 122 ? 119.308 1.801   330.369 1.00 106.77 ? 501 LEU C CD1   1 
ATOM   4262  C  CD2   . LEU B 2 122 ? 121.295 3.235   329.840 1.00 107.54 ? 501 LEU C CD2   1 
ATOM   4263  N  N     . VAL B 2 123 ? 120.743 -1.856  328.686 1.00 104.24 ? 502 VAL C N     1 
ATOM   4264  C  CA    . VAL B 2 123 ? 120.888 -2.406  327.346 1.00 111.32 ? 502 VAL C CA    1 
ATOM   4265  C  C     . VAL B 2 123 ? 120.226 -1.519  326.299 1.00 123.35 ? 502 VAL C C     1 
ATOM   4266  O  O     . VAL B 2 123 ? 119.050 -1.177  326.419 1.00 127.95 ? 502 VAL C O     1 
ATOM   4267  C  CB    . VAL B 2 123 ? 120.278 -3.812  327.251 1.00 112.60 ? 502 VAL C CB    1 
ATOM   4268  C  CG1   . VAL B 2 123 ? 120.638 -4.459  325.920 1.00 112.90 ? 502 VAL C CG1   1 
ATOM   4269  C  CG2   . VAL B 2 123 ? 120.748 -4.669  328.414 1.00 113.90 ? 502 VAL C CG2   1 
ATOM   4270  N  N     . LEU B 2 124 ? 120.988 -1.143  325.276 1.00 120.64 ? 503 LEU C N     1 
ATOM   4271  C  CA    . LEU B 2 124 ? 120.435 -0.404  324.147 1.00 100.98 ? 503 LEU C CA    1 
ATOM   4272  C  C     . LEU B 2 124 ? 119.925 -1.389  323.108 1.00 103.40 ? 503 LEU C C     1 
ATOM   4273  O  O     . LEU B 2 124 ? 120.711 -2.037  322.418 1.00 116.45 ? 503 LEU C O     1 
ATOM   4274  C  CB    . LEU B 2 124 ? 121.489 0.515   323.529 1.00 87.63  ? 503 LEU C CB    1 
ATOM   4275  C  CG    . LEU B 2 124 ? 122.053 1.620   324.425 1.00 99.84  ? 503 LEU C CG    1 
ATOM   4276  C  CD1   . LEU B 2 124 ? 122.980 2.526   323.628 1.00 97.68  ? 503 LEU C CD1   1 
ATOM   4277  C  CD2   . LEU B 2 124 ? 120.938 2.417   325.094 1.00 93.69  ? 503 LEU C CD2   1 
ATOM   4278  N  N     . MET B 2 125 ? 118.606 -1.499  323.000 1.00 105.16 ? 504 MET C N     1 
ATOM   4279  C  CA    . MET B 2 125 ? 117.996 -2.485  322.116 1.00 107.85 ? 504 MET C CA    1 
ATOM   4280  C  C     . MET B 2 125 ? 117.242 -1.819  320.973 1.00 113.17 ? 504 MET C C     1 
ATOM   4281  O  O     . MET B 2 125 ? 116.031 -1.988  320.834 1.00 112.58 ? 504 MET C O     1 
ATOM   4282  C  CB    . MET B 2 125 ? 117.054 -3.384  322.911 1.00 103.91 ? 504 MET C CB    1 
ATOM   4283  C  CG    . MET B 2 125 ? 116.881 -4.770  322.327 1.00 89.91  ? 504 MET C CG    1 
ATOM   4284  S  SD    . MET B 2 125 ? 115.844 -5.799  323.369 1.00 105.79 ? 504 MET C SD    1 
ATOM   4285  C  CE    . MET B 2 125 ? 116.208 -7.409  322.689 1.00 157.93 ? 504 MET C CE    1 
ATOM   4286  N  N     . THR B 2 126 ? 117.966 -1.061  320.158 1.00 116.92 ? 505 THR C N     1 
ATOM   4287  C  CA    . THR B 2 126 ? 117.369 -0.384  319.015 1.00 114.84 ? 505 THR C CA    1 
ATOM   4288  C  C     . THR B 2 126 ? 117.056 -1.377  317.900 1.00 120.66 ? 505 THR C C     1 
ATOM   4289  O  O     . THR B 2 126 ? 117.572 -2.494  317.893 1.00 122.26 ? 505 THR C O     1 
ATOM   4290  C  CB    . THR B 2 126 ? 118.293 0.723   318.480 1.00 111.00 ? 505 THR C CB    1 
ATOM   4291  O  OG1   . THR B 2 126 ? 119.632 0.221   318.384 1.00 119.58 ? 505 THR C OG1   1 
ATOM   4292  C  CG2   . THR B 2 126 ? 118.283 1.921   319.415 1.00 106.48 ? 505 THR C CG2   1 
ATOM   4293  N  N     . ASP B 2 127 ? 116.200 -0.964  316.968 1.00 125.50 ? 506 ASP C N     1 
ATOM   4294  C  CA    . ASP B 2 127 ? 115.829 -1.803  315.831 1.00 126.14 ? 506 ASP C CA    1 
ATOM   4295  C  C     . ASP B 2 127 ? 117.029 -2.126  314.945 1.00 117.35 ? 506 ASP C C     1 
ATOM   4296  O  O     . ASP B 2 127 ? 118.053 -1.443  314.989 1.00 113.53 ? 506 ASP C O     1 
ATOM   4297  C  CB    . ASP B 2 127 ? 114.721 -1.140  315.007 1.00 131.17 ? 506 ASP C CB    1 
ATOM   4298  C  CG    . ASP B 2 127 ? 113.332 -1.482  315.514 1.00 133.61 ? 506 ASP C CG    1 
ATOM   4299  O  OD1   . ASP B 2 127 ? 113.036 -2.685  315.676 1.00 131.88 ? 506 ASP C OD1   1 
ATOM   4300  O  OD2   . ASP B 2 127 ? 112.535 -0.550  315.752 1.00 136.10 ? 506 ASP C OD2   1 
ATOM   4301  N  N     . ALA B 2 128 ? 116.888 -3.169  314.135 1.00 111.72 ? 507 ALA C N     1 
ATOM   4302  C  CA    . ALA B 2 128 ? 117.996 -3.676  313.333 1.00 117.49 ? 507 ALA C CA    1 
ATOM   4303  C  C     . ALA B 2 128 ? 118.113 -3.012  311.961 1.00 132.58 ? 507 ALA C C     1 
ATOM   4304  O  O     . ALA B 2 128 ? 118.866 -3.475  311.105 1.00 136.11 ? 507 ALA C O     1 
ATOM   4305  C  CB    . ALA B 2 128 ? 117.893 -5.192  313.190 1.00 105.18 ? 507 ALA C CB    1 
ATOM   4306  N  N     . ASP B 2 129 ? 117.369 -1.932  311.750 1.00 131.78 ? 508 ASP C N     1 
ATOM   4307  C  CA    . ASP B 2 129 ? 117.502 -1.164  310.518 1.00 127.93 ? 508 ASP C CA    1 
ATOM   4308  C  C     . ASP B 2 129 ? 118.496 -0.022  310.706 1.00 129.38 ? 508 ASP C C     1 
ATOM   4309  O  O     . ASP B 2 129 ? 119.146 0.077   311.746 1.00 135.09 ? 508 ASP C O     1 
ATOM   4310  C  CB    . ASP B 2 129 ? 116.146 -0.639  310.039 1.00 129.02 ? 508 ASP C CB    1 
ATOM   4311  C  CG    . ASP B 2 129 ? 115.192 -0.352  311.179 1.00 129.47 ? 508 ASP C CG    1 
ATOM   4312  O  OD1   . ASP B 2 129 ? 115.331 0.710   311.821 1.00 134.18 ? 508 ASP C OD1   1 
ATOM   4313  O  OD2   . ASP B 2 129 ? 114.297 -1.188  311.428 1.00 122.22 ? 508 ASP C OD2   1 
ATOM   4314  N  N     . VAL B 2 130 ? 118.617 0.834   309.697 1.00 122.13 ? 509 VAL C N     1 
ATOM   4315  C  CA    . VAL B 2 130 ? 119.576 1.933   309.745 1.00 116.97 ? 509 VAL C CA    1 
ATOM   4316  C  C     . VAL B 2 130 ? 119.112 3.057   310.672 1.00 108.95 ? 509 VAL C C     1 
ATOM   4317  O  O     . VAL B 2 130 ? 119.924 3.723   311.325 1.00 102.77 ? 509 VAL C O     1 
ATOM   4318  C  CB    . VAL B 2 130 ? 119.862 2.492   308.338 1.00 120.33 ? 509 VAL C CB    1 
ATOM   4319  C  CG1   . VAL B 2 130 ? 120.626 1.467   307.512 1.00 127.59 ? 509 VAL C CG1   1 
ATOM   4320  C  CG2   . VAL B 2 130 ? 118.569 2.882   307.641 1.00 112.96 ? 509 VAL C CG2   1 
ATOM   4321  N  N     . ASP B 2 131 ? 117.800 3.257   310.732 1.00 106.28 ? 510 ASP C N     1 
ATOM   4322  C  CA    . ASP B 2 131 ? 117.219 4.249   311.624 1.00 112.30 ? 510 ASP C CA    1 
ATOM   4323  C  C     . ASP B 2 131 ? 117.444 3.821   313.067 1.00 120.78 ? 510 ASP C C     1 
ATOM   4324  O  O     . ASP B 2 131 ? 117.562 4.654   313.963 1.00 120.12 ? 510 ASP C O     1 
ATOM   4325  C  CB    . ASP B 2 131 ? 115.728 4.407   311.341 1.00 115.47 ? 510 ASP C CB    1 
ATOM   4326  C  CG    . ASP B 2 131 ? 115.438 4.658   309.874 1.00 127.41 ? 510 ASP C CG    1 
ATOM   4327  O  OD1   . ASP B 2 131 ? 115.412 5.836   309.462 1.00 128.55 ? 510 ASP C OD1   1 
ATOM   4328  O  OD2   . ASP B 2 131 ? 115.233 3.673   309.133 1.00 135.01 ? 510 ASP C OD2   1 
ATOM   4329  N  N     . GLY B 2 132 ? 117.503 2.510   313.281 1.00 117.92 ? 511 GLY C N     1 
ATOM   4330  C  CA    . GLY B 2 132 ? 117.841 1.960   314.579 1.00 114.69 ? 511 GLY C CA    1 
ATOM   4331  C  C     . GLY B 2 132 ? 119.257 2.338   314.963 1.00 113.00 ? 511 GLY C C     1 
ATOM   4332  O  O     . GLY B 2 132 ? 119.533 2.664   316.117 1.00 123.81 ? 511 GLY C O     1 
ATOM   4333  N  N     . ALA B 2 133 ? 120.157 2.297   313.985 1.00 108.41 ? 512 ALA C N     1 
ATOM   4334  C  CA    . ALA B 2 133 ? 121.533 2.722   314.200 1.00 115.28 ? 512 ALA C CA    1 
ATOM   4335  C  C     . ALA B 2 133 ? 121.572 4.211   314.530 1.00 112.72 ? 512 ALA C C     1 
ATOM   4336  O  O     . ALA B 2 133 ? 122.371 4.652   315.359 1.00 118.11 ? 512 ALA C O     1 
ATOM   4337  C  CB    . ALA B 2 133 ? 122.384 2.422   312.977 1.00 116.80 ? 512 ALA C CB    1 
ATOM   4338  N  N     . HIS B 2 134 ? 120.699 4.980   313.882 1.00 103.89 ? 513 HIS C N     1 
ATOM   4339  C  CA    . HIS B 2 134 ? 120.584 6.410   314.163 1.00 106.54 ? 513 HIS C CA    1 
ATOM   4340  C  C     . HIS B 2 134 ? 120.163 6.657   315.615 1.00 116.53 ? 513 HIS C C     1 
ATOM   4341  O  O     . HIS B 2 134 ? 120.786 7.453   316.328 1.00 116.38 ? 513 HIS C O     1 
ATOM   4342  C  CB    . HIS B 2 134 ? 119.585 7.069   313.205 1.00 101.02 ? 513 HIS C CB    1 
ATOM   4343  C  CG    . HIS B 2 134 ? 119.698 8.561   313.141 1.00 102.04 ? 513 HIS C CG    1 
ATOM   4344  N  ND1   . HIS B 2 134 ? 118.616 9.382   312.907 1.00 107.79 ? 513 HIS C ND1   1 
ATOM   4345  C  CD2   . HIS B 2 134 ? 120.769 9.380   313.271 1.00 98.13  ? 513 HIS C CD2   1 
ATOM   4346  C  CE1   . HIS B 2 134 ? 119.014 10.642  312.903 1.00 109.27 ? 513 HIS C CE1   1 
ATOM   4347  N  NE2   . HIS B 2 134 ? 120.316 10.668  313.121 1.00 101.26 ? 513 HIS C NE2   1 
ATOM   4348  N  N     . ILE B 2 135 ? 119.108 5.968   316.045 1.00 117.24 ? 514 ILE C N     1 
ATOM   4349  C  CA    . ILE B 2 135 ? 118.610 6.089   317.413 1.00 109.28 ? 514 ILE C CA    1 
ATOM   4350  C  C     . ILE B 2 135 ? 119.682 5.676   318.416 1.00 111.21 ? 514 ILE C C     1 
ATOM   4351  O  O     . ILE B 2 135 ? 119.858 6.317   319.451 1.00 119.08 ? 514 ILE C O     1 
ATOM   4352  C  CB    . ILE B 2 135 ? 117.350 5.229   317.642 1.00 105.84 ? 514 ILE C CB    1 
ATOM   4353  C  CG1   . ILE B 2 135 ? 116.237 5.630   316.671 1.00 110.13 ? 514 ILE C CG1   1 
ATOM   4354  C  CG2   . ILE B 2 135 ? 116.862 5.369   319.072 1.00 110.98 ? 514 ILE C CG2   1 
ATOM   4355  C  CD1   . ILE B 2 135 ? 114.996 4.762   316.776 1.00 117.41 ? 514 ILE C CD1   1 
ATOM   4356  N  N     . ARG B 2 136 ? 120.394 4.600   318.096 1.00 105.97 ? 515 ARG C N     1 
ATOM   4357  C  CA    . ARG B 2 136 ? 121.504 4.133   318.915 1.00 107.51 ? 515 ARG C CA    1 
ATOM   4358  C  C     . ARG B 2 136 ? 122.550 5.228   319.066 1.00 109.72 ? 515 ARG C C     1 
ATOM   4359  O  O     . ARG B 2 136 ? 123.062 5.472   320.160 1.00 113.60 ? 515 ARG C O     1 
ATOM   4360  C  CB    . ARG B 2 136 ? 122.143 2.895   318.287 1.00 106.28 ? 515 ARG C CB    1 
ATOM   4361  C  CG    . ARG B 2 136 ? 123.354 2.372   319.041 1.00 116.72 ? 515 ARG C CG    1 
ATOM   4362  C  CD    . ARG B 2 136 ? 124.052 1.280   318.253 1.00 129.10 ? 515 ARG C CD    1 
ATOM   4363  N  NE    . ARG B 2 136 ? 123.096 0.325   317.699 1.00 137.75 ? 515 ARG C NE    1 
ATOM   4364  C  CZ    . ARG B 2 136 ? 123.433 -0.730  316.964 1.00 141.08 ? 515 ARG C CZ    1 
ATOM   4365  N  NH1   . ARG B 2 136 ? 124.708 -0.973  316.694 1.00 143.76 ? 515 ARG C NH1   1 
ATOM   4366  N  NH2   . ARG B 2 136 ? 122.493 -1.542  316.502 1.00 143.02 ? 515 ARG C NH2   1 
ATOM   4367  N  N     . THR B 2 137 ? 122.858 5.885   317.953 1.00 109.25 ? 516 THR C N     1 
ATOM   4368  C  CA    . THR B 2 137 ? 123.812 6.986   317.940 1.00 108.74 ? 516 THR C CA    1 
ATOM   4369  C  C     . THR B 2 137 ? 123.372 8.115   318.871 1.00 114.44 ? 516 THR C C     1 
ATOM   4370  O  O     . THR B 2 137 ? 124.119 8.518   319.768 1.00 120.14 ? 516 THR C O     1 
ATOM   4371  C  CB    . THR B 2 137 ? 124.001 7.534   316.517 1.00 106.88 ? 516 THR C CB    1 
ATOM   4372  O  OG1   . THR B 2 137 ? 124.566 6.513   315.686 1.00 115.24 ? 516 THR C OG1   1 
ATOM   4373  C  CG2   . THR B 2 137 ? 124.921 8.731   316.529 1.00 111.14 ? 516 THR C CG2   1 
ATOM   4374  N  N     . LEU B 2 138 ? 122.154 8.607   318.659 1.00 114.59 ? 517 LEU C N     1 
ATOM   4375  C  CA    . LEU B 2 138 ? 121.589 9.675   319.486 1.00 118.81 ? 517 LEU C CA    1 
ATOM   4376  C  C     . LEU B 2 138 ? 121.622 9.326   320.978 1.00 124.74 ? 517 LEU C C     1 
ATOM   4377  O  O     . LEU B 2 138 ? 122.035 10.139  321.816 1.00 130.02 ? 517 LEU C O     1 
ATOM   4378  C  CB    . LEU B 2 138 ? 120.151 9.964   319.048 1.00 117.66 ? 517 LEU C CB    1 
ATOM   4379  C  CG    . LEU B 2 138 ? 119.957 10.345  317.577 1.00 115.95 ? 517 LEU C CG    1 
ATOM   4380  C  CD1   . LEU B 2 138 ? 118.547 10.012  317.110 1.00 110.84 ? 517 LEU C CD1   1 
ATOM   4381  C  CD2   . LEU B 2 138 ? 120.258 11.820  317.362 1.00 116.64 ? 517 LEU C CD2   1 
ATOM   4382  N  N     . LEU B 2 139 ? 121.192 8.107   321.294 1.00 118.12 ? 518 LEU C N     1 
ATOM   4383  C  CA    . LEU B 2 139 ? 121.192 7.611   322.666 1.00 109.47 ? 518 LEU C CA    1 
ATOM   4384  C  C     . LEU B 2 139 ? 122.597 7.595   323.260 1.00 112.36 ? 518 LEU C C     1 
ATOM   4385  O  O     . LEU B 2 139 ? 122.790 7.953   324.422 1.00 114.78 ? 518 LEU C O     1 
ATOM   4386  C  CB    . LEU B 2 139 ? 120.584 6.208   322.725 1.00 101.65 ? 518 LEU C CB    1 
ATOM   4387  C  CG    . LEU B 2 139 ? 119.061 6.109   322.632 1.00 97.76  ? 518 LEU C CG    1 
ATOM   4388  C  CD1   . LEU B 2 139 ? 118.624 4.668   322.407 1.00 87.83  ? 518 LEU C CD1   1 
ATOM   4389  C  CD2   . LEU B 2 139 ? 118.420 6.675   323.891 1.00 95.56  ? 518 LEU C CD2   1 
ATOM   4390  N  N     . LEU B 2 140 ? 123.573 7.178   322.459 1.00 110.28 ? 519 LEU C N     1 
ATOM   4391  C  CA    . LEU B 2 140 ? 124.961 7.149   322.905 1.00 107.22 ? 519 LEU C CA    1 
ATOM   4392  C  C     . LEU B 2 140 ? 125.497 8.552   323.171 1.00 119.05 ? 519 LEU C C     1 
ATOM   4393  O  O     . LEU B 2 140 ? 126.288 8.759   324.094 1.00 124.09 ? 519 LEU C O     1 
ATOM   4394  C  CB    . LEU B 2 140 ? 125.846 6.415   321.894 1.00 108.83 ? 519 LEU C CB    1 
ATOM   4395  C  CG    . LEU B 2 140 ? 125.786 4.886   321.934 1.00 108.36 ? 519 LEU C CG    1 
ATOM   4396  C  CD1   . LEU B 2 140 ? 126.658 4.277   320.851 1.00 112.02 ? 519 LEU C CD1   1 
ATOM   4397  C  CD2   . LEU B 2 140 ? 126.207 4.384   323.304 1.00 97.22  ? 519 LEU C CD2   1 
ATOM   4398  N  N     . THR B 2 141 ? 125.063 9.515   322.362 1.00 128.28 ? 520 THR C N     1 
ATOM   4399  C  CA    . THR B 2 141 ? 125.435 10.909  322.587 1.00 130.19 ? 520 THR C CA    1 
ATOM   4400  C  C     . THR B 2 141 ? 124.861 11.393  323.911 1.00 129.79 ? 520 THR C C     1 
ATOM   4401  O  O     . THR B 2 141 ? 125.561 12.017  324.714 1.00 135.97 ? 520 THR C O     1 
ATOM   4402  C  CB    . THR B 2 141 ? 124.937 11.828  321.459 1.00 135.29 ? 520 THR C CB    1 
ATOM   4403  O  OG1   . THR B 2 141 ? 123.504 11.852  321.454 1.00 144.33 ? 520 THR C OG1   1 
ATOM   4404  C  CG2   . THR B 2 141 ? 125.434 11.333  320.120 1.00 132.82 ? 520 THR C CG2   1 
ATOM   4405  N  N     . LEU B 2 142 ? 123.585 11.092  324.133 1.00 126.54 ? 521 LEU C N     1 
ATOM   4406  C  CA    . LEU B 2 142 ? 122.915 11.458  325.376 1.00 122.42 ? 521 LEU C CA    1 
ATOM   4407  C  C     . LEU B 2 142 ? 123.629 10.867  326.592 1.00 123.02 ? 521 LEU C C     1 
ATOM   4408  O  O     . LEU B 2 142 ? 123.843 11.550  327.598 1.00 124.50 ? 521 LEU C O     1 
ATOM   4409  C  CB    . LEU B 2 142 ? 121.463 10.981  325.347 1.00 118.71 ? 521 LEU C CB    1 
ATOM   4410  C  CG    . LEU B 2 142 ? 120.594 11.320  326.558 1.00 112.21 ? 521 LEU C CG    1 
ATOM   4411  C  CD1   . LEU B 2 142 ? 120.336 12.816  326.629 1.00 114.60 ? 521 LEU C CD1   1 
ATOM   4412  C  CD2   . LEU B 2 142 ? 119.285 10.548  326.513 1.00 103.41 ? 521 LEU C CD2   1 
ATOM   4413  N  N     . ILE B 2 143 ? 124.003 9.596   326.479 1.00 123.97 ? 522 ILE C N     1 
ATOM   4414  C  CA    . ILE B 2 143 ? 124.622 8.865   327.578 1.00 121.90 ? 522 ILE C CA    1 
ATOM   4415  C  C     . ILE B 2 143 ? 126.046 9.330   327.863 1.00 127.41 ? 522 ILE C C     1 
ATOM   4416  O  O     . ILE B 2 143 ? 126.471 9.366   329.015 1.00 134.25 ? 522 ILE C O     1 
ATOM   4417  C  CB    . ILE B 2 143 ? 124.639 7.348   327.306 1.00 105.34 ? 522 ILE C CB    1 
ATOM   4418  N  N     . TYR B 2 144 ? 126.786 9.680   326.818 1.00 125.28 ? 523 TYR C N     1 
ATOM   4419  C  CA    . TYR B 2 144 ? 128.157 10.140  327.004 1.00 131.61 ? 523 TYR C CA    1 
ATOM   4420  C  C     . TYR B 2 144 ? 128.196 11.583  327.496 1.00 132.21 ? 523 TYR C C     1 
ATOM   4421  O  O     . TYR B 2 144 ? 129.115 11.978  328.215 1.00 133.79 ? 523 TYR C O     1 
ATOM   4422  C  CB    . TYR B 2 144 ? 128.962 10.003  325.709 1.00 137.44 ? 523 TYR C CB    1 
ATOM   4423  C  CG    . TYR B 2 144 ? 130.401 10.459  325.831 1.00 142.95 ? 523 TYR C CG    1 
ATOM   4424  C  CD1   . TYR B 2 144 ? 131.389 9.593   326.283 1.00 143.50 ? 523 TYR C CD1   1 
ATOM   4425  C  CD2   . TYR B 2 144 ? 130.773 11.754  325.489 1.00 146.81 ? 523 TYR C CD2   1 
ATOM   4426  C  CE1   . TYR B 2 144 ? 132.706 10.006  326.396 1.00 148.03 ? 523 TYR C CE1   1 
ATOM   4427  C  CE2   . TYR B 2 144 ? 132.084 12.175  325.599 1.00 152.33 ? 523 TYR C CE2   1 
ATOM   4428  C  CZ    . TYR B 2 144 ? 133.047 11.299  326.053 1.00 153.02 ? 523 TYR C CZ    1 
ATOM   4429  O  OH    . TYR B 2 144 ? 134.355 11.717  326.161 1.00 152.59 ? 523 TYR C OH    1 
ATOM   4430  N  N     . ARG B 2 145 ? 127.194 12.366  327.112 1.00 130.24 ? 524 ARG C N     1 
ATOM   4431  C  CA    . ARG B 2 145 ? 127.197 13.795  327.413 1.00 135.18 ? 524 ARG C CA    1 
ATOM   4432  C  C     . ARG B 2 145 ? 126.469 14.167  328.705 1.00 141.68 ? 524 ARG C C     1 
ATOM   4433  O  O     . ARG B 2 145 ? 126.723 15.229  329.274 1.00 147.71 ? 524 ARG C O     1 
ATOM   4434  C  CB    . ARG B 2 145 ? 126.620 14.593  326.241 1.00 128.80 ? 524 ARG C CB    1 
ATOM   4435  N  N     . TYR B 2 146 ? 125.567 13.306  329.171 1.00 137.54 ? 525 TYR C N     1 
ATOM   4436  C  CA    . TYR B 2 146 ? 124.771 13.642  330.350 1.00 133.45 ? 525 TYR C CA    1 
ATOM   4437  C  C     . TYR B 2 146 ? 124.564 12.483  331.327 1.00 134.62 ? 525 TYR C C     1 
ATOM   4438  O  O     . TYR B 2 146 ? 123.872 12.628  332.335 1.00 134.64 ? 525 TYR C O     1 
ATOM   4439  C  CB    . TYR B 2 146 ? 123.427 14.249  329.934 1.00 128.26 ? 525 TYR C CB    1 
ATOM   4440  C  CG    . TYR B 2 146 ? 123.563 15.609  329.284 1.00 136.12 ? 525 TYR C CG    1 
ATOM   4441  C  CD1   . TYR B 2 146 ? 123.622 15.740  327.902 1.00 144.65 ? 525 TYR C CD1   1 
ATOM   4442  C  CD2   . TYR B 2 146 ? 123.646 16.761  330.054 1.00 139.48 ? 525 TYR C CD2   1 
ATOM   4443  C  CE1   . TYR B 2 146 ? 123.752 16.980  327.306 1.00 148.19 ? 525 TYR C CE1   1 
ATOM   4444  C  CE2   . TYR B 2 146 ? 123.776 18.007  329.467 1.00 143.69 ? 525 TYR C CE2   1 
ATOM   4445  C  CZ    . TYR B 2 146 ? 123.828 18.110  328.093 1.00 149.37 ? 525 TYR C CZ    1 
ATOM   4446  O  OH    . TYR B 2 146 ? 123.958 19.345  327.501 1.00 154.09 ? 525 TYR C OH    1 
ATOM   4447  N  N     . MET B 2 147 ? 125.167 11.338  331.026 1.00 132.87 ? 526 MET C N     1 
ATOM   4448  C  CA    . MET B 2 147 ? 125.150 10.196  331.935 1.00 126.24 ? 526 MET C CA    1 
ATOM   4449  C  C     . MET B 2 147 ? 126.523 9.536   331.954 1.00 123.44 ? 526 MET C C     1 
ATOM   4450  O  O     . MET B 2 147 ? 126.633 8.317   332.076 1.00 119.89 ? 526 MET C O     1 
ATOM   4451  C  CB    . MET B 2 147 ? 124.091 9.174   331.513 1.00 122.60 ? 526 MET C CB    1 
ATOM   4452  C  CG    . MET B 2 147 ? 122.660 9.680   331.588 1.00 123.83 ? 526 MET C CG    1 
ATOM   4453  S  SD    . MET B 2 147 ? 121.442 8.399   331.228 1.00 145.14 ? 526 MET C SD    1 
ATOM   4454  C  CE    . MET B 2 147 ? 121.728 7.268   332.585 1.00 97.32  ? 526 MET C CE    1 
ATOM   4455  N  N     . LYS B 2 148 ? 127.564 10.352  331.827 1.00 122.38 ? 527 LYS C N     1 
ATOM   4456  C  CA    . LYS B 2 148 ? 128.934 9.858   331.663 1.00 127.62 ? 527 LYS C CA    1 
ATOM   4457  C  C     . LYS B 2 148 ? 129.433 8.839   332.704 1.00 132.75 ? 527 LYS C C     1 
ATOM   4458  O  O     . LYS B 2 148 ? 130.120 7.884   332.336 1.00 137.34 ? 527 LYS C O     1 
ATOM   4459  C  CB    . LYS B 2 148 ? 129.921 11.025  331.523 1.00 132.23 ? 527 LYS C CB    1 
ATOM   4460  C  CG    . LYS B 2 148 ? 131.287 10.616  331.001 1.00 133.31 ? 527 LYS C CG    1 
ATOM   4461  C  CD    . LYS B 2 148 ? 132.034 11.801  330.419 1.00 137.27 ? 527 LYS C CD    1 
ATOM   4462  C  CE    . LYS B 2 148 ? 133.336 11.362  329.773 1.00 144.99 ? 527 LYS C CE    1 
ATOM   4463  N  NZ    . LYS B 2 148 ? 134.028 12.496  329.098 1.00 150.24 ? 527 LYS C NZ    1 
ATOM   4464  N  N     . PRO B 2 149 ? 129.109 9.035   333.998 1.00 132.82 ? 528 PRO C N     1 
ATOM   4465  C  CA    . PRO B 2 149 ? 129.529 8.017   334.970 1.00 130.98 ? 528 PRO C CA    1 
ATOM   4466  C  C     . PRO B 2 149 ? 128.961 6.628   334.684 1.00 139.62 ? 528 PRO C C     1 
ATOM   4467  O  O     . PRO B 2 149 ? 129.632 5.633   334.960 1.00 146.03 ? 528 PRO C O     1 
ATOM   4468  C  CB    . PRO B 2 149 ? 128.968 8.548   336.290 1.00 127.41 ? 528 PRO C CB    1 
ATOM   4469  C  CG    . PRO B 2 149 ? 128.947 10.016  336.110 1.00 132.20 ? 528 PRO C CG    1 
ATOM   4470  C  CD    . PRO B 2 149 ? 128.575 10.234  334.672 1.00 135.91 ? 528 PRO C CD    1 
ATOM   4471  N  N     . ILE B 2 150 ? 127.745 6.567   334.147 1.00 137.94 ? 529 ILE C N     1 
ATOM   4472  C  CA    . ILE B 2 150 ? 127.110 5.295   333.810 1.00 129.50 ? 529 ILE C CA    1 
ATOM   4473  C  C     . ILE B 2 150 ? 127.951 4.507   332.808 1.00 131.81 ? 529 ILE C C     1 
ATOM   4474  O  O     . ILE B 2 150 ? 128.198 3.315   332.992 1.00 127.37 ? 529 ILE C O     1 
ATOM   4475  C  CB    . ILE B 2 150 ? 125.689 5.505   333.244 1.00 126.51 ? 529 ILE C CB    1 
ATOM   4476  C  CG1   . ILE B 2 150 ? 124.779 6.122   334.304 1.00 125.88 ? 529 ILE C CG1   1 
ATOM   4477  C  CG2   . ILE B 2 150 ? 125.103 4.192   332.761 1.00 132.49 ? 529 ILE C CG2   1 
ATOM   4478  C  CD1   . ILE B 2 150 ? 124.498 5.204   335.473 1.00 128.70 ? 529 ILE C CD1   1 
ATOM   4479  N  N     . LEU B 2 151 ? 128.396 5.184   331.754 1.00 138.02 ? 530 LEU C N     1 
ATOM   4480  C  CA    . LEU B 2 151 ? 129.262 4.566   330.757 1.00 139.83 ? 530 LEU C CA    1 
ATOM   4481  C  C     . LEU B 2 151 ? 130.642 4.288   331.343 1.00 143.85 ? 530 LEU C C     1 
ATOM   4482  O  O     . LEU B 2 151 ? 131.301 3.317   330.972 1.00 142.63 ? 530 LEU C O     1 
ATOM   4483  C  CB    . LEU B 2 151 ? 129.385 5.461   329.522 1.00 137.61 ? 530 LEU C CB    1 
ATOM   4484  N  N     . GLU B 2 152 ? 131.071 5.146   332.263 1.00 147.30 ? 531 GLU C N     1 
ATOM   4485  C  CA    . GLU B 2 152 ? 132.373 5.005   332.904 1.00 147.21 ? 531 GLU C CA    1 
ATOM   4486  C  C     . GLU B 2 152 ? 132.401 3.800   333.838 1.00 152.30 ? 531 GLU C C     1 
ATOM   4487  O  O     . GLU B 2 152 ? 133.399 3.083   333.913 1.00 157.63 ? 531 GLU C O     1 
ATOM   4488  C  CB    . GLU B 2 152 ? 132.728 6.278   333.677 1.00 141.20 ? 531 GLU C CB    1 
ATOM   4489  N  N     . ALA B 2 153 ? 131.297 3.583   334.545 1.00 151.35 ? 532 ALA C N     1 
ATOM   4490  C  CA    . ALA B 2 153 ? 131.187 2.463   335.473 1.00 152.60 ? 532 ALA C CA    1 
ATOM   4491  C  C     . ALA B 2 153 ? 131.010 1.144   334.727 1.00 151.63 ? 532 ALA C C     1 
ATOM   4492  O  O     . ALA B 2 153 ? 131.178 0.067   335.300 1.00 151.06 ? 532 ALA C O     1 
ATOM   4493  C  CB    . ALA B 2 153 ? 130.035 2.687   336.443 1.00 148.48 ? 532 ALA C CB    1 
ATOM   4494  N  N     . GLY B 2 154 ? 130.671 1.238   333.445 1.00 149.17 ? 533 GLY C N     1 
ATOM   4495  C  CA    . GLY B 2 154 ? 130.477 0.064   332.615 1.00 149.40 ? 533 GLY C CA    1 
ATOM   4496  C  C     . GLY B 2 154 ? 129.087 -0.523  332.757 1.00 149.81 ? 533 GLY C C     1 
ATOM   4497  O  O     . GLY B 2 154 ? 128.925 -1.739  332.858 1.00 151.30 ? 533 GLY C O     1 
ATOM   4498  N  N     . TYR B 2 155 ? 128.080 0.345   332.765 1.00 147.04 ? 534 TYR C N     1 
ATOM   4499  C  CA    . TYR B 2 155 ? 126.694 -0.089  332.900 1.00 144.42 ? 534 TYR C CA    1 
ATOM   4500  C  C     . TYR B 2 155 ? 125.988 -0.142  331.549 1.00 142.20 ? 534 TYR C C     1 
ATOM   4501  O  O     . TYR B 2 155 ? 124.956 -0.796  331.407 1.00 144.94 ? 534 TYR C O     1 
ATOM   4502  C  CB    . TYR B 2 155 ? 125.919 0.844   333.833 1.00 143.25 ? 534 TYR C CB    1 
ATOM   4503  C  CG    . TYR B 2 155 ? 126.360 0.818   335.279 1.00 143.19 ? 534 TYR C CG    1 
ATOM   4504  C  CD1   . TYR B 2 155 ? 125.933 1.797   336.166 1.00 145.43 ? 534 TYR C CD1   1 
ATOM   4505  C  CD2   . TYR B 2 155 ? 127.196 -0.183  335.760 1.00 144.45 ? 534 TYR C CD2   1 
ATOM   4506  C  CE1   . TYR B 2 155 ? 126.325 1.784   337.488 1.00 146.13 ? 534 TYR C CE1   1 
ATOM   4507  C  CE2   . TYR B 2 155 ? 127.595 -0.204  337.084 1.00 147.31 ? 534 TYR C CE2   1 
ATOM   4508  C  CZ    . TYR B 2 155 ? 127.155 0.783   337.943 1.00 146.05 ? 534 TYR C CZ    1 
ATOM   4509  O  OH    . TYR B 2 155 ? 127.548 0.768   339.262 1.00 146.68 ? 534 TYR C OH    1 
ATOM   4510  N  N     . VAL B 2 156 ? 126.541 0.555   330.562 1.00 135.27 ? 535 VAL C N     1 
ATOM   4511  C  CA    . VAL B 2 156 ? 125.905 0.654   329.252 1.00 127.10 ? 535 VAL C CA    1 
ATOM   4512  C  C     . VAL B 2 156 ? 126.250 -0.526  328.352 1.00 122.93 ? 535 VAL C C     1 
ATOM   4513  O  O     . VAL B 2 156 ? 127.403 -0.703  327.957 1.00 116.13 ? 535 VAL C O     1 
ATOM   4514  C  CB    . VAL B 2 156 ? 126.295 1.955   328.527 1.00 124.26 ? 535 VAL C CB    1 
ATOM   4515  C  CG1   . VAL B 2 156 ? 125.578 2.047   327.186 1.00 118.99 ? 535 VAL C CG1   1 
ATOM   4516  C  CG2   . VAL B 2 156 ? 125.972 3.158   329.389 1.00 121.31 ? 535 VAL C CG2   1 
ATOM   4517  N  N     . TYR B 2 157 ? 125.240 -1.325  328.025 1.00 127.05 ? 536 TYR C N     1 
ATOM   4518  C  CA    . TYR B 2 157 ? 125.425 -2.461  327.133 1.00 131.44 ? 536 TYR C CA    1 
ATOM   4519  C  C     . TYR B 2 157 ? 124.582 -2.305  325.871 1.00 129.57 ? 536 TYR C C     1 
ATOM   4520  O  O     . TYR B 2 157 ? 123.572 -1.604  325.867 1.00 133.65 ? 536 TYR C O     1 
ATOM   4521  C  CB    . TYR B 2 157 ? 125.083 -3.772  327.847 1.00 134.90 ? 536 TYR C CB    1 
ATOM   4522  C  CG    . TYR B 2 157 ? 125.999 -4.101  329.008 1.00 139.89 ? 536 TYR C CG    1 
ATOM   4523  C  CD1   . TYR B 2 157 ? 127.071 -4.970  328.849 1.00 143.97 ? 536 TYR C CD1   1 
ATOM   4524  C  CD2   . TYR B 2 157 ? 125.790 -3.544  330.262 1.00 144.79 ? 536 TYR C CD2   1 
ATOM   4525  C  CE1   . TYR B 2 157 ? 127.909 -5.275  329.908 1.00 148.01 ? 536 TYR C CE1   1 
ATOM   4526  C  CE2   . TYR B 2 157 ? 126.623 -3.840  331.326 1.00 154.66 ? 536 TYR C CE2   1 
ATOM   4527  C  CZ    . TYR B 2 157 ? 127.680 -4.706  331.143 1.00 156.10 ? 536 TYR C CZ    1 
ATOM   4528  O  OH    . TYR B 2 157 ? 128.509 -5.002  332.202 1.00 158.39 ? 536 TYR C OH    1 
ATOM   4529  N  N     . ILE B 2 158 ? 125.013 -2.956  324.797 1.00 125.93 ? 537 ILE C N     1 
ATOM   4530  C  CA    . ILE B 2 158 ? 124.307 -2.895  323.526 1.00 122.09 ? 537 ILE C CA    1 
ATOM   4531  C  C     . ILE B 2 158 ? 123.971 -4.298  323.032 1.00 124.07 ? 537 ILE C C     1 
ATOM   4532  O  O     . ILE B 2 158 ? 124.855 -5.148  322.891 1.00 133.02 ? 537 ILE C O     1 
ATOM   4533  C  CB    . ILE B 2 158 ? 125.130 -2.149  322.461 1.00 109.28 ? 537 ILE C CB    1 
ATOM   4534  C  CG1   . ILE B 2 158 ? 125.281 -0.676  322.848 1.00 101.82 ? 537 ILE C CG1   1 
ATOM   4535  C  CG2   . ILE B 2 158 ? 124.474 -2.272  321.095 1.00 103.21 ? 537 ILE C CG2   1 
ATOM   4536  C  CD1   . ILE B 2 158 ? 126.054 0.150   321.843 1.00 103.46 ? 537 ILE C CD1   1 
ATOM   4537  N  N     . ALA B 2 159 ? 122.687 -4.534  322.778 1.00 117.49 ? 538 ALA C N     1 
ATOM   4538  C  CA    . ALA B 2 159 ? 122.214 -5.840  322.335 1.00 122.01 ? 538 ALA C CA    1 
ATOM   4539  C  C     . ALA B 2 159 ? 122.667 -6.141  320.914 1.00 133.93 ? 538 ALA C C     1 
ATOM   4540  O  O     . ALA B 2 159 ? 122.653 -5.264  320.050 1.00 144.95 ? 538 ALA C O     1 
ATOM   4541  C  CB    . ALA B 2 159 ? 120.698 -5.917  322.435 1.00 87.20  ? 538 ALA C CB    1 
ATOM   4542  N  N     . GLN B 2 160 ? 123.066 -7.388  320.682 1.00 132.34 ? 539 GLN C N     1 
ATOM   4543  C  CA    . GLN B 2 160 ? 123.516 -7.830  319.366 1.00 131.39 ? 539 GLN C CA    1 
ATOM   4544  C  C     . GLN B 2 160 ? 122.630 -8.963  318.856 1.00 128.67 ? 539 GLN C C     1 
ATOM   4545  O  O     . GLN B 2 160 ? 122.965 -10.135 319.013 1.00 132.45 ? 539 GLN C O     1 
ATOM   4546  C  CB    . GLN B 2 160 ? 124.969 -8.302  319.430 1.00 129.00 ? 539 GLN C CB    1 
ATOM   4547  C  CG    . GLN B 2 160 ? 125.909 -7.351  320.152 1.00 122.41 ? 539 GLN C CG    1 
ATOM   4548  C  CD    . GLN B 2 160 ? 125.978 -5.988  319.495 1.00 117.73 ? 539 GLN C CD    1 
ATOM   4549  N  N     . PRO B 2 161 ? 121.490 -8.611  318.243 1.00 125.00 ? 540 PRO C N     1 
ATOM   4550  C  CA    . PRO B 2 161 ? 120.507 -9.575  317.733 1.00 121.47 ? 540 PRO C CA    1 
ATOM   4551  C  C     . PRO B 2 161 ? 121.045 -10.416 316.578 1.00 130.43 ? 540 PRO C C     1 
ATOM   4552  O  O     . PRO B 2 161 ? 122.031 -10.029 315.951 1.00 139.53 ? 540 PRO C O     1 
ATOM   4553  C  CB    . PRO B 2 161 ? 119.366 -8.677  317.236 1.00 114.42 ? 540 PRO C CB    1 
ATOM   4554  C  CG    . PRO B 2 161 ? 119.560 -7.377  317.934 1.00 113.54 ? 540 PRO C CG    1 
ATOM   4555  C  CD    . PRO B 2 161 ? 121.036 -7.223  318.065 1.00 119.01 ? 540 PRO C CD    1 
ATOM   4556  N  N     . PRO B 2 162 ? 120.409 -11.567 316.308 1.00 134.94 ? 541 PRO C N     1 
ATOM   4557  C  CA    . PRO B 2 162 ? 120.759 -12.384 315.143 1.00 136.04 ? 541 PRO C CA    1 
ATOM   4558  C  C     . PRO B 2 162 ? 120.028 -11.901 313.895 1.00 130.72 ? 541 PRO C C     1 
ATOM   4559  O  O     . PRO B 2 162 ? 119.058 -11.153 314.026 1.00 126.39 ? 541 PRO C O     1 
ATOM   4560  C  CB    . PRO B 2 162 ? 120.254 -13.770 315.537 1.00 140.04 ? 541 PRO C CB    1 
ATOM   4561  C  CG    . PRO B 2 162 ? 119.075 -13.487 316.395 1.00 138.68 ? 541 PRO C CG    1 
ATOM   4562  C  CD    . PRO B 2 162 ? 119.412 -12.234 317.164 1.00 139.93 ? 541 PRO C CD    1 
ATOM   4563  N  N     . LEU B 2 208 ? 112.381 -5.239  315.317 1.00 144.31 ? 587 LEU C N     1 
ATOM   4564  C  CA    . LEU B 2 208 ? 112.103 -6.024  316.515 1.00 146.60 ? 587 LEU C CA    1 
ATOM   4565  C  C     . LEU B 2 208 ? 110.608 -6.282  316.677 1.00 150.39 ? 587 LEU C C     1 
ATOM   4566  O  O     . LEU B 2 208 ? 110.202 -7.284  317.262 1.00 150.27 ? 587 LEU C O     1 
ATOM   4567  C  CB    . LEU B 2 208 ? 112.661 -5.325  317.757 1.00 137.88 ? 587 LEU C CB    1 
ATOM   4568  C  CG    . LEU B 2 208 ? 114.181 -5.181  317.854 1.00 131.35 ? 587 LEU C CG    1 
ATOM   4569  C  CD1   . LEU B 2 208 ? 114.561 -4.370  319.081 1.00 137.78 ? 587 LEU C CD1   1 
ATOM   4570  C  CD2   . LEU B 2 208 ? 114.845 -6.548  317.890 1.00 123.53 ? 587 LEU C CD2   1 
ATOM   4571  N  N     . GLY B 2 209 ? 109.794 -5.370  316.154 1.00 146.43 ? 588 GLY C N     1 
ATOM   4572  C  CA    . GLY B 2 209 ? 108.352 -5.533  316.178 1.00 143.07 ? 588 GLY C CA    1 
ATOM   4573  C  C     . GLY B 2 209 ? 107.909 -6.676  315.286 1.00 142.42 ? 588 GLY C C     1 
ATOM   4574  O  O     . GLY B 2 209 ? 106.851 -7.269  315.494 1.00 137.79 ? 588 GLY C O     1 
ATOM   4575  N  N     . GLU B 2 210 ? 108.733 -6.987  314.291 1.00 141.06 ? 589 GLU C N     1 
ATOM   4576  C  CA    . GLU B 2 210 ? 108.463 -8.087  313.374 1.00 131.57 ? 589 GLU C CA    1 
ATOM   4577  C  C     . GLU B 2 210 ? 109.013 -9.393  313.930 1.00 126.41 ? 589 GLU C C     1 
ATOM   4578  O  O     . GLU B 2 210 ? 109.493 -10.248 313.185 1.00 123.95 ? 589 GLU C O     1 
ATOM   4579  C  CB    . GLU B 2 210 ? 109.089 -7.805  312.008 1.00 129.28 ? 589 GLU C CB    1 
ATOM   4580  N  N     . MET B 2 211 ? 108.946 -9.538  315.248 1.00 128.43 ? 590 MET C N     1 
ATOM   4581  C  CA    . MET B 2 211 ? 109.443 -10.733 315.912 1.00 123.21 ? 590 MET C CA    1 
ATOM   4582  C  C     . MET B 2 211 ? 108.489 -11.128 317.031 1.00 128.63 ? 590 MET C C     1 
ATOM   4583  O  O     . MET B 2 211 ? 107.798 -10.283 317.598 1.00 137.65 ? 590 MET C O     1 
ATOM   4584  C  CB    . MET B 2 211 ? 110.838 -10.477 316.478 1.00 113.95 ? 590 MET C CB    1 
ATOM   4585  C  CG    . MET B 2 211 ? 111.765 -11.677 316.441 1.00 108.95 ? 590 MET C CG    1 
ATOM   4586  S  SD    . MET B 2 211 ? 113.308 -11.355 317.306 1.00 130.81 ? 590 MET C SD    1 
ATOM   4587  C  CE    . MET B 2 211 ? 113.861 -9.867  316.474 1.00 81.55  ? 590 MET C CE    1 
ATOM   4588  N  N     . ASP B 2 212 ? 108.456 -12.417 317.347 1.00 125.70 ? 591 ASP C N     1 
ATOM   4589  C  CA    . ASP B 2 212 ? 107.557 -12.925 318.377 1.00 126.14 ? 591 ASP C CA    1 
ATOM   4590  C  C     . ASP B 2 212 ? 108.153 -12.752 319.771 1.00 135.77 ? 591 ASP C C     1 
ATOM   4591  O  O     . ASP B 2 212 ? 109.263 -12.241 319.921 1.00 142.20 ? 591 ASP C O     1 
ATOM   4592  C  CB    . ASP B 2 212 ? 107.226 -14.398 318.118 1.00 118.14 ? 591 ASP C CB    1 
ATOM   4593  N  N     . ASP B 2 213 ? 107.406 -13.171 320.788 1.00 133.02 ? 592 ASP C N     1 
ATOM   4594  C  CA    . ASP B 2 213 ? 107.890 -13.129 322.163 1.00 124.35 ? 592 ASP C CA    1 
ATOM   4595  C  C     . ASP B 2 213 ? 109.040 -14.116 322.316 1.00 124.37 ? 592 ASP C C     1 
ATOM   4596  O  O     . ASP B 2 213 ? 110.149 -13.758 322.732 1.00 132.46 ? 592 ASP C O     1 
ATOM   4597  C  CB    . ASP B 2 213 ? 106.769 -13.508 323.136 1.00 126.78 ? 592 ASP C CB    1 
ATOM   4598  C  CG    . ASP B 2 213 ? 105.460 -12.805 322.826 1.00 140.65 ? 592 ASP C CG    1 
ATOM   4599  O  OD1   . ASP B 2 213 ? 105.489 -11.602 322.488 1.00 150.31 ? 592 ASP C OD1   1 
ATOM   4600  O  OD2   . ASP B 2 213 ? 104.399 -13.461 322.917 1.00 141.07 ? 592 ASP C OD2   1 
ATOM   4601  N  N     . HIS B 2 214 ? 108.752 -15.364 321.959 1.00 118.48 ? 593 HIS C N     1 
ATOM   4602  C  CA    . HIS B 2 214 ? 109.692 -16.469 322.091 1.00 132.78 ? 593 HIS C CA    1 
ATOM   4603  C  C     . HIS B 2 214 ? 110.991 -16.220 321.334 1.00 135.85 ? 593 HIS C C     1 
ATOM   4604  O  O     . HIS B 2 214 ? 112.073 -16.526 321.832 1.00 134.95 ? 593 HIS C O     1 
ATOM   4605  C  CB    . HIS B 2 214 ? 109.046 -17.768 321.604 1.00 139.17 ? 593 HIS C CB    1 
ATOM   4606  N  N     . GLN B 2 215 ? 110.880 -15.669 320.131 1.00 132.27 ? 594 GLN C N     1 
ATOM   4607  C  CA    . GLN B 2 215 ? 112.055 -15.358 319.327 1.00 127.34 ? 594 GLN C CA    1 
ATOM   4608  C  C     . GLN B 2 215 ? 112.904 -14.279 319.995 1.00 121.99 ? 594 GLN C C     1 
ATOM   4609  O  O     . GLN B 2 215 ? 114.109 -14.459 320.181 1.00 125.67 ? 594 GLN C O     1 
ATOM   4610  C  CB    . GLN B 2 215 ? 111.644 -14.932 317.915 1.00 128.39 ? 594 GLN C CB    1 
ATOM   4611  C  CG    . GLN B 2 215 ? 111.101 -16.066 317.055 1.00 135.52 ? 594 GLN C CG    1 
ATOM   4612  C  CD    . GLN B 2 215 ? 110.608 -15.590 315.703 1.00 142.50 ? 594 GLN C CD    1 
ATOM   4613  O  OE1   . GLN B 2 215 ? 110.288 -14.415 315.525 1.00 148.24 ? 594 GLN C OE1   1 
ATOM   4614  N  NE2   . GLN B 2 215 ? 110.544 -16.502 314.741 1.00 141.51 ? 594 GLN C NE2   1 
ATOM   4615  N  N     . LEU B 2 216 ? 112.263 -13.172 320.366 1.00 115.73 ? 595 LEU C N     1 
ATOM   4616  C  CA    . LEU B 2 216 ? 112.939 -12.059 321.029 1.00 112.95 ? 595 LEU C CA    1 
ATOM   4617  C  C     . LEU B 2 216 ? 113.718 -12.551 322.240 1.00 126.64 ? 595 LEU C C     1 
ATOM   4618  O  O     . LEU B 2 216 ? 114.919 -12.288 322.375 1.00 131.60 ? 595 LEU C O     1 
ATOM   4619  C  CB    . LEU B 2 216 ? 111.927 -10.999 321.473 1.00 107.00 ? 595 LEU C CB    1 
ATOM   4620  C  CG    . LEU B 2 216 ? 112.163 -9.540  321.067 1.00 105.51 ? 595 LEU C CG    1 
ATOM   4621  C  CD1   . LEU B 2 216 ? 111.557 -8.589  322.091 1.00 105.35 ? 595 LEU C CD1   1 
ATOM   4622  C  CD2   . LEU B 2 216 ? 113.639 -9.242  320.859 1.00 98.14  ? 595 LEU C CD2   1 
ATOM   4623  N  N     . TRP B 2 217 ? 113.027 -13.285 323.108 1.00 130.51 ? 596 TRP C N     1 
ATOM   4624  C  CA    . TRP B 2 217 ? 113.647 -13.827 324.311 1.00 134.37 ? 596 TRP C CA    1 
ATOM   4625  C  C     . TRP B 2 217 ? 114.794 -14.790 324.008 1.00 137.94 ? 596 TRP C C     1 
ATOM   4626  O  O     . TRP B 2 217 ? 115.943 -14.537 324.371 1.00 136.54 ? 596 TRP C O     1 
ATOM   4627  C  CB    . TRP B 2 217 ? 112.606 -14.532 325.182 1.00 128.89 ? 596 TRP C CB    1 
ATOM   4628  C  CG    . TRP B 2 217 ? 113.226 -15.341 326.272 1.00 120.52 ? 596 TRP C CG    1 
ATOM   4629  C  CD1   . TRP B 2 217 ? 113.314 -16.700 326.335 1.00 115.55 ? 596 TRP C CD1   1 
ATOM   4630  C  CD2   . TRP B 2 217 ? 113.871 -14.841 327.449 1.00 121.31 ? 596 TRP C CD2   1 
ATOM   4631  N  NE1   . TRP B 2 217 ? 113.965 -17.079 327.484 1.00 120.32 ? 596 TRP C NE1   1 
ATOM   4632  C  CE2   . TRP B 2 217 ? 114.318 -15.956 328.185 1.00 120.86 ? 596 TRP C CE2   1 
ATOM   4633  C  CE3   . TRP B 2 217 ? 114.109 -13.559 327.954 1.00 124.20 ? 596 TRP C CE3   1 
ATOM   4634  C  CZ2   . TRP B 2 217 ? 114.988 -15.828 329.399 1.00 119.81 ? 596 TRP C CZ2   1 
ATOM   4635  C  CZ3   . TRP B 2 217 ? 114.775 -13.433 329.158 1.00 125.93 ? 596 TRP C CZ3   1 
ATOM   4636  C  CH2   . TRP B 2 217 ? 115.207 -14.561 329.867 1.00 120.20 ? 596 TRP C CH2   1 
ATOM   4637  N  N     . GLU B 2 218 ? 114.470 -15.892 323.336 1.00 140.40 ? 597 GLU C N     1 
ATOM   4638  C  CA    . GLU B 2 218 ? 115.427 -16.970 323.095 1.00 141.51 ? 597 GLU C CA    1 
ATOM   4639  C  C     . GLU B 2 218 ? 116.637 -16.539 322.268 1.00 137.62 ? 597 GLU C C     1 
ATOM   4640  O  O     . GLU B 2 218 ? 117.678 -17.195 322.299 1.00 139.45 ? 597 GLU C O     1 
ATOM   4641  C  CB    . GLU B 2 218 ? 114.736 -18.161 322.425 1.00 138.52 ? 597 GLU C CB    1 
ATOM   4642  N  N     . THR B 2 219 ? 116.508 -15.437 321.536 1.00 128.82 ? 598 THR C N     1 
ATOM   4643  C  CA    . THR B 2 219 ? 117.608 -14.980 320.695 1.00 123.94 ? 598 THR C CA    1 
ATOM   4644  C  C     . THR B 2 219 ? 118.420 -13.829 321.286 1.00 122.29 ? 598 THR C C     1 
ATOM   4645  O  O     . THR B 2 219 ? 119.637 -13.780 321.113 1.00 123.90 ? 598 THR C O     1 
ATOM   4646  C  CB    . THR B 2 219 ? 117.129 -14.580 319.284 1.00 118.72 ? 598 THR C CB    1 
ATOM   4647  O  OG1   . THR B 2 219 ? 116.115 -13.573 319.386 1.00 116.01 ? 598 THR C OG1   1 
ATOM   4648  C  CG2   . THR B 2 219 ? 116.570 -15.787 318.551 1.00 122.56 ? 598 THR C CG2   1 
ATOM   4649  N  N     . THR B 2 220 ? 117.758 -12.910 321.985 1.00 117.21 ? 599 THR C N     1 
ATOM   4650  C  CA    . THR B 2 220 ? 118.415 -11.661 322.369 1.00 114.67 ? 599 THR C CA    1 
ATOM   4651  C  C     . THR B 2 220 ? 118.379 -11.312 323.856 1.00 117.51 ? 599 THR C C     1 
ATOM   4652  O  O     . THR B 2 220 ? 119.186 -10.508 324.324 1.00 113.14 ? 599 THR C O     1 
ATOM   4653  C  CB    . THR B 2 220 ? 117.813 -10.480 321.600 1.00 114.41 ? 599 THR C CB    1 
ATOM   4654  O  OG1   . THR B 2 220 ? 116.400 -10.448 321.822 1.00 130.49 ? 599 THR C OG1   1 
ATOM   4655  C  CG2   . THR B 2 220 ? 118.069 -10.633 320.117 1.00 110.76 ? 599 THR C CG2   1 
ATOM   4656  N  N     . MET B 2 221 ? 117.450 -11.904 324.597 1.00 123.56 ? 600 MET C N     1 
ATOM   4657  C  CA    . MET B 2 221 ? 117.219 -11.484 325.977 1.00 122.76 ? 600 MET C CA    1 
ATOM   4658  C  C     . MET B 2 221 ? 117.598 -12.547 327.007 1.00 124.70 ? 600 MET C C     1 
ATOM   4659  O  O     . MET B 2 221 ? 117.824 -12.234 328.176 1.00 126.95 ? 600 MET C O     1 
ATOM   4660  C  CB    . MET B 2 221 ? 115.765 -11.047 326.160 1.00 123.84 ? 600 MET C CB    1 
ATOM   4661  C  CG    . MET B 2 221 ? 115.311 -10.024 325.130 1.00 126.07 ? 600 MET C CG    1 
ATOM   4662  S  SD    . MET B 2 221 ? 113.593 -9.512  325.327 1.00 143.03 ? 600 MET C SD    1 
ATOM   4663  C  CE    . MET B 2 221 ? 113.684 -8.619  326.877 1.00 89.22  ? 600 MET C CE    1 
ATOM   4664  N  N     . ASP B 2 222 ? 117.665 -13.799 326.568 1.00 125.32 ? 601 ASP C N     1 
ATOM   4665  C  CA    . ASP B 2 222 ? 118.079 -14.894 327.436 1.00 129.78 ? 601 ASP C CA    1 
ATOM   4666  C  C     . ASP B 2 222 ? 119.598 -14.882 327.579 1.00 127.32 ? 601 ASP C C     1 
ATOM   4667  O  O     . ASP B 2 222 ? 120.313 -15.115 326.606 1.00 129.68 ? 601 ASP C O     1 
ATOM   4668  C  CB    . ASP B 2 222 ? 117.611 -16.232 326.856 1.00 137.00 ? 601 ASP C CB    1 
ATOM   4669  C  CG    . ASP B 2 222 ? 117.621 -17.356 327.878 1.00 148.71 ? 601 ASP C CG    1 
ATOM   4670  O  OD1   . ASP B 2 222 ? 118.448 -17.319 328.813 1.00 153.91 ? 601 ASP C OD1   1 
ATOM   4671  O  OD2   . ASP B 2 222 ? 116.796 -18.285 327.744 1.00 149.71 ? 601 ASP C OD2   1 
ATOM   4672  N  N     . PRO B 2 223 ? 120.095 -14.619 328.798 1.00 127.71 ? 602 PRO C N     1 
ATOM   4673  C  CA    . PRO B 2 223 ? 121.534 -14.498 329.071 1.00 132.13 ? 602 PRO C CA    1 
ATOM   4674  C  C     . PRO B 2 223 ? 122.307 -15.777 328.756 1.00 142.26 ? 602 PRO C C     1 
ATOM   4675  O  O     . PRO B 2 223 ? 123.531 -15.744 328.621 1.00 142.60 ? 602 PRO C O     1 
ATOM   4676  C  CB    . PRO B 2 223 ? 121.584 -14.215 330.577 1.00 118.87 ? 602 PRO C CB    1 
ATOM   4677  C  CG    . PRO B 2 223 ? 120.229 -13.676 330.918 1.00 114.83 ? 602 PRO C CG    1 
ATOM   4678  C  CD    . PRO B 2 223 ? 119.285 -14.401 330.009 1.00 122.74 ? 602 PRO C CD    1 
ATOM   4679  N  N     . GLU B 2 224 ? 121.593 -16.890 328.636 1.00 149.73 ? 603 GLU C N     1 
ATOM   4680  C  CA    . GLU B 2 224 ? 122.225 -18.174 328.367 1.00 162.04 ? 603 GLU C CA    1 
ATOM   4681  C  C     . GLU B 2 224 ? 122.546 -18.359 326.887 1.00 167.36 ? 603 GLU C C     1 
ATOM   4682  O  O     . GLU B 2 224 ? 123.328 -19.237 326.524 1.00 176.29 ? 603 GLU C O     1 
ATOM   4683  C  CB    . GLU B 2 224 ? 121.336 -19.318 328.858 1.00 165.01 ? 603 GLU C CB    1 
ATOM   4684  N  N     . HIS B 2 225 ? 121.945 -17.535 326.033 1.00 161.26 ? 604 HIS C N     1 
ATOM   4685  C  CA    . HIS B 2 225 ? 122.122 -17.690 324.591 1.00 160.25 ? 604 HIS C CA    1 
ATOM   4686  C  C     . HIS B 2 225 ? 122.198 -16.366 323.829 1.00 150.96 ? 604 HIS C C     1 
ATOM   4687  O  O     . HIS B 2 225 ? 122.199 -16.356 322.598 1.00 151.22 ? 604 HIS C O     1 
ATOM   4688  C  CB    . HIS B 2 225 ? 121.003 -18.557 324.003 1.00 166.94 ? 604 HIS C CB    1 
ATOM   4689  C  CG    . HIS B 2 225 ? 120.865 -19.894 324.663 1.00 176.96 ? 604 HIS C CG    1 
ATOM   4690  N  ND1   . HIS B 2 225 ? 119.991 -20.122 325.704 1.00 180.71 ? 604 HIS C ND1   1 
ATOM   4691  C  CD2   . HIS B 2 225 ? 121.494 -21.071 324.435 1.00 181.01 ? 604 HIS C CD2   1 
ATOM   4692  C  CE1   . HIS B 2 225 ? 120.085 -21.383 326.087 1.00 182.29 ? 604 HIS C CE1   1 
ATOM   4693  N  NE2   . HIS B 2 225 ? 120.990 -21.981 325.333 1.00 182.67 ? 604 HIS C NE2   1 
ATOM   4694  N  N     . ARG B 2 226 ? 122.263 -15.253 324.552 1.00 143.02 ? 605 ARG C N     1 
ATOM   4695  C  CA    . ARG B 2 226 ? 122.325 -13.945 323.908 1.00 137.03 ? 605 ARG C CA    1 
ATOM   4696  C  C     . ARG B 2 226 ? 123.761 -13.444 323.819 1.00 140.82 ? 605 ARG C C     1 
ATOM   4697  O  O     . ARG B 2 226 ? 124.635 -13.900 324.556 1.00 152.13 ? 605 ARG C O     1 
ATOM   4698  C  CB    . ARG B 2 226 ? 121.470 -12.927 324.665 1.00 137.34 ? 605 ARG C CB    1 
ATOM   4699  C  CG    . ARG B 2 226 ? 122.136 -12.375 325.914 1.00 144.36 ? 605 ARG C CG    1 
ATOM   4700  C  CD    . ARG B 2 226 ? 121.172 -11.538 326.735 1.00 145.20 ? 605 ARG C CD    1 
ATOM   4701  N  NE    . ARG B 2 226 ? 121.850 -10.843 327.826 1.00 147.93 ? 605 ARG C NE    1 
ATOM   4702  C  CZ    . ARG B 2 226 ? 121.232 -10.334 328.887 1.00 142.66 ? 605 ARG C CZ    1 
ATOM   4703  N  NH1   . ARG B 2 226 ? 119.917 -10.450 329.012 1.00 141.76 ? 605 ARG C NH1   1 
ATOM   4704  N  NH2   . ARG B 2 226 ? 121.932 -9.716  329.829 1.00 137.32 ? 605 ARG C NH2   1 
ATOM   4705  N  N     . LEU B 2 227 ? 123.996 -12.506 322.909 1.00 133.61 ? 606 LEU C N     1 
ATOM   4706  C  CA    . LEU B 2 227 ? 125.305 -11.882 322.767 1.00 131.83 ? 606 LEU C CA    1 
ATOM   4707  C  C     . LEU B 2 227 ? 125.181 -10.375 322.954 1.00 137.23 ? 606 LEU C C     1 
ATOM   4708  O  O     . LEU B 2 227 ? 124.447 -9.712  322.223 1.00 137.80 ? 606 LEU C O     1 
ATOM   4709  C  CB    . LEU B 2 227 ? 125.904 -12.197 321.396 1.00 124.63 ? 606 LEU C CB    1 
ATOM   4710  N  N     . MET B 2 228 ? 125.895 -9.839  323.938 1.00 138.39 ? 607 MET C N     1 
ATOM   4711  C  CA    . MET B 2 228 ? 125.827 -8.413  324.238 1.00 133.67 ? 607 MET C CA    1 
ATOM   4712  C  C     . MET B 2 228 ? 127.202 -7.756  324.200 1.00 135.66 ? 607 MET C C     1 
ATOM   4713  O  O     . MET B 2 228 ? 128.226 -8.430  324.315 1.00 139.52 ? 607 MET C O     1 
ATOM   4714  C  CB    . MET B 2 228 ? 125.174 -8.182  325.601 1.00 124.21 ? 607 MET C CB    1 
ATOM   4715  C  CG    . MET B 2 228 ? 123.752 -8.704  325.703 1.00 123.09 ? 607 MET C CG    1 
ATOM   4716  S  SD    . MET B 2 228 ? 122.622 -7.484  326.400 1.00 138.99 ? 607 MET C SD    1 
ATOM   4717  C  CE    . MET B 2 228 ? 123.427 -7.131  327.959 1.00 195.19 ? 607 MET C CE    1 
ATOM   4718  N  N     . ALA B 2 229 ? 127.218 -6.437  324.042 1.00 132.73 ? 608 ALA C N     1 
ATOM   4719  C  CA    . ALA B 2 229 ? 128.473 -5.701  323.970 1.00 128.31 ? 608 ALA C CA    1 
ATOM   4720  C  C     . ALA B 2 229 ? 128.592 -4.673  325.090 1.00 124.29 ? 608 ALA C C     1 
ATOM   4721  O  O     . ALA B 2 229 ? 127.694 -3.863  325.293 1.00 117.85 ? 608 ALA C O     1 
ATOM   4722  C  CB    . ALA B 2 229 ? 128.609 -5.025  322.617 1.00 126.70 ? 608 ALA C CB    1 
ATOM   4723  N  N     . ARG B 2 230 ? 129.703 -4.707  325.818 1.00 127.63 ? 609 ARG C N     1 
ATOM   4724  C  CA    . ARG B 2 230 ? 129.969 -3.690  326.828 1.00 129.35 ? 609 ARG C CA    1 
ATOM   4725  C  C     . ARG B 2 230 ? 130.608 -2.467  326.187 1.00 131.81 ? 609 ARG C C     1 
ATOM   4726  O  O     . ARG B 2 230 ? 131.667 -2.564  325.567 1.00 140.39 ? 609 ARG C O     1 
ATOM   4727  C  CB    . ARG B 2 230 ? 130.881 -4.230  327.930 1.00 138.69 ? 609 ARG C CB    1 
ATOM   4728  C  CG    . ARG B 2 230 ? 131.508 -3.132  328.781 1.00 145.56 ? 609 ARG C CG    1 
ATOM   4729  C  CD    . ARG B 2 230 ? 131.167 -3.289  330.253 1.00 146.30 ? 609 ARG C CD    1 
ATOM   4730  N  NE    . ARG B 2 230 ? 131.795 -4.468  330.838 1.00 147.92 ? 609 ARG C NE    1 
ATOM   4731  C  CZ    . ARG B 2 230 ? 131.611 -4.867  332.092 1.00 150.89 ? 609 ARG C CZ    1 
ATOM   4732  N  NH1   . ARG B 2 230 ? 130.813 -4.180  332.898 1.00 152.83 ? 609 ARG C NH1   1 
ATOM   4733  N  NH2   . ARG B 2 230 ? 132.223 -5.954  332.541 1.00 152.14 ? 609 ARG C NH2   1 
ATOM   4734  N  N     . VAL B 2 231 ? 129.961 -1.316  326.337 1.00 131.19 ? 610 VAL C N     1 
ATOM   4735  C  CA    . VAL B 2 231 ? 130.483 -0.077  325.778 1.00 133.55 ? 610 VAL C CA    1 
ATOM   4736  C  C     . VAL B 2 231 ? 131.577 0.490   326.674 1.00 142.45 ? 610 VAL C C     1 
ATOM   4737  O  O     . VAL B 2 231 ? 131.314 0.915   327.799 1.00 138.95 ? 610 VAL C O     1 
ATOM   4738  C  CB    . VAL B 2 231 ? 129.379 0.978   325.600 1.00 120.55 ? 610 VAL C CB    1 
ATOM   4739  C  CG1   . VAL B 2 231 ? 129.916 2.178   324.836 1.00 110.74 ? 610 VAL C CG1   1 
ATOM   4740  C  CG2   . VAL B 2 231 ? 128.187 0.377   324.878 1.00 113.79 ? 610 VAL C CG2   1 
ATOM   4741  N  N     . SER B 2 232 ? 132.804 0.491   326.166 1.00 147.80 ? 611 SER C N     1 
ATOM   4742  C  CA    . SER B 2 232 ? 133.942 0.994   326.922 1.00 148.76 ? 611 SER C CA    1 
ATOM   4743  C  C     . SER B 2 232 ? 134.735 2.014   326.113 1.00 146.23 ? 611 SER C C     1 
ATOM   4744  O  O     . SER B 2 232 ? 135.139 1.747   324.981 1.00 150.88 ? 611 SER C O     1 
ATOM   4745  C  CB    . SER B 2 232 ? 134.848 -0.161  327.352 1.00 155.22 ? 611 SER C CB    1 
ATOM   4746  O  OG    . SER B 2 232 ? 135.954 0.312   328.101 1.00 162.25 ? 611 SER C OG    1 
ATOM   4747  N  N     . VAL B 2 233 ? 134.958 3.182   326.706 1.00 142.80 ? 612 VAL C N     1 
ATOM   4748  C  CA    . VAL B 2 233 ? 135.669 4.266   326.040 1.00 144.86 ? 612 VAL C CA    1 
ATOM   4749  C  C     . VAL B 2 233 ? 137.175 4.010   326.027 1.00 148.53 ? 612 VAL C C     1 
ATOM   4750  O  O     . VAL B 2 233 ? 137.729 3.463   326.981 1.00 155.39 ? 612 VAL C O     1 
ATOM   4751  C  CB    . VAL B 2 233 ? 135.390 5.618   326.732 1.00 136.87 ? 612 VAL C CB    1 
ATOM   4752  C  CG1   . VAL B 2 233 ? 135.885 6.778   325.876 1.00 134.92 ? 612 VAL C CG1   1 
ATOM   4753  C  CG2   . VAL B 2 233 ? 133.905 5.765   327.021 1.00 126.09 ? 612 VAL C CG2   1 
ATOM   4754  N  N     . ASP B 2 234 ? 137.828 4.396   324.937 1.00 143.32 ? 613 ASP C N     1 
ATOM   4755  C  CA    . ASP B 2 234 ? 139.281 4.335   324.853 1.00 145.00 ? 613 ASP C CA    1 
ATOM   4756  C  C     . ASP B 2 234 ? 139.879 5.599   325.460 1.00 146.61 ? 613 ASP C C     1 
ATOM   4757  O  O     . ASP B 2 234 ? 140.296 5.609   326.620 1.00 148.21 ? 613 ASP C O     1 
ATOM   4758  C  CB    . ASP B 2 234 ? 139.730 4.189   323.398 1.00 143.32 ? 613 ASP C CB    1 
ATOM   4759  N  N     . ASP B 2 235 ? 139.912 6.664   324.666 1.00 142.11 ? 614 ASP C N     1 
ATOM   4760  C  CA    . ASP B 2 235 ? 140.356 7.969   325.137 1.00 137.70 ? 614 ASP C CA    1 
ATOM   4761  C  C     . ASP B 2 235 ? 139.210 8.973   325.039 1.00 142.91 ? 614 ASP C C     1 
ATOM   4762  O  O     . ASP B 2 235 ? 138.456 8.976   324.064 1.00 146.20 ? 614 ASP C O     1 
ATOM   4763  C  CB    . ASP B 2 235 ? 141.561 8.453   324.328 1.00 128.94 ? 614 ASP C CB    1 
ATOM   4764  N  N     . ALA B 2 236 ? 139.083 9.820   326.055 1.00 146.63 ? 615 ALA C N     1 
ATOM   4765  C  CA    . ALA B 2 236 ? 137.989 10.783  326.121 1.00 151.10 ? 615 ALA C CA    1 
ATOM   4766  C  C     . ALA B 2 236 ? 138.147 11.898  325.092 1.00 155.62 ? 615 ALA C C     1 
ATOM   4767  O  O     . ALA B 2 236 ? 137.165 12.515  324.678 1.00 157.12 ? 615 ALA C O     1 
ATOM   4768  C  CB    . ALA B 2 236 ? 137.877 11.364  327.524 1.00 156.07 ? 615 ALA C CB    1 
ATOM   4769  N  N     . ALA B 2 237 ? 139.386 12.153  324.681 1.00 155.91 ? 616 ALA C N     1 
ATOM   4770  C  CA    . ALA B 2 237 ? 139.669 13.190  323.694 1.00 157.64 ? 616 ALA C CA    1 
ATOM   4771  C  C     . ALA B 2 237 ? 139.094 12.820  322.330 1.00 161.14 ? 616 ALA C C     1 
ATOM   4772  O  O     . ALA B 2 237 ? 138.302 13.570  321.753 1.00 164.87 ? 616 ALA C O     1 
ATOM   4773  C  CB    . ALA B 2 237 ? 141.167 13.429  323.594 1.00 160.95 ? 616 ALA C CB    1 
ATOM   4774  N  N     . GLU B 2 238 ? 139.502 11.659  321.826 1.00 160.39 ? 617 GLU C N     1 
ATOM   4775  C  CA    . GLU B 2 238 ? 139.028 11.161  320.540 1.00 152.87 ? 617 GLU C CA    1 
ATOM   4776  C  C     . GLU B 2 238 ? 137.514 10.991  320.550 1.00 147.05 ? 617 GLU C C     1 
ATOM   4777  O  O     . GLU B 2 238 ? 136.845 11.233  319.545 1.00 140.57 ? 617 GLU C O     1 
ATOM   4778  C  CB    . GLU B 2 238 ? 139.703 9.831   320.198 1.00 152.35 ? 617 GLU C CB    1 
ATOM   4779  N  N     . ALA B 2 239 ? 136.982 10.577  321.696 1.00 150.93 ? 618 ALA C N     1 
ATOM   4780  C  CA    . ALA B 2 239 ? 135.543 10.429  321.868 1.00 148.15 ? 618 ALA C CA    1 
ATOM   4781  C  C     . ALA B 2 239 ? 134.843 11.772  321.699 1.00 148.43 ? 618 ALA C C     1 
ATOM   4782  O  O     . ALA B 2 239 ? 133.999 11.932  320.817 1.00 148.44 ? 618 ALA C O     1 
ATOM   4783  C  CB    . ALA B 2 239 ? 135.231 9.832   323.231 1.00 141.90 ? 618 ALA C CB    1 
ATOM   4784  N  N     . ASP B 2 240 ? 135.213 12.736  322.540 1.00 147.33 ? 619 ASP C N     1 
ATOM   4785  C  CA    . ASP B 2 240 ? 134.626 14.073  322.505 1.00 147.86 ? 619 ASP C CA    1 
ATOM   4786  C  C     . ASP B 2 240 ? 134.716 14.692  321.114 1.00 151.40 ? 619 ASP C C     1 
ATOM   4787  O  O     . ASP B 2 240 ? 133.775 15.339  320.651 1.00 152.81 ? 619 ASP C O     1 
ATOM   4788  C  CB    . ASP B 2 240 ? 135.304 14.984  323.530 1.00 146.85 ? 619 ASP C CB    1 
ATOM   4789  N  N     . LYS B 2 241 ? 135.849 14.484  320.450 1.00 151.83 ? 620 LYS C N     1 
ATOM   4790  C  CA    . LYS B 2 241 ? 136.030 14.969  319.086 1.00 144.24 ? 620 LYS C CA    1 
ATOM   4791  C  C     . LYS B 2 241 ? 135.053 14.293  318.127 1.00 147.60 ? 620 LYS C C     1 
ATOM   4792  O  O     . LYS B 2 241 ? 134.452 14.949  317.275 1.00 151.99 ? 620 LYS C O     1 
ATOM   4793  C  CB    . LYS B 2 241 ? 137.469 14.738  318.621 1.00 138.95 ? 620 LYS C CB    1 
ATOM   4794  N  N     . ILE B 2 242 ? 134.899 12.979  318.277 1.00 146.54 ? 621 ILE C N     1 
ATOM   4795  C  CA    . ILE B 2 242 ? 134.006 12.200  317.423 1.00 139.28 ? 621 ILE C CA    1 
ATOM   4796  C  C     . ILE B 2 242 ? 132.557 12.652  317.566 1.00 141.57 ? 621 ILE C C     1 
ATOM   4797  O  O     . ILE B 2 242 ? 131.849 12.812  316.570 1.00 139.44 ? 621 ILE C O     1 
ATOM   4798  C  CB    . ILE B 2 242 ? 134.097 10.693  317.733 1.00 129.75 ? 621 ILE C CB    1 
ATOM   4799  N  N     . PHE B 2 243 ? 132.123 12.858  318.806 1.00 143.92 ? 622 PHE C N     1 
ATOM   4800  C  CA    . PHE B 2 243 ? 130.780 13.365  319.072 1.00 141.90 ? 622 PHE C CA    1 
ATOM   4801  C  C     . PHE B 2 243 ? 130.620 14.783  318.535 1.00 145.57 ? 622 PHE C C     1 
ATOM   4802  O  O     . PHE B 2 243 ? 129.556 15.151  318.040 1.00 141.58 ? 622 PHE C O     1 
ATOM   4803  C  CB    . PHE B 2 243 ? 130.469 13.334  320.572 1.00 136.84 ? 622 PHE C CB    1 
ATOM   4804  C  CG    . PHE B 2 243 ? 130.205 11.957  321.111 1.00 131.16 ? 622 PHE C CG    1 
ATOM   4805  C  CD1   . PHE B 2 243 ? 131.234 11.196  321.634 1.00 130.70 ? 622 PHE C CD1   1 
ATOM   4806  C  CD2   . PHE B 2 243 ? 128.927 11.425  321.098 1.00 129.95 ? 622 PHE C CD2   1 
ATOM   4807  C  CE1   . PHE B 2 243 ? 130.998 9.931   322.130 1.00 127.92 ? 622 PHE C CE1   1 
ATOM   4808  C  CE2   . PHE B 2 243 ? 128.684 10.158  321.593 1.00 126.67 ? 622 PHE C CE2   1 
ATOM   4809  C  CZ    . PHE B 2 243 ? 129.723 9.411   322.112 1.00 124.59 ? 622 PHE C CZ    1 
ATOM   4810  N  N     . ASP B 2 244 ? 131.684 15.573  318.633 1.00 148.59 ? 623 ASP C N     1 
ATOM   4811  C  CA    . ASP B 2 244 ? 131.663 16.946  318.142 1.00 151.43 ? 623 ASP C CA    1 
ATOM   4812  C  C     . ASP B 2 244 ? 131.573 16.991  316.619 1.00 150.91 ? 623 ASP C C     1 
ATOM   4813  O  O     . ASP B 2 244 ? 131.080 17.961  316.046 1.00 153.27 ? 623 ASP C O     1 
ATOM   4814  C  CB    . ASP B 2 244 ? 132.902 17.707  318.618 1.00 150.38 ? 623 ASP C CB    1 
ATOM   4815  N  N     . MET B 2 245 ? 132.052 15.935  315.970 1.00 144.28 ? 624 MET C N     1 
ATOM   4816  C  CA    . MET B 2 245 ? 132.045 15.864  314.514 1.00 136.62 ? 624 MET C CA    1 
ATOM   4817  C  C     . MET B 2 245 ? 130.739 15.293  313.970 1.00 142.48 ? 624 MET C C     1 
ATOM   4818  O  O     . MET B 2 245 ? 130.036 15.947  313.201 1.00 147.68 ? 624 MET C O     1 
ATOM   4819  C  CB    . MET B 2 245 ? 133.221 15.021  314.015 1.00 127.88 ? 624 MET C CB    1 
ATOM   4820  C  CG    . MET B 2 245 ? 133.224 14.791  312.513 1.00 122.94 ? 624 MET C CG    1 
ATOM   4821  S  SD    . MET B 2 245 ? 134.534 13.672  311.980 1.00 166.66 ? 624 MET C SD    1 
ATOM   4822  C  CE    . MET B 2 245 ? 135.980 14.511  312.621 1.00 189.60 ? 624 MET C CE    1 
ATOM   4823  N  N     . LEU B 2 246 ? 130.422 14.068  314.374 1.00 141.13 ? 625 LEU C N     1 
ATOM   4824  C  CA    . LEU B 2 246 ? 129.255 13.364  313.853 1.00 135.85 ? 625 LEU C CA    1 
ATOM   4825  C  C     . LEU B 2 246 ? 127.939 13.999  314.292 1.00 129.26 ? 625 LEU C C     1 
ATOM   4826  O  O     . LEU B 2 246 ? 126.935 13.920  313.584 1.00 116.70 ? 625 LEU C O     1 
ATOM   4827  C  CB    . LEU B 2 246 ? 129.289 11.895  314.284 1.00 140.13 ? 625 LEU C CB    1 
ATOM   4828  C  CG    . LEU B 2 246 ? 130.582 11.124  314.008 1.00 143.84 ? 625 LEU C CG    1 
ATOM   4829  C  CD1   . LEU B 2 246 ? 130.474 9.689   314.501 1.00 142.82 ? 625 LEU C CD1   1 
ATOM   4830  C  CD2   . LEU B 2 246 ? 130.916 11.161  312.529 1.00 145.45 ? 625 LEU C CD2   1 
ATOM   4831  N  N     . MET B 2 247 ? 127.950 14.631  315.461 1.00 130.02 ? 626 MET C N     1 
ATOM   4832  C  CA    . MET B 2 247 ? 126.718 15.118  316.078 1.00 117.76 ? 626 MET C CA    1 
ATOM   4833  C  C     . MET B 2 247 ? 126.695 16.631  316.258 1.00 122.31 ? 626 MET C C     1 
ATOM   4834  O  O     . MET B 2 247 ? 125.629 17.228  316.411 1.00 120.64 ? 626 MET C O     1 
ATOM   4835  C  CB    . MET B 2 247 ? 126.521 14.443  317.430 1.00 107.46 ? 626 MET C CB    1 
ATOM   4836  C  CG    . MET B 2 247 ? 126.872 12.973  317.414 1.00 103.46 ? 626 MET C CG    1 
ATOM   4837  S  SD    . MET B 2 247 ? 125.910 12.081  316.184 1.00 125.10 ? 626 MET C SD    1 
ATOM   4838  C  CE    . MET B 2 247 ? 124.242 12.391  316.757 1.00 92.29  ? 626 MET C CE    1 
ATOM   4839  N  N     . GLY B 2 248 ? 127.876 17.242  316.256 1.00 122.58 ? 627 GLY C N     1 
ATOM   4840  C  CA    . GLY B 2 248 ? 127.994 18.677  316.435 1.00 125.65 ? 627 GLY C CA    1 
ATOM   4841  C  C     . GLY B 2 248 ? 127.361 19.451  315.296 1.00 126.95 ? 627 GLY C C     1 
ATOM   4842  O  O     . GLY B 2 248 ? 127.150 18.913  314.211 1.00 126.53 ? 627 GLY C O     1 
ATOM   4843  N  N     . ASP B 2 249 ? 127.067 20.725  315.541 1.00 132.71 ? 628 ASP C N     1 
ATOM   4844  C  CA    . ASP B 2 249 ? 126.417 21.571  314.545 1.00 133.58 ? 628 ASP C CA    1 
ATOM   4845  C  C     . ASP B 2 249 ? 127.298 21.828  313.323 1.00 139.04 ? 628 ASP C C     1 
ATOM   4846  O  O     . ASP B 2 249 ? 126.818 22.308  312.296 1.00 132.47 ? 628 ASP C O     1 
ATOM   4847  C  CB    . ASP B 2 249 ? 125.985 22.899  315.172 1.00 132.37 ? 628 ASP C CB    1 
ATOM   4848  N  N     . ARG B 2 250 ? 128.584 21.512  313.440 1.00 145.09 ? 629 ARG C N     1 
ATOM   4849  C  CA    . ARG B 2 250 ? 129.518 21.675  312.332 1.00 150.11 ? 629 ARG C CA    1 
ATOM   4850  C  C     . ARG B 2 250 ? 129.233 20.663  311.226 1.00 153.68 ? 629 ARG C C     1 
ATOM   4851  O  O     . ARG B 2 250 ? 129.477 19.467  311.385 1.00 155.09 ? 629 ARG C O     1 
ATOM   4852  C  CB    . ARG B 2 250 ? 130.961 21.535  312.820 1.00 150.86 ? 629 ARG C CB    1 
ATOM   4853  N  N     . VAL B 2 251 ? 128.716 21.153  310.104 1.00 151.33 ? 630 VAL C N     1 
ATOM   4854  C  CA    . VAL B 2 251 ? 128.294 20.286  309.009 1.00 139.16 ? 630 VAL C CA    1 
ATOM   4855  C  C     . VAL B 2 251 ? 129.455 19.859  308.115 1.00 143.55 ? 630 VAL C C     1 
ATOM   4856  O  O     . VAL B 2 251 ? 129.626 18.673  307.836 1.00 149.91 ? 630 VAL C O     1 
ATOM   4857  C  CB    . VAL B 2 251 ? 127.211 20.962  308.145 1.00 129.45 ? 630 VAL C CB    1 
ATOM   4858  C  CG1   . VAL B 2 251 ? 126.800 20.054  306.999 1.00 119.25 ? 630 VAL C CG1   1 
ATOM   4859  C  CG2   . VAL B 2 251 ? 126.006 21.319  308.996 1.00 134.63 ? 630 VAL C CG2   1 
ATOM   4860  N  N     . GLU B 2 252 ? 130.246 20.833  307.672 1.00 144.39 ? 631 GLU C N     1 
ATOM   4861  C  CA    . GLU B 2 252 ? 131.349 20.586  306.739 1.00 155.15 ? 631 GLU C CA    1 
ATOM   4862  C  C     . GLU B 2 252 ? 132.335 19.474  307.143 1.00 166.89 ? 631 GLU C C     1 
ATOM   4863  O  O     . GLU B 2 252 ? 132.666 18.624  306.313 1.00 173.40 ? 631 GLU C O     1 
ATOM   4864  C  CB    . GLU B 2 252 ? 132.095 21.890  306.420 1.00 160.11 ? 631 GLU C CB    1 
ATOM   4865  N  N     . PRO B 2 253 ? 132.813 19.472  308.405 1.00 168.83 ? 632 PRO C N     1 
ATOM   4866  C  CA    . PRO B 2 253 ? 133.714 18.375  308.779 1.00 169.36 ? 632 PRO C CA    1 
ATOM   4867  C  C     . PRO B 2 253 ? 133.019 17.015  308.755 1.00 162.19 ? 632 PRO C C     1 
ATOM   4868  O  O     . PRO B 2 253 ? 133.663 16.004  308.476 1.00 162.13 ? 632 PRO C O     1 
ATOM   4869  C  CB    . PRO B 2 253 ? 134.122 18.729  310.213 1.00 173.15 ? 632 PRO C CB    1 
ATOM   4870  C  CG    . PRO B 2 253 ? 133.910 20.196  310.320 1.00 176.40 ? 632 PRO C CG    1 
ATOM   4871  C  CD    . PRO B 2 253 ? 132.704 20.473  309.482 1.00 172.02 ? 632 PRO C CD    1 
ATOM   4872  N  N     . ARG B 2 254 ? 131.722 16.996  309.047 1.00 155.76 ? 633 ARG C N     1 
ATOM   4873  C  CA    . ARG B 2 254 ? 130.949 15.759  309.007 1.00 148.90 ? 633 ARG C CA    1 
ATOM   4874  C  C     . ARG B 2 254 ? 130.828 15.254  307.574 1.00 151.23 ? 633 ARG C C     1 
ATOM   4875  O  O     . ARG B 2 254 ? 130.965 14.058  307.312 1.00 153.66 ? 633 ARG C O     1 
ATOM   4876  C  CB    . ARG B 2 254 ? 129.557 15.970  309.603 1.00 138.72 ? 633 ARG C CB    1 
ATOM   4877  C  CG    . ARG B 2 254 ? 128.719 14.703  309.650 1.00 131.69 ? 633 ARG C CG    1 
ATOM   4878  C  CD    . ARG B 2 254 ? 127.259 14.992  309.956 1.00 127.96 ? 633 ARG C CD    1 
ATOM   4879  N  NE    . ARG B 2 254 ? 127.078 15.681  311.230 1.00 126.06 ? 633 ARG C NE    1 
ATOM   4880  C  CZ    . ARG B 2 254 ? 126.737 16.960  311.343 1.00 123.62 ? 633 ARG C CZ    1 
ATOM   4881  N  NH1   . ARG B 2 254 ? 126.534 17.689  310.255 1.00 128.84 ? 633 ARG C NH1   1 
ATOM   4882  N  NH2   . ARG B 2 254 ? 126.593 17.508  312.541 1.00 115.69 ? 633 ARG C NH2   1 
ATOM   4883  N  N     . ARG B 2 255 ? 130.569 16.176  306.652 1.00 149.96 ? 634 ARG C N     1 
ATOM   4884  C  CA    . ARG B 2 255 ? 130.482 15.846  305.236 1.00 148.05 ? 634 ARG C CA    1 
ATOM   4885  C  C     . ARG B 2 255 ? 131.827 15.340  304.735 1.00 147.36 ? 634 ARG C C     1 
ATOM   4886  O  O     . ARG B 2 255 ? 131.891 14.446  303.890 1.00 145.79 ? 634 ARG C O     1 
ATOM   4887  C  CB    . ARG B 2 255 ? 130.044 17.069  304.427 1.00 150.55 ? 634 ARG C CB    1 
ATOM   4888  N  N     . GLU B 2 256 ? 132.901 15.918  305.265 1.00 149.37 ? 635 GLU C N     1 
ATOM   4889  C  CA    . GLU B 2 256 ? 134.249 15.478  304.932 1.00 152.44 ? 635 GLU C CA    1 
ATOM   4890  C  C     . GLU B 2 256 ? 134.480 14.058  305.441 1.00 143.06 ? 635 GLU C C     1 
ATOM   4891  O  O     . GLU B 2 256 ? 135.092 13.235  304.758 1.00 137.48 ? 635 GLU C O     1 
ATOM   4892  C  CB    . GLU B 2 256 ? 135.287 16.432  305.525 1.00 159.90 ? 635 GLU C CB    1 
ATOM   4893  C  CG    . GLU B 2 256 ? 136.723 16.099  305.152 1.00 170.16 ? 635 GLU C CG    1 
ATOM   4894  C  CD    . GLU B 2 256 ? 137.722 17.080  305.733 1.00 181.34 ? 635 GLU C CD    1 
ATOM   4895  O  OE1   . GLU B 2 256 ? 138.928 16.953  305.430 1.00 185.64 ? 635 GLU C OE1   1 
ATOM   4896  O  OE2   . GLU B 2 256 ? 137.303 17.977  306.494 1.00 183.85 ? 635 GLU C OE2   1 
ATOM   4897  N  N     . PHE B 2 257 ? 133.977 13.778  306.641 1.00 140.10 ? 636 PHE C N     1 
ATOM   4898  C  CA    . PHE B 2 257 ? 134.090 12.450  307.233 1.00 139.64 ? 636 PHE C CA    1 
ATOM   4899  C  C     . PHE B 2 257 ? 133.339 11.412  306.406 1.00 137.11 ? 636 PHE C C     1 
ATOM   4900  O  O     . PHE B 2 257 ? 133.834 10.308  306.187 1.00 135.55 ? 636 PHE C O     1 
ATOM   4901  C  CB    . PHE B 2 257 ? 133.564 12.452  308.672 1.00 138.12 ? 636 PHE C CB    1 
ATOM   4902  C  CG    . PHE B 2 257 ? 133.552 11.093  309.319 1.00 136.03 ? 636 PHE C CG    1 
ATOM   4903  C  CD1   . PHE B 2 257 ? 134.703 10.572  309.889 1.00 139.18 ? 636 PHE C CD1   1 
ATOM   4904  C  CD2   . PHE B 2 257 ? 132.389 10.339  309.363 1.00 125.65 ? 636 PHE C CD2   1 
ATOM   4905  C  CE1   . PHE B 2 257 ? 134.696 9.323   310.485 1.00 134.68 ? 636 PHE C CE1   1 
ATOM   4906  C  CE2   . PHE B 2 257 ? 132.376 9.089   309.956 1.00 121.56 ? 636 PHE C CE2   1 
ATOM   4907  C  CZ    . PHE B 2 257 ? 133.531 8.582   310.519 1.00 127.99 ? 636 PHE C CZ    1 
ATOM   4908  N  N     . ILE B 2 258 ? 132.143 11.774  305.955 1.00 136.39 ? 637 ILE C N     1 
ATOM   4909  C  CA    . ILE B 2 258 ? 131.308 10.866  305.176 1.00 130.06 ? 637 ILE C CA    1 
ATOM   4910  C  C     . ILE B 2 258 ? 131.835 10.705  303.753 1.00 136.99 ? 637 ILE C C     1 
ATOM   4911  O  O     . ILE B 2 258 ? 131.562 9.706   303.090 1.00 135.73 ? 637 ILE C O     1 
ATOM   4912  C  CB    . ILE B 2 258 ? 129.843 11.346  305.128 1.00 114.51 ? 637 ILE C CB    1 
ATOM   4913  N  N     . GLU B 2 259 ? 132.594 11.690  303.287 1.00 140.53 ? 638 GLU C N     1 
ATOM   4914  C  CA    . GLU B 2 259 ? 133.145 11.642  301.938 1.00 144.87 ? 638 GLU C CA    1 
ATOM   4915  C  C     . GLU B 2 259 ? 134.515 10.971  301.913 1.00 148.09 ? 638 GLU C C     1 
ATOM   4916  O  O     . GLU B 2 259 ? 134.994 10.560  300.856 1.00 143.26 ? 638 GLU C O     1 
ATOM   4917  C  CB    . GLU B 2 259 ? 133.237 13.049  301.344 1.00 149.07 ? 638 GLU C CB    1 
ATOM   4918  N  N     . GLU B 2 260 ? 135.138 10.858  303.081 1.00 153.95 ? 639 GLU C N     1 
ATOM   4919  C  CA    . GLU B 2 260 ? 136.467 10.263  303.174 1.00 155.99 ? 639 GLU C CA    1 
ATOM   4920  C  C     . GLU B 2 260 ? 136.461 8.882   303.826 1.00 150.25 ? 639 GLU C C     1 
ATOM   4921  O  O     . GLU B 2 260 ? 137.442 8.144   303.736 1.00 156.52 ? 639 GLU C O     1 
ATOM   4922  C  CB    . GLU B 2 260 ? 137.416 11.192  303.933 1.00 160.08 ? 639 GLU C CB    1 
ATOM   4923  N  N     . ASN B 2 261 ? 135.358 8.534   304.480 1.00 140.95 ? 640 ASN C N     1 
ATOM   4924  C  CA    . ASN B 2 261 ? 135.276 7.264   305.194 1.00 134.97 ? 640 ASN C CA    1 
ATOM   4925  C  C     . ASN B 2 261 ? 134.010 6.465   304.898 1.00 136.87 ? 640 ASN C C     1 
ATOM   4926  O  O     . ASN B 2 261 ? 133.436 5.847   305.793 1.00 145.20 ? 640 ASN C O     1 
ATOM   4927  C  CB    . ASN B 2 261 ? 135.406 7.493   306.701 1.00 125.74 ? 640 ASN C CB    1 
ATOM   4928  N  N     . ALA B 2 262 ? 133.580 6.475   303.641 1.00 132.71 ? 641 ALA C N     1 
ATOM   4929  C  CA    . ALA B 2 262 ? 132.425 5.686   303.230 1.00 131.94 ? 641 ALA C CA    1 
ATOM   4930  C  C     . ALA B 2 262 ? 132.687 4.967   301.912 1.00 143.27 ? 641 ALA C C     1 
ATOM   4931  O  O     . ALA B 2 262 ? 133.050 5.588   300.913 1.00 151.82 ? 641 ALA C O     1 
ATOM   4932  C  CB    . ALA B 2 262 ? 131.189 6.562   303.126 1.00 122.65 ? 641 ALA C CB    1 
ATOM   4933  N  N     . VAL B 2 263 ? 132.505 3.651   301.921 1.00 142.90 ? 642 VAL C N     1 
ATOM   4934  C  CA    . VAL B 2 263 ? 132.710 2.837   300.731 1.00 145.30 ? 642 VAL C CA    1 
ATOM   4935  C  C     . VAL B 2 263 ? 131.375 2.501   300.077 1.00 154.64 ? 642 VAL C C     1 
ATOM   4936  O  O     . VAL B 2 263 ? 130.674 1.587   300.510 1.00 161.43 ? 642 VAL C O     1 
ATOM   4937  C  CB    . VAL B 2 263 ? 133.452 1.531   301.065 1.00 133.19 ? 642 VAL C CB    1 
ATOM   4938  N  N     . TYR B 2 264 ? 131.026 3.246   299.034 1.00 150.20 ? 643 TYR C N     1 
ATOM   4939  C  CA    . TYR B 2 264 ? 129.769 3.030   298.329 1.00 144.58 ? 643 TYR C CA    1 
ATOM   4940  C  C     . TYR B 2 264 ? 129.796 1.727   297.538 1.00 146.19 ? 643 TYR C C     1 
ATOM   4941  O  O     . TYR B 2 264 ? 128.972 1.512   296.650 1.00 145.51 ? 643 TYR C O     1 
ATOM   4942  C  CB    . TYR B 2 264 ? 129.465 4.207   297.398 1.00 146.22 ? 643 TYR C CB    1 
ATOM   4943  C  CG    . TYR B 2 264 ? 129.339 5.534   298.110 1.00 144.49 ? 643 TYR C CG    1 
ATOM   4944  C  CD1   . TYR B 2 264 ? 128.168 5.878   298.772 1.00 137.35 ? 643 TYR C CD1   1 
ATOM   4945  C  CD2   . TYR B 2 264 ? 130.388 6.444   298.118 1.00 147.60 ? 643 TYR C CD2   1 
ATOM   4946  C  CE1   . TYR B 2 264 ? 128.045 7.091   299.424 1.00 135.00 ? 643 TYR C CE1   1 
ATOM   4947  C  CE2   . TYR B 2 264 ? 130.275 7.660   298.767 1.00 145.26 ? 643 TYR C CE2   1 
ATOM   4948  C  CZ    . TYR B 2 264 ? 129.101 7.978   299.418 1.00 137.67 ? 643 TYR C CZ    1 
ATOM   4949  O  OH    . TYR B 2 264 ? 128.982 9.186   300.066 1.00 132.94 ? 643 TYR C OH    1 
ATOM   4950  N  N     . GLN C 1 2   ? 123.553 -11.396 334.467 1.00 136.59 ? 2   GLN B N     1 
ATOM   4951  C  CA    . GLN C 1 2   ? 124.904 -11.809 334.104 1.00 149.83 ? 2   GLN B CA    1 
ATOM   4952  C  C     . GLN C 1 2   ? 124.900 -12.660 332.837 1.00 157.22 ? 2   GLN B C     1 
ATOM   4953  O  O     . GLN C 1 2   ? 124.111 -13.596 332.708 1.00 162.15 ? 2   GLN B O     1 
ATOM   4954  C  CB    . GLN C 1 2   ? 125.554 -12.578 335.255 1.00 152.36 ? 2   GLN B CB    1 
ATOM   4955  N  N     . ASP C 1 3   ? 125.789 -12.332 331.906 1.00 155.55 ? 3   ASP B N     1 
ATOM   4956  C  CA    . ASP C 1 3   ? 125.828 -13.012 330.616 1.00 152.32 ? 3   ASP B CA    1 
ATOM   4957  C  C     . ASP C 1 3   ? 126.869 -14.123 330.572 1.00 151.96 ? 3   ASP B C     1 
ATOM   4958  O  O     . ASP C 1 3   ? 127.833 -14.120 331.339 1.00 156.56 ? 3   ASP B O     1 
ATOM   4959  C  CB    . ASP C 1 3   ? 126.094 -12.008 329.493 1.00 152.90 ? 3   ASP B CB    1 
ATOM   4960  C  CG    . ASP C 1 3   ? 124.918 -11.085 329.245 1.00 150.50 ? 3   ASP B CG    1 
ATOM   4961  O  OD1   . ASP C 1 3   ? 124.169 -11.326 328.276 1.00 150.36 ? 3   ASP B OD1   1 
ATOM   4962  O  OD2   . ASP C 1 3   ? 124.739 -10.121 330.020 1.00 148.06 ? 3   ASP B OD2   1 
ATOM   4963  N  N     . LYS C 1 4   ? 126.664 -15.072 329.664 1.00 149.94 ? 4   LYS B N     1 
ATOM   4964  C  CA    . LYS C 1 4   ? 127.622 -16.147 329.442 1.00 145.37 ? 4   LYS B CA    1 
ATOM   4965  C  C     . LYS C 1 4   ? 128.620 -15.738 328.366 1.00 144.55 ? 4   LYS B C     1 
ATOM   4966  O  O     . LYS C 1 4   ? 129.831 -15.881 328.539 1.00 141.59 ? 4   LYS B O     1 
ATOM   4967  C  CB    . LYS C 1 4   ? 126.901 -17.431 329.032 1.00 138.98 ? 4   LYS B CB    1 
ATOM   4968  N  N     . ASN C 1 5   ? 128.101 -15.225 327.255 1.00 144.01 ? 5   ASN B N     1 
ATOM   4969  C  CA    . ASN C 1 5   ? 128.937 -14.747 326.161 1.00 145.07 ? 5   ASN B CA    1 
ATOM   4970  C  C     . ASN C 1 5   ? 128.873 -13.228 326.020 1.00 142.86 ? 5   ASN B C     1 
ATOM   4971  O  O     . ASN C 1 5   ? 127.873 -12.678 325.558 1.00 143.60 ? 5   ASN B O     1 
ATOM   4972  C  CB    . ASN C 1 5   ? 128.539 -15.424 324.848 1.00 142.96 ? 5   ASN B CB    1 
ATOM   4973  N  N     . LEU C 1 6   ? 129.944 -12.556 326.429 1.00 140.62 ? 6   LEU B N     1 
ATOM   4974  C  CA    . LEU C 1 6   ? 130.009 -11.103 326.354 1.00 140.90 ? 6   LEU B CA    1 
ATOM   4975  C  C     . LEU C 1 6   ? 131.215 -10.653 325.537 1.00 143.82 ? 6   LEU B C     1 
ATOM   4976  O  O     . LEU C 1 6   ? 132.246 -11.326 325.513 1.00 149.27 ? 6   LEU B O     1 
ATOM   4977  C  CB    . LEU C 1 6   ? 130.068 -10.495 327.757 1.00 137.72 ? 6   LEU B CB    1 
ATOM   4978  N  N     . VAL C 1 7   ? 131.076 -9.515  324.865 1.00 139.72 ? 7   VAL B N     1 
ATOM   4979  C  CA    . VAL C 1 7   ? 132.159 -8.958  324.066 1.00 137.03 ? 7   VAL B CA    1 
ATOM   4980  C  C     . VAL C 1 7   ? 132.303 -7.465  324.334 1.00 138.07 ? 7   VAL B C     1 
ATOM   4981  O  O     . VAL C 1 7   ? 131.347 -6.805  324.739 1.00 137.88 ? 7   VAL B O     1 
ATOM   4982  C  CB    . VAL C 1 7   ? 131.925 -9.184  322.561 1.00 132.35 ? 7   VAL B CB    1 
ATOM   4983  N  N     . ASN C 1 8   ? 133.500 -6.935  324.115 1.00 140.26 ? 8   ASN B N     1 
ATOM   4984  C  CA    . ASN C 1 8   ? 133.744 -5.515  324.332 1.00 143.82 ? 8   ASN B CA    1 
ATOM   4985  C  C     . ASN C 1 8   ? 133.510 -4.703  323.065 1.00 139.77 ? 8   ASN B C     1 
ATOM   4986  O  O     . ASN C 1 8   ? 133.787 -5.167  321.959 1.00 138.96 ? 8   ASN B O     1 
ATOM   4987  C  CB    . ASN C 1 8   ? 135.161 -5.283  324.857 1.00 156.69 ? 8   ASN B CB    1 
ATOM   4988  C  CG    . ASN C 1 8   ? 135.429 -3.827  325.183 1.00 167.82 ? 8   ASN B CG    1 
ATOM   4989  O  OD1   . ASN C 1 8   ? 135.020 -3.330  326.232 1.00 171.69 ? 8   ASN B OD1   1 
ATOM   4990  N  ND2   . ASN C 1 8   ? 136.120 -3.135  324.285 1.00 170.30 ? 8   ASN B ND2   1 
ATOM   4991  N  N     . VAL C 1 9   ? 132.994 -3.490  323.233 1.00 137.05 ? 9   VAL B N     1 
ATOM   4992  C  CA    . VAL C 1 9   ? 132.728 -2.612  322.101 1.00 131.26 ? 9   VAL B CA    1 
ATOM   4993  C  C     . VAL C 1 9   ? 133.214 -1.194  322.376 1.00 137.98 ? 9   VAL B C     1 
ATOM   4994  O  O     . VAL C 1 9   ? 132.693 -0.508  323.256 1.00 142.07 ? 9   VAL B O     1 
ATOM   4995  C  CB    . VAL C 1 9   ? 131.228 -2.572  321.758 1.00 119.38 ? 9   VAL B CB    1 
ATOM   4996  N  N     . ASN C 1 10  ? 134.220 -0.764  321.621 1.00 137.78 ? 10  ASN B N     1 
ATOM   4997  C  CA    . ASN C 1 10  ? 134.724 0.599   321.719 1.00 142.10 ? 10  ASN B CA    1 
ATOM   4998  C  C     . ASN C 1 10  ? 133.653 1.597   321.301 1.00 145.90 ? 10  ASN B C     1 
ATOM   4999  O  O     . ASN C 1 10  ? 132.936 1.376   320.326 1.00 150.90 ? 10  ASN B O     1 
ATOM   5000  C  CB    . ASN C 1 10  ? 135.977 0.773   320.859 1.00 140.04 ? 10  ASN B CB    1 
ATOM   5001  N  N     . LEU C 1 11  ? 133.546 2.691   322.048 1.00 139.82 ? 11  LEU B N     1 
ATOM   5002  C  CA    . LEU C 1 11  ? 132.515 3.693   321.804 1.00 134.04 ? 11  LEU B CA    1 
ATOM   5003  C  C     . LEU C 1 11  ? 132.662 4.330   320.427 1.00 135.22 ? 11  LEU B C     1 
ATOM   5004  O  O     . LEU C 1 11  ? 131.729 4.312   319.621 1.00 130.21 ? 11  LEU B O     1 
ATOM   5005  C  CB    . LEU C 1 11  ? 132.566 4.779   322.880 1.00 131.65 ? 11  LEU B CB    1 
ATOM   5006  C  CG    . LEU C 1 11  ? 131.233 5.282   323.440 1.00 117.38 ? 11  LEU B CG    1 
ATOM   5007  C  CD1   . LEU C 1 11  ? 131.364 6.717   323.919 1.00 113.91 ? 11  LEU B CD1   1 
ATOM   5008  C  CD2   . LEU C 1 11  ? 130.106 5.153   322.427 1.00 104.68 ? 11  LEU B CD2   1 
ATOM   5009  N  N     . THR C 1 12  ? 133.839 4.893   320.169 1.00 143.42 ? 12  THR B N     1 
ATOM   5010  C  CA    . THR C 1 12  ? 134.115 5.577   318.909 1.00 136.33 ? 12  THR B CA    1 
ATOM   5011  C  C     . THR C 1 12  ? 133.907 4.663   317.705 1.00 130.53 ? 12  THR B C     1 
ATOM   5012  O  O     . THR C 1 12  ? 133.478 5.111   316.641 1.00 129.49 ? 12  THR B O     1 
ATOM   5013  C  CB    . THR C 1 12  ? 135.552 6.132   318.874 1.00 132.54 ? 12  THR B CB    1 
ATOM   5014  N  N     . LYS C 1 13  ? 134.206 3.381   317.886 1.00 128.07 ? 13  LYS B N     1 
ATOM   5015  C  CA    . LYS C 1 13  ? 134.061 2.394   316.824 1.00 123.22 ? 13  LYS B CA    1 
ATOM   5016  C  C     . LYS C 1 13  ? 132.603 2.227   316.410 1.00 125.80 ? 13  LYS B C     1 
ATOM   5017  O  O     . LYS C 1 13  ? 132.253 2.426   315.243 1.00 128.93 ? 13  LYS B O     1 
ATOM   5018  C  CB    . LYS C 1 13  ? 134.631 1.045   317.269 1.00 118.41 ? 13  LYS B CB    1 
ATOM   5019  N  N     . GLU C 1 14  ? 131.762 1.858   317.374 1.00 125.20 ? 14  GLU B N     1 
ATOM   5020  C  CA    . GLU C 1 14  ? 130.340 1.636   317.128 1.00 125.38 ? 14  GLU B CA    1 
ATOM   5021  C  C     . GLU C 1 14  ? 129.657 2.917   316.663 1.00 126.56 ? 14  GLU B C     1 
ATOM   5022  O  O     . GLU C 1 14  ? 128.780 2.884   315.796 1.00 132.87 ? 14  GLU B O     1 
ATOM   5023  C  CB    . GLU C 1 14  ? 129.652 1.095   318.385 1.00 125.43 ? 14  GLU B CB    1 
ATOM   5024  C  CG    . GLU C 1 14  ? 128.202 0.684   318.174 1.00 116.04 ? 14  GLU B CG    1 
ATOM   5025  N  N     . MET C 1 15  ? 130.062 4.044   317.244 1.00 120.44 ? 15  MET B N     1 
ATOM   5026  C  CA    . MET C 1 15  ? 129.563 5.344   316.813 1.00 122.22 ? 15  MET B CA    1 
ATOM   5027  C  C     . MET C 1 15  ? 129.857 5.576   315.333 1.00 136.52 ? 15  MET B C     1 
ATOM   5028  O  O     . MET C 1 15  ? 128.956 5.902   314.555 1.00 145.63 ? 15  MET B O     1 
ATOM   5029  C  CB    . MET C 1 15  ? 130.181 6.463   317.650 1.00 121.10 ? 15  MET B CB    1 
ATOM   5030  C  CG    . MET C 1 15  ? 129.556 6.627   319.024 1.00 128.64 ? 15  MET B CG    1 
ATOM   5031  S  SD    . MET C 1 15  ? 127.876 7.279   318.947 1.00 144.80 ? 15  MET B SD    1 
ATOM   5032  C  CE    . MET C 1 15  ? 128.166 8.863   318.160 1.00 132.55 ? 15  MET B CE    1 
ATOM   5033  N  N     . LYS C 1 16  ? 131.119 5.391   314.952 1.00 132.20 ? 16  LYS B N     1 
ATOM   5034  C  CA    . LYS C 1 16  ? 131.548 5.581   313.570 1.00 117.72 ? 16  LYS B CA    1 
ATOM   5035  C  C     . LYS C 1 16  ? 130.807 4.660   312.603 1.00 116.81 ? 16  LYS B C     1 
ATOM   5036  O  O     . LYS C 1 16  ? 130.292 5.110   311.578 1.00 118.43 ? 16  LYS B O     1 
ATOM   5037  C  CB    . LYS C 1 16  ? 133.057 5.360   313.446 1.00 111.27 ? 16  LYS B CB    1 
ATOM   5038  N  N     . ALA C 1 17  ? 130.757 3.373   312.936 1.00 114.25 ? 17  ALA B N     1 
ATOM   5039  C  CA    . ALA C 1 17  ? 130.120 2.376   312.078 1.00 112.07 ? 17  ALA B CA    1 
ATOM   5040  C  C     . ALA C 1 17  ? 128.629 2.648   311.891 1.00 115.72 ? 17  ALA B C     1 
ATOM   5041  O  O     . ALA C 1 17  ? 128.138 2.718   310.760 1.00 120.99 ? 17  ALA B O     1 
ATOM   5042  C  CB    . ALA C 1 17  ? 130.339 0.978   312.641 1.00 105.08 ? 17  ALA B CB    1 
ATOM   5043  N  N     . SER C 1 18  ? 127.919 2.801   313.006 1.00 112.25 ? 18  SER B N     1 
ATOM   5044  C  CA    . SER C 1 18  ? 126.487 3.077   312.975 1.00 119.28 ? 18  SER B CA    1 
ATOM   5045  C  C     . SER C 1 18  ? 126.187 4.354   312.197 1.00 135.38 ? 18  SER B C     1 
ATOM   5046  O  O     . SER C 1 18  ? 125.281 4.383   311.353 1.00 142.47 ? 18  SER B O     1 
ATOM   5047  C  CB    . SER C 1 18  ? 125.927 3.191   314.395 1.00 114.70 ? 18  SER B CB    1 
ATOM   5048  O  OG    . SER C 1 18  ? 126.129 1.995   315.125 1.00 117.92 ? 18  SER B OG    1 
ATOM   5049  N  N     . PHE C 1 19  ? 126.954 5.406   312.475 1.00 133.36 ? 19  PHE B N     1 
ATOM   5050  C  CA    . PHE C 1 19  ? 126.730 6.683   311.809 1.00 127.34 ? 19  PHE B CA    1 
ATOM   5051  C  C     . PHE C 1 19  ? 126.974 6.610   310.307 1.00 123.28 ? 19  PHE B C     1 
ATOM   5052  O  O     . PHE C 1 19  ? 126.185 7.136   309.529 1.00 115.57 ? 19  PHE B O     1 
ATOM   5053  C  CB    . PHE C 1 19  ? 127.583 7.793   312.420 1.00 127.32 ? 19  PHE B CB    1 
ATOM   5054  C  CG    . PHE C 1 19  ? 127.262 9.159   311.882 1.00 128.66 ? 19  PHE B CG    1 
ATOM   5055  C  CD1   . PHE C 1 19  ? 128.055 9.741   310.907 1.00 128.94 ? 19  PHE B CD1   1 
ATOM   5056  C  CD2   . PHE C 1 19  ? 126.151 9.849   312.335 1.00 130.70 ? 19  PHE B CD2   1 
ATOM   5057  C  CE1   . PHE C 1 19  ? 127.755 10.993  310.407 1.00 136.07 ? 19  PHE B CE1   1 
ATOM   5058  C  CE2   . PHE C 1 19  ? 125.844 11.099  311.841 1.00 136.49 ? 19  PHE B CE2   1 
ATOM   5059  C  CZ    . PHE C 1 19  ? 126.646 11.673  310.875 1.00 141.20 ? 19  PHE B CZ    1 
ATOM   5060  N  N     . ILE C 1 20  ? 128.068 5.969   309.906 1.00 126.94 ? 20  ILE B N     1 
ATOM   5061  C  CA    . ILE C 1 20  ? 128.380 5.814   308.489 1.00 122.85 ? 20  ILE B CA    1 
ATOM   5062  C  C     . ILE C 1 20  ? 127.272 5.023   307.801 1.00 124.70 ? 20  ILE B C     1 
ATOM   5063  O  O     . ILE C 1 20  ? 126.874 5.339   306.676 1.00 128.40 ? 20  ILE B O     1 
ATOM   5064  C  CB    . ILE C 1 20  ? 129.731 5.102   308.274 1.00 111.91 ? 20  ILE B CB    1 
ATOM   5065  N  N     . ASP C 1 21  ? 126.772 4.005   308.497 1.00 120.46 ? 21  ASP B N     1 
ATOM   5066  C  CA    . ASP C 1 21  ? 125.659 3.205   308.001 1.00 113.49 ? 21  ASP B CA    1 
ATOM   5067  C  C     . ASP C 1 21  ? 124.437 4.074   307.716 1.00 112.78 ? 21  ASP B C     1 
ATOM   5068  O  O     . ASP C 1 21  ? 123.946 4.124   306.580 1.00 116.61 ? 21  ASP B O     1 
ATOM   5069  C  CB    . ASP C 1 21  ? 125.298 2.112   309.010 1.00 101.54 ? 21  ASP B CB    1 
ATOM   5070  N  N     . TYR C 1 22  ? 123.956 4.761   308.750 1.00 108.55 ? 22  TYR B N     1 
ATOM   5071  C  CA    . TYR C 1 22  ? 122.771 5.602   308.614 1.00 108.22 ? 22  TYR B CA    1 
ATOM   5072  C  C     . TYR C 1 22  ? 122.947 6.675   307.544 1.00 117.33 ? 22  TYR B C     1 
ATOM   5073  O  O     . TYR C 1 22  ? 122.076 6.862   306.696 1.00 120.57 ? 22  TYR B O     1 
ATOM   5074  C  CB    . TYR C 1 22  ? 122.401 6.251   309.949 1.00 103.13 ? 22  TYR B CB    1 
ATOM   5075  C  CG    . TYR C 1 22  ? 121.227 7.200   309.856 1.00 96.36  ? 22  TYR B CG    1 
ATOM   5076  C  CD1   . TYR C 1 22  ? 119.927 6.722   309.743 1.00 96.72  ? 22  TYR B CD1   1 
ATOM   5077  C  CD2   . TYR C 1 22  ? 121.418 8.575   309.881 1.00 98.89  ? 22  TYR B CD2   1 
ATOM   5078  C  CE1   . TYR C 1 22  ? 118.851 7.588   309.662 1.00 101.90 ? 22  TYR B CE1   1 
ATOM   5079  C  CE2   . TYR C 1 22  ? 120.348 9.450   309.798 1.00 99.16  ? 22  TYR B CE2   1 
ATOM   5080  C  CZ    . TYR C 1 22  ? 119.067 8.950   309.689 1.00 97.88  ? 22  TYR B CZ    1 
ATOM   5081  O  OH    . TYR C 1 22  ? 118.000 9.815   309.605 1.00 93.05  ? 22  TYR B OH    1 
ATOM   5082  N  N     . ALA C 1 23  ? 124.082 7.368   307.587 1.00 118.85 ? 23  ALA B N     1 
ATOM   5083  C  CA    . ALA C 1 23  ? 124.390 8.432   306.635 1.00 110.32 ? 23  ALA B CA    1 
ATOM   5084  C  C     . ALA C 1 23  ? 124.356 7.937   305.194 1.00 108.44 ? 23  ALA B C     1 
ATOM   5085  O  O     . ALA C 1 23  ? 123.637 8.490   304.361 1.00 110.99 ? 23  ALA B O     1 
ATOM   5086  C  CB    . ALA C 1 23  ? 125.745 9.050   306.952 1.00 104.16 ? 23  ALA B CB    1 
ATOM   5087  N  N     . MET C 1 24  ? 125.134 6.896   304.908 1.00 105.76 ? 24  MET B N     1 
ATOM   5088  C  CA    . MET C 1 24  ? 125.193 6.332   303.563 1.00 101.62 ? 24  MET B CA    1 
ATOM   5089  C  C     . MET C 1 24  ? 123.814 5.882   303.089 1.00 101.69 ? 24  MET B C     1 
ATOM   5090  O  O     . MET C 1 24  ? 123.419 6.148   301.949 1.00 102.31 ? 24  MET B O     1 
ATOM   5091  C  CB    . MET C 1 24  ? 126.172 5.157   303.517 1.00 91.73  ? 24  MET B CB    1 
ATOM   5092  N  N     . SER C 1 25  ? 123.084 5.211   303.975 1.00 98.96  ? 25  SER B N     1 
ATOM   5093  C  CA    . SER C 1 25  ? 121.760 4.699   303.638 1.00 92.49  ? 25  SER B CA    1 
ATOM   5094  C  C     . SER C 1 25  ? 120.761 5.817   303.349 1.00 101.62 ? 25  SER B C     1 
ATOM   5095  O  O     . SER C 1 25  ? 119.864 5.658   302.522 1.00 109.01 ? 25  SER B O     1 
ATOM   5096  C  CB    . SER C 1 25  ? 121.229 3.795   304.754 1.00 87.22  ? 25  SER B CB    1 
ATOM   5097  N  N     . VAL C 1 26  ? 120.921 6.946   304.034 1.00 104.30 ? 26  VAL B N     1 
ATOM   5098  C  CA    . VAL C 1 26  ? 120.042 8.099   303.841 1.00 104.12 ? 26  VAL B CA    1 
ATOM   5099  C  C     . VAL C 1 26  ? 120.396 8.855   302.560 1.00 107.32 ? 26  VAL B C     1 
ATOM   5100  O  O     . VAL C 1 26  ? 119.514 9.345   301.849 1.00 101.44 ? 26  VAL B O     1 
ATOM   5101  C  CB    . VAL C 1 26  ? 120.082 9.051   305.063 1.00 97.41  ? 26  VAL B CB    1 
ATOM   5102  C  CG1   . VAL C 1 26  ? 119.463 10.402  304.731 1.00 94.65  ? 26  VAL B CG1   1 
ATOM   5103  C  CG2   . VAL C 1 26  ? 119.366 8.419   306.242 1.00 95.30  ? 26  VAL B CG2   1 
ATOM   5104  N  N     . ILE C 1 27  ? 121.688 8.932   302.260 1.00 108.86 ? 27  ILE B N     1 
ATOM   5105  C  CA    . ILE C 1 27  ? 122.143 9.610   301.052 1.00 112.59 ? 27  ILE B CA    1 
ATOM   5106  C  C     . ILE C 1 27  ? 121.754 8.844   299.792 1.00 113.41 ? 27  ILE B C     1 
ATOM   5107  O  O     . ILE C 1 27  ? 121.054 9.369   298.925 1.00 118.08 ? 27  ILE B O     1 
ATOM   5108  C  CB    . ILE C 1 27  ? 123.672 9.807   301.046 1.00 115.34 ? 27  ILE B CB    1 
ATOM   5109  C  CG1   . ILE C 1 27  ? 124.107 10.703  302.207 1.00 121.20 ? 27  ILE B CG1   1 
ATOM   5110  C  CG2   . ILE C 1 27  ? 124.119 10.413  299.727 1.00 116.27 ? 27  ILE B CG2   1 
ATOM   5111  C  CD1   . ILE C 1 27  ? 125.610 10.757  302.405 1.00 123.12 ? 27  ILE B CD1   1 
ATOM   5112  N  N     . VAL C 1 28  ? 122.206 7.598   299.702 1.00 105.56 ? 28  VAL B N     1 
ATOM   5113  C  CA    . VAL C 1 28  ? 122.082 6.834   298.467 1.00 92.07  ? 28  VAL B CA    1 
ATOM   5114  C  C     . VAL C 1 28  ? 120.827 5.970   298.381 1.00 102.40 ? 28  VAL B C     1 
ATOM   5115  O  O     . VAL C 1 28  ? 120.733 5.106   297.509 1.00 103.31 ? 28  VAL B O     1 
ATOM   5116  C  CB    . VAL C 1 28  ? 123.313 5.928   298.250 1.00 71.09  ? 28  VAL B CB    1 
ATOM   5117  N  N     . ALA C 1 29  ? 119.863 6.197   299.271 1.00 105.04 ? 29  ALA B N     1 
ATOM   5118  C  CA    . ALA C 1 29  ? 118.655 5.370   299.282 1.00 100.90 ? 29  ALA B CA    1 
ATOM   5119  C  C     . ALA C 1 29  ? 117.463 5.991   300.005 1.00 103.89 ? 29  ALA B C     1 
ATOM   5120  O  O     . ALA C 1 29  ? 116.624 5.267   300.541 1.00 99.21  ? 29  ALA B O     1 
ATOM   5121  C  CB    . ALA C 1 29  ? 118.961 4.001   299.874 1.00 88.68  ? 29  ALA B CB    1 
ATOM   5122  N  N     . ARG C 1 30  ? 117.374 7.318   300.014 1.00 112.70 ? 30  ARG B N     1 
ATOM   5123  C  CA    . ARG C 1 30  ? 116.274 7.981   300.711 1.00 119.63 ? 30  ARG B CA    1 
ATOM   5124  C  C     . ARG C 1 30  ? 116.066 9.438   300.312 1.00 112.67 ? 30  ARG B C     1 
ATOM   5125  O  O     . ARG C 1 30  ? 115.055 9.790   299.704 1.00 113.57 ? 30  ARG B O     1 
ATOM   5126  C  CB    . ARG C 1 30  ? 116.477 7.896   302.227 1.00 127.66 ? 30  ARG B CB    1 
ATOM   5127  C  CG    . ARG C 1 30  ? 115.404 7.094   302.935 1.00 130.99 ? 30  ARG B CG    1 
ATOM   5128  C  CD    . ARG C 1 30  ? 114.741 7.908   304.029 1.00 134.91 ? 30  ARG B CD    1 
ATOM   5129  N  NE    . ARG C 1 30  ? 115.582 8.043   305.213 1.00 136.27 ? 30  ARG B NE    1 
ATOM   5130  C  CZ    . ARG C 1 30  ? 115.569 7.195   306.237 1.00 128.58 ? 30  ARG B CZ    1 
ATOM   5131  N  NH1   . ARG C 1 30  ? 114.762 6.143   306.220 1.00 114.41 ? 30  ARG B NH1   1 
ATOM   5132  N  NH2   . ARG C 1 30  ? 116.366 7.397   307.276 1.00 132.21 ? 30  ARG B NH2   1 
ATOM   5133  N  N     . ALA C 1 31  ? 117.028 10.280  300.668 1.00 105.53 ? 31  ALA B N     1 
ATOM   5134  C  CA    . ALA C 1 31  ? 116.861 11.725  300.574 1.00 107.03 ? 31  ALA B CA    1 
ATOM   5135  C  C     . ALA C 1 31  ? 117.204 12.316  299.209 1.00 114.54 ? 31  ALA B C     1 
ATOM   5136  O  O     . ALA C 1 31  ? 116.709 13.384  298.848 1.00 101.15 ? 31  ALA B O     1 
ATOM   5137  C  CB    . ALA C 1 31  ? 117.672 12.407  301.656 1.00 103.89 ? 31  ALA B CB    1 
ATOM   5138  N  N     . LEU C 1 32  ? 118.053 11.629  298.454 1.00 119.68 ? 32  LEU B N     1 
ATOM   5139  C  CA    . LEU C 1 32  ? 118.521 12.162  297.182 1.00 110.07 ? 32  LEU B CA    1 
ATOM   5140  C  C     . LEU C 1 32  ? 118.020 11.344  295.995 1.00 110.41 ? 32  LEU B C     1 
ATOM   5141  O  O     . LEU C 1 32  ? 117.849 10.129  296.101 1.00 114.64 ? 32  LEU B O     1 
ATOM   5142  C  CB    . LEU C 1 32  ? 120.049 12.247  297.176 1.00 98.41  ? 32  LEU B CB    1 
ATOM   5143  C  CG    . LEU C 1 32  ? 120.660 13.068  298.314 1.00 94.80  ? 32  LEU B CG    1 
ATOM   5144  C  CD1   . LEU C 1 32  ? 122.169 13.182  298.149 1.00 101.28 ? 32  LEU B CD1   1 
ATOM   5145  C  CD2   . LEU C 1 32  ? 120.015 14.448  298.419 1.00 85.51  ? 32  LEU B CD2   1 
ATOM   5146  N  N     . PRO C 1 33  ? 117.773 12.018  294.860 1.00 111.63 ? 33  PRO B N     1 
ATOM   5147  C  CA    . PRO C 1 33  ? 117.277 11.347  293.657 1.00 105.04 ? 33  PRO B CA    1 
ATOM   5148  C  C     . PRO C 1 33  ? 118.412 10.810  292.791 1.00 104.18 ? 33  PRO B C     1 
ATOM   5149  O  O     . PRO C 1 33  ? 119.578 11.147  293.005 1.00 101.35 ? 33  PRO B O     1 
ATOM   5150  C  CB    . PRO C 1 33  ? 116.565 12.477  292.917 1.00 105.22 ? 33  PRO B CB    1 
ATOM   5151  C  CG    . PRO C 1 33  ? 117.388 13.676  293.249 1.00 101.42 ? 33  PRO B CG    1 
ATOM   5152  C  CD    . PRO C 1 33  ? 117.860 13.479  294.672 1.00 107.31 ? 33  PRO B CD    1 
ATOM   5153  N  N     . ASP C 1 34  ? 118.062 9.975   291.819 1.00 105.00 ? 34  ASP B N     1 
ATOM   5154  C  CA    . ASP C 1 34  ? 119.022 9.497   290.838 1.00 95.38  ? 34  ASP B CA    1 
ATOM   5155  C  C     . ASP C 1 34  ? 119.083 10.529  289.721 1.00 98.47  ? 34  ASP B C     1 
ATOM   5156  O  O     . ASP C 1 34  ? 118.061 11.092  289.338 1.00 100.36 ? 34  ASP B O     1 
ATOM   5157  C  CB    . ASP C 1 34  ? 118.586 8.139   290.286 1.00 89.50  ? 34  ASP B CB    1 
ATOM   5158  C  CG    . ASP C 1 34  ? 119.716 7.394   289.599 1.00 96.84  ? 34  ASP B CG    1 
ATOM   5159  O  OD1   . ASP C 1 34  ? 119.782 6.155   289.745 1.00 93.22  ? 34  ASP B OD1   1 
ATOM   5160  O  OD2   . ASP C 1 34  ? 120.537 8.040   288.915 1.00 104.76 ? 34  ASP B OD2   1 
ATOM   5161  N  N     . VAL C 1 35  ? 120.281 10.784  289.206 1.00 102.29 ? 35  VAL B N     1 
ATOM   5162  C  CA    . VAL C 1 35  ? 120.467 11.788  288.162 1.00 104.18 ? 35  VAL B CA    1 
ATOM   5163  C  C     . VAL C 1 35  ? 119.745 11.392  286.870 1.00 101.49 ? 35  VAL B C     1 
ATOM   5164  O  O     . VAL C 1 35  ? 119.376 12.246  286.061 1.00 106.48 ? 35  VAL B O     1 
ATOM   5165  C  CB    . VAL C 1 35  ? 121.971 12.038  287.887 1.00 104.03 ? 35  VAL B CB    1 
ATOM   5166  C  CG1   . VAL C 1 35  ? 122.645 10.773  287.373 1.00 102.92 ? 35  VAL B CG1   1 
ATOM   5167  C  CG2   . VAL C 1 35  ? 122.160 13.185  286.905 1.00 106.78 ? 35  VAL B CG2   1 
ATOM   5168  N  N     . ARG C 1 36  ? 119.521 10.094  286.702 1.00 97.90  ? 36  ARG B N     1 
ATOM   5169  C  CA    . ARG C 1 36  ? 118.945 9.562   285.474 1.00 100.80 ? 36  ARG B CA    1 
ATOM   5170  C  C     . ARG C 1 36  ? 117.429 9.751   285.377 1.00 102.24 ? 36  ARG B C     1 
ATOM   5171  O  O     . ARG C 1 36  ? 116.933 10.315  284.402 1.00 113.94 ? 36  ARG B O     1 
ATOM   5172  C  CB    . ARG C 1 36  ? 119.317 8.086   285.318 1.00 102.76 ? 36  ARG B CB    1 
ATOM   5173  C  CG    . ARG C 1 36  ? 120.819 7.839   285.240 1.00 105.25 ? 36  ARG B CG    1 
ATOM   5174  C  CD    . ARG C 1 36  ? 121.135 6.359   285.266 1.00 108.57 ? 36  ARG B CD    1 
ATOM   5175  N  NE    . ARG C 1 36  ? 120.736 5.739   286.526 1.00 104.16 ? 36  ARG B NE    1 
ATOM   5176  C  CZ    . ARG C 1 36  ? 120.794 4.434   286.768 1.00 98.50  ? 36  ARG B CZ    1 
ATOM   5177  N  NH1   . ARG C 1 36  ? 121.230 3.604   285.834 1.00 98.88  ? 36  ARG B NH1   1 
ATOM   5178  N  NH2   . ARG C 1 36  ? 120.412 3.961   287.945 1.00 101.26 ? 36  ARG B NH2   1 
ATOM   5179  N  N     . ASP C 1 37  ? 116.692 9.281   286.380 1.00 100.26 ? 37  ASP B N     1 
ATOM   5180  C  CA    . ASP C 1 37  ? 115.232 9.386   286.348 1.00 104.47 ? 37  ASP B CA    1 
ATOM   5181  C  C     . ASP C 1 37  ? 114.683 10.461  287.288 1.00 104.55 ? 37  ASP B C     1 
ATOM   5182  O  O     . ASP C 1 37  ? 113.478 10.707  287.324 1.00 104.51 ? 37  ASP B O     1 
ATOM   5183  C  CB    . ASP C 1 37  ? 114.577 8.031   286.639 1.00 108.14 ? 37  ASP B CB    1 
ATOM   5184  C  CG    . ASP C 1 37  ? 114.842 7.541   288.049 1.00 111.83 ? 37  ASP B CG    1 
ATOM   5185  O  OD1   . ASP C 1 37  ? 115.879 7.921   288.630 1.00 119.90 ? 37  ASP B OD1   1 
ATOM   5186  O  OD2   . ASP C 1 37  ? 114.013 6.768   288.574 1.00 106.72 ? 37  ASP B OD2   1 
ATOM   5187  N  N     . GLY C 1 38  ? 115.574 11.100  288.040 1.00 99.72  ? 38  GLY B N     1 
ATOM   5188  C  CA    . GLY C 1 38  ? 115.191 12.174  288.940 1.00 94.63  ? 38  GLY B CA    1 
ATOM   5189  C  C     . GLY C 1 38  ? 114.285 11.726  290.071 1.00 99.56  ? 38  GLY B C     1 
ATOM   5190  O  O     . GLY C 1 38  ? 113.515 12.523  290.608 1.00 106.68 ? 38  GLY B O     1 
ATOM   5191  N  N     . LEU C 1 39  ? 114.377 10.452  290.438 1.00 102.19 ? 39  LEU B N     1 
ATOM   5192  C  CA    . LEU C 1 39  ? 113.502 9.898   291.465 1.00 102.14 ? 39  LEU B CA    1 
ATOM   5193  C  C     . LEU C 1 39  ? 114.241 9.414   292.708 1.00 107.89 ? 39  LEU B C     1 
ATOM   5194  O  O     . LEU C 1 39  ? 115.340 8.866   292.625 1.00 111.59 ? 39  LEU B O     1 
ATOM   5195  C  CB    . LEU C 1 39  ? 112.661 8.753   290.896 1.00 87.24  ? 39  LEU B CB    1 
ATOM   5196  C  CG    . LEU C 1 39  ? 111.568 9.116   289.891 1.00 78.64  ? 39  LEU B CG    1 
ATOM   5197  C  CD1   . LEU C 1 39  ? 110.810 7.872   289.471 1.00 78.13  ? 39  LEU B CD1   1 
ATOM   5198  C  CD2   . LEU C 1 39  ? 110.620 10.147  290.479 1.00 81.42  ? 39  LEU B CD2   1 
ATOM   5199  N  N     . LYS C 1 40  ? 113.616 9.628   293.860 1.00 103.94 ? 40  LYS B N     1 
ATOM   5200  C  CA    . LYS C 1 40  ? 114.070 9.040   295.112 1.00 102.44 ? 40  LYS B CA    1 
ATOM   5201  C  C     . LYS C 1 40  ? 113.227 7.793   295.386 1.00 103.62 ? 40  LYS B C     1 
ATOM   5202  O  O     . LYS C 1 40  ? 112.055 7.753   295.005 1.00 109.84 ? 40  LYS B O     1 
ATOM   5203  C  CB    . LYS C 1 40  ? 113.966 10.058  296.251 1.00 103.27 ? 40  LYS B CB    1 
ATOM   5204  C  CG    . LYS C 1 40  ? 112.756 10.961  296.171 1.00 105.09 ? 40  LYS B CG    1 
ATOM   5205  C  CD    . LYS C 1 40  ? 112.780 12.004  297.279 1.00 104.52 ? 40  LYS B CD    1 
ATOM   5206  C  CE    . LYS C 1 40  ? 114.003 12.898  297.173 1.00 95.66  ? 40  LYS B CE    1 
ATOM   5207  N  NZ    . LYS C 1 40  ? 114.113 13.834  298.323 1.00 89.74  ? 40  LYS B NZ    1 
ATOM   5208  N  N     . PRO C 1 41  ? 113.827 6.770   296.027 1.00 94.62  ? 41  PRO B N     1 
ATOM   5209  C  CA    . PRO C 1 41  ? 113.265 5.425   296.213 1.00 92.38  ? 41  PRO B CA    1 
ATOM   5210  C  C     . PRO C 1 41  ? 111.750 5.346   296.420 1.00 95.25  ? 41  PRO B C     1 
ATOM   5211  O  O     . PRO C 1 41  ? 111.100 4.533   295.763 1.00 105.00 ? 41  PRO B O     1 
ATOM   5212  C  CB    . PRO C 1 41  ? 113.999 4.924   297.455 1.00 69.54  ? 41  PRO B CB    1 
ATOM   5213  C  CG    . PRO C 1 41  ? 115.343 5.522   297.321 1.00 84.37  ? 41  PRO B CG    1 
ATOM   5214  C  CD    . PRO C 1 41  ? 115.145 6.883   296.682 1.00 89.84  ? 41  PRO B CD    1 
ATOM   5215  N  N     . VAL C 1 42  ? 111.197 6.171   297.304 1.00 91.65  ? 42  VAL B N     1 
ATOM   5216  C  CA    . VAL C 1 42  ? 109.760 6.137   297.566 1.00 93.71  ? 42  VAL B CA    1 
ATOM   5217  C  C     . VAL C 1 42  ? 108.932 6.458   296.316 1.00 97.67  ? 42  VAL B C     1 
ATOM   5218  O  O     . VAL C 1 42  ? 107.948 5.779   296.028 1.00 97.57  ? 42  VAL B O     1 
ATOM   5219  C  CB    . VAL C 1 42  ? 109.361 7.056   298.752 1.00 103.69 ? 42  VAL B CB    1 
ATOM   5220  C  CG1   . VAL C 1 42  ? 109.919 8.461   298.571 1.00 109.87 ? 42  VAL B CG1   1 
ATOM   5221  C  CG2   . VAL C 1 42  ? 107.848 7.083   298.926 1.00 104.09 ? 42  VAL B CG2   1 
ATOM   5222  N  N     . HIS C 1 43  ? 109.349 7.471   295.562 1.00 101.35 ? 43  HIS B N     1 
ATOM   5223  C  CA    . HIS C 1 43  ? 108.636 7.867   294.349 1.00 104.22 ? 43  HIS B CA    1 
ATOM   5224  C  C     . HIS C 1 43  ? 108.714 6.793   293.264 1.00 101.52 ? 43  HIS B C     1 
ATOM   5225  O  O     . HIS C 1 43  ? 107.710 6.469   292.625 1.00 105.77 ? 43  HIS B O     1 
ATOM   5226  C  CB    . HIS C 1 43  ? 109.176 9.196   293.813 1.00 111.90 ? 43  HIS B CB    1 
ATOM   5227  C  CG    . HIS C 1 43  ? 108.986 10.349  294.749 1.00 116.94 ? 43  HIS B CG    1 
ATOM   5228  N  ND1   . HIS C 1 43  ? 109.620 10.430  295.969 1.00 113.25 ? 43  HIS B ND1   1 
ATOM   5229  C  CD2   . HIS C 1 43  ? 108.232 11.468  294.643 1.00 125.65 ? 43  HIS B CD2   1 
ATOM   5230  C  CE1   . HIS C 1 43  ? 109.268 11.550  296.574 1.00 122.17 ? 43  HIS B CE1   1 
ATOM   5231  N  NE2   . HIS C 1 43  ? 108.425 12.198  295.791 1.00 128.84 ? 43  HIS B NE2   1 
ATOM   5232  N  N     . ARG C 1 44  ? 109.911 6.250   293.060 1.00 91.07  ? 44  ARG B N     1 
ATOM   5233  C  CA    . ARG C 1 44  ? 110.122 5.201   292.067 1.00 91.53  ? 44  ARG B CA    1 
ATOM   5234  C  C     . ARG C 1 44  ? 109.281 3.975   292.410 1.00 86.79  ? 44  ARG B C     1 
ATOM   5235  O  O     . ARG C 1 44  ? 108.638 3.379   291.540 1.00 94.39  ? 44  ARG B O     1 
ATOM   5236  C  CB    . ARG C 1 44  ? 111.606 4.828   291.985 1.00 95.79  ? 44  ARG B CB    1 
ATOM   5237  C  CG    . ARG C 1 44  ? 111.955 3.894   290.835 1.00 96.64  ? 44  ARG B CG    1 
ATOM   5238  C  CD    . ARG C 1 44  ? 113.454 3.627   290.757 1.00 96.31  ? 44  ARG B CD    1 
ATOM   5239  N  NE    . ARG C 1 44  ? 114.233 4.846   290.556 1.00 99.78  ? 44  ARG B NE    1 
ATOM   5240  C  CZ    . ARG C 1 44  ? 115.054 5.369   291.462 1.00 104.94 ? 44  ARG B CZ    1 
ATOM   5241  N  NH1   . ARG C 1 44  ? 115.217 4.774   292.636 1.00 104.75 ? 44  ARG B NH1   1 
ATOM   5242  N  NH2   . ARG C 1 44  ? 115.719 6.485   291.192 1.00 108.99 ? 44  ARG B NH2   1 
ATOM   5243  N  N     . ARG C 1 45  ? 109.278 3.616   293.690 1.00 78.86  ? 45  ARG B N     1 
ATOM   5244  C  CA    . ARG C 1 45  ? 108.488 2.488   294.168 1.00 77.99  ? 45  ARG B CA    1 
ATOM   5245  C  C     . ARG C 1 45  ? 106.988 2.741   294.041 1.00 84.99  ? 45  ARG B C     1 
ATOM   5246  O  O     . ARG C 1 45  ? 106.219 1.808   293.820 1.00 81.19  ? 45  ARG B O     1 
ATOM   5247  C  CB    . ARG C 1 45  ? 108.857 2.137   295.612 1.00 69.07  ? 45  ARG B CB    1 
ATOM   5248  C  CG    . ARG C 1 45  ? 110.220 1.476   295.759 1.00 78.58  ? 45  ARG B CG    1 
ATOM   5249  C  CD    . ARG C 1 45  ? 110.470 1.025   297.190 1.00 90.94  ? 45  ARG B CD    1 
ATOM   5250  N  NE    . ARG C 1 45  ? 111.716 0.275   297.322 1.00 96.31  ? 45  ARG B NE    1 
ATOM   5251  C  CZ    . ARG C 1 45  ? 112.819 0.750   297.890 1.00 100.28 ? 45  ARG B CZ    1 
ATOM   5252  N  NH1   . ARG C 1 45  ? 112.830 1.976   298.392 1.00 104.27 ? 45  ARG B NH1   1 
ATOM   5253  N  NH2   . ARG C 1 45  ? 113.907 -0.003  297.964 1.00 98.89  ? 45  ARG B NH2   1 
ATOM   5254  N  N     . ILE C 1 46  ? 106.570 3.995   294.188 1.00 91.53  ? 46  ILE B N     1 
ATOM   5255  C  CA    . ILE C 1 46  ? 105.160 4.320   294.006 1.00 90.55  ? 46  ILE B CA    1 
ATOM   5256  C  C     . ILE C 1 46  ? 104.763 4.200   292.538 1.00 95.42  ? 46  ILE B C     1 
ATOM   5257  O  O     . ILE C 1 46  ? 103.728 3.625   292.220 1.00 98.76  ? 46  ILE B O     1 
ATOM   5258  C  CB    . ILE C 1 46  ? 104.790 5.719   294.543 1.00 86.01  ? 46  ILE B CB    1 
ATOM   5259  C  CG1   . ILE C 1 46  ? 104.856 5.743   296.070 1.00 87.90  ? 46  ILE B CG1   1 
ATOM   5260  C  CG2   . ILE C 1 46  ? 103.386 6.094   294.105 1.00 85.46  ? 46  ILE B CG2   1 
ATOM   5261  C  CD1   . ILE C 1 46  ? 104.503 7.082   296.674 1.00 92.25  ? 46  ILE B CD1   1 
ATOM   5262  N  N     . LEU C 1 47  ? 105.594 4.729   291.644 1.00 98.78  ? 47  LEU B N     1 
ATOM   5263  C  CA    . LEU C 1 47  ? 105.306 4.649   290.212 1.00 93.85  ? 47  LEU B CA    1 
ATOM   5264  C  C     . LEU C 1 47  ? 105.277 3.206   289.710 1.00 92.40  ? 47  LEU B C     1 
ATOM   5265  O  O     . LEU C 1 47  ? 104.360 2.815   288.983 1.00 97.60  ? 47  LEU B O     1 
ATOM   5266  C  CB    . LEU C 1 47  ? 106.304 5.473   289.398 1.00 90.20  ? 47  LEU B CB    1 
ATOM   5267  C  CG    . LEU C 1 47  ? 106.139 6.993   289.478 1.00 89.02  ? 47  LEU B CG    1 
ATOM   5268  C  CD1   . LEU C 1 47  ? 107.001 7.687   288.432 1.00 89.07  ? 47  LEU B CD1   1 
ATOM   5269  C  CD2   . LEU C 1 47  ? 104.674 7.388   289.331 1.00 76.78  ? 47  LEU B CD2   1 
ATOM   5270  N  N     . TYR C 1 48  ? 106.276 2.419   290.102 1.00 83.54  ? 48  TYR B N     1 
ATOM   5271  C  CA    . TYR C 1 48  ? 106.321 1.015   289.707 1.00 81.03  ? 48  TYR B CA    1 
ATOM   5272  C  C     . TYR C 1 48  ? 105.173 0.228   290.331 1.00 90.64  ? 48  TYR B C     1 
ATOM   5273  O  O     . TYR C 1 48  ? 104.566 -0.628  289.682 1.00 95.68  ? 48  TYR B O     1 
ATOM   5274  C  CB    . TYR C 1 48  ? 107.662 0.392   290.088 1.00 77.84  ? 48  TYR B CB    1 
ATOM   5275  C  CG    . TYR C 1 48  ? 107.798 -1.063  289.696 1.00 82.63  ? 48  TYR B CG    1 
ATOM   5276  C  CD1   . TYR C 1 48  ? 107.758 -2.069  290.654 1.00 86.48  ? 48  TYR B CD1   1 
ATOM   5277  C  CD2   . TYR C 1 48  ? 107.961 -1.431  288.366 1.00 90.73  ? 48  TYR B CD2   1 
ATOM   5278  C  CE1   . TYR C 1 48  ? 107.881 -3.401  290.297 1.00 97.48  ? 48  TYR B CE1   1 
ATOM   5279  C  CE2   . TYR C 1 48  ? 108.084 -2.758  288.002 1.00 103.37 ? 48  TYR B CE2   1 
ATOM   5280  C  CZ    . TYR C 1 48  ? 108.043 -3.739  288.970 1.00 106.49 ? 48  TYR B CZ    1 
ATOM   5281  O  OH    . TYR C 1 48  ? 108.166 -5.061  288.605 1.00 109.99 ? 48  TYR B OH    1 
ATOM   5282  N  N     . GLY C 1 49  ? 104.880 0.528   291.592 1.00 101.17 ? 49  GLY B N     1 
ATOM   5283  C  CA    . GLY C 1 49  ? 103.799 -0.129  292.303 1.00 106.99 ? 49  GLY B CA    1 
ATOM   5284  C  C     . GLY C 1 49  ? 102.464 0.140   291.636 1.00 99.92  ? 49  GLY B C     1 
ATOM   5285  O  O     . GLY C 1 49  ? 101.629 -0.756  291.511 1.00 110.00 ? 49  GLY B O     1 
ATOM   5286  N  N     . MET C 1 50  ? 102.266 1.383   291.209 1.00 90.52  ? 50  MET B N     1 
ATOM   5287  C  CA    . MET C 1 50  ? 101.071 1.767   290.474 1.00 94.87  ? 50  MET B CA    1 
ATOM   5288  C  C     . MET C 1 50  ? 101.043 1.068   289.119 1.00 98.41  ? 50  MET B C     1 
ATOM   5289  O  O     . MET C 1 50  ? 99.979  0.680   288.634 1.00 103.39 ? 50  MET B O     1 
ATOM   5290  C  CB    . MET C 1 50  ? 101.013 3.287   290.288 1.00 89.60  ? 50  MET B CB    1 
ATOM   5291  C  CG    . MET C 1 50  ? 100.705 4.062   291.558 1.00 83.96  ? 50  MET B CG    1 
ATOM   5292  S  SD    . MET C 1 50  ? 100.521 5.841   291.274 1.00 107.87 ? 50  MET B SD    1 
ATOM   5293  C  CE    . MET C 1 50  ? 98.792  6.072   291.662 1.00 104.85 ? 50  MET B CE    1 
ATOM   5294  N  N     . ASN C 1 51  ? 102.216 0.903   288.512 1.00 91.59  ? 51  ASN B N     1 
ATOM   5295  C  CA    . ASN C 1 51  ? 102.313 0.207   287.232 1.00 92.30  ? 51  ASN B CA    1 
ATOM   5296  C  C     . ASN C 1 51  ? 101.812 -1.227  287.334 1.00 99.57  ? 51  ASN B C     1 
ATOM   5297  O  O     . ASN C 1 51  ? 100.916 -1.635  286.596 1.00 112.95 ? 51  ASN B O     1 
ATOM   5298  C  CB    . ASN C 1 51  ? 103.752 0.210   286.720 1.00 89.11  ? 51  ASN B CB    1 
ATOM   5299  C  CG    . ASN C 1 51  ? 103.850 -0.161  285.253 1.00 93.56  ? 51  ASN B CG    1 
ATOM   5300  O  OD1   . ASN C 1 51  ? 102.999 0.216   284.451 1.00 95.14  ? 51  ASN B OD1   1 
ATOM   5301  N  ND2   . ASN C 1 51  ? 104.886 -0.913  284.897 1.00 103.60 ? 51  ASN B ND2   1 
ATOM   5302  N  N     . GLU C 1 52  ? 102.393 -1.984  288.260 1.00 89.11  ? 52  GLU B N     1 
ATOM   5303  C  CA    . GLU C 1 52  ? 102.019 -3.381  288.449 1.00 79.76  ? 52  GLU B CA    1 
ATOM   5304  C  C     . GLU C 1 52  ? 100.566 -3.518  288.904 1.00 92.08  ? 52  GLU B C     1 
ATOM   5305  O  O     . GLU C 1 52  ? 99.920  -4.533  288.650 1.00 98.01  ? 52  GLU B O     1 
ATOM   5306  C  CB    . GLU C 1 52  ? 102.957 -4.055  289.452 1.00 89.91  ? 52  GLU B CB    1 
ATOM   5307  C  CG    . GLU C 1 52  ? 104.439 -3.888  289.134 1.00 104.82 ? 52  GLU B CG    1 
ATOM   5308  C  CD    . GLU C 1 52  ? 104.843 -4.568  287.841 1.00 127.12 ? 52  GLU B CD    1 
ATOM   5309  O  OE1   . GLU C 1 52  ? 104.903 -5.815  287.820 1.00 136.35 ? 52  GLU B OE1   1 
ATOM   5310  O  OE2   . GLU C 1 52  ? 105.100 -3.858  286.845 1.00 135.64 ? 52  GLU B OE2   1 
ATOM   5311  N  N     . LEU C 1 53  ? 100.059 -2.486  289.571 1.00 97.93  ? 53  LEU B N     1 
ATOM   5312  C  CA    . LEU C 1 53  ? 98.684  -2.479  290.063 1.00 107.29 ? 53  LEU B CA    1 
ATOM   5313  C  C     . LEU C 1 53  ? 97.668  -2.288  288.943 1.00 110.72 ? 53  LEU B C     1 
ATOM   5314  O  O     . LEU C 1 53  ? 96.472  -2.508  289.133 1.00 115.70 ? 53  LEU B O     1 
ATOM   5315  C  CB    . LEU C 1 53  ? 98.501  -1.381  291.110 1.00 114.12 ? 53  LEU B CB    1 
ATOM   5316  C  CG    . LEU C 1 53  ? 98.328  -1.892  292.536 1.00 111.11 ? 53  LEU B CG    1 
ATOM   5317  C  CD1   . LEU C 1 53  ? 96.977  -2.571  292.685 1.00 101.00 ? 53  LEU B CD1   1 
ATOM   5318  C  CD2   . LEU C 1 53  ? 99.456  -2.849  292.882 1.00 113.92 ? 53  LEU B CD2   1 
ATOM   5319  N  N     . GLY C 1 54  ? 98.146  -1.859  287.782 1.00 105.22 ? 54  GLY B N     1 
ATOM   5320  C  CA    . GLY C 1 54  ? 97.278  -1.651  286.641 1.00 100.19 ? 54  GLY B CA    1 
ATOM   5321  C  C     . GLY C 1 54  ? 96.435  -0.396  286.753 1.00 100.58 ? 54  GLY B C     1 
ATOM   5322  O  O     . GLY C 1 54  ? 95.298  -0.363  286.281 1.00 105.68 ? 54  GLY B O     1 
ATOM   5323  N  N     . VAL C 1 55  ? 96.984  0.638   287.384 1.00 102.14 ? 55  VAL B N     1 
ATOM   5324  C  CA    . VAL C 1 55  ? 96.313  1.934   287.414 1.00 110.94 ? 55  VAL B CA    1 
ATOM   5325  C  C     . VAL C 1 55  ? 96.952  2.900   286.414 1.00 113.36 ? 55  VAL B C     1 
ATOM   5326  O  O     . VAL C 1 55  ? 97.342  4.018   286.755 1.00 106.86 ? 55  VAL B O     1 
ATOM   5327  C  CB    . VAL C 1 55  ? 96.244  2.543   288.837 1.00 108.77 ? 55  VAL B CB    1 
ATOM   5328  C  CG1   . VAL C 1 55  ? 95.200  1.818   289.672 1.00 108.67 ? 55  VAL B CG1   1 
ATOM   5329  C  CG2   . VAL C 1 55  ? 97.593  2.495   289.519 1.00 98.20  ? 55  VAL B CG2   1 
ATOM   5330  N  N     . THR C 1 56  ? 97.055  2.437   285.173 1.00 116.32 ? 56  THR B N     1 
ATOM   5331  C  CA    . THR C 1 56  ? 97.487  3.262   284.057 1.00 112.27 ? 56  THR B CA    1 
ATOM   5332  C  C     . THR C 1 56  ? 96.373  4.259   283.728 1.00 110.77 ? 56  THR B C     1 
ATOM   5333  O  O     . THR C 1 56  ? 95.216  4.017   284.074 1.00 109.25 ? 56  THR B O     1 
ATOM   5334  C  CB    . THR C 1 56  ? 97.802  2.383   282.830 1.00 117.53 ? 56  THR B CB    1 
ATOM   5335  O  OG1   . THR C 1 56  ? 96.698  1.507   282.573 1.00 122.24 ? 56  THR B OG1   1 
ATOM   5336  C  CG2   . THR C 1 56  ? 99.050  1.550   283.082 1.00 112.85 ? 56  THR B CG2   1 
ATOM   5337  N  N     . PRO C 1 57  ? 96.716  5.389   283.075 1.00 108.87 ? 57  PRO B N     1 
ATOM   5338  C  CA    . PRO C 1 57  ? 95.741  6.450   282.782 1.00 110.57 ? 57  PRO B CA    1 
ATOM   5339  C  C     . PRO C 1 57  ? 94.470  5.978   282.075 1.00 119.03 ? 57  PRO B C     1 
ATOM   5340  O  O     . PRO C 1 57  ? 93.434  6.632   282.191 1.00 116.67 ? 57  PRO B O     1 
ATOM   5341  C  CB    . PRO C 1 57  ? 96.524  7.392   281.866 1.00 106.50 ? 57  PRO B CB    1 
ATOM   5342  C  CG    . PRO C 1 57  ? 97.930  7.223   282.286 1.00 104.72 ? 57  PRO B CG    1 
ATOM   5343  C  CD    . PRO C 1 57  ? 98.075  5.775   282.650 1.00 100.98 ? 57  PRO B CD    1 
ATOM   5344  N  N     . ASP C 1 58  ? 94.551  4.866   281.352 1.00 121.40 ? 58  ASP B N     1 
ATOM   5345  C  CA    . ASP C 1 58  ? 93.384  4.322   280.668 1.00 122.37 ? 58  ASP B CA    1 
ATOM   5346  C  C     . ASP C 1 58  ? 92.437  3.642   281.655 1.00 121.64 ? 58  ASP B C     1 
ATOM   5347  O  O     . ASP C 1 58  ? 91.222  3.837   281.605 1.00 116.07 ? 58  ASP B O     1 
ATOM   5348  C  CB    . ASP C 1 58  ? 93.811  3.344   279.569 1.00 133.96 ? 58  ASP B CB    1 
ATOM   5349  C  CG    . ASP C 1 58  ? 94.745  2.262   280.079 1.00 141.83 ? 58  ASP B CG    1 
ATOM   5350  O  OD1   . ASP C 1 58  ? 95.975  2.471   280.041 1.00 140.24 ? 58  ASP B OD1   1 
ATOM   5351  O  OD2   . ASP C 1 58  ? 94.247  1.205   280.522 1.00 145.78 ? 58  ASP B OD2   1 
ATOM   5352  N  N     . LYS C 1 59  ? 93.009  2.851   282.557 1.00 125.36 ? 59  LYS B N     1 
ATOM   5353  C  CA    . LYS C 1 59  ? 92.242  2.139   283.575 1.00 120.22 ? 59  LYS B CA    1 
ATOM   5354  C  C     . LYS C 1 59  ? 91.718  3.102   284.644 1.00 117.27 ? 59  LYS B C     1 
ATOM   5355  O  O     . LYS C 1 59  ? 92.309  4.159   284.873 1.00 107.72 ? 59  LYS B O     1 
ATOM   5356  C  CB    . LYS C 1 59  ? 93.110  1.047   284.209 1.00 111.83 ? 59  LYS B CB    1 
ATOM   5357  N  N     . PRO C 1 60  ? 90.594  2.748   285.294 1.00 123.13 ? 60  PRO B N     1 
ATOM   5358  C  CA    . PRO C 1 60  ? 90.017  3.605   286.337 1.00 124.62 ? 60  PRO B CA    1 
ATOM   5359  C  C     . PRO C 1 60  ? 90.876  3.643   287.597 1.00 122.32 ? 60  PRO B C     1 
ATOM   5360  O  O     . PRO C 1 60  ? 91.786  2.828   287.750 1.00 111.32 ? 60  PRO B O     1 
ATOM   5361  C  CB    . PRO C 1 60  ? 88.670  2.938   286.634 1.00 123.67 ? 60  PRO B CB    1 
ATOM   5362  C  CG    . PRO C 1 60  ? 88.859  1.518   286.241 1.00 122.86 ? 60  PRO B CG    1 
ATOM   5363  C  CD    . PRO C 1 60  ? 89.770  1.552   285.049 1.00 126.62 ? 60  PRO B CD    1 
ATOM   5364  N  N     . HIS C 1 61  ? 90.579  4.587   288.485 1.00 124.28 ? 61  HIS B N     1 
ATOM   5365  C  CA    . HIS C 1 61  ? 91.353  4.776   289.706 1.00 114.57 ? 61  HIS B CA    1 
ATOM   5366  C  C     . HIS C 1 61  ? 91.174  3.621   290.688 1.00 115.01 ? 61  HIS B C     1 
ATOM   5367  O  O     . HIS C 1 61  ? 90.179  2.898   290.642 1.00 116.29 ? 61  HIS B O     1 
ATOM   5368  C  CB    . HIS C 1 61  ? 90.953  6.085   290.393 1.00 115.87 ? 61  HIS B CB    1 
ATOM   5369  C  CG    . HIS C 1 61  ? 91.142  7.304   289.545 1.00 114.00 ? 61  HIS B CG    1 
ATOM   5370  N  ND1   . HIS C 1 61  ? 92.294  8.062   289.576 1.00 112.90 ? 61  HIS B ND1   1 
ATOM   5371  C  CD2   . HIS C 1 61  ? 90.319  7.908   288.656 1.00 112.37 ? 61  HIS B CD2   1 
ATOM   5372  C  CE1   . HIS C 1 61  ? 92.174  9.075   288.736 1.00 114.72 ? 61  HIS B CE1   1 
ATOM   5373  N  NE2   . HIS C 1 61  ? 90.986  9.003   288.164 1.00 118.29 ? 61  HIS B NE2   1 
ATOM   5374  N  N     . LYS C 1 62  ? 92.150  3.459   291.574 1.00 114.66 ? 62  LYS B N     1 
ATOM   5375  C  CA    . LYS C 1 62  ? 92.040  2.534   292.695 1.00 108.66 ? 62  LYS B CA    1 
ATOM   5376  C  C     . LYS C 1 62  ? 92.270  3.323   293.982 1.00 102.80 ? 62  LYS B C     1 
ATOM   5377  O  O     . LYS C 1 62  ? 93.041  4.281   293.990 1.00 97.13  ? 62  LYS B O     1 
ATOM   5378  C  CB    . LYS C 1 62  ? 93.051  1.392   292.561 1.00 97.54  ? 62  LYS B CB    1 
ATOM   5379  N  N     . LYS C 1 63  ? 91.587  2.935   295.055 1.00 100.32 ? 63  LYS B N     1 
ATOM   5380  C  CA    . LYS C 1 63  ? 91.696  3.634   296.335 1.00 100.97 ? 63  LYS B CA    1 
ATOM   5381  C  C     . LYS C 1 63  ? 93.141  3.728   296.811 1.00 98.74  ? 63  LYS B C     1 
ATOM   5382  O  O     . LYS C 1 63  ? 93.945  2.835   296.555 1.00 95.23  ? 63  LYS B O     1 
ATOM   5383  C  CB    . LYS C 1 63  ? 90.833  2.953   297.398 1.00 100.51 ? 63  LYS B CB    1 
ATOM   5384  C  CG    . LYS C 1 63  ? 89.353  2.942   297.072 1.00 108.65 ? 63  LYS B CG    1 
ATOM   5385  N  N     . SER C 1 64  ? 93.463  4.822   297.495 1.00 99.56  ? 64  SER B N     1 
ATOM   5386  C  CA    . SER C 1 64  ? 94.830  5.083   297.933 1.00 102.05 ? 64  SER B CA    1 
ATOM   5387  C  C     . SER C 1 64  ? 95.353  4.017   298.891 1.00 106.09 ? 64  SER B C     1 
ATOM   5388  O  O     . SER C 1 64  ? 96.545  3.724   298.902 1.00 106.51 ? 64  SER B O     1 
ATOM   5389  C  CB    . SER C 1 64  ? 94.939  6.465   298.583 1.00 104.45 ? 64  SER B CB    1 
ATOM   5390  O  OG    . SER C 1 64  ? 94.659  7.498   297.653 1.00 103.99 ? 64  SER B OG    1 
ATOM   5391  N  N     . ALA C 1 65  ? 94.465  3.442   299.695 1.00 112.12 ? 65  ALA B N     1 
ATOM   5392  C  CA    . ALA C 1 65  ? 94.866  2.413   300.651 1.00 109.74 ? 65  ALA B CA    1 
ATOM   5393  C  C     . ALA C 1 65  ? 95.341  1.145   299.943 1.00 102.84 ? 65  ALA B C     1 
ATOM   5394  O  O     . ALA C 1 65  ? 96.209  0.427   300.442 1.00 96.20  ? 65  ALA B O     1 
ATOM   5395  C  CB    . ALA C 1 65  ? 93.725  2.098   301.599 1.00 110.26 ? 65  ALA B CB    1 
ATOM   5396  N  N     . ARG C 1 66  ? 94.762  0.882   298.776 1.00 104.60 ? 66  ARG B N     1 
ATOM   5397  C  CA    . ARG C 1 66  ? 95.148  -0.254  297.953 1.00 103.80 ? 66  ARG B CA    1 
ATOM   5398  C  C     . ARG C 1 66  ? 96.594  -0.083  297.494 1.00 99.43  ? 66  ARG B C     1 
ATOM   5399  O  O     . ARG C 1 66  ? 97.433  -0.975  297.670 1.00 100.17 ? 66  ARG B O     1 
ATOM   5400  C  CB    . ARG C 1 66  ? 94.220  -0.341  296.739 1.00 107.33 ? 66  ARG B CB    1 
ATOM   5401  C  CG    . ARG C 1 66  ? 93.391  -1.609  296.652 1.00 111.74 ? 66  ARG B CG    1 
ATOM   5402  C  CD    . ARG C 1 66  ? 94.180  -2.725  296.000 1.00 113.36 ? 66  ARG B CD    1 
ATOM   5403  N  NE    . ARG C 1 66  ? 93.304  -3.707  295.370 1.00 121.70 ? 66  ARG B NE    1 
ATOM   5404  C  CZ    . ARG C 1 66  ? 93.733  -4.692  294.588 1.00 130.33 ? 66  ARG B CZ    1 
ATOM   5405  N  NH1   . ARG C 1 66  ? 95.028  -4.827  294.335 1.00 127.30 ? 66  ARG B NH1   1 
ATOM   5406  N  NH2   . ARG C 1 66  ? 92.867  -5.542  294.054 1.00 138.41 ? 66  ARG B NH2   1 
ATOM   5407  N  N     . ILE C 1 67  ? 96.875  1.084   296.922 1.00 91.18  ? 67  ILE B N     1 
ATOM   5408  C  CA    . ILE C 1 67  ? 98.195  1.397   296.391 1.00 88.01  ? 67  ILE B CA    1 
ATOM   5409  C  C     . ILE C 1 67  ? 99.248  1.448   297.488 1.00 92.94  ? 67  ILE B C     1 
ATOM   5410  O  O     . ILE C 1 67  ? 100.323 0.874   297.348 1.00 95.56  ? 67  ILE B O     1 
ATOM   5411  C  CB    . ILE C 1 67  ? 98.192  2.745   295.650 1.00 86.95  ? 67  ILE B CB    1 
ATOM   5412  C  CG1   . ILE C 1 67  ? 96.932  2.877   294.790 1.00 83.49  ? 67  ILE B CG1   1 
ATOM   5413  C  CG2   . ILE C 1 67  ? 99.455  2.890   294.810 1.00 85.15  ? 67  ILE B CG2   1 
ATOM   5414  C  CD1   . ILE C 1 67  ? 96.783  4.227   294.131 1.00 72.70  ? 67  ILE B CD1   1 
ATOM   5415  N  N     . THR C 1 68  ? 98.933  2.145   298.576 1.00 104.52 ? 68  THR B N     1 
ATOM   5416  C  CA    . THR C 1 68  ? 99.841  2.267   299.714 1.00 105.19 ? 68  THR B CA    1 
ATOM   5417  C  C     . THR C 1 68  ? 100.151 0.888   300.282 1.00 101.62 ? 68  THR B C     1 
ATOM   5418  O  O     . THR C 1 68  ? 101.308 0.565   300.569 1.00 101.10 ? 68  THR B O     1 
ATOM   5419  C  CB    . THR C 1 68  ? 99.236  3.134   300.840 1.00 111.69 ? 68  THR B CB    1 
ATOM   5420  O  OG1   . THR C 1 68  ? 98.727  4.357   300.293 1.00 111.82 ? 68  THR B OG1   1 
ATOM   5421  C  CG2   . THR C 1 68  ? 100.288 3.450   301.894 1.00 120.18 ? 68  THR B CG2   1 
ATOM   5422  N  N     . GLY C 1 69  ? 99.104  0.081   300.437 1.00 93.55  ? 69  GLY B N     1 
ATOM   5423  C  CA    . GLY C 1 69  ? 99.244  -1.272  300.940 1.00 94.02  ? 69  GLY B CA    1 
ATOM   5424  C  C     . GLY C 1 69  ? 100.160 -2.119  300.081 1.00 96.73  ? 69  GLY B C     1 
ATOM   5425  O  O     . GLY C 1 69  ? 101.107 -2.727  300.586 1.00 92.08  ? 69  GLY B O     1 
ATOM   5426  N  N     . ASP C 1 70  ? 99.883  -2.152  298.780 1.00 102.26 ? 70  ASP B N     1 
ATOM   5427  C  CA    . ASP C 1 70  ? 100.695 -2.927  297.847 1.00 104.93 ? 70  ASP B CA    1 
ATOM   5428  C  C     . ASP C 1 70  ? 102.150 -2.462  297.828 1.00 101.87 ? 70  ASP B C     1 
ATOM   5429  O  O     . ASP C 1 70  ? 103.071 -3.276  297.863 1.00 102.49 ? 70  ASP B O     1 
ATOM   5430  C  CB    . ASP C 1 70  ? 100.100 -2.859  296.440 1.00 110.36 ? 70  ASP B CB    1 
ATOM   5431  C  CG    . ASP C 1 70  ? 99.014  -3.892  296.214 1.00 120.87 ? 70  ASP B CG    1 
ATOM   5432  O  OD1   . ASP C 1 70  ? 99.298  -4.908  295.545 1.00 128.54 ? 70  ASP B OD1   1 
ATOM   5433  O  OD2   . ASP C 1 70  ? 97.882  -3.693  296.705 1.00 121.59 ? 70  ASP B OD2   1 
ATOM   5434  N  N     . VAL C 1 71  ? 102.345 -1.148  297.780 1.00 94.28  ? 71  VAL B N     1 
ATOM   5435  C  CA    . VAL C 1 71  ? 103.681 -0.563  297.720 1.00 95.67  ? 71  VAL B CA    1 
ATOM   5436  C  C     . VAL C 1 71  ? 104.499 -0.877  298.970 1.00 94.11  ? 71  VAL B C     1 
ATOM   5437  O  O     . VAL C 1 71  ? 105.676 -1.230  298.874 1.00 93.89  ? 71  VAL B O     1 
ATOM   5438  C  CB    . VAL C 1 71  ? 103.627 0.968   297.492 1.00 100.15 ? 71  VAL B CB    1 
ATOM   5439  C  CG1   . VAL C 1 71  ? 104.980 1.605   297.781 1.00 100.47 ? 71  VAL B CG1   1 
ATOM   5440  C  CG2   . VAL C 1 71  ? 103.187 1.276   296.071 1.00 101.09 ? 71  VAL B CG2   1 
ATOM   5441  N  N     . MET C 1 72  ? 103.878 -0.754  300.140 1.00 90.43  ? 72  MET B N     1 
ATOM   5442  C  CA    . MET C 1 72  ? 104.575 -1.078  301.378 1.00 100.05 ? 72  MET B CA    1 
ATOM   5443  C  C     . MET C 1 72  ? 104.883 -2.565  301.476 1.00 108.27 ? 72  MET B C     1 
ATOM   5444  O  O     . MET C 1 72  ? 106.002 -2.958  301.809 1.00 117.39 ? 72  MET B O     1 
ATOM   5445  C  CB    . MET C 1 72  ? 103.774 -0.653  302.607 1.00 106.97 ? 72  MET B CB    1 
ATOM   5446  C  CG    . MET C 1 72  ? 104.435 -1.084  303.910 1.00 106.40 ? 72  MET B CG    1 
ATOM   5447  S  SD    . MET C 1 72  ? 103.375 -0.913  305.352 1.00 188.89 ? 72  MET B SD    1 
ATOM   5448  C  CE    . MET C 1 72  ? 102.881 0.791   305.178 1.00 96.76  ? 72  MET B CE    1 
ATOM   5449  N  N     . GLY C 1 73  ? 103.879 -3.388  301.194 1.00 97.34  ? 73  GLY B N     1 
ATOM   5450  C  CA    . GLY C 1 73  ? 104.019 -4.827  301.307 1.00 80.56  ? 73  GLY B CA    1 
ATOM   5451  C  C     . GLY C 1 73  ? 105.047 -5.409  300.358 1.00 92.83  ? 73  GLY B C     1 
ATOM   5452  O  O     . GLY C 1 73  ? 105.742 -6.368  300.695 1.00 102.89 ? 73  GLY B O     1 
ATOM   5453  N  N     . LYS C 1 74  ? 105.163 -4.819  299.173 1.00 100.87 ? 74  LYS B N     1 
ATOM   5454  C  CA    . LYS C 1 74  ? 106.023 -5.382  298.138 1.00 91.38  ? 74  LYS B CA    1 
ATOM   5455  C  C     . LYS C 1 74  ? 107.389 -4.713  298.006 1.00 93.34  ? 74  LYS B C     1 
ATOM   5456  O  O     . LYS C 1 74  ? 108.399 -5.397  297.844 1.00 85.41  ? 74  LYS B O     1 
ATOM   5457  C  CB    . LYS C 1 74  ? 105.302 -5.386  296.787 1.00 79.98  ? 74  LYS B CB    1 
ATOM   5458  C  CG    . LYS C 1 74  ? 104.174 -6.403  296.700 1.00 84.93  ? 74  LYS B CG    1 
ATOM   5459  C  CD    . LYS C 1 74  ? 103.616 -6.507  295.290 1.00 94.95  ? 74  LYS B CD    1 
ATOM   5460  C  CE    . LYS C 1 74  ? 102.924 -5.221  294.868 1.00 112.69 ? 74  LYS B CE    1 
ATOM   5461  N  NZ    . LYS C 1 74  ? 102.385 -5.319  293.483 1.00 116.18 ? 74  LYS B NZ    1 
ATOM   5462  N  N     . TYR C 1 75  ? 107.427 -3.387  298.077 1.00 101.61 ? 75  TYR B N     1 
ATOM   5463  C  CA    . TYR C 1 75  ? 108.653 -2.667  297.736 1.00 99.15  ? 75  TYR B CA    1 
ATOM   5464  C  C     . TYR C 1 75  ? 109.206 -1.764  298.839 1.00 98.52  ? 75  TYR B C     1 
ATOM   5465  O  O     . TYR C 1 75  ? 110.375 -1.878  299.207 1.00 102.10 ? 75  TYR B O     1 
ATOM   5466  C  CB    . TYR C 1 75  ? 108.448 -1.858  296.453 1.00 91.62  ? 75  TYR B CB    1 
ATOM   5467  C  CG    . TYR C 1 75  ? 107.631 -2.579  295.405 1.00 93.90  ? 75  TYR B CG    1 
ATOM   5468  C  CD1   . TYR C 1 75  ? 106.316 -2.211  295.149 1.00 98.77  ? 75  TYR B CD1   1 
ATOM   5469  C  CD2   . TYR C 1 75  ? 108.170 -3.633  294.677 1.00 89.27  ? 75  TYR B CD2   1 
ATOM   5470  C  CE1   . TYR C 1 75  ? 105.562 -2.867  294.195 1.00 99.65  ? 75  TYR B CE1   1 
ATOM   5471  C  CE2   . TYR C 1 75  ? 107.420 -4.297  293.717 1.00 91.20  ? 75  TYR B CE2   1 
ATOM   5472  C  CZ    . TYR C 1 75  ? 106.117 -3.908  293.482 1.00 100.03 ? 75  TYR B CZ    1 
ATOM   5473  O  OH    . TYR C 1 75  ? 105.365 -4.560  292.531 1.00 105.24 ? 75  TYR B OH    1 
ATOM   5474  N  N     . HIS C 1 76  ? 108.371 -0.867  299.354 1.00 96.77  ? 76  HIS B N     1 
ATOM   5475  C  CA    . HIS C 1 76  ? 108.825 0.154   300.296 1.00 94.17  ? 76  HIS B CA    1 
ATOM   5476  C  C     . HIS C 1 76  ? 108.579 -0.256  301.747 1.00 106.55 ? 76  HIS B C     1 
ATOM   5477  O  O     . HIS C 1 76  ? 107.450 -0.193  302.227 1.00 115.84 ? 76  HIS B O     1 
ATOM   5478  C  CB    . HIS C 1 76  ? 108.132 1.487   300.001 1.00 84.74  ? 76  HIS B CB    1 
ATOM   5479  C  CG    . HIS C 1 76  ? 108.872 2.678   300.520 1.00 91.42  ? 76  HIS B CG    1 
ATOM   5480  N  ND1   . HIS C 1 76  ? 110.157 2.982   300.124 1.00 90.79  ? 76  HIS B ND1   1 
ATOM   5481  C  CD2   . HIS C 1 76  ? 108.513 3.642   301.400 1.00 95.82  ? 76  HIS B CD2   1 
ATOM   5482  C  CE1   . HIS C 1 76  ? 110.558 4.079   300.738 1.00 91.90  ? 76  HIS B CE1   1 
ATOM   5483  N  NE2   . HIS C 1 76  ? 109.579 4.501   301.519 1.00 91.09  ? 76  HIS B NE2   1 
ATOM   5484  N  N     . PRO C 1 77  ? 109.644 -0.669  302.454 1.00 104.83 ? 77  PRO B N     1 
ATOM   5485  C  CA    . PRO C 1 77  ? 109.520 -1.182  303.821 1.00 100.05 ? 77  PRO B CA    1 
ATOM   5486  C  C     . PRO C 1 77  ? 109.450 -0.067  304.863 1.00 101.98 ? 77  PRO B C     1 
ATOM   5487  O  O     . PRO C 1 77  ? 110.302 -0.007  305.750 1.00 100.84 ? 77  PRO B O     1 
ATOM   5488  C  CB    . PRO C 1 77  ? 110.814 -1.975  303.998 1.00 92.44  ? 77  PRO B CB    1 
ATOM   5489  C  CG    . PRO C 1 77  ? 111.808 -1.225  303.177 1.00 97.28  ? 77  PRO B CG    1 
ATOM   5490  C  CD    . PRO C 1 77  ? 111.046 -0.653  302.000 1.00 102.32 ? 77  PRO B CD    1 
ATOM   5491  N  N     . HIS C 1 78  ? 108.448 0.801   304.758 1.00 100.68 ? 78  HIS B N     1 
ATOM   5492  C  CA    . HIS C 1 78  ? 108.279 1.891   305.715 1.00 98.14  ? 78  HIS B CA    1 
ATOM   5493  C  C     . HIS C 1 78  ? 106.807 2.120   306.053 1.00 94.45  ? 78  HIS B C     1 
ATOM   5494  O  O     . HIS C 1 78  ? 105.977 1.234   305.864 1.00 93.22  ? 78  HIS B O     1 
ATOM   5495  C  CB    . HIS C 1 78  ? 108.928 3.175   305.193 1.00 104.85 ? 78  HIS B CB    1 
ATOM   5496  C  CG    . HIS C 1 78  ? 110.417 3.085   305.059 1.00 109.57 ? 78  HIS B CG    1 
ATOM   5497  N  ND1   . HIS C 1 78  ? 111.202 2.383   305.948 1.00 106.12 ? 78  HIS B ND1   1 
ATOM   5498  C  CD2   . HIS C 1 78  ? 111.262 3.601   304.135 1.00 117.75 ? 78  HIS B CD2   1 
ATOM   5499  C  CE1   . HIS C 1 78  ? 112.468 2.475   305.581 1.00 109.92 ? 78  HIS B CE1   1 
ATOM   5500  N  NE2   . HIS C 1 78  ? 112.532 3.208   304.484 1.00 116.17 ? 78  HIS B NE2   1 
ATOM   5501  N  N     . GLY C 1 79  ? 106.487 3.309   306.554 1.00 98.51  ? 79  GLY B N     1 
ATOM   5502  C  CA    . GLY C 1 79  ? 105.142 3.599   307.023 1.00 105.99 ? 79  GLY B CA    1 
ATOM   5503  C  C     . GLY C 1 79  ? 104.169 4.041   305.946 1.00 114.38 ? 79  GLY B C     1 
ATOM   5504  O  O     . GLY C 1 79  ? 104.576 4.464   304.863 1.00 115.81 ? 79  GLY B O     1 
ATOM   5505  N  N     . ASP C 1 80  ? 102.877 3.942   306.251 1.00 118.40 ? 80  ASP B N     1 
ATOM   5506  C  CA    . ASP C 1 80  ? 101.821 4.353   305.330 1.00 127.42 ? 80  ASP B CA    1 
ATOM   5507  C  C     . ASP C 1 80  ? 101.897 5.844   305.044 1.00 127.16 ? 80  ASP B C     1 
ATOM   5508  O  O     . ASP C 1 80  ? 101.882 6.271   303.889 1.00 128.20 ? 80  ASP B O     1 
ATOM   5509  C  CB    . ASP C 1 80  ? 100.440 4.034   305.914 1.00 143.41 ? 80  ASP B CB    1 
ATOM   5510  C  CG    . ASP C 1 80  ? 100.202 2.549   306.086 1.00 153.32 ? 80  ASP B CG    1 
ATOM   5511  O  OD1   . ASP C 1 80  ? 99.751  1.903   305.116 1.00 153.93 ? 80  ASP B OD1   1 
ATOM   5512  O  OD2   . ASP C 1 80  ? 100.459 2.026   307.191 1.00 154.90 ? 80  ASP B OD2   1 
ATOM   5513  N  N     . SER C 1 81  ? 101.972 6.625   306.118 1.00 123.74 ? 81  SER B N     1 
ATOM   5514  C  CA    . SER C 1 81  ? 101.936 8.083   306.046 1.00 114.24 ? 81  SER B CA    1 
ATOM   5515  C  C     . SER C 1 81  ? 102.965 8.665   305.083 1.00 124.64 ? 81  SER B C     1 
ATOM   5516  O  O     . SER C 1 81  ? 102.669 9.610   304.357 1.00 138.70 ? 81  SER B O     1 
ATOM   5517  C  CB    . SER C 1 81  ? 102.125 8.690   307.439 1.00 102.09 ? 81  SER B CB    1 
ATOM   5518  N  N     . SER C 1 82  ? 104.167 8.099   305.077 1.00 117.25 ? 82  SER B N     1 
ATOM   5519  C  CA    . SER C 1 82  ? 105.236 8.584   304.209 1.00 114.69 ? 82  SER B CA    1 
ATOM   5520  C  C     . SER C 1 82  ? 104.918 8.352   302.732 1.00 122.18 ? 82  SER B C     1 
ATOM   5521  O  O     . SER C 1 82  ? 104.986 9.277   301.915 1.00 129.33 ? 82  SER B O     1 
ATOM   5522  C  CB    . SER C 1 82  ? 106.563 7.920   304.576 1.00 107.41 ? 82  SER B CB    1 
ATOM   5523  N  N     . ILE C 1 83  ? 104.569 7.112   302.401 1.00 115.74 ? 83  ILE B N     1 
ATOM   5524  C  CA    . ILE C 1 83  ? 104.230 6.738   301.032 1.00 101.41 ? 83  ILE B CA    1 
ATOM   5525  C  C     . ILE C 1 83  ? 103.055 7.566   300.518 1.00 106.99 ? 83  ILE B C     1 
ATOM   5526  O  O     . ILE C 1 83  ? 103.112 8.145   299.427 1.00 119.41 ? 83  ILE B O     1 
ATOM   5527  C  CB    . ILE C 1 83  ? 103.880 5.239   300.935 1.00 85.45  ? 83  ILE B CB    1 
ATOM   5528  C  CG1   . ILE C 1 83  ? 105.072 4.390   301.376 1.00 81.92  ? 83  ILE B CG1   1 
ATOM   5529  C  CG2   . ILE C 1 83  ? 103.459 4.876   299.522 1.00 85.82  ? 83  ILE B CG2   1 
ATOM   5530  C  CD1   . ILE C 1 83  ? 104.757 2.917   301.509 1.00 83.52  ? 83  ILE B CD1   1 
ATOM   5531  N  N     . TYR C 1 84  ? 101.995 7.628   301.316 1.00 96.28  ? 84  TYR B N     1 
ATOM   5532  C  CA    . TYR C 1 84  ? 100.812 8.385   300.933 1.00 91.42  ? 84  TYR B CA    1 
ATOM   5533  C  C     . TYR C 1 84  ? 101.115 9.871   300.784 1.00 100.28 ? 84  TYR B C     1 
ATOM   5534  O  O     . TYR C 1 84  ? 100.593 10.521  299.883 1.00 110.33 ? 84  TYR B O     1 
ATOM   5535  C  CB    . TYR C 1 84  ? 99.678  8.175   301.933 1.00 91.33  ? 84  TYR B CB    1 
ATOM   5536  C  CG    . TYR C 1 84  ? 98.400  8.879   301.547 1.00 87.82  ? 84  TYR B CG    1 
ATOM   5537  C  CD1   . TYR C 1 84  ? 97.703  8.514   300.404 1.00 82.91  ? 84  TYR B CD1   1 
ATOM   5538  C  CD2   . TYR C 1 84  ? 97.885  9.905   302.327 1.00 93.90  ? 84  TYR B CD2   1 
ATOM   5539  C  CE1   . TYR C 1 84  ? 96.529  9.157   300.048 1.00 88.18  ? 84  TYR B CE1   1 
ATOM   5540  C  CE2   . TYR C 1 84  ? 96.717  10.547  301.982 1.00 97.35  ? 84  TYR B CE2   1 
ATOM   5541  C  CZ    . TYR C 1 84  ? 96.043  10.172  300.845 1.00 97.23  ? 84  TYR B CZ    1 
ATOM   5542  O  OH    . TYR C 1 84  ? 94.876  10.820  300.511 1.00 106.74 ? 84  TYR B OH    1 
ATOM   5543  N  N     . GLU C 1 85  ? 101.955 10.404  301.666 1.00 97.82  ? 85  GLU B N     1 
ATOM   5544  C  CA    . GLU C 1 85  ? 102.386 11.795  301.562 1.00 106.31 ? 85  GLU B CA    1 
ATOM   5545  C  C     . GLU C 1 85  ? 103.103 12.052  300.241 1.00 98.65  ? 85  GLU B C     1 
ATOM   5546  O  O     . GLU C 1 85  ? 102.850 13.059  299.573 1.00 106.10 ? 85  GLU B O     1 
ATOM   5547  C  CB    . GLU C 1 85  ? 103.301 12.170  302.730 1.00 118.16 ? 85  GLU B CB    1 
ATOM   5548  N  N     . ALA C 1 86  ? 103.998 11.136  299.875 1.00 92.92  ? 86  ALA B N     1 
ATOM   5549  C  CA    . ALA C 1 86  ? 104.729 11.236  298.614 1.00 98.22  ? 86  ALA B CA    1 
ATOM   5550  C  C     . ALA C 1 86  ? 103.757 11.254  297.440 1.00 103.18 ? 86  ALA B C     1 
ATOM   5551  O  O     . ALA C 1 86  ? 103.832 12.135  296.574 1.00 106.18 ? 86  ALA B O     1 
ATOM   5552  C  CB    . ALA C 1 86  ? 105.707 10.081  298.469 1.00 82.49  ? 86  ALA B CB    1 
ATOM   5553  N  N     . MET C 1 87  ? 102.844 10.281  297.427 1.00 95.15  ? 87  MET B N     1 
ATOM   5554  C  CA    . MET C 1 87  ? 101.836 10.178  296.372 1.00 89.87  ? 87  MET B CA    1 
ATOM   5555  C  C     . MET C 1 87  ? 101.004 11.444  296.253 1.00 90.88  ? 87  MET B C     1 
ATOM   5556  O  O     . MET C 1 87  ? 100.730 11.909  295.148 1.00 103.91 ? 87  MET B O     1 
ATOM   5557  C  CB    . MET C 1 87  ? 100.908 8.980   296.596 1.00 90.51  ? 87  MET B CB    1 
ATOM   5558  C  CG    . MET C 1 87  ? 99.725  8.932   295.629 1.00 80.32  ? 87  MET B CG    1 
ATOM   5559  S  SD    . MET C 1 87  ? 98.760  7.435   295.849 1.00 98.54  ? 87  MET B SD    1 
ATOM   5560  C  CE    . MET C 1 87  ? 100.086 6.251   295.717 1.00 71.50  ? 87  MET B CE    1 
ATOM   5561  N  N     . VAL C 1 88  ? 100.602 11.993  297.394 1.00 87.57  ? 88  VAL B N     1 
ATOM   5562  C  CA    . VAL C 1 88  ? 99.830  13.229  297.420 1.00 89.33  ? 88  VAL B CA    1 
ATOM   5563  C  C     . VAL C 1 88  ? 100.638 14.374  296.812 1.00 94.48  ? 88  VAL B C     1 
ATOM   5564  O  O     . VAL C 1 88  ? 100.122 15.142  295.998 1.00 98.09  ? 88  VAL B O     1 
ATOM   5565  C  CB    . VAL C 1 88  ? 99.376  13.581  298.854 1.00 85.09  ? 88  VAL B CB    1 
ATOM   5566  C  CG1   . VAL C 1 88  ? 98.832  14.998  298.916 1.00 93.02  ? 88  VAL B CG1   1 
ATOM   5567  C  CG2   . VAL C 1 88  ? 98.329  12.584  299.337 1.00 84.73  ? 88  VAL B CG2   1 
ATOM   5568  N  N     . ARG C 1 89  ? 101.909 14.469  297.193 1.00 96.07  ? 89  ARG B N     1 
ATOM   5569  C  CA    . ARG C 1 89  ? 102.789 15.495  296.639 1.00 99.71  ? 89  ARG B CA    1 
ATOM   5570  C  C     . ARG C 1 89  ? 102.986 15.334  295.132 1.00 107.86 ? 89  ARG B C     1 
ATOM   5571  O  O     . ARG C 1 89  ? 103.232 16.310  294.424 1.00 112.21 ? 89  ARG B O     1 
ATOM   5572  C  CB    . ARG C 1 89  ? 104.141 15.515  297.359 1.00 108.31 ? 89  ARG B CB    1 
ATOM   5573  C  CG    . ARG C 1 89  ? 104.112 16.225  298.706 1.00 126.33 ? 89  ARG B CG    1 
ATOM   5574  C  CD    . ARG C 1 89  ? 105.502 16.701  299.126 1.00 132.82 ? 89  ARG B CD    1 
ATOM   5575  N  NE    . ARG C 1 89  ? 106.008 17.766  298.263 1.00 134.26 ? 89  ARG B NE    1 
ATOM   5576  C  CZ    . ARG C 1 89  ? 106.904 17.586  297.296 1.00 134.59 ? 89  ARG B CZ    1 
ATOM   5577  N  NH1   . ARG C 1 89  ? 107.402 16.379  297.063 1.00 125.31 ? 89  ARG B NH1   1 
ATOM   5578  N  NH2   . ARG C 1 89  ? 107.306 18.615  296.563 1.00 137.46 ? 89  ARG B NH2   1 
ATOM   5579  N  N     . MET C 1 90  ? 102.865 14.105  294.641 1.00 109.11 ? 90  MET B N     1 
ATOM   5580  C  CA    . MET C 1 90  ? 103.001 13.853  293.210 1.00 103.28 ? 90  MET B CA    1 
ATOM   5581  C  C     . MET C 1 90  ? 101.693 14.094  292.454 1.00 104.24 ? 90  MET B C     1 
ATOM   5582  O  O     . MET C 1 90  ? 101.587 13.771  291.272 1.00 112.12 ? 90  MET B O     1 
ATOM   5583  C  CB    . MET C 1 90  ? 103.498 12.428  292.950 1.00 92.72  ? 90  MET B CB    1 
ATOM   5584  C  CG    . MET C 1 90  ? 104.882 12.130  293.502 1.00 86.75  ? 90  MET B CG    1 
ATOM   5585  S  SD    . MET C 1 90  ? 105.494 10.527  292.951 1.00 106.76 ? 90  MET B SD    1 
ATOM   5586  C  CE    . MET C 1 90  ? 104.224 9.458   293.603 1.00 85.12  ? 90  MET B CE    1 
ATOM   5587  N  N     . ALA C 1 91  ? 100.702 14.663  293.134 1.00 97.60  ? 91  ALA B N     1 
ATOM   5588  C  CA    . ALA C 1 91  ? 99.397  14.890  292.520 1.00 98.86  ? 91  ALA B CA    1 
ATOM   5589  C  C     . ALA C 1 91  ? 98.893  16.318  292.711 1.00 102.91 ? 91  ALA B C     1 
ATOM   5590  O  O     . ALA C 1 91  ? 97.720  16.607  292.475 1.00 111.56 ? 91  ALA B O     1 
ATOM   5591  C  CB    . ALA C 1 91  ? 98.382  13.894  293.060 1.00 96.42  ? 91  ALA B CB    1 
ATOM   5592  N  N     . GLN C 1 92  ? 99.782  17.210  293.134 1.00 97.76  ? 92  GLN B N     1 
ATOM   5593  C  CA    . GLN C 1 92  ? 99.413  18.600  293.385 1.00 100.60 ? 92  GLN B CA    1 
ATOM   5594  C  C     . GLN C 1 92  ? 100.069 19.528  292.369 1.00 106.46 ? 92  GLN B C     1 
ATOM   5595  O  O     . GLN C 1 92  ? 101.277 19.461  292.147 1.00 103.28 ? 92  GLN B O     1 
ATOM   5596  C  CB    . GLN C 1 92  ? 99.804  19.003  294.806 1.00 104.84 ? 92  GLN B CB    1 
ATOM   5597  C  CG    . GLN C 1 92  ? 99.123  18.175  295.887 1.00 114.47 ? 92  GLN B CG    1 
ATOM   5598  C  CD    . GLN C 1 92  ? 99.706  18.420  297.265 1.00 115.99 ? 92  GLN B CD    1 
ATOM   5599  O  OE1   . GLN C 1 92  ? 100.875 18.779  297.403 1.00 128.34 ? 92  GLN B OE1   1 
ATOM   5600  N  NE2   . GLN C 1 92  ? 98.891  18.227  298.292 1.00 101.83 ? 92  GLN B NE2   1 
ATOM   5601  N  N     . TRP C 1 93  ? 99.273  20.391  291.747 1.00 114.38 ? 93  TRP B N     1 
ATOM   5602  C  CA    . TRP C 1 93  ? 99.783  21.245  290.679 1.00 117.33 ? 93  TRP B CA    1 
ATOM   5603  C  C     . TRP C 1 93  ? 100.817 22.245  291.178 1.00 124.67 ? 93  TRP B C     1 
ATOM   5604  O  O     . TRP C 1 93  ? 101.703 22.646  290.431 1.00 132.17 ? 93  TRP B O     1 
ATOM   5605  C  CB    . TRP C 1 93  ? 98.642  21.951  289.928 1.00 93.87  ? 93  TRP B CB    1 
ATOM   5606  C  CG    . TRP C 1 93  ? 98.312  23.349  290.394 1.00 97.21  ? 93  TRP B CG    1 
ATOM   5607  C  CD1   . TRP C 1 93  ? 99.042  24.490  290.179 1.00 102.10 ? 93  TRP B CD1   1 
ATOM   5608  C  CD2   . TRP C 1 93  ? 97.139  23.758  291.104 1.00 112.37 ? 93  TRP B CD2   1 
ATOM   5609  N  NE1   . TRP C 1 93  ? 98.407  25.574  290.737 1.00 102.17 ? 93  TRP B NE1   1 
ATOM   5610  C  CE2   . TRP C 1 93  ? 97.239  25.152  291.303 1.00 121.38 ? 93  TRP B CE2   1 
ATOM   5611  C  CE3   . TRP C 1 93  ? 96.023  23.082  291.595 1.00 99.44  ? 93  TRP B CE3   1 
ATOM   5612  C  CZ2   . TRP C 1 93  ? 96.257  25.872  291.977 1.00 128.58 ? 93  TRP B CZ2   1 
ATOM   5613  C  CZ3   . TRP C 1 93  ? 95.053  23.800  292.263 1.00 136.37 ? 93  TRP B CZ3   1 
ATOM   5614  C  CH2   . TRP C 1 93  ? 95.175  25.180  292.449 1.00 134.26 ? 93  TRP B CH2   1 
ATOM   5615  N  N     . TRP C 1 94  ? 100.700 22.647  292.438 1.00 126.82 ? 94  TRP B N     1 
ATOM   5616  C  CA    . TRP C 1 94  ? 101.601 23.646  293.002 1.00 123.64 ? 94  TRP B CA    1 
ATOM   5617  C  C     . TRP C 1 94  ? 102.893 23.037  293.549 1.00 111.57 ? 94  TRP B C     1 
ATOM   5618  O  O     . TRP C 1 94  ? 103.815 23.758  293.933 1.00 112.07 ? 94  TRP B O     1 
ATOM   5619  C  CB    . TRP C 1 94  ? 100.891 24.456  294.088 1.00 131.75 ? 94  TRP B CB    1 
ATOM   5620  C  CG    . TRP C 1 94  ? 100.451 23.638  295.261 1.00 131.83 ? 94  TRP B CG    1 
ATOM   5621  C  CD1   . TRP C 1 94  ? 101.097 23.506  296.455 1.00 130.76 ? 94  TRP B CD1   1 
ATOM   5622  C  CD2   . TRP C 1 94  ? 99.265  22.838  295.356 1.00 133.24 ? 94  TRP B CD2   1 
ATOM   5623  N  NE1   . TRP C 1 94  ? 100.388 22.675  297.288 1.00 131.70 ? 94  TRP B NE1   1 
ATOM   5624  C  CE2   . TRP C 1 94  ? 99.259  22.251  296.637 1.00 133.82 ? 94  TRP B CE2   1 
ATOM   5625  C  CE3   . TRP C 1 94  ? 98.208  22.561  294.483 1.00 132.95 ? 94  TRP B CE3   1 
ATOM   5626  C  CZ2   . TRP C 1 94  ? 98.239  21.406  297.067 1.00 133.66 ? 94  TRP B CZ2   1 
ATOM   5627  C  CZ3   . TRP C 1 94  ? 97.197  21.720  294.912 1.00 132.65 ? 94  TRP B CZ3   1 
ATOM   5628  C  CH2   . TRP C 1 94  ? 97.220  21.153  296.191 1.00 133.07 ? 94  TRP B CH2   1 
ATOM   5629  N  N     . SER C 1 95  ? 102.953 21.709  293.584 1.00 104.04 ? 95  SER B N     1 
ATOM   5630  C  CA    . SER C 1 95  ? 104.143 21.007  294.053 1.00 107.97 ? 95  SER B CA    1 
ATOM   5631  C  C     . SER C 1 95  ? 104.974 20.502  292.878 1.00 126.40 ? 95  SER B C     1 
ATOM   5632  O  O     . SER C 1 95  ? 106.133 20.886  292.713 1.00 138.94 ? 95  SER B O     1 
ATOM   5633  C  CB    . SER C 1 95  ? 103.755 19.842  294.964 1.00 98.94  ? 95  SER B CB    1 
ATOM   5634  N  N     . TYR C 1 96  ? 104.376 19.640  292.063 1.00 123.70 ? 96  TYR B N     1 
ATOM   5635  C  CA    . TYR C 1 96  ? 105.044 19.124  290.877 1.00 127.67 ? 96  TYR B CA    1 
ATOM   5636  C  C     . TYR C 1 96  ? 104.639 19.905  289.635 1.00 125.23 ? 96  TYR B C     1 
ATOM   5637  O  O     . TYR C 1 96  ? 103.459 19.975  289.292 1.00 125.55 ? 96  TYR B O     1 
ATOM   5638  C  CB    . TYR C 1 96  ? 104.751 17.632  290.689 1.00 142.82 ? 96  TYR B CB    1 
ATOM   5639  C  CG    . TYR C 1 96  ? 105.698 16.725  291.443 1.00 151.45 ? 96  TYR B CG    1 
ATOM   5640  C  CD1   . TYR C 1 96  ? 106.522 17.226  292.442 1.00 158.29 ? 96  TYR B CD1   1 
ATOM   5641  C  CD2   . TYR C 1 96  ? 105.783 15.373  291.141 1.00 146.87 ? 96  TYR B CD2   1 
ATOM   5642  C  CE1   . TYR C 1 96  ? 107.393 16.403  293.129 1.00 155.69 ? 96  TYR B CE1   1 
ATOM   5643  C  CE2   . TYR C 1 96  ? 106.653 14.544  291.820 1.00 144.56 ? 96  TYR B CE2   1 
ATOM   5644  C  CZ    . TYR C 1 96  ? 107.454 15.063  292.814 1.00 146.60 ? 96  TYR B CZ    1 
ATOM   5645  O  OH    . TYR C 1 96  ? 108.322 14.243  293.495 1.00 142.49 ? 96  TYR B OH    1 
ATOM   5646  N  N     . ARG C 1 97  ? 105.630 20.497  288.975 1.00 126.41 ? 97  ARG B N     1 
ATOM   5647  C  CA    . ARG C 1 97  ? 105.416 21.270  287.756 1.00 128.27 ? 97  ARG B CA    1 
ATOM   5648  C  C     . ARG C 1 97  ? 104.724 20.430  286.690 1.00 132.67 ? 97  ARG B C     1 
ATOM   5649  O  O     . ARG C 1 97  ? 103.874 20.922  285.950 1.00 136.89 ? 97  ARG B O     1 
ATOM   5650  C  CB    . ARG C 1 97  ? 106.753 21.796  287.233 1.00 118.92 ? 97  ARG B CB    1 
ATOM   5651  C  CG    . ARG C 1 97  ? 106.695 22.481  285.880 1.00 112.86 ? 97  ARG B CG    1 
ATOM   5652  C  CD    . ARG C 1 97  ? 105.818 23.716  285.895 1.00 116.43 ? 97  ARG B CD    1 
ATOM   5653  N  NE    . ARG C 1 97  ? 105.853 24.407  284.609 1.00 124.71 ? 97  ARG B NE    1 
ATOM   5654  C  CZ    . ARG C 1 97  ? 105.060 24.117  283.582 1.00 132.61 ? 97  ARG B CZ    1 
ATOM   5655  N  NH1   . ARG C 1 97  ? 104.159 23.150  283.688 1.00 134.00 ? 97  ARG B NH1   1 
ATOM   5656  N  NH2   . ARG C 1 97  ? 105.166 24.797  282.449 1.00 137.95 ? 97  ARG B NH2   1 
ATOM   5657  N  N     . TYR C 1 98  ? 105.100 19.159  286.619 1.00 125.19 ? 98  TYR B N     1 
ATOM   5658  C  CA    . TYR C 1 98  ? 104.400 18.201  285.775 1.00 116.23 ? 98  TYR B CA    1 
ATOM   5659  C  C     . TYR C 1 98  ? 104.032 16.973  286.600 1.00 112.22 ? 98  TYR B C     1 
ATOM   5660  O  O     . TYR C 1 98  ? 104.859 16.091  286.838 1.00 106.52 ? 98  TYR B O     1 
ATOM   5661  C  CB    . TYR C 1 98  ? 105.235 17.832  284.546 1.00 108.99 ? 98  TYR B CB    1 
ATOM   5662  C  CG    . TYR C 1 98  ? 105.426 18.987  283.586 1.00 106.06 ? 98  TYR B CG    1 
ATOM   5663  C  CD1   . TYR C 1 98  ? 106.549 19.795  283.660 1.00 102.75 ? 98  TYR B CD1   1 
ATOM   5664  C  CD2   . TYR C 1 98  ? 104.475 19.276  282.615 1.00 112.67 ? 98  TYR B CD2   1 
ATOM   5665  C  CE1   . TYR C 1 98  ? 106.730 20.854  282.789 1.00 108.91 ? 98  TYR B CE1   1 
ATOM   5666  C  CE2   . TYR C 1 98  ? 104.645 20.333  281.740 1.00 122.61 ? 98  TYR B CE2   1 
ATOM   5667  C  CZ    . TYR C 1 98  ? 105.774 21.120  281.832 1.00 124.82 ? 98  TYR B CZ    1 
ATOM   5668  O  OH    . TYR C 1 98  ? 105.953 22.174  280.964 1.00 138.41 ? 98  TYR B OH    1 
ATOM   5669  N  N     . MET C 1 99  ? 102.776 16.942  287.036 1.00 115.55 ? 99  MET B N     1 
ATOM   5670  C  CA    . MET C 1 99  ? 102.276 15.951  287.985 1.00 112.34 ? 99  MET B CA    1 
ATOM   5671  C  C     . MET C 1 99  ? 102.418 14.516  287.487 1.00 100.41 ? 99  MET B C     1 
ATOM   5672  O  O     . MET C 1 99  ? 102.128 14.216  286.331 1.00 99.86  ? 99  MET B O     1 
ATOM   5673  C  CB    . MET C 1 99  ? 100.813 16.253  288.311 1.00 115.05 ? 99  MET B CB    1 
ATOM   5674  C  CG    . MET C 1 99  ? 100.571 17.705  288.692 1.00 115.48 ? 99  MET B CG    1 
ATOM   5675  S  SD    . MET C 1 99  ? 99.007  18.345  288.063 1.00 123.43 ? 99  MET B SD    1 
ATOM   5676  C  CE    . MET C 1 99  ? 99.236  18.119  286.301 1.00 182.99 ? 99  MET B CE    1 
ATOM   5677  N  N     . LEU C 1 100 ? 102.861 13.634  288.377 1.00 97.97  ? 100 LEU B N     1 
ATOM   5678  C  CA    . LEU C 1 100 ? 103.071 12.233  288.034 1.00 92.06  ? 100 LEU B CA    1 
ATOM   5679  C  C     . LEU C 1 100 ? 101.916 11.358  288.518 1.00 91.24  ? 100 LEU B C     1 
ATOM   5680  O  O     . LEU C 1 100 ? 101.818 10.187  288.149 1.00 99.08  ? 100 LEU B O     1 
ATOM   5681  C  CB    . LEU C 1 100 ? 104.391 11.731  288.621 1.00 80.13  ? 100 LEU B CB    1 
ATOM   5682  C  CG    . LEU C 1 100 ? 105.644 12.497  288.192 1.00 82.32  ? 100 LEU B CG    1 
ATOM   5683  C  CD1   . LEU C 1 100 ? 106.893 11.853  288.777 1.00 79.29  ? 100 LEU B CD1   1 
ATOM   5684  C  CD2   . LEU C 1 100 ? 105.737 12.570  286.678 1.00 81.83  ? 100 LEU B CD2   1 
ATOM   5685  N  N     . VAL C 1 101 ? 101.046 11.928  289.346 1.00 87.17  ? 101 VAL B N     1 
ATOM   5686  C  CA    . VAL C 1 101 ? 99.892  11.196  289.856 1.00 87.45  ? 101 VAL B CA    1 
ATOM   5687  C  C     . VAL C 1 101 ? 98.588  11.958  289.616 1.00 95.96  ? 101 VAL B C     1 
ATOM   5688  O  O     . VAL C 1 101 ? 98.504  13.156  289.875 1.00 109.04 ? 101 VAL B O     1 
ATOM   5689  C  CB    . VAL C 1 101 ? 100.040 10.880  291.362 1.00 84.19  ? 101 VAL B CB    1 
ATOM   5690  C  CG1   . VAL C 1 101 ? 98.744  10.315  291.922 1.00 75.37  ? 101 VAL B CG1   1 
ATOM   5691  C  CG2   . VAL C 1 101 ? 101.187 9.910   291.591 1.00 74.59  ? 101 VAL B CG2   1 
ATOM   5692  N  N     . ASP C 1 102 ? 97.581  11.258  289.104 1.00 94.57  ? 102 ASP B N     1 
ATOM   5693  C  CA    . ASP C 1 102 ? 96.256  11.832  288.916 1.00 108.21 ? 102 ASP B CA    1 
ATOM   5694  C  C     . ASP C 1 102 ? 95.317  11.235  289.953 1.00 106.04 ? 102 ASP B C     1 
ATOM   5695  O  O     . ASP C 1 102 ? 95.069  10.030  289.952 1.00 106.08 ? 102 ASP B O     1 
ATOM   5696  C  CB    . ASP C 1 102 ? 95.737  11.538  287.509 1.00 121.33 ? 102 ASP B CB    1 
ATOM   5697  C  CG    . ASP C 1 102 ? 94.387  12.176  287.240 1.00 137.72 ? 102 ASP B CG    1 
ATOM   5698  O  OD1   . ASP C 1 102 ? 94.354  13.381  286.912 1.00 147.54 ? 102 ASP B OD1   1 
ATOM   5699  O  OD2   . ASP C 1 102 ? 93.360  11.472  287.349 1.00 140.59 ? 102 ASP B OD2   1 
ATOM   5700  N  N     . GLY C 1 103 ? 94.800  12.081  290.839 1.00 97.46  ? 103 GLY B N     1 
ATOM   5701  C  CA    . GLY C 1 103 ? 93.981  11.614  291.942 1.00 92.95  ? 103 GLY B CA    1 
ATOM   5702  C  C     . GLY C 1 103 ? 92.603  12.244  292.033 1.00 100.74 ? 103 GLY B C     1 
ATOM   5703  O  O     . GLY C 1 103 ? 92.375  13.356  291.554 1.00 110.91 ? 103 GLY B O     1 
ATOM   5704  N  N     . HIS C 1 104 ? 91.677  11.521  292.656 1.00 101.55 ? 104 HIS B N     1 
ATOM   5705  C  CA    . HIS C 1 104 ? 90.328  12.023  292.897 1.00 114.23 ? 104 HIS B CA    1 
ATOM   5706  C  C     . HIS C 1 104 ? 90.094  12.236  294.384 1.00 121.35 ? 104 HIS B C     1 
ATOM   5707  O  O     . HIS C 1 104 ? 90.613  11.493  295.217 1.00 124.14 ? 104 HIS B O     1 
ATOM   5708  C  CB    . HIS C 1 104 ? 89.279  11.055  292.349 1.00 129.54 ? 104 HIS B CB    1 
ATOM   5709  C  CG    . HIS C 1 104 ? 89.144  11.090  290.861 1.00 158.01 ? 104 HIS B CG    1 
ATOM   5710  N  ND1   . HIS C 1 104 ? 89.874  11.952  290.071 1.00 171.60 ? 104 HIS B ND1   1 
ATOM   5711  C  CD2   . HIS C 1 104 ? 88.366  10.373  290.017 1.00 169.17 ? 104 HIS B CD2   1 
ATOM   5712  C  CE1   . HIS C 1 104 ? 89.552  11.764  288.804 1.00 174.82 ? 104 HIS B CE1   1 
ATOM   5713  N  NE2   . HIS C 1 104 ? 88.639  10.811  288.743 1.00 175.07 ? 104 HIS B NE2   1 
ATOM   5714  N  N     . GLY C 1 105 ? 89.305  13.253  294.712 1.00 122.74 ? 105 GLY B N     1 
ATOM   5715  C  CA    . GLY C 1 105 ? 89.023  13.582  296.096 1.00 114.89 ? 105 GLY B CA    1 
ATOM   5716  C  C     . GLY C 1 105 ? 89.995  14.612  296.634 1.00 112.52 ? 105 GLY B C     1 
ATOM   5717  O  O     . GLY C 1 105 ? 90.855  15.105  295.904 1.00 121.54 ? 105 GLY B O     1 
ATOM   5718  N  N     . ASN C 1 106 ? 89.858  14.936  297.916 1.00 106.43 ? 106 ASN B N     1 
ATOM   5719  C  CA    . ASN C 1 106 ? 90.709  15.933  298.552 1.00 106.71 ? 106 ASN B CA    1 
ATOM   5720  C  C     . ASN C 1 106 ? 92.168  15.501  298.614 1.00 103.91 ? 106 ASN B C     1 
ATOM   5721  O  O     . ASN C 1 106 ? 92.508  14.523  299.279 1.00 106.40 ? 106 ASN B O     1 
ATOM   5722  C  CB    . ASN C 1 106 ? 90.199  16.248  299.960 1.00 103.57 ? 106 ASN B CB    1 
ATOM   5723  N  N     . PHE C 1 107 ? 93.025  16.233  297.911 1.00 99.93  ? 107 PHE B N     1 
ATOM   5724  C  CA    . PHE C 1 107 ? 94.463  15.983  297.943 1.00 96.91  ? 107 PHE B CA    1 
ATOM   5725  C  C     . PHE C 1 107 ? 95.208  17.193  298.491 1.00 100.68 ? 107 PHE B C     1 
ATOM   5726  O  O     . PHE C 1 107 ? 96.370  17.426  298.158 1.00 95.31  ? 107 PHE B O     1 
ATOM   5727  C  CB    . PHE C 1 107 ? 94.982  15.624  296.550 1.00 98.92  ? 107 PHE B CB    1 
ATOM   5728  C  CG    . PHE C 1 107 ? 94.909  14.157  296.236 1.00 97.67  ? 107 PHE B CG    1 
ATOM   5729  C  CD1   . PHE C 1 107 ? 93.718  13.578  295.836 1.00 103.12 ? 107 PHE B CD1   1 
ATOM   5730  C  CD2   . PHE C 1 107 ? 96.036  13.357  296.340 1.00 98.74  ? 107 PHE B CD2   1 
ATOM   5731  C  CE1   . PHE C 1 107 ? 93.650  12.228  295.548 1.00 107.08 ? 107 PHE B CE1   1 
ATOM   5732  C  CE2   . PHE C 1 107 ? 95.975  12.007  296.053 1.00 103.40 ? 107 PHE B CE2   1 
ATOM   5733  C  CZ    . PHE C 1 107 ? 94.779  11.441  295.656 1.00 106.53 ? 107 PHE B CZ    1 
ATOM   5734  N  N     . GLY C 1 108 ? 94.527  17.960  299.336 1.00 108.23 ? 108 GLY B N     1 
ATOM   5735  C  CA    . GLY C 1 108 ? 95.113  19.138  299.944 1.00 114.09 ? 108 GLY B CA    1 
ATOM   5736  C  C     . GLY C 1 108 ? 94.986  20.374  299.077 1.00 120.65 ? 108 GLY B C     1 
ATOM   5737  O  O     . GLY C 1 108 ? 94.753  20.277  297.872 1.00 126.86 ? 108 GLY B O     1 
ATOM   5738  N  N     . SER C 1 109 ? 95.136  21.540  299.694 1.00 118.09 ? 109 SER B N     1 
ATOM   5739  C  CA    . SER C 1 109 ? 95.060  22.802  298.972 1.00 120.80 ? 109 SER B CA    1 
ATOM   5740  C  C     . SER C 1 109 ? 96.391  23.538  299.030 1.00 125.67 ? 109 SER B C     1 
ATOM   5741  O  O     . SER C 1 109 ? 97.317  23.109  299.719 1.00 116.50 ? 109 SER B O     1 
ATOM   5742  C  CB    . SER C 1 109 ? 93.950  23.683  299.548 1.00 125.16 ? 109 SER B CB    1 
ATOM   5743  N  N     . MET C 1 110 ? 96.482  24.647  298.302 1.00 137.91 ? 110 MET B N     1 
ATOM   5744  C  CA    . MET C 1 110 ? 97.667  25.494  298.348 1.00 142.69 ? 110 MET B CA    1 
ATOM   5745  C  C     . MET C 1 110 ? 97.825  26.087  299.741 1.00 152.28 ? 110 MET B C     1 
ATOM   5746  O  O     . MET C 1 110 ? 98.937  26.375  300.183 1.00 157.40 ? 110 MET B O     1 
ATOM   5747  C  CB    . MET C 1 110 ? 97.556  26.629  297.332 1.00 138.27 ? 110 MET B CB    1 
ATOM   5748  C  CG    . MET C 1 110 ? 97.505  26.187  295.883 1.00 129.74 ? 110 MET B CG    1 
ATOM   5749  S  SD    . MET C 1 110 ? 97.255  27.590  294.776 1.00 160.44 ? 110 MET B SD    1 
ATOM   5750  C  CE    . MET C 1 110 ? 98.605  28.663  295.262 1.00 132.25 ? 110 MET B CE    1 
ATOM   5751  N  N     . ASP C 1 111 ? 96.700  26.261  300.427 1.00 148.87 ? 111 ASP B N     1 
ATOM   5752  C  CA    . ASP C 1 111 ? 96.676  26.902  301.737 1.00 144.44 ? 111 ASP B CA    1 
ATOM   5753  C  C     . ASP C 1 111 ? 97.004  25.945  302.882 1.00 139.86 ? 111 ASP B C     1 
ATOM   5754  O  O     . ASP C 1 111 ? 96.411  26.025  303.959 1.00 144.22 ? 111 ASP B O     1 
ATOM   5755  C  CB    . ASP C 1 111 ? 95.319  27.569  301.975 1.00 150.20 ? 111 ASP B CB    1 
ATOM   5756  C  CG    . ASP C 1 111 ? 94.995  28.616  300.927 1.00 155.08 ? 111 ASP B CG    1 
ATOM   5757  O  OD1   . ASP C 1 111 ? 95.941  29.210  300.368 1.00 158.55 ? 111 ASP B OD1   1 
ATOM   5758  O  OD2   . ASP C 1 111 ? 93.797  28.845  300.659 1.00 156.80 ? 111 ASP B OD2   1 
ATOM   5759  N  N     . GLY C 1 112 ? 97.944  25.037  302.641 1.00 131.89 ? 112 GLY B N     1 
ATOM   5760  C  CA    . GLY C 1 112 ? 98.475  24.189  303.691 1.00 129.46 ? 112 GLY B CA    1 
ATOM   5761  C  C     . GLY C 1 112 ? 97.620  23.001  304.087 1.00 125.73 ? 112 GLY B C     1 
ATOM   5762  O  O     . GLY C 1 112 ? 98.117  22.075  304.729 1.00 126.69 ? 112 GLY B O     1 
ATOM   5763  N  N     . ASP C 1 113 ? 96.342  23.025  303.716 1.00 123.51 ? 113 ASP B N     1 
ATOM   5764  C  CA    . ASP C 1 113 ? 95.419  21.945  304.063 1.00 120.76 ? 113 ASP B CA    1 
ATOM   5765  C  C     . ASP C 1 113 ? 95.936  20.593  303.579 1.00 119.26 ? 113 ASP B C     1 
ATOM   5766  O  O     . ASP C 1 113 ? 96.432  20.472  302.459 1.00 123.16 ? 113 ASP B O     1 
ATOM   5767  C  CB    . ASP C 1 113 ? 94.026  22.220  303.491 1.00 115.36 ? 113 ASP B CB    1 
ATOM   5768  N  N     . SER C 1 114 ? 95.830  19.584  304.438 1.00 119.46 ? 114 SER B N     1 
ATOM   5769  C  CA    . SER C 1 114 ? 96.337  18.254  304.122 1.00 115.17 ? 114 SER B CA    1 
ATOM   5770  C  C     . SER C 1 114 ? 95.342  17.468  303.280 1.00 110.27 ? 114 SER B C     1 
ATOM   5771  O  O     . SER C 1 114 ? 94.189  17.871  303.120 1.00 112.71 ? 114 SER B O     1 
ATOM   5772  C  CB    . SER C 1 114 ? 96.655  17.485  305.404 1.00 97.15  ? 114 SER B CB    1 
ATOM   5773  N  N     . ALA C 1 115 ? 95.800  16.343  302.746 1.00 92.98  ? 115 ALA B N     1 
ATOM   5774  C  CA    . ALA C 1 115 ? 94.949  15.469  301.953 1.00 112.22 ? 115 ALA B CA    1 
ATOM   5775  C  C     . ALA C 1 115 ? 93.962  14.728  302.848 1.00 107.10 ? 115 ALA B C     1 
ATOM   5776  O  O     . ALA C 1 115 ? 94.151  14.648  304.062 1.00 112.26 ? 115 ALA B O     1 
ATOM   5777  C  CB    . ALA C 1 115 ? 95.797  14.483  301.168 1.00 103.07 ? 115 ALA B CB    1 
ATOM   5778  N  N     . ALA C 1 116 ? 92.906  14.193  302.243 1.00 104.02 ? 116 ALA B N     1 
ATOM   5779  C  CA    . ALA C 1 116 ? 91.952  13.366  302.967 1.00 102.78 ? 116 ALA B CA    1 
ATOM   5780  C  C     . ALA C 1 116 ? 92.589  12.017  303.262 1.00 111.55 ? 116 ALA B C     1 
ATOM   5781  O  O     . ALA C 1 116 ? 93.652  11.697  302.727 1.00 110.29 ? 116 ALA B O     1 
ATOM   5782  C  CB    . ALA C 1 116 ? 90.677  13.188  302.157 1.00 96.74  ? 116 ALA B CB    1 
ATOM   5783  N  N     . ALA C 1 117 ? 91.943  11.227  304.113 1.00 114.08 ? 117 ALA B N     1 
ATOM   5784  C  CA    . ALA C 1 117 ? 92.459  9.907   304.469 1.00 109.25 ? 117 ALA B CA    1 
ATOM   5785  C  C     . ALA C 1 117 ? 92.527  8.996   303.248 1.00 108.80 ? 117 ALA B C     1 
ATOM   5786  O  O     . ALA C 1 117 ? 91.855  9.242   302.246 1.00 113.07 ? 117 ALA B O     1 
ATOM   5787  C  CB    . ALA C 1 117 ? 91.603  9.279   305.554 1.00 110.61 ? 117 ALA B CB    1 
ATOM   5788  N  N     . GLN C 1 118 ? 93.335  7.943   303.338 1.00 108.14 ? 118 GLN B N     1 
ATOM   5789  C  CA    . GLN C 1 118 ? 93.512  7.014   302.225 1.00 98.12  ? 118 GLN B CA    1 
ATOM   5790  C  C     . GLN C 1 118 ? 92.217  6.274   301.886 1.00 97.31  ? 118 GLN B C     1 
ATOM   5791  O  O     . GLN C 1 118 ? 92.077  5.717   300.796 1.00 100.65 ? 118 GLN B O     1 
ATOM   5792  C  CB    . GLN C 1 118 ? 94.610  5.998   302.545 1.00 97.70  ? 118 GLN B CB    1 
ATOM   5793  C  CG    . GLN C 1 118 ? 95.962  6.601   302.895 1.00 101.26 ? 118 GLN B CG    1 
ATOM   5794  C  CD    . GLN C 1 118 ? 96.956  5.547   303.345 1.00 106.44 ? 118 GLN B CD    1 
ATOM   5795  O  OE1   . GLN C 1 118 ? 98.165  5.776   303.355 1.00 104.66 ? 118 GLN B OE1   1 
ATOM   5796  N  NE2   . GLN C 1 118 ? 96.447  4.379   303.720 1.00 112.17 ? 118 GLN B NE2   1 
ATOM   5797  N  N     . ARG C 1 119 ? 91.274  6.274   302.823 1.00 102.94 ? 119 ARG B N     1 
ATOM   5798  C  CA    . ARG C 1 119 ? 90.017  5.563   302.636 1.00 109.11 ? 119 ARG B CA    1 
ATOM   5799  C  C     . ARG C 1 119 ? 88.972  6.426   301.940 1.00 106.30 ? 119 ARG B C     1 
ATOM   5800  O  O     . ARG C 1 119 ? 87.801  6.054   301.856 1.00 115.48 ? 119 ARG B O     1 
ATOM   5801  C  CB    . ARG C 1 119 ? 89.479  5.063   303.981 1.00 118.42 ? 119 ARG B CB    1 
ATOM   5802  C  CG    . ARG C 1 119 ? 88.869  6.135   304.869 1.00 119.20 ? 119 ARG B CG    1 
ATOM   5803  C  CD    . ARG C 1 119 ? 88.342  5.522   306.158 1.00 127.29 ? 119 ARG B CD    1 
ATOM   5804  N  NE    . ARG C 1 119 ? 87.073  6.108   306.580 1.00 138.25 ? 119 ARG B NE    1 
ATOM   5805  C  CZ    . ARG C 1 119 ? 85.891  5.761   306.079 1.00 145.42 ? 119 ARG B CZ    1 
ATOM   5806  N  NH1   . ARG C 1 119 ? 85.816  4.838   305.129 1.00 149.00 ? 119 ARG B NH1   1 
ATOM   5807  N  NH2   . ARG C 1 119 ? 84.783  6.340   306.521 1.00 145.77 ? 119 ARG B NH2   1 
ATOM   5808  N  N     . TYR C 1 120 ? 89.400  7.576   301.432 1.00 104.27 ? 120 TYR B N     1 
ATOM   5809  C  CA    . TYR C 1 120 ? 88.486  8.501   300.773 1.00 116.58 ? 120 TYR B CA    1 
ATOM   5810  C  C     . TYR C 1 120 ? 89.007  8.938   299.410 1.00 111.46 ? 120 TYR B C     1 
ATOM   5811  O  O     . TYR C 1 120 ? 88.254  9.449   298.585 1.00 121.24 ? 120 TYR B O     1 
ATOM   5812  C  CB    . TYR C 1 120 ? 88.248  9.730   301.651 1.00 92.56  ? 120 TYR B CB    1 
ATOM   5813  C  CG    . TYR C 1 120 ? 87.315  9.480   302.812 1.00 106.23 ? 120 TYR B CG    1 
ATOM   5814  C  CD1   . TYR C 1 120 ? 86.170  8.714   302.652 1.00 112.47 ? 120 TYR B CD1   1 
ATOM   5815  C  CD2   . TYR C 1 120 ? 87.579  10.010  304.069 1.00 107.78 ? 120 TYR B CD2   1 
ATOM   5816  C  CE1   . TYR C 1 120 ? 85.312  8.481   303.708 1.00 123.71 ? 120 TYR B CE1   1 
ATOM   5817  C  CE2   . TYR C 1 120 ? 86.728  9.781   305.133 1.00 119.02 ? 120 TYR B CE2   1 
ATOM   5818  C  CZ    . TYR C 1 120 ? 85.595  9.017   304.947 1.00 127.66 ? 120 TYR B CZ    1 
ATOM   5819  O  OH    . TYR C 1 120 ? 84.744  8.787   306.004 1.00 132.30 ? 120 TYR B OH    1 
ATOM   5820  N  N     . THR C 1 121 ? 90.298  8.736   299.177 1.00 92.08  ? 121 THR B N     1 
ATOM   5821  C  CA    . THR C 1 121 ? 90.916  9.193   297.943 1.00 85.62  ? 121 THR B CA    1 
ATOM   5822  C  C     . THR C 1 121 ? 91.416  8.030   297.101 1.00 112.29 ? 121 THR B C     1 
ATOM   5823  O  O     . THR C 1 121 ? 92.027  7.098   297.616 1.00 99.16  ? 121 THR B O     1 
ATOM   5824  C  CB    . THR C 1 121 ? 92.091  10.146  298.226 1.00 99.96  ? 121 THR B CB    1 
ATOM   5825  O  OG1   . THR C 1 121 ? 93.101  9.449   298.965 1.00 92.53  ? 121 THR B OG1   1 
ATOM   5826  C  CG2   . THR C 1 121 ? 91.618  11.349  299.037 1.00 87.73  ? 121 THR B CG2   1 
ATOM   5827  N  N     . GLU C 1 122 ? 91.139  8.084   295.804 1.00 115.24 ? 122 GLU B N     1 
ATOM   5828  C  CA    . GLU C 1 122 ? 91.665  7.099   294.871 1.00 111.37 ? 122 GLU B CA    1 
ATOM   5829  C  C     . GLU C 1 122 ? 92.627  7.782   293.911 1.00 99.57  ? 122 GLU B C     1 
ATOM   5830  O  O     . GLU C 1 122 ? 92.610  9.006   293.778 1.00 94.69  ? 122 GLU B O     1 
ATOM   5831  C  CB    . GLU C 1 122 ? 90.532  6.404   294.115 1.00 126.17 ? 122 GLU B CB    1 
ATOM   5832  C  CG    . GLU C 1 122 ? 89.534  7.346   293.464 1.00 141.81 ? 122 GLU B CG    1 
ATOM   5833  C  CD    . GLU C 1 122 ? 88.367  6.603   292.843 1.00 151.84 ? 122 GLU B CD    1 
ATOM   5834  O  OE1   . GLU C 1 122 ? 87.650  7.199   292.010 1.00 155.48 ? 122 GLU B OE1   1 
ATOM   5835  O  OE2   . GLU C 1 122 ? 88.166  5.418   293.188 1.00 154.21 ? 122 GLU B OE2   1 
ATOM   5836  N  N     . ALA C 1 123 ? 93.471  6.998   293.250 1.00 98.96  ? 123 ALA B N     1 
ATOM   5837  C  CA    . ALA C 1 123 ? 94.490  7.573   292.379 1.00 97.22  ? 123 ALA B CA    1 
ATOM   5838  C  C     . ALA C 1 123 ? 94.995  6.607   291.316 1.00 105.71 ? 123 ALA B C     1 
ATOM   5839  O  O     . ALA C 1 123 ? 94.922  5.387   291.474 1.00 107.61 ? 123 ALA B O     1 
ATOM   5840  C  CB    . ALA C 1 123 ? 95.657  8.099   293.207 1.00 90.42  ? 123 ALA B CB    1 
ATOM   5841  N  N     . ARG C 1 124 ? 95.505  7.176   290.230 1.00 112.16 ? 124 ARG B N     1 
ATOM   5842  C  CA    . ARG C 1 124 ? 96.166  6.412   289.184 1.00 106.98 ? 124 ARG B CA    1 
ATOM   5843  C  C     . ARG C 1 124 ? 97.331  7.234   288.659 1.00 102.72 ? 124 ARG B C     1 
ATOM   5844  O  O     . ARG C 1 124 ? 97.539  8.370   289.082 1.00 102.97 ? 124 ARG B O     1 
ATOM   5845  C  CB    . ARG C 1 124 ? 95.196  6.092   288.047 1.00 103.52 ? 124 ARG B CB    1 
ATOM   5846  C  CG    . ARG C 1 124 ? 94.735  7.302   287.257 1.00 96.50  ? 124 ARG B CG    1 
ATOM   5847  C  CD    . ARG C 1 124 ? 93.660  6.919   286.253 1.00 95.49  ? 124 ARG B CD    1 
ATOM   5848  N  NE    . ARG C 1 124 ? 93.004  8.096   285.693 1.00 102.31 ? 124 ARG B NE    1 
ATOM   5849  C  CZ    . ARG C 1 124 ? 91.861  8.062   285.017 1.00 110.47 ? 124 ARG B CZ    1 
ATOM   5850  N  NH1   . ARG C 1 124 ? 91.240  6.905   284.817 1.00 111.48 ? 124 ARG B NH1   1 
ATOM   5851  N  NH2   . ARG C 1 124 ? 91.335  9.184   284.545 1.00 115.10 ? 124 ARG B NH2   1 
ATOM   5852  N  N     . MET C 1 125 ? 98.095  6.655   287.743 1.00 98.28  ? 125 MET B N     1 
ATOM   5853  C  CA    . MET C 1 125 ? 99.216  7.358   287.140 1.00 98.64  ? 125 MET B CA    1 
ATOM   5854  C  C     . MET C 1 125 ? 98.723  8.496   286.256 1.00 101.90 ? 125 MET B C     1 
ATOM   5855  O  O     . MET C 1 125 ? 97.626  8.435   285.704 1.00 105.96 ? 125 MET B O     1 
ATOM   5856  C  CB    . MET C 1 125 ? 100.050 6.393   286.301 1.00 101.37 ? 125 MET B CB    1 
ATOM   5857  C  CG    . MET C 1 125 ? 100.625 5.217   287.065 1.00 101.56 ? 125 MET B CG    1 
ATOM   5858  S  SD    . MET C 1 125 ? 101.319 3.999   285.933 1.00 166.37 ? 125 MET B SD    1 
ATOM   5859  C  CE    . MET C 1 125 ? 102.116 5.078   284.746 1.00 71.03  ? 125 MET B CE    1 
ATOM   5860  N  N     . SER C 1 126 ? 99.537  9.536   286.125 1.00 101.11 ? 126 SER B N     1 
ATOM   5861  C  CA    . SER C 1 126 ? 99.246  10.598  285.177 1.00 104.88 ? 126 SER B CA    1 
ATOM   5862  C  C     . SER C 1 126 ? 99.616  10.094  283.792 1.00 115.79 ? 126 SER B C     1 
ATOM   5863  O  O     . SER C 1 126 ? 100.272 9.062   283.659 1.00 126.55 ? 126 SER B O     1 
ATOM   5864  C  CB    . SER C 1 126 ? 100.049 11.853  285.509 1.00 107.38 ? 126 SER B CB    1 
ATOM   5865  O  OG    . SER C 1 126 ? 101.434 11.626  285.319 1.00 104.58 ? 126 SER B OG    1 
ATOM   5866  N  N     . LYS C 1 127 ? 99.192  10.817  282.761 1.00 114.34 ? 127 LYS B N     1 
ATOM   5867  C  CA    . LYS C 1 127 ? 99.516  10.436  281.392 1.00 95.21  ? 127 LYS B CA    1 
ATOM   5868  C  C     . LYS C 1 127 ? 101.018 10.545  281.149 1.00 97.72  ? 127 LYS B C     1 
ATOM   5869  O  O     . LYS C 1 127 ? 101.599 9.738   280.426 1.00 110.55 ? 127 LYS B O     1 
ATOM   5870  C  CB    . LYS C 1 127 ? 98.746  11.298  280.388 1.00 86.82  ? 127 LYS B CB    1 
ATOM   5871  C  CG    . LYS C 1 127 ? 97.237  11.090  280.409 1.00 82.81  ? 127 LYS B CG    1 
ATOM   5872  N  N     . ILE C 1 128 ? 101.644 11.538  281.772 1.00 97.03  ? 128 ILE B N     1 
ATOM   5873  C  CA    . ILE C 1 128 ? 103.062 11.801  281.551 1.00 104.63 ? 128 ILE B CA    1 
ATOM   5874  C  C     . ILE C 1 128 ? 103.969 10.827  282.313 1.00 110.69 ? 128 ILE B C     1 
ATOM   5875  O  O     . ILE C 1 128 ? 105.109 10.594  281.914 1.00 119.71 ? 128 ILE B O     1 
ATOM   5876  C  CB    . ILE C 1 128 ? 103.422 13.274  281.885 1.00 97.36  ? 128 ILE B CB    1 
ATOM   5877  C  CG1   . ILE C 1 128 ? 104.819 13.631  281.368 1.00 92.29  ? 128 ILE B CG1   1 
ATOM   5878  C  CG2   . ILE C 1 128 ? 103.304 13.535  283.376 1.00 101.97 ? 128 ILE B CG2   1 
ATOM   5879  C  CD1   . ILE C 1 128 ? 105.184 15.089  281.550 1.00 93.62  ? 128 ILE B CD1   1 
ATOM   5880  N  N     . ALA C 1 129 ? 103.459 10.245  283.396 1.00 106.48 ? 129 ALA B N     1 
ATOM   5881  C  CA    . ALA C 1 129 ? 104.224 9.264   284.170 1.00 105.47 ? 129 ALA B CA    1 
ATOM   5882  C  C     . ALA C 1 129 ? 104.453 7.990   283.357 1.00 115.74 ? 129 ALA B C     1 
ATOM   5883  O  O     . ALA C 1 129 ? 105.417 7.241   283.579 1.00 127.60 ? 129 ALA B O     1 
ATOM   5884  C  CB    . ALA C 1 129 ? 103.513 8.944   285.474 1.00 103.14 ? 129 ALA B CB    1 
ATOM   5885  N  N     . LEU C 1 130 ? 103.558 7.752   282.405 1.00 112.85 ? 130 LEU B N     1 
ATOM   5886  C  CA    . LEU C 1 130 ? 103.690 6.622   281.500 1.00 106.30 ? 130 LEU B CA    1 
ATOM   5887  C  C     . LEU C 1 130 ? 105.003 6.730   280.730 1.00 100.64 ? 130 LEU B C     1 
ATOM   5888  O  O     . LEU C 1 130 ? 105.607 5.720   280.369 1.00 99.62  ? 130 LEU B O     1 
ATOM   5889  C  CB    . LEU C 1 130 ? 102.497 6.567   280.547 1.00 110.25 ? 130 LEU B CB    1 
ATOM   5890  C  CG    . LEU C 1 130 ? 102.314 5.287   279.732 1.00 120.98 ? 130 LEU B CG    1 
ATOM   5891  C  CD1   . LEU C 1 130 ? 102.670 4.065   280.565 1.00 121.44 ? 130 LEU B CD1   1 
ATOM   5892  C  CD2   . LEU C 1 130 ? 100.881 5.193   279.230 1.00 126.15 ? 130 LEU B CD2   1 
ATOM   5893  N  N     . GLU C 1 131 ? 105.446 7.964   280.498 1.00 100.67 ? 131 GLU B N     1 
ATOM   5894  C  CA    . GLU C 1 131 ? 106.736 8.206   279.865 1.00 97.80  ? 131 GLU B CA    1 
ATOM   5895  C  C     . GLU C 1 131 ? 107.868 7.792   280.795 1.00 93.42  ? 131 GLU B C     1 
ATOM   5896  O  O     . GLU C 1 131 ? 108.902 7.302   280.343 1.00 105.76 ? 131 GLU B O     1 
ATOM   5897  C  CB    . GLU C 1 131 ? 106.885 9.674   279.464 1.00 106.28 ? 131 GLU B CB    1 
ATOM   5898  C  CG    . GLU C 1 131 ? 105.783 10.180  278.549 1.00 119.32 ? 131 GLU B CG    1 
ATOM   5899  C  CD    . GLU C 1 131 ? 105.695 9.401   277.251 1.00 117.12 ? 131 GLU B CD    1 
ATOM   5900  O  OE1   . GLU C 1 131 ? 106.742 8.914   276.771 1.00 114.79 ? 131 GLU B OE1   1 
ATOM   5901  O  OE2   . GLU C 1 131 ? 104.575 9.273   276.712 1.00 118.30 ? 131 GLU B OE2   1 
ATOM   5902  N  N     . MET C 1 132 ? 107.668 7.984   282.095 1.00 87.60  ? 132 MET B N     1 
ATOM   5903  C  CA    . MET C 1 132 ? 108.627 7.496   283.081 1.00 91.97  ? 132 MET B CA    1 
ATOM   5904  C  C     . MET C 1 132 ? 108.666 5.974   283.037 1.00 87.60  ? 132 MET B C     1 
ATOM   5905  O  O     . MET C 1 132 ? 109.693 5.365   283.335 1.00 83.62  ? 132 MET B O     1 
ATOM   5906  C  CB    . MET C 1 132 ? 108.260 7.960   284.494 1.00 89.48  ? 132 MET B CB    1 
ATOM   5907  C  CG    . MET C 1 132 ? 108.382 9.454   284.733 1.00 71.40  ? 132 MET B CG    1 
ATOM   5908  S  SD    . MET C 1 132 ? 110.083 10.029  284.675 1.00 95.46  ? 132 MET B SD    1 
ATOM   5909  C  CE    . MET C 1 132 ? 110.813 9.074   286.002 1.00 87.21  ? 132 MET B CE    1 
ATOM   5910  N  N     . LEU C 1 133 ? 107.548 5.362   282.654 1.00 84.83  ? 133 LEU B N     1 
ATOM   5911  C  CA    . LEU C 1 133 ? 107.474 3.900   282.638 1.00 93.52  ? 133 LEU B CA    1 
ATOM   5912  C  C     . LEU C 1 133 ? 107.489 3.251   281.251 1.00 109.02 ? 133 LEU B C     1 
ATOM   5913  O  O     . LEU C 1 133 ? 107.245 2.049   281.128 1.00 113.57 ? 133 LEU B O     1 
ATOM   5914  C  CB    . LEU C 1 133 ? 106.254 3.423   283.425 1.00 91.18  ? 133 LEU B CB    1 
ATOM   5915  C  CG    . LEU C 1 133 ? 106.333 3.728   284.918 1.00 85.54  ? 133 LEU B CG    1 
ATOM   5916  C  CD1   . LEU C 1 133 ? 105.071 3.272   285.609 1.00 80.50  ? 133 LEU B CD1   1 
ATOM   5917  C  CD2   . LEU C 1 133 ? 107.556 3.069   285.535 1.00 63.66  ? 133 LEU B CD2   1 
ATOM   5918  N  N     . ARG C 1 134 ? 107.780 4.038   280.221 1.00 115.30 ? 134 ARG B N     1 
ATOM   5919  C  CA    . ARG C 1 134 ? 107.802 3.539   278.846 1.00 105.05 ? 134 ARG B CA    1 
ATOM   5920  C  C     . ARG C 1 134 ? 108.758 2.369   278.645 1.00 113.95 ? 134 ARG B C     1 
ATOM   5921  O  O     . ARG C 1 134 ? 109.948 2.469   278.942 1.00 118.54 ? 134 ARG B O     1 
ATOM   5922  C  CB    . ARG C 1 134 ? 108.179 4.660   277.881 1.00 100.00 ? 134 ARG B CB    1 
ATOM   5923  C  CG    . ARG C 1 134 ? 107.014 5.483   277.386 1.00 109.30 ? 134 ARG B CG    1 
ATOM   5924  C  CD    . ARG C 1 134 ? 106.634 5.081   275.973 1.00 110.47 ? 134 ARG B CD    1 
ATOM   5925  N  NE    . ARG C 1 134 ? 105.229 4.704   275.868 1.00 121.12 ? 134 ARG B NE    1 
ATOM   5926  C  CZ    . ARG C 1 134 ? 104.233 5.574   275.750 1.00 130.81 ? 134 ARG B CZ    1 
ATOM   5927  N  NH1   . ARG C 1 134 ? 104.486 6.875   275.728 1.00 133.94 ? 134 ARG B NH1   1 
ATOM   5928  N  NH2   . ARG C 1 134 ? 102.982 5.145   275.659 1.00 134.84 ? 134 ARG B NH2   1 
ATOM   5929  N  N     . ASP C 1 135 ? 108.218 1.264   278.137 1.00 118.18 ? 135 ASP B N     1 
ATOM   5930  C  CA    . ASP C 1 135 ? 109.003 0.081   277.792 1.00 116.83 ? 135 ASP B CA    1 
ATOM   5931  C  C     . ASP C 1 135 ? 109.843 -0.462  278.949 1.00 110.94 ? 135 ASP B C     1 
ATOM   5932  O  O     . ASP C 1 135 ? 110.946 -0.969  278.743 1.00 111.71 ? 135 ASP B O     1 
ATOM   5933  C  CB    . ASP C 1 135 ? 109.881 0.360   276.569 1.00 116.72 ? 135 ASP B CB    1 
ATOM   5934  C  CG    . ASP C 1 135 ? 109.066 0.685   275.333 1.00 120.44 ? 135 ASP B CG    1 
ATOM   5935  O  OD1   . ASP C 1 135 ? 108.142 -0.090  275.006 1.00 124.71 ? 135 ASP B OD1   1 
ATOM   5936  O  OD2   . ASP C 1 135 ? 109.341 1.724   274.696 1.00 116.63 ? 135 ASP B OD2   1 
ATOM   5937  N  N     . ILE C 1 136 ? 109.309 -0.356  280.163 1.00 99.87  ? 136 ILE B N     1 
ATOM   5938  C  CA    . ILE C 1 136 ? 109.946 -0.935  281.339 1.00 89.03  ? 136 ILE B CA    1 
ATOM   5939  C  C     . ILE C 1 136 ? 109.927 -2.457  281.217 1.00 91.16  ? 136 ILE B C     1 
ATOM   5940  O  O     . ILE C 1 136 ? 110.765 -3.154  281.791 1.00 94.10  ? 136 ILE B O     1 
ATOM   5941  C  CB    . ILE C 1 136 ? 109.228 -0.489  282.639 1.00 81.85  ? 136 ILE B CB    1 
ATOM   5942  C  CG1   . ILE C 1 136 ? 109.929 -1.044  283.883 1.00 79.30  ? 136 ILE B CG1   1 
ATOM   5943  C  CG2   . ILE C 1 136 ? 107.762 -0.902  282.616 1.00 90.40  ? 136 ILE B CG2   1 
ATOM   5944  C  CD1   . ILE C 1 136 ? 111.276 -0.419  284.157 1.00 80.67  ? 136 ILE B CD1   1 
ATOM   5945  N  N     . ASN C 1 137 ? 108.971 -2.960  280.441 1.00 101.10 ? 137 ASN B N     1 
ATOM   5946  C  CA    . ASN C 1 137 ? 108.805 -4.393  280.243 1.00 114.52 ? 137 ASN B CA    1 
ATOM   5947  C  C     . ASN C 1 137 ? 109.590 -4.919  279.048 1.00 110.98 ? 137 ASN B C     1 
ATOM   5948  O  O     . ASN C 1 137 ? 109.299 -5.998  278.537 1.00 105.90 ? 137 ASN B O     1 
ATOM   5949  C  CB    . ASN C 1 137 ? 107.325 -4.732  280.065 1.00 127.36 ? 137 ASN B CB    1 
ATOM   5950  C  CG    . ASN C 1 137 ? 106.714 -4.047  278.857 1.00 133.41 ? 137 ASN B CG    1 
ATOM   5951  O  OD1   . ASN C 1 137 ? 107.029 -2.894  278.558 1.00 135.17 ? 137 ASN B OD1   1 
ATOM   5952  N  ND2   . ASN C 1 137 ? 105.837 -4.756  278.154 1.00 132.03 ? 137 ASN B ND2   1 
ATOM   5953  N  N     . LYS C 1 138 ? 110.579 -4.154  278.599 1.00 107.12 ? 138 LYS B N     1 
ATOM   5954  C  CA    . LYS C 1 138 ? 111.403 -4.566  277.466 1.00 98.36  ? 138 LYS B CA    1 
ATOM   5955  C  C     . LYS C 1 138 ? 112.888 -4.608  277.816 1.00 103.81 ? 138 LYS B C     1 
ATOM   5956  O  O     . LYS C 1 138 ? 113.737 -4.303  276.978 1.00 112.19 ? 138 LYS B O     1 
ATOM   5957  C  CB    . LYS C 1 138 ? 111.175 -3.647  276.264 1.00 90.72  ? 138 LYS B CB    1 
ATOM   5958  C  CG    . LYS C 1 138 ? 109.841 -3.851  275.556 1.00 92.25  ? 138 LYS B CG    1 
ATOM   5959  C  CD    . LYS C 1 138 ? 109.788 -3.050  274.263 1.00 96.91  ? 138 LYS B CD    1 
ATOM   5960  C  CE    . LYS C 1 138 ? 108.526 -3.339  273.468 1.00 99.13  ? 138 LYS B CE    1 
ATOM   5961  N  NZ    . LYS C 1 138 ? 108.524 -2.599  272.173 1.00 104.16 ? 138 LYS B NZ    1 
ATOM   5962  N  N     . ASN C 1 139 ? 113.189 -4.996  279.053 1.00 103.18 ? 139 ASN B N     1 
ATOM   5963  C  CA    . ASN C 1 139 ? 114.563 -5.060  279.552 1.00 100.87 ? 139 ASN B CA    1 
ATOM   5964  C  C     . ASN C 1 139 ? 115.341 -3.770  279.297 1.00 103.07 ? 139 ASN B C     1 
ATOM   5965  O  O     . ASN C 1 139 ? 116.478 -3.802  278.825 1.00 113.80 ? 139 ASN B O     1 
ATOM   5966  C  CB    . ASN C 1 139 ? 115.306 -6.258  278.954 1.00 97.41  ? 139 ASN B CB    1 
ATOM   5967  C  CG    . ASN C 1 139 ? 116.489 -6.695  279.801 1.00 106.13 ? 139 ASN B CG    1 
ATOM   5968  O  OD1   . ASN C 1 139 ? 116.967 -5.949  280.652 1.00 101.50 ? 139 ASN B OD1   1 
ATOM   5969  N  ND2   . ASN C 1 139 ? 116.967 -7.910  279.567 1.00 114.24 ? 139 ASN B ND2   1 
ATOM   5970  N  N     . THR C 1 140 ? 114.715 -2.639  279.602 1.00 91.23  ? 140 THR B N     1 
ATOM   5971  C  CA    . THR C 1 140 ? 115.357 -1.338  279.463 1.00 83.46  ? 140 THR B CA    1 
ATOM   5972  C  C     . THR C 1 140 ? 115.989 -0.919  280.781 1.00 93.90  ? 140 THR B C     1 
ATOM   5973  O  O     . THR C 1 140 ? 116.739 0.055   280.844 1.00 97.05  ? 140 THR B O     1 
ATOM   5974  C  CB    . THR C 1 140 ? 114.344 -0.257  279.043 1.00 88.54  ? 140 THR B CB    1 
ATOM   5975  O  OG1   . THR C 1 140 ? 113.149 -0.394  279.824 1.00 100.79 ? 140 THR B OG1   1 
ATOM   5976  C  CG2   . THR C 1 140 ? 113.991 -0.395  277.578 1.00 88.59  ? 140 THR B CG2   1 
ATOM   5977  N  N     . VAL C 1 141 ? 115.688 -1.672  281.832 1.00 104.40 ? 141 VAL B N     1 
ATOM   5978  C  CA    . VAL C 1 141 ? 116.072 -1.292  283.184 1.00 98.92  ? 141 VAL B CA    1 
ATOM   5979  C  C     . VAL C 1 141 ? 116.468 -2.501  284.030 1.00 94.96  ? 141 VAL B C     1 
ATOM   5980  O  O     . VAL C 1 141 ? 115.823 -3.546  283.969 1.00 103.49 ? 141 VAL B O     1 
ATOM   5981  C  CB    . VAL C 1 141 ? 114.916 -0.531  283.867 1.00 96.04  ? 141 VAL B CB    1 
ATOM   5982  C  CG1   . VAL C 1 141 ? 114.846 -0.851  285.350 1.00 103.56 ? 141 VAL B CG1   1 
ATOM   5983  C  CG2   . VAL C 1 141 ? 115.049 0.963   283.626 1.00 85.47  ? 141 VAL B CG2   1 
ATOM   5984  N  N     . ASP C 1 142 ? 117.531 -2.352  284.817 1.00 90.44  ? 142 ASP B N     1 
ATOM   5985  C  CA    . ASP C 1 142 ? 117.969 -3.410  285.724 1.00 103.54 ? 142 ASP B CA    1 
ATOM   5986  C  C     . ASP C 1 142 ? 117.057 -3.553  286.941 1.00 100.20 ? 142 ASP B C     1 
ATOM   5987  O  O     . ASP C 1 142 ? 116.575 -2.564  287.496 1.00 101.94 ? 142 ASP B O     1 
ATOM   5988  C  CB    . ASP C 1 142 ? 119.412 -3.175  286.181 1.00 110.86 ? 142 ASP B CB    1 
ATOM   5989  C  CG    . ASP C 1 142 ? 120.403 -3.242  285.037 1.00 119.04 ? 142 ASP B CG    1 
ATOM   5990  O  OD1   . ASP C 1 142 ? 120.059 -3.826  283.990 1.00 122.50 ? 142 ASP B OD1   1 
ATOM   5991  O  OD2   . ASP C 1 142 ? 121.524 -2.713  285.185 1.00 122.43 ? 142 ASP B OD2   1 
ATOM   5992  N  N     . PHE C 1 143 ? 116.838 -4.795  287.357 1.00 91.90  ? 143 PHE B N     1 
ATOM   5993  C  CA    . PHE C 1 143 ? 115.985 -5.085  288.501 1.00 91.96  ? 143 PHE B CA    1 
ATOM   5994  C  C     . PHE C 1 143 ? 116.778 -5.663  289.668 1.00 94.20  ? 143 PHE B C     1 
ATOM   5995  O  O     . PHE C 1 143 ? 117.904 -6.135  289.495 1.00 94.48  ? 143 PHE B O     1 
ATOM   5996  C  CB    . PHE C 1 143 ? 114.868 -6.050  288.100 1.00 84.59  ? 143 PHE B CB    1 
ATOM   5997  C  CG    . PHE C 1 143 ? 113.696 -5.381  287.437 1.00 75.06  ? 143 PHE B CG    1 
ATOM   5998  C  CD1   . PHE C 1 143 ? 113.842 -4.744  286.216 1.00 76.54  ? 143 PHE B CD1   1 
ATOM   5999  C  CD2   . PHE C 1 143 ? 112.446 -5.404  288.029 1.00 85.19  ? 143 PHE B CD2   1 
ATOM   6000  C  CE1   . PHE C 1 143 ? 112.767 -4.131  285.606 1.00 84.93  ? 143 PHE B CE1   1 
ATOM   6001  C  CE2   . PHE C 1 143 ? 111.367 -4.795  287.424 1.00 88.64  ? 143 PHE B CE2   1 
ATOM   6002  C  CZ    . PHE C 1 143 ? 111.525 -4.158  286.212 1.00 84.96  ? 143 PHE B CZ    1 
ATOM   6003  N  N     . VAL C 1 144 ? 116.179 -5.613  290.854 1.00 94.62  ? 144 VAL B N     1 
ATOM   6004  C  CA    . VAL C 1 144 ? 116.789 -6.144  292.066 1.00 97.95  ? 144 VAL B CA    1 
ATOM   6005  C  C     . VAL C 1 144 ? 115.724 -6.743  292.974 1.00 103.14 ? 144 VAL B C     1 
ATOM   6006  O  O     . VAL C 1 144 ? 114.564 -6.337  292.932 1.00 104.95 ? 144 VAL B O     1 
ATOM   6007  C  CB    . VAL C 1 144 ? 117.517 -5.046  292.859 1.00 87.79  ? 144 VAL B CB    1 
ATOM   6008  C  CG1   . VAL C 1 144 ? 118.869 -4.735  292.238 1.00 86.76  ? 144 VAL B CG1   1 
ATOM   6009  C  CG2   . VAL C 1 144 ? 116.651 -3.800  292.942 1.00 82.78  ? 144 VAL B CG2   1 
ATOM   6010  N  N     . ASP C 1 145 ? 116.119 -7.707  293.798 1.00 101.13 ? 145 ASP B N     1 
ATOM   6011  C  CA    . ASP C 1 145 ? 115.216 -8.273  294.792 1.00 105.70 ? 145 ASP B CA    1 
ATOM   6012  C  C     . ASP C 1 145 ? 114.791 -7.204  295.790 1.00 111.04 ? 145 ASP B C     1 
ATOM   6013  O  O     . ASP C 1 145 ? 115.598 -6.364  296.187 1.00 119.36 ? 145 ASP B O     1 
ATOM   6014  C  CB    . ASP C 1 145 ? 115.891 -9.429  295.536 1.00 112.65 ? 145 ASP B CB    1 
ATOM   6015  C  CG    . ASP C 1 145 ? 115.941 -10.700 294.718 1.00 115.23 ? 145 ASP B CG    1 
ATOM   6016  O  OD1   . ASP C 1 145 ? 114.984 -10.956 293.956 1.00 116.58 ? 145 ASP B OD1   1 
ATOM   6017  O  OD2   . ASP C 1 145 ? 116.934 -11.447 294.841 1.00 112.38 ? 145 ASP B OD2   1 
ATOM   6018  N  N     . ASN C 1 146 ? 113.526 -7.238  296.199 1.00 101.15 ? 146 ASN B N     1 
ATOM   6019  C  CA    . ASN C 1 146 ? 113.031 -6.307  297.209 1.00 93.65  ? 146 ASN B CA    1 
ATOM   6020  C  C     . ASN C 1 146 ? 113.610 -6.606  298.591 1.00 101.48 ? 146 ASN B C     1 
ATOM   6021  O  O     . ASN C 1 146 ? 114.438 -7.503  298.740 1.00 97.08  ? 146 ASN B O     1 
ATOM   6022  C  CB    . ASN C 1 146 ? 111.500 -6.308  297.253 1.00 86.69  ? 146 ASN B CB    1 
ATOM   6023  C  CG    . ASN C 1 146 ? 110.928 -7.611  297.775 1.00 90.58  ? 146 ASN B CG    1 
ATOM   6024  O  OD1   . ASN C 1 146 ? 111.553 -8.665  297.670 1.00 88.10  ? 146 ASN B OD1   1 
ATOM   6025  N  ND2   . ASN C 1 146 ? 109.727 -7.544  298.336 1.00 99.88  ? 146 ASN B ND2   1 
ATOM   6026  N  N     . TYR C 1 147 ? 113.174 -5.854  299.598 1.00 104.43 ? 147 TYR B N     1 
ATOM   6027  C  CA    . TYR C 1 147 ? 113.697 -6.015  300.952 1.00 99.60  ? 147 TYR B CA    1 
ATOM   6028  C  C     . TYR C 1 147 ? 113.435 -7.415  301.506 1.00 107.44 ? 147 TYR B C     1 
ATOM   6029  O  O     . TYR C 1 147 ? 114.288 -7.991  302.181 1.00 107.48 ? 147 TYR B O     1 
ATOM   6030  C  CB    . TYR C 1 147 ? 113.119 -4.952  301.889 1.00 92.79  ? 147 TYR B CB    1 
ATOM   6031  C  CG    . TYR C 1 147 ? 111.627 -5.056  302.100 1.00 85.04  ? 147 TYR B CG    1 
ATOM   6032  C  CD1   . TYR C 1 147 ? 111.108 -5.686  303.223 1.00 86.44  ? 147 TYR B CD1   1 
ATOM   6033  C  CD2   . TYR C 1 147 ? 110.738 -4.528  301.175 1.00 84.43  ? 147 TYR B CD2   1 
ATOM   6034  C  CE1   . TYR C 1 147 ? 109.746 -5.785  303.420 1.00 85.41  ? 147 TYR B CE1   1 
ATOM   6035  C  CE2   . TYR C 1 147 ? 109.375 -4.622  301.363 1.00 91.37  ? 147 TYR B CE2   1 
ATOM   6036  C  CZ    . TYR C 1 147 ? 108.885 -5.252  302.487 1.00 89.41  ? 147 TYR B CZ    1 
ATOM   6037  O  OH    . TYR C 1 147 ? 107.526 -5.349  302.681 1.00 94.53  ? 147 TYR B OH    1 
ATOM   6038  N  N     . ASP C 1 148 ? 112.257 -7.959  301.214 1.00 113.42 ? 148 ASP B N     1 
ATOM   6039  C  CA    . ASP C 1 148 ? 111.905 -9.303  301.658 1.00 115.39 ? 148 ASP B CA    1 
ATOM   6040  C  C     . ASP C 1 148 ? 112.550 -10.366 300.778 1.00 114.92 ? 148 ASP B C     1 
ATOM   6041  O  O     . ASP C 1 148 ? 112.518 -11.553 301.106 1.00 111.82 ? 148 ASP B O     1 
ATOM   6042  C  CB    . ASP C 1 148 ? 110.386 -9.491  301.670 1.00 127.84 ? 148 ASP B CB    1 
ATOM   6043  C  CG    . ASP C 1 148 ? 109.770 -9.172  303.016 1.00 152.43 ? 148 ASP B CG    1 
ATOM   6044  O  OD1   . ASP C 1 148 ? 108.607 -8.716  303.049 1.00 164.33 ? 148 ASP B OD1   1 
ATOM   6045  O  OD2   . ASP C 1 148 ? 110.448 -9.381  304.044 1.00 157.01 ? 148 ASP B OD2   1 
ATOM   6046  N  N     . ALA C 1 149 ? 113.124 -9.926  299.660 1.00 119.68 ? 149 ALA B N     1 
ATOM   6047  C  CA    . ALA C 1 149 ? 113.743 -10.819 298.681 1.00 113.23 ? 149 ALA B CA    1 
ATOM   6048  C  C     . ALA C 1 149 ? 112.751 -11.838 298.121 1.00 102.07 ? 149 ALA B C     1 
ATOM   6049  O  O     . ALA C 1 149 ? 113.105 -12.992 297.881 1.00 99.81  ? 149 ALA B O     1 
ATOM   6050  C  CB    . ALA C 1 149 ? 114.967 -11.517 299.273 1.00 114.01 ? 149 ALA B CB    1 
ATOM   6051  N  N     . ASN C 1 150 ? 111.510 -11.403 297.916 1.00 94.71  ? 150 ASN B N     1 
ATOM   6052  C  CA    . ASN C 1 150 ? 110.490 -12.248 297.301 1.00 97.25  ? 150 ASN B CA    1 
ATOM   6053  C  C     . ASN C 1 150 ? 109.693 -11.503 296.228 1.00 95.49  ? 150 ASN B C     1 
ATOM   6054  O  O     . ASN C 1 150 ? 108.661 -11.980 295.754 1.00 88.83  ? 150 ASN B O     1 
ATOM   6055  C  CB    . ASN C 1 150 ? 109.563 -12.861 298.359 1.00 105.56 ? 150 ASN B CB    1 
ATOM   6056  C  CG    . ASN C 1 150 ? 109.042 -11.835 299.346 1.00 120.69 ? 150 ASN B CG    1 
ATOM   6057  O  OD1   . ASN C 1 150 ? 108.970 -10.646 299.042 1.00 126.77 ? 150 ASN B OD1   1 
ATOM   6058  N  ND2   . ASN C 1 150 ? 108.675 -12.292 300.536 1.00 125.13 ? 150 ASN B ND2   1 
ATOM   6059  N  N     . GLU C 1 151 ? 110.187 -10.324 295.862 1.00 97.49  ? 151 GLU B N     1 
ATOM   6060  C  CA    . GLU C 1 151 ? 109.659 -9.559  294.739 1.00 90.33  ? 151 GLU B CA    1 
ATOM   6061  C  C     . GLU C 1 151 ? 110.851 -8.941  294.018 1.00 87.97  ? 151 GLU B C     1 
ATOM   6062  O  O     . GLU C 1 151 ? 111.985 -9.060  294.483 1.00 87.22  ? 151 GLU B O     1 
ATOM   6063  C  CB    . GLU C 1 151 ? 108.710 -8.458  295.224 1.00 90.01  ? 151 GLU B CB    1 
ATOM   6064  C  CG    . GLU C 1 151 ? 107.497 -8.944  296.016 1.00 102.89 ? 151 GLU B CG    1 
ATOM   6065  C  CD    . GLU C 1 151 ? 106.401 -9.523  295.137 1.00 121.49 ? 151 GLU B CD    1 
ATOM   6066  O  OE1   . GLU C 1 151 ? 106.613 -9.649  293.913 1.00 132.51 ? 151 GLU B OE1   1 
ATOM   6067  O  OE2   . GLU C 1 151 ? 105.319 -9.849  295.673 1.00 129.32 ? 151 GLU B OE2   1 
ATOM   6068  N  N     . ARG C 1 152 ? 110.608 -8.288  292.886 1.00 88.81  ? 152 ARG B N     1 
ATOM   6069  C  CA    . ARG C 1 152 ? 111.674 -7.559  292.198 1.00 96.42  ? 152 ARG B CA    1 
ATOM   6070  C  C     . ARG C 1 152 ? 111.227 -6.164  291.753 1.00 98.68  ? 152 ARG B C     1 
ATOM   6071  O  O     . ARG C 1 152 ? 110.064 -5.949  291.417 1.00 104.23 ? 152 ARG B O     1 
ATOM   6072  C  CB    . ARG C 1 152 ? 112.249 -8.367  291.026 1.00 85.07  ? 152 ARG B CB    1 
ATOM   6073  C  CG    . ARG C 1 152 ? 113.085 -9.569  291.462 1.00 81.37  ? 152 ARG B CG    1 
ATOM   6074  C  CD    . ARG C 1 152 ? 113.842 -10.205 290.302 1.00 91.92  ? 152 ARG B CD    1 
ATOM   6075  N  NE    . ARG C 1 152 ? 115.009 -9.426  289.890 1.00 99.68  ? 152 ARG B NE    1 
ATOM   6076  C  CZ    . ARG C 1 152 ? 116.212 -9.532  290.446 1.00 96.34  ? 152 ARG B CZ    1 
ATOM   6077  N  NH1   . ARG C 1 152 ? 116.410 -10.376 291.450 1.00 97.77  ? 152 ARG B NH1   1 
ATOM   6078  N  NH2   . ARG C 1 152 ? 117.219 -8.791  290.005 1.00 96.26  ? 152 ARG B NH2   1 
ATOM   6079  N  N     . GLU C 1 153 ? 112.164 -5.220  291.767 1.00 88.32  ? 153 GLU B N     1 
ATOM   6080  C  CA    . GLU C 1 153 ? 111.865 -3.821  291.490 1.00 91.32  ? 153 GLU B CA    1 
ATOM   6081  C  C     . GLU C 1 153 ? 112.967 -3.183  290.649 1.00 78.82  ? 153 GLU B C     1 
ATOM   6082  O  O     . GLU C 1 153 ? 114.124 -3.586  290.731 1.00 67.88  ? 153 GLU B O     1 
ATOM   6083  C  CB    . GLU C 1 153 ? 111.703 -3.056  292.806 1.00 98.00  ? 153 GLU B CB    1 
ATOM   6084  C  CG    . GLU C 1 153 ? 112.943 -3.068  293.679 1.00 97.50  ? 153 GLU B CG    1 
ATOM   6085  C  CD    . GLU C 1 153 ? 112.801 -2.201  294.910 1.00 102.66 ? 153 GLU B CD    1 
ATOM   6086  O  OE1   . GLU C 1 153 ? 113.744 -2.174  295.729 1.00 112.66 ? 153 GLU B OE1   1 
ATOM   6087  O  OE2   . GLU C 1 153 ? 111.750 -1.544  295.058 1.00 102.52 ? 153 GLU B OE2   1 
ATOM   6088  N  N     . PRO C 1 154 ? 112.606 -2.182  289.831 1.00 71.52  ? 154 PRO B N     1 
ATOM   6089  C  CA    . PRO C 1 154 ? 113.569 -1.481  288.975 1.00 70.53  ? 154 PRO B CA    1 
ATOM   6090  C  C     . PRO C 1 154 ? 114.548 -0.638  289.783 1.00 74.77  ? 154 PRO B C     1 
ATOM   6091  O  O     . PRO C 1 154 ? 114.126 0.047   290.713 1.00 79.80  ? 154 PRO B O     1 
ATOM   6092  C  CB    . PRO C 1 154 ? 112.678 -0.569  288.126 1.00 86.20  ? 154 PRO B CB    1 
ATOM   6093  C  CG    . PRO C 1 154 ? 111.431 -0.401  288.919 1.00 92.08  ? 154 PRO B CG    1 
ATOM   6094  C  CD    . PRO C 1 154 ? 111.230 -1.705  289.618 1.00 83.55  ? 154 PRO B CD    1 
ATOM   6095  N  N     . LEU C 1 155 ? 115.831 -0.691  289.433 1.00 78.88  ? 155 LEU B N     1 
ATOM   6096  C  CA    . LEU C 1 155 ? 116.834 0.160   290.066 1.00 83.90  ? 155 LEU B CA    1 
ATOM   6097  C  C     . LEU C 1 155 ? 116.614 1.608   289.655 1.00 88.17  ? 155 LEU B C     1 
ATOM   6098  O  O     . LEU C 1 155 ? 116.804 2.533   290.446 1.00 96.62  ? 155 LEU B O     1 
ATOM   6099  C  CB    . LEU C 1 155 ? 118.245 -0.277  289.669 1.00 85.48  ? 155 LEU B CB    1 
ATOM   6100  C  CG    . LEU C 1 155 ? 118.876 -1.415  290.470 1.00 95.16  ? 155 LEU B CG    1 
ATOM   6101  C  CD1   . LEU C 1 155 ? 120.274 -1.726  289.955 1.00 99.11  ? 155 LEU B CD1   1 
ATOM   6102  C  CD2   . LEU C 1 155 ? 118.914 -1.063  291.951 1.00 101.84 ? 155 LEU B CD2   1 
ATOM   6103  N  N     . VAL C 1 156 ? 116.206 1.786   288.404 1.00 85.03  ? 156 VAL B N     1 
ATOM   6104  C  CA    . VAL C 1 156 ? 115.945 3.101   287.843 1.00 86.97  ? 156 VAL B CA    1 
ATOM   6105  C  C     . VAL C 1 156 ? 114.750 2.965   286.901 1.00 84.94  ? 156 VAL B C     1 
ATOM   6106  O  O     . VAL C 1 156 ? 114.257 1.864   286.688 1.00 75.40  ? 156 VAL B O     1 
ATOM   6107  C  CB    . VAL C 1 156 ? 117.181 3.611   287.076 1.00 77.28  ? 156 VAL B CB    1 
ATOM   6108  C  CG1   . VAL C 1 156 ? 117.285 2.930   285.720 1.00 73.53  ? 156 VAL B CG1   1 
ATOM   6109  C  CG2   . VAL C 1 156 ? 117.149 5.125   286.925 1.00 79.44  ? 156 VAL B CG2   1 
ATOM   6110  N  N     . LEU C 1 157 ? 114.260 4.072   286.358 1.00 81.55  ? 157 LEU B N     1 
ATOM   6111  C  CA    . LEU C 1 157 ? 113.181 4.010   285.381 1.00 80.29  ? 157 LEU B CA    1 
ATOM   6112  C  C     . LEU C 1 157 ? 113.691 4.546   284.054 1.00 97.93  ? 157 LEU B C     1 
ATOM   6113  O  O     . LEU C 1 157 ? 114.630 5.340   284.037 1.00 104.42 ? 157 LEU B O     1 
ATOM   6114  C  CB    . LEU C 1 157 ? 111.973 4.811   285.863 1.00 84.86  ? 157 LEU B CB    1 
ATOM   6115  C  CG    . LEU C 1 157 ? 111.277 4.239   287.102 1.00 88.09  ? 157 LEU B CG    1 
ATOM   6116  C  CD1   . LEU C 1 157 ? 110.000 5.005   287.419 1.00 85.00  ? 157 LEU B CD1   1 
ATOM   6117  C  CD2   . LEU C 1 157 ? 110.985 2.764   286.901 1.00 89.73  ? 157 LEU B CD2   1 
ATOM   6118  N  N     . PRO C 1 158 ? 113.089 4.101   282.937 1.00 104.21 ? 158 PRO B N     1 
ATOM   6119  C  CA    . PRO C 1 158 ? 113.477 4.601   281.613 1.00 98.01  ? 158 PRO B CA    1 
ATOM   6120  C  C     . PRO C 1 158 ? 113.421 6.123   281.554 1.00 103.10 ? 158 PRO B C     1 
ATOM   6121  O  O     . PRO C 1 158 ? 114.315 6.743   280.974 1.00 102.31 ? 158 PRO B O     1 
ATOM   6122  C  CB    . PRO C 1 158 ? 112.416 3.999   280.693 1.00 89.37  ? 158 PRO B CB    1 
ATOM   6123  C  CG    . PRO C 1 158 ? 112.012 2.738   281.381 1.00 89.38  ? 158 PRO B CG    1 
ATOM   6124  C  CD    . PRO C 1 158 ? 112.064 3.045   282.848 1.00 97.98  ? 158 PRO B CD    1 
ATOM   6125  N  N     . ALA C 1 159 ? 112.381 6.700   282.155 1.00 98.50  ? 159 ALA B N     1 
ATOM   6126  C  CA    . ALA C 1 159 ? 112.220 8.149   282.253 1.00 90.73  ? 159 ALA B CA    1 
ATOM   6127  C  C     . ALA C 1 159 ? 112.386 8.845   280.907 1.00 96.87  ? 159 ALA B C     1 
ATOM   6128  O  O     . ALA C 1 159 ? 113.404 9.489   280.657 1.00 100.29 ? 159 ALA B O     1 
ATOM   6129  C  CB    . ALA C 1 159 ? 113.195 8.724   283.271 1.00 87.62  ? 159 ALA B CB    1 
ATOM   6130  N  N     . ARG C 1 160 ? 111.383 8.723   280.044 1.00 99.29  ? 160 ARG B N     1 
ATOM   6131  C  CA    . ARG C 1 160 ? 111.490 9.262   278.691 1.00 101.81 ? 160 ARG B CA    1 
ATOM   6132  C  C     . ARG C 1 160 ? 111.357 10.783  278.624 1.00 106.42 ? 160 ARG B C     1 
ATOM   6133  O  O     . ARG C 1 160 ? 111.377 11.365  277.540 1.00 111.61 ? 160 ARG B O     1 
ATOM   6134  C  CB    . ARG C 1 160 ? 110.501 8.582   277.742 1.00 101.17 ? 160 ARG B CB    1 
ATOM   6135  C  CG    . ARG C 1 160 ? 110.638 7.064   277.678 1.00 96.73  ? 160 ARG B CG    1 
ATOM   6136  C  CD    . ARG C 1 160 ? 112.087 6.598   277.596 1.00 97.55  ? 160 ARG B CD    1 
ATOM   6137  N  NE    . ARG C 1 160 ? 112.840 7.298   276.561 1.00 106.57 ? 160 ARG B NE    1 
ATOM   6138  C  CZ    . ARG C 1 160 ? 112.882 6.932   275.285 1.00 109.33 ? 160 ARG B CZ    1 
ATOM   6139  N  NH1   . ARG C 1 160 ? 112.214 5.863   274.878 1.00 109.35 ? 160 ARG B NH1   1 
ATOM   6140  N  NH2   . ARG C 1 160 ? 113.594 7.637   274.417 1.00 112.07 ? 160 ARG B NH2   1 
ATOM   6141  N  N     . PHE C 1 161 ? 111.217 11.420  279.782 1.00 106.46 ? 161 PHE B N     1 
ATOM   6142  C  CA    . PHE C 1 161 ? 111.346 12.869  279.873 1.00 109.37 ? 161 PHE B CA    1 
ATOM   6143  C  C     . PHE C 1 161 ? 112.231 13.211  281.069 1.00 106.02 ? 161 PHE B C     1 
ATOM   6144  O  O     . PHE C 1 161 ? 112.121 12.581  282.121 1.00 104.54 ? 161 PHE B O     1 
ATOM   6145  C  CB    . PHE C 1 161 ? 109.978 13.557  279.954 1.00 114.15 ? 161 PHE B CB    1 
ATOM   6146  C  CG    . PHE C 1 161 ? 109.278 13.387  281.272 1.00 119.66 ? 161 PHE B CG    1 
ATOM   6147  C  CD1   . PHE C 1 161 ? 108.472 12.287  281.509 1.00 116.45 ? 161 PHE B CD1   1 
ATOM   6148  C  CD2   . PHE C 1 161 ? 109.408 14.342  282.267 1.00 118.53 ? 161 PHE B CD2   1 
ATOM   6149  C  CE1   . PHE C 1 161 ? 107.820 12.138  282.717 1.00 117.56 ? 161 PHE B CE1   1 
ATOM   6150  C  CE2   . PHE C 1 161 ? 108.761 14.197  283.478 1.00 113.51 ? 161 PHE B CE2   1 
ATOM   6151  C  CZ    . PHE C 1 161 ? 107.965 13.092  283.704 1.00 114.51 ? 161 PHE B CZ    1 
ATOM   6152  N  N     . PRO C 1 162 ? 113.119 14.206  280.907 1.00 97.81  ? 162 PRO B N     1 
ATOM   6153  C  CA    . PRO C 1 162 ? 114.111 14.563  281.929 1.00 94.49  ? 162 PRO B CA    1 
ATOM   6154  C  C     . PRO C 1 162 ? 113.476 15.013  283.245 1.00 110.42 ? 162 PRO B C     1 
ATOM   6155  O  O     . PRO C 1 162 ? 113.448 16.206  283.544 1.00 117.59 ? 162 PRO B O     1 
ATOM   6156  C  CB    . PRO C 1 162 ? 114.880 15.719  281.280 1.00 81.62  ? 162 PRO B CB    1 
ATOM   6157  C  CG    . PRO C 1 162 ? 113.945 16.279  280.265 1.00 88.86  ? 162 PRO B CG    1 
ATOM   6158  C  CD    . PRO C 1 162 ? 113.190 15.100  279.739 1.00 92.14  ? 162 PRO B CD    1 
ATOM   6159  N  N     . ASN C 1 163 ? 112.999 14.050  284.027 1.00 113.18 ? 163 ASN B N     1 
ATOM   6160  C  CA    . ASN C 1 163 ? 112.244 14.327  285.245 1.00 104.03 ? 163 ASN B CA    1 
ATOM   6161  C  C     . ASN C 1 163 ? 113.001 15.136  286.298 1.00 104.11 ? 163 ASN B C     1 
ATOM   6162  O  O     . ASN C 1 163 ? 112.394 15.892  287.056 1.00 111.80 ? 163 ASN B O     1 
ATOM   6163  C  CB    . ASN C 1 163 ? 111.733 13.018  285.855 1.00 100.33 ? 163 ASN B CB    1 
ATOM   6164  C  CG    . ASN C 1 163 ? 110.769 13.245  287.004 1.00 99.68  ? 163 ASN B CG    1 
ATOM   6165  O  OD1   . ASN C 1 163 ? 109.968 14.180  286.986 1.00 97.71  ? 163 ASN B OD1   1 
ATOM   6166  N  ND2   . ASN C 1 163 ? 110.844 12.388  288.013 1.00 98.01  ? 163 ASN B ND2   1 
ATOM   6167  N  N     . LEU C 1 164 ? 114.320 14.977  286.342 1.00 99.45  ? 164 LEU B N     1 
ATOM   6168  C  CA    . LEU C 1 164 ? 115.141 15.643  287.353 1.00 98.39  ? 164 LEU B CA    1 
ATOM   6169  C  C     . LEU C 1 164 ? 115.064 17.165  287.239 1.00 104.20 ? 164 LEU B C     1 
ATOM   6170  O  O     . LEU C 1 164 ? 114.676 17.847  288.187 1.00 104.47 ? 164 LEU B O     1 
ATOM   6171  C  CB    . LEU C 1 164 ? 116.600 15.181  287.257 1.00 94.97  ? 164 LEU B CB    1 
ATOM   6172  C  CG    . LEU C 1 164 ? 117.431 15.088  288.544 1.00 91.03  ? 164 LEU B CG    1 
ATOM   6173  C  CD1   . LEU C 1 164 ? 118.740 15.856  288.411 1.00 89.08  ? 164 LEU B CD1   1 
ATOM   6174  C  CD2   . LEU C 1 164 ? 116.651 15.556  289.767 1.00 98.47  ? 164 LEU B CD2   1 
ATOM   6175  N  N     . LEU C 1 165 ? 115.432 17.691  286.074 1.00 103.93 ? 165 LEU B N     1 
ATOM   6176  C  CA    . LEU C 1 165 ? 115.409 19.133  285.844 1.00 106.57 ? 165 LEU B CA    1 
ATOM   6177  C  C     . LEU C 1 165 ? 113.984 19.657  285.717 1.00 107.01 ? 165 LEU B C     1 
ATOM   6178  O  O     . LEU C 1 165 ? 113.668 20.749  286.192 1.00 102.43 ? 165 LEU B O     1 
ATOM   6179  C  CB    . LEU C 1 165 ? 116.207 19.485  284.589 1.00 104.21 ? 165 LEU B CB    1 
ATOM   6180  C  CG    . LEU C 1 165 ? 117.730 19.442  284.709 1.00 103.54 ? 165 LEU B CG    1 
ATOM   6181  C  CD1   . LEU C 1 165 ? 118.370 19.440  283.330 1.00 103.60 ? 165 LEU B CD1   1 
ATOM   6182  C  CD2   . LEU C 1 165 ? 118.231 20.619  285.535 1.00 100.19 ? 165 LEU B CD2   1 
ATOM   6183  N  N     . VAL C 1 166 ? 113.131 18.868  285.072 1.00 108.74 ? 166 VAL B N     1 
ATOM   6184  C  CA    . VAL C 1 166 ? 111.746 19.252  284.818 1.00 106.87 ? 166 VAL B CA    1 
ATOM   6185  C  C     . VAL C 1 166 ? 110.927 19.419  286.101 1.00 107.05 ? 166 VAL B C     1 
ATOM   6186  O  O     . VAL C 1 166 ? 110.219 20.413  286.263 1.00 109.89 ? 166 VAL B O     1 
ATOM   6187  C  CB    . VAL C 1 166 ? 111.060 18.240  283.871 1.00 100.22 ? 166 VAL B CB    1 
ATOM   6188  C  CG1   . VAL C 1 166 ? 109.553 18.287  284.019 1.00 86.60  ? 166 VAL B CG1   1 
ATOM   6189  C  CG2   . VAL C 1 166 ? 111.481 18.494  282.427 1.00 103.60 ? 166 VAL B CG2   1 
ATOM   6190  N  N     . ASN C 1 167 ? 111.026 18.453  287.010 1.00 107.40 ? 167 ASN B N     1 
ATOM   6191  C  CA    . ASN C 1 167 ? 110.258 18.503  288.253 1.00 107.17 ? 167 ASN B CA    1 
ATOM   6192  C  C     . ASN C 1 167 ? 111.059 18.971  289.465 1.00 115.04 ? 167 ASN B C     1 
ATOM   6193  O  O     . ASN C 1 167 ? 110.500 19.170  290.543 1.00 118.60 ? 167 ASN B O     1 
ATOM   6194  C  CB    . ASN C 1 167 ? 109.607 17.148  288.547 1.00 92.15  ? 167 ASN B CB    1 
ATOM   6195  C  CG    . ASN C 1 167 ? 108.272 16.976  287.846 1.00 93.07  ? 167 ASN B CG    1 
ATOM   6196  O  OD1   . ASN C 1 167 ? 107.548 17.945  287.616 1.00 92.54  ? 167 ASN B OD1   1 
ATOM   6197  N  ND2   . ASN C 1 167 ? 107.936 15.737  287.510 1.00 97.99  ? 167 ASN B ND2   1 
ATOM   6198  N  N     . GLY C 1 168 ? 112.365 19.142  289.290 1.00 117.80 ? 168 GLY B N     1 
ATOM   6199  C  CA    . GLY C 1 168 ? 113.217 19.583  290.379 1.00 120.66 ? 168 GLY B CA    1 
ATOM   6200  C  C     . GLY C 1 168 ? 113.440 18.512  291.432 1.00 123.43 ? 168 GLY B C     1 
ATOM   6201  O  O     . GLY C 1 168 ? 113.011 17.370  291.265 1.00 126.14 ? 168 GLY B O     1 
ATOM   6202  N  N     . ALA C 1 169 ? 114.108 18.879  292.523 1.00 124.62 ? 169 ALA B N     1 
ATOM   6203  C  CA    . ALA C 1 169 ? 114.410 17.924  293.589 1.00 129.54 ? 169 ALA B CA    1 
ATOM   6204  C  C     . ALA C 1 169 ? 114.605 18.584  294.956 1.00 132.58 ? 169 ALA B C     1 
ATOM   6205  O  O     . ALA C 1 169 ? 114.917 19.773  295.046 1.00 138.06 ? 169 ALA B O     1 
ATOM   6206  C  CB    . ALA C 1 169 ? 115.630 17.089  293.223 1.00 135.78 ? 169 ALA B CB    1 
ATOM   6207  N  N     . THR C 1 170 ? 114.425 17.790  296.011 1.00 128.37 ? 170 THR B N     1 
ATOM   6208  C  CA    . THR C 1 170 ? 114.555 18.247  297.394 1.00 123.21 ? 170 THR B CA    1 
ATOM   6209  C  C     . THR C 1 170 ? 114.431 17.041  298.331 1.00 127.41 ? 170 THR B C     1 
ATOM   6210  O  O     . THR C 1 170 ? 113.653 16.126  298.057 1.00 129.31 ? 170 THR B O     1 
ATOM   6211  C  CB    . THR C 1 170 ? 113.479 19.310  297.744 1.00 103.59 ? 170 THR B CB    1 
ATOM   6212  O  OG1   . THR C 1 170 ? 113.609 19.705  299.115 1.00 118.49 ? 170 THR B OG1   1 
ATOM   6213  C  CG2   . THR C 1 170 ? 112.077 18.767  297.502 1.00 97.69  ? 170 THR B CG2   1 
ATOM   6214  N  N     . GLY C 1 171 ? 115.201 17.016  299.420 1.00 132.75 ? 171 GLY B N     1 
ATOM   6215  C  CA    . GLY C 1 171 ? 116.171 18.047  299.735 1.00 134.23 ? 171 GLY B CA    1 
ATOM   6216  C  C     . GLY C 1 171 ? 117.195 17.632  300.780 1.00 135.98 ? 171 GLY B C     1 
ATOM   6217  O  O     . GLY C 1 171 ? 118.351 17.371  300.452 1.00 138.90 ? 171 GLY B O     1 
ATOM   6218  N  N     . ILE C 1 172 ? 116.766 17.557  302.038 1.00 135.08 ? 172 ILE B N     1 
ATOM   6219  C  CA    . ILE C 1 172 ? 117.681 17.373  303.166 1.00 127.50 ? 172 ILE B CA    1 
ATOM   6220  C  C     . ILE C 1 172 ? 118.145 15.932  303.355 1.00 115.35 ? 172 ILE B C     1 
ATOM   6221  O  O     . ILE C 1 172 ? 117.336 15.007  303.359 1.00 109.82 ? 172 ILE B O     1 
ATOM   6222  C  CB    . ILE C 1 172 ? 117.031 17.824  304.487 1.00 124.24 ? 172 ILE B CB    1 
ATOM   6223  C  CG1   . ILE C 1 172 ? 116.087 19.003  304.248 1.00 125.35 ? 172 ILE B CG1   1 
ATOM   6224  C  CG2   . ILE C 1 172 ? 118.097 18.166  305.520 1.00 125.83 ? 172 ILE B CG2   1 
ATOM   6225  C  CD1   . ILE C 1 172 ? 115.250 19.356  305.453 1.00 127.26 ? 172 ILE B CD1   1 
ATOM   6226  N  N     . ALA C 1 173 ? 119.451 15.758  303.534 1.00 111.89 ? 173 ALA B N     1 
ATOM   6227  C  CA    . ALA C 1 173 ? 120.034 14.452  303.824 1.00 114.54 ? 173 ALA B CA    1 
ATOM   6228  C  C     . ALA C 1 173 ? 120.944 14.541  305.045 1.00 125.16 ? 173 ALA B C     1 
ATOM   6229  O  O     . ALA C 1 173 ? 120.677 15.304  305.973 1.00 138.43 ? 173 ALA B O     1 
ATOM   6230  C  CB    . ALA C 1 173 ? 120.811 13.939  302.626 1.00 114.17 ? 173 ALA B CB    1 
ATOM   6231  N  N     . VAL C 1 174 ? 122.019 13.759  305.042 1.00 121.58 ? 174 VAL B N     1 
ATOM   6232  C  CA    . VAL C 1 174 ? 123.002 13.815  306.117 1.00 127.23 ? 174 VAL B CA    1 
ATOM   6233  C  C     . VAL C 1 174 ? 124.335 14.332  305.590 1.00 121.82 ? 174 VAL B C     1 
ATOM   6234  O  O     . VAL C 1 174 ? 124.942 13.724  304.708 1.00 122.91 ? 174 VAL B O     1 
ATOM   6235  C  CB    . VAL C 1 174 ? 123.218 12.438  306.777 1.00 127.03 ? 174 VAL B CB    1 
ATOM   6236  C  CG1   . VAL C 1 174 ? 124.385 12.499  307.752 1.00 119.29 ? 174 VAL B CG1   1 
ATOM   6237  C  CG2   . VAL C 1 174 ? 121.950 11.975  307.481 1.00 125.51 ? 174 VAL B CG2   1 
ATOM   6238  N  N     . GLY C 1 175 ? 124.778 15.462  306.133 1.00 119.65 ? 175 GLY B N     1 
ATOM   6239  C  CA    . GLY C 1 175 ? 126.024 16.080  305.718 1.00 131.21 ? 175 GLY B CA    1 
ATOM   6240  C  C     . GLY C 1 175 ? 125.892 16.846  304.417 1.00 129.08 ? 175 GLY B C     1 
ATOM   6241  O  O     . GLY C 1 175 ? 126.839 17.492  303.967 1.00 128.07 ? 175 GLY B O     1 
ATOM   6242  N  N     . MET C 1 176 ? 124.709 16.777  303.814 1.00 119.34 ? 176 MET B N     1 
ATOM   6243  C  CA    . MET C 1 176 ? 124.463 17.421  302.530 1.00 115.69 ? 176 MET B CA    1 
ATOM   6244  C  C     . MET C 1 176 ? 122.969 17.568  302.263 1.00 116.84 ? 176 MET B C     1 
ATOM   6245  O  O     . MET C 1 176 ? 122.142 16.928  302.916 1.00 116.15 ? 176 MET B O     1 
ATOM   6246  C  CB    . MET C 1 176 ? 125.108 16.613  301.404 1.00 114.21 ? 176 MET B CB    1 
ATOM   6247  C  CG    . MET C 1 176 ? 124.508 15.231  301.236 1.00 104.17 ? 176 MET B CG    1 
ATOM   6248  S  SD    . MET C 1 176 ? 125.516 14.152  300.206 1.00 125.86 ? 176 MET B SD    1 
ATOM   6249  C  CE    . MET C 1 176 ? 127.029 14.104  301.162 1.00 96.37  ? 176 MET B CE    1 
ATOM   6250  N  N     . ALA C 1 177 ? 122.631 18.420  301.301 1.00 119.82 ? 177 ALA B N     1 
ATOM   6251  C  CA    . ALA C 1 177 ? 121.246 18.615  300.894 1.00 121.34 ? 177 ALA B CA    1 
ATOM   6252  C  C     . ALA C 1 177 ? 121.193 19.051  299.435 1.00 129.80 ? 177 ALA B C     1 
ATOM   6253  O  O     . ALA C 1 177 ? 122.193 19.500  298.877 1.00 134.14 ? 177 ALA B O     1 
ATOM   6254  C  CB    . ALA C 1 177 ? 120.567 19.642  301.783 1.00 120.12 ? 177 ALA B CB    1 
ATOM   6255  N  N     . THR C 1 178 ? 120.024 18.919  298.817 1.00 129.46 ? 178 THR B N     1 
ATOM   6256  C  CA    . THR C 1 178 ? 119.870 19.289  297.416 1.00 127.29 ? 178 THR B CA    1 
ATOM   6257  C  C     . THR C 1 178 ? 118.705 20.250  297.200 1.00 131.88 ? 178 THR B C     1 
ATOM   6258  O  O     . THR C 1 178 ? 117.734 20.250  297.957 1.00 137.74 ? 178 THR B O     1 
ATOM   6259  C  CB    . THR C 1 178 ? 119.679 18.046  296.518 1.00 126.09 ? 178 THR B CB    1 
ATOM   6260  O  OG1   . THR C 1 178 ? 119.645 18.445  295.141 1.00 125.13 ? 178 THR B OG1   1 
ATOM   6261  C  CG2   . THR C 1 178 ? 118.388 17.320  296.865 1.00 125.84 ? 178 THR B CG2   1 
ATOM   6262  N  N     . ASN C 1 179 ? 118.818 21.079  296.168 1.00 132.28 ? 179 ASN B N     1 
ATOM   6263  C  CA    . ASN C 1 179 ? 117.721 21.945  295.756 1.00 129.97 ? 179 ASN B CA    1 
ATOM   6264  C  C     . ASN C 1 179 ? 117.797 22.276  294.269 1.00 126.73 ? 179 ASN B C     1 
ATOM   6265  O  O     . ASN C 1 179 ? 118.687 23.001  293.823 1.00 129.22 ? 179 ASN B O     1 
ATOM   6266  C  CB    . ASN C 1 179 ? 117.681 23.227  296.590 1.00 132.10 ? 179 ASN B CB    1 
ATOM   6267  C  CG    . ASN C 1 179 ? 116.292 23.836  296.651 1.00 132.80 ? 179 ASN B CG    1 
ATOM   6268  O  OD1   . ASN C 1 179 ? 115.290 23.122  296.630 1.00 133.72 ? 179 ASN B OD1   1 
ATOM   6269  N  ND2   . ASN C 1 179 ? 116.227 25.161  296.719 1.00 135.97 ? 179 ASN B ND2   1 
ATOM   6270  N  N     . ILE C 1 180 ? 116.860 21.725  293.507 1.00 117.30 ? 180 ILE B N     1 
ATOM   6271  C  CA    . ILE C 1 180 ? 116.788 21.950  292.072 1.00 103.51 ? 180 ILE B CA    1 
ATOM   6272  C  C     . ILE C 1 180 ? 115.378 22.419  291.733 1.00 107.08 ? 180 ILE B C     1 
ATOM   6273  O  O     . ILE C 1 180 ? 114.402 21.820  292.179 1.00 118.07 ? 180 ILE B O     1 
ATOM   6274  C  CB    . ILE C 1 180 ? 117.101 20.657  291.293 1.00 101.02 ? 180 ILE B CB    1 
ATOM   6275  C  CG1   . ILE C 1 180 ? 118.439 20.072  291.751 1.00 93.96  ? 180 ILE B CG1   1 
ATOM   6276  C  CG2   . ILE C 1 180 ? 117.110 20.915  289.794 1.00 105.38 ? 180 ILE B CG2   1 
ATOM   6277  C  CD1   . ILE C 1 180 ? 118.835 18.802  291.031 1.00 91.02  ? 180 ILE B CD1   1 
ATOM   6278  N  N     . PRO C 1 181 ? 115.264 23.509  290.960 1.00 111.04 ? 181 PRO B N     1 
ATOM   6279  C  CA    . PRO C 1 181 ? 113.944 24.044  290.615 1.00 114.12 ? 181 PRO B CA    1 
ATOM   6280  C  C     . PRO C 1 181 ? 113.316 23.265  289.471 1.00 114.82 ? 181 PRO B C     1 
ATOM   6281  O  O     . PRO C 1 181 ? 114.027 22.544  288.769 1.00 122.14 ? 181 PRO B O     1 
ATOM   6282  C  CB    . PRO C 1 181 ? 114.266 25.462  290.147 1.00 116.05 ? 181 PRO B CB    1 
ATOM   6283  C  CG    . PRO C 1 181 ? 115.616 25.334  289.545 1.00 117.94 ? 181 PRO B CG    1 
ATOM   6284  C  CD    . PRO C 1 181 ? 116.350 24.344  290.418 1.00 116.30 ? 181 PRO B CD    1 
ATOM   6285  N  N     . PRO C 1 182 ? 111.993 23.400  289.292 1.00 116.65 ? 182 PRO B N     1 
ATOM   6286  C  CA    . PRO C 1 182 ? 111.296 22.797  288.153 1.00 124.99 ? 182 PRO B CA    1 
ATOM   6287  C  C     . PRO C 1 182 ? 111.564 23.576  286.869 1.00 129.97 ? 182 PRO B C     1 
ATOM   6288  O  O     . PRO C 1 182 ? 111.904 24.758  286.925 1.00 132.74 ? 182 PRO B O     1 
ATOM   6289  C  CB    . PRO C 1 182 ? 109.816 22.927  288.539 1.00 122.93 ? 182 PRO B CB    1 
ATOM   6290  C  CG    . PRO C 1 182 ? 109.809 23.197  290.019 1.00 123.67 ? 182 PRO B CG    1 
ATOM   6291  C  CD    . PRO C 1 182 ? 111.050 23.987  290.257 1.00 122.22 ? 182 PRO B CD    1 
ATOM   6292  N  N     . HIS C 1 183 ? 111.412 22.918  285.725 1.00 119.69 ? 183 HIS B N     1 
ATOM   6293  C  CA    . HIS C 1 183 ? 111.622 23.572  284.439 1.00 113.82 ? 183 HIS B CA    1 
ATOM   6294  C  C     . HIS C 1 183 ? 110.502 23.250  283.461 1.00 117.75 ? 183 HIS B C     1 
ATOM   6295  O  O     . HIS C 1 183 ? 109.809 22.242  283.606 1.00 123.69 ? 183 HIS B O     1 
ATOM   6296  C  CB    . HIS C 1 183 ? 112.963 23.157  283.832 1.00 110.65 ? 183 HIS B CB    1 
ATOM   6297  C  CG    . HIS C 1 183 ? 114.151 23.668  284.583 1.00 110.85 ? 183 HIS B CG    1 
ATOM   6298  N  ND1   . HIS C 1 183 ? 114.546 23.148  285.796 1.00 107.12 ? 183 HIS B ND1   1 
ATOM   6299  C  CD2   . HIS C 1 183 ? 115.032 24.654  284.291 1.00 112.52 ? 183 HIS B CD2   1 
ATOM   6300  C  CE1   . HIS C 1 183 ? 115.619 23.791  286.219 1.00 113.78 ? 183 HIS B CE1   1 
ATOM   6301  N  NE2   . HIS C 1 183 ? 115.935 24.710  285.324 1.00 118.01 ? 183 HIS B NE2   1 
ATOM   6302  N  N     . ASN C 1 184 ? 110.330 24.114  282.466 1.00 119.64 ? 184 ASN B N     1 
ATOM   6303  C  CA    . ASN C 1 184 ? 109.376 23.862  281.397 1.00 123.12 ? 184 ASN B CA    1 
ATOM   6304  C  C     . ASN C 1 184 ? 109.831 22.663  280.572 1.00 128.59 ? 184 ASN B C     1 
ATOM   6305  O  O     . ASN C 1 184 ? 111.005 22.561  280.214 1.00 134.34 ? 184 ASN B O     1 
ATOM   6306  C  CB    . ASN C 1 184 ? 109.227 25.100  280.511 1.00 123.60 ? 184 ASN B CB    1 
ATOM   6307  C  CG    . ASN C 1 184 ? 108.163 24.931  279.445 1.00 123.24 ? 184 ASN B CG    1 
ATOM   6308  O  OD1   . ASN C 1 184 ? 108.466 24.626  278.292 1.00 129.30 ? 184 ASN B OD1   1 
ATOM   6309  N  ND2   . ASN C 1 184 ? 106.906 25.128  279.826 1.00 113.53 ? 184 ASN B ND2   1 
ATOM   6310  N  N     . LEU C 1 185 ? 108.900 21.757  280.285 1.00 121.75 ? 185 LEU B N     1 
ATOM   6311  C  CA    . LEU C 1 185 ? 109.200 20.513  279.575 1.00 104.95 ? 185 LEU B CA    1 
ATOM   6312  C  C     . LEU C 1 185 ? 109.883 20.775  278.237 1.00 111.65 ? 185 LEU B C     1 
ATOM   6313  O  O     . LEU C 1 185 ? 110.976 20.260  277.967 1.00 114.06 ? 185 LEU B O     1 
ATOM   6314  C  CB    . LEU C 1 185 ? 107.911 19.722  279.340 1.00 90.70  ? 185 LEU B CB    1 
ATOM   6315  C  CG    . LEU C 1 185 ? 107.917 18.207  279.572 1.00 94.16  ? 185 LEU B CG    1 
ATOM   6316  C  CD1   . LEU C 1 185 ? 106.697 17.569  278.918 1.00 99.59  ? 185 LEU B CD1   1 
ATOM   6317  C  CD2   . LEU C 1 185 ? 109.203 17.554  279.079 1.00 93.88  ? 185 LEU B CD2   1 
ATOM   6318  N  N     . GLY C 1 186 ? 109.227 21.582  277.408 1.00 113.06 ? 186 GLY B N     1 
ATOM   6319  C  CA    . GLY C 1 186 ? 109.717 21.905  276.082 1.00 118.13 ? 186 GLY B CA    1 
ATOM   6320  C  C     . GLY C 1 186 ? 111.134 22.438  276.068 1.00 126.10 ? 186 GLY B C     1 
ATOM   6321  O  O     . GLY C 1 186 ? 111.940 22.042  275.231 1.00 143.30 ? 186 GLY B O     1 
ATOM   6322  N  N     . GLU C 1 187 ? 111.443 23.323  277.010 1.00 118.63 ? 187 GLU B N     1 
ATOM   6323  C  CA    . GLU C 1 187 ? 112.758 23.952  277.068 1.00 120.60 ? 187 GLU B CA    1 
ATOM   6324  C  C     . GLU C 1 187 ? 113.849 22.964  277.477 1.00 123.27 ? 187 GLU B C     1 
ATOM   6325  O  O     . GLU C 1 187 ? 114.953 22.983  276.932 1.00 132.94 ? 187 GLU B O     1 
ATOM   6326  C  CB    . GLU C 1 187 ? 112.728 25.146  278.020 1.00 119.02 ? 187 GLU B CB    1 
ATOM   6327  C  CG    . GLU C 1 187 ? 111.593 26.115  277.723 1.00 123.31 ? 187 GLU B CG    1 
ATOM   6328  C  CD    . GLU C 1 187 ? 111.646 27.360  278.579 1.00 131.83 ? 187 GLU B CD    1 
ATOM   6329  O  OE1   . GLU C 1 187 ? 112.393 27.364  279.580 1.00 136.14 ? 187 GLU B OE1   1 
ATOM   6330  O  OE2   . GLU C 1 187 ? 110.943 28.340  278.251 1.00 138.44 ? 187 GLU B OE2   1 
ATOM   6331  N  N     . THR C 1 188 ? 113.532 22.102  278.438 1.00 117.37 ? 188 THR B N     1 
ATOM   6332  C  CA    . THR C 1 188 ? 114.470 21.080  278.883 1.00 118.17 ? 188 THR B CA    1 
ATOM   6333  C  C     . THR C 1 188 ? 114.760 20.123  277.732 1.00 126.78 ? 188 THR B C     1 
ATOM   6334  O  O     . THR C 1 188 ? 115.908 19.726  277.509 1.00 136.33 ? 188 THR B O     1 
ATOM   6335  C  CB    . THR C 1 188 ? 113.911 20.287  280.076 1.00 119.59 ? 188 THR B CB    1 
ATOM   6336  O  OG1   . THR C 1 188 ? 113.161 21.163  280.927 1.00 124.82 ? 188 THR B OG1   1 
ATOM   6337  C  CG2   . THR C 1 188 ? 115.042 19.651  280.871 1.00 117.58 ? 188 THR B CG2   1 
ATOM   6338  N  N     . ILE C 1 189 ? 113.711 19.764  276.996 1.00 122.35 ? 189 ILE B N     1 
ATOM   6339  C  CA    . ILE C 1 189 ? 113.860 18.907  275.823 1.00 113.61 ? 189 ILE B CA    1 
ATOM   6340  C  C     . ILE C 1 189 ? 114.721 19.577  274.751 1.00 113.03 ? 189 ILE B C     1 
ATOM   6341  O  O     . ILE C 1 189 ? 115.582 18.933  274.141 1.00 115.78 ? 189 ILE B O     1 
ATOM   6342  C  CB    . ILE C 1 189 ? 112.487 18.497  275.250 1.00 110.24 ? 189 ILE B CB    1 
ATOM   6343  C  CG1   . ILE C 1 189 ? 111.829 17.472  276.176 1.00 104.11 ? 189 ILE B CG1   1 
ATOM   6344  C  CG2   . ILE C 1 189 ? 112.630 17.927  273.849 1.00 117.15 ? 189 ILE B CG2   1 
ATOM   6345  C  CD1   . ILE C 1 189 ? 110.487 16.980  275.697 1.00 105.93 ? 189 ILE B CD1   1 
ATOM   6346  N  N     . ASP C 1 190 ? 114.492 20.871  274.540 1.00 108.41 ? 190 ASP B N     1 
ATOM   6347  C  CA    . ASP C 1 190 ? 115.295 21.659  273.611 1.00 107.94 ? 190 ASP B CA    1 
ATOM   6348  C  C     . ASP C 1 190 ? 116.761 21.636  274.026 1.00 115.66 ? 190 ASP B C     1 
ATOM   6349  O  O     . ASP C 1 190 ? 117.652 21.567  273.182 1.00 125.48 ? 190 ASP B O     1 
ATOM   6350  C  CB    . ASP C 1 190 ? 114.796 23.107  273.548 1.00 103.04 ? 190 ASP B CB    1 
ATOM   6351  C  CG    . ASP C 1 190 ? 113.384 23.217  273.004 1.00 108.93 ? 190 ASP B CG    1 
ATOM   6352  O  OD1   . ASP C 1 190 ? 112.950 22.292  272.285 1.00 123.24 ? 190 ASP B OD1   1 
ATOM   6353  O  OD2   . ASP C 1 190 ? 112.705 24.225  273.298 1.00 98.62  ? 190 ASP B OD2   1 
ATOM   6354  N  N     . ALA C 1 191 ? 117.001 21.689  275.332 1.00 113.62 ? 191 ALA B N     1 
ATOM   6355  C  CA    . ALA C 1 191 ? 118.356 21.674  275.869 1.00 118.25 ? 191 ALA B CA    1 
ATOM   6356  C  C     . ALA C 1 191 ? 119.027 20.324  275.641 1.00 123.71 ? 191 ALA B C     1 
ATOM   6357  O  O     . ALA C 1 191 ? 120.207 20.261  275.286 1.00 127.36 ? 191 ALA B O     1 
ATOM   6358  C  CB    . ALA C 1 191 ? 118.343 22.022  277.349 1.00 116.63 ? 191 ALA B CB    1 
ATOM   6359  N  N     . VAL C 1 192 ? 118.273 19.248  275.853 1.00 125.08 ? 192 VAL B N     1 
ATOM   6360  C  CA    . VAL C 1 192 ? 118.786 17.903  275.618 1.00 118.03 ? 192 VAL B CA    1 
ATOM   6361  C  C     . VAL C 1 192 ? 119.166 17.731  274.152 1.00 119.15 ? 192 VAL B C     1 
ATOM   6362  O  O     . VAL C 1 192 ? 120.273 17.291  273.831 1.00 126.56 ? 192 VAL B O     1 
ATOM   6363  C  CB    . VAL C 1 192 ? 117.758 16.824  276.007 1.00 101.45 ? 192 VAL B CB    1 
ATOM   6364  N  N     . LYS C 1 193 ? 118.243 18.095  273.267 1.00 109.55 ? 193 LYS B N     1 
ATOM   6365  C  CA    . LYS C 1 193 ? 118.480 18.015  271.830 1.00 99.11  ? 193 LYS B CA    1 
ATOM   6366  C  C     . LYS C 1 193 ? 119.658 18.882  271.395 1.00 100.46 ? 193 LYS B C     1 
ATOM   6367  O  O     . LYS C 1 193 ? 120.406 18.517  270.487 1.00 99.82  ? 193 LYS B O     1 
ATOM   6368  C  CB    . LYS C 1 193 ? 117.218 18.413  271.065 1.00 91.44  ? 193 LYS B CB    1 
ATOM   6369  C  CG    . LYS C 1 193 ? 116.109 17.380  271.114 1.00 89.35  ? 193 LYS B CG    1 
ATOM   6370  C  CD    . LYS C 1 193 ? 114.753 18.008  270.840 1.00 100.60 ? 193 LYS B CD    1 
ATOM   6371  C  CE    . LYS C 1 193 ? 114.759 18.836  269.561 1.00 110.88 ? 193 LYS B CE    1 
ATOM   6372  N  NZ    . LYS C 1 193 ? 113.522 19.662  269.425 1.00 111.34 ? 193 LYS B NZ    1 
ATOM   6373  N  N     . LEU C 1 194 ? 119.815 20.031  272.045 1.00 114.00 ? 194 LEU B N     1 
ATOM   6374  C  CA    . LEU C 1 194 ? 120.903 20.945  271.719 1.00 121.53 ? 194 LEU B CA    1 
ATOM   6375  C  C     . LEU C 1 194 ? 122.244 20.352  272.139 1.00 123.10 ? 194 LEU B C     1 
ATOM   6376  O  O     . LEU C 1 194 ? 123.238 20.477  271.422 1.00 120.04 ? 194 LEU B O     1 
ATOM   6377  C  CB    . LEU C 1 194 ? 120.681 22.312  272.375 1.00 116.98 ? 194 LEU B CB    1 
ATOM   6378  C  CG    . LEU C 1 194 ? 121.514 23.492  271.862 1.00 121.03 ? 194 LEU B CG    1 
ATOM   6379  C  CD1   . LEU C 1 194 ? 120.719 24.785  271.955 1.00 125.25 ? 194 LEU B CD1   1 
ATOM   6380  C  CD2   . LEU C 1 194 ? 122.826 23.627  272.625 1.00 125.20 ? 194 LEU B CD2   1 
ATOM   6381  N  N     . VAL C 1 195 ? 122.265 19.708  273.302 1.00 120.04 ? 195 VAL B N     1 
ATOM   6382  C  CA    . VAL C 1 195 ? 123.469 19.039  273.784 1.00 112.42 ? 195 VAL B CA    1 
ATOM   6383  C  C     . VAL C 1 195 ? 123.826 17.860  272.884 1.00 115.07 ? 195 VAL B C     1 
ATOM   6384  O  O     . VAL C 1 195 ? 125.001 17.576  272.651 1.00 114.72 ? 195 VAL B O     1 
ATOM   6385  C  CB    . VAL C 1 195 ? 123.303 18.540  275.234 1.00 95.87  ? 195 VAL B CB    1 
ATOM   6386  N  N     . MET C 1 196 ? 122.803 17.181  272.373 1.00 112.31 ? 196 MET B N     1 
ATOM   6387  C  CA    . MET C 1 196 ? 123.013 16.045  271.483 1.00 111.01 ? 196 MET B CA    1 
ATOM   6388  C  C     . MET C 1 196 ? 123.545 16.485  270.121 1.00 113.50 ? 196 MET B C     1 
ATOM   6389  O  O     . MET C 1 196 ? 124.412 15.829  269.543 1.00 111.79 ? 196 MET B O     1 
ATOM   6390  C  CB    . MET C 1 196 ? 121.719 15.245  271.316 1.00 105.84 ? 196 MET B CB    1 
ATOM   6391  C  CG    . MET C 1 196 ? 121.266 14.543  272.582 1.00 102.50 ? 196 MET B CG    1 
ATOM   6392  S  SD    . MET C 1 196 ? 119.650 13.760  272.432 1.00 134.39 ? 196 MET B SD    1 
ATOM   6393  C  CE    . MET C 1 196 ? 120.032 12.387  271.351 1.00 79.64  ? 196 MET B CE    1 
ATOM   6394  N  N     . ASP C 1 197 ? 123.026 17.598  269.614 1.00 118.32 ? 197 ASP B N     1 
ATOM   6395  C  CA    . ASP C 1 197 ? 123.454 18.107  268.314 1.00 124.48 ? 197 ASP B CA    1 
ATOM   6396  C  C     . ASP C 1 197 ? 124.882 18.648  268.341 1.00 130.32 ? 197 ASP B C     1 
ATOM   6397  O  O     . ASP C 1 197 ? 125.757 18.142  267.638 1.00 131.47 ? 197 ASP B O     1 
ATOM   6398  C  CB    . ASP C 1 197 ? 122.486 19.176  267.805 1.00 129.76 ? 197 ASP B CB    1 
ATOM   6399  C  CG    . ASP C 1 197 ? 121.140 18.601  267.415 1.00 129.10 ? 197 ASP B CG    1 
ATOM   6400  O  OD1   . ASP C 1 197 ? 121.070 17.388  267.124 1.00 122.42 ? 197 ASP B OD1   1 
ATOM   6401  O  OD2   . ASP C 1 197 ? 120.151 19.364  267.395 1.00 134.44 ? 197 ASP B OD2   1 
ATOM   6402  N  N     . ASN C 1 198 ? 125.113 19.676  269.152 1.00 132.71 ? 198 ASN B N     1 
ATOM   6403  C  CA    . ASN C 1 198 ? 126.435 20.283  269.257 1.00 130.13 ? 198 ASN B CA    1 
ATOM   6404  C  C     . ASN C 1 198 ? 127.051 20.097  270.641 1.00 135.36 ? 198 ASN B C     1 
ATOM   6405  O  O     . ASN C 1 198 ? 126.717 20.824  271.578 1.00 140.96 ? 198 ASN B O     1 
ATOM   6406  C  CB    . ASN C 1 198 ? 126.373 21.769  268.902 1.00 126.93 ? 198 ASN B CB    1 
ATOM   6407  N  N     . PRO C 1 199 ? 127.957 19.116  270.769 1.00 134.47 ? 199 PRO B N     1 
ATOM   6408  C  CA    . PRO C 1 199 ? 128.635 18.795  272.030 1.00 128.58 ? 199 PRO B CA    1 
ATOM   6409  C  C     . PRO C 1 199 ? 129.575 19.907  272.490 1.00 134.63 ? 199 PRO B C     1 
ATOM   6410  O  O     . PRO C 1 199 ? 129.960 19.934  273.658 1.00 127.94 ? 199 PRO B O     1 
ATOM   6411  C  CB    . PRO C 1 199 ? 129.443 17.539  271.682 1.00 129.86 ? 199 PRO B CB    1 
ATOM   6412  C  CG    . PRO C 1 199 ? 128.774 16.972  270.475 1.00 134.64 ? 199 PRO B CG    1 
ATOM   6413  C  CD    . PRO C 1 199 ? 128.307 18.162  269.704 1.00 138.58 ? 199 PRO B CD    1 
ATOM   6414  N  N     . GLU C 1 200 ? 129.939 20.807  271.581 1.00 144.53 ? 200 GLU B N     1 
ATOM   6415  C  CA    . GLU C 1 200 ? 130.842 21.908  271.906 1.00 142.77 ? 200 GLU B CA    1 
ATOM   6416  C  C     . GLU C 1 200 ? 130.085 23.138  272.406 1.00 149.64 ? 200 GLU B C     1 
ATOM   6417  O  O     . GLU C 1 200 ? 130.600 24.256  272.365 1.00 162.90 ? 200 GLU B O     1 
ATOM   6418  C  CB    . GLU C 1 200 ? 131.701 22.270  270.691 1.00 131.58 ? 200 GLU B CB    1 
ATOM   6419  N  N     . VAL C 1 201 ? 128.864 22.924  272.885 1.00 140.65 ? 201 VAL B N     1 
ATOM   6420  C  CA    . VAL C 1 201 ? 128.022 24.020  273.354 1.00 143.47 ? 201 VAL B CA    1 
ATOM   6421  C  C     . VAL C 1 201 ? 128.474 24.540  274.715 1.00 153.64 ? 201 VAL B C     1 
ATOM   6422  O  O     . VAL C 1 201 ? 129.140 23.835  275.472 1.00 157.35 ? 201 VAL B O     1 
ATOM   6423  C  CB    . VAL C 1 201 ? 126.542 23.601  273.439 1.00 138.83 ? 201 VAL B CB    1 
ATOM   6424  N  N     . THR C 1 202 ? 128.102 25.780  275.017 1.00 154.07 ? 202 THR B N     1 
ATOM   6425  C  CA    . THR C 1 202 ? 128.453 26.400  276.288 1.00 152.19 ? 202 THR B CA    1 
ATOM   6426  C  C     . THR C 1 202 ? 127.211 26.630  277.144 1.00 151.03 ? 202 THR B C     1 
ATOM   6427  O  O     . THR C 1 202 ? 126.110 26.220  276.777 1.00 149.80 ? 202 THR B O     1 
ATOM   6428  C  CB    . THR C 1 202 ? 129.180 27.740  276.077 1.00 153.33 ? 202 THR B CB    1 
ATOM   6429  O  OG1   . THR C 1 202 ? 128.303 28.664  275.422 1.00 150.01 ? 202 THR B OG1   1 
ATOM   6430  C  CG2   . THR C 1 202 ? 130.426 27.538  275.228 1.00 156.02 ? 202 THR B CG2   1 
ATOM   6431  N  N     . THR C 1 203 ? 127.395 27.286  278.285 1.00 150.54 ? 203 THR B N     1 
ATOM   6432  C  CA    . THR C 1 203 ? 126.299 27.529  279.217 1.00 153.59 ? 203 THR B CA    1 
ATOM   6433  C  C     . THR C 1 203 ? 125.313 28.565  278.677 1.00 153.64 ? 203 THR B C     1 
ATOM   6434  O  O     . THR C 1 203 ? 124.099 28.382  278.768 1.00 156.60 ? 203 THR B O     1 
ATOM   6435  C  CB    . THR C 1 203 ? 126.823 27.974  280.601 1.00 159.05 ? 203 THR B CB    1 
ATOM   6436  O  OG1   . THR C 1 203 ? 127.667 26.950  281.143 1.00 160.94 ? 203 THR B OG1   1 
ATOM   6437  C  CG2   . THR C 1 203 ? 125.671 28.232  281.559 1.00 152.41 ? 203 THR B CG2   1 
ATOM   6438  N  N     . LYS C 1 204 ? 125.843 29.646  278.111 1.00 144.94 ? 204 LYS B N     1 
ATOM   6439  C  CA    . LYS C 1 204 ? 125.021 30.719  277.556 1.00 135.90 ? 204 LYS B CA    1 
ATOM   6440  C  C     . LYS C 1 204 ? 124.111 30.208  276.441 1.00 143.38 ? 204 LYS B C     1 
ATOM   6441  O  O     . LYS C 1 204 ? 122.906 30.491  276.423 1.00 145.07 ? 204 LYS B O     1 
ATOM   6442  C  CB    . LYS C 1 204 ? 125.909 31.851  277.030 1.00 128.78 ? 204 LYS B CB    1 
ATOM   6443  N  N     . ASP C 1 205 ? 124.699 29.450  275.519 1.00 148.46 ? 205 ASP B N     1 
ATOM   6444  C  CA    . ASP C 1 205 ? 123.959 28.851  274.416 1.00 152.56 ? 205 ASP B CA    1 
ATOM   6445  C  C     . ASP C 1 205 ? 122.809 27.997  274.941 1.00 145.99 ? 205 ASP B C     1 
ATOM   6446  O  O     . ASP C 1 205 ? 121.706 28.026  274.398 1.00 152.97 ? 205 ASP B O     1 
ATOM   6447  C  CB    . ASP C 1 205 ? 124.887 27.998  273.544 1.00 156.16 ? 205 ASP B CB    1 
ATOM   6448  C  CG    . ASP C 1 205 ? 125.999 28.810  272.903 1.00 160.03 ? 205 ASP B CG    1 
ATOM   6449  O  OD1   . ASP C 1 205 ? 125.846 30.044  272.790 1.00 165.87 ? 205 ASP B OD1   1 
ATOM   6450  O  OD2   . ASP C 1 205 ? 127.023 28.214  272.505 1.00 155.96 ? 205 ASP B OD2   1 
ATOM   6451  N  N     . LEU C 1 206 ? 123.077 27.240  276.000 1.00 132.61 ? 206 LEU B N     1 
ATOM   6452  C  CA    . LEU C 1 206 ? 122.045 26.435  276.641 1.00 122.22 ? 206 LEU B CA    1 
ATOM   6453  C  C     . LEU C 1 206 ? 120.954 27.328  277.220 1.00 123.93 ? 206 LEU B C     1 
ATOM   6454  O  O     . LEU C 1 206 ? 119.766 27.018  277.124 1.00 126.89 ? 206 LEU B O     1 
ATOM   6455  C  CB    . LEU C 1 206 ? 122.645 25.560  277.742 1.00 116.32 ? 206 LEU B CB    1 
ATOM   6456  C  CG    . LEU C 1 206 ? 123.369 24.287  277.306 1.00 112.47 ? 206 LEU B CG    1 
ATOM   6457  C  CD1   . LEU C 1 206 ? 123.845 23.504  278.517 1.00 105.99 ? 206 LEU B CD1   1 
ATOM   6458  C  CD2   . LEU C 1 206 ? 122.455 23.436  276.443 1.00 113.64 ? 206 LEU B CD2   1 
ATOM   6459  N  N     . MET C 1 207 ? 121.366 28.446  277.810 1.00 128.20 ? 207 MET B N     1 
ATOM   6460  C  CA    . MET C 1 207 ? 120.426 29.367  278.438 1.00 133.52 ? 207 MET B CA    1 
ATOM   6461  C  C     . MET C 1 207 ? 119.570 30.100  277.411 1.00 142.41 ? 207 MET B C     1 
ATOM   6462  O  O     . MET C 1 207 ? 118.534 30.672  277.754 1.00 147.03 ? 207 MET B O     1 
ATOM   6463  C  CB    . MET C 1 207 ? 121.157 30.370  279.333 1.00 126.19 ? 207 MET B CB    1 
ATOM   6464  C  CG    . MET C 1 207 ? 121.784 29.752  280.572 1.00 112.13 ? 207 MET B CG    1 
ATOM   6465  S  SD    . MET C 1 207 ? 122.300 30.988  281.780 1.00 167.27 ? 207 MET B SD    1 
ATOM   6466  C  CE    . MET C 1 207 ? 120.728 31.751  282.173 1.00 141.59 ? 207 MET B CE    1 
ATOM   6467  N  N     . GLU C 1 208 ? 120.007 30.083  276.156 1.00 142.86 ? 208 GLU B N     1 
ATOM   6468  C  CA    . GLU C 1 208 ? 119.224 30.673  275.074 1.00 142.98 ? 208 GLU B CA    1 
ATOM   6469  C  C     . GLU C 1 208 ? 117.869 29.980  274.917 1.00 130.31 ? 208 GLU B C     1 
ATOM   6470  O  O     . GLU C 1 208 ? 116.849 30.638  274.710 1.00 126.24 ? 208 GLU B O     1 
ATOM   6471  C  CB    . GLU C 1 208 ? 119.997 30.622  273.755 1.00 149.26 ? 208 GLU B CB    1 
ATOM   6472  N  N     . VAL C 1 209 ? 117.862 28.654  275.020 1.00 127.93 ? 209 VAL B N     1 
ATOM   6473  C  CA    . VAL C 1 209 ? 116.623 27.887  274.908 1.00 131.71 ? 209 VAL B CA    1 
ATOM   6474  C  C     . VAL C 1 209 ? 116.086 27.455  276.271 1.00 135.51 ? 209 VAL B C     1 
ATOM   6475  O  O     . VAL C 1 209 ? 114.937 27.028  276.389 1.00 131.16 ? 209 VAL B O     1 
ATOM   6476  C  CB    . VAL C 1 209 ? 116.790 26.655  274.001 1.00 120.79 ? 209 VAL B CB    1 
ATOM   6477  C  CG1   . VAL C 1 209 ? 116.735 27.068  272.539 1.00 123.84 ? 209 VAL B CG1   1 
ATOM   6478  C  CG2   . VAL C 1 209 ? 118.088 25.928  274.317 1.00 104.25 ? 209 VAL B CG2   1 
ATOM   6479  N  N     . LEU C 1 210 ? 116.922 27.572  277.297 1.00 134.48 ? 210 LEU B N     1 
ATOM   6480  C  CA    . LEU C 1 210 ? 116.496 27.317  278.667 1.00 125.31 ? 210 LEU B CA    1 
ATOM   6481  C  C     . LEU C 1 210 ? 116.818 28.532  279.525 1.00 136.31 ? 210 LEU B C     1 
ATOM   6482  O  O     . LEU C 1 210 ? 117.832 28.549  280.221 1.00 143.41 ? 210 LEU B O     1 
ATOM   6483  C  CB    . LEU C 1 210 ? 117.190 26.075  279.228 1.00 111.16 ? 210 LEU B CB    1 
ATOM   6484  C  CG    . LEU C 1 210 ? 116.295 25.038  279.912 1.00 109.10 ? 210 LEU B CG    1 
ATOM   6485  C  CD1   . LEU C 1 210 ? 117.131 24.015  280.666 1.00 103.51 ? 210 LEU B CD1   1 
ATOM   6486  C  CD2   . LEU C 1 210 ? 115.284 25.701  280.837 1.00 115.39 ? 210 LEU B CD2   1 
ATOM   6487  N  N     . PRO C 1 211 ? 115.950 29.556  279.471 1.00 136.02 ? 211 PRO B N     1 
ATOM   6488  C  CA    . PRO C 1 211 ? 116.130 30.832  280.172 1.00 138.00 ? 211 PRO B CA    1 
ATOM   6489  C  C     . PRO C 1 211 ? 116.356 30.646  281.668 1.00 137.44 ? 211 PRO B C     1 
ATOM   6490  O  O     . PRO C 1 211 ? 117.229 31.293  282.245 1.00 144.92 ? 211 PRO B O     1 
ATOM   6491  C  CB    . PRO C 1 211 ? 114.795 31.547  279.939 1.00 141.78 ? 211 PRO B CB    1 
ATOM   6492  C  CG    . PRO C 1 211 ? 114.259 30.950  278.693 1.00 142.70 ? 211 PRO B CG    1 
ATOM   6493  C  CD    . PRO C 1 211 ? 114.679 29.514  278.727 1.00 135.27 ? 211 PRO B CD    1 
ATOM   6494  N  N     . GLY C 1 212 ? 115.572 29.766  282.281 1.00 125.81 ? 212 GLY B N     1 
ATOM   6495  C  CA    . GLY C 1 212 ? 115.681 29.511  283.704 1.00 116.53 ? 212 GLY B CA    1 
ATOM   6496  C  C     . GLY C 1 212 ? 114.568 28.620  284.218 1.00 114.29 ? 212 GLY B C     1 
ATOM   6497  O  O     . GLY C 1 212 ? 113.933 27.905  283.443 1.00 113.52 ? 212 GLY B O     1 
ATOM   6498  N  N     . PRO C 1 213 ? 114.325 28.658  285.535 1.00 117.77 ? 213 PRO B N     1 
ATOM   6499  C  CA    . PRO C 1 213 ? 113.300 27.832  286.180 1.00 116.69 ? 213 PRO B CA    1 
ATOM   6500  C  C     . PRO C 1 213 ? 111.894 28.228  285.749 1.00 120.36 ? 213 PRO B C     1 
ATOM   6501  O  O     . PRO C 1 213 ? 111.648 29.393  285.441 1.00 120.68 ? 213 PRO B O     1 
ATOM   6502  C  CB    . PRO C 1 213 ? 113.488 28.139  287.671 1.00 117.65 ? 213 PRO B CB    1 
ATOM   6503  C  CG    . PRO C 1 213 ? 114.866 28.706  287.784 1.00 120.76 ? 213 PRO B CG    1 
ATOM   6504  C  CD    . PRO C 1 213 ? 115.084 29.454  286.513 1.00 124.86 ? 213 PRO B CD    1 
ATOM   6505  N  N     . ASP C 1 214 ? 110.986 27.259  285.726 1.00 122.51 ? 214 ASP B N     1 
ATOM   6506  C  CA    . ASP C 1 214 ? 109.584 27.525  285.433 1.00 125.54 ? 214 ASP B CA    1 
ATOM   6507  C  C     . ASP C 1 214 ? 108.733 26.937  286.548 1.00 129.64 ? 214 ASP B C     1 
ATOM   6508  O  O     . ASP C 1 214 ? 108.401 25.751  286.530 1.00 132.13 ? 214 ASP B O     1 
ATOM   6509  C  CB    . ASP C 1 214 ? 109.184 26.918  284.088 1.00 123.16 ? 214 ASP B CB    1 
ATOM   6510  C  CG    . ASP C 1 214 ? 107.801 27.356  283.641 1.00 125.25 ? 214 ASP B CG    1 
ATOM   6511  O  OD1   . ASP C 1 214 ? 107.465 28.545  283.826 1.00 126.27 ? 214 ASP B OD1   1 
ATOM   6512  O  OD2   . ASP C 1 214 ? 107.049 26.514  283.108 1.00 129.89 ? 214 ASP B OD2   1 
ATOM   6513  N  N     . PHE C 1 215 ? 108.388 27.774  287.520 1.00 132.12 ? 215 PHE B N     1 
ATOM   6514  C  CA    . PHE C 1 215 ? 107.689 27.317  288.714 1.00 125.22 ? 215 PHE B CA    1 
ATOM   6515  C  C     . PHE C 1 215 ? 106.198 27.098  288.476 1.00 119.61 ? 215 PHE B C     1 
ATOM   6516  O  O     . PHE C 1 215 ? 105.549 27.884  287.783 1.00 122.59 ? 215 PHE B O     1 
ATOM   6517  C  CB    . PHE C 1 215 ? 107.915 28.296  289.869 1.00 122.11 ? 215 PHE B CB    1 
ATOM   6518  C  CG    . PHE C 1 215 ? 109.361 28.462  290.240 1.00 123.43 ? 215 PHE B CG    1 
ATOM   6519  C  CD1   . PHE C 1 215 ? 110.013 27.498  290.991 1.00 121.68 ? 215 PHE B CD1   1 
ATOM   6520  C  CD2   . PHE C 1 215 ? 110.069 29.579  289.830 1.00 127.01 ? 215 PHE B CD2   1 
ATOM   6521  C  CE1   . PHE C 1 215 ? 111.345 27.648  291.330 1.00 123.48 ? 215 PHE B CE1   1 
ATOM   6522  C  CE2   . PHE C 1 215 ? 111.400 29.734  290.166 1.00 129.20 ? 215 PHE B CE2   1 
ATOM   6523  C  CZ    . PHE C 1 215 ? 112.039 28.767  290.917 1.00 129.17 ? 215 PHE B CZ    1 
ATOM   6524  N  N     . PRO C 1 216 ? 105.657 26.016  289.054 1.00 114.69 ? 216 PRO B N     1 
ATOM   6525  C  CA    . PRO C 1 216 ? 104.243 25.641  288.945 1.00 119.07 ? 216 PRO B CA    1 
ATOM   6526  C  C     . PRO C 1 216 ? 103.300 26.743  289.427 1.00 121.19 ? 216 PRO B C     1 
ATOM   6527  O  O     . PRO C 1 216 ? 102.163 26.822  288.962 1.00 119.58 ? 216 PRO B O     1 
ATOM   6528  C  CB    . PRO C 1 216 ? 104.139 24.412  289.857 1.00 113.12 ? 216 PRO B CB    1 
ATOM   6529  C  CG    . PRO C 1 216 ? 105.352 24.478  290.750 1.00 109.62 ? 216 PRO B CG    1 
ATOM   6530  C  CD    . PRO C 1 216 ? 106.411 25.058  289.879 1.00 109.24 ? 216 PRO B CD    1 
ATOM   6531  N  N     . THR C 1 217 ? 103.768 27.583  290.345 1.00 127.06 ? 217 THR B N     1 
ATOM   6532  C  CA    . THR C 1 217 ? 102.960 28.688  290.842 1.00 132.81 ? 217 THR B CA    1 
ATOM   6533  C  C     . THR C 1 217 ? 103.058 29.879  289.897 1.00 135.35 ? 217 THR B C     1 
ATOM   6534  O  O     . THR C 1 217 ? 102.174 30.732  289.868 1.00 137.12 ? 217 THR B O     1 
ATOM   6535  C  CB    . THR C 1 217 ? 103.411 29.140  292.239 1.00 127.12 ? 217 THR B CB    1 
ATOM   6536  O  OG1   . THR C 1 217 ? 104.286 30.269  292.117 1.00 134.28 ? 217 THR B OG1   1 
ATOM   6537  C  CG2   . THR C 1 217 ? 104.131 28.013  292.966 1.00 119.43 ? 217 THR B CG2   1 
ATOM   6538  N  N     . GLY C 1 218 ? 104.142 29.931  289.128 1.00 129.03 ? 218 GLY B N     1 
ATOM   6539  C  CA    . GLY C 1 218 ? 104.372 31.023  288.199 1.00 127.56 ? 218 GLY B CA    1 
ATOM   6540  C  C     . GLY C 1 218 ? 105.273 32.093  288.784 1.00 127.15 ? 218 GLY B C     1 
ATOM   6541  O  O     . GLY C 1 218 ? 106.461 31.856  289.017 1.00 124.11 ? 218 GLY B O     1 
ATOM   6542  N  N     . ALA C 1 219 ? 104.701 33.272  289.014 1.00 130.25 ? 219 ALA B N     1 
ATOM   6543  C  CA    . ALA C 1 219 ? 105.410 34.393  289.633 1.00 135.29 ? 219 ALA B CA    1 
ATOM   6544  C  C     . ALA C 1 219 ? 106.645 34.836  288.849 1.00 135.39 ? 219 ALA B C     1 
ATOM   6545  O  O     . ALA C 1 219 ? 106.841 34.441  287.698 1.00 133.23 ? 219 ALA B O     1 
ATOM   6546  C  CB    . ALA C 1 219 ? 105.771 34.069  291.077 1.00 143.03 ? 219 ALA B CB    1 
ATOM   6547  N  N     . LEU C 1 220 ? 107.476 35.662  289.479 1.00 139.83 ? 220 LEU B N     1 
ATOM   6548  C  CA    . LEU C 1 220 ? 108.609 36.269  288.789 1.00 141.75 ? 220 LEU B CA    1 
ATOM   6549  C  C     . LEU C 1 220 ? 109.954 35.932  289.429 1.00 147.30 ? 220 LEU B C     1 
ATOM   6550  O  O     . LEU C 1 220 ? 110.037 35.647  290.625 1.00 149.71 ? 220 LEU B O     1 
ATOM   6551  C  CB    . LEU C 1 220 ? 108.430 37.789  288.712 1.00 134.92 ? 220 LEU B CB    1 
ATOM   6552  N  N     . VAL C 1 221 ? 111.001 35.959  288.611 1.00 153.37 ? 221 VAL B N     1 
ATOM   6553  C  CA    . VAL C 1 221 ? 112.364 35.760  289.082 1.00 158.13 ? 221 VAL B CA    1 
ATOM   6554  C  C     . VAL C 1 221 ? 113.194 36.988  288.723 1.00 167.66 ? 221 VAL B C     1 
ATOM   6555  O  O     . VAL C 1 221 ? 113.211 37.419  287.569 1.00 171.36 ? 221 VAL B O     1 
ATOM   6556  C  CB    . VAL C 1 221 ? 113.004 34.508  288.454 1.00 117.66 ? 221 VAL B CB    1 
ATOM   6557  N  N     . MET C 1 222 ? 113.873 37.553  289.717 1.00 168.06 ? 222 MET B N     1 
ATOM   6558  C  CA    . MET C 1 222 ? 114.648 38.772  289.518 1.00 167.00 ? 222 MET B CA    1 
ATOM   6559  C  C     . MET C 1 222 ? 116.140 38.483  289.356 1.00 164.96 ? 222 MET B C     1 
ATOM   6560  O  O     . MET C 1 222 ? 116.782 37.949  290.261 1.00 163.95 ? 222 MET B O     1 
ATOM   6561  C  CB    . MET C 1 222 ? 114.413 39.739  290.680 1.00 168.60 ? 222 MET B CB    1 
ATOM   6562  C  CG    . MET C 1 222 ? 112.950 40.098  290.879 1.00 136.61 ? 222 MET B CG    1 
ATOM   6563  S  SD    . MET C 1 222 ? 112.224 40.826  289.400 1.00 231.96 ? 222 MET B SD    1 
ATOM   6564  C  CE    . MET C 1 222 ? 110.491 40.834  289.843 1.00 138.96 ? 222 MET B CE    1 
ATOM   6565  N  N     . GLY C 1 223 ? 116.684 38.839  288.196 1.00 164.78 ? 223 GLY B N     1 
ATOM   6566  C  CA    . GLY C 1 223 ? 118.092 38.625  287.916 1.00 171.67 ? 223 GLY B CA    1 
ATOM   6567  C  C     . GLY C 1 223 ? 118.332 37.375  287.092 1.00 177.62 ? 223 GLY B C     1 
ATOM   6568  O  O     . GLY C 1 223 ? 117.463 36.509  286.997 1.00 179.20 ? 223 GLY B O     1 
ATOM   6569  N  N     . LYS C 1 224 ? 119.518 37.282  286.496 1.00 176.27 ? 224 LYS B N     1 
ATOM   6570  C  CA    . LYS C 1 224 ? 119.875 36.137  285.664 1.00 163.81 ? 224 LYS B CA    1 
ATOM   6571  C  C     . LYS C 1 224 ? 121.287 35.644  285.968 1.00 157.01 ? 224 LYS B C     1 
ATOM   6572  O  O     . LYS C 1 224 ? 121.631 34.495  285.674 1.00 145.79 ? 224 LYS B O     1 
ATOM   6573  C  CB    . LYS C 1 224 ? 119.747 36.493  284.181 1.00 165.11 ? 224 LYS B CB    1 
ATOM   6574  N  N     . SER C 1 225 ? 122.097 36.520  286.556 1.00 164.90 ? 225 SER B N     1 
ATOM   6575  C  CA    . SER C 1 225 ? 123.478 36.196  286.901 1.00 166.02 ? 225 SER B CA    1 
ATOM   6576  C  C     . SER C 1 225 ? 123.546 34.975  287.813 1.00 166.14 ? 225 SER B C     1 
ATOM   6577  O  O     . SER C 1 225 ? 124.367 34.075  287.610 1.00 162.89 ? 225 SER B O     1 
ATOM   6578  C  CB    . SER C 1 225 ? 124.152 37.393  287.577 1.00 160.02 ? 225 SER B CB    1 
ATOM   6579  N  N     . GLY C 1 226 ? 122.670 34.951  288.812 1.00 165.35 ? 226 GLY B N     1 
ATOM   6580  C  CA    . GLY C 1 226 ? 122.581 33.831  289.728 1.00 159.59 ? 226 GLY B CA    1 
ATOM   6581  C  C     . GLY C 1 226 ? 122.195 32.552  289.014 1.00 153.35 ? 226 GLY B C     1 
ATOM   6582  O  O     . GLY C 1 226 ? 122.670 31.470  289.360 1.00 154.96 ? 226 GLY B O     1 
ATOM   6583  N  N     . ILE C 1 227 ? 121.338 32.679  288.006 1.00 143.03 ? 227 ILE B N     1 
ATOM   6584  C  CA    . ILE C 1 227 ? 120.913 31.529  287.218 1.00 124.48 ? 227 ILE B CA    1 
ATOM   6585  C  C     . ILE C 1 227 ? 122.088 30.962  286.430 1.00 130.47 ? 227 ILE B C     1 
ATOM   6586  O  O     . ILE C 1 227 ? 122.276 29.748  286.368 1.00 129.29 ? 227 ILE B O     1 
ATOM   6587  C  CB    . ILE C 1 227 ? 119.783 31.893  286.237 1.00 116.32 ? 227 ILE B CB    1 
ATOM   6588  C  CG1   . ILE C 1 227 ? 118.691 32.698  286.940 1.00 128.11 ? 227 ILE B CG1   1 
ATOM   6589  C  CG2   . ILE C 1 227 ? 119.199 30.641  285.616 1.00 110.59 ? 227 ILE B CG2   1 
ATOM   6590  C  CD1   . ILE C 1 227 ? 117.499 33.003  286.054 1.00 113.47 ? 227 ILE B CD1   1 
ATOM   6591  N  N     . HIS C 1 228 ? 122.875 31.850  285.831 1.00 140.90 ? 228 HIS B N     1 
ATOM   6592  C  CA    . HIS C 1 228 ? 124.048 31.431  285.071 1.00 143.72 ? 228 HIS B CA    1 
ATOM   6593  C  C     . HIS C 1 228 ? 125.070 30.747  285.975 1.00 141.58 ? 228 HIS B C     1 
ATOM   6594  O  O     . HIS C 1 228 ? 125.588 29.677  285.642 1.00 140.03 ? 228 HIS B O     1 
ATOM   6595  C  CB    . HIS C 1 228 ? 124.692 32.619  284.354 1.00 152.14 ? 228 HIS B CB    1 
ATOM   6596  C  CG    . HIS C 1 228 ? 125.879 32.246  283.522 1.00 153.22 ? 228 HIS B CG    1 
ATOM   6597  N  ND1   . HIS C 1 228 ? 127.175 32.410  283.959 1.00 156.57 ? 228 HIS B ND1   1 
ATOM   6598  C  CD2   . HIS C 1 228 ? 125.964 31.708  282.283 1.00 150.15 ? 228 HIS B CD2   1 
ATOM   6599  C  CE1   . HIS C 1 228 ? 128.009 31.994  283.022 1.00 155.61 ? 228 HIS B CE1   1 
ATOM   6600  N  NE2   . HIS C 1 228 ? 127.300 31.562  281.995 1.00 151.56 ? 228 HIS B NE2   1 
ATOM   6601  N  N     . LYS C 1 229 ? 125.352 31.371  287.117 1.00 140.22 ? 229 LYS B N     1 
ATOM   6602  C  CA    . LYS C 1 229 ? 126.262 30.799  288.103 1.00 133.76 ? 229 LYS B CA    1 
ATOM   6603  C  C     . LYS C 1 229 ? 125.773 29.422  288.536 1.00 135.89 ? 229 LYS B C     1 
ATOM   6604  O  O     . LYS C 1 229 ? 126.565 28.500  288.735 1.00 134.78 ? 229 LYS B O     1 
ATOM   6605  C  CB    . LYS C 1 229 ? 126.375 31.718  289.321 1.00 123.59 ? 229 LYS B CB    1 
ATOM   6606  N  N     . ALA C 1 230 ? 124.457 29.295  288.664 1.00 134.49 ? 230 ALA B N     1 
ATOM   6607  C  CA    . ALA C 1 230 ? 123.831 28.040  289.055 1.00 128.94 ? 230 ALA B CA    1 
ATOM   6608  C  C     . ALA C 1 230 ? 124.059 26.945  288.019 1.00 132.22 ? 230 ALA B C     1 
ATOM   6609  O  O     . ALA C 1 230 ? 124.648 25.907  288.321 1.00 138.02 ? 230 ALA B O     1 
ATOM   6610  C  CB    . ALA C 1 230 ? 122.351 28.249  289.274 1.00 120.11 ? 230 ALA B CB    1 
ATOM   6611  N  N     . TYR C 1 231 ? 123.587 27.186  286.798 1.00 128.31 ? 231 TYR B N     1 
ATOM   6612  C  CA    . TYR C 1 231 ? 123.700 26.211  285.716 1.00 122.38 ? 231 TYR B CA    1 
ATOM   6613  C  C     . TYR C 1 231 ? 125.150 25.858  285.401 1.00 118.52 ? 231 TYR B C     1 
ATOM   6614  O  O     . TYR C 1 231 ? 125.439 24.760  284.927 1.00 109.70 ? 231 TYR B O     1 
ATOM   6615  C  CB    . TYR C 1 231 ? 123.005 26.725  284.451 1.00 121.63 ? 231 TYR B CB    1 
ATOM   6616  C  CG    . TYR C 1 231 ? 121.494 26.735  284.534 1.00 118.96 ? 231 TYR B CG    1 
ATOM   6617  C  CD1   . TYR C 1 231 ? 120.817 25.860  285.374 1.00 118.56 ? 231 TYR B CD1   1 
ATOM   6618  C  CD2   . TYR C 1 231 ? 120.746 27.620  283.769 1.00 117.11 ? 231 TYR B CD2   1 
ATOM   6619  C  CE1   . TYR C 1 231 ? 119.433 25.869  285.450 1.00 116.21 ? 231 TYR B CE1   1 
ATOM   6620  C  CE2   . TYR C 1 231 ? 119.367 27.634  283.837 1.00 114.35 ? 231 TYR B CE2   1 
ATOM   6621  C  CZ    . TYR C 1 231 ? 118.715 26.760  284.678 1.00 114.21 ? 231 TYR B CZ    1 
ATOM   6622  O  OH    . TYR C 1 231 ? 117.341 26.782  284.740 1.00 110.69 ? 231 TYR B OH    1 
ATOM   6623  N  N     . GLU C 1 232 ? 126.059 26.789  285.671 1.00 126.07 ? 232 GLU B N     1 
ATOM   6624  C  CA    . GLU C 1 232 ? 127.471 26.569  285.383 1.00 130.07 ? 232 GLU B CA    1 
ATOM   6625  C  C     . GLU C 1 232 ? 128.188 25.791  286.487 1.00 129.44 ? 232 GLU B C     1 
ATOM   6626  O  O     . GLU C 1 232 ? 128.997 24.909  286.202 1.00 123.10 ? 232 GLU B O     1 
ATOM   6627  C  CB    . GLU C 1 232 ? 128.184 27.901  285.129 1.00 134.34 ? 232 GLU B CB    1 
ATOM   6628  N  N     . THR C 1 233 ? 127.887 26.113  287.742 1.00 133.42 ? 233 THR B N     1 
ATOM   6629  C  CA    . THR C 1 233 ? 128.627 25.541  288.866 1.00 137.72 ? 233 THR B CA    1 
ATOM   6630  C  C     . THR C 1 233 ? 127.846 24.497  289.662 1.00 142.36 ? 233 THR B C     1 
ATOM   6631  O  O     . THR C 1 233 ? 128.433 23.703  290.397 1.00 146.14 ? 233 THR B O     1 
ATOM   6632  C  CB    . THR C 1 233 ? 129.116 26.637  289.833 1.00 144.37 ? 233 THR B CB    1 
ATOM   6633  O  OG1   . THR C 1 233 ? 127.991 27.248  290.476 1.00 149.89 ? 233 THR B OG1   1 
ATOM   6634  C  CG2   . THR C 1 233 ? 129.909 27.696  289.081 1.00 145.21 ? 233 THR B CG2   1 
ATOM   6635  N  N     . GLY C 1 234 ? 126.526 24.503  289.521 1.00 140.13 ? 234 GLY B N     1 
ATOM   6636  C  CA    . GLY C 1 234 ? 125.687 23.585  290.269 1.00 132.12 ? 234 GLY B CA    1 
ATOM   6637  C  C     . GLY C 1 234 ? 125.123 24.229  291.519 1.00 131.30 ? 234 GLY B C     1 
ATOM   6638  O  O     . GLY C 1 234 ? 124.156 23.740  292.104 1.00 134.63 ? 234 GLY B O     1 
ATOM   6639  N  N     . LYS C 1 235 ? 125.735 25.335  291.929 1.00 121.94 ? 235 LYS B N     1 
ATOM   6640  C  CA    . LYS C 1 235 ? 125.298 26.061  293.113 1.00 121.09 ? 235 LYS B CA    1 
ATOM   6641  C  C     . LYS C 1 235 ? 125.161 27.552  292.819 1.00 130.83 ? 235 LYS B C     1 
ATOM   6642  O  O     . LYS C 1 235 ? 126.039 28.153  292.197 1.00 110.31 ? 235 LYS B O     1 
ATOM   6643  C  CB    . LYS C 1 235 ? 126.271 25.834  294.272 1.00 107.15 ? 235 LYS B CB    1 
ATOM   6644  N  N     . GLY C 1 236 ? 124.055 28.146  293.262 1.00 132.14 ? 236 GLY B N     1 
ATOM   6645  C  CA    . GLY C 1 236 ? 123.807 29.555  293.009 1.00 128.73 ? 236 GLY B CA    1 
ATOM   6646  C  C     . GLY C 1 236 ? 122.677 30.139  293.834 1.00 132.37 ? 236 GLY B C     1 
ATOM   6647  O  O     . GLY C 1 236 ? 122.155 29.488  294.738 1.00 138.58 ? 236 GLY B O     1 
ATOM   6648  N  N     . SER C 1 237 ? 122.295 31.373  293.519 1.00 136.71 ? 237 SER B N     1 
ATOM   6649  C  CA    . SER C 1 237 ? 121.237 32.054  294.255 1.00 140.82 ? 237 SER B CA    1 
ATOM   6650  C  C     . SER C 1 237 ? 120.416 32.960  293.344 1.00 148.40 ? 237 SER B C     1 
ATOM   6651  O  O     . SER C 1 237 ? 120.967 33.750  292.577 1.00 150.53 ? 237 SER B O     1 
ATOM   6652  C  CB    . SER C 1 237 ? 121.826 32.865  295.412 1.00 136.90 ? 237 SER B CB    1 
ATOM   6653  N  N     . ILE C 1 238 ? 119.095 32.837  293.431 1.00 148.94 ? 238 ILE B N     1 
ATOM   6654  C  CA    . ILE C 1 238 ? 118.189 33.662  292.641 1.00 139.68 ? 238 ILE B CA    1 
ATOM   6655  C  C     . ILE C 1 238 ? 117.053 34.194  293.512 1.00 143.44 ? 238 ILE B C     1 
ATOM   6656  O  O     . ILE C 1 238 ? 116.613 33.528  294.449 1.00 141.86 ? 238 ILE B O     1 
ATOM   6657  C  CB    . ILE C 1 238 ? 117.602 32.876  291.451 1.00 117.81 ? 238 ILE B CB    1 
ATOM   6658  N  N     . VAL C 1 239 ? 116.585 35.398  293.202 1.00 144.88 ? 239 VAL B N     1 
ATOM   6659  C  CA    . VAL C 1 239 ? 115.508 36.021  293.963 1.00 147.34 ? 239 VAL B CA    1 
ATOM   6660  C  C     . VAL C 1 239 ? 114.159 35.807  293.281 1.00 150.03 ? 239 VAL B C     1 
ATOM   6661  O  O     . VAL C 1 239 ? 114.058 35.853  292.055 1.00 159.19 ? 239 VAL B O     1 
ATOM   6662  C  CB    . VAL C 1 239 ? 115.755 37.532  294.160 1.00 139.27 ? 239 VAL B CB    1 
ATOM   6663  N  N     . LEU C 1 240 ? 113.129 35.565  294.085 1.00 137.18 ? 240 LEU B N     1 
ATOM   6664  C  CA    . LEU C 1 240 ? 111.785 35.316  293.572 1.00 134.93 ? 240 LEU B CA    1 
ATOM   6665  C  C     . LEU C 1 240 ? 110.788 36.324  294.137 1.00 146.62 ? 240 LEU B C     1 
ATOM   6666  O  O     . LEU C 1 240 ? 110.817 36.638  295.327 1.00 158.04 ? 240 LEU B O     1 
ATOM   6667  C  CB    . LEU C 1 240 ? 111.333 33.893  293.908 1.00 132.25 ? 240 LEU B CB    1 
ATOM   6668  C  CG    . LEU C 1 240 ? 111.746 32.747  292.979 1.00 128.19 ? 240 LEU B CG    1 
ATOM   6669  C  CD1   . LEU C 1 240 ? 113.248 32.504  293.000 1.00 130.98 ? 240 LEU B CD1   1 
ATOM   6670  C  CD2   . LEU C 1 240 ? 110.995 31.478  293.350 1.00 120.70 ? 240 LEU B CD2   1 
ATOM   6671  N  N     . ARG C 1 241 ? 109.906 36.826  293.277 1.00 150.58 ? 241 ARG B N     1 
ATOM   6672  C  CA    . ARG C 1 241 ? 108.902 37.805  293.685 1.00 148.88 ? 241 ARG B CA    1 
ATOM   6673  C  C     . ARG C 1 241 ? 107.511 37.447  293.164 1.00 147.55 ? 241 ARG B C     1 
ATOM   6674  O  O     . ARG C 1 241 ? 107.369 36.682  292.209 1.00 156.35 ? 241 ARG B O     1 
ATOM   6675  C  CB    . ARG C 1 241 ? 109.300 39.208  293.219 1.00 131.84 ? 241 ARG B CB    1 
ATOM   6676  N  N     . SER C 1 242 ? 106.491 38.017  293.798 1.00 139.31 ? 242 SER B N     1 
ATOM   6677  C  CA    . SER C 1 242 ? 105.102 37.713  293.475 1.00 133.26 ? 242 SER B CA    1 
ATOM   6678  C  C     . SER C 1 242 ? 104.605 38.492  292.259 1.00 131.33 ? 242 SER B C     1 
ATOM   6679  O  O     . SER C 1 242 ? 105.098 39.582  291.966 1.00 131.17 ? 242 SER B O     1 
ATOM   6680  C  CB    . SER C 1 242 ? 104.208 38.017  294.678 1.00 126.56 ? 242 SER B CB    1 
ATOM   6681  O  OG    . SER C 1 242 ? 104.697 37.386  295.847 1.00 134.27 ? 242 SER B OG    1 
ATOM   6682  N  N     . ARG C 1 243 ? 103.630 37.925  291.554 1.00 130.99 ? 243 ARG B N     1 
ATOM   6683  C  CA    . ARG C 1 243 ? 102.987 38.614  290.439 1.00 138.26 ? 243 ARG B CA    1 
ATOM   6684  C  C     . ARG C 1 243 ? 101.731 39.331  290.928 1.00 140.18 ? 243 ARG B C     1 
ATOM   6685  O  O     . ARG C 1 243 ? 100.779 38.693  291.396 1.00 133.69 ? 243 ARG B O     1 
ATOM   6686  C  CB    . ARG C 1 243 ? 102.647 37.637  289.313 1.00 135.57 ? 243 ARG B CB    1 
ATOM   6687  N  N     . THR C 1 244 ? 101.747 40.659  290.810 1.00 146.50 ? 244 THR B N     1 
ATOM   6688  C  CA    . THR C 1 244 ? 100.727 41.524  291.398 1.00 143.69 ? 244 THR B CA    1 
ATOM   6689  C  C     . THR C 1 244 ? 100.147 42.522  290.397 1.00 155.66 ? 244 THR B C     1 
ATOM   6690  O  O     . THR C 1 244 ? 100.542 42.550  289.231 1.00 169.15 ? 244 THR B O     1 
ATOM   6691  C  CB    . THR C 1 244 ? 101.313 42.343  292.562 1.00 137.01 ? 244 THR B CB    1 
ATOM   6692  O  OG1   . THR C 1 244 ? 102.223 43.322  292.045 1.00 133.72 ? 244 THR B OG1   1 
ATOM   6693  C  CG2   . THR C 1 244 ? 102.051 41.443  293.539 1.00 129.79 ? 244 THR B CG2   1 
ATOM   6694  N  N     . GLU C 1 245 ? 99.217  43.347  290.877 1.00 154.62 ? 245 GLU B N     1 
ATOM   6695  C  CA    . GLU C 1 245 ? 98.608  44.415  290.084 1.00 158.32 ? 245 GLU B CA    1 
ATOM   6696  C  C     . GLU C 1 245 ? 97.761  45.327  290.973 1.00 138.54 ? 245 GLU B C     1 
ATOM   6697  O  O     . GLU C 1 245 ? 96.952  44.849  291.769 1.00 156.89 ? 245 GLU B O     1 
ATOM   6698  C  CB    . GLU C 1 245 ? 97.749  43.835  288.957 1.00 140.59 ? 245 GLU B CB    1 
ATOM   6699  N  N     . ILE C 1 246 ? 97.949  46.637  290.833 1.00 165.23 ? 246 ILE B N     1 
ATOM   6700  C  CA    . ILE C 1 246 ? 97.211  47.617  291.630 1.00 169.42 ? 246 ILE B CA    1 
ATOM   6701  C  C     . ILE C 1 246 ? 96.010  48.179  290.867 1.00 171.16 ? 246 ILE B C     1 
ATOM   6702  O  O     . ILE C 1 246 ? 96.155  49.060  290.017 1.00 176.02 ? 246 ILE B O     1 
ATOM   6703  C  CB    . ILE C 1 246 ? 98.120  48.778  292.078 1.00 142.83 ? 246 ILE B CB    1 
ATOM   6704  N  N     . GLU C 1 247 ? 94.826  47.667  291.186 1.00 168.79 ? 247 GLU B N     1 
ATOM   6705  C  CA    . GLU C 1 247 ? 93.607  48.041  290.478 1.00 167.45 ? 247 GLU B CA    1 
ATOM   6706  C  C     . GLU C 1 247 ? 93.003  49.349  290.985 1.00 171.82 ? 247 GLU B C     1 
ATOM   6707  O  O     . GLU C 1 247 ? 93.639  50.097  291.729 1.00 169.78 ? 247 GLU B O     1 
ATOM   6708  C  CB    . GLU C 1 247 ? 92.570  46.917  290.573 1.00 159.52 ? 247 GLU B CB    1 
ATOM   6709  N  N     . THR C 1 248 ? 91.768  49.611  290.569 1.00 175.50 ? 248 THR B N     1 
ATOM   6710  C  CA    . THR C 1 248 ? 91.047  50.814  290.970 1.00 171.18 ? 248 THR B CA    1 
ATOM   6711  C  C     . THR C 1 248 ? 89.622  50.463  291.394 1.00 174.38 ? 248 THR B C     1 
ATOM   6712  O  O     . THR C 1 248 ? 88.908  49.758  290.681 1.00 179.84 ? 248 THR B O     1 
ATOM   6713  C  CB    . THR C 1 248 ? 91.010  51.854  289.832 1.00 161.08 ? 248 THR B CB    1 
ATOM   6714  O  OG1   . THR C 1 248 ? 92.345  52.268  289.520 1.00 158.09 ? 248 THR B OG1   1 
ATOM   6715  C  CG2   . THR C 1 248 ? 90.194  53.070  290.239 1.00 160.21 ? 248 THR B CG2   1 
ATOM   6716  N  N     . THR C 1 249 ? 89.214  50.961  292.557 1.00 169.93 ? 249 THR B N     1 
ATOM   6717  C  CA    . THR C 1 249 ? 87.908  50.635  293.120 1.00 170.68 ? 249 THR B CA    1 
ATOM   6718  C  C     . THR C 1 249 ? 86.787  51.495  292.545 1.00 178.99 ? 249 THR B C     1 
ATOM   6719  O  O     . THR C 1 249 ? 87.038  52.499  291.880 1.00 182.76 ? 249 THR B O     1 
ATOM   6720  C  CB    . THR C 1 249 ? 87.907  50.791  294.652 1.00 171.96 ? 249 THR B CB    1 
ATOM   6721  O  OG1   . THR C 1 249 ? 88.141  52.163  294.995 1.00 175.70 ? 249 THR B OG1   1 
ATOM   6722  C  CG2   . THR C 1 249 ? 88.994  49.929  295.274 1.00 169.17 ? 249 THR B CG2   1 
ATOM   6723  N  N     . LYS C 1 250 ? 85.549  51.092  292.814 1.00 181.53 ? 250 LYS B N     1 
ATOM   6724  C  CA    . LYS C 1 250 ? 84.377  51.840  292.372 1.00 181.59 ? 250 LYS B CA    1 
ATOM   6725  C  C     . LYS C 1 250 ? 84.214  53.118  293.190 1.00 182.15 ? 250 LYS B C     1 
ATOM   6726  O  O     . LYS C 1 250 ? 83.503  54.038  292.787 1.00 185.75 ? 250 LYS B O     1 
ATOM   6727  C  CB    . LYS C 1 250 ? 83.117  50.979  292.482 1.00 164.75 ? 250 LYS B CB    1 
ATOM   6728  N  N     . THR C 1 251 ? 84.872  53.162  294.344 1.00 181.38 ? 251 THR B N     1 
ATOM   6729  C  CA    . THR C 1 251 ? 84.876  54.354  295.180 1.00 166.51 ? 251 THR B CA    1 
ATOM   6730  C  C     . THR C 1 251 ? 85.903  55.353  294.660 1.00 179.47 ? 251 THR B C     1 
ATOM   6731  O  O     . THR C 1 251 ? 85.875  56.533  295.013 1.00 181.33 ? 251 THR B O     1 
ATOM   6732  C  CB    . THR C 1 251 ? 85.197  54.015  296.646 1.00 164.58 ? 251 THR B CB    1 
ATOM   6733  N  N     . GLY C 1 252 ? 86.810  54.869  293.816 1.00 178.97 ? 252 GLY B N     1 
ATOM   6734  C  CA    . GLY C 1 252 ? 87.833  55.709  293.222 1.00 179.11 ? 252 GLY B CA    1 
ATOM   6735  C  C     . GLY C 1 252 ? 89.129  55.721  294.011 1.00 175.41 ? 252 GLY B C     1 
ATOM   6736  O  O     . GLY C 1 252 ? 89.764  56.765  294.156 1.00 177.12 ? 252 GLY B O     1 
ATOM   6737  N  N     . ARG C 1 253 ? 89.527  54.557  294.515 1.00 172.07 ? 253 ARG B N     1 
ATOM   6738  C  CA    . ARG C 1 253 ? 90.743  54.446  295.314 1.00 169.12 ? 253 ARG B CA    1 
ATOM   6739  C  C     . ARG C 1 253 ? 91.739  53.468  294.695 1.00 172.10 ? 253 ARG B C     1 
ATOM   6740  O  O     . ARG C 1 253 ? 91.679  53.180  293.499 1.00 172.30 ? 253 ARG B O     1 
ATOM   6741  C  CB    . ARG C 1 253 ? 90.404  54.013  296.743 1.00 159.47 ? 253 ARG B CB    1 
ATOM   6742  N  N     . GLU C 1 254 ? 92.657  52.968  295.516 1.00 172.66 ? 254 GLU B N     1 
ATOM   6743  C  CA    . GLU C 1 254 ? 93.644  51.993  295.065 1.00 165.76 ? 254 GLU B CA    1 
ATOM   6744  C  C     . GLU C 1 254 ? 93.361  50.628  295.681 1.00 167.64 ? 254 GLU B C     1 
ATOM   6745  O  O     . GLU C 1 254 ? 92.654  50.526  296.685 1.00 175.83 ? 254 GLU B O     1 
ATOM   6746  C  CB    . GLU C 1 254 ? 95.059  52.452  295.422 1.00 162.21 ? 254 GLU B CB    1 
ATOM   6747  N  N     . ARG C 1 255 ? 93.917  49.580  295.080 1.00 162.92 ? 255 ARG B N     1 
ATOM   6748  C  CA    . ARG C 1 255 ? 93.651  48.217  295.527 1.00 154.18 ? 255 ARG B CA    1 
ATOM   6749  C  C     . ARG C 1 255 ? 94.749  47.261  295.064 1.00 159.02 ? 255 ARG B C     1 
ATOM   6750  O  O     . ARG C 1 255 ? 94.702  46.747  293.946 1.00 161.10 ? 255 ARG B O     1 
ATOM   6751  C  CB    . ARG C 1 255 ? 92.295  47.750  294.995 1.00 151.60 ? 255 ARG B CB    1 
ATOM   6752  C  CG    . ARG C 1 255 ? 91.767  46.492  295.653 1.00 155.16 ? 255 ARG B CG    1 
ATOM   6753  C  CD    . ARG C 1 255 ? 90.831  45.731  294.725 1.00 162.71 ? 255 ARG B CD    1 
ATOM   6754  N  NE    . ARG C 1 255 ? 89.632  46.489  294.380 1.00 169.49 ? 255 ARG B NE    1 
ATOM   6755  C  CZ    . ARG C 1 255 ? 88.467  46.368  295.008 1.00 172.10 ? 255 ARG B CZ    1 
ATOM   6756  N  NH1   . ARG C 1 255 ? 88.342  45.519  296.020 1.00 169.94 ? 255 ARG B NH1   1 
ATOM   6757  N  NH2   . ARG C 1 255 ? 87.427  47.094  294.624 1.00 173.49 ? 255 ARG B NH2   1 
ATOM   6758  N  N     . ILE C 1 256 ? 95.732  47.021  295.926 1.00 161.30 ? 256 ILE B N     1 
ATOM   6759  C  CA    . ILE C 1 256 ? 96.867  46.169  295.577 1.00 161.76 ? 256 ILE B CA    1 
ATOM   6760  C  C     . ILE C 1 256 ? 96.510  44.686  295.652 1.00 156.49 ? 256 ILE B C     1 
ATOM   6761  O  O     . ILE C 1 256 ? 96.381  44.124  296.738 1.00 162.76 ? 256 ILE B O     1 
ATOM   6762  C  CB    . ILE C 1 256 ? 98.082  46.445  296.485 1.00 134.72 ? 256 ILE B CB    1 
ATOM   6763  N  N     . VAL C 1 257 ? 96.361  44.056  294.492 1.00 145.60 ? 257 VAL B N     1 
ATOM   6764  C  CA    . VAL C 1 257 ? 95.949  42.657  294.431 1.00 148.18 ? 257 VAL B CA    1 
ATOM   6765  C  C     . VAL C 1 257 ? 97.069  41.753  293.923 1.00 150.89 ? 257 VAL B C     1 
ATOM   6766  O  O     . VAL C 1 257 ? 97.622  41.978  292.847 1.00 155.83 ? 257 VAL B O     1 
ATOM   6767  C  CB    . VAL C 1 257 ? 94.708  42.481  293.533 1.00 147.92 ? 257 VAL B CB    1 
ATOM   6768  C  CG1   . VAL C 1 257 ? 94.235  41.035  293.557 1.00 133.95 ? 257 VAL B CG1   1 
ATOM   6769  C  CG2   . VAL C 1 257 ? 93.597  43.419  293.978 1.00 143.50 ? 257 VAL B CG2   1 
ATOM   6770  N  N     . VAL C 1 258 ? 97.397  40.730  294.707 1.00 148.37 ? 258 VAL B N     1 
ATOM   6771  C  CA    . VAL C 1 258 ? 98.415  39.758  294.327 1.00 150.10 ? 258 VAL B CA    1 
ATOM   6772  C  C     . VAL C 1 258 ? 97.765  38.538  293.681 1.00 153.45 ? 258 VAL B C     1 
ATOM   6773  O  O     . VAL C 1 258 ? 96.811  37.977  294.221 1.00 154.82 ? 258 VAL B O     1 
ATOM   6774  C  CB    . VAL C 1 258 ? 99.228  39.296  295.549 1.00 140.05 ? 258 VAL B CB    1 
ATOM   6775  C  CG1   . VAL C 1 258 ? 100.298 38.293  295.138 1.00 131.94 ? 258 VAL B CG1   1 
ATOM   6776  C  CG2   . VAL C 1 258 ? 99.844  40.494  296.259 1.00 130.19 ? 258 VAL B CG2   1 
ATOM   6777  N  N     . THR C 1 259 ? 98.286  38.124  292.530 1.00 151.26 ? 259 THR B N     1 
ATOM   6778  C  CA    . THR C 1 259 ? 97.701  37.007  291.797 1.00 153.60 ? 259 THR B CA    1 
ATOM   6779  C  C     . THR C 1 259 ? 98.572  35.752  291.813 1.00 153.72 ? 259 THR B C     1 
ATOM   6780  O  O     . THR C 1 259 ? 98.056  34.639  291.713 1.00 145.98 ? 259 THR B O     1 
ATOM   6781  C  CB    . THR C 1 259 ? 97.386  37.388  290.337 1.00 155.36 ? 259 THR B CB    1 
ATOM   6782  O  OG1   . THR C 1 259 ? 98.607  37.642  289.632 1.00 161.07 ? 259 THR B OG1   1 
ATOM   6783  C  CG2   . THR C 1 259 ? 96.507  38.629  290.288 1.00 151.97 ? 259 THR B CG2   1 
ATOM   6784  N  N     . GLU C 1 260 ? 99.887  35.919  291.933 1.00 155.04 ? 260 GLU B N     1 
ATOM   6785  C  CA    . GLU C 1 260 ? 100.769 34.749  291.955 1.00 147.82 ? 260 GLU B CA    1 
ATOM   6786  C  C     . GLU C 1 260 ? 101.814 34.785  293.071 1.00 147.29 ? 260 GLU B C     1 
ATOM   6787  O  O     . GLU C 1 260 ? 102.673 35.662  293.099 1.00 128.69 ? 260 GLU B O     1 
ATOM   6788  C  CB    . GLU C 1 260 ? 101.449 34.549  290.594 1.00 147.42 ? 260 GLU B CB    1 
ATOM   6789  C  CG    . GLU C 1 260 ? 100.492 34.207  289.457 1.00 151.14 ? 260 GLU B CG    1 
ATOM   6790  C  CD    . GLU C 1 260 ? 101.198 34.005  288.128 1.00 153.98 ? 260 GLU B CD    1 
ATOM   6791  O  OE1   . GLU C 1 260 ? 102.398 33.657  288.134 1.00 151.50 ? 260 GLU B OE1   1 
ATOM   6792  O  OE2   . GLU C 1 260 ? 100.552 34.198  287.076 1.00 144.24 ? 260 GLU B OE2   1 
ATOM   6793  N  N     . PHE C 1 261 ? 101.734 33.819  293.984 1.00 146.68 ? 261 PHE B N     1 
ATOM   6794  C  CA    . PHE C 1 261 ? 102.706 33.690  295.068 1.00 142.61 ? 261 PHE B CA    1 
ATOM   6795  C  C     . PHE C 1 261 ? 103.880 32.806  294.650 1.00 140.85 ? 261 PHE B C     1 
ATOM   6796  O  O     . PHE C 1 261 ? 103.712 31.894  293.839 1.00 152.09 ? 261 PHE B O     1 
ATOM   6797  C  CB    . PHE C 1 261 ? 102.042 33.127  296.328 1.00 141.03 ? 261 PHE B CB    1 
ATOM   6798  C  CG    . PHE C 1 261 ? 101.147 34.106  297.031 1.00 133.27 ? 261 PHE B CG    1 
ATOM   6799  C  CD1   . PHE C 1 261 ? 99.801  34.182  296.715 1.00 132.86 ? 261 PHE B CD1   1 
ATOM   6800  C  CD2   . PHE C 1 261 ? 101.651 34.953  298.004 1.00 124.63 ? 261 PHE B CD2   1 
ATOM   6801  C  CE1   . PHE C 1 261 ? 98.973  35.083  297.358 1.00 132.33 ? 261 PHE B CE1   1 
ATOM   6802  C  CE2   . PHE C 1 261 ? 100.828 35.856  298.651 1.00 131.24 ? 261 PHE B CE2   1 
ATOM   6803  C  CZ    . PHE C 1 261 ? 99.489  35.921  298.328 1.00 134.35 ? 261 PHE B CZ    1 
ATOM   6804  N  N     . PRO C 1 262 ? 105.077 33.078  295.201 1.00 135.94 ? 262 PRO B N     1 
ATOM   6805  C  CA    . PRO C 1 262 ? 106.298 32.331  294.870 1.00 127.68 ? 262 PRO B CA    1 
ATOM   6806  C  C     . PRO C 1 262 ? 106.216 30.838  295.184 1.00 140.34 ? 262 PRO B C     1 
ATOM   6807  O  O     . PRO C 1 262 ? 105.244 30.367  295.774 1.00 138.31 ? 262 PRO B O     1 
ATOM   6808  C  CB    . PRO C 1 262 ? 107.359 32.989  295.758 1.00 126.48 ? 262 PRO B CB    1 
ATOM   6809  C  CG    . PRO C 1 262 ? 106.850 34.372  295.986 1.00 125.59 ? 262 PRO B CG    1 
ATOM   6810  C  CD    . PRO C 1 262 ? 105.361 34.221  296.088 1.00 125.15 ? 262 PRO B CD    1 
ATOM   6811  N  N     . TYR C 1 263 ? 107.256 30.109  294.792 1.00 141.76 ? 263 TYR B N     1 
ATOM   6812  C  CA    . TYR C 1 263 ? 107.320 28.661  294.969 1.00 144.26 ? 263 TYR B CA    1 
ATOM   6813  C  C     . TYR C 1 263 ? 107.364 28.271  296.445 1.00 141.49 ? 263 TYR B C     1 
ATOM   6814  O  O     . TYR C 1 263 ? 108.071 28.893  297.236 1.00 135.93 ? 263 TYR B O     1 
ATOM   6815  C  CB    . TYR C 1 263 ? 108.542 28.111  294.230 1.00 145.31 ? 263 TYR B CB    1 
ATOM   6816  C  CG    . TYR C 1 263 ? 108.648 26.604  294.201 1.00 136.31 ? 263 TYR B CG    1 
ATOM   6817  C  CD1   . TYR C 1 263 ? 107.599 25.821  293.736 1.00 161.88 ? 263 TYR B CD1   1 
ATOM   6818  C  CD2   . TYR C 1 263 ? 109.809 25.964  294.614 1.00 137.06 ? 263 TYR B CD2   1 
ATOM   6819  C  CE1   . TYR C 1 263 ? 107.698 24.443  293.700 1.00 163.86 ? 263 TYR B CE1   1 
ATOM   6820  C  CE2   . TYR C 1 263 ? 109.918 24.587  294.580 1.00 139.89 ? 263 TYR B CE2   1 
ATOM   6821  C  CZ    . TYR C 1 263 ? 108.860 23.831  294.122 1.00 142.29 ? 263 TYR B CZ    1 
ATOM   6822  O  OH    . TYR C 1 263 ? 108.964 22.460  294.086 1.00 165.48 ? 263 TYR B OH    1 
ATOM   6823  N  N     . MET C 1 264 ? 106.598 27.241  296.799 1.00 146.92 ? 264 MET B N     1 
ATOM   6824  C  CA    . MET C 1 264 ? 106.507 26.749  298.176 1.00 155.17 ? 264 MET B CA    1 
ATOM   6825  C  C     . MET C 1 264 ? 106.127 27.837  299.182 1.00 151.78 ? 264 MET B C     1 
ATOM   6826  O  O     . MET C 1 264 ? 106.646 27.870  300.297 1.00 156.14 ? 264 MET B O     1 
ATOM   6827  C  CB    . MET C 1 264 ? 107.814 26.076  298.609 1.00 131.37 ? 264 MET B CB    1 
ATOM   6828  C  CG    . MET C 1 264 ? 108.177 24.829  297.824 1.00 134.51 ? 264 MET B CG    1 
ATOM   6829  S  SD    . MET C 1 264 ? 109.632 24.021  298.517 1.00 153.53 ? 264 MET B SD    1 
ATOM   6830  C  CE    . MET C 1 264 ? 110.777 25.398  298.568 1.00 151.61 ? 264 MET B CE    1 
ATOM   6831  N  N     . VAL C 1 265 ? 105.217 28.720  298.783 1.00 141.26 ? 265 VAL B N     1 
ATOM   6832  C  CA    . VAL C 1 265 ? 104.777 29.811  299.646 1.00 130.76 ? 265 VAL B CA    1 
ATOM   6833  C  C     . VAL C 1 265 ? 103.278 29.735  299.923 1.00 128.08 ? 265 VAL B C     1 
ATOM   6834  O  O     . VAL C 1 265 ? 102.470 29.631  298.999 1.00 132.19 ? 265 VAL B O     1 
ATOM   6835  C  CB    . VAL C 1 265 ? 105.124 31.187  299.038 1.00 124.50 ? 265 VAL B CB    1 
ATOM   6836  C  CG1   . VAL C 1 265 ? 104.345 32.298  299.729 1.00 123.44 ? 265 VAL B CG1   1 
ATOM   6837  C  CG2   . VAL C 1 265 ? 106.624 31.437  299.122 1.00 126.10 ? 265 VAL B CG2   1 
ATOM   6838  N  N     . ASN C 1 266 ? 102.914 29.786  301.200 1.00 128.33 ? 266 ASN B N     1 
ATOM   6839  C  CA    . ASN C 1 266 ? 101.517 29.710  301.605 1.00 134.23 ? 266 ASN B CA    1 
ATOM   6840  C  C     . ASN C 1 266 ? 100.871 31.092  301.672 1.00 136.03 ? 266 ASN B C     1 
ATOM   6841  O  O     . ASN C 1 266 ? 101.351 31.978  302.380 1.00 133.68 ? 266 ASN B O     1 
ATOM   6842  C  CB    . ASN C 1 266 ? 101.405 29.008  302.960 1.00 127.00 ? 266 ASN B CB    1 
ATOM   6843  C  CG    . ASN C 1 266 ? 100.037 28.399  303.193 1.00 145.71 ? 266 ASN B CG    1 
ATOM   6844  O  OD1   . ASN C 1 266 ? 99.014  28.997  302.865 1.00 128.95 ? 266 ASN B OD1   1 
ATOM   6845  N  ND2   . ASN C 1 266 ? 100.013 27.199  303.758 1.00 130.82 ? 266 ASN B ND2   1 
ATOM   6846  N  N     . LYS C 1 267 ? 99.780  31.271  300.930 1.00 138.81 ? 267 LYS B N     1 
ATOM   6847  C  CA    . LYS C 1 267 ? 99.042  32.530  300.937 1.00 138.60 ? 267 LYS B CA    1 
ATOM   6848  C  C     . LYS C 1 267 ? 98.436  32.789  302.314 1.00 140.63 ? 267 LYS B C     1 
ATOM   6849  O  O     . LYS C 1 267 ? 98.358  33.930  302.768 1.00 137.94 ? 267 LYS B O     1 
ATOM   6850  C  CB    . LYS C 1 267 ? 97.945  32.514  299.871 1.00 135.66 ? 267 LYS B CB    1 
ATOM   6851  N  N     . THR C 1 268 ? 98.011  31.715  302.973 1.00 144.83 ? 268 THR B N     1 
ATOM   6852  C  CA    . THR C 1 268 ? 97.431  31.807  304.308 1.00 145.07 ? 268 THR B CA    1 
ATOM   6853  C  C     . THR C 1 268 ? 98.469  32.239  305.340 1.00 141.15 ? 268 THR B C     1 
ATOM   6854  O  O     . THR C 1 268 ? 98.217  33.133  306.146 1.00 131.32 ? 268 THR B O     1 
ATOM   6855  C  CB    . THR C 1 268 ? 96.800  30.468  304.741 1.00 145.24 ? 268 THR B CB    1 
ATOM   6856  O  OG1   . THR C 1 268 ? 95.623  30.221  303.963 1.00 145.94 ? 268 THR B OG1   1 
ATOM   6857  C  CG2   . THR C 1 268 ? 96.427  30.499  306.215 1.00 146.93 ? 268 THR B CG2   1 
ATOM   6858  N  N     . LYS C 1 269 ? 99.636  31.602  305.308 1.00 144.41 ? 269 LYS B N     1 
ATOM   6859  C  CA    . LYS C 1 269 ? 100.719 31.939  306.226 1.00 142.42 ? 269 LYS B CA    1 
ATOM   6860  C  C     . LYS C 1 269 ? 101.185 33.375  306.010 1.00 150.62 ? 269 LYS B C     1 
ATOM   6861  O  O     . LYS C 1 269 ? 101.496 34.088  306.965 1.00 156.01 ? 269 LYS B O     1 
ATOM   6862  C  CB    . LYS C 1 269 ? 101.892 30.974  306.051 1.00 130.04 ? 269 LYS B CB    1 
ATOM   6863  N  N     . VAL C 1 270 ? 101.228 33.788  304.747 1.00 153.42 ? 270 VAL B N     1 
ATOM   6864  C  CA    . VAL C 1 270 ? 101.596 35.152  304.391 1.00 156.63 ? 270 VAL B CA    1 
ATOM   6865  C  C     . VAL C 1 270 ? 100.552 36.127  304.918 1.00 164.62 ? 270 VAL B C     1 
ATOM   6866  O  O     . VAL C 1 270 ? 100.880 37.232  305.343 1.00 169.98 ? 270 VAL B O     1 
ATOM   6867  C  CB    . VAL C 1 270 ? 101.718 35.322  302.867 1.00 147.79 ? 270 VAL B CB    1 
ATOM   6868  N  N     . HIS C 1 271 ? 99.294  35.703  304.881 1.00 163.75 ? 271 HIS B N     1 
ATOM   6869  C  CA    . HIS C 1 271 ? 98.190  36.494  305.409 1.00 155.72 ? 271 HIS B CA    1 
ATOM   6870  C  C     . HIS C 1 271 ? 98.378  36.696  306.912 1.00 158.25 ? 271 HIS B C     1 
ATOM   6871  O  O     . HIS C 1 271 ? 98.323  37.824  307.413 1.00 160.91 ? 271 HIS B O     1 
ATOM   6872  C  CB    . HIS C 1 271 ? 96.863  35.787  305.118 1.00 154.77 ? 271 HIS B CB    1 
ATOM   6873  C  CG    . HIS C 1 271 ? 95.649  36.603  305.436 1.00 153.91 ? 271 HIS B CG    1 
ATOM   6874  N  ND1   . HIS C 1 271 ? 95.701  37.778  306.156 1.00 160.17 ? 271 HIS B ND1   1 
ATOM   6875  C  CD2   . HIS C 1 271 ? 94.345  36.412  305.127 1.00 151.85 ? 271 HIS B CD2   1 
ATOM   6876  C  CE1   . HIS C 1 271 ? 94.484  38.272  306.278 1.00 161.44 ? 271 HIS B CE1   1 
ATOM   6877  N  NE2   . HIS C 1 271 ? 93.641  37.462  305.662 1.00 156.55 ? 271 HIS B NE2   1 
ATOM   6878  N  N     . GLU C 1 272 ? 98.608  35.593  307.620 1.00 160.18 ? 272 GLU B N     1 
ATOM   6879  C  CA    . GLU C 1 272 ? 98.811  35.618  309.065 1.00 158.60 ? 272 GLU B CA    1 
ATOM   6880  C  C     . GLU C 1 272 ? 99.988  36.505  309.458 1.00 163.84 ? 272 GLU B C     1 
ATOM   6881  O  O     . GLU C 1 272 ? 99.877  37.330  310.367 1.00 169.86 ? 272 GLU B O     1 
ATOM   6882  C  CB    . GLU C 1 272 ? 99.034  34.200  309.598 1.00 154.02 ? 272 GLU B CB    1 
ATOM   6883  C  CG    . GLU C 1 272 ? 97.874  33.246  309.368 1.00 154.77 ? 272 GLU B CG    1 
ATOM   6884  C  CD    . GLU C 1 272 ? 98.195  31.828  309.799 1.00 159.63 ? 272 GLU B CD    1 
ATOM   6885  O  OE1   . GLU C 1 272 ? 99.356  31.569  310.182 1.00 159.11 ? 272 GLU B OE1   1 
ATOM   6886  O  OE2   . GLU C 1 272 ? 97.287  30.971  309.754 1.00 162.38 ? 272 GLU B OE2   1 
ATOM   6887  N  N     . HIS C 1 273 ? 101.113 36.333  308.771 1.00 162.38 ? 273 HIS B N     1 
ATOM   6888  C  CA    . HIS C 1 273 ? 102.315 37.104  309.070 1.00 166.20 ? 273 HIS B CA    1 
ATOM   6889  C  C     . HIS C 1 273 ? 102.123 38.583  308.745 1.00 164.43 ? 273 HIS B C     1 
ATOM   6890  O  O     . HIS C 1 273 ? 102.662 39.454  309.432 1.00 164.03 ? 273 HIS B O     1 
ATOM   6891  C  CB    . HIS C 1 273 ? 103.516 36.546  308.305 1.00 166.74 ? 273 HIS B CB    1 
ATOM   6892  C  CG    . HIS C 1 273 ? 104.820 37.168  308.695 1.00 168.52 ? 273 HIS B CG    1 
ATOM   6893  N  ND1   . HIS C 1 273 ? 105.393 38.202  307.986 1.00 169.23 ? 273 HIS B ND1   1 
ATOM   6894  C  CD2   . HIS C 1 273 ? 105.662 36.907  309.723 1.00 170.38 ? 273 HIS B CD2   1 
ATOM   6895  C  CE1   . HIS C 1 273 ? 106.532 38.548  308.558 1.00 174.23 ? 273 HIS B CE1   1 
ATOM   6896  N  NE2   . HIS C 1 273 ? 106.718 37.778  309.615 1.00 173.58 ? 273 HIS B NE2   1 
ATOM   6897  N  N     . ILE C 1 274 ? 101.350 38.858  307.698 1.00 162.97 ? 274 ILE B N     1 
ATOM   6898  C  CA    . ILE C 1 274 ? 101.064 40.229  307.289 1.00 161.28 ? 274 ILE B CA    1 
ATOM   6899  C  C     . ILE C 1 274 ? 100.183 40.933  308.313 1.00 160.90 ? 274 ILE B C     1 
ATOM   6900  O  O     . ILE C 1 274 ? 100.368 42.117  308.588 1.00 135.74 ? 274 ILE B O     1 
ATOM   6901  C  CB    . ILE C 1 274 ? 100.372 40.286  305.913 1.00 128.90 ? 274 ILE B CB    1 
ATOM   6902  N  N     . VAL C 1 275 ? 99.219  40.203  308.868 1.00 160.41 ? 275 VAL B N     1 
ATOM   6903  C  CA    . VAL C 1 275 ? 98.367  40.745  309.924 1.00 164.52 ? 275 VAL B CA    1 
ATOM   6904  C  C     . VAL C 1 275 ? 99.185  40.978  311.190 1.00 159.07 ? 275 VAL B C     1 
ATOM   6905  O  O     . VAL C 1 275 ? 99.070  42.023  311.843 1.00 143.63 ? 275 VAL B O     1 
ATOM   6906  C  CB    . VAL C 1 275 ? 97.189  39.799  310.238 1.00 162.88 ? 275 VAL B CB    1 
ATOM   6907  C  CG1   . VAL C 1 275 ? 96.566  40.140  311.585 1.00 167.29 ? 275 VAL B CG1   1 
ATOM   6908  C  CG2   . VAL C 1 275 ? 96.149  39.860  309.130 1.00 156.42 ? 275 VAL B CG2   1 
ATOM   6909  N  N     . ARG C 1 276 ? 100.016 39.993  311.521 1.00 163.81 ? 276 ARG B N     1 
ATOM   6910  C  CA    . ARG C 1 276 ? 100.907 40.073  312.669 1.00 166.20 ? 276 ARG B CA    1 
ATOM   6911  C  C     . ARG C 1 276 ? 101.809 41.299  312.569 1.00 169.19 ? 276 ARG B C     1 
ATOM   6912  O  O     . ARG C 1 276 ? 102.096 41.956  313.570 1.00 178.03 ? 276 ARG B O     1 
ATOM   6913  C  CB    . ARG C 1 276 ? 101.757 38.805  312.763 1.00 162.68 ? 276 ARG B CB    1 
ATOM   6914  C  CG    . ARG C 1 276 ? 102.799 38.831  313.869 1.00 168.16 ? 276 ARG B CG    1 
ATOM   6915  C  CD    . ARG C 1 276 ? 103.674 37.588  313.835 1.00 165.72 ? 276 ARG B CD    1 
ATOM   6916  N  N     . LEU C 1 277 ? 102.245 41.604  311.352 1.00 165.41 ? 277 LEU B N     1 
ATOM   6917  C  CA    . LEU C 1 277 ? 103.082 42.771  311.109 1.00 164.89 ? 277 LEU B CA    1 
ATOM   6918  C  C     . LEU C 1 277 ? 102.240 44.042  311.019 1.00 166.26 ? 277 LEU B C     1 
ATOM   6919  O  O     . LEU C 1 277 ? 102.759 45.151  311.146 1.00 173.79 ? 277 LEU B O     1 
ATOM   6920  C  CB    . LEU C 1 277 ? 103.897 42.586  309.827 1.00 160.12 ? 277 LEU B CB    1 
ATOM   6921  N  N     . VAL C 1 278 ? 100.939 43.874  310.801 1.00 162.50 ? 278 VAL B N     1 
ATOM   6922  C  CA    . VAL C 1 278 ? 100.032 45.011  310.686 1.00 168.39 ? 278 VAL B CA    1 
ATOM   6923  C  C     . VAL C 1 278 ? 99.680  45.568  312.057 1.00 179.80 ? 278 VAL B C     1 
ATOM   6924  O  O     . VAL C 1 278 ? 99.597  46.782  312.240 1.00 183.60 ? 278 VAL B O     1 
ATOM   6925  C  CB    . VAL C 1 278 ? 98.736  44.638  309.943 1.00 163.12 ? 278 VAL B CB    1 
ATOM   6926  N  N     . GLN C 1 279 ? 99.480  44.676  313.023 1.00 181.93 ? 279 GLN B N     1 
ATOM   6927  C  CA    . GLN C 1 279 ? 99.200  45.097  314.394 1.00 176.90 ? 279 GLN B CA    1 
ATOM   6928  C  C     . GLN C 1 279 ? 100.491 45.408  315.151 1.00 176.81 ? 279 GLN B C     1 
ATOM   6929  O  O     . GLN C 1 279 ? 100.590 45.170  316.354 1.00 182.59 ? 279 GLN B O     1 
ATOM   6930  C  CB    . GLN C 1 279 ? 98.394  44.027  315.134 1.00 169.95 ? 279 GLN B CB    1 
ATOM   6931  N  N     . GLU C 1 280 ? 101.476 45.941  314.434 1.00 176.05 ? 280 GLU B N     1 
ATOM   6932  C  CA    . GLU C 1 280 ? 102.763 46.296  315.020 1.00 185.24 ? 280 GLU B CA    1 
ATOM   6933  C  C     . GLU C 1 280 ? 103.299 47.599  314.428 1.00 198.63 ? 280 GLU B C     1 
ATOM   6934  O  O     . GLU C 1 280 ? 104.482 47.917  314.567 1.00 208.14 ? 280 GLU B O     1 
ATOM   6935  C  CB    . GLU C 1 280 ? 103.774 45.168  314.812 1.00 179.24 ? 280 GLU B CB    1 
ATOM   6936  N  N     . LYS C 1 281 ? 102.417 48.336  313.758 1.00 197.63 ? 281 LYS B N     1 
ATOM   6937  C  CA    . LYS C 1 281 ? 102.732 49.655  313.202 1.00 197.46 ? 281 LYS B CA    1 
ATOM   6938  C  C     . LYS C 1 281 ? 103.869 49.664  312.178 1.00 187.80 ? 281 LYS B C     1 
ATOM   6939  O  O     . LYS C 1 281 ? 104.503 50.695  311.957 1.00 195.69 ? 281 LYS B O     1 
ATOM   6940  C  CB    . LYS C 1 281 ? 103.023 50.657  314.323 1.00 203.46 ? 281 LYS B CB    1 
ATOM   6941  N  N     . ARG C 1 282 ? 104.122 48.519  311.553 1.00 175.31 ? 282 ARG B N     1 
ATOM   6942  C  CA    . ARG C 1 282 ? 105.124 48.444  310.494 1.00 158.93 ? 282 ARG B CA    1 
ATOM   6943  C  C     . ARG C 1 282 ? 104.525 48.850  309.152 1.00 185.86 ? 282 ARG B C     1 
ATOM   6944  O  O     . ARG C 1 282 ? 105.087 49.678  308.436 1.00 158.04 ? 282 ARG B O     1 
ATOM   6945  C  CB    . ARG C 1 282 ? 105.725 47.039  310.399 1.00 154.77 ? 282 ARG B CB    1 
ATOM   6946  C  CG    . ARG C 1 282 ? 106.761 46.723  311.465 1.00 157.88 ? 282 ARG B CG    1 
ATOM   6947  N  N     . ILE C 1 283 ? 103.381 48.260  308.821 1.00 175.06 ? 283 ILE B N     1 
ATOM   6948  C  CA    . ILE C 1 283 ? 102.704 48.541  307.561 1.00 162.93 ? 283 ILE B CA    1 
ATOM   6949  C  C     . ILE C 1 283 ? 101.424 49.347  307.777 1.00 157.12 ? 283 ILE B C     1 
ATOM   6950  O  O     . ILE C 1 283 ? 100.375 48.794  308.111 1.00 153.11 ? 283 ILE B O     1 
ATOM   6951  C  CB    . ILE C 1 283 ? 102.370 47.241  306.803 1.00 149.44 ? 283 ILE B CB    1 
ATOM   6952  N  N     . GLU C 1 284 ? 101.521 50.658  307.592 1.00 159.17 ? 284 GLU B N     1 
ATOM   6953  C  CA    . GLU C 1 284 ? 100.361 51.531  307.700 1.00 172.53 ? 284 GLU B CA    1 
ATOM   6954  C  C     . GLU C 1 284 ? 99.762  51.784  306.322 1.00 180.44 ? 284 GLU B C     1 
ATOM   6955  O  O     . GLU C 1 284 ? 100.396 51.510  305.302 1.00 173.80 ? 284 GLU B O     1 
ATOM   6956  C  CB    . GLU C 1 284 ? 100.745 52.858  308.359 1.00 165.81 ? 284 GLU B CB    1 
ATOM   6957  N  N     . GLY C 1 285 ? 98.538  52.301  306.299 1.00 189.82 ? 285 GLY B N     1 
ATOM   6958  C  CA    . GLY C 1 285 ? 97.871  52.634  305.053 1.00 184.13 ? 285 GLY B CA    1 
ATOM   6959  C  C     . GLY C 1 285 ? 96.842  51.608  304.618 1.00 166.48 ? 285 GLY B C     1 
ATOM   6960  O  O     . GLY C 1 285 ? 95.856  51.947  303.963 1.00 156.67 ? 285 GLY B O     1 
ATOM   6961  N  N     . ILE C 1 286 ? 97.075  50.350  304.982 1.00 162.32 ? 286 ILE B N     1 
ATOM   6962  C  CA    . ILE C 1 286 ? 96.183  49.259  304.604 1.00 162.71 ? 286 ILE B CA    1 
ATOM   6963  C  C     . ILE C 1 286 ? 94.831  49.355  305.309 1.00 165.50 ? 286 ILE B C     1 
ATOM   6964  O  O     . ILE C 1 286 ? 94.765  49.529  306.526 1.00 159.88 ? 286 ILE B O     1 
ATOM   6965  C  CB    . ILE C 1 286 ? 96.815  47.885  304.904 1.00 142.28 ? 286 ILE B CB    1 
ATOM   6966  N  N     . THR C 1 287 ? 93.755  49.241  304.536 1.00 165.70 ? 287 THR B N     1 
ATOM   6967  C  CA    . THR C 1 287 ? 92.407  49.297  305.089 1.00 160.28 ? 287 THR B CA    1 
ATOM   6968  C  C     . THR C 1 287 ? 91.890  47.906  305.445 1.00 164.13 ? 287 THR B C     1 
ATOM   6969  O  O     . THR C 1 287 ? 91.329  47.702  306.521 1.00 169.60 ? 287 THR B O     1 
ATOM   6970  C  CB    . THR C 1 287 ? 91.421  49.973  304.117 1.00 152.73 ? 287 THR B CB    1 
ATOM   6971  N  N     . ALA C 1 288 ? 92.086  46.956  304.535 1.00 159.13 ? 288 ALA B N     1 
ATOM   6972  C  CA    . ALA C 1 288 ? 91.640  45.583  304.747 1.00 150.10 ? 288 ALA B CA    1 
ATOM   6973  C  C     . ALA C 1 288 ? 92.387  44.612  303.837 1.00 147.95 ? 288 ALA B C     1 
ATOM   6974  O  O     . ALA C 1 288 ? 92.657  44.917  302.673 1.00 153.50 ? 288 ALA B O     1 
ATOM   6975  C  CB    . ALA C 1 288 ? 90.139  45.472  304.523 1.00 147.87 ? 288 ALA B CB    1 
ATOM   6976  N  N     . VAL C 1 289 ? 92.724  43.444  304.377 1.00 145.83 ? 289 VAL B N     1 
ATOM   6977  C  CA    . VAL C 1 289 ? 93.412  42.412  303.611 1.00 148.09 ? 289 VAL B CA    1 
ATOM   6978  C  C     . VAL C 1 289 ? 92.551  41.157  303.520 1.00 149.84 ? 289 VAL B C     1 
ATOM   6979  O  O     . VAL C 1 289 ? 92.592  40.298  304.401 1.00 150.61 ? 289 VAL B O     1 
ATOM   6980  C  CB    . VAL C 1 289 ? 94.770  42.050  304.239 1.00 131.90 ? 289 VAL B CB    1 
ATOM   6981  N  N     . ARG C 1 290 ? 91.769  41.059  302.449 1.00 153.04 ? 290 ARG B N     1 
ATOM   6982  C  CA    . ARG C 1 290 ? 90.858  39.935  302.264 1.00 155.79 ? 290 ARG B CA    1 
ATOM   6983  C  C     . ARG C 1 290 ? 91.323  38.994  301.154 1.00 163.53 ? 290 ARG B C     1 
ATOM   6984  O  O     . ARG C 1 290 ? 91.510  39.409  300.011 1.00 169.67 ? 290 ARG B O     1 
ATOM   6985  C  CB    . ARG C 1 290 ? 89.444  40.437  301.965 1.00 153.23 ? 290 ARG B CB    1 
ATOM   6986  N  N     . ASP C 1 291 ? 91.504  37.725  301.503 1.00 160.74 ? 291 ASP B N     1 
ATOM   6987  C  CA    . ASP C 1 291 ? 91.886  36.706  300.534 1.00 156.83 ? 291 ASP B CA    1 
ATOM   6988  C  C     . ASP C 1 291 ? 90.668  36.317  299.701 1.00 155.13 ? 291 ASP B C     1 
ATOM   6989  O  O     . ASP C 1 291 ? 89.734  35.694  300.206 1.00 155.38 ? 291 ASP B O     1 
ATOM   6990  C  CB    . ASP C 1 291 ? 92.452  35.479  301.254 1.00 158.59 ? 291 ASP B CB    1 
ATOM   6991  C  CG    . ASP C 1 291 ? 93.259  34.577  300.336 1.00 157.47 ? 291 ASP B CG    1 
ATOM   6992  O  OD1   . ASP C 1 291 ? 94.271  34.014  300.802 1.00 157.21 ? 291 ASP B OD1   1 
ATOM   6993  O  OD2   . ASP C 1 291 ? 92.885  34.428  299.154 1.00 156.89 ? 291 ASP B OD2   1 
ATOM   6994  N  N     . GLU C 1 292 ? 90.684  36.688  298.425 1.00 153.51 ? 292 GLU B N     1 
ATOM   6995  C  CA    . GLU C 1 292 ? 89.546  36.449  297.544 1.00 156.32 ? 292 GLU B CA    1 
ATOM   6996  C  C     . GLU C 1 292 ? 89.864  35.424  296.458 1.00 161.35 ? 292 GLU B C     1 
ATOM   6997  O  O     . GLU C 1 292 ? 89.486  35.597  295.300 1.00 164.82 ? 292 GLU B O     1 
ATOM   6998  C  CB    . GLU C 1 292 ? 89.082  37.761  296.906 1.00 155.04 ? 292 GLU B CB    1 
ATOM   6999  N  N     . SER C 1 293 ? 90.559  34.357  296.836 1.00 162.12 ? 293 SER B N     1 
ATOM   7000  C  CA    . SER C 1 293 ? 90.913  33.308  295.887 1.00 161.93 ? 293 SER B CA    1 
ATOM   7001  C  C     . SER C 1 293 ? 89.764  32.323  295.715 1.00 164.46 ? 293 SER B C     1 
ATOM   7002  O  O     . SER C 1 293 ? 89.151  31.894  296.690 1.00 163.99 ? 293 SER B O     1 
ATOM   7003  C  CB    . SER C 1 293 ? 92.173  32.569  296.343 1.00 137.83 ? 293 SER B CB    1 
ATOM   7004  O  OG    . SER C 1 293 ? 93.279  33.450  296.424 1.00 147.00 ? 293 SER B OG    1 
ATOM   7005  N  N     . ASN C 1 294 ? 89.471  31.971  294.469 1.00 168.28 ? 294 ASN B N     1 
ATOM   7006  C  CA    . ASN C 1 294 ? 88.444  30.980  294.180 1.00 172.50 ? 294 ASN B CA    1 
ATOM   7007  C  C     . ASN C 1 294 ? 89.070  29.683  293.685 1.00 172.75 ? 294 ASN B C     1 
ATOM   7008  O  O     . ASN C 1 294 ? 90.291  29.526  293.710 1.00 164.39 ? 294 ASN B O     1 
ATOM   7009  C  CB    . ASN C 1 294 ? 87.456  31.519  293.144 1.00 155.62 ? 294 ASN B CB    1 
ATOM   7010  N  N     . ARG C 1 295 ? 88.233  28.755  293.235 1.00 181.65 ? 295 ARG B N     1 
ATOM   7011  C  CA    . ARG C 1 295 ? 88.723  27.517  292.644 1.00 181.86 ? 295 ARG B CA    1 
ATOM   7012  C  C     . ARG C 1 295 ? 89.072  27.755  291.179 1.00 185.30 ? 295 ARG B C     1 
ATOM   7013  O  O     . ARG C 1 295 ? 89.543  26.855  290.484 1.00 190.25 ? 295 ARG B O     1 
ATOM   7014  C  CB    . ARG C 1 295 ? 87.678  26.407  292.769 1.00 182.05 ? 295 ARG B CB    1 
ATOM   7015  N  N     . GLU C 1 296 ? 88.838  28.981  290.721 1.00 184.01 ? 296 GLU B N     1 
ATOM   7016  C  CA    . GLU C 1 296 ? 89.119  29.359  289.343 1.00 190.25 ? 296 GLU B CA    1 
ATOM   7017  C  C     . GLU C 1 296 ? 90.425  30.141  289.235 1.00 188.03 ? 296 GLU B C     1 
ATOM   7018  O  O     . GLU C 1 296 ? 90.964  30.314  288.143 1.00 197.36 ? 296 GLU B O     1 
ATOM   7019  C  CB    . GLU C 1 296 ? 87.965  30.185  288.772 1.00 195.87 ? 296 GLU B CB    1 
ATOM   7020  N  N     . GLY C 1 297 ? 90.930  30.613  290.370 1.00 176.28 ? 297 GLY B N     1 
ATOM   7021  C  CA    . GLY C 1 297 ? 92.174  31.360  290.391 1.00 168.60 ? 297 GLY B CA    1 
ATOM   7022  C  C     . GLY C 1 297 ? 92.446  32.059  291.709 1.00 165.07 ? 297 GLY B C     1 
ATOM   7023  O  O     . GLY C 1 297 ? 91.694  31.914  292.672 1.00 170.65 ? 297 GLY B O     1 
ATOM   7024  N  N     . VAL C 1 298 ? 93.533  32.824  291.745 1.00 155.04 ? 298 VAL B N     1 
ATOM   7025  C  CA    . VAL C 1 298 ? 93.922  33.559  292.942 1.00 149.22 ? 298 VAL B CA    1 
ATOM   7026  C  C     . VAL C 1 298 ? 93.648  35.053  292.794 1.00 153.50 ? 298 VAL B C     1 
ATOM   7027  O  O     . VAL C 1 298 ? 93.297  35.526  291.713 1.00 139.94 ? 298 VAL B O     1 
ATOM   7028  C  CB    . VAL C 1 298 ? 95.413  33.349  293.265 1.00 136.09 ? 298 VAL B CB    1 
ATOM   7029  C  CG1   . VAL C 1 298 ? 95.857  34.288  294.377 1.00 132.69 ? 298 VAL B CG1   1 
ATOM   7030  C  CG2   . VAL C 1 298 ? 95.672  31.899  293.641 1.00 136.98 ? 298 VAL B CG2   1 
ATOM   7031  N  N     . PHE C 1 300 ? 93.668  37.300  296.130 1.00 146.57 ? 300 PHE B N     1 
ATOM   7032  C  CA    . PHE C 1 300 ? 94.249  37.790  297.377 1.00 145.36 ? 300 PHE B CA    1 
ATOM   7033  C  C     . PHE C 1 300 ? 94.371  39.309  297.348 1.00 144.51 ? 300 PHE B C     1 
ATOM   7034  O  O     . PHE C 1 300 ? 95.382  39.854  296.905 1.00 140.90 ? 300 PHE B O     1 
ATOM   7035  C  CB    . PHE C 1 300 ? 95.615  37.148  297.622 1.00 143.18 ? 300 PHE B CB    1 
ATOM   7036  C  CG    . PHE C 1 300 ? 96.186  37.435  298.980 1.00 145.45 ? 300 PHE B CG    1 
ATOM   7037  C  CD1   . PHE C 1 300 ? 95.699  36.784  300.100 1.00 146.76 ? 300 PHE B CD1   1 
ATOM   7038  C  CD2   . PHE C 1 300 ? 97.214  38.349  299.137 1.00 146.06 ? 300 PHE B CD2   1 
ATOM   7039  C  CE1   . PHE C 1 300 ? 96.221  37.042  301.350 1.00 145.04 ? 300 PHE B CE1   1 
ATOM   7040  C  CE2   . PHE C 1 300 ? 97.742  38.610  300.386 1.00 149.79 ? 300 PHE B CE2   1 
ATOM   7041  C  CZ    . PHE C 1 300 ? 97.243  37.955  301.494 1.00 146.29 ? 300 PHE B CZ    1 
ATOM   7042  N  N     . VAL C 1 301 ? 93.336  39.984  297.836 1.00 148.12 ? 301 VAL B N     1 
ATOM   7043  C  CA    . VAL C 1 301 ? 93.237  41.436  297.737 1.00 150.98 ? 301 VAL B CA    1 
ATOM   7044  C  C     . VAL C 1 301 ? 93.715  42.160  298.995 1.00 145.41 ? 301 VAL B C     1 
ATOM   7045  O  O     . VAL C 1 301 ? 93.267  41.869  300.104 1.00 143.54 ? 301 VAL B O     1 
ATOM   7046  C  CB    . VAL C 1 301 ? 91.788  41.868  297.426 1.00 149.34 ? 301 VAL B CB    1 
ATOM   7047  C  CG1   . VAL C 1 301 ? 91.670  43.381  297.431 1.00 140.22 ? 301 VAL B CG1   1 
ATOM   7048  C  CG2   . VAL C 1 301 ? 91.336  41.293  296.092 1.00 150.87 ? 301 VAL B CG2   1 
ATOM   7049  N  N     . ILE C 1 302 ? 94.630  43.105  298.806 1.00 145.07 ? 302 ILE B N     1 
ATOM   7050  C  CA    . ILE C 1 302 ? 95.107  43.957  299.888 1.00 152.46 ? 302 ILE B CA    1 
ATOM   7051  C  C     . ILE C 1 302 ? 94.821  45.419  299.552 1.00 160.20 ? 302 ILE B C     1 
ATOM   7052  O  O     . ILE C 1 302 ? 95.403  45.977  298.621 1.00 159.60 ? 302 ILE B O     1 
ATOM   7053  C  CB    . ILE C 1 302 ? 96.617  43.774  300.127 1.00 130.55 ? 302 ILE B CB    1 
ATOM   7054  N  N     . GLU C 1 303 ? 93.916  46.035  300.305 1.00 165.46 ? 303 GLU B N     1 
ATOM   7055  C  CA    . GLU C 1 303 ? 93.506  47.408  300.029 1.00 167.39 ? 303 GLU B CA    1 
ATOM   7056  C  C     . GLU C 1 303 ? 94.284  48.421  300.863 1.00 164.13 ? 303 GLU B C     1 
ATOM   7057  O  O     . GLU C 1 303 ? 94.717  48.121  301.974 1.00 152.33 ? 303 GLU B O     1 
ATOM   7058  C  CB    . GLU C 1 303 ? 92.003  47.577  300.256 1.00 170.14 ? 303 GLU B CB    1 
ATOM   7059  C  CG    . GLU C 1 303 ? 91.141  46.768  299.304 1.00 173.51 ? 303 GLU B CG    1 
ATOM   7060  C  CD    . GLU C 1 303 ? 89.663  47.048  299.478 1.00 180.63 ? 303 GLU B CD    1 
ATOM   7061  O  OE1   . GLU C 1 303 ? 89.307  47.810  300.402 1.00 186.73 ? 303 GLU B OE1   1 
ATOM   7062  O  OE2   . GLU C 1 303 ? 88.858  46.507  298.690 1.00 179.85 ? 303 GLU B OE2   1 
ATOM   7063  N  N     . VAL C 1 304 ? 94.457  49.620  300.313 1.00 171.29 ? 304 VAL B N     1 
ATOM   7064  C  CA    . VAL C 1 304 ? 95.183  50.687  300.993 1.00 175.25 ? 304 VAL B CA    1 
ATOM   7065  C  C     . VAL C 1 304 ? 94.374  51.981  301.010 1.00 177.63 ? 304 VAL B C     1 
ATOM   7066  O  O     . VAL C 1 304 ? 93.364  52.102  300.317 1.00 175.30 ? 304 VAL B O     1 
ATOM   7067  C  CB    . VAL C 1 304 ? 96.550  50.949  300.330 1.00 146.13 ? 304 VAL B CB    1 
ATOM   7068  N  N     . LYS C 1 305 ? 94.824  52.945  301.807 1.00 181.48 ? 305 LYS B N     1 
ATOM   7069  C  CA    . LYS C 1 305 ? 94.140  54.228  301.919 1.00 186.08 ? 305 LYS B CA    1 
ATOM   7070  C  C     . LYS C 1 305 ? 95.024  55.369  301.427 1.00 186.66 ? 305 LYS B C     1 
ATOM   7071  O  O     . LYS C 1 305 ? 96.209  55.177  301.157 1.00 185.58 ? 305 LYS B O     1 
ATOM   7072  C  CB    . LYS C 1 305 ? 93.705  54.478  303.364 1.00 161.36 ? 305 LYS B CB    1 
ATOM   7073  N  N     . ARG C 1 306 ? 94.436  56.556  301.311 1.00 185.05 ? 306 ARG B N     1 
ATOM   7074  C  CA    . ARG C 1 306 ? 95.163  57.740  300.866 1.00 185.76 ? 306 ARG B CA    1 
ATOM   7075  C  C     . ARG C 1 306 ? 96.287  58.079  301.840 1.00 199.61 ? 306 ARG B C     1 
ATOM   7076  O  O     . ARG C 1 306 ? 96.038  58.365  303.013 1.00 201.62 ? 306 ARG B O     1 
ATOM   7077  C  CB    . ARG C 1 306 ? 94.214  58.930  300.713 1.00 182.88 ? 306 ARG B CB    1 
ATOM   7078  N  N     . ASP C 1 307 ? 97.519  58.038  301.338 1.00 204.62 ? 307 ASP B N     1 
ATOM   7079  C  CA    . ASP C 1 307 ? 98.715  58.264  302.147 1.00 208.21 ? 307 ASP B CA    1 
ATOM   7080  C  C     . ASP C 1 307 ? 98.815  57.274  303.305 1.00 208.77 ? 307 ASP B C     1 
ATOM   7081  O  O     . ASP C 1 307 ? 99.033  56.080  303.097 1.00 200.49 ? 307 ASP B O     1 
ATOM   7082  C  CB    . ASP C 1 307 ? 98.769  59.706  302.663 1.00 209.65 ? 307 ASP B CB    1 
ATOM   7083  N  N     . SER C 1 309 ? 100.212 56.274  297.873 1.00 188.16 ? 309 SER B N     1 
ATOM   7084  C  CA    . SER C 1 309 ? 101.238 55.641  298.693 1.00 185.00 ? 309 SER B CA    1 
ATOM   7085  C  C     . SER C 1 309 ? 101.236 54.127  298.504 1.00 179.66 ? 309 SER B C     1 
ATOM   7086  O  O     . SER C 1 309 ? 101.906 53.400  299.237 1.00 182.38 ? 309 SER B O     1 
ATOM   7087  C  CB    . SER C 1 309 ? 101.028 55.987  300.169 1.00 183.62 ? 309 SER B CB    1 
ATOM   7088  O  OG    . SER C 1 309 ? 102.028 55.397  300.982 1.00 179.57 ? 309 SER B OG    1 
ATOM   7089  N  N     . ALA C 1 310 ? 100.484 53.664  297.510 1.00 174.58 ? 310 ALA B N     1 
ATOM   7090  C  CA    . ALA C 1 310 ? 100.308 52.234  297.268 1.00 168.28 ? 310 ALA B CA    1 
ATOM   7091  C  C     . ALA C 1 310 ? 101.604 51.530  296.870 1.00 173.94 ? 310 ALA B C     1 
ATOM   7092  O  O     . ALA C 1 310 ? 101.871 50.411  297.313 1.00 165.64 ? 310 ALA B O     1 
ATOM   7093  C  CB    . ALA C 1 310 ? 99.231  52.008  296.214 1.00 161.22 ? 310 ALA B CB    1 
ATOM   7094  N  N     . ASN C 1 311 ? 102.399 52.186  296.030 1.00 183.51 ? 311 ASN B N     1 
ATOM   7095  C  CA    . ASN C 1 311 ? 103.672 51.629  295.583 1.00 180.39 ? 311 ASN B CA    1 
ATOM   7096  C  C     . ASN C 1 311 ? 104.620 51.400  296.753 1.00 176.63 ? 311 ASN B C     1 
ATOM   7097  O  O     . ASN C 1 311 ? 105.289 50.368  296.834 1.00 175.59 ? 311 ASN B O     1 
ATOM   7098  C  CB    . ASN C 1 311 ? 104.325 52.546  294.547 1.00 181.51 ? 311 ASN B CB    1 
ATOM   7099  N  N     . VAL C 1 312 ? 104.664 52.372  297.659 1.00 176.80 ? 312 VAL B N     1 
ATOM   7100  C  CA    . VAL C 1 312 ? 105.485 52.274  298.858 1.00 175.52 ? 312 VAL B CA    1 
ATOM   7101  C  C     . VAL C 1 312 ? 105.020 51.116  299.736 1.00 175.50 ? 312 VAL B C     1 
ATOM   7102  O  O     . VAL C 1 312 ? 105.833 50.351  300.253 1.00 172.62 ? 312 VAL B O     1 
ATOM   7103  C  CB    . VAL C 1 312 ? 105.435 53.578  299.678 1.00 176.77 ? 312 VAL B CB    1 
ATOM   7104  C  CG1   . VAL C 1 312 ? 106.353 53.480  300.886 1.00 178.96 ? 312 VAL B CG1   1 
ATOM   7105  C  CG2   . VAL C 1 312 ? 105.817 54.767  298.810 1.00 164.42 ? 312 VAL B CG2   1 
ATOM   7106  N  N     . ILE C 1 313 ? 103.705 50.992  299.885 1.00 180.95 ? 313 ILE B N     1 
ATOM   7107  C  CA    . ILE C 1 313 ? 103.109 49.961  300.728 1.00 184.27 ? 313 ILE B CA    1 
ATOM   7108  C  C     . ILE C 1 313 ? 103.361 48.558  300.185 1.00 183.54 ? 313 ILE B C     1 
ATOM   7109  O  O     . ILE C 1 313 ? 103.606 47.625  300.949 1.00 139.21 ? 313 ILE B O     1 
ATOM   7110  C  CB    . ILE C 1 313 ? 101.589 50.175  300.890 1.00 145.18 ? 313 ILE B CB    1 
ATOM   7111  N  N     . LEU C 1 314 ? 103.295 48.413  298.865 1.00 178.30 ? 314 LEU B N     1 
ATOM   7112  C  CA    . LEU C 1 314 ? 103.536 47.125  298.225 1.00 169.71 ? 314 LEU B CA    1 
ATOM   7113  C  C     . LEU C 1 314 ? 105.020 46.779  298.270 1.00 169.02 ? 314 LEU B C     1 
ATOM   7114  O  O     . LEU C 1 314 ? 105.395 45.620  298.469 1.00 134.82 ? 314 LEU B O     1 
ATOM   7115  C  CB    . LEU C 1 314 ? 103.036 47.141  296.780 1.00 165.72 ? 314 LEU B CB    1 
ATOM   7116  N  N     . ASN C 1 315 ? 105.859 47.794  298.081 1.00 166.20 ? 315 ASN B N     1 
ATOM   7117  C  CA    . ASN C 1 315 ? 107.302 47.629  298.202 1.00 162.73 ? 315 ASN B CA    1 
ATOM   7118  C  C     . ASN C 1 315 ? 107.651 47.158  299.610 1.00 150.93 ? 315 ASN B C     1 
ATOM   7119  O  O     . ASN C 1 315 ? 108.534 46.320  299.798 1.00 145.73 ? 315 ASN B O     1 
ATOM   7120  C  CB    . ASN C 1 315 ? 108.022 48.941  297.876 1.00 176.83 ? 315 ASN B CB    1 
ATOM   7121  C  CG    . ASN C 1 315 ? 109.490 48.739  297.545 1.00 182.15 ? 315 ASN B CG    1 
ATOM   7122  O  OD1   . ASN C 1 315 ? 110.179 47.938  298.176 1.00 176.96 ? 315 ASN B OD1   1 
ATOM   7123  N  ND2   . ASN C 1 315 ? 109.976 49.467  296.546 1.00 188.56 ? 315 ASN B ND2   1 
ATOM   7124  N  N     . ASN C 1 316 ? 106.939 47.698  300.595 1.00 150.47 ? 316 ASN B N     1 
ATOM   7125  C  CA    . ASN C 1 316 ? 107.089 47.267  301.979 1.00 146.13 ? 316 ASN B CA    1 
ATOM   7126  C  C     . ASN C 1 316 ? 106.630 45.826  302.160 1.00 145.42 ? 316 ASN B C     1 
ATOM   7127  O  O     . ASN C 1 316 ? 107.316 45.023  302.788 1.00 152.05 ? 316 ASN B O     1 
ATOM   7128  C  CB    . ASN C 1 316 ? 106.311 48.190  302.922 1.00 145.09 ? 316 ASN B CB    1 
ATOM   7129  C  CG    . ASN C 1 316 ? 106.872 49.600  302.955 1.00 150.31 ? 316 ASN B CG    1 
ATOM   7130  O  OD1   . ASN C 1 316 ? 108.075 49.807  302.793 1.00 152.52 ? 316 ASN B OD1   1 
ATOM   7131  N  ND2   . ASN C 1 316 ? 105.999 50.581  303.164 1.00 152.81 ? 316 ASN B ND2   1 
ATOM   7132  N  N     . LEU C 1 317 ? 105.468 45.506  301.596 1.00 135.83 ? 317 LEU B N     1 
ATOM   7133  C  CA    . LEU C 1 317 ? 104.896 44.167  301.700 1.00 176.44 ? 317 LEU B CA    1 
ATOM   7134  C  C     . LEU C 1 317 ? 105.792 43.119  301.044 1.00 157.58 ? 317 LEU B C     1 
ATOM   7135  O  O     . LEU C 1 317 ? 105.717 41.934  301.369 1.00 151.80 ? 317 LEU B O     1 
ATOM   7136  C  CB    . LEU C 1 317 ? 103.496 44.132  301.081 1.00 131.26 ? 317 LEU B CB    1 
ATOM   7137  N  N     . PHE C 1 318 ? 106.638 43.561  300.119 1.00 160.43 ? 318 PHE B N     1 
ATOM   7138  C  CA    . PHE C 1 318 ? 107.600 42.671  299.482 1.00 161.94 ? 318 PHE B CA    1 
ATOM   7139  C  C     . PHE C 1 318 ? 108.895 42.602  300.289 1.00 164.30 ? 318 PHE B C     1 
ATOM   7140  O  O     . PHE C 1 318 ? 109.532 41.552  300.371 1.00 157.32 ? 318 PHE B O     1 
ATOM   7141  C  CB    . PHE C 1 318 ? 107.893 43.129  298.052 1.00 160.71 ? 318 PHE B CB    1 
ATOM   7142  N  N     . LYS C 1 319 ? 109.274 43.725  300.891 1.00 170.33 ? 319 LYS B N     1 
ATOM   7143  C  CA    . LYS C 1 319 ? 110.526 43.807  301.636 1.00 167.79 ? 319 LYS B CA    1 
ATOM   7144  C  C     . LYS C 1 319 ? 110.382 43.357  303.089 1.00 169.35 ? 319 LYS B C     1 
ATOM   7145  O  O     . LYS C 1 319 ? 111.344 43.400  303.855 1.00 171.92 ? 319 LYS B O     1 
ATOM   7146  C  CB    . LYS C 1 319 ? 111.085 45.232  301.585 1.00 162.69 ? 319 LYS B CB    1 
ATOM   7147  N  N     . MET C 1 320 ? 109.184 42.919  303.463 1.00 170.47 ? 320 MET B N     1 
ATOM   7148  C  CA    . MET C 1 320 ? 108.911 42.533  304.845 1.00 180.08 ? 320 MET B CA    1 
ATOM   7149  C  C     . MET C 1 320 ? 108.945 41.022  305.055 1.00 187.25 ? 320 MET B C     1 
ATOM   7150  O  O     . MET C 1 320 ? 109.652 40.527  305.933 1.00 193.67 ? 320 MET B O     1 
ATOM   7151  C  CB    . MET C 1 320 ? 107.561 43.092  305.302 1.00 178.18 ? 320 MET B CB    1 
ATOM   7152  N  N     . THR C 1 321 ? 108.174 40.295  304.251 1.00 184.17 ? 321 THR B N     1 
ATOM   7153  C  CA    . THR C 1 321 ? 108.066 38.847  304.395 1.00 176.13 ? 321 THR B CA    1 
ATOM   7154  C  C     . THR C 1 321 ? 109.389 38.152  304.087 1.00 174.95 ? 321 THR B C     1 
ATOM   7155  O  O     . THR C 1 321 ? 110.164 37.843  304.994 1.00 172.41 ? 321 THR B O     1 
ATOM   7156  C  CB    . THR C 1 321 ? 106.972 38.270  303.477 1.00 166.98 ? 321 THR B CB    1 
ATOM   7157  O  OG1   . THR C 1 321 ? 107.408 38.325  302.113 1.00 165.16 ? 321 THR B OG1   1 
ATOM   7158  C  CG2   . THR C 1 321 ? 105.678 39.057  303.629 1.00 160.44 ? 321 THR B CG2   1 
ATOM   7159  N  N     . MET C 1 323 ? 106.119 36.629  300.027 1.00 133.84 ? 323 MET B N     1 
ATOM   7160  C  CA    . MET C 1 323 ? 105.978 37.617  298.964 1.00 140.62 ? 323 MET B CA    1 
ATOM   7161  C  C     . MET C 1 323 ? 107.274 37.767  298.171 1.00 143.58 ? 323 MET B C     1 
ATOM   7162  O  O     . MET C 1 323 ? 107.254 38.103  296.988 1.00 140.82 ? 323 MET B O     1 
ATOM   7163  C  CB    . MET C 1 323 ? 105.546 38.967  299.541 1.00 141.82 ? 323 MET B CB    1 
ATOM   7164  N  N     . GLN C 1 324 ? 108.399 37.519  298.833 1.00 144.60 ? 324 GLN B N     1 
ATOM   7165  C  CA    . GLN C 1 324 ? 109.700 37.544  298.173 1.00 146.49 ? 324 GLN B CA    1 
ATOM   7166  C  C     . GLN C 1 324 ? 110.642 36.546  298.833 1.00 146.42 ? 324 GLN B C     1 
ATOM   7167  O  O     . GLN C 1 324 ? 110.882 36.612  300.038 1.00 148.11 ? 324 GLN B O     1 
ATOM   7168  C  CB    . GLN C 1 324 ? 110.306 38.948  298.199 1.00 150.25 ? 324 GLN B CB    1 
ATOM   7169  C  CG    . GLN C 1 324 ? 111.687 39.032  297.568 1.00 150.39 ? 324 GLN B CG    1 
ATOM   7170  C  CD    . GLN C 1 324 ? 112.138 40.460  297.328 1.00 152.68 ? 324 GLN B CD    1 
ATOM   7171  O  OE1   . GLN C 1 324 ? 111.321 41.380  297.272 1.00 152.49 ? 324 GLN B OE1   1 
ATOM   7172  N  NE2   . GLN C 1 324 ? 113.445 40.651  297.186 1.00 155.74 ? 324 GLN B NE2   1 
ATOM   7173  N  N     . THR C 1 325 ? 111.172 35.621  298.039 1.00 146.17 ? 325 THR B N     1 
ATOM   7174  C  CA    . THR C 1 325 ? 111.983 34.537  298.582 1.00 149.46 ? 325 THR B CA    1 
ATOM   7175  C  C     . THR C 1 325 ? 113.345 34.400  297.909 1.00 147.05 ? 325 THR B C     1 
ATOM   7176  O  O     . THR C 1 325 ? 113.614 35.026  296.884 1.00 148.81 ? 325 THR B O     1 
ATOM   7177  C  CB    . THR C 1 325 ? 111.241 33.186  298.501 1.00 154.75 ? 325 THR B CB    1 
ATOM   7178  O  OG1   . THR C 1 325 ? 110.634 33.050  297.210 1.00 158.74 ? 325 THR B OG1   1 
ATOM   7179  C  CG2   . THR C 1 325 ? 110.164 33.106  299.569 1.00 153.09 ? 325 THR B CG2   1 
ATOM   7180  N  N     . ASN C 1 326 ? 114.200 33.576  298.505 1.00 151.85 ? 326 ASN B N     1 
ATOM   7181  C  CA    . ASN C 1 326 ? 115.522 33.304  297.961 1.00 156.51 ? 326 ASN B CA    1 
ATOM   7182  C  C     . ASN C 1 326 ? 115.689 31.832  297.602 1.00 158.46 ? 326 ASN B C     1 
ATOM   7183  O  O     . ASN C 1 326 ? 115.816 30.984  298.484 1.00 160.63 ? 326 ASN B O     1 
ATOM   7184  C  CB    . ASN C 1 326 ? 116.605 33.706  298.965 1.00 157.28 ? 326 ASN B CB    1 
ATOM   7185  C  CG    . ASN C 1 326 ? 116.719 35.208  299.136 1.00 160.53 ? 326 ASN B CG    1 
ATOM   7186  O  OD1   . ASN C 1 326 ? 115.814 35.957  298.772 1.00 160.85 ? 326 ASN B OD1   1 
ATOM   7187  N  ND2   . ASN C 1 326 ? 117.838 35.655  299.696 1.00 168.94 ? 326 ASN B ND2   1 
ATOM   7188  N  N     . PHE C 1 327 ? 115.683 31.527  296.309 1.00 156.99 ? 327 PHE B N     1 
ATOM   7189  C  CA    . PHE C 1 327 ? 115.964 30.168  295.863 1.00 154.05 ? 327 PHE B CA    1 
ATOM   7190  C  C     . PHE C 1 327 ? 117.468 29.941  295.815 1.00 154.32 ? 327 PHE B C     1 
ATOM   7191  O  O     . PHE C 1 327 ? 118.199 30.686  295.161 1.00 159.78 ? 327 PHE B O     1 
ATOM   7192  C  CB    . PHE C 1 327 ? 115.355 29.889  294.487 1.00 148.05 ? 327 PHE B CB    1 
ATOM   7193  C  CG    . PHE C 1 327 ? 115.312 28.426  294.132 1.00 137.77 ? 327 PHE B CG    1 
ATOM   7194  C  CD1   . PHE C 1 327 ? 114.140 27.703  294.269 1.00 133.64 ? 327 PHE B CD1   1 
ATOM   7195  C  CD2   . PHE C 1 327 ? 116.446 27.772  293.674 1.00 136.00 ? 327 PHE B CD2   1 
ATOM   7196  C  CE1   . PHE C 1 327 ? 114.097 26.359  293.950 1.00 134.82 ? 327 PHE B CE1   1 
ATOM   7197  C  CE2   . PHE C 1 327 ? 116.410 26.429  293.357 1.00 131.83 ? 327 PHE B CE2   1 
ATOM   7198  C  CZ    . PHE C 1 327 ? 115.233 25.721  293.495 1.00 134.47 ? 327 PHE B CZ    1 
ATOM   7199  N  N     . GLY C 1 328 ? 117.924 28.903  296.506 1.00 146.85 ? 328 GLY B N     1 
ATOM   7200  C  CA    . GLY C 1 328 ? 119.331 28.558  296.511 1.00 142.39 ? 328 GLY B CA    1 
ATOM   7201  C  C     . GLY C 1 328 ? 119.611 27.282  295.745 1.00 138.27 ? 328 GLY B C     1 
ATOM   7202  O  O     . GLY C 1 328 ? 119.354 26.183  296.237 1.00 131.57 ? 328 GLY B O     1 
ATOM   7203  N  N     . PHE C 1 329 ? 120.131 27.431  294.530 1.00 142.33 ? 329 PHE B N     1 
ATOM   7204  C  CA    . PHE C 1 329 ? 120.554 26.288  293.735 1.00 141.75 ? 329 PHE B CA    1 
ATOM   7205  C  C     . PHE C 1 329 ? 121.638 25.504  294.457 1.00 139.71 ? 329 PHE B C     1 
ATOM   7206  O  O     . PHE C 1 329 ? 122.694 26.046  294.785 1.00 146.85 ? 329 PHE B O     1 
ATOM   7207  C  CB    . PHE C 1 329 ? 121.098 26.747  292.383 1.00 148.33 ? 329 PHE B CB    1 
ATOM   7208  C  CG    . PHE C 1 329 ? 120.044 27.225  291.425 1.00 151.43 ? 329 PHE B CG    1 
ATOM   7209  C  CD1   . PHE C 1 329 ? 119.610 26.410  290.395 1.00 144.21 ? 329 PHE B CD1   1 
ATOM   7210  C  CD2   . PHE C 1 329 ? 119.509 28.498  291.536 1.00 161.84 ? 329 PHE B CD2   1 
ATOM   7211  C  CE1   . PHE C 1 329 ? 118.655 26.849  289.501 1.00 143.82 ? 329 PHE B CE1   1 
ATOM   7212  C  CE2   . PHE C 1 329 ? 118.548 28.942  290.646 1.00 159.71 ? 329 PHE B CE2   1 
ATOM   7213  C  CZ    . PHE C 1 329 ? 118.120 28.114  289.627 1.00 148.66 ? 329 PHE B CZ    1 
ATOM   7214  N  N     . ASN C 1 330 ? 121.363 24.231  294.711 1.00 131.69 ? 330 ASN B N     1 
ATOM   7215  C  CA    . ASN C 1 330 ? 122.371 23.308  295.208 1.00 133.23 ? 330 ASN B CA    1 
ATOM   7216  C  C     . ASN C 1 330 ? 122.149 21.958  294.543 1.00 128.92 ? 330 ASN B C     1 
ATOM   7217  O  O     . ASN C 1 330 ? 121.853 20.962  295.204 1.00 124.65 ? 330 ASN B O     1 
ATOM   7218  C  CB    . ASN C 1 330 ? 122.299 23.185  296.729 1.00 147.98 ? 330 ASN B CB    1 
ATOM   7219  C  CG    . ASN C 1 330 ? 123.478 22.431  297.309 1.00 157.88 ? 330 ASN B CG    1 
ATOM   7220  O  OD1   . ASN C 1 330 ? 124.523 22.307  296.673 1.00 160.23 ? 330 ASN B OD1   1 
ATOM   7221  N  ND2   . ASN C 1 330 ? 123.314 21.921  298.523 1.00 160.26 ? 330 ASN B ND2   1 
ATOM   7222  N  N     . MET C 1 331 ? 122.284 21.946  293.221 1.00 134.09 ? 331 MET B N     1 
ATOM   7223  C  CA    . MET C 1 331 ? 121.948 20.778  292.413 1.00 126.72 ? 331 MET B CA    1 
ATOM   7224  C  C     . MET C 1 331 ? 122.819 19.564  292.737 1.00 119.13 ? 331 MET B C     1 
ATOM   7225  O  O     . MET C 1 331 ? 123.837 19.319  292.090 1.00 112.95 ? 331 MET B O     1 
ATOM   7226  C  CB    . MET C 1 331 ? 122.016 21.125  290.923 1.00 124.69 ? 331 MET B CB    1 
ATOM   7227  C  CG    . MET C 1 331 ? 121.135 22.308  290.538 1.00 124.56 ? 331 MET B CG    1 
ATOM   7228  S  SD    . MET C 1 331 ? 121.002 22.578  288.760 1.00 138.37 ? 331 MET B SD    1 
ATOM   7229  C  CE    . MET C 1 331 ? 122.701 22.944  288.343 1.00 96.20  ? 331 MET B CE    1 
ATOM   7230  N  N     . LEU C 1 332 ? 122.401 18.810  293.749 1.00 118.35 ? 332 LEU B N     1 
ATOM   7231  C  CA    . LEU C 1 332 ? 123.102 17.605  294.175 1.00 113.90 ? 332 LEU B CA    1 
ATOM   7232  C  C     . LEU C 1 332 ? 122.268 16.372  293.852 1.00 116.09 ? 332 LEU B C     1 
ATOM   7233  O  O     . LEU C 1 332 ? 121.093 16.302  294.207 1.00 120.10 ? 332 LEU B O     1 
ATOM   7234  C  CB    . LEU C 1 332 ? 123.387 17.665  295.678 1.00 107.74 ? 332 LEU B CB    1 
ATOM   7235  C  CG    . LEU C 1 332 ? 123.639 16.352  296.424 1.00 104.90 ? 332 LEU B CG    1 
ATOM   7236  C  CD1   . LEU C 1 332 ? 124.928 15.691  295.966 1.00 98.89  ? 332 LEU B CD1   1 
ATOM   7237  C  CD2   . LEU C 1 332 ? 123.661 16.599  297.923 1.00 114.31 ? 332 LEU B CD2   1 
ATOM   7238  N  N     . ALA C 1 333 ? 122.874 15.398  293.180 1.00 113.44 ? 333 ALA B N     1 
ATOM   7239  C  CA    . ALA C 1 333 ? 122.159 14.177  292.822 1.00 111.39 ? 333 ALA B CA    1 
ATOM   7240  C  C     . ALA C 1 333 ? 123.068 12.956  292.859 1.00 105.20 ? 333 ALA B C     1 
ATOM   7241  O  O     . ALA C 1 333 ? 124.287 13.076  292.765 1.00 107.96 ? 333 ALA B O     1 
ATOM   7242  C  CB    . ALA C 1 333 ? 121.517 14.319  291.450 1.00 119.51 ? 333 ALA B CB    1 
ATOM   7243  N  N     . ILE C 1 334 ? 122.465 11.779  292.994 1.00 99.66  ? 334 ILE B N     1 
ATOM   7244  C  CA    . ILE C 1 334 ? 123.219 10.534  293.008 1.00 98.25  ? 334 ILE B CA    1 
ATOM   7245  C  C     . ILE C 1 334 ? 123.583 10.123  291.586 1.00 110.19 ? 334 ILE B C     1 
ATOM   7246  O  O     . ILE C 1 334 ? 122.724 10.057  290.708 1.00 116.28 ? 334 ILE B O     1 
ATOM   7247  C  CB    . ILE C 1 334 ? 122.428 9.394   293.676 1.00 89.89  ? 334 ILE B CB    1 
ATOM   7248  C  CG1   . ILE C 1 334 ? 121.882 9.841   295.031 1.00 90.33  ? 334 ILE B CG1   1 
ATOM   7249  C  CG2   . ILE C 1 334 ? 123.304 8.162   293.838 1.00 92.89  ? 334 ILE B CG2   1 
ATOM   7250  C  CD1   . ILE C 1 334 ? 122.955 10.221  296.026 1.00 93.25  ? 334 ILE B CD1   1 
ATOM   7251  N  N     . GLN C 1 335 ? 124.865 9.853   291.366 1.00 111.17 ? 335 GLN B N     1 
ATOM   7252  C  CA    . GLN C 1 335 ? 125.360 9.469   290.052 1.00 108.78 ? 335 GLN B CA    1 
ATOM   7253  C  C     . GLN C 1 335 ? 126.417 8.382   290.193 1.00 110.39 ? 335 GLN B C     1 
ATOM   7254  O  O     . GLN C 1 335 ? 127.462 8.607   290.803 1.00 109.66 ? 335 GLN B O     1 
ATOM   7255  C  CB    . GLN C 1 335 ? 125.956 10.683  289.342 1.00 116.51 ? 335 GLN B CB    1 
ATOM   7256  C  CG    . GLN C 1 335 ? 126.550 10.382  287.977 1.00 125.18 ? 335 GLN B CG    1 
ATOM   7257  C  CD    . GLN C 1 335 ? 127.812 11.179  287.708 1.00 133.44 ? 335 GLN B CD    1 
ATOM   7258  O  OE1   . GLN C 1 335 ? 128.760 11.142  288.492 1.00 137.23 ? 335 GLN B OE1   1 
ATOM   7259  N  NE2   . GLN C 1 335 ? 127.826 11.912  286.602 1.00 132.37 ? 335 GLN B NE2   1 
ATOM   7260  N  N     . ASN C 1 336 ? 126.134 7.211   289.626 1.00 114.14 ? 336 ASN B N     1 
ATOM   7261  C  CA    . ASN C 1 336 ? 127.019 6.050   289.725 1.00 120.02 ? 336 ASN B CA    1 
ATOM   7262  C  C     . ASN C 1 336 ? 127.272 5.616   291.166 1.00 127.07 ? 336 ASN B C     1 
ATOM   7263  O  O     . ASN C 1 336 ? 128.365 5.166   291.508 1.00 133.22 ? 336 ASN B O     1 
ATOM   7264  C  CB    . ASN C 1 336 ? 128.348 6.300   289.003 1.00 126.11 ? 336 ASN B CB    1 
ATOM   7265  C  CG    . ASN C 1 336 ? 128.171 6.535   287.516 1.00 138.11 ? 336 ASN B CG    1 
ATOM   7266  O  OD1   . ASN C 1 336 ? 127.326 5.914   286.873 1.00 139.14 ? 336 ASN B OD1   1 
ATOM   7267  N  ND2   . ASN C 1 336 ? 128.970 7.436   286.961 1.00 143.52 ? 336 ASN B ND2   1 
ATOM   7268  N  N     . GLY C 1 337 ? 126.253 5.759   292.006 1.00 122.95 ? 337 GLY B N     1 
ATOM   7269  C  CA    . GLY C 1 337 ? 126.348 5.359   293.397 1.00 120.07 ? 337 GLY B CA    1 
ATOM   7270  C  C     . GLY C 1 337 ? 126.728 6.495   294.325 1.00 122.51 ? 337 GLY B C     1 
ATOM   7271  O  O     . GLY C 1 337 ? 126.174 6.626   295.416 1.00 129.44 ? 337 GLY B O     1 
ATOM   7272  N  N     . ILE C 1 338 ? 127.678 7.319   293.893 1.00 124.05 ? 338 ILE B N     1 
ATOM   7273  C  CA    . ILE C 1 338 ? 128.138 8.439   294.708 1.00 132.61 ? 338 ILE B CA    1 
ATOM   7274  C  C     . ILE C 1 338 ? 127.350 9.717   294.409 1.00 133.08 ? 338 ILE B C     1 
ATOM   7275  O  O     . ILE C 1 338 ? 126.941 9.951   293.270 1.00 131.62 ? 338 ILE B O     1 
ATOM   7276  C  CB    . ILE C 1 338 ? 129.659 8.694   294.533 1.00 127.14 ? 338 ILE B CB    1 
ATOM   7277  C  CG1   . ILE C 1 338 ? 129.954 9.374   293.195 1.00 127.35 ? 338 ILE B CG1   1 
ATOM   7278  C  CG2   . ILE C 1 338 ? 130.438 7.391   294.660 1.00 126.20 ? 338 ILE B CG2   1 
ATOM   7279  C  CD1   . ILE C 1 338 ? 131.407 9.744   293.005 1.00 130.88 ? 338 ILE B CD1   1 
ATOM   7280  N  N     . PRO C 1 339 ? 127.114 10.539  295.444 1.00 130.80 ? 339 PRO B N     1 
ATOM   7281  C  CA    . PRO C 1 339 ? 126.422 11.820  295.269 1.00 133.05 ? 339 PRO B CA    1 
ATOM   7282  C  C     . PRO C 1 339 ? 127.362 12.886  294.714 1.00 138.77 ? 339 PRO B C     1 
ATOM   7283  O  O     . PRO C 1 339 ? 128.562 12.849  294.985 1.00 145.78 ? 339 PRO B O     1 
ATOM   7284  C  CB    . PRO C 1 339 ? 126.000 12.178  296.695 1.00 127.44 ? 339 PRO B CB    1 
ATOM   7285  C  CG    . PRO C 1 339 ? 127.038 11.546  297.553 1.00 127.58 ? 339 PRO B CG    1 
ATOM   7286  C  CD    . PRO C 1 339 ? 127.415 10.263  296.860 1.00 125.52 ? 339 PRO B CD    1 
ATOM   7287  N  N     . LYS C 1 340 ? 126.822 13.824  293.943 1.00 134.12 ? 340 LYS B N     1 
ATOM   7288  C  CA    . LYS C 1 340 ? 127.644 14.863  293.338 1.00 131.23 ? 340 LYS B CA    1 
ATOM   7289  C  C     . LYS C 1 340 ? 126.868 16.156  293.096 1.00 127.16 ? 340 LYS B C     1 
ATOM   7290  O  O     . LYS C 1 340 ? 125.673 16.129  292.788 1.00 122.56 ? 340 LYS B O     1 
ATOM   7291  C  CB    . LYS C 1 340 ? 128.255 14.361  292.025 1.00 128.04 ? 340 LYS B CB    1 
ATOM   7292  N  N     . ILE C 1 341 ? 127.557 17.283  293.261 1.00 126.05 ? 341 ILE B N     1 
ATOM   7293  C  CA    . ILE C 1 341 ? 127.026 18.587  292.885 1.00 118.64 ? 341 ILE B CA    1 
ATOM   7294  C  C     . ILE C 1 341 ? 127.220 18.759  291.382 1.00 125.61 ? 341 ILE B C     1 
ATOM   7295  O  O     . ILE C 1 341 ? 128.332 19.002  290.914 1.00 137.05 ? 341 ILE B O     1 
ATOM   7296  C  CB    . ILE C 1 341 ? 127.743 19.729  293.633 1.00 99.11  ? 341 ILE B CB    1 
ATOM   7297  N  N     . LEU C 1 342 ? 126.135 18.620  290.629 1.00 117.51 ? 342 LEU B N     1 
ATOM   7298  C  CA    . LEU C 1 342 ? 126.219 18.592  289.175 1.00 110.17 ? 342 LEU B CA    1 
ATOM   7299  C  C     . LEU C 1 342 ? 125.838 19.919  288.533 1.00 116.55 ? 342 LEU B C     1 
ATOM   7300  O  O     . LEU C 1 342 ? 124.974 20.639  289.034 1.00 114.86 ? 342 LEU B O     1 
ATOM   7301  C  CB    . LEU C 1 342 ? 125.334 17.478  288.617 1.00 109.51 ? 342 LEU B CB    1 
ATOM   7302  C  CG    . LEU C 1 342 ? 125.668 16.070  289.111 1.00 117.50 ? 342 LEU B CG    1 
ATOM   7303  C  CD1   . LEU C 1 342 ? 124.631 15.076  288.628 1.00 108.03 ? 342 LEU B CD1   1 
ATOM   7304  C  CD2   . LEU C 1 342 ? 127.060 15.656  288.656 1.00 122.91 ? 342 LEU B CD2   1 
ATOM   7305  N  N     . SER C 1 343 ? 126.492 20.229  287.418 1.00 121.73 ? 343 SER B N     1 
ATOM   7306  C  CA    . SER C 1 343 ? 126.142 21.389  286.613 1.00 126.39 ? 343 SER B CA    1 
ATOM   7307  C  C     . SER C 1 343 ? 124.918 21.055  285.773 1.00 121.91 ? 343 SER B C     1 
ATOM   7308  O  O     . SER C 1 343 ? 124.288 20.019  285.971 1.00 126.10 ? 343 SER B O     1 
ATOM   7309  C  CB    . SER C 1 343 ? 127.309 21.780  285.705 1.00 133.00 ? 343 SER B CB    1 
ATOM   7310  O  OG    . SER C 1 343 ? 127.665 20.711  284.844 1.00 133.42 ? 343 SER B OG    1 
ATOM   7311  N  N     . LEU C 1 344 ? 124.581 21.933  284.836 1.00 132.81 ? 344 LEU B N     1 
ATOM   7312  C  CA    . LEU C 1 344 ? 123.480 21.671  283.919 1.00 124.45 ? 344 LEU B CA    1 
ATOM   7313  C  C     . LEU C 1 344 ? 123.924 20.655  282.873 1.00 123.24 ? 344 LEU B C     1 
ATOM   7314  O  O     . LEU C 1 344 ? 123.205 19.697  282.562 1.00 105.44 ? 344 LEU B O     1 
ATOM   7315  C  CB    . LEU C 1 344 ? 123.030 22.968  283.245 1.00 125.68 ? 344 LEU B CB    1 
ATOM   7316  C  CG    . LEU C 1 344 ? 121.864 22.873  282.260 1.00 126.42 ? 344 LEU B CG    1 
ATOM   7317  C  CD1   . LEU C 1 344 ? 120.670 22.198  282.910 1.00 116.96 ? 344 LEU B CD1   1 
ATOM   7318  C  CD2   . LEU C 1 344 ? 121.484 24.254  281.749 1.00 132.12 ? 344 LEU B CD2   1 
ATOM   7319  N  N     . ARG C 1 345 ? 125.129 20.869  282.353 1.00 126.96 ? 345 ARG B N     1 
ATOM   7320  C  CA    . ARG C 1 345 ? 125.700 20.017  281.318 1.00 127.32 ? 345 ARG B CA    1 
ATOM   7321  C  C     . ARG C 1 345 ? 125.869 18.574  281.784 1.00 134.84 ? 345 ARG B C     1 
ATOM   7322  O  O     . ARG C 1 345 ? 125.647 17.643  281.014 1.00 143.81 ? 345 ARG B O     1 
ATOM   7323  C  CB    . ARG C 1 345 ? 127.046 20.574  280.854 1.00 122.29 ? 345 ARG B CB    1 
ATOM   7324  N  N     . GLN C 1 346 ? 126.262 18.393  283.042 1.00 129.03 ? 346 GLN B N     1 
ATOM   7325  C  CA    . GLN C 1 346 ? 126.480 17.056  283.585 1.00 119.68 ? 346 GLN B CA    1 
ATOM   7326  C  C     . GLN C 1 346 ? 125.169 16.284  283.728 1.00 117.31 ? 346 GLN B C     1 
ATOM   7327  O  O     . GLN C 1 346 ? 125.092 15.099  283.389 1.00 120.17 ? 346 GLN B O     1 
ATOM   7328  C  CB    . GLN C 1 346 ? 127.223 17.138  284.921 1.00 119.70 ? 346 GLN B CB    1 
ATOM   7329  C  CG    . GLN C 1 346 ? 128.681 17.566  284.777 1.00 113.04 ? 346 GLN B CG    1 
ATOM   7330  C  CD    . GLN C 1 346 ? 129.341 17.881  286.105 1.00 127.50 ? 346 GLN B CD    1 
ATOM   7331  O  OE1   . GLN C 1 346 ? 128.669 18.059  287.120 1.00 137.50 ? 346 GLN B OE1   1 
ATOM   7332  N  NE2   . GLN C 1 346 ? 130.667 17.955  286.102 1.00 125.63 ? 346 GLN B NE2   1 
ATOM   7333  N  N     . ILE C 1 347 ? 124.138 16.966  284.221 1.00 115.13 ? 347 ILE B N     1 
ATOM   7334  C  CA    . ILE C 1 347 ? 122.806 16.378  284.328 1.00 117.67 ? 347 ILE B CA    1 
ATOM   7335  C  C     . ILE C 1 347 ? 122.296 15.988  282.946 1.00 120.44 ? 347 ILE B C     1 
ATOM   7336  O  O     . ILE C 1 347 ? 121.820 14.869  282.736 1.00 118.79 ? 347 ILE B O     1 
ATOM   7337  C  CB    . ILE C 1 347 ? 121.801 17.355  284.973 1.00 115.10 ? 347 ILE B CB    1 
ATOM   7338  C  CG1   . ILE C 1 347 ? 122.214 17.680  286.408 1.00 121.56 ? 347 ILE B CG1   1 
ATOM   7339  C  CG2   . ILE C 1 347 ? 120.400 16.764  284.958 1.00 92.97  ? 347 ILE B CG2   1 
ATOM   7340  C  CD1   . ILE C 1 347 ? 121.359 18.748  287.061 1.00 125.69 ? 347 ILE B CD1   1 
ATOM   7341  N  N     . LEU C 1 348 ? 122.412 16.921  282.005 1.00 116.30 ? 348 LEU B N     1 
ATOM   7342  C  CA    . LEU C 1 348 ? 121.975 16.686  280.632 1.00 112.78 ? 348 LEU B CA    1 
ATOM   7343  C  C     . LEU C 1 348 ? 122.683 15.492  279.991 1.00 116.32 ? 348 LEU B C     1 
ATOM   7344  O  O     . LEU C 1 348 ? 122.034 14.622  279.414 1.00 111.15 ? 348 LEU B O     1 
ATOM   7345  C  CB    . LEU C 1 348 ? 122.164 17.947  279.787 1.00 103.78 ? 348 LEU B CB    1 
ATOM   7346  C  CG    . LEU C 1 348 ? 121.183 19.080  280.095 1.00 104.21 ? 348 LEU B CG    1 
ATOM   7347  C  CD1   . LEU C 1 348 ? 121.572 20.349  279.356 1.00 139.43 ? 348 LEU B CD1   1 
ATOM   7348  C  CD2   . LEU C 1 348 ? 119.765 18.667  279.735 1.00 101.86 ? 348 LEU B CD2   1 
ATOM   7349  N  N     . ASP C 1 349 ? 124.008 15.452  280.106 1.00 102.17 ? 349 ASP B N     1 
ATOM   7350  C  CA    . ASP C 1 349 ? 124.806 14.352  279.569 1.00 111.85 ? 349 ASP B CA    1 
ATOM   7351  C  C     . ASP C 1 349 ? 124.403 13.019  280.192 1.00 113.57 ? 349 ASP B C     1 
ATOM   7352  O  O     . ASP C 1 349 ? 124.271 12.008  279.496 1.00 116.36 ? 349 ASP B O     1 
ATOM   7353  C  CB    . ASP C 1 349 ? 126.298 14.602  279.805 1.00 120.81 ? 349 ASP B CB    1 
ATOM   7354  C  CG    . ASP C 1 349 ? 126.828 15.782  279.011 1.00 140.83 ? 349 ASP B CG    1 
ATOM   7355  O  OD1   . ASP C 1 349 ? 127.743 16.472  279.509 1.00 146.54 ? 349 ASP B OD1   1 
ATOM   7356  O  OD2   . ASP C 1 349 ? 126.329 16.022  277.891 1.00 150.97 ? 349 ASP B OD2   1 
ATOM   7357  N  N     . ALA C 1 350 ? 124.211 13.028  281.508 1.00 116.47 ? 350 ALA B N     1 
ATOM   7358  C  CA    . ALA C 1 350 ? 123.803 11.829  282.228 1.00 120.05 ? 350 ALA B CA    1 
ATOM   7359  C  C     . ALA C 1 350 ? 122.471 11.302  281.700 1.00 119.47 ? 350 ALA B C     1 
ATOM   7360  O  O     . ALA C 1 350 ? 122.339 10.112  281.383 1.00 127.64 ? 350 ALA B O     1 
ATOM   7361  C  CB    . ALA C 1 350 ? 123.711 12.114  283.717 1.00 122.97 ? 350 ALA B CB    1 
ATOM   7362  N  N     . TYR C 1 351 ? 121.491 12.195  281.597 1.00 111.37 ? 351 TYR B N     1 
ATOM   7363  C  CA    . TYR C 1 351 ? 120.172 11.825  281.093 1.00 108.23 ? 351 TYR B CA    1 
ATOM   7364  C  C     . TYR C 1 351 ? 120.236 11.310  279.657 1.00 111.01 ? 351 TYR B C     1 
ATOM   7365  O  O     . TYR C 1 351 ? 119.568 10.333  279.313 1.00 109.12 ? 351 TYR B O     1 
ATOM   7366  C  CB    . TYR C 1 351 ? 119.205 13.006  281.181 1.00 106.15 ? 351 TYR B CB    1 
ATOM   7367  C  CG    . TYR C 1 351 ? 117.855 12.723  280.564 1.00 97.97  ? 351 TYR B CG    1 
ATOM   7368  C  CD1   . TYR C 1 351 ? 116.924 11.926  281.217 1.00 86.84  ? 351 TYR B CD1   1 
ATOM   7369  C  CD2   . TYR C 1 351 ? 117.516 13.245  279.323 1.00 88.54  ? 351 TYR B CD2   1 
ATOM   7370  C  CE1   . TYR C 1 351 ? 115.695 11.661  280.655 1.00 86.92  ? 351 TYR B CE1   1 
ATOM   7371  C  CE2   . TYR C 1 351 ? 116.288 12.986  278.751 1.00 94.02  ? 351 TYR B CE2   1 
ATOM   7372  C  CZ    . TYR C 1 351 ? 115.381 12.193  279.421 1.00 93.68  ? 351 TYR B CZ    1 
ATOM   7373  O  OH    . TYR C 1 351 ? 114.157 11.929  278.857 1.00 96.26  ? 351 TYR B OH    1 
ATOM   7374  N  N     . ILE C 1 352 ? 121.041 11.970  278.828 1.00 109.40 ? 352 ILE B N     1 
ATOM   7375  C  CA    . ILE C 1 352 ? 121.217 11.565  277.437 1.00 107.38 ? 352 ILE B CA    1 
ATOM   7376  C  C     . ILE C 1 352 ? 121.774 10.147  277.338 1.00 102.76 ? 352 ILE B C     1 
ATOM   7377  O  O     . ILE C 1 352 ? 121.220 9.303   276.631 1.00 100.12 ? 352 ILE B O     1 
ATOM   7378  C  CB    . ILE C 1 352 ? 122.146 12.533  276.681 1.00 110.38 ? 352 ILE B CB    1 
ATOM   7379  C  CG1   . ILE C 1 352 ? 121.443 13.872  276.443 1.00 114.38 ? 352 ILE B CG1   1 
ATOM   7380  C  CG2   . ILE C 1 352 ? 122.569 11.936  275.348 1.00 112.19 ? 352 ILE B CG2   1 
ATOM   7381  C  CD1   . ILE C 1 352 ? 122.373 14.979  275.985 1.00 120.03 ? 352 ILE B CD1   1 
ATOM   7382  N  N     . GLU C 1 353 ? 122.868 9.895   278.052 1.00 105.77 ? 353 GLU B N     1 
ATOM   7383  C  CA    . GLU C 1 353 ? 123.495 8.577   278.066 1.00 107.83 ? 353 GLU B CA    1 
ATOM   7384  C  C     . GLU C 1 353 ? 122.516 7.511   278.550 1.00 111.25 ? 353 GLU B C     1 
ATOM   7385  O  O     . GLU C 1 353 ? 122.433 6.414   277.973 1.00 109.86 ? 353 GLU B O     1 
ATOM   7386  C  CB    . GLU C 1 353 ? 124.740 8.587   278.954 1.00 96.15  ? 353 GLU B CB    1 
ATOM   7387  N  N     . HIS C 1 354 ? 121.773 7.840   279.605 1.00 109.68 ? 354 HIS B N     1 
ATOM   7388  C  CA    . HIS C 1 354 ? 120.755 6.935   280.129 1.00 104.99 ? 354 HIS B CA    1 
ATOM   7389  C  C     . HIS C 1 354 ? 119.725 6.604   279.054 1.00 107.96 ? 354 HIS B C     1 
ATOM   7390  O  O     . HIS C 1 354 ? 119.311 5.452   278.905 1.00 101.16 ? 354 HIS B O     1 
ATOM   7391  C  CB    . HIS C 1 354 ? 120.070 7.553   281.345 1.00 97.80  ? 354 HIS B CB    1 
ATOM   7392  C  CG    . HIS C 1 354 ? 118.961 6.717   281.903 1.00 93.16  ? 354 HIS B CG    1 
ATOM   7393  N  ND1   . HIS C 1 354 ? 119.154 5.427   282.350 1.00 93.08  ? 354 HIS B ND1   1 
ATOM   7394  C  CD2   . HIS C 1 354 ? 117.644 6.981   282.078 1.00 86.92  ? 354 HIS B CD2   1 
ATOM   7395  C  CE1   . HIS C 1 354 ? 118.006 4.936   282.781 1.00 87.70  ? 354 HIS B CE1   1 
ATOM   7396  N  NE2   . HIS C 1 354 ? 117.073 5.858   282.627 1.00 82.40  ? 354 HIS B NE2   1 
ATOM   7397  N  N     . GLN C 1 355 ? 119.327 7.621   278.298 1.00 112.95 ? 355 GLN B N     1 
ATOM   7398  C  CA    . GLN C 1 355 ? 118.357 7.444   277.228 1.00 105.11 ? 355 GLN B CA    1 
ATOM   7399  C  C     . GLN C 1 355 ? 118.902 6.547   276.125 1.00 108.72 ? 355 GLN B C     1 
ATOM   7400  O  O     . GLN C 1 355 ? 118.172 5.729   275.560 1.00 116.59 ? 355 GLN B O     1 
ATOM   7401  C  CB    . GLN C 1 355 ? 117.943 8.800   276.658 1.00 102.65 ? 355 GLN B CB    1 
ATOM   7402  C  CG    . GLN C 1 355 ? 116.445 8.959   276.485 1.00 106.79 ? 355 GLN B CG    1 
ATOM   7403  C  CD    . GLN C 1 355 ? 115.695 8.881   277.799 1.00 109.86 ? 355 GLN B CD    1 
ATOM   7404  O  OE1   . GLN C 1 355 ? 114.515 8.545   277.829 1.00 110.70 ? 355 GLN B OE1   1 
ATOM   7405  N  NE2   . GLN C 1 355 ? 116.375 9.204   278.893 1.00 119.63 ? 355 GLN B NE2   1 
ATOM   7406  N  N     . LYS C 1 356 ? 120.188 6.702   275.824 1.00 103.91 ? 356 LYS B N     1 
ATOM   7407  C  CA    . LYS C 1 356 ? 120.842 5.859   274.833 1.00 104.38 ? 356 LYS B CA    1 
ATOM   7408  C  C     . LYS C 1 356 ? 120.831 4.402   275.281 1.00 105.79 ? 356 LYS B C     1 
ATOM   7409  O  O     . LYS C 1 356 ? 120.515 3.505   274.493 1.00 99.21  ? 356 LYS B O     1 
ATOM   7410  C  CB    . LYS C 1 356 ? 122.272 6.334   274.579 1.00 93.31  ? 356 LYS B CB    1 
ATOM   7411  C  CG    . LYS C 1 356 ? 122.354 7.708   273.936 1.00 96.31  ? 356 LYS B CG    1 
ATOM   7412  C  CD    . LYS C 1 356 ? 123.793 8.132   273.701 1.00 121.21 ? 356 LYS B CD    1 
ATOM   7413  C  CE    . LYS C 1 356 ? 123.868 9.471   272.978 1.00 133.81 ? 356 LYS B CE    1 
ATOM   7414  N  NZ    . LYS C 1 356 ? 125.273 9.903   272.731 1.00 147.96 ? 356 LYS B NZ    1 
ATOM   7415  N  N     . GLU C 1 357 ? 121.168 4.171   276.548 1.00 107.36 ? 357 GLU B N     1 
ATOM   7416  C  CA    . GLU C 1 357 ? 121.168 2.815   277.086 1.00 98.42  ? 357 GLU B CA    1 
ATOM   7417  C  C     . GLU C 1 357 ? 119.769 2.205   277.037 1.00 89.53  ? 357 GLU B C     1 
ATOM   7418  O  O     . GLU C 1 357 ? 119.604 1.039   276.671 1.00 92.96  ? 357 GLU B O     1 
ATOM   7419  C  CB    . GLU C 1 357 ? 121.702 2.793   278.517 1.00 94.70  ? 357 GLU B CB    1 
ATOM   7420  C  CG    . GLU C 1 357 ? 122.060 1.397   279.013 1.00 105.01 ? 357 GLU B CG    1 
ATOM   7421  C  CD    . GLU C 1 357 ? 121.912 1.249   280.515 1.00 119.33 ? 357 GLU B CD    1 
ATOM   7422  O  OE1   . GLU C 1 357 ? 122.842 0.721   281.161 1.00 119.61 ? 357 GLU B OE1   1 
ATOM   7423  O  OE2   . GLU C 1 357 ? 120.858 1.652   281.050 1.00 126.11 ? 357 GLU B OE2   1 
ATOM   7424  N  N     . VAL C 1 358 ? 118.764 3.000   277.399 1.00 86.46  ? 358 VAL B N     1 
ATOM   7425  C  CA    . VAL C 1 358 ? 117.378 2.537   277.371 1.00 92.84  ? 358 VAL B CA    1 
ATOM   7426  C  C     . VAL C 1 358 ? 116.928 2.154   275.959 1.00 100.17 ? 358 VAL B C     1 
ATOM   7427  O  O     . VAL C 1 358 ? 116.429 1.047   275.737 1.00 102.26 ? 358 VAL B O     1 
ATOM   7428  C  CB    . VAL C 1 358 ? 116.412 3.589   277.958 1.00 96.65  ? 358 VAL B CB    1 
ATOM   7429  C  CG1   . VAL C 1 358 ? 114.971 3.251   277.601 1.00 98.50  ? 358 VAL B CG1   1 
ATOM   7430  C  CG2   . VAL C 1 358 ? 116.588 3.688   279.471 1.00 94.73  ? 358 VAL B CG2   1 
ATOM   7431  N  N     . VAL C 1 359 ? 117.114 3.069   275.010 1.00 101.36 ? 359 VAL B N     1 
ATOM   7432  C  CA    . VAL C 1 359 ? 116.725 2.823   273.622 1.00 105.73 ? 359 VAL B CA    1 
ATOM   7433  C  C     . VAL C 1 359 ? 117.449 1.610   273.034 1.00 106.32 ? 359 VAL B C     1 
ATOM   7434  O  O     . VAL C 1 359 ? 116.828 0.758   272.392 1.00 109.06 ? 359 VAL B O     1 
ATOM   7435  C  CB    . VAL C 1 359 ? 116.953 4.066   272.732 1.00 111.13 ? 359 VAL B CB    1 
ATOM   7436  C  CG1   . VAL C 1 359 ? 116.758 3.717   271.262 1.00 108.09 ? 359 VAL B CG1   1 
ATOM   7437  C  CG2   . VAL C 1 359 ? 116.012 5.188   273.142 1.00 108.12 ? 359 VAL B CG2   1 
ATOM   7438  N  N     . VAL C 1 360 ? 118.755 1.524   273.270 1.00 102.01 ? 360 VAL B N     1 
ATOM   7439  C  CA    . VAL C 1 360 ? 119.538 0.393   272.785 1.00 84.57  ? 360 VAL B CA    1 
ATOM   7440  C  C     . VAL C 1 360 ? 119.048 -0.935  273.372 1.00 97.03  ? 360 VAL B C     1 
ATOM   7441  O  O     . VAL C 1 360 ? 118.788 -1.887  272.630 1.00 95.04  ? 360 VAL B O     1 
ATOM   7442  C  CB    . VAL C 1 360 ? 121.044 0.585   273.060 1.00 87.74  ? 360 VAL B CB    1 
ATOM   7443  C  CG1   . VAL C 1 360 ? 121.792 -0.728  272.894 1.00 89.23  ? 360 VAL B CG1   1 
ATOM   7444  C  CG2   . VAL C 1 360 ? 121.620 1.656   272.140 1.00 91.32  ? 360 VAL B CG2   1 
ATOM   7445  N  N     . ARG C 1 361 ? 118.911 -0.988  274.695 1.00 99.45  ? 361 ARG B N     1 
ATOM   7446  C  CA    . ARG C 1 361 ? 118.403 -2.181  275.373 1.00 102.20 ? 361 ARG B CA    1 
ATOM   7447  C  C     . ARG C 1 361 ? 117.041 -2.622  274.831 1.00 107.66 ? 361 ARG B C     1 
ATOM   7448  O  O     . ARG C 1 361 ? 116.819 -3.808  274.562 1.00 111.42 ? 361 ARG B O     1 
ATOM   7449  C  CB    . ARG C 1 361 ? 118.312 -1.938  276.881 1.00 95.91  ? 361 ARG B CB    1 
ATOM   7450  C  CG    . ARG C 1 361 ? 119.628 -2.120  277.622 1.00 99.08  ? 361 ARG B CG    1 
ATOM   7451  C  CD    . ARG C 1 361 ? 119.547 -1.593  279.044 1.00 110.66 ? 361 ARG B CD    1 
ATOM   7452  N  NE    . ARG C 1 361 ? 120.111 -2.526  280.016 1.00 116.01 ? 361 ARG B NE    1 
ATOM   7453  C  CZ    . ARG C 1 361 ? 119.383 -3.341  280.773 1.00 116.29 ? 361 ARG B CZ    1 
ATOM   7454  N  NH1   . ARG C 1 361 ? 118.063 -3.328  280.675 1.00 108.44 ? 361 ARG B NH1   1 
ATOM   7455  N  NH2   . ARG C 1 361 ? 119.971 -4.163  281.631 1.00 124.02 ? 361 ARG B NH2   1 
ATOM   7456  N  N     . ARG C 1 362 ? 116.141 -1.657  274.667 1.00 103.61 ? 362 ARG B N     1 
ATOM   7457  C  CA    . ARG C 1 362 ? 114.820 -1.915  274.100 1.00 98.82  ? 362 ARG B CA    1 
ATOM   7458  C  C     . ARG C 1 362 ? 114.930 -2.533  272.709 1.00 103.47 ? 362 ARG B C     1 
ATOM   7459  O  O     . ARG C 1 362 ? 114.300 -3.555  272.417 1.00 109.73 ? 362 ARG B O     1 
ATOM   7460  C  CB    . ARG C 1 362 ? 114.016 -0.616  274.023 1.00 90.63  ? 362 ARG B CB    1 
ATOM   7461  C  CG    . ARG C 1 362 ? 112.630 -0.778  273.423 1.00 82.75  ? 362 ARG B CG    1 
ATOM   7462  C  CD    . ARG C 1 362 ? 111.947 0.570   273.253 1.00 76.68  ? 362 ARG B CD    1 
ATOM   7463  N  NE    . ARG C 1 362 ? 112.662 1.433   272.321 1.00 87.83  ? 362 ARG B NE    1 
ATOM   7464  C  CZ    . ARG C 1 362 ? 112.260 2.649   271.968 1.00 103.11 ? 362 ARG B CZ    1 
ATOM   7465  N  NH1   . ARG C 1 362 ? 111.140 3.153   272.469 1.00 107.05 ? 362 ARG B NH1   1 
ATOM   7466  N  NH2   . ARG C 1 362 ? 112.976 3.366   271.111 1.00 109.95 ? 362 ARG B NH2   1 
ATOM   7467  N  N     . THR C 1 363 ? 115.738 -1.903  271.859 1.00 99.33  ? 363 THR B N     1 
ATOM   7468  C  CA    . THR C 1 363 ? 115.950 -2.382  270.496 1.00 99.91  ? 363 THR B CA    1 
ATOM   7469  C  C     . THR C 1 363 ? 116.473 -3.817  270.489 1.00 98.77  ? 363 THR B C     1 
ATOM   7470  O  O     . THR C 1 363 ? 116.072 -4.630  269.657 1.00 103.33 ? 363 THR B O     1 
ATOM   7471  C  CB    . THR C 1 363 ? 116.926 -1.469  269.719 1.00 101.94 ? 363 THR B CB    1 
ATOM   7472  O  OG1   . THR C 1 363 ? 116.371 -0.152  269.613 1.00 97.48  ? 363 THR B OG1   1 
ATOM   7473  C  CG2   . THR C 1 363 ? 117.181 -2.015  268.322 1.00 104.46 ? 363 THR B CG2   1 
ATOM   7474  N  N     . ARG C 1 364 ? 117.360 -4.124  271.432 1.00 94.17  ? 364 ARG B N     1 
ATOM   7475  C  CA    . ARG C 1 364 ? 117.896 -5.475  271.569 1.00 80.56  ? 364 ARG B CA    1 
ATOM   7476  C  C     . ARG C 1 364 ? 116.802 -6.471  271.948 1.00 90.03  ? 364 ARG B C     1 
ATOM   7477  O  O     . ARG C 1 364 ? 116.722 -7.565  271.381 1.00 82.44  ? 364 ARG B O     1 
ATOM   7478  C  CB    . ARG C 1 364 ? 119.016 -5.504  272.609 1.00 81.86  ? 364 ARG B CB    1 
ATOM   7479  C  CG    . ARG C 1 364 ? 120.243 -4.689  272.230 1.00 85.21  ? 364 ARG B CG    1 
ATOM   7480  C  CD    . ARG C 1 364 ? 121.266 -4.688  273.354 1.00 106.71 ? 364 ARG B CD    1 
ATOM   7481  N  NE    . ARG C 1 364 ? 121.693 -6.040  273.697 1.00 111.23 ? 364 ARG B NE    1 
ATOM   7482  C  CZ    . ARG C 1 364 ? 122.947 -6.471  273.612 1.00 124.36 ? 364 ARG B CZ    1 
ATOM   7483  N  NH1   . ARG C 1 364 ? 123.907 -5.652  273.201 1.00 134.38 ? 364 ARG B NH1   1 
ATOM   7484  N  NH2   . ARG C 1 364 ? 123.243 -7.719  273.947 1.00 124.80 ? 364 ARG B NH2   1 
ATOM   7485  N  N     . PHE C 1 365 ? 115.965 -6.086  272.910 1.00 96.45  ? 365 PHE B N     1 
ATOM   7486  C  CA    . PHE C 1 365 ? 114.839 -6.918  273.333 1.00 93.02  ? 365 PHE B CA    1 
ATOM   7487  C  C     . PHE C 1 365 ? 113.934 -7.250  272.147 1.00 98.55  ? 365 PHE B C     1 
ATOM   7488  O  O     . PHE C 1 365 ? 113.653 -8.426  271.865 1.00 108.89 ? 365 PHE B O     1 
ATOM   7489  C  CB    . PHE C 1 365 ? 114.045 -6.202  274.429 1.00 90.85  ? 365 PHE B CB    1 
ATOM   7490  C  CG    . PHE C 1 365 ? 112.831 -6.955  274.901 1.00 89.49  ? 365 PHE B CG    1 
ATOM   7491  C  CD1   . PHE C 1 365 ? 112.926 -7.867  275.940 1.00 87.40  ? 365 PHE B CD1   1 
ATOM   7492  C  CD2   . PHE C 1 365 ? 111.592 -6.734  274.321 1.00 80.69  ? 365 PHE B CD2   1 
ATOM   7493  C  CE1   . PHE C 1 365 ? 111.811 -8.555  276.383 1.00 75.92  ? 365 PHE B CE1   1 
ATOM   7494  C  CE2   . PHE C 1 365 ? 110.475 -7.420  274.757 1.00 84.04  ? 365 PHE B CE2   1 
ATOM   7495  C  CZ    . PHE C 1 365 ? 110.583 -8.330  275.789 1.00 78.82  ? 365 PHE B CZ    1 
ATOM   7496  N  N     . ASP C 1 366 ? 113.486 -6.203  271.457 1.00 93.59  ? 366 ASP B N     1 
ATOM   7497  C  CA    . ASP C 1 366 ? 112.658 -6.362  270.266 1.00 89.92  ? 366 ASP B CA    1 
ATOM   7498  C  C     . ASP C 1 366 ? 113.323 -7.270  269.234 1.00 93.32  ? 366 ASP B C     1 
ATOM   7499  O  O     . ASP C 1 366 ? 112.668 -8.133  268.646 1.00 97.42  ? 366 ASP B O     1 
ATOM   7500  C  CB    . ASP C 1 366 ? 112.350 -5.004  269.638 1.00 93.55  ? 366 ASP B CB    1 
ATOM   7501  C  CG    . ASP C 1 366 ? 111.477 -4.135  270.521 1.00 96.89  ? 366 ASP B CG    1 
ATOM   7502  O  OD1   . ASP C 1 366 ? 110.695 -4.686  271.325 1.00 97.87  ? 366 ASP B OD1   1 
ATOM   7503  O  OD2   . ASP C 1 366 ? 111.575 -2.893  270.406 1.00 96.49  ? 366 ASP B OD2   1 
ATOM   7504  N  N     . LYS C 1 367 ? 114.621 -7.063  269.024 1.00 93.84  ? 367 LYS B N     1 
ATOM   7505  C  CA    . LYS C 1 367 ? 115.411 -7.881  268.107 1.00 96.42  ? 367 LYS B CA    1 
ATOM   7506  C  C     . LYS C 1 367 ? 115.302 -9.363  268.448 1.00 96.95  ? 367 LYS B C     1 
ATOM   7507  O  O     . LYS C 1 367 ? 114.918 -10.181 267.608 1.00 109.42 ? 367 LYS B O     1 
ATOM   7508  C  CB    . LYS C 1 367 ? 116.879 -7.451  268.151 1.00 97.73  ? 367 LYS B CB    1 
ATOM   7509  C  CG    . LYS C 1 367 ? 117.841 -8.420  267.478 1.00 94.84  ? 367 LYS B CG    1 
ATOM   7510  C  CD    . LYS C 1 367 ? 117.921 -8.181  265.981 1.00 100.30 ? 367 LYS B CD    1 
ATOM   7511  C  CE    . LYS C 1 367 ? 119.333 -7.795  265.570 1.00 102.91 ? 367 LYS B CE    1 
ATOM   7512  N  NZ    . LYS C 1 367 ? 120.331 -8.821  265.988 1.00 100.83 ? 367 LYS B NZ    1 
ATOM   7513  N  N     . GLU C 1 368 ? 115.638 -9.696  269.691 1.00 87.33  ? 368 GLU B N     1 
ATOM   7514  C  CA    . GLU C 1 368 ? 115.634 -11.080 270.145 1.00 90.14  ? 368 GLU B CA    1 
ATOM   7515  C  C     . GLU C 1 368 ? 114.253 -11.716 269.994 1.00 97.29  ? 368 GLU B C     1 
ATOM   7516  O  O     . GLU C 1 368 ? 114.125 -12.841 269.488 1.00 106.88 ? 368 GLU B O     1 
ATOM   7517  C  CB    . GLU C 1 368 ? 116.097 -11.163 271.602 1.00 78.22  ? 368 GLU B CB    1 
ATOM   7518  N  N     . LYS C 1 369 ? 113.225 -10.985 270.423 1.00 98.65  ? 369 LYS B N     1 
ATOM   7519  C  CA    . LYS C 1 369 ? 111.850 -11.467 270.317 1.00 105.90 ? 369 LYS B CA    1 
ATOM   7520  C  C     . LYS C 1 369 ? 111.488 -11.789 268.869 1.00 109.22 ? 369 LYS B C     1 
ATOM   7521  O  O     . LYS C 1 369 ? 110.996 -12.887 268.559 1.00 120.00 ? 369 LYS B O     1 
ATOM   7522  C  CB    . LYS C 1 369 ? 110.877 -10.427 270.879 1.00 103.82 ? 369 LYS B CB    1 
ATOM   7523  N  N     . ALA C 1 370 ? 111.750 -10.825 267.990 1.00 107.31 ? 370 ALA B N     1 
ATOM   7524  C  CA    . ALA C 1 370 ? 111.451 -10.965 266.570 1.00 108.55 ? 370 ALA B CA    1 
ATOM   7525  C  C     . ALA C 1 370 ? 112.154 -12.177 265.967 1.00 100.00 ? 370 ALA B C     1 
ATOM   7526  O  O     . ALA C 1 370 ? 111.535 -12.966 265.250 1.00 100.44 ? 370 ALA B O     1 
ATOM   7527  C  CB    . ALA C 1 370 ? 111.836 -9.699  265.820 1.00 109.55 ? 370 ALA B CB    1 
ATOM   7528  N  N     . GLU C 1 371 ? 113.441 -12.327 266.268 1.00 91.29  ? 371 GLU B N     1 
ATOM   7529  C  CA    . GLU C 1 371 ? 114.220 -13.440 265.736 1.00 97.67  ? 371 GLU B CA    1 
ATOM   7530  C  C     . GLU C 1 371 ? 113.708 -14.799 266.212 1.00 103.05 ? 371 GLU B C     1 
ATOM   7531  O  O     . GLU C 1 371 ? 113.611 -15.746 265.422 1.00 110.51 ? 371 GLU B O     1 
ATOM   7532  C  CB    . GLU C 1 371 ? 115.703 -13.274 266.077 1.00 84.44  ? 371 GLU B CB    1 
ATOM   7533  C  CG    . GLU C 1 371 ? 116.352 -12.072 265.412 1.00 109.09 ? 371 GLU B CG    1 
ATOM   7534  C  CD    . GLU C 1 371 ? 117.858 -12.188 265.344 1.00 123.11 ? 371 GLU B CD    1 
ATOM   7535  O  OE1   . GLU C 1 371 ? 118.403 -12.113 264.224 1.00 129.85 ? 371 GLU B OE1   1 
ATOM   7536  O  OE2   . GLU C 1 371 ? 118.497 -12.348 266.405 1.00 129.39 ? 371 GLU B OE2   1 
ATOM   7537  N  N     . ALA C 1 372 ? 113.380 -14.892 267.498 1.00 102.32 ? 372 ALA B N     1 
ATOM   7538  C  CA    . ALA C 1 372 ? 112.831 -16.130 268.045 1.00 99.92  ? 372 ALA B CA    1 
ATOM   7539  C  C     . ALA C 1 372 ? 111.534 -16.499 267.326 1.00 97.57  ? 372 ALA B C     1 
ATOM   7540  O  O     . ALA C 1 372 ? 111.361 -17.638 266.858 1.00 101.28 ? 372 ALA B O     1 
ATOM   7541  C  CB    . ALA C 1 372 ? 112.593 -15.990 269.540 1.00 87.49  ? 372 ALA B CB    1 
ATOM   7542  N  N     . ARG C 1 373 ? 110.634 -15.522 267.232 1.00 85.80  ? 373 ARG B N     1 
ATOM   7543  C  CA    . ARG C 1 373 ? 109.356 -15.724 266.558 1.00 85.44  ? 373 ARG B CA    1 
ATOM   7544  C  C     . ARG C 1 373 ? 109.562 -16.173 265.109 1.00 88.98  ? 373 ARG B C     1 
ATOM   7545  O  O     . ARG C 1 373 ? 108.838 -17.036 264.604 1.00 82.36  ? 373 ARG B O     1 
ATOM   7546  C  CB    . ARG C 1 373 ? 108.519 -14.444 266.611 1.00 74.91  ? 373 ARG B CB    1 
ATOM   7547  C  CG    . ARG C 1 373 ? 107.139 -14.567 265.984 1.00 105.01 ? 373 ARG B CG    1 
ATOM   7548  C  CD    . ARG C 1 373 ? 106.329 -15.681 266.624 1.00 104.78 ? 373 ARG B CD    1 
ATOM   7549  N  NE    . ARG C 1 373 ? 105.022 -15.826 265.991 1.00 105.76 ? 373 ARG B NE    1 
ATOM   7550  C  CZ    . ARG C 1 373 ? 104.154 -16.788 266.283 1.00 104.03 ? 373 ARG B CZ    1 
ATOM   7551  N  NH1   . ARG C 1 373 ? 104.454 -17.698 267.199 1.00 105.99 ? 373 ARG B NH1   1 
ATOM   7552  N  NH2   . ARG C 1 373 ? 102.988 -16.844 265.655 1.00 97.61  ? 373 ARG B NH2   1 
ATOM   7553  N  N     . ALA C 1 374 ? 110.564 -15.593 264.454 1.00 89.61  ? 374 ALA B N     1 
ATOM   7554  C  CA    . ALA C 1 374 ? 110.892 -15.955 263.081 1.00 90.09  ? 374 ALA B CA    1 
ATOM   7555  C  C     . ALA C 1 374 ? 111.345 -17.410 262.985 1.00 92.03  ? 374 ALA B C     1 
ATOM   7556  O  O     . ALA C 1 374 ? 110.930 -18.137 262.085 1.00 98.36  ? 374 ALA B O     1 
ATOM   7557  C  CB    . ALA C 1 374 ? 111.958 -15.025 262.529 1.00 94.27  ? 374 ALA B CB    1 
ATOM   7558  N  N     . HIS C 1 375 ? 112.200 -17.823 263.915 1.00 83.61  ? 375 HIS B N     1 
ATOM   7559  C  CA    . HIS C 1 375 ? 112.684 -19.202 263.980 1.00 104.44 ? 375 HIS B CA    1 
ATOM   7560  C  C     . HIS C 1 375 ? 111.513 -20.181 264.087 1.00 103.83 ? 375 HIS B C     1 
ATOM   7561  O  O     . HIS C 1 375 ? 111.361 -21.112 263.264 1.00 111.78 ? 375 HIS B O     1 
ATOM   7562  C  CB    . HIS C 1 375 ? 113.604 -19.349 265.191 1.00 85.50  ? 375 HIS B CB    1 
ATOM   7563  C  CG    . HIS C 1 375 ? 114.253 -20.692 265.309 1.00 93.55  ? 375 HIS B CG    1 
ATOM   7564  N  ND1   . HIS C 1 375 ? 115.442 -21.005 264.685 1.00 99.29  ? 375 HIS B ND1   1 
ATOM   7565  C  CD2   . HIS C 1 375 ? 113.889 -21.800 265.997 1.00 94.99  ? 375 HIS B CD2   1 
ATOM   7566  C  CE1   . HIS C 1 375 ? 115.776 -22.249 264.976 1.00 106.92 ? 375 HIS B CE1   1 
ATOM   7567  N  NE2   . HIS C 1 375 ? 114.850 -22.755 265.770 1.00 98.91  ? 375 HIS B NE2   1 
ATOM   7568  N  N     . ILE C 1 376 ? 110.678 -19.954 265.100 1.00 94.95  ? 376 ILE B N     1 
ATOM   7569  C  CA    . ILE C 1 376 ? 109.498 -20.788 265.308 1.00 98.08  ? 376 ILE B CA    1 
ATOM   7570  C  C     . ILE C 1 376 ? 108.627 -20.827 264.049 1.00 108.41 ? 376 ILE B C     1 
ATOM   7571  O  O     . ILE C 1 376 ? 108.136 -21.886 263.657 1.00 116.70 ? 376 ILE B O     1 
ATOM   7572  C  CB    . ILE C 1 376 ? 108.672 -20.322 266.532 1.00 96.83  ? 376 ILE B CB    1 
ATOM   7573  C  CG1   . ILE C 1 376 ? 109.133 -21.048 267.801 1.00 105.45 ? 376 ILE B CG1   1 
ATOM   7574  C  CG2   . ILE C 1 376 ? 107.186 -20.581 266.319 1.00 92.77  ? 376 ILE B CG2   1 
ATOM   7575  C  CD1   . ILE C 1 376 ? 110.559 -20.746 268.225 1.00 110.12 ? 376 ILE B CD1   1 
ATOM   7576  N  N     . LEU C 1 377 ? 108.469 -19.675 263.402 1.00 104.93 ? 377 LEU B N     1 
ATOM   7577  C  CA    . LEU C 1 377 ? 107.660 -19.583 262.188 1.00 95.73  ? 377 LEU B CA    1 
ATOM   7578  C  C     . LEU C 1 377 ? 108.247 -20.362 261.010 1.00 95.25  ? 377 LEU B C     1 
ATOM   7579  O  O     . LEU C 1 377 ? 107.503 -20.896 260.183 1.00 97.81  ? 377 LEU B O     1 
ATOM   7580  C  CB    . LEU C 1 377 ? 107.426 -18.120 261.806 1.00 100.78 ? 377 LEU B CB    1 
ATOM   7581  C  CG    . LEU C 1 377 ? 106.041 -17.569 262.152 1.00 101.33 ? 377 LEU B CG    1 
ATOM   7582  C  CD1   . LEU C 1 377 ? 105.533 -18.152 263.465 1.00 89.22  ? 377 LEU B CD1   1 
ATOM   7583  C  CD2   . LEU C 1 377 ? 106.073 -16.050 262.215 1.00 107.12 ? 377 LEU B CD2   1 
ATOM   7584  N  N     . GLU C 1 378 ? 109.574 -20.419 260.933 1.00 101.15 ? 378 GLU B N     1 
ATOM   7585  C  CA    . GLU C 1 378 ? 110.239 -21.254 259.938 1.00 106.23 ? 378 GLU B CA    1 
ATOM   7586  C  C     . GLU C 1 378 ? 109.851 -22.702 260.191 1.00 109.37 ? 378 GLU B C     1 
ATOM   7587  O  O     . GLU C 1 378 ? 109.435 -23.424 259.271 1.00 111.76 ? 378 GLU B O     1 
ATOM   7588  C  CB    . GLU C 1 378 ? 111.758 -21.106 260.026 1.00 104.07 ? 378 GLU B CB    1 
ATOM   7589  C  CG    . GLU C 1 378 ? 112.277 -19.727 259.657 1.00 106.22 ? 378 GLU B CG    1 
ATOM   7590  C  CD    . GLU C 1 378 ? 113.751 -19.557 259.969 1.00 112.46 ? 378 GLU B CD    1 
ATOM   7591  O  OE1   . GLU C 1 378 ? 114.375 -20.521 260.463 1.00 113.54 ? 378 GLU B OE1   1 
ATOM   7592  O  OE2   . GLU C 1 378 ? 114.286 -18.456 259.720 1.00 112.42 ? 378 GLU B OE2   1 
ATOM   7593  N  N     . GLY C 1 379 ? 109.980 -23.115 261.451 1.00 109.73 ? 379 GLY B N     1 
ATOM   7594  C  CA    . GLY C 1 379 ? 109.574 -24.455 261.846 1.00 113.95 ? 379 GLY B CA    1 
ATOM   7595  C  C     . GLY C 1 379 ? 108.151 -24.789 261.426 1.00 116.11 ? 379 GLY B C     1 
ATOM   7596  O  O     . GLY C 1 379 ? 107.903 -25.800 260.759 1.00 117.37 ? 379 GLY B O     1 
ATOM   7597  N  N     . LEU C 1 380 ? 107.215 -23.922 261.804 1.00 108.73 ? 380 LEU B N     1 
ATOM   7598  C  CA    . LEU C 1 380 ? 105.801 -24.113 261.490 1.00 101.33 ? 380 LEU B CA    1 
ATOM   7599  C  C     . LEU C 1 380 ? 105.540 -24.181 259.986 1.00 101.25 ? 380 LEU B C     1 
ATOM   7600  O  O     . LEU C 1 380 ? 104.747 -25.004 259.524 1.00 94.34  ? 380 LEU B O     1 
ATOM   7601  C  CB    . LEU C 1 380 ? 104.956 -23.002 262.123 1.00 83.36  ? 380 LEU B CB    1 
ATOM   7602  C  CG    . LEU C 1 380 ? 105.007 -22.910 263.649 1.00 116.10 ? 380 LEU B CG    1 
ATOM   7603  C  CD1   . LEU C 1 380 ? 104.101 -21.798 264.150 1.00 123.12 ? 380 LEU B CD1   1 
ATOM   7604  C  CD2   . LEU C 1 380 ? 104.625 -24.242 264.279 1.00 82.25  ? 380 LEU B CD2   1 
ATOM   7605  N  N     . LEU C 1 381 ? 106.206 -23.313 259.228 1.00 106.71 ? 381 LEU B N     1 
ATOM   7606  C  CA    . LEU C 1 381 ? 106.068 -23.302 257.775 1.00 91.05  ? 381 LEU B CA    1 
ATOM   7607  C  C     . LEU C 1 381 ? 106.497 -24.636 257.178 1.00 93.31  ? 381 LEU B C     1 
ATOM   7608  O  O     . LEU C 1 381 ? 105.811 -25.191 256.313 1.00 95.01  ? 381 LEU B O     1 
ATOM   7609  C  CB    . LEU C 1 381 ? 106.881 -22.161 257.167 1.00 108.12 ? 381 LEU B CB    1 
ATOM   7610  C  CG    . LEU C 1 381 ? 106.103 -21.005 256.527 1.00 104.38 ? 381 LEU B CG    1 
ATOM   7611  C  CD1   . LEU C 1 381 ? 104.597 -21.138 256.748 1.00 96.40  ? 381 LEU B CD1   1 
ATOM   7612  C  CD2   . LEU C 1 381 ? 106.613 -19.668 257.045 1.00 97.32  ? 381 LEU B CD2   1 
ATOM   7613  N  N     . ILE C 1 382 ? 107.630 -25.150 257.648 1.00 114.69 ? 382 ILE B N     1 
ATOM   7614  C  CA    . ILE C 1 382 ? 108.082 -26.474 257.228 1.00 96.17  ? 382 ILE B CA    1 
ATOM   7615  C  C     . ILE C 1 382 ? 107.021 -27.527 257.555 1.00 98.06  ? 382 ILE B C     1 
ATOM   7616  O  O     . ILE C 1 382 ? 106.680 -28.366 256.714 1.00 97.66  ? 382 ILE B O     1 
ATOM   7617  C  CB    . ILE C 1 382 ? 109.415 -26.861 257.893 1.00 101.10 ? 382 ILE B CB    1 
ATOM   7618  C  CG1   . ILE C 1 382 ? 110.523 -25.908 257.446 1.00 98.53  ? 382 ILE B CG1   1 
ATOM   7619  C  CG2   . ILE C 1 382 ? 109.783 -28.294 257.546 1.00 99.95  ? 382 ILE B CG2   1 
ATOM   7620  C  CD1   . ILE C 1 382 ? 111.876 -26.219 258.049 1.00 112.89 ? 382 ILE B CD1   1 
ATOM   7621  N  N     . ALA C 1 383 ? 106.492 -27.462 258.776 1.00 97.94  ? 383 ALA B N     1 
ATOM   7622  C  CA    . ALA C 1 383 ? 105.460 -28.397 259.222 1.00 101.13 ? 383 ALA B CA    1 
ATOM   7623  C  C     . ALA C 1 383 ? 104.236 -28.407 258.300 1.00 107.46 ? 383 ALA B C     1 
ATOM   7624  O  O     . ALA C 1 383 ? 103.756 -29.470 257.900 1.00 95.20  ? 383 ALA B O     1 
ATOM   7625  C  CB    . ALA C 1 383 ? 105.048 -28.081 260.653 1.00 95.44  ? 383 ALA B CB    1 
ATOM   7626  N  N     . LEU C 1 384 ? 103.740 -27.220 257.962 1.00 111.19 ? 384 LEU B N     1 
ATOM   7627  C  CA    . LEU C 1 384 ? 102.584 -27.097 257.081 1.00 113.17 ? 384 LEU B CA    1 
ATOM   7628  C  C     . LEU C 1 384 ? 102.918 -27.529 255.656 1.00 119.75 ? 384 LEU B C     1 
ATOM   7629  O  O     . LEU C 1 384 ? 102.042 -27.956 254.905 1.00 123.46 ? 384 LEU B O     1 
ATOM   7630  C  CB    . LEU C 1 384 ? 102.050 -25.664 257.094 1.00 109.33 ? 384 LEU B CB    1 
ATOM   7631  C  CG    . LEU C 1 384 ? 101.500 -25.165 258.430 1.00 100.51 ? 384 LEU B CG    1 
ATOM   7632  C  CD1   . LEU C 1 384 ? 101.003 -23.740 258.295 1.00 99.42  ? 384 LEU B CD1   1 
ATOM   7633  C  CD2   . LEU C 1 384 ? 100.382 -26.071 258.916 1.00 90.90  ? 384 LEU B CD2   1 
ATOM   7634  N  N     . ASP C 1 385 ? 104.190 -27.414 255.285 1.00 122.55 ? 385 ASP B N     1 
ATOM   7635  C  CA    . ASP C 1 385 ? 104.633 -27.876 253.974 1.00 123.09 ? 385 ASP B CA    1 
ATOM   7636  C  C     . ASP C 1 385 ? 104.698 -29.397 253.922 1.00 123.15 ? 385 ASP B C     1 
ATOM   7637  O  O     . ASP C 1 385 ? 104.593 -29.996 252.851 1.00 128.14 ? 385 ASP B O     1 
ATOM   7638  C  CB    . ASP C 1 385 ? 105.991 -27.275 253.610 1.00 122.08 ? 385 ASP B CB    1 
ATOM   7639  C  CG    . ASP C 1 385 ? 105.917 -25.787 253.356 1.00 118.70 ? 385 ASP B CG    1 
ATOM   7640  O  OD1   . ASP C 1 385 ? 104.800 -25.275 253.125 1.00 111.46 ? 385 ASP B OD1   1 
ATOM   7641  O  OD2   . ASP C 1 385 ? 106.976 -25.127 253.384 1.00 119.25 ? 385 ASP B OD2   1 
ATOM   7642  N  N     . HIS C 1 386 ? 104.871 -30.017 255.085 1.00 126.19 ? 386 HIS B N     1 
ATOM   7643  C  CA    . HIS C 1 386 ? 104.907 -31.472 255.164 1.00 126.57 ? 386 HIS B CA    1 
ATOM   7644  C  C     . HIS C 1 386 ? 103.930 -31.985 256.218 1.00 132.99 ? 386 HIS B C     1 
ATOM   7645  O  O     . HIS C 1 386 ? 104.299 -32.779 257.085 1.00 129.57 ? 386 HIS B O     1 
ATOM   7646  C  CB    . HIS C 1 386 ? 106.322 -31.952 255.483 1.00 122.56 ? 386 HIS B CB    1 
ATOM   7647  C  CG    . HIS C 1 386 ? 107.353 -31.499 254.495 1.00 122.14 ? 386 HIS B CG    1 
ATOM   7648  N  ND1   . HIS C 1 386 ? 107.777 -30.191 254.409 1.00 116.69 ? 386 HIS B ND1   1 
ATOM   7649  C  CD2   . HIS C 1 386 ? 108.046 -32.183 253.553 1.00 126.71 ? 386 HIS B CD2   1 
ATOM   7650  C  CE1   . HIS C 1 386 ? 108.687 -30.087 253.456 1.00 124.01 ? 386 HIS B CE1   1 
ATOM   7651  N  NE2   . HIS C 1 386 ? 108.868 -31.281 252.921 1.00 127.24 ? 386 HIS B NE2   1 
ATOM   7652  N  N     . ILE C 1 387 ? 102.686 -31.522 256.130 1.00 117.45 ? 387 ILE B N     1 
ATOM   7653  C  CA    . ILE C 1 387 ? 101.651 -31.857 257.105 1.00 119.42 ? 387 ILE B CA    1 
ATOM   7654  C  C     . ILE C 1 387 ? 101.409 -33.359 257.249 1.00 127.59 ? 387 ILE B C     1 
ATOM   7655  O  O     . ILE C 1 387 ? 101.420 -33.885 258.359 1.00 125.83 ? 387 ILE B O     1 
ATOM   7656  C  CB    . ILE C 1 387 ? 100.315 -31.167 256.764 1.00 110.88 ? 387 ILE B CB    1 
ATOM   7657  N  N     . ASP C 1 388 ? 101.194 -34.040 256.128 1.00 132.62 ? 388 ASP B N     1 
ATOM   7658  C  CA    . ASP C 1 388 ? 100.876 -35.466 256.145 1.00 133.83 ? 388 ASP B CA    1 
ATOM   7659  C  C     . ASP C 1 388 ? 102.005 -36.302 256.741 1.00 130.06 ? 388 ASP B C     1 
ATOM   7660  O  O     . ASP C 1 388 ? 101.764 -37.206 257.541 1.00 129.79 ? 388 ASP B O     1 
ATOM   7661  C  CB    . ASP C 1 388 ? 100.547 -35.962 254.734 1.00 148.20 ? 388 ASP B CB    1 
ATOM   7662  C  CG    . ASP C 1 388 ? 99.474  -35.132 254.061 1.00 159.45 ? 388 ASP B CG    1 
ATOM   7663  O  OD1   . ASP C 1 388 ? 98.283  -35.317 254.388 1.00 156.38 ? 388 ASP B OD1   1 
ATOM   7664  O  OD2   . ASP C 1 388 ? 99.822  -34.294 253.202 1.00 170.49 ? 388 ASP B OD2   1 
ATOM   7665  N  N     . GLU C 1 389 ? 103.235 -35.994 256.347 1.00 129.78 ? 389 GLU B N     1 
ATOM   7666  C  CA    . GLU C 1 389 ? 104.399 -36.707 256.855 1.00 132.93 ? 389 GLU B CA    1 
ATOM   7667  C  C     . GLU C 1 389 ? 104.592 -36.423 258.339 1.00 132.21 ? 389 GLU B C     1 
ATOM   7668  O  O     . GLU C 1 389 ? 104.961 -37.310 259.110 1.00 130.00 ? 389 GLU B O     1 
ATOM   7669  C  CB    . GLU C 1 389 ? 105.647 -36.312 256.066 1.00 138.08 ? 389 GLU B CB    1 
ATOM   7670  C  CG    . GLU C 1 389 ? 106.898 -37.089 256.439 1.00 142.53 ? 389 GLU B CG    1 
ATOM   7671  C  CD    . GLU C 1 389 ? 108.090 -36.713 255.583 1.00 153.64 ? 389 GLU B CD    1 
ATOM   7672  O  OE1   . GLU C 1 389 ? 109.177 -37.289 255.794 1.00 160.84 ? 389 GLU B OE1   1 
ATOM   7673  O  OE2   . GLU C 1 389 ? 107.943 -35.842 254.700 1.00 152.64 ? 389 GLU B OE2   1 
ATOM   7674  N  N     . VAL C 1 390 ? 104.329 -35.179 258.728 1.00 129.99 ? 390 VAL B N     1 
ATOM   7675  C  CA    . VAL C 1 390 ? 104.435 -34.760 260.122 1.00 119.74 ? 390 VAL B CA    1 
ATOM   7676  C  C     . VAL C 1 390 ? 103.462 -35.531 261.005 1.00 110.65 ? 390 VAL B C     1 
ATOM   7677  O  O     . VAL C 1 390 ? 103.847 -36.091 262.031 1.00 117.05 ? 390 VAL B O     1 
ATOM   7678  C  CB    . VAL C 1 390 ? 104.150 -33.254 260.278 1.00 111.73 ? 390 VAL B CB    1 
ATOM   7679  N  N     . ILE C 1 391 ? 102.197 -35.553 260.597 1.00 100.45 ? 391 ILE B N     1 
ATOM   7680  C  CA    . ILE C 1 391 ? 101.158 -36.251 261.345 1.00 100.48 ? 391 ILE B CA    1 
ATOM   7681  C  C     . ILE C 1 391 ? 101.407 -37.758 261.326 1.00 113.43 ? 391 ILE B C     1 
ATOM   7682  O  O     . ILE C 1 391 ? 101.066 -38.463 262.277 1.00 108.86 ? 391 ILE B O     1 
ATOM   7683  C  CB    . ILE C 1 391 ? 99.751  -35.921 260.802 1.00 90.82  ? 391 ILE B CB    1 
ATOM   7684  C  CG1   . ILE C 1 391 ? 99.522  -34.410 260.843 1.00 93.81  ? 391 ILE B CG1   1 
ATOM   7685  C  CG2   . ILE C 1 391 ? 98.670  -36.645 261.602 1.00 80.17  ? 391 ILE B CG2   1 
ATOM   7686  C  CD1   . ILE C 1 391 ? 98.314  -33.950 260.065 1.00 102.35 ? 391 ILE B CD1   1 
ATOM   7687  N  N     . ARG C 1 392 ? 102.014 -38.246 260.246 1.00 122.06 ? 392 ARG B N     1 
ATOM   7688  C  CA    . ARG C 1 392 ? 102.426 -39.644 260.171 1.00 126.56 ? 392 ARG B CA    1 
ATOM   7689  C  C     . ARG C 1 392 ? 103.450 -39.954 261.260 1.00 123.66 ? 392 ARG B C     1 
ATOM   7690  O  O     . ARG C 1 392 ? 103.331 -40.953 261.979 1.00 124.29 ? 392 ARG B O     1 
ATOM   7691  C  CB    . ARG C 1 392 ? 103.001 -39.967 258.790 1.00 133.21 ? 392 ARG B CB    1 
ATOM   7692  C  CG    . ARG C 1 392 ? 103.765 -41.284 258.722 1.00 135.67 ? 392 ARG B CG    1 
ATOM   7693  C  CD    . ARG C 1 392 ? 103.861 -41.816 257.293 1.00 140.48 ? 392 ARG B CD    1 
ATOM   7694  N  NE    . ARG C 1 392 ? 104.473 -40.867 256.365 1.00 140.76 ? 392 ARG B NE    1 
ATOM   7695  C  CZ    . ARG C 1 392 ? 103.791 -40.118 255.501 1.00 134.61 ? 392 ARG B CZ    1 
ATOM   7696  N  NH1   . ARG C 1 392 ? 102.468 -40.198 255.443 1.00 122.99 ? 392 ARG B NH1   1 
ATOM   7697  N  NH2   . ARG C 1 392 ? 104.434 -39.286 254.694 1.00 135.65 ? 392 ARG B NH2   1 
ATOM   7698  N  N     . ILE C 1 393 ? 104.449 -39.084 261.377 1.00 119.20 ? 393 ILE B N     1 
ATOM   7699  C  CA    . ILE C 1 393 ? 105.484 -39.220 262.395 1.00 119.84 ? 393 ILE B CA    1 
ATOM   7700  C  C     . ILE C 1 393 ? 104.901 -39.150 263.807 1.00 115.46 ? 393 ILE B C     1 
ATOM   7701  O  O     . ILE C 1 393 ? 105.259 -39.945 264.679 1.00 112.53 ? 393 ILE B O     1 
ATOM   7702  C  CB    . ILE C 1 393 ? 106.569 -38.134 262.222 1.00 122.23 ? 393 ILE B CB    1 
ATOM   7703  C  CG1   . ILE C 1 393 ? 107.367 -38.378 260.938 1.00 125.01 ? 393 ILE B CG1   1 
ATOM   7704  C  CG2   . ILE C 1 393 ? 107.497 -38.100 263.418 1.00 122.37 ? 393 ILE B CG2   1 
ATOM   7705  C  CD1   . ILE C 1 393 ? 108.071 -39.719 260.897 1.00 128.79 ? 393 ILE B CD1   1 
ATOM   7706  N  N     . ILE C 1 394 ? 103.995 -38.199 264.018 1.00 118.80 ? 394 ILE B N     1 
ATOM   7707  C  CA    . ILE C 1 394 ? 103.369 -37.984 265.321 1.00 119.89 ? 394 ILE B CA    1 
ATOM   7708  C  C     . ILE C 1 394 ? 102.508 -39.174 265.739 1.00 119.96 ? 394 ILE B C     1 
ATOM   7709  O  O     . ILE C 1 394 ? 102.514 -39.580 266.901 1.00 121.10 ? 394 ILE B O     1 
ATOM   7710  C  CB    . ILE C 1 394 ? 102.495 -36.713 265.322 1.00 106.08 ? 394 ILE B CB    1 
ATOM   7711  N  N     . ARG C 1 395 ? 101.765 -39.726 264.785 1.00 111.58 ? 395 ARG B N     1 
ATOM   7712  C  CA    . ARG C 1 395 ? 100.908 -40.875 265.053 1.00 104.70 ? 395 ARG B CA    1 
ATOM   7713  C  C     . ARG C 1 395 ? 101.737 -42.122 265.308 1.00 112.44 ? 395 ARG B C     1 
ATOM   7714  O  O     . ARG C 1 395 ? 101.412 -42.922 266.185 1.00 118.86 ? 395 ARG B O     1 
ATOM   7715  C  CB    . ARG C 1 395 ? 99.939  -41.118 263.895 1.00 98.37  ? 395 ARG B CB    1 
ATOM   7716  C  CG    . ARG C 1 395 ? 98.781  -40.137 263.824 1.00 91.82  ? 395 ARG B CG    1 
ATOM   7717  C  CD    . ARG C 1 395 ? 97.772  -40.561 262.770 1.00 88.76  ? 395 ARG B CD    1 
ATOM   7718  N  N     . ALA C 1 396 ? 102.811 -42.281 264.542 1.00 114.84 ? 396 ALA B N     1 
ATOM   7719  C  CA    . ALA C 1 396 ? 103.690 -43.432 264.706 1.00 112.53 ? 396 ALA B CA    1 
ATOM   7720  C  C     . ALA C 1 396 ? 104.380 -43.425 266.069 1.00 120.59 ? 396 ALA B C     1 
ATOM   7721  O  O     . ALA C 1 396 ? 104.773 -44.472 266.582 1.00 122.05 ? 396 ALA B O     1 
ATOM   7722  C  CB    . ALA C 1 396 ? 104.718 -43.481 263.587 1.00 101.50 ? 396 ALA B CB    1 
ATOM   7723  N  N     . SER C 1 397 ? 104.519 -42.238 266.652 1.00 123.39 ? 397 SER B N     1 
ATOM   7724  C  CA    . SER C 1 397 ? 105.165 -42.089 267.950 1.00 129.06 ? 397 SER B CA    1 
ATOM   7725  C  C     . SER C 1 397 ? 104.255 -42.537 269.091 1.00 137.51 ? 397 SER B C     1 
ATOM   7726  O  O     . SER C 1 397 ? 103.031 -42.441 268.995 1.00 141.44 ? 397 SER B O     1 
ATOM   7727  C  CB    . SER C 1 397 ? 105.591 -40.637 268.168 1.00 122.31 ? 397 SER B CB    1 
ATOM   7728  N  N     . GLU C 1 398 ? 104.863 -43.025 270.168 1.00 138.19 ? 398 GLU B N     1 
ATOM   7729  C  CA    . GLU C 1 398 ? 104.124 -43.450 271.353 1.00 136.80 ? 398 GLU B CA    1 
ATOM   7730  C  C     . GLU C 1 398 ? 104.167 -42.373 272.435 1.00 140.11 ? 398 GLU B C     1 
ATOM   7731  O  O     . GLU C 1 398 ? 103.151 -42.064 273.059 1.00 146.37 ? 398 GLU B O     1 
ATOM   7732  C  CB    . GLU C 1 398 ? 104.685 -44.767 271.893 1.00 135.18 ? 398 GLU B CB    1 
ATOM   7733  N  N     . THR C 1 399 ? 105.352 -41.809 272.654 1.00 134.53 ? 399 THR B N     1 
ATOM   7734  C  CA    . THR C 1 399 ? 105.523 -40.713 273.603 1.00 122.01 ? 399 THR B CA    1 
ATOM   7735  C  C     . THR C 1 399 ? 106.039 -39.474 272.877 1.00 125.73 ? 399 THR B C     1 
ATOM   7736  O  O     . THR C 1 399 ? 106.781 -39.582 271.904 1.00 133.74 ? 399 THR B O     1 
ATOM   7737  C  CB    . THR C 1 399 ? 106.500 -41.087 274.734 1.00 117.23 ? 399 THR B CB    1 
ATOM   7738  O  OG1   . THR C 1 399 ? 107.847 -41.054 274.245 1.00 116.08 ? 399 THR B OG1   1 
ATOM   7739  C  CG2   . THR C 1 399 ? 106.189 -42.480 275.265 1.00 123.43 ? 399 THR B CG2   1 
ATOM   7740  N  N     . ASP C 1 400 ? 105.644 -38.299 273.357 1.00 121.87 ? 400 ASP B N     1 
ATOM   7741  C  CA    . ASP C 1 400 ? 105.954 -37.036 272.687 1.00 121.40 ? 400 ASP B CA    1 
ATOM   7742  C  C     . ASP C 1 400 ? 107.453 -36.801 272.488 1.00 116.63 ? 400 ASP B C     1 
ATOM   7743  O  O     . ASP C 1 400 ? 107.859 -36.058 271.592 1.00 117.64 ? 400 ASP B O     1 
ATOM   7744  C  CB    . ASP C 1 400 ? 105.339 -35.865 273.459 1.00 137.56 ? 400 ASP B CB    1 
ATOM   7745  C  CG    . ASP C 1 400 ? 103.860 -36.061 273.733 1.00 155.24 ? 400 ASP B CG    1 
ATOM   7746  O  OD1   . ASP C 1 400 ? 103.169 -36.657 272.880 1.00 159.54 ? 400 ASP B OD1   1 
ATOM   7747  O  OD2   . ASP C 1 400 ? 103.390 -35.623 274.804 1.00 163.40 ? 400 ASP B OD2   1 
ATOM   7748  N  N     . ALA C 1 401 ? 108.268 -37.436 273.324 1.00 120.49 ? 401 ALA B N     1 
ATOM   7749  C  CA    . ALA C 1 401 ? 109.720 -37.296 273.242 1.00 128.69 ? 401 ALA B CA    1 
ATOM   7750  C  C     . ALA C 1 401 ? 110.270 -37.834 271.922 1.00 134.54 ? 401 ALA B C     1 
ATOM   7751  O  O     . ALA C 1 401 ? 110.982 -37.128 271.200 1.00 131.84 ? 401 ALA B O     1 
ATOM   7752  C  CB    . ALA C 1 401 ? 110.387 -37.994 274.421 1.00 128.76 ? 401 ALA B CB    1 
ATOM   7753  N  N     . GLU C 1 402 ? 109.936 -39.083 271.610 1.00 138.87 ? 402 GLU B N     1 
ATOM   7754  C  CA    . GLU C 1 402 ? 110.403 -39.715 270.381 1.00 143.44 ? 402 GLU B CA    1 
ATOM   7755  C  C     . GLU C 1 402 ? 109.782 -39.052 269.157 1.00 139.05 ? 402 GLU B C     1 
ATOM   7756  O  O     . GLU C 1 402 ? 110.358 -39.075 268.070 1.00 146.65 ? 402 GLU B O     1 
ATOM   7757  C  CB    . GLU C 1 402 ? 110.112 -41.220 270.393 1.00 146.68 ? 402 GLU B CB    1 
ATOM   7758  C  CG    . GLU C 1 402 ? 108.637 -41.584 270.340 1.00 144.59 ? 402 GLU B CG    1 
ATOM   7759  C  CD    . GLU C 1 402 ? 108.385 -43.049 270.646 1.00 152.98 ? 402 GLU B CD    1 
ATOM   7760  O  OE1   . GLU C 1 402 ? 109.283 -43.704 271.216 1.00 158.80 ? 402 GLU B OE1   1 
ATOM   7761  O  OE2   . GLU C 1 402 ? 107.288 -43.544 270.317 1.00 153.63 ? 402 GLU B OE2   1 
ATOM   7762  N  N     . ALA C 1 403 ? 108.608 -38.456 269.342 1.00 126.44 ? 403 ALA B N     1 
ATOM   7763  C  CA    . ALA C 1 403 ? 107.964 -37.687 268.285 1.00 117.52 ? 403 ALA B CA    1 
ATOM   7764  C  C     . ALA C 1 403 ? 108.813 -36.467 267.964 1.00 119.43 ? 403 ALA B C     1 
ATOM   7765  O  O     . ALA C 1 403 ? 109.131 -36.197 266.804 1.00 119.81 ? 403 ALA B O     1 
ATOM   7766  C  CB    . ALA C 1 403 ? 106.574 -37.258 268.718 1.00 108.93 ? 403 ALA B CB    1 
ATOM   7767  N  N     . GLN C 1 404 ? 109.176 -35.736 269.012 1.00 122.03 ? 404 GLN B N     1 
ATOM   7768  C  CA    . GLN C 1 404 ? 110.014 -34.554 268.883 1.00 120.62 ? 404 GLN B CA    1 
ATOM   7769  C  C     . GLN C 1 404 ? 111.347 -34.897 268.232 1.00 123.95 ? 404 GLN B C     1 
ATOM   7770  O  O     . GLN C 1 404 ? 111.785 -34.219 267.306 1.00 119.94 ? 404 GLN B O     1 
ATOM   7771  C  CB    . GLN C 1 404 ? 110.252 -33.925 270.254 1.00 114.37 ? 404 GLN B CB    1 
ATOM   7772  C  CG    . GLN C 1 404 ? 111.204 -32.750 270.232 1.00 115.92 ? 404 GLN B CG    1 
ATOM   7773  C  CD    . GLN C 1 404 ? 111.406 -32.135 271.599 1.00 120.98 ? 404 GLN B CD    1 
ATOM   7774  O  OE1   . GLN C 1 404 ? 110.777 -32.545 272.574 1.00 124.22 ? 404 GLN B OE1   1 
ATOM   7775  N  NE2   . GLN C 1 404 ? 112.289 -31.146 271.679 1.00 124.62 ? 404 GLN B NE2   1 
ATOM   7776  N  N     . ALA C 1 405 ? 111.984 -35.957 268.720 1.00 121.46 ? 405 ALA B N     1 
ATOM   7777  C  CA    . ALA C 1 405 ? 113.268 -36.393 268.182 1.00 113.12 ? 405 ALA B CA    1 
ATOM   7778  C  C     . ALA C 1 405 ? 113.161 -36.778 266.709 1.00 113.57 ? 405 ALA B C     1 
ATOM   7779  O  O     . ALA C 1 405 ? 114.040 -36.458 265.906 1.00 109.04 ? 405 ALA B O     1 
ATOM   7780  C  CB    . ALA C 1 405 ? 113.815 -37.555 268.998 1.00 106.33 ? 405 ALA B CB    1 
ATOM   7781  N  N     . GLU C 1 406 ? 112.074 -37.462 266.362 1.00 116.29 ? 406 GLU B N     1 
ATOM   7782  C  CA    . GLU C 1 406 ? 111.849 -37.899 264.988 1.00 123.56 ? 406 GLU B CA    1 
ATOM   7783  C  C     . GLU C 1 406 ? 111.625 -36.717 264.051 1.00 125.54 ? 406 GLU B C     1 
ATOM   7784  O  O     . GLU C 1 406 ? 112.128 -36.708 262.927 1.00 127.96 ? 406 GLU B O     1 
ATOM   7785  C  CB    . GLU C 1 406 ? 110.663 -38.860 264.914 1.00 117.74 ? 406 GLU B CB    1 
ATOM   7786  N  N     . LEU C 1 407 ? 110.863 -35.727 264.513 1.00 119.30 ? 407 LEU B N     1 
ATOM   7787  C  CA    . LEU C 1 407 ? 110.635 -34.513 263.735 1.00 107.90 ? 407 LEU B CA    1 
ATOM   7788  C  C     . LEU C 1 407 ? 111.940 -33.747 263.547 1.00 114.30 ? 407 LEU B C     1 
ATOM   7789  O  O     . LEU C 1 407 ? 112.235 -33.254 262.454 1.00 125.53 ? 407 LEU B O     1 
ATOM   7790  C  CB    . LEU C 1 407 ? 109.591 -33.622 264.411 1.00 99.42  ? 407 LEU B CB    1 
ATOM   7791  C  CG    . LEU C 1 407 ? 108.129 -34.070 264.335 1.00 101.88 ? 407 LEU B CG    1 
ATOM   7792  C  CD1   . LEU C 1 407 ? 107.241 -33.175 265.190 1.00 103.60 ? 407 LEU B CD1   1 
ATOM   7793  C  CD2   . LEU C 1 407 ? 107.643 -34.094 262.892 1.00 96.99  ? 407 LEU B CD2   1 
ATOM   7794  N  N     . MET C 1 408 ? 112.721 -33.662 264.620 1.00 111.24 ? 408 MET B N     1 
ATOM   7795  C  CA    . MET C 1 408 ? 114.005 -32.969 264.593 1.00 114.33 ? 408 MET B CA    1 
ATOM   7796  C  C     . MET C 1 408 ? 115.009 -33.652 263.673 1.00 125.60 ? 408 MET B C     1 
ATOM   7797  O  O     . MET C 1 408 ? 115.864 -32.993 263.085 1.00 129.98 ? 408 MET B O     1 
ATOM   7798  C  CB    . MET C 1 408 ? 114.589 -32.857 266.002 1.00 107.65 ? 408 MET B CB    1 
ATOM   7799  C  CG    . MET C 1 408 ? 113.856 -31.886 266.904 1.00 100.37 ? 408 MET B CG    1 
ATOM   7800  S  SD    . MET C 1 408 ? 114.480 -31.883 268.597 1.00 124.41 ? 408 MET B SD    1 
ATOM   7801  C  CE    . MET C 1 408 ? 116.192 -31.426 268.337 1.00 88.27  ? 408 MET B CE    1 
ATOM   7802  N  N     . SER C 1 409 ? 114.912 -34.973 263.560 1.00 128.97 ? 409 SER B N     1 
ATOM   7803  C  CA    . SER C 1 409 ? 115.806 -35.730 262.689 1.00 128.91 ? 409 SER B CA    1 
ATOM   7804  C  C     . SER C 1 409 ? 115.375 -35.638 261.227 1.00 121.90 ? 409 SER B C     1 
ATOM   7805  O  O     . SER C 1 409 ? 116.208 -35.474 260.335 1.00 111.86 ? 409 SER B O     1 
ATOM   7806  C  CB    . SER C 1 409 ? 115.867 -37.196 263.121 1.00 128.16 ? 409 SER B CB    1 
ATOM   7807  N  N     . LYS C 1 410 ? 114.070 -35.741 260.993 1.00 121.04 ? 410 LYS B N     1 
ATOM   7808  C  CA    . LYS C 1 410 ? 113.531 -35.771 259.638 1.00 120.14 ? 410 LYS B CA    1 
ATOM   7809  C  C     . LYS C 1 410 ? 113.550 -34.403 258.959 1.00 121.54 ? 410 LYS B C     1 
ATOM   7810  O  O     . LYS C 1 410 ? 114.001 -34.276 257.821 1.00 136.40 ? 410 LYS B O     1 
ATOM   7811  C  CB    . LYS C 1 410 ? 112.104 -36.326 259.643 1.00 115.65 ? 410 LYS B CB    1 
ATOM   7812  N  N     . PHE C 1 411 ? 113.058 -33.384 259.656 1.00 107.37 ? 411 PHE B N     1 
ATOM   7813  C  CA    . PHE C 1 411 ? 112.906 -32.064 259.051 1.00 106.09 ? 411 PHE B CA    1 
ATOM   7814  C  C     . PHE C 1 411 ? 114.004 -31.081 259.454 1.00 110.62 ? 411 PHE B C     1 
ATOM   7815  O  O     . PHE C 1 411 ? 113.915 -29.891 259.150 1.00 120.15 ? 411 PHE B O     1 
ATOM   7816  C  CB    . PHE C 1 411 ? 111.530 -31.481 259.376 1.00 101.37 ? 411 PHE B CB    1 
ATOM   7817  C  CG    . PHE C 1 411 ? 110.386 -32.338 258.916 1.00 102.20 ? 411 PHE B CG    1 
ATOM   7818  C  CD1   . PHE C 1 411 ? 109.597 -33.017 259.830 1.00 102.11 ? 411 PHE B CD1   1 
ATOM   7819  C  CD2   . PHE C 1 411 ? 110.103 -32.471 257.569 1.00 105.59 ? 411 PHE B CD2   1 
ATOM   7820  C  CE1   . PHE C 1 411 ? 108.542 -33.807 259.408 1.00 102.27 ? 411 PHE B CE1   1 
ATOM   7821  C  CE2   . PHE C 1 411 ? 109.053 -33.260 257.140 1.00 109.95 ? 411 PHE B CE2   1 
ATOM   7822  C  CZ    . PHE C 1 411 ? 108.270 -33.929 258.059 1.00 103.95 ? 411 PHE B CZ    1 
ATOM   7823  N  N     . LYS C 1 412 ? 115.034 -31.589 260.126 1.00 110.05 ? 412 LYS B N     1 
ATOM   7824  C  CA    . LYS C 1 412 ? 116.157 -30.770 260.584 1.00 117.57 ? 412 LYS B CA    1 
ATOM   7825  C  C     . LYS C 1 412 ? 115.691 -29.569 261.407 1.00 121.98 ? 412 LYS B C     1 
ATOM   7826  O  O     . LYS C 1 412 ? 115.890 -28.418 261.017 1.00 129.24 ? 412 LYS B O     1 
ATOM   7827  C  CB    . LYS C 1 412 ? 117.016 -30.313 259.400 1.00 112.39 ? 412 LYS B CB    1 
ATOM   7828  N  N     . LEU C 1 413 ? 115.063 -29.842 262.545 1.00 117.18 ? 413 LEU B N     1 
ATOM   7829  C  CA    . LEU C 1 413 ? 114.516 -28.779 263.377 1.00 109.98 ? 413 LEU B CA    1 
ATOM   7830  C  C     . LEU C 1 413 ? 115.207 -28.711 264.728 1.00 118.75 ? 413 LEU B C     1 
ATOM   7831  O  O     . LEU C 1 413 ? 115.890 -29.650 265.137 1.00 124.50 ? 413 LEU B O     1 
ATOM   7832  C  CB    . LEU C 1 413 ? 113.015 -28.978 263.584 1.00 97.15  ? 413 LEU B CB    1 
ATOM   7833  C  CG    . LEU C 1 413 ? 112.141 -29.047 262.331 1.00 94.81  ? 413 LEU B CG    1 
ATOM   7834  C  CD1   . LEU C 1 413 ? 110.676 -29.202 262.716 1.00 80.44  ? 413 LEU B CD1   1 
ATOM   7835  C  CD2   . LEU C 1 413 ? 112.344 -27.814 261.468 1.00 87.72  ? 413 LEU B CD2   1 
ATOM   7836  N  N     . SER C 1 414 ? 115.025 -27.588 265.412 1.00 119.93 ? 414 SER B N     1 
ATOM   7837  C  CA    . SER C 1 414 ? 115.518 -27.431 266.770 1.00 115.81 ? 414 SER B CA    1 
ATOM   7838  C  C     . SER C 1 414 ? 114.478 -27.963 267.745 1.00 116.27 ? 414 SER B C     1 
ATOM   7839  O  O     . SER C 1 414 ? 113.380 -28.351 267.344 1.00 112.55 ? 414 SER B O     1 
ATOM   7840  C  CB    . SER C 1 414 ? 115.814 -25.961 267.067 1.00 110.54 ? 414 SER B CB    1 
ATOM   7841  O  OG    . SER C 1 414 ? 114.665 -25.158 266.858 1.00 101.59 ? 414 SER B OG    1 
ATOM   7842  N  N     . GLU C 1 415 ? 114.828 -27.978 269.026 1.00 117.48 ? 415 GLU B N     1 
ATOM   7843  C  CA    . GLU C 1 415 ? 113.911 -28.430 270.064 1.00 109.48 ? 415 GLU B CA    1 
ATOM   7844  C  C     . GLU C 1 415 ? 112.704 -27.503 270.148 1.00 109.87 ? 415 GLU B C     1 
ATOM   7845  O  O     . GLU C 1 415 ? 111.569 -27.954 270.310 1.00 105.98 ? 415 GLU B O     1 
ATOM   7846  C  CB    . GLU C 1 415 ? 114.626 -28.490 271.416 1.00 103.54 ? 415 GLU B CB    1 
ATOM   7847  N  N     . ARG C 1 416 ? 112.964 -26.204 270.023 1.00 110.59 ? 416 ARG B N     1 
ATOM   7848  C  CA    . ARG C 1 416 ? 111.922 -25.187 270.105 1.00 106.51 ? 416 ARG B CA    1 
ATOM   7849  C  C     . ARG C 1 416 ? 110.931 -25.317 268.952 1.00 106.25 ? 416 ARG B C     1 
ATOM   7850  O  O     . ARG C 1 416 ? 109.719 -25.252 269.156 1.00 104.84 ? 416 ARG B O     1 
ATOM   7851  C  CB    . ARG C 1 416 ? 112.551 -23.793 270.107 1.00 90.63  ? 416 ARG B CB    1 
ATOM   7852  C  CG    . ARG C 1 416 ? 113.680 -23.622 271.113 1.00 112.66 ? 416 ARG B CG    1 
ATOM   7853  N  N     . GLN C 1 417 ? 111.457 -25.503 267.744 1.00 108.13 ? 417 GLN B N     1 
ATOM   7854  C  CA    . GLN C 1 417 ? 110.627 -25.642 266.548 1.00 100.20 ? 417 GLN B CA    1 
ATOM   7855  C  C     . GLN C 1 417 ? 109.744 -26.883 266.597 1.00 96.79  ? 417 GLN B C     1 
ATOM   7856  O  O     . GLN C 1 417 ? 108.553 -26.823 266.290 1.00 98.04  ? 417 GLN B O     1 
ATOM   7857  C  CB    . GLN C 1 417 ? 111.500 -25.669 265.292 1.00 98.95  ? 417 GLN B CB    1 
ATOM   7858  C  CG    . GLN C 1 417 ? 111.968 -24.299 264.830 1.00 103.83 ? 417 GLN B CG    1 
ATOM   7859  C  CD    . GLN C 1 417 ? 113.021 -24.381 263.742 1.00 105.44 ? 417 GLN B CD    1 
ATOM   7860  O  OE1   . GLN C 1 417 ? 113.764 -25.358 263.657 1.00 101.58 ? 417 GLN B OE1   1 
ATOM   7861  N  NE2   . GLN C 1 417 ? 113.088 -23.353 262.901 1.00 95.35  ? 417 GLN B NE2   1 
ATOM   7862  N  N     . SER C 1 418 ? 110.338 -28.008 266.979 1.00 93.81  ? 418 SER B N     1 
ATOM   7863  C  CA    . SER C 1 418 ? 109.604 -29.261 267.092 1.00 93.27  ? 418 SER B CA    1 
ATOM   7864  C  C     . SER C 1 418 ? 108.548 -29.164 268.188 1.00 98.46  ? 418 SER B C     1 
ATOM   7865  O  O     . SER C 1 418 ? 107.439 -29.687 268.041 1.00 93.62  ? 418 SER B O     1 
ATOM   7866  C  CB    . SER C 1 418 ? 110.562 -30.413 267.385 1.00 92.34  ? 418 SER B CB    1 
ATOM   7867  O  OG    . SER C 1 418 ? 111.403 -30.101 268.484 1.00 102.00 ? 418 SER B OG    1 
ATOM   7868  N  N     . GLN C 1 419 ? 108.897 -28.487 269.280 1.00 96.02  ? 419 GLN B N     1 
ATOM   7869  C  CA    . GLN C 1 419 ? 107.965 -28.268 270.376 1.00 96.64  ? 419 GLN B CA    1 
ATOM   7870  C  C     . GLN C 1 419 ? 106.770 -27.451 269.896 1.00 91.50  ? 419 GLN B C     1 
ATOM   7871  O  O     . GLN C 1 419 ? 105.621 -27.760 270.211 1.00 92.01  ? 419 GLN B O     1 
ATOM   7872  C  CB    . GLN C 1 419 ? 108.665 -27.552 271.533 1.00 109.50 ? 419 GLN B CB    1 
ATOM   7873  C  CG    . GLN C 1 419 ? 108.002 -27.762 272.884 1.00 114.01 ? 419 GLN B CG    1 
ATOM   7874  C  CD    . GLN C 1 419 ? 108.145 -29.189 273.379 1.00 119.99 ? 419 GLN B CD    1 
ATOM   7875  O  OE1   . GLN C 1 419 ? 107.170 -29.815 273.786 1.00 119.33 ? 419 GLN B OE1   1 
ATOM   7876  N  NE2   . GLN C 1 419 ? 109.367 -29.707 273.351 1.00 121.44 ? 419 GLN B NE2   1 
ATOM   7877  N  N     . ALA C 1 420 ? 107.056 -26.409 269.123 1.00 89.84  ? 420 ALA B N     1 
ATOM   7878  C  CA    . ALA C 1 420 ? 106.018 -25.536 268.588 1.00 93.42  ? 420 ALA B CA    1 
ATOM   7879  C  C     . ALA C 1 420 ? 105.120 -26.283 267.608 1.00 97.74  ? 420 ALA B C     1 
ATOM   7880  O  O     . ALA C 1 420 ? 103.909 -26.064 267.570 1.00 93.36  ? 420 ALA B O     1 
ATOM   7881  C  CB    . ALA C 1 420 ? 106.642 -24.322 267.917 1.00 80.38  ? 420 ALA B CB    1 
ATOM   7882  N  N     . ILE C 1 421 ? 105.722 -27.172 266.825 1.00 101.42 ? 421 ILE B N     1 
ATOM   7883  C  CA    . ILE C 1 421 ? 104.982 -27.982 265.862 1.00 104.97 ? 421 ILE B CA    1 
ATOM   7884  C  C     . ILE C 1 421 ? 104.072 -28.968 266.583 1.00 110.73 ? 421 ILE B C     1 
ATOM   7885  O  O     . ILE C 1 421 ? 102.952 -29.229 266.144 1.00 107.49 ? 421 ILE B O     1 
ATOM   7886  C  CB    . ILE C 1 421 ? 105.931 -28.758 264.924 1.00 100.36 ? 421 ILE B CB    1 
ATOM   7887  N  N     . LEU C 1 422 ? 104.559 -29.514 267.694 1.00 111.63 ? 422 LEU B N     1 
ATOM   7888  C  CA    . LEU C 1 422 ? 103.769 -30.446 268.494 1.00 103.74 ? 422 LEU B CA    1 
ATOM   7889  C  C     . LEU C 1 422 ? 102.633 -29.722 269.207 1.00 103.59 ? 422 LEU B C     1 
ATOM   7890  O  O     . LEU C 1 422 ? 101.560 -30.285 269.419 1.00 107.53 ? 422 LEU B O     1 
ATOM   7891  C  CB    . LEU C 1 422 ? 104.652 -31.172 269.509 1.00 103.21 ? 422 LEU B CB    1 
ATOM   7892  C  CG    . LEU C 1 422 ? 105.621 -32.221 268.959 1.00 106.53 ? 422 LEU B CG    1 
ATOM   7893  C  CD1   . LEU C 1 422 ? 106.468 -32.808 270.078 1.00 103.98 ? 422 LEU B CD1   1 
ATOM   7894  C  CD2   . LEU C 1 422 ? 104.863 -33.316 268.224 1.00 103.74 ? 422 LEU B CD2   1 
ATOM   7895  N  N     . ASP C 1 423 ? 102.876 -28.465 269.567 1.00 99.45  ? 423 ASP B N     1 
ATOM   7896  C  CA    . ASP C 1 423 ? 101.877 -27.663 270.265 1.00 98.58  ? 423 ASP B CA    1 
ATOM   7897  C  C     . ASP C 1 423 ? 100.997 -26.878 269.299 1.00 102.00 ? 423 ASP B C     1 
ATOM   7898  O  O     . ASP C 1 423 ? 100.501 -25.803 269.631 1.00 104.88 ? 423 ASP B O     1 
ATOM   7899  C  CB    . ASP C 1 423 ? 102.551 -26.712 271.257 1.00 108.96 ? 423 ASP B CB    1 
ATOM   7900  C  CG    . ASP C 1 423 ? 103.216 -27.444 272.402 1.00 120.04 ? 423 ASP B CG    1 
ATOM   7901  O  OD1   . ASP C 1 423 ? 102.719 -28.523 272.789 1.00 123.85 ? 423 ASP B OD1   1 
ATOM   7902  O  OD2   . ASP C 1 423 ? 104.236 -26.939 272.915 1.00 124.96 ? 423 ASP B OD2   1 
ATOM   7903  N  N     . MET C 1 424 ? 100.803 -27.426 268.104 1.00 106.25 ? 424 MET B N     1 
ATOM   7904  C  CA    . MET C 1 424 ? 99.973  -26.781 267.091 1.00 103.66 ? 424 MET B CA    1 
ATOM   7905  C  C     . MET C 1 424 ? 98.514  -27.206 267.186 1.00 93.83  ? 424 MET B C     1 
ATOM   7906  O  O     . MET C 1 424 ? 98.201  -28.397 267.162 1.00 90.56  ? 424 MET B O     1 
ATOM   7907  C  CB    . MET C 1 424 ? 100.492 -27.084 265.686 1.00 110.22 ? 424 MET B CB    1 
ATOM   7908  C  CG    . MET C 1 424 ? 101.625 -26.195 265.230 1.00 122.87 ? 424 MET B CG    1 
ATOM   7909  S  SD    . MET C 1 424 ? 101.621 -26.033 263.438 1.00 135.86 ? 424 MET B SD    1 
ATOM   7910  C  CE    . MET C 1 424 ? 99.984  -25.349 263.176 1.00 77.78  ? 424 MET B CE    1 
ATOM   7911  N  N     . ARG C 1 425 ? 97.626  -26.223 267.283 1.00 90.77  ? 425 ARG B N     1 
ATOM   7912  C  CA    . ARG C 1 425 ? 96.195  -26.486 267.244 1.00 101.79 ? 425 ARG B CA    1 
ATOM   7913  C  C     . ARG C 1 425 ? 95.836  -27.043 265.873 1.00 104.09 ? 425 ARG B C     1 
ATOM   7914  O  O     . ARG C 1 425 ? 96.474  -26.703 264.876 1.00 109.26 ? 425 ARG B O     1 
ATOM   7915  C  CB    . ARG C 1 425 ? 95.402  -25.205 267.513 1.00 118.53 ? 425 ARG B CB    1 
ATOM   7916  C  CG    . ARG C 1 425 ? 95.811  -24.463 268.775 1.00 128.95 ? 425 ARG B CG    1 
ATOM   7917  C  CD    . ARG C 1 425 ? 95.725  -25.360 269.997 1.00 135.66 ? 425 ARG B CD    1 
ATOM   7918  N  NE    . ARG C 1 425 ? 95.925  -24.619 271.240 1.00 142.79 ? 425 ARG B NE    1 
ATOM   7919  C  CZ    . ARG C 1 425 ? 94.941  -24.228 272.043 1.00 150.48 ? 425 ARG B CZ    1 
ATOM   7920  N  NH1   . ARG C 1 425 ? 93.684  -24.514 271.738 1.00 155.13 ? 425 ARG B NH1   1 
ATOM   7921  N  NH2   . ARG C 1 425 ? 95.214  -23.557 273.153 1.00 155.70 ? 425 ARG B NH2   1 
ATOM   7922  N  N     . LEU C 1 426 ? 94.824  -27.905 265.825 1.00 103.27 ? 426 LEU B N     1 
ATOM   7923  C  CA    . LEU C 1 426 ? 94.378  -28.492 264.564 1.00 100.48 ? 426 LEU B CA    1 
ATOM   7924  C  C     . LEU C 1 426 ? 93.807  -27.443 263.617 1.00 108.99 ? 426 LEU B C     1 
ATOM   7925  O  O     . LEU C 1 426 ? 93.913  -27.575 262.399 1.00 120.07 ? 426 LEU B O     1 
ATOM   7926  C  CB    . LEU C 1 426 ? 93.332  -29.584 264.810 1.00 100.39 ? 426 LEU B CB    1 
ATOM   7927  C  CG    . LEU C 1 426 ? 93.827  -30.944 265.309 1.00 90.05  ? 426 LEU B CG    1 
ATOM   7928  C  CD1   . LEU C 1 426 ? 92.662  -31.919 265.432 1.00 80.44  ? 426 LEU B CD1   1 
ATOM   7929  C  CD2   . LEU C 1 426 ? 94.902  -31.505 264.389 1.00 77.91  ? 426 LEU B CD2   1 
ATOM   7930  N  N     . ARG C 1 427 ? 93.206  -26.400 264.182 1.00 109.05 ? 427 ARG B N     1 
ATOM   7931  C  CA    . ARG C 1 427 ? 92.538  -25.377 263.380 1.00 111.88 ? 427 ARG B CA    1 
ATOM   7932  C  C     . ARG C 1 427 ? 93.492  -24.517 262.551 1.00 110.74 ? 427 ARG B C     1 
ATOM   7933  O  O     . ARG C 1 427 ? 93.049  -23.736 261.708 1.00 123.11 ? 427 ARG B O     1 
ATOM   7934  C  CB    . ARG C 1 427 ? 91.651  -24.486 264.258 1.00 117.68 ? 427 ARG B CB    1 
ATOM   7935  C  CG    . ARG C 1 427 ? 92.371  -23.839 265.430 1.00 118.22 ? 427 ARG B CG    1 
ATOM   7936  C  CD    . ARG C 1 427 ? 91.503  -22.775 266.096 1.00 120.43 ? 427 ARG B CD    1 
ATOM   7937  N  NE    . ARG C 1 427 ? 90.126  -23.220 266.289 1.00 123.60 ? 427 ARG B NE    1 
ATOM   7938  C  CZ    . ARG C 1 427 ? 89.057  -22.536 265.890 1.00 134.26 ? 427 ARG B CZ    1 
ATOM   7939  N  NH1   . ARG C 1 427 ? 89.202  -21.369 265.276 1.00 138.61 ? 427 ARG B NH1   1 
ATOM   7940  N  NH2   . ARG C 1 427 ? 87.839  -23.016 266.108 1.00 138.66 ? 427 ARG B NH2   1 
ATOM   7941  N  N     . ARG C 1 428 ? 94.792  -24.657 262.789 1.00 101.30 ? 428 ARG B N     1 
ATOM   7942  C  CA    . ARG C 1 428 ? 95.782  -23.904 262.030 1.00 116.81 ? 428 ARG B CA    1 
ATOM   7943  C  C     . ARG C 1 428 ? 96.357  -24.739 260.887 1.00 118.66 ? 428 ARG B C     1 
ATOM   7944  O  O     . ARG C 1 428 ? 97.348  -24.358 260.261 1.00 125.70 ? 428 ARG B O     1 
ATOM   7945  C  CB    . ARG C 1 428 ? 96.899  -23.391 262.944 1.00 131.19 ? 428 ARG B CB    1 
ATOM   7946  C  CG    . ARG C 1 428 ? 96.413  -22.465 264.050 1.00 148.48 ? 428 ARG B CG    1 
ATOM   7947  C  CD    . ARG C 1 428 ? 97.289  -21.227 264.173 1.00 160.35 ? 428 ARG B CD    1 
ATOM   7948  N  NE    . ARG C 1 428 ? 98.653  -21.547 264.582 1.00 166.70 ? 428 ARG B NE    1 
ATOM   7949  C  CZ    . ARG C 1 428 ? 99.588  -20.636 264.829 1.00 176.90 ? 428 ARG B CZ    1 
ATOM   7950  N  NH1   . ARG C 1 428 ? 99.306  -19.345 264.709 1.00 183.76 ? 428 ARG B NH1   1 
ATOM   7951  N  NH2   . ARG C 1 428 ? 100.805 -21.013 265.198 1.00 177.83 ? 428 ARG B NH2   1 
ATOM   7952  N  N     . LEU C 1 429 ? 95.726  -25.878 260.617 1.00 116.29 ? 429 LEU B N     1 
ATOM   7953  C  CA    . LEU C 1 429 ? 96.141  -26.748 259.522 1.00 108.26 ? 429 LEU B CA    1 
ATOM   7954  C  C     . LEU C 1 429 ? 95.287  -26.483 258.284 1.00 115.33 ? 429 LEU B C     1 
ATOM   7955  O  O     . LEU C 1 429 ? 95.256  -27.284 257.349 1.00 111.87 ? 429 LEU B O     1 
ATOM   7956  C  CB    . LEU C 1 429 ? 96.047  -28.218 259.940 1.00 86.60  ? 429 LEU B CB    1 
ATOM   7957  N  N     . THR C 1 430 ? 94.597  -25.348 258.286 1.00 126.76 ? 430 THR B N     1 
ATOM   7958  C  CA    . THR C 1 430 ? 93.738  -24.977 257.168 1.00 137.12 ? 430 THR B CA    1 
ATOM   7959  C  C     . THR C 1 430 ? 94.564  -24.445 256.002 1.00 143.78 ? 430 THR B C     1 
ATOM   7960  O  O     . THR C 1 430 ? 95.793  -24.459 256.044 1.00 145.09 ? 430 THR B O     1 
ATOM   7961  C  CB    . THR C 1 430 ? 92.693  -23.923 257.580 1.00 143.08 ? 430 THR B CB    1 
ATOM   7962  O  OG1   . THR C 1 430 ? 93.360  -22.763 258.092 1.00 140.40 ? 430 THR B OG1   1 
ATOM   7963  C  CG2   . THR C 1 430 ? 91.771  -24.487 258.652 1.00 144.42 ? 430 THR B CG2   1 
ATOM   7964  N  N     . GLY C 1 431 ? 93.881  -23.974 254.965 1.00 144.04 ? 431 GLY B N     1 
ATOM   7965  C  CA    . GLY C 1 431 ? 94.549  -23.485 253.773 1.00 140.29 ? 431 GLY B CA    1 
ATOM   7966  C  C     . GLY C 1 431 ? 95.135  -22.094 253.919 1.00 138.89 ? 431 GLY B C     1 
ATOM   7967  O  O     . GLY C 1 431 ? 96.322  -21.884 253.676 1.00 140.48 ? 431 GLY B O     1 
ATOM   7968  N  N     . LEU C 1 432 ? 94.302  -21.143 254.324 1.00 133.16 ? 432 LEU B N     1 
ATOM   7969  C  CA    . LEU C 1 432 ? 94.702  -19.739 254.381 1.00 127.02 ? 432 LEU B CA    1 
ATOM   7970  C  C     . LEU C 1 432 ? 95.678  -19.431 255.518 1.00 128.59 ? 432 LEU B C     1 
ATOM   7971  O  O     . LEU C 1 432 ? 96.234  -18.335 255.588 1.00 135.40 ? 432 LEU B O     1 
ATOM   7972  C  CB    . LEU C 1 432 ? 93.467  -18.838 254.489 1.00 124.26 ? 432 LEU B CB    1 
ATOM   7973  N  N     . GLU C 1 433 ? 95.888  -20.400 256.403 1.00 129.17 ? 433 GLU B N     1 
ATOM   7974  C  CA    . GLU C 1 433 ? 96.732  -20.193 257.577 1.00 124.87 ? 433 GLU B CA    1 
ATOM   7975  C  C     . GLU C 1 433 ? 98.217  -20.089 257.233 1.00 114.72 ? 433 GLU B C     1 
ATOM   7976  O  O     . GLU C 1 433 ? 98.934  -19.268 257.803 1.00 113.43 ? 433 GLU B O     1 
ATOM   7977  C  CB    . GLU C 1 433 ? 96.508  -21.306 258.603 1.00 123.82 ? 433 GLU B CB    1 
ATOM   7978  C  CG    . GLU C 1 433 ? 97.260  -21.110 259.912 1.00 130.04 ? 433 GLU B CG    1 
ATOM   7979  C  CD    . GLU C 1 433 ? 96.810  -19.881 260.684 1.00 144.27 ? 433 GLU B CD    1 
ATOM   7980  O  OE1   . GLU C 1 433 ? 95.660  -19.429 260.490 1.00 152.70 ? 433 GLU B OE1   1 
ATOM   7981  O  OE2   . GLU C 1 433 ? 97.614  -19.366 261.489 1.00 143.18 ? 433 GLU B OE2   1 
ATOM   7982  N  N     . ARG C 1 434 ? 98.666  -20.926 256.302 1.00 108.32 ? 434 ARG B N     1 
ATOM   7983  C  CA    . ARG C 1 434 ? 100.060 -20.944 255.862 1.00 104.67 ? 434 ARG B CA    1 
ATOM   7984  C  C     . ARG C 1 434 ? 100.515 -19.579 255.336 1.00 106.85 ? 434 ARG B C     1 
ATOM   7985  O  O     . ARG C 1 434 ? 101.604 -19.098 255.676 1.00 107.82 ? 434 ARG B O     1 
ATOM   7986  C  CB    . ARG C 1 434 ? 100.251 -22.029 254.795 1.00 106.39 ? 434 ARG B CB    1 
ATOM   7987  C  CG    . ARG C 1 434 ? 101.141 -21.624 253.629 1.00 105.89 ? 434 ARG B CG    1 
ATOM   7988  C  CD    . ARG C 1 434 ? 102.534 -22.214 253.741 1.00 106.89 ? 434 ARG B CD    1 
ATOM   7989  N  NE    . ARG C 1 434 ? 103.527 -21.351 253.109 1.00 110.97 ? 434 ARG B NE    1 
ATOM   7990  C  CZ    . ARG C 1 434 ? 104.806 -21.679 252.953 1.00 113.99 ? 434 ARG B CZ    1 
ATOM   7991  N  NH1   . ARG C 1 434 ? 105.245 -22.855 253.377 1.00 104.42 ? 434 ARG B NH1   1 
ATOM   7992  N  NH2   . ARG C 1 434 ? 105.644 -20.835 252.369 1.00 121.68 ? 434 ARG B NH2   1 
ATOM   7993  N  N     . ASP C 1 435 ? 99.664  -18.955 254.526 1.00 111.90 ? 435 ASP B N     1 
ATOM   7994  C  CA    . ASP C 1 435 ? 99.980  -17.670 253.909 1.00 115.94 ? 435 ASP B CA    1 
ATOM   7995  C  C     . ASP C 1 435 ? 100.122 -16.565 254.949 1.00 113.20 ? 435 ASP B C     1 
ATOM   7996  O  O     . ASP C 1 435 ? 101.011 -15.718 254.850 1.00 113.02 ? 435 ASP B O     1 
ATOM   7997  C  CB    . ASP C 1 435 ? 98.910  -17.291 252.883 1.00 118.67 ? 435 ASP B CB    1 
ATOM   7998  N  N     . LYS C 1 436 ? 99.236  -16.575 255.939 1.00 117.53 ? 436 LYS B N     1 
ATOM   7999  C  CA    . LYS C 1 436 ? 99.286  -15.601 257.025 1.00 117.85 ? 436 LYS B CA    1 
ATOM   8000  C  C     . LYS C 1 436 ? 100.618 -15.701 257.760 1.00 120.45 ? 436 LYS B C     1 
ATOM   8001  O  O     . LYS C 1 436 ? 101.255 -14.686 258.069 1.00 124.93 ? 436 LYS B O     1 
ATOM   8002  C  CB    . LYS C 1 436 ? 98.129  -15.830 258.000 1.00 108.56 ? 436 LYS B CB    1 
ATOM   8003  C  CG    . LYS C 1 436 ? 97.983  -14.745 259.057 1.00 115.67 ? 436 LYS B CG    1 
ATOM   8004  N  N     . ILE C 1 437 ? 101.036 -16.934 258.026 1.00 114.15 ? 437 ILE B N     1 
ATOM   8005  C  CA    . ILE C 1 437 ? 102.317 -17.190 258.669 1.00 109.15 ? 437 ILE B CA    1 
ATOM   8006  C  C     . ILE C 1 437 ? 103.460 -16.661 257.811 1.00 115.94 ? 437 ILE B C     1 
ATOM   8007  O  O     . ILE C 1 437 ? 104.409 -16.067 258.326 1.00 122.75 ? 437 ILE B O     1 
ATOM   8008  C  CB    . ILE C 1 437 ? 102.524 -18.691 258.940 1.00 106.80 ? 437 ILE B CB    1 
ATOM   8009  C  CG1   . ILE C 1 437 ? 101.423 -19.216 259.863 1.00 113.96 ? 437 ILE B CG1   1 
ATOM   8010  C  CG2   . ILE C 1 437 ? 103.891 -18.942 259.549 1.00 92.26  ? 437 ILE B CG2   1 
ATOM   8011  C  CD1   . ILE C 1 437 ? 101.608 -20.657 260.290 1.00 94.97  ? 437 ILE B CD1   1 
ATOM   8012  N  N     . GLN C 1 438 ? 103.357 -16.871 256.500 1.00 109.48 ? 438 GLN B N     1 
ATOM   8013  C  CA    . GLN C 1 438 ? 104.346 -16.345 255.564 1.00 104.84 ? 438 GLN B CA    1 
ATOM   8014  C  C     . GLN C 1 438 ? 104.463 -14.821 255.651 1.00 105.66 ? 438 GLN B C     1 
ATOM   8015  O  O     . GLN C 1 438 ? 105.565 -14.275 255.724 1.00 111.22 ? 438 GLN B O     1 
ATOM   8016  C  CB    . GLN C 1 438 ? 104.010 -16.777 254.133 1.00 107.22 ? 438 GLN B CB    1 
ATOM   8017  C  CG    . GLN C 1 438 ? 104.900 -17.884 253.596 1.00 106.36 ? 438 GLN B CG    1 
ATOM   8018  C  CD    . GLN C 1 438 ? 106.313 -17.406 253.333 1.00 104.14 ? 438 GLN B CD    1 
ATOM   8019  O  OE1   . GLN C 1 438 ? 106.567 -16.205 253.241 1.00 103.41 ? 438 GLN B OE1   1 
ATOM   8020  N  NE2   . GLN C 1 438 ? 107.243 -18.345 253.218 1.00 100.50 ? 438 GLN B NE2   1 
ATOM   8021  N  N     . SER C 1 439 ? 103.319 -14.145 255.655 1.00 103.79 ? 439 SER B N     1 
ATOM   8022  C  CA    . SER C 1 439 ? 103.283 -12.688 255.741 1.00 113.42 ? 439 SER B CA    1 
ATOM   8023  C  C     . SER C 1 439 ? 103.913 -12.185 257.040 1.00 120.83 ? 439 SER B C     1 
ATOM   8024  O  O     . SER C 1 439 ? 104.768 -11.285 257.023 1.00 130.33 ? 439 SER B O     1 
ATOM   8025  C  CB    . SER C 1 439 ? 101.845 -12.179 255.620 1.00 121.47 ? 439 SER B CB    1 
ATOM   8026  O  OG    . SER C 1 439 ? 101.036 -12.692 256.665 1.00 129.02 ? 439 SER B OG    1 
ATOM   8027  N  N     . GLU C 1 440 ? 103.496 -12.775 258.159 1.00 114.82 ? 440 GLU B N     1 
ATOM   8028  C  CA    . GLU C 1 440 ? 104.065 -12.433 259.461 1.00 110.61 ? 440 GLU B CA    1 
ATOM   8029  C  C     . GLU C 1 440 ? 105.579 -12.626 259.448 1.00 114.96 ? 440 GLU B C     1 
ATOM   8030  O  O     . GLU C 1 440 ? 106.331 -11.825 260.010 1.00 126.63 ? 440 GLU B O     1 
ATOM   8031  C  CB    . GLU C 1 440 ? 103.433 -13.286 260.565 1.00 110.67 ? 440 GLU B CB    1 
ATOM   8032  C  CG    . GLU C 1 440 ? 103.952 -12.977 261.965 1.00 114.81 ? 440 GLU B CG    1 
ATOM   8033  C  CD    . GLU C 1 440 ? 103.366 -13.887 263.033 1.00 117.13 ? 440 GLU B CD    1 
ATOM   8034  O  OE1   . GLU C 1 440 ? 103.686 -13.687 264.224 1.00 122.05 ? 440 GLU B OE1   1 
ATOM   8035  O  OE2   . GLU C 1 440 ? 102.588 -14.802 262.685 1.00 109.48 ? 440 GLU B OE2   1 
ATOM   8036  N  N     . TYR C 1 441 ? 106.016 -13.689 258.781 1.00 112.92 ? 441 TYR B N     1 
ATOM   8037  C  CA    . TYR C 1 441 ? 107.432 -14.025 258.690 1.00 111.72 ? 441 TYR B CA    1 
ATOM   8038  C  C     . TYR C 1 441 ? 108.220 -12.973 257.909 1.00 112.91 ? 441 TYR B C     1 
ATOM   8039  O  O     . TYR C 1 441 ? 109.293 -12.542 258.341 1.00 122.00 ? 441 TYR B O     1 
ATOM   8040  C  CB    . TYR C 1 441 ? 107.604 -15.408 258.055 1.00 107.54 ? 441 TYR B CB    1 
ATOM   8041  C  CG    . TYR C 1 441 ? 109.039 -15.862 257.931 1.00 97.17  ? 441 TYR B CG    1 
ATOM   8042  C  CD1   . TYR C 1 441 ? 109.803 -16.127 259.058 1.00 95.51  ? 441 TYR B CD1   1 
ATOM   8043  C  CD2   . TYR C 1 441 ? 109.624 -16.040 256.685 1.00 95.89  ? 441 TYR B CD2   1 
ATOM   8044  C  CE1   . TYR C 1 441 ? 111.116 -16.546 258.948 1.00 96.12  ? 441 TYR B CE1   1 
ATOM   8045  C  CE2   . TYR C 1 441 ? 110.933 -16.462 256.565 1.00 98.35  ? 441 TYR B CE2   1 
ATOM   8046  C  CZ    . TYR C 1 441 ? 111.675 -16.713 257.698 1.00 102.29 ? 441 TYR B CZ    1 
ATOM   8047  O  OH    . TYR C 1 441 ? 112.980 -17.131 257.578 1.00 114.06 ? 441 TYR B OH    1 
ATOM   8048  N  N     . ASP C 1 442 ? 107.681 -12.560 256.765 1.00 108.19 ? 442 ASP B N     1 
ATOM   8049  C  CA    . ASP C 1 442 ? 108.321 -11.537 255.941 1.00 113.20 ? 442 ASP B CA    1 
ATOM   8050  C  C     . ASP C 1 442 ? 108.422 -10.200 256.682 1.00 111.14 ? 442 ASP B C     1 
ATOM   8051  O  O     . ASP C 1 442 ? 109.498 -9.575  256.731 1.00 117.85 ? 442 ASP B O     1 
ATOM   8052  C  CB    . ASP C 1 442 ? 107.553 -11.357 254.631 1.00 119.21 ? 442 ASP B CB    1 
ATOM   8053  C  CG    . ASP C 1 442 ? 107.407 -12.656 253.859 1.00 111.87 ? 442 ASP B CG    1 
ATOM   8054  O  OD1   . ASP C 1 442 ? 108.341 -13.487 253.903 1.00 108.99 ? 442 ASP B OD1   1 
ATOM   8055  O  OD2   . ASP C 1 442 ? 106.356 -12.848 253.210 1.00 107.63 ? 442 ASP B OD2   1 
ATOM   8056  N  N     . ASP C 1 443 ? 107.296 -9.768  257.252 1.00 98.86  ? 443 ASP B N     1 
ATOM   8057  C  CA    . ASP C 1 443 ? 107.271 -8.557  258.071 1.00 100.18 ? 443 ASP B CA    1 
ATOM   8058  C  C     . ASP C 1 443 ? 108.336 -8.635  259.158 1.00 108.91 ? 443 ASP B C     1 
ATOM   8059  O  O     . ASP C 1 443 ? 109.055 -7.663  259.417 1.00 117.47 ? 443 ASP B O     1 
ATOM   8060  C  CB    . ASP C 1 443 ? 105.893 -8.355  258.705 1.00 104.88 ? 443 ASP B CB    1 
ATOM   8061  C  CG    . ASP C 1 443 ? 104.863 -7.848  257.717 1.00 111.65 ? 443 ASP B CG    1 
ATOM   8062  O  OD1   . ASP C 1 443 ? 105.234 -7.082  256.804 1.00 124.61 ? 443 ASP B OD1   1 
ATOM   8063  O  OD2   . ASP C 1 443 ? 103.678 -8.213  257.859 1.00 109.47 ? 443 ASP B OD2   1 
ATOM   8064  N  N     . LEU C 1 444 ? 108.438 -9.805  259.781 1.00 105.48 ? 444 LEU B N     1 
ATOM   8065  C  CA    . LEU C 1 444 ? 109.459 -10.043 260.793 1.00 98.60  ? 444 LEU B CA    1 
ATOM   8066  C  C     . LEU C 1 444 ? 110.863 -9.857  260.237 1.00 100.42 ? 444 LEU B C     1 
ATOM   8067  O  O     . LEU C 1 444 ? 111.712 -9.271  260.899 1.00 105.13 ? 444 LEU B O     1 
ATOM   8068  C  CB    . LEU C 1 444 ? 109.326 -11.442 261.389 1.00 94.98  ? 444 LEU B CB    1 
ATOM   8069  C  CG    . LEU C 1 444 ? 108.469 -11.568 262.644 1.00 94.98  ? 444 LEU B CG    1 
ATOM   8070  C  CD1   . LEU C 1 444 ? 108.537 -12.989 263.160 1.00 95.78  ? 444 LEU B CD1   1 
ATOM   8071  C  CD2   . LEU C 1 444 ? 108.932 -10.585 263.705 1.00 99.47  ? 444 LEU B CD2   1 
ATOM   8072  N  N     . LEU C 1 445 ? 111.105 -10.360 259.029 1.00 100.87 ? 445 LEU B N     1 
ATOM   8073  C  CA    . LEU C 1 445 ? 112.412 -10.205 258.393 1.00 93.43  ? 445 LEU B CA    1 
ATOM   8074  C  C     . LEU C 1 445 ? 112.775 -8.734  258.237 1.00 94.98  ? 445 LEU B C     1 
ATOM   8075  O  O     . LEU C 1 445 ? 113.867 -8.305  258.638 1.00 99.98  ? 445 LEU B O     1 
ATOM   8076  C  CB    . LEU C 1 445 ? 112.443 -10.896 257.028 1.00 99.23  ? 445 LEU B CB    1 
ATOM   8077  C  CG    . LEU C 1 445 ? 113.267 -12.179 256.902 1.00 95.44  ? 445 LEU B CG    1 
ATOM   8078  C  CD1   . LEU C 1 445 ? 113.961 -12.524 258.209 1.00 96.05  ? 445 LEU B CD1   1 
ATOM   8079  C  CD2   . LEU C 1 445 ? 112.384 -13.323 256.450 1.00 93.07  ? 445 LEU B CD2   1 
ATOM   8080  N  N     . ALA C 1 446 ? 111.853 -7.966  257.658 1.00 106.21 ? 446 ALA B N     1 
ATOM   8081  C  CA    . ALA C 1 446 ? 112.059 -6.525  257.501 1.00 114.85 ? 446 ALA B CA    1 
ATOM   8082  C  C     . ALA C 1 446 ? 112.372 -5.866  258.846 1.00 116.25 ? 446 ALA B C     1 
ATOM   8083  O  O     . ALA C 1 446 ? 113.336 -5.097  258.972 1.00 117.38 ? 446 ALA B O     1 
ATOM   8084  C  CB    . ALA C 1 446 ? 110.837 -5.878  256.863 1.00 101.22 ? 446 ALA B CB    1 
ATOM   8085  N  N     . LEU C 1 447 ? 111.558 -6.194  259.846 1.00 113.49 ? 447 LEU B N     1 
ATOM   8086  C  CA    . LEU C 1 447 ? 111.731 -5.677  261.200 1.00 110.56 ? 447 LEU B CA    1 
ATOM   8087  C  C     . LEU C 1 447 ? 113.132 -5.945  261.749 1.00 109.96 ? 447 LEU B C     1 
ATOM   8088  O  O     . LEU C 1 447 ? 113.825 -5.023  262.183 1.00 115.91 ? 447 LEU B O     1 
ATOM   8089  C  CB    . LEU C 1 447 ? 110.675 -6.282  262.129 1.00 118.05 ? 447 LEU B CB    1 
ATOM   8090  C  CG    . LEU C 1 447 ? 110.767 -5.983  263.627 1.00 96.21  ? 447 LEU B CG    1 
ATOM   8091  C  CD1   . LEU C 1 447 ? 110.802 -4.484  263.889 1.00 98.18  ? 447 LEU B CD1   1 
ATOM   8092  C  CD2   . LEU C 1 447 ? 109.595 -6.618  264.352 1.00 99.66  ? 447 LEU B CD2   1 
ATOM   8093  N  N     . ILE C 1 448 ? 113.541 -7.209  261.714 1.00 102.03 ? 448 ILE B N     1 
ATOM   8094  C  CA    . ILE C 1 448 ? 114.854 -7.622  262.193 1.00 102.81 ? 448 ILE B CA    1 
ATOM   8095  C  C     . ILE C 1 448 ? 115.970 -6.870  261.477 1.00 102.77 ? 448 ILE B C     1 
ATOM   8096  O  O     . ILE C 1 448 ? 116.933 -6.430  262.109 1.00 101.39 ? 448 ILE B O     1 
ATOM   8097  C  CB    . ILE C 1 448 ? 115.061 -9.140  262.021 1.00 91.90  ? 448 ILE B CB    1 
ATOM   8098  C  CG1   . ILE C 1 448 ? 114.050 -9.913  262.869 1.00 101.70 ? 448 ILE B CG1   1 
ATOM   8099  C  CG2   . ILE C 1 448 ? 116.474 -9.535  262.407 1.00 91.87  ? 448 ILE B CG2   1 
ATOM   8100  C  CD1   . ILE C 1 448 ? 114.075 -11.414 262.645 1.00 100.86 ? 448 ILE B CD1   1 
ATOM   8101  N  N     . ALA C 1 449 ? 115.834 -6.722  260.162 1.00 99.53  ? 449 ALA B N     1 
ATOM   8102  C  CA    . ALA C 1 449 ? 116.796 -5.945  259.387 1.00 104.02 ? 449 ALA B CA    1 
ATOM   8103  C  C     . ALA C 1 449 ? 116.918 -4.528  259.944 1.00 113.79 ? 449 ALA B C     1 
ATOM   8104  O  O     . ALA C 1 449 ? 118.025 -4.034  260.200 1.00 116.80 ? 449 ALA B O     1 
ATOM   8105  C  CB    . ALA C 1 449 ? 116.391 -5.910  257.921 1.00 105.32 ? 449 ALA B CB    1 
ATOM   8106  N  N     . ASP C 1 450 ? 115.769 -3.888  260.148 1.00 118.61 ? 450 ASP B N     1 
ATOM   8107  C  CA    . ASP C 1 450 ? 115.735 -2.517  260.659 1.00 118.40 ? 450 ASP B CA    1 
ATOM   8108  C  C     . ASP C 1 450 ? 116.384 -2.388  262.041 1.00 98.31  ? 450 ASP B C     1 
ATOM   8109  O  O     . ASP C 1 450 ? 117.151 -1.456  262.296 1.00 110.65 ? 450 ASP B O     1 
ATOM   8110  C  CB    . ASP C 1 450 ? 114.295 -1.995  260.696 1.00 101.50 ? 450 ASP B CB    1 
ATOM   8111  C  CG    . ASP C 1 450 ? 114.223 -0.479  260.787 1.00 127.95 ? 450 ASP B CG    1 
ATOM   8112  O  OD1   . ASP C 1 450 ? 115.239 0.184   260.499 1.00 105.54 ? 450 ASP B OD1   1 
ATOM   8113  O  OD2   . ASP C 1 450 ? 113.145 0.053   261.132 1.00 129.05 ? 450 ASP B OD2   1 
ATOM   8114  N  N     . LEU C 1 451 ? 116.073 -3.330  262.927 1.00 112.60 ? 451 LEU B N     1 
ATOM   8115  C  CA    . LEU C 1 451 ? 116.601 -3.310  264.291 1.00 106.02 ? 451 LEU B CA    1 
ATOM   8116  C  C     . LEU C 1 451 ? 118.110 -3.540  264.323 1.00 96.04  ? 451 LEU B C     1 
ATOM   8117  O  O     . LEU C 1 451 ? 118.830 -2.889  265.083 1.00 95.83  ? 451 LEU B O     1 
ATOM   8118  C  CB    . LEU C 1 451 ? 115.890 -4.352  265.154 1.00 93.74  ? 451 LEU B CB    1 
ATOM   8119  C  CG    . LEU C 1 451 ? 114.371 -4.192  265.252 1.00 94.79  ? 451 LEU B CG    1 
ATOM   8120  C  CD1   . LEU C 1 451 ? 113.755 -5.322  266.060 1.00 94.06  ? 451 LEU B CD1   1 
ATOM   8121  C  CD2   . LEU C 1 451 ? 114.006 -2.841  265.850 1.00 96.56  ? 451 LEU B CD2   1 
ATOM   8122  N  N     . ALA C 1 452 ? 118.580 -4.473  263.501 1.00 95.77  ? 452 ALA B N     1 
ATOM   8123  C  CA    . ALA C 1 452 ? 120.007 -4.740  263.383 1.00 100.89 ? 452 ALA B CA    1 
ATOM   8124  C  C     . ALA C 1 452 ? 120.720 -3.494  262.867 1.00 106.42 ? 452 ALA B C     1 
ATOM   8125  O  O     . ALA C 1 452 ? 121.812 -3.149  263.331 1.00 107.35 ? 452 ALA B O     1 
ATOM   8126  C  CB    . ALA C 1 452 ? 120.250 -5.916  262.455 1.00 102.61 ? 452 ALA B CB    1 
ATOM   8127  N  N     . ASP C 1 453 ? 120.089 -2.817  261.910 1.00 108.80 ? 453 ASP B N     1 
ATOM   8128  C  CA    . ASP C 1 453 ? 120.642 -1.574  261.379 1.00 104.70 ? 453 ASP B CA    1 
ATOM   8129  C  C     . ASP C 1 453 ? 120.732 -0.514  262.471 1.00 105.81 ? 453 ASP B C     1 
ATOM   8130  O  O     . ASP C 1 453 ? 121.719 0.215   262.561 1.00 103.98 ? 453 ASP B O     1 
ATOM   8131  C  CB    . ASP C 1 453 ? 119.808 -1.056  260.206 1.00 111.88 ? 453 ASP B CB    1 
ATOM   8132  C  CG    . ASP C 1 453 ? 120.449 0.136   259.518 1.00 127.52 ? 453 ASP B CG    1 
ATOM   8133  O  OD1   . ASP C 1 453 ? 121.694 0.176   259.439 1.00 137.07 ? 453 ASP B OD1   1 
ATOM   8134  O  OD2   . ASP C 1 453 ? 119.713 1.037   259.062 1.00 129.83 ? 453 ASP B OD2   1 
ATOM   8135  N  N     . ILE C 1 454 ? 119.693 -0.432  263.296 1.00 115.01 ? 454 ILE B N     1 
ATOM   8136  C  CA    . ILE C 1 454 ? 119.681 0.493   264.425 1.00 112.55 ? 454 ILE B CA    1 
ATOM   8137  C  C     . ILE C 1 454 ? 120.825 0.199   265.396 1.00 106.96 ? 454 ILE B C     1 
ATOM   8138  O  O     . ILE C 1 454 ? 121.508 1.112   265.861 1.00 102.85 ? 454 ILE B O     1 
ATOM   8139  C  CB    . ILE C 1 454 ? 118.332 0.445   265.177 1.00 112.38 ? 454 ILE B CB    1 
ATOM   8140  C  CG1   . ILE C 1 454 ? 117.242 1.128   264.351 1.00 101.01 ? 454 ILE B CG1   1 
ATOM   8141  C  CG2   . ILE C 1 454 ? 118.442 1.115   266.536 1.00 98.13  ? 454 ILE B CG2   1 
ATOM   8142  C  CD1   . ILE C 1 454 ? 115.873 1.118   265.008 1.00 101.45 ? 454 ILE B CD1   1 
ATOM   8143  N  N     . LEU C 1 455 ? 121.036 -1.081  265.689 1.00 110.24 ? 455 LEU B N     1 
ATOM   8144  C  CA    . LEU C 1 455 ? 122.096 -1.486  266.607 1.00 106.44 ? 455 LEU B CA    1 
ATOM   8145  C  C     . LEU C 1 455 ? 123.488 -1.291  266.009 1.00 100.71 ? 455 LEU B C     1 
ATOM   8146  O  O     . LEU C 1 455 ? 124.472 -1.184  266.738 1.00 98.32  ? 455 LEU B O     1 
ATOM   8147  C  CB    . LEU C 1 455 ? 121.901 -2.938  267.049 1.00 93.17  ? 455 LEU B CB    1 
ATOM   8148  C  CG    . LEU C 1 455 ? 120.734 -3.190  268.003 1.00 104.76 ? 455 LEU B CG    1 
ATOM   8149  C  CD1   . LEU C 1 455 ? 120.712 -4.643  268.449 1.00 112.42 ? 455 LEU B CD1   1 
ATOM   8150  C  CD2   . LEU C 1 455 ? 120.810 -2.257  269.204 1.00 97.34  ? 455 LEU B CD2   1 
ATOM   8151  N  N     . ALA C 1 456 ? 123.570 -1.242  264.683 1.00 101.27 ? 456 ALA B N     1 
ATOM   8152  C  CA    . ALA C 1 456 ? 124.854 -1.045  264.014 1.00 99.41  ? 456 ALA B CA    1 
ATOM   8153  C  C     . ALA C 1 456 ? 125.198 0.432   263.830 1.00 110.76 ? 456 ALA B C     1 
ATOM   8154  O  O     . ALA C 1 456 ? 126.317 0.772   263.441 1.00 114.50 ? 456 ALA B O     1 
ATOM   8155  C  CB    . ALA C 1 456 ? 124.866 -1.762  262.674 1.00 116.30 ? 456 ALA B CB    1 
ATOM   8156  N  N     . LYS C 1 457 ? 124.233 1.303   264.112 1.00 110.57 ? 457 LYS B N     1 
ATOM   8157  C  CA    . LYS C 1 457 ? 124.410 2.737   263.898 1.00 110.75 ? 457 LYS B CA    1 
ATOM   8158  C  C     . LYS C 1 457 ? 123.904 3.586   265.066 1.00 109.42 ? 457 LYS B C     1 
ATOM   8159  O  O     . LYS C 1 457 ? 122.698 3.688   265.295 1.00 113.34 ? 457 LYS B O     1 
ATOM   8160  C  CB    . LYS C 1 457 ? 123.732 3.174   262.597 1.00 106.51 ? 457 LYS B CB    1 
ATOM   8161  N  N     . PRO C 1 458 ? 124.839 4.199   265.809 1.00 101.73 ? 458 PRO B N     1 
ATOM   8162  C  CA    . PRO C 1 458 ? 124.534 5.069   266.951 1.00 104.50 ? 458 PRO B CA    1 
ATOM   8163  C  C     . PRO C 1 458 ? 123.702 6.287   266.552 1.00 117.74 ? 458 PRO B C     1 
ATOM   8164  O  O     . PRO C 1 458 ? 122.821 6.713   267.308 1.00 125.25 ? 458 PRO B O     1 
ATOM   8165  C  CB    . PRO C 1 458 ? 125.923 5.511   267.429 1.00 107.32 ? 458 PRO B CB    1 
ATOM   8166  C  CG    . PRO C 1 458 ? 126.840 4.422   266.977 1.00 114.04 ? 458 PRO B CG    1 
ATOM   8167  C  CD    . PRO C 1 458 ? 126.288 3.988   265.651 1.00 115.44 ? 458 PRO B CD    1 
ATOM   8168  N  N     . GLU C 1 459 ? 123.985 6.834   265.372 1.00 119.38 ? 459 GLU B N     1 
ATOM   8169  C  CA    . GLU C 1 459 ? 123.276 8.005   264.856 1.00 121.72 ? 459 GLU B CA    1 
ATOM   8170  C  C     . GLU C 1 459 ? 121.765 7.787   264.810 1.00 126.83 ? 459 GLU B C     1 
ATOM   8171  O  O     . GLU C 1 459 ? 120.989 8.678   265.161 1.00 129.21 ? 459 GLU B O     1 
ATOM   8172  C  CB    . GLU C 1 459 ? 123.794 8.371   263.465 1.00 107.43 ? 459 GLU B CB    1 
ATOM   8173  N  N     . ARG C 1 460 ? 121.353 6.598   264.378 1.00 125.44 ? 460 ARG B N     1 
ATOM   8174  C  CA    . ARG C 1 460 ? 119.936 6.258   264.333 1.00 120.71 ? 460 ARG B CA    1 
ATOM   8175  C  C     . ARG C 1 460 ? 119.321 6.243   265.728 1.00 119.35 ? 460 ARG B C     1 
ATOM   8176  O  O     . ARG C 1 460 ? 118.213 6.728   265.917 1.00 119.84 ? 460 ARG B O     1 
ATOM   8177  C  CB    . ARG C 1 460 ? 119.709 4.913   263.637 1.00 113.08 ? 460 ARG B CB    1 
ATOM   8178  C  CG    . ARG C 1 460 ? 119.837 4.964   262.125 1.00 114.20 ? 460 ARG B CG    1 
ATOM   8179  C  CD    . ARG C 1 460 ? 119.252 3.716   261.483 1.00 117.05 ? 460 ARG B CD    1 
ATOM   8180  N  NE    . ARG C 1 460 ? 117.805 3.631   261.667 1.00 112.19 ? 460 ARG B NE    1 
ATOM   8181  C  CZ    . ARG C 1 460 ? 117.059 2.604   261.271 1.00 109.71 ? 460 ARG B CZ    1 
ATOM   8182  N  NH1   . ARG C 1 460 ? 117.624 1.565   260.672 1.00 108.73 ? 460 ARG B NH1   1 
ATOM   8183  N  NH2   . ARG C 1 460 ? 115.749 2.612   261.481 1.00 112.31 ? 460 ARG B NH2   1 
ATOM   8184  N  N     . VAL C 1 461 ? 120.041 5.682   266.696 1.00 114.24 ? 461 VAL B N     1 
ATOM   8185  C  CA    . VAL C 1 461 ? 119.583 5.665   268.083 1.00 105.12 ? 461 VAL B CA    1 
ATOM   8186  C  C     . VAL C 1 461 ? 119.375 7.087   268.598 1.00 107.28 ? 461 VAL B C     1 
ATOM   8187  O  O     . VAL C 1 461 ? 118.337 7.408   269.191 1.00 109.13 ? 461 VAL B O     1 
ATOM   8188  C  CB    . VAL C 1 461 ? 120.582 4.925   269.002 1.00 91.04  ? 461 VAL B CB    1 
ATOM   8189  C  CG1   . VAL C 1 461 ? 120.246 5.168   270.464 1.00 87.84  ? 461 VAL B CG1   1 
ATOM   8190  C  CG2   . VAL C 1 461 ? 120.584 3.441   268.698 1.00 87.38  ? 461 VAL B CG2   1 
ATOM   8191  N  N     . SER C 1 462 ? 120.368 7.936   268.353 1.00 105.06 ? 462 SER B N     1 
ATOM   8192  C  CA    . SER C 1 462 ? 120.294 9.340   268.736 1.00 105.80 ? 462 SER B CA    1 
ATOM   8193  C  C     . SER C 1 462 ? 119.063 10.006  268.121 1.00 110.36 ? 462 SER B C     1 
ATOM   8194  O  O     . SER C 1 462 ? 118.323 10.735  268.794 1.00 113.75 ? 462 SER B O     1 
ATOM   8195  C  CB    . SER C 1 462 ? 121.569 10.063  268.299 1.00 113.35 ? 462 SER B CB    1 
ATOM   8196  O  OG    . SER C 1 462 ? 121.602 11.391  268.789 1.00 122.87 ? 462 SER B OG    1 
ATOM   8197  N  N     . GLN C 1 463 ? 118.837 9.726   266.842 1.00 111.11 ? 463 GLN B N     1 
ATOM   8198  C  CA    . GLN C 1 463 ? 117.691 10.276  266.129 1.00 109.87 ? 463 GLN B CA    1 
ATOM   8199  C  C     . GLN C 1 463 ? 116.367 9.795   266.722 1.00 108.91 ? 463 GLN B C     1 
ATOM   8200  O  O     . GLN C 1 463 ? 115.407 10.554  266.804 1.00 117.32 ? 463 GLN B O     1 
ATOM   8201  C  CB    . GLN C 1 463 ? 117.765 9.919   264.646 1.00 105.35 ? 463 GLN B CB    1 
ATOM   8202  C  CG    . GLN C 1 463 ? 116.831 10.737  263.774 1.00 109.54 ? 463 GLN B CG    1 
ATOM   8203  C  CD    . GLN C 1 463 ? 117.148 12.218  263.823 1.00 128.10 ? 463 GLN B CD    1 
ATOM   8204  O  OE1   . GLN C 1 463 ? 118.308 12.612  263.945 1.00 133.08 ? 463 GLN B OE1   1 
ATOM   8205  N  NE2   . GLN C 1 463 ? 116.114 13.048  263.737 1.00 141.18 ? 463 GLN B NE2   1 
ATOM   8206  N  N     . ILE C 1 464 ? 116.323 8.530   267.127 1.00 98.05  ? 464 ILE B N     1 
ATOM   8207  C  CA    . ILE C 1 464 ? 115.135 7.962   267.756 1.00 100.09 ? 464 ILE B CA    1 
ATOM   8208  C  C     . ILE C 1 464 ? 114.841 8.707   269.053 1.00 106.09 ? 464 ILE B C     1 
ATOM   8209  O  O     . ILE C 1 464 ? 113.694 9.095   269.318 1.00 109.49 ? 464 ILE B O     1 
ATOM   8210  C  CB    . ILE C 1 464 ? 115.318 6.460   268.059 1.00 95.66  ? 464 ILE B CB    1 
ATOM   8211  C  CG1   . ILE C 1 464 ? 115.407 5.656   266.762 1.00 88.81  ? 464 ILE B CG1   1 
ATOM   8212  C  CG2   . ILE C 1 464 ? 114.174 5.949   268.916 1.00 96.44  ? 464 ILE B CG2   1 
ATOM   8213  C  CD1   . ILE C 1 464 ? 116.007 4.276   266.941 1.00 87.16  ? 464 ILE B CD1   1 
ATOM   8214  N  N     . ILE C 1 465 ? 115.888 8.910   269.850 1.00 100.92 ? 465 ILE B N     1 
ATOM   8215  C  CA    . ILE C 1 465 ? 115.770 9.677   271.084 1.00 104.71 ? 465 ILE B CA    1 
ATOM   8216  C  C     . ILE C 1 465 ? 115.201 11.068  270.818 1.00 107.43 ? 465 ILE B C     1 
ATOM   8217  O  O     . ILE C 1 465 ? 114.253 11.495  271.479 1.00 110.19 ? 465 ILE B O     1 
ATOM   8218  C  CB    . ILE C 1 465 ? 117.130 9.811   271.794 1.00 103.44 ? 465 ILE B CB    1 
ATOM   8219  C  CG1   . ILE C 1 465 ? 117.593 8.450   272.315 1.00 98.49  ? 465 ILE B CG1   1 
ATOM   8220  C  CG2   . ILE C 1 465 ? 117.045 10.813  272.933 1.00 96.22  ? 465 ILE B CG2   1 
ATOM   8221  C  CD1   . ILE C 1 465 ? 118.891 8.510   273.083 1.00 97.80  ? 465 ILE B CD1   1 
ATOM   8222  N  N     . LYS C 1 466 ? 115.775 11.766  269.843 1.00 102.65 ? 466 LYS B N     1 
ATOM   8223  C  CA    . LYS C 1 466 ? 115.317 13.111  269.509 1.00 99.14  ? 466 LYS B CA    1 
ATOM   8224  C  C     . LYS C 1 466 ? 113.857 13.139  269.058 1.00 102.15 ? 466 LYS B C     1 
ATOM   8225  O  O     . LYS C 1 466 ? 113.086 14.002  269.478 1.00 113.74 ? 466 LYS B O     1 
ATOM   8226  C  CB    . LYS C 1 466 ? 116.218 13.737  268.445 1.00 100.24 ? 466 LYS B CB    1 
ATOM   8227  C  CG    . LYS C 1 466 ? 117.593 14.122  268.958 1.00 140.43 ? 466 LYS B CG    1 
ATOM   8228  C  CD    . LYS C 1 466 ? 118.505 14.533  267.814 1.00 146.50 ? 466 LYS B CD    1 
ATOM   8229  C  CE    . LYS C 1 466 ? 117.887 15.636  266.973 1.00 145.01 ? 466 LYS B CE    1 
ATOM   8230  N  NZ    . LYS C 1 466 ? 118.668 15.886  265.728 1.00 143.97 ? 466 LYS B NZ    1 
ATOM   8231  N  N     . ASP C 1 467 ? 113.482 12.187  268.211 1.00 100.01 ? 467 ASP B N     1 
ATOM   8232  C  CA    . ASP C 1 467 ? 112.111 12.093  267.722 1.00 110.63 ? 467 ASP B CA    1 
ATOM   8233  C  C     . ASP C 1 467 ? 111.110 11.865  268.852 1.00 115.32 ? 467 ASP B C     1 
ATOM   8234  O  O     . ASP C 1 467 ? 110.116 12.587  268.970 1.00 123.84 ? 467 ASP B O     1 
ATOM   8235  C  CB    . ASP C 1 467 ? 111.984 10.974  266.685 1.00 122.15 ? 467 ASP B CB    1 
ATOM   8236  C  CG    . ASP C 1 467 ? 112.764 11.259  265.418 1.00 130.92 ? 467 ASP B CG    1 
ATOM   8237  O  OD1   . ASP C 1 467 ? 112.932 12.448  265.074 1.00 138.66 ? 467 ASP B OD1   1 
ATOM   8238  O  OD2   . ASP C 1 467 ? 113.204 10.292  264.762 1.00 129.40 ? 467 ASP B OD2   1 
ATOM   8239  N  N     . GLU C 1 468 ? 111.373 10.857  269.679 1.00 114.21 ? 468 GLU B N     1 
ATOM   8240  C  CA    . GLU C 1 468 ? 110.470 10.530  270.778 1.00 110.23 ? 468 GLU B CA    1 
ATOM   8241  C  C     . GLU C 1 468 ? 110.381 11.664  271.801 1.00 104.21 ? 468 GLU B C     1 
ATOM   8242  O  O     . GLU C 1 468 ? 109.297 11.968  272.313 1.00 107.62 ? 468 GLU B O     1 
ATOM   8243  C  CB    . GLU C 1 468 ? 110.881 9.212   271.438 1.00 108.56 ? 468 GLU B CB    1 
ATOM   8244  C  CG    . GLU C 1 468 ? 110.823 8.023   270.493 1.00 103.72 ? 468 GLU B CG    1 
ATOM   8245  C  CD    . GLU C 1 468 ? 111.075 6.704   271.191 1.00 103.34 ? 468 GLU B CD    1 
ATOM   8246  O  OE1   . GLU C 1 468 ? 111.685 6.709   272.281 1.00 111.89 ? 468 GLU B OE1   1 
ATOM   8247  O  OE2   . GLU C 1 468 ? 110.653 5.661   270.648 1.00 94.46  ? 468 GLU B OE2   1 
ATOM   8248  N  N     . LEU C 1 469 ? 111.521 12.293  272.083 1.00 103.58 ? 469 LEU B N     1 
ATOM   8249  C  CA    . LEU C 1 469 ? 111.546 13.477  272.939 1.00 103.16 ? 469 LEU B CA    1 
ATOM   8250  C  C     . LEU C 1 469 ? 110.660 14.578  272.368 1.00 105.71 ? 469 LEU B C     1 
ATOM   8251  O  O     . LEU C 1 469 ? 109.881 15.197  273.095 1.00 110.65 ? 469 LEU B O     1 
ATOM   8252  C  CB    . LEU C 1 469 ? 112.972 14.001  273.125 1.00 98.31  ? 469 LEU B CB    1 
ATOM   8253  C  CG    . LEU C 1 469 ? 113.787 13.421  274.284 1.00 94.57  ? 469 LEU B CG    1 
ATOM   8254  C  CD1   . LEU C 1 469 ? 115.098 14.178  274.455 1.00 90.79  ? 469 LEU B CD1   1 
ATOM   8255  C  CD2   . LEU C 1 469 ? 112.983 13.437  275.577 1.00 94.82  ? 469 LEU B CD2   1 
ATOM   8256  N  N     . ASP C 1 470 ? 110.783 14.814  271.064 1.00 107.31 ? 470 ASP B N     1 
ATOM   8257  C  CA    . ASP C 1 470 ? 109.948 15.800  270.382 1.00 108.32 ? 470 ASP B CA    1 
ATOM   8258  C  C     . ASP C 1 470 ? 108.465 15.462  270.506 1.00 108.33 ? 470 ASP B C     1 
ATOM   8259  O  O     . ASP C 1 470 ? 107.625 16.354  270.641 1.00 111.11 ? 470 ASP B O     1 
ATOM   8260  C  CB    . ASP C 1 470 ? 110.339 15.926  268.907 1.00 113.53 ? 470 ASP B CB    1 
ATOM   8261  C  CG    . ASP C 1 470 ? 111.452 16.934  268.681 1.00 125.87 ? 470 ASP B CG    1 
ATOM   8262  O  OD1   . ASP C 1 470 ? 111.591 17.861  269.506 1.00 123.14 ? 470 ASP B OD1   1 
ATOM   8263  O  OD2   . ASP C 1 470 ? 112.181 16.805  267.674 1.00 136.92 ? 470 ASP B OD2   1 
ATOM   8264  N  N     . GLU C 1 471 ? 108.147 14.172  270.463 1.00 103.83 ? 471 GLU B N     1 
ATOM   8265  C  CA    . GLU C 1 471 ? 106.759 13.743  270.597 1.00 102.08 ? 471 GLU B CA    1 
ATOM   8266  C  C     . GLU C 1 471 ? 106.231 13.983  272.013 1.00 100.50 ? 471 GLU B C     1 
ATOM   8267  O  O     . GLU C 1 471 ? 105.075 14.371  272.190 1.00 98.52  ? 471 GLU B O     1 
ATOM   8268  C  CB    . GLU C 1 471 ? 106.587 12.279  270.176 1.00 103.54 ? 471 GLU B CB    1 
ATOM   8269  C  CG    . GLU C 1 471 ? 105.134 11.816  270.069 1.00 113.65 ? 471 GLU B CG    1 
ATOM   8270  C  CD    . GLU C 1 471 ? 104.397 12.377  268.855 1.00 132.73 ? 471 GLU B CD    1 
ATOM   8271  O  OE1   . GLU C 1 471 ? 103.323 11.837  268.513 1.00 144.45 ? 471 GLU B OE1   1 
ATOM   8272  O  OE2   . GLU C 1 471 ? 104.877 13.353  268.240 1.00 136.97 ? 471 GLU B OE2   1 
ATOM   8273  N  N     . VAL C 1 472 ? 107.079 13.762  273.016 1.00 105.82 ? 472 VAL B N     1 
ATOM   8274  C  CA    . VAL C 1 472 ? 106.715 14.099  274.392 1.00 101.43 ? 472 VAL B CA    1 
ATOM   8275  C  C     . VAL C 1 472 ? 106.463 15.600  274.523 1.00 106.78 ? 472 VAL B C     1 
ATOM   8276  O  O     . VAL C 1 472 ? 105.460 16.030  275.108 1.00 106.57 ? 472 VAL B O     1 
ATOM   8277  C  CB    . VAL C 1 472 ? 107.801 13.659  275.400 1.00 88.81  ? 472 VAL B CB    1 
ATOM   8278  C  CG1   . VAL C 1 472 ? 107.689 14.444  276.701 1.00 89.16  ? 472 VAL B CG1   1 
ATOM   8279  C  CG2   . VAL C 1 472 ? 107.702 12.168  275.669 1.00 90.71  ? 472 VAL B CG2   1 
ATOM   8280  N  N     . LYS C 1 473 ? 107.375 16.389  273.960 1.00 108.68 ? 473 LYS B N     1 
ATOM   8281  C  CA    . LYS C 1 473 ? 107.262 17.845  273.959 1.00 102.60 ? 473 LYS B CA    1 
ATOM   8282  C  C     . LYS C 1 473 ? 105.951 18.307  273.334 1.00 99.32  ? 473 LYS B C     1 
ATOM   8283  O  O     . LYS C 1 473 ? 105.303 19.228  273.830 1.00 100.19 ? 473 LYS B O     1 
ATOM   8284  C  CB    . LYS C 1 473 ? 108.432 18.463  273.196 1.00 110.11 ? 473 LYS B CB    1 
ATOM   8285  C  CG    . LYS C 1 473 ? 108.395 19.977  273.115 1.00 123.26 ? 473 LYS B CG    1 
ATOM   8286  C  CD    . LYS C 1 473 ? 109.459 20.498  272.164 1.00 136.08 ? 473 LYS B CD    1 
ATOM   8287  C  CE    . LYS C 1 473 ? 109.374 22.007  272.005 1.00 146.03 ? 473 LYS B CE    1 
ATOM   8288  N  NZ    . LYS C 1 473 ? 110.335 22.523  270.991 1.00 156.13 ? 473 LYS B NZ    1 
ATOM   8289  N  N     . ARG C 1 474 ? 105.567 17.657  272.241 1.00 96.81  ? 474 ARG B N     1 
ATOM   8290  C  CA    . ARG C 1 474 ? 104.331 17.989  271.545 1.00 110.72 ? 474 ARG B CA    1 
ATOM   8291  C  C     . ARG C 1 474 ? 103.115 17.609  272.382 1.00 112.30 ? 474 ARG B C     1 
ATOM   8292  O  O     . ARG C 1 474 ? 102.148 18.365  272.468 1.00 117.96 ? 474 ARG B O     1 
ATOM   8293  C  CB    . ARG C 1 474 ? 104.285 17.279  270.188 1.00 107.99 ? 474 ARG B CB    1 
ATOM   8294  C  CG    . ARG C 1 474 ? 103.189 17.755  269.240 1.00 121.13 ? 474 ARG B CG    1 
ATOM   8295  C  CD    . ARG C 1 474 ? 101.899 16.955  269.388 1.00 123.06 ? 474 ARG B CD    1 
ATOM   8296  N  NE    . ARG C 1 474 ? 102.099 15.522  269.173 1.00 120.91 ? 474 ARG B NE    1 
ATOM   8297  C  CZ    . ARG C 1 474 ? 101.112 14.631  269.130 1.00 123.01 ? 474 ARG B CZ    1 
ATOM   8298  N  NH1   . ARG C 1 474 ? 99.854  15.024  269.281 1.00 131.31 ? 474 ARG B NH1   1 
ATOM   8299  N  NH2   . ARG C 1 474 ? 101.379 13.349  268.932 1.00 120.06 ? 474 ARG B NH2   1 
ATOM   8300  N  N     . LYS C 1 475 ? 103.169 16.431  272.997 1.00 105.97 ? 475 LYS B N     1 
ATOM   8301  C  CA    . LYS C 1 475 ? 102.016 15.896  273.716 1.00 101.54 ? 475 LYS B CA    1 
ATOM   8302  C  C     . LYS C 1 475 ? 101.738 16.548  275.072 1.00 95.38  ? 475 LYS B C     1 
ATOM   8303  O  O     . LYS C 1 475 ? 100.583 16.627  275.488 1.00 93.40  ? 475 LYS B O     1 
ATOM   8304  C  CB    . LYS C 1 475 ? 102.146 14.380  273.897 1.00 99.30  ? 475 LYS B CB    1 
ATOM   8305  C  CG    . LYS C 1 475 ? 101.956 13.571  272.623 1.00 109.35 ? 475 LYS B CG    1 
ATOM   8306  C  CD    . LYS C 1 475 ? 102.062 12.076  272.888 1.00 102.40 ? 475 LYS B CD    1 
ATOM   8307  N  N     . PHE C 1 476 ? 102.777 17.011  275.763 1.00 92.78  ? 476 PHE B N     1 
ATOM   8308  C  CA    . PHE C 1 476 ? 102.606 17.365  277.174 1.00 87.74  ? 476 PHE B CA    1 
ATOM   8309  C  C     . PHE C 1 476 ? 103.003 18.780  277.613 1.00 93.54  ? 476 PHE B C     1 
ATOM   8310  O  O     . PHE C 1 476 ? 102.445 19.303  278.576 1.00 103.44 ? 476 PHE B O     1 
ATOM   8311  C  CB    . PHE C 1 476 ? 103.311 16.331  278.056 1.00 89.48  ? 476 PHE B CB    1 
ATOM   8312  C  CG    . PHE C 1 476 ? 102.774 14.938  277.895 1.00 93.27  ? 476 PHE B CG    1 
ATOM   8313  C  CD1   . PHE C 1 476 ? 101.410 14.699  277.936 1.00 95.67  ? 476 PHE B CD1   1 
ATOM   8314  C  CD2   . PHE C 1 476 ? 103.631 13.869  277.684 1.00 100.13 ? 476 PHE B CD2   1 
ATOM   8315  C  CE1   . PHE C 1 476 ? 100.911 13.419  277.780 1.00 96.34  ? 476 PHE B CE1   1 
ATOM   8316  C  CE2   . PHE C 1 476 ? 103.137 12.587  277.526 1.00 101.36 ? 476 PHE B CE2   1 
ATOM   8317  C  CZ    . PHE C 1 476 ? 101.775 12.363  277.574 1.00 98.29  ? 476 PHE B CZ    1 
ATOM   8318  N  N     . SER C 1 477 ? 103.958 19.390  276.923 1.00 98.39  ? 477 SER B N     1 
ATOM   8319  C  CA    . SER C 1 477 ? 104.535 20.657  277.378 1.00 88.83  ? 477 SER B CA    1 
ATOM   8320  C  C     . SER C 1 477 ? 103.522 21.790  277.575 1.00 114.00 ? 477 SER B C     1 
ATOM   8321  O  O     . SER C 1 477 ? 102.564 21.923  276.816 1.00 93.25  ? 477 SER B O     1 
ATOM   8322  C  CB    . SER C 1 477 ? 105.646 21.111  276.435 1.00 138.26 ? 477 SER B CB    1 
ATOM   8323  O  OG    . SER C 1 477 ? 106.290 22.268  276.937 1.00 94.29  ? 477 SER B OG    1 
ATOM   8324  N  N     . ASP C 1 478 ? 103.744 22.595  278.609 1.00 115.42 ? 478 ASP B N     1 
ATOM   8325  C  CA    . ASP C 1 478 ? 102.914 23.764  278.872 1.00 97.65  ? 478 ASP B CA    1 
ATOM   8326  C  C     . ASP C 1 478 ? 103.621 25.033  278.424 1.00 106.06 ? 478 ASP B C     1 
ATOM   8327  O  O     . ASP C 1 478 ? 104.823 25.024  278.159 1.00 105.04 ? 478 ASP B O     1 
ATOM   8328  C  CB    . ASP C 1 478 ? 102.589 23.869  280.364 1.00 142.17 ? 478 ASP B CB    1 
ATOM   8329  C  CG    . ASP C 1 478 ? 101.634 22.794  280.831 1.00 143.12 ? 478 ASP B CG    1 
ATOM   8330  O  OD1   . ASP C 1 478 ? 100.571 22.627  280.198 1.00 154.38 ? 478 ASP B OD1   1 
ATOM   8331  O  OD2   . ASP C 1 478 ? 101.948 22.112  281.828 1.00 134.44 ? 478 ASP B OD2   1 
ATOM   8332  N  N     . LYS C 1 479 ? 102.863 26.121  278.337 1.00 106.91 ? 479 LYS B N     1 
ATOM   8333  C  CA    . LYS C 1 479 ? 103.441 27.436  278.107 1.00 115.81 ? 479 LYS B CA    1 
ATOM   8334  C  C     . LYS C 1 479 ? 104.178 27.846  279.377 1.00 115.37 ? 479 LYS B C     1 
ATOM   8335  O  O     . LYS C 1 479 ? 103.903 27.317  280.454 1.00 103.73 ? 479 LYS B O     1 
ATOM   8336  C  CB    . LYS C 1 479 ? 102.345 28.449  277.774 1.00 110.20 ? 479 LYS B CB    1 
ATOM   8337  N  N     . ARG C 1 480 ? 105.117 28.778  279.255 1.00 121.58 ? 480 ARG B N     1 
ATOM   8338  C  CA    . ARG C 1 480 ? 105.901 29.211  280.407 1.00 121.61 ? 480 ARG B CA    1 
ATOM   8339  C  C     . ARG C 1 480 ? 105.032 29.916  281.445 1.00 122.26 ? 480 ARG B C     1 
ATOM   8340  O  O     . ARG C 1 480 ? 104.221 30.779  281.111 1.00 117.74 ? 480 ARG B O     1 
ATOM   8341  C  CB    . ARG C 1 480 ? 107.056 30.115  279.971 1.00 122.35 ? 480 ARG B CB    1 
ATOM   8342  C  CG    . ARG C 1 480 ? 108.052 30.411  281.079 1.00 122.96 ? 480 ARG B CG    1 
ATOM   8343  C  CD    . ARG C 1 480 ? 109.274 31.140  280.554 1.00 127.83 ? 480 ARG B CD    1 
ATOM   8344  N  NE    . ARG C 1 480 ? 110.329 31.216  281.560 1.00 131.83 ? 480 ARG B NE    1 
ATOM   8345  C  CZ    . ARG C 1 480 ? 111.246 30.274  281.749 1.00 129.30 ? 480 ARG B CZ    1 
ATOM   8346  N  NH1   . ARG C 1 480 ? 111.237 29.183  280.998 1.00 115.51 ? 480 ARG B NH1   1 
ATOM   8347  N  NH2   . ARG C 1 480 ? 112.171 30.419  282.687 1.00 136.96 ? 480 ARG B NH2   1 
ATOM   8348  N  N     . ARG C 1 481 ? 105.200 29.533  282.705 1.00 127.85 ? 481 ARG B N     1 
ATOM   8349  C  CA    . ARG C 1 481 ? 104.415 30.112  283.787 1.00 133.66 ? 481 ARG B CA    1 
ATOM   8350  C  C     . ARG C 1 481 ? 105.162 31.258  284.461 1.00 140.81 ? 481 ARG B C     1 
ATOM   8351  O  O     . ARG C 1 481 ? 104.558 32.246  284.878 1.00 132.25 ? 481 ARG B O     1 
ATOM   8352  C  CB    . ARG C 1 481 ? 104.056 29.041  284.818 1.00 119.87 ? 481 ARG B CB    1 
ATOM   8353  N  N     . THR C 1 482 ? 106.480 31.124  284.557 1.00 144.12 ? 482 THR B N     1 
ATOM   8354  C  CA    . THR C 1 482 ? 107.302 32.108  285.252 1.00 136.60 ? 482 THR B CA    1 
ATOM   8355  C  C     . THR C 1 482 ? 107.905 33.117  284.283 1.00 136.91 ? 482 THR B C     1 
ATOM   8356  O  O     . THR C 1 482 ? 108.550 32.743  283.304 1.00 141.03 ? 482 THR B O     1 
ATOM   8357  C  CB    . THR C 1 482 ? 108.436 31.427  286.048 1.00 120.82 ? 482 THR B CB    1 
ATOM   8358  O  OG1   . THR C 1 482 ? 107.876 30.627  287.097 1.00 111.98 ? 482 THR B OG1   1 
ATOM   8359  C  CG2   . THR C 1 482 ? 109.369 32.467  286.654 1.00 117.61 ? 482 THR B CG2   1 
ATOM   8360  N  N     . GLU C 1 483 ? 107.685 34.398  284.558 1.00 135.59 ? 483 GLU B N     1 
ATOM   8361  C  CA    . GLU C 1 483 ? 108.285 35.460  283.764 1.00 144.52 ? 483 GLU B CA    1 
ATOM   8362  C  C     . GLU C 1 483 ? 109.602 35.905  284.390 1.00 148.64 ? 483 GLU B C     1 
ATOM   8363  O  O     . GLU C 1 483 ? 109.663 36.204  285.584 1.00 153.34 ? 483 GLU B O     1 
ATOM   8364  C  CB    . GLU C 1 483 ? 107.328 36.648  283.646 1.00 152.72 ? 483 GLU B CB    1 
ATOM   8365  N  N     . LEU C 1 484 ? 110.655 35.941  283.580 1.00 150.78 ? 484 LEU B N     1 
ATOM   8366  C  CA    . LEU C 1 484 ? 111.972 36.342  284.059 1.00 153.02 ? 484 LEU B CA    1 
ATOM   8367  C  C     . LEU C 1 484 ? 112.205 37.826  283.801 1.00 159.90 ? 484 LEU B C     1 
ATOM   8368  O  O     . LEU C 1 484 ? 111.887 38.337  282.727 1.00 167.57 ? 484 LEU B O     1 
ATOM   8369  C  CB    . LEU C 1 484 ? 113.067 35.511  283.390 1.00 153.03 ? 484 LEU B CB    1 
ATOM   8370  C  CG    . LEU C 1 484 ? 112.767 34.026  283.168 1.00 145.61 ? 484 LEU B CG    1 
ATOM   8371  C  CD1   . LEU C 1 484 ? 112.367 33.781  281.721 1.00 146.78 ? 484 LEU B CD1   1 
ATOM   8372  C  CD2   . LEU C 1 484 ? 113.957 33.163  283.557 1.00 135.10 ? 484 LEU B CD2   1 
ATOM   8373  N  N     . MET C 1 485 ? 112.767 38.512  284.792 1.00 158.18 ? 485 MET B N     1 
ATOM   8374  C  CA    . MET C 1 485 ? 112.977 39.951  284.709 1.00 153.85 ? 485 MET B CA    1 
ATOM   8375  C  C     . MET C 1 485 ? 114.448 40.296  284.929 1.00 158.04 ? 485 MET B C     1 
ATOM   8376  O  O     . MET C 1 485 ? 115.275 39.411  285.150 1.00 156.97 ? 485 MET B O     1 
ATOM   8377  C  CB    . MET C 1 485 ? 112.122 40.663  285.758 1.00 147.51 ? 485 MET B CB    1 
ATOM   8378  C  CG    . MET C 1 485 ? 110.793 39.980  286.045 1.00 135.24 ? 485 MET B CG    1 
ATOM   8379  S  SD    . MET C 1 485 ? 109.474 40.418  284.890 1.00 186.02 ? 485 MET B SD    1 
ATOM   8380  C  CE    . MET C 1 485 ? 108.951 41.992  285.568 1.00 142.99 ? 485 MET B CE    1 
ATOM   8381  N  N     . VAL C 1 486 ? 114.765 41.587  284.868 1.00 163.10 ? 486 VAL B N     1 
ATOM   8382  C  CA    . VAL C 1 486 ? 116.114 42.074  285.150 1.00 160.02 ? 486 VAL B CA    1 
ATOM   8383  C  C     . VAL C 1 486 ? 116.071 43.441  285.825 1.00 160.68 ? 486 VAL B C     1 
ATOM   8384  O  O     . VAL C 1 486 ? 115.760 43.551  287.012 1.00 147.88 ? 486 VAL B O     1 
ATOM   8385  C  CB    . VAL C 1 486 ? 116.973 42.172  283.871 1.00 158.41 ? 486 VAL B CB    1 
ATOM   8386  C  CG1   . VAL C 1 486 ? 117.812 40.915  283.687 1.00 151.54 ? 486 VAL B CG1   1 
ATOM   8387  C  CG2   . VAL C 1 486 ? 116.097 42.438  282.654 1.00 158.47 ? 486 VAL B CG2   1 
ATOM   8388  N  N     . MET D 2 24  ? 81.526  43.170  303.998 1.00 169.63 ? 403 MET D N     1 
ATOM   8389  C  CA    . MET D 2 24  ? 82.715  42.375  304.278 1.00 168.77 ? 403 MET D CA    1 
ATOM   8390  C  C     . MET D 2 24  ? 83.328  42.768  305.619 1.00 163.80 ? 403 MET D C     1 
ATOM   8391  O  O     . MET D 2 24  ? 82.899  43.737  306.244 1.00 157.42 ? 403 MET D O     1 
ATOM   8392  C  CB    . MET D 2 24  ? 83.741  42.535  303.154 1.00 138.95 ? 403 MET D CB    1 
ATOM   8393  N  N     . LYS D 2 25  ? 84.326  42.008  306.062 1.00 160.55 ? 404 LYS D N     1 
ATOM   8394  C  CA    . LYS D 2 25  ? 85.026  42.317  307.304 1.00 155.86 ? 404 LYS D CA    1 
ATOM   8395  C  C     . LYS D 2 25  ? 86.246  43.185  307.027 1.00 164.00 ? 404 LYS D C     1 
ATOM   8396  O  O     . LYS D 2 25  ? 86.190  44.103  306.208 1.00 174.58 ? 404 LYS D O     1 
ATOM   8397  C  CB    . LYS D 2 25  ? 85.446  41.034  308.024 1.00 144.80 ? 404 LYS D CB    1 
ATOM   8398  N  N     . SER D 2 26  ? 87.349  42.888  307.706 1.00 162.11 ? 405 SER D N     1 
ATOM   8399  C  CA    . SER D 2 26  ? 88.579  43.654  307.541 1.00 168.67 ? 405 SER D CA    1 
ATOM   8400  C  C     . SER D 2 26  ? 89.792  42.883  308.048 1.00 171.33 ? 405 SER D C     1 
ATOM   8401  O  O     . SER D 2 26  ? 90.918  43.373  307.975 1.00 168.11 ? 405 SER D O     1 
ATOM   8402  C  CB    . SER D 2 26  ? 88.478  44.998  308.266 1.00 171.49 ? 405 SER D CB    1 
ATOM   8403  N  N     . GLY D 2 27  ? 89.557  41.679  308.559 1.00 176.72 ? 406 GLY D N     1 
ATOM   8404  C  CA    . GLY D 2 27  ? 90.626  40.862  309.106 1.00 186.42 ? 406 GLY D CA    1 
ATOM   8405  C  C     . GLY D 2 27  ? 91.294  41.533  310.291 1.00 195.40 ? 406 GLY D C     1 
ATOM   8406  O  O     . GLY D 2 27  ? 90.640  42.243  311.055 1.00 198.27 ? 406 GLY D O     1 
ATOM   8407  N  N     . LEU D 2 28  ? 92.592  41.288  310.453 1.00 197.70 ? 407 LEU D N     1 
ATOM   8408  C  CA    . LEU D 2 28  ? 93.410  41.947  311.478 1.00 196.76 ? 407 LEU D CA    1 
ATOM   8409  C  C     . LEU D 2 28  ? 93.023  41.630  312.928 1.00 191.11 ? 407 LEU D C     1 
ATOM   8410  O  O     . LEU D 2 28  ? 93.810  41.861  313.846 1.00 189.33 ? 407 LEU D O     1 
ATOM   8411  C  CB    . LEU D 2 28  ? 93.442  43.465  311.256 1.00 200.40 ? 407 LEU D CB    1 
ATOM   8412  N  N     . GLU D 2 29  ? 91.820  41.103  313.130 1.00 187.47 ? 408 GLU D N     1 
ATOM   8413  C  CA    . GLU D 2 29  ? 91.327  40.805  314.469 1.00 188.47 ? 408 GLU D CA    1 
ATOM   8414  C  C     . GLU D 2 29  ? 92.097  39.656  315.112 1.00 190.04 ? 408 GLU D C     1 
ATOM   8415  O  O     . GLU D 2 29  ? 92.864  38.958  314.448 1.00 190.80 ? 408 GLU D O     1 
ATOM   8416  C  CB    . GLU D 2 29  ? 89.832  40.479  314.427 1.00 186.39 ? 408 GLU D CB    1 
ATOM   8417  N  N     . ILE D 2 30  ? 91.886  39.466  316.411 1.00 187.43 ? 409 ILE D N     1 
ATOM   8418  C  CA    . ILE D 2 30  ? 92.568  38.416  317.157 1.00 180.84 ? 409 ILE D CA    1 
ATOM   8419  C  C     . ILE D 2 30  ? 91.918  37.056  316.924 1.00 175.51 ? 409 ILE D C     1 
ATOM   8420  O  O     . ILE D 2 30  ? 91.301  36.820  315.885 1.00 173.15 ? 409 ILE D O     1 
ATOM   8421  C  CB    . ILE D 2 30  ? 92.577  38.716  318.667 1.00 176.24 ? 409 ILE D CB    1 
ATOM   8422  N  N     . PRO D 2 34  ? 88.121  29.590  316.779 1.00 131.54 ? 413 PRO D N     1 
ATOM   8423  C  CA    . PRO D 2 34  ? 88.497  28.189  316.994 1.00 134.64 ? 413 PRO D CA    1 
ATOM   8424  C  C     . PRO D 2 34  ? 89.736  27.803  316.195 1.00 145.88 ? 413 PRO D C     1 
ATOM   8425  O  O     . PRO D 2 34  ? 90.102  28.507  315.251 1.00 142.27 ? 413 PRO D O     1 
ATOM   8426  C  CB    . PRO D 2 34  ? 87.279  27.423  316.476 1.00 118.27 ? 413 PRO D CB    1 
ATOM   8427  C  CG    . PRO D 2 34  ? 86.138  28.352  316.700 1.00 118.61 ? 413 PRO D CG    1 
ATOM   8428  C  CD    . PRO D 2 34  ? 86.687  29.737  316.475 1.00 128.40 ? 413 PRO D CD    1 
ATOM   8429  N  N     . GLY D 2 35  ? 90.376  26.704  316.583 1.00 155.06 ? 414 GLY D N     1 
ATOM   8430  C  CA    . GLY D 2 35  ? 91.528  26.193  315.864 1.00 157.49 ? 414 GLY D CA    1 
ATOM   8431  C  C     . GLY D 2 35  ? 91.152  25.835  314.441 1.00 153.65 ? 414 GLY D C     1 
ATOM   8432  O  O     . GLY D 2 35  ? 91.840  26.205  313.490 1.00 154.77 ? 414 GLY D O     1 
ATOM   8433  N  N     . LYS D 2 36  ? 90.045  25.112  314.298 1.00 147.86 ? 415 LYS D N     1 
ATOM   8434  C  CA    . LYS D 2 36  ? 89.485  24.822  312.984 1.00 139.92 ? 415 LYS D CA    1 
ATOM   8435  C  C     . LYS D 2 36  ? 88.703  26.034  312.489 1.00 139.09 ? 415 LYS D C     1 
ATOM   8436  O  O     . LYS D 2 36  ? 89.150  27.170  312.645 1.00 145.68 ? 415 LYS D O     1 
ATOM   8437  C  CB    . LYS D 2 36  ? 88.575  23.594  313.045 1.00 129.34 ? 415 LYS D CB    1 
ATOM   8438  N  N     . LEU D 2 37  ? 87.538  25.783  311.900 1.00 125.14 ? 416 LEU D N     1 
ATOM   8439  C  CA    . LEU D 2 37  ? 86.646  26.840  311.422 1.00 120.40 ? 416 LEU D CA    1 
ATOM   8440  C  C     . LEU D 2 37  ? 87.310  27.826  310.464 1.00 126.11 ? 416 LEU D C     1 
ATOM   8441  O  O     . LEU D 2 37  ? 87.908  28.816  310.885 1.00 135.17 ? 416 LEU D O     1 
ATOM   8442  C  CB    . LEU D 2 37  ? 86.011  27.601  312.590 1.00 109.62 ? 416 LEU D CB    1 
ATOM   8443  C  CG    . LEU D 2 37  ? 85.032  28.717  312.200 1.00 108.89 ? 416 LEU D CG    1 
ATOM   8444  C  CD1   . LEU D 2 37  ? 83.779  28.152  311.542 1.00 103.74 ? 416 LEU D CD1   1 
ATOM   8445  C  CD2   . LEU D 2 37  ? 84.672  29.582  313.400 1.00 119.95 ? 416 LEU D CD2   1 
ATOM   8446  N  N     . ALA D 2 38  ? 87.196  27.552  309.171 1.00 114.97 ? 417 ALA D N     1 
ATOM   8447  C  CA    . ALA D 2 38  ? 87.620  28.510  308.164 1.00 113.73 ? 417 ALA D CA    1 
ATOM   8448  C  C     . ALA D 2 38  ? 86.501  29.520  307.956 1.00 118.90 ? 417 ALA D C     1 
ATOM   8449  O  O     . ALA D 2 38  ? 85.522  29.240  307.266 1.00 126.86 ? 417 ALA D O     1 
ATOM   8450  C  CB    . ALA D 2 38  ? 87.956  27.810  306.861 1.00 119.05 ? 417 ALA D CB    1 
ATOM   8451  N  N     . ASP D 2 39  ? 86.648  30.695  308.557 1.00 111.35 ? 418 ASP D N     1 
ATOM   8452  C  CA    . ASP D 2 39  ? 85.594  31.702  308.528 1.00 121.61 ? 418 ASP D CA    1 
ATOM   8453  C  C     . ASP D 2 39  ? 85.373  32.268  307.126 1.00 134.45 ? 418 ASP D C     1 
ATOM   8454  O  O     . ASP D 2 39  ? 86.085  31.920  306.183 1.00 133.59 ? 418 ASP D O     1 
ATOM   8455  C  CB    . ASP D 2 39  ? 85.898  32.831  309.518 1.00 130.05 ? 418 ASP D CB    1 
ATOM   8456  C  CG    . ASP D 2 39  ? 84.645  33.403  310.156 1.00 132.95 ? 418 ASP D CG    1 
ATOM   8457  O  OD1   . ASP D 2 39  ? 83.529  33.025  309.738 1.00 133.59 ? 418 ASP D OD1   1 
ATOM   8458  O  OD2   . ASP D 2 39  ? 84.778  34.237  311.074 1.00 129.73 ? 418 ASP D OD2   1 
ATOM   8459  N  N     . CYS D 2 40  ? 84.378  33.140  307.000 1.00 143.16 ? 419 CYS D N     1 
ATOM   8460  C  CA    . CYS D 2 40  ? 84.017  33.726  305.715 1.00 143.67 ? 419 CYS D CA    1 
ATOM   8461  C  C     . CYS D 2 40  ? 84.768  35.031  305.488 1.00 143.61 ? 419 CYS D C     1 
ATOM   8462  O  O     . CYS D 2 40  ? 85.995  35.079  305.577 1.00 119.61 ? 419 CYS D O     1 
ATOM   8463  C  CB    . CYS D 2 40  ? 82.512  33.986  305.665 1.00 116.83 ? 419 CYS D CB    1 
ATOM   8464  S  SG    . CYS D 2 40  ? 81.962  35.254  306.829 1.00 202.64 ? 419 CYS D SG    1 
ATOM   8465  N  N     . SER D 2 41  ? 84.017  36.089  305.198 1.00 145.68 ? 420 SER D N     1 
ATOM   8466  C  CA    . SER D 2 41  ? 84.590  37.412  304.979 1.00 142.33 ? 420 SER D CA    1 
ATOM   8467  C  C     . SER D 2 41  ? 83.550  38.501  305.217 1.00 146.80 ? 420 SER D C     1 
ATOM   8468  O  O     . SER D 2 41  ? 83.880  39.592  305.680 1.00 149.88 ? 420 SER D O     1 
ATOM   8469  C  CB    . SER D 2 41  ? 85.154  37.524  303.563 1.00 137.10 ? 420 SER D CB    1 
ATOM   8470  N  N     . SER D 2 42  ? 82.294  38.205  304.899 1.00 149.45 ? 421 SER D N     1 
ATOM   8471  C  CA    . SER D 2 42  ? 81.222  39.179  305.077 1.00 155.34 ? 421 SER D CA    1 
ATOM   8472  C  C     . SER D 2 42  ? 80.649  39.117  306.487 1.00 159.30 ? 421 SER D C     1 
ATOM   8473  O  O     . SER D 2 42  ? 80.343  38.040  306.996 1.00 158.99 ? 421 SER D O     1 
ATOM   8474  C  CB    . SER D 2 42  ? 80.105  38.963  304.054 1.00 158.24 ? 421 SER D CB    1 
ATOM   8475  O  OG    . SER D 2 42  ? 79.310  37.841  304.400 1.00 156.04 ? 421 SER D OG    1 
ATOM   8476  N  N     . ASN D 2 43  ? 80.512  40.280  307.114 1.00 163.37 ? 422 ASN D N     1 
ATOM   8477  C  CA    . ASN D 2 43  ? 79.901  40.375  308.432 1.00 158.99 ? 422 ASN D CA    1 
ATOM   8478  C  C     . ASN D 2 43  ? 78.400  40.624  308.319 1.00 155.68 ? 422 ASN D C     1 
ATOM   8479  O  O     . ASN D 2 43  ? 77.904  41.675  308.723 1.00 166.50 ? 422 ASN D O     1 
ATOM   8480  C  CB    . ASN D 2 43  ? 80.565  41.485  309.250 1.00 159.84 ? 422 ASN D CB    1 
ATOM   8481  C  CG    . ASN D 2 43  ? 81.994  41.151  309.637 1.00 161.09 ? 422 ASN D CG    1 
ATOM   8482  O  OD1   . ASN D 2 43  ? 82.510  40.088  309.294 1.00 161.49 ? 422 ASN D OD1   1 
ATOM   8483  N  ND2   . ASN D 2 43  ? 82.643  42.064  310.350 1.00 161.74 ? 422 ASN D ND2   1 
ATOM   8484  N  N     . ASN D 2 44  ? 77.685  39.650  307.764 1.00 147.14 ? 423 ASN D N     1 
ATOM   8485  C  CA    . ASN D 2 44  ? 76.249  39.779  307.537 1.00 147.65 ? 423 ASN D CA    1 
ATOM   8486  C  C     . ASN D 2 44  ? 75.506  38.473  307.812 1.00 148.15 ? 423 ASN D C     1 
ATOM   8487  O  O     . ASN D 2 44  ? 75.473  37.582  306.962 1.00 150.31 ? 423 ASN D O     1 
ATOM   8488  C  CB    . ASN D 2 44  ? 75.981  40.244  306.102 1.00 155.75 ? 423 ASN D CB    1 
ATOM   8489  C  CG    . ASN D 2 44  ? 74.582  40.802  305.916 1.00 164.76 ? 423 ASN D CG    1 
ATOM   8490  O  OD1   . ASN D 2 44  ? 73.696  40.576  306.738 1.00 167.69 ? 423 ASN D OD1   1 
ATOM   8491  N  ND2   . ASN D 2 44  ? 74.379  41.534  304.828 1.00 167.42 ? 423 ASN D ND2   1 
ATOM   8492  N  N     . PRO D 2 45  ? 74.901  38.361  309.004 1.00 152.40 ? 424 PRO D N     1 
ATOM   8493  C  CA    . PRO D 2 45  ? 74.136  37.177  309.416 1.00 154.70 ? 424 PRO D CA    1 
ATOM   8494  C  C     . PRO D 2 45  ? 72.772  37.081  308.730 1.00 154.49 ? 424 PRO D C     1 
ATOM   8495  O  O     . PRO D 2 45  ? 71.835  36.532  309.310 1.00 156.76 ? 424 PRO D O     1 
ATOM   8496  C  CB    . PRO D 2 45  ? 73.946  37.386  310.926 1.00 160.60 ? 424 PRO D CB    1 
ATOM   8497  C  CG    . PRO D 2 45  ? 74.939  38.435  311.314 1.00 163.25 ? 424 PRO D CG    1 
ATOM   8498  C  CD    . PRO D 2 45  ? 75.062  39.314  310.112 1.00 162.90 ? 424 PRO D CD    1 
ATOM   8499  N  N     . ALA D 2 46  ? 72.667  37.613  307.517 1.00 151.05 ? 425 ALA D N     1 
ATOM   8500  C  CA    . ALA D 2 46  ? 71.442  37.518  306.734 1.00 144.27 ? 425 ALA D CA    1 
ATOM   8501  C  C     . ALA D 2 46  ? 71.707  36.746  305.446 1.00 146.18 ? 425 ALA D C     1 
ATOM   8502  O  O     . ALA D 2 46  ? 70.783  36.224  304.822 1.00 152.17 ? 425 ALA D O     1 
ATOM   8503  C  CB    . ALA D 2 46  ? 70.898  38.902  306.424 1.00 144.58 ? 425 ALA D CB    1 
ATOM   8504  N  N     A GLU D 2 47  ? 72.979  36.669  305.066 0.18 144.23 ? 426 GLU D N     1 
ATOM   8505  N  N     B GLU D 2 47  ? 72.973  36.684  305.048 0.82 144.83 ? 426 GLU D N     1 
ATOM   8506  C  CA    A GLU D 2 47  ? 73.382  35.988  303.842 0.18 142.88 ? 426 GLU D CA    1 
ATOM   8507  C  CA    B GLU D 2 47  ? 73.365  35.954  303.849 0.82 142.24 ? 426 GLU D CA    1 
ATOM   8508  C  C     A GLU D 2 47  ? 74.392  34.883  304.141 0.18 135.99 ? 426 GLU D C     1 
ATOM   8509  C  C     B GLU D 2 47  ? 74.355  34.846  304.184 0.82 135.23 ? 426 GLU D C     1 
ATOM   8510  O  O     A GLU D 2 47  ? 74.389  33.834  303.495 0.18 132.93 ? 426 GLU D O     1 
ATOM   8511  O  O     B GLU D 2 47  ? 74.305  33.761  303.604 0.82 131.07 ? 426 GLU D O     1 
ATOM   8512  C  CB    A GLU D 2 47  ? 73.993  36.986  302.857 0.18 149.35 ? 426 GLU D CB    1 
ATOM   8513  C  CB    B GLU D 2 47  ? 73.988  36.896  302.817 0.82 147.54 ? 426 GLU D CB    1 
ATOM   8514  C  CG    A GLU D 2 47  ? 73.163  38.241  302.640 0.18 156.37 ? 426 GLU D CG    1 
ATOM   8515  C  CG    B GLU D 2 47  ? 73.098  38.047  302.381 0.82 154.52 ? 426 GLU D CG    1 
ATOM   8516  C  CD    A GLU D 2 47  ? 73.862  39.250  301.752 0.18 166.16 ? 426 GLU D CD    1 
ATOM   8517  C  CD    B GLU D 2 47  ? 73.690  38.823  301.222 0.82 166.67 ? 426 GLU D CD    1 
ATOM   8518  O  OE1   A GLU D 2 47  ? 74.802  38.855  301.030 0.18 167.64 ? 426 GLU D OE1   1 
ATOM   8519  O  OE1   B GLU D 2 47  ? 74.191  38.182  300.273 0.82 168.45 ? 426 GLU D OE1   1 
ATOM   8520  O  OE2   A GLU D 2 47  ? 73.477  40.437  301.781 0.18 170.13 ? 426 GLU D OE2   1 
ATOM   8521  O  OE2   B GLU D 2 47  ? 73.663  40.072  301.261 0.82 171.23 ? 426 GLU D OE2   1 
ATOM   8522  N  N     . THR D 2 48  ? 75.253  35.131  305.123 1.00 134.94 ? 427 THR D N     1 
ATOM   8523  C  CA    . THR D 2 48  ? 76.326  34.206  305.478 1.00 135.25 ? 427 THR D CA    1 
ATOM   8524  C  C     . THR D 2 48  ? 75.816  32.844  305.941 1.00 134.08 ? 427 THR D C     1 
ATOM   8525  O  O     . THR D 2 48  ? 74.750  32.740  306.546 1.00 134.90 ? 427 THR D O     1 
ATOM   8526  C  CB    . THR D 2 48  ? 77.243  34.799  306.566 1.00 118.01 ? 427 THR D CB    1 
ATOM   8527  O  OG1   . THR D 2 48  ? 77.355  36.215  306.382 1.00 147.63 ? 427 THR D OG1   1 
ATOM   8528  C  CG2   . THR D 2 48  ? 78.624  34.173  306.493 1.00 116.60 ? 427 THR D CG2   1 
ATOM   8529  N  N     . GLU D 2 49  ? 76.590  31.804  305.647 1.00 132.12 ? 428 GLU D N     1 
ATOM   8530  C  CA    . GLU D 2 49  ? 76.172  30.434  305.908 1.00 133.43 ? 428 GLU D CA    1 
ATOM   8531  C  C     . GLU D 2 49  ? 77.285  29.626  306.563 1.00 130.51 ? 428 GLU D C     1 
ATOM   8532  O  O     . GLU D 2 49  ? 78.442  29.711  306.161 1.00 108.78 ? 428 GLU D O     1 
ATOM   8533  C  CB    . GLU D 2 49  ? 75.749  29.766  304.599 1.00 139.75 ? 428 GLU D CB    1 
ATOM   8534  C  CG    . GLU D 2 49  ? 74.625  30.494  303.876 1.00 153.02 ? 428 GLU D CG    1 
ATOM   8535  C  CD    . GLU D 2 49  ? 74.568  30.175  302.396 1.00 161.75 ? 428 GLU D CD    1 
ATOM   8536  O  OE1   . GLU D 2 49  ? 75.523  29.560  301.877 1.00 114.21 ? 428 GLU D OE1   1 
ATOM   8537  O  OE2   . GLU D 2 49  ? 73.565  30.546  301.751 1.00 166.87 ? 428 GLU D OE2   1 
ATOM   8538  N  N     . LEU D 2 50  ? 76.927  28.843  307.575 1.00 125.34 ? 429 LEU D N     1 
ATOM   8539  C  CA    . LEU D 2 50  ? 77.875  27.963  308.246 1.00 120.39 ? 429 LEU D CA    1 
ATOM   8540  C  C     . LEU D 2 50  ? 77.583  26.513  307.871 1.00 108.99 ? 429 LEU D C     1 
ATOM   8541  O  O     . LEU D 2 50  ? 76.501  25.993  308.150 1.00 106.48 ? 429 LEU D O     1 
ATOM   8542  C  CB    . LEU D 2 50  ? 77.795  28.156  309.764 1.00 129.81 ? 429 LEU D CB    1 
ATOM   8543  C  CG    . LEU D 2 50  ? 78.938  27.652  310.656 1.00 129.88 ? 429 LEU D CG    1 
ATOM   8544  C  CD1   . LEU D 2 50  ? 78.868  26.147  310.888 1.00 122.59 ? 429 LEU D CD1   1 
ATOM   8545  C  CD2   . LEU D 2 50  ? 80.292  28.045  310.080 1.00 135.27 ? 429 LEU D CD2   1 
ATOM   8546  N  N     . PHE D 2 51  ? 78.555  25.865  307.240 1.00 108.78 ? 430 PHE D N     1 
ATOM   8547  C  CA    . PHE D 2 51  ? 78.412  24.472  306.836 1.00 114.61 ? 430 PHE D CA    1 
ATOM   8548  C  C     . PHE D 2 51  ? 79.073  23.531  307.833 1.00 110.01 ? 430 PHE D C     1 
ATOM   8549  O  O     . PHE D 2 51  ? 80.300  23.473  307.925 1.00 104.26 ? 430 PHE D O     1 
ATOM   8550  C  CB    . PHE D 2 51  ? 79.023  24.248  305.451 1.00 117.81 ? 430 PHE D CB    1 
ATOM   8551  C  CG    . PHE D 2 51  ? 78.176  24.753  304.320 1.00 124.52 ? 430 PHE D CG    1 
ATOM   8552  C  CD1   . PHE D 2 51  ? 78.324  26.047  303.852 1.00 130.21 ? 430 PHE D CD1   1 
ATOM   8553  C  CD2   . PHE D 2 51  ? 77.240  23.929  303.717 1.00 126.20 ? 430 PHE D CD2   1 
ATOM   8554  C  CE1   . PHE D 2 51  ? 77.550  26.513  302.808 1.00 130.21 ? 430 PHE D CE1   1 
ATOM   8555  C  CE2   . PHE D 2 51  ? 76.463  24.389  302.672 1.00 128.35 ? 430 PHE D CE2   1 
ATOM   8556  C  CZ    . PHE D 2 51  ? 76.618  25.683  302.217 1.00 128.72 ? 430 PHE D CZ    1 
ATOM   8557  N  N     . ILE D 2 52  ? 78.259  22.795  308.580 1.00 107.78 ? 431 ILE D N     1 
ATOM   8558  C  CA    . ILE D 2 52  ? 78.781  21.766  309.468 1.00 108.58 ? 431 ILE D CA    1 
ATOM   8559  C  C     . ILE D 2 52  ? 79.152  20.538  308.645 1.00 105.61 ? 431 ILE D C     1 
ATOM   8560  O  O     . ILE D 2 52  ? 78.280  19.796  308.189 1.00 102.73 ? 431 ILE D O     1 
ATOM   8561  C  CB    . ILE D 2 52  ? 77.768  21.378  310.561 1.00 105.77 ? 431 ILE D CB    1 
ATOM   8562  C  CG1   . ILE D 2 52  ? 77.431  22.592  311.427 1.00 100.02 ? 431 ILE D CG1   1 
ATOM   8563  C  CG2   . ILE D 2 52  ? 78.320  20.252  311.426 1.00 90.41  ? 431 ILE D CG2   1 
ATOM   8564  C  CD1   . ILE D 2 52  ? 76.448  22.297  312.535 1.00 103.79 ? 431 ILE D CD1   1 
ATOM   8565  N  N     . VAL D 2 53  ? 80.452  20.346  308.443 1.00 105.73 ? 432 VAL D N     1 
ATOM   8566  C  CA    . VAL D 2 53  ? 80.952  19.216  307.667 1.00 110.23 ? 432 VAL D CA    1 
ATOM   8567  C  C     . VAL D 2 53  ? 81.688  18.281  308.618 1.00 111.06 ? 432 VAL D C     1 
ATOM   8568  O  O     . VAL D 2 53  ? 82.231  18.731  309.620 1.00 105.79 ? 432 VAL D O     1 
ATOM   8569  C  CB    . VAL D 2 53  ? 81.873  19.688  306.504 1.00 100.56 ? 432 VAL D CB    1 
ATOM   8570  C  CG1   . VAL D 2 53  ? 83.336  19.336  306.765 1.00 93.01  ? 432 VAL D CG1   1 
ATOM   8571  C  CG2   . VAL D 2 53  ? 81.404  19.106  305.179 1.00 106.21 ? 432 VAL D CG2   1 
ATOM   8572  N  N     . GLU D 2 54  ? 81.684  16.983  308.335 1.00 116.87 ? 433 GLU D N     1 
ATOM   8573  C  CA    . GLU D 2 54  ? 82.335  16.036  309.238 1.00 115.52 ? 433 GLU D CA    1 
ATOM   8574  C  C     . GLU D 2 54  ? 83.769  15.700  308.826 1.00 111.65 ? 433 GLU D C     1 
ATOM   8575  O  O     . GLU D 2 54  ? 84.025  15.252  307.708 1.00 113.32 ? 433 GLU D O     1 
ATOM   8576  C  CB    . GLU D 2 54  ? 81.500  14.762  309.420 1.00 115.24 ? 433 GLU D CB    1 
ATOM   8577  C  CG    . GLU D 2 54  ? 81.226  13.973  308.154 1.00 114.52 ? 433 GLU D CG    1 
ATOM   8578  C  CD    . GLU D 2 54  ? 80.899  12.520  308.441 1.00 109.69 ? 433 GLU D CD    1 
ATOM   8579  O  OE1   . GLU D 2 54  ? 81.829  11.753  308.770 1.00 112.78 ? 433 GLU D OE1   1 
ATOM   8580  O  OE2   . GLU D 2 54  ? 79.713  12.144  308.342 1.00 105.26 ? 433 GLU D OE2   1 
ATOM   8581  N  N     . GLY D 2 55  ? 84.701  15.940  309.744 1.00 101.46 ? 434 GLY D N     1 
ATOM   8582  C  CA    . GLY D 2 55  ? 86.099  15.617  309.528 1.00 95.05  ? 434 GLY D CA    1 
ATOM   8583  C  C     . GLY D 2 55  ? 86.831  16.607  308.642 1.00 99.56  ? 434 GLY D C     1 
ATOM   8584  O  O     . GLY D 2 55  ? 86.224  17.313  307.829 1.00 113.39 ? 434 GLY D O     1 
ATOM   8585  N  N     . ASP D 2 56  ? 88.151  16.648  308.798 1.00 97.70  ? 435 ASP D N     1 
ATOM   8586  C  CA    . ASP D 2 56  ? 89.002  17.521  307.998 1.00 104.82 ? 435 ASP D CA    1 
ATOM   8587  C  C     . ASP D 2 56  ? 89.152  16.990  306.573 1.00 106.89 ? 435 ASP D C     1 
ATOM   8588  O  O     . ASP D 2 56  ? 89.647  17.689  305.690 1.00 112.14 ? 435 ASP D O     1 
ATOM   8589  C  CB    . ASP D 2 56  ? 90.377  17.672  308.652 1.00 92.72  ? 435 ASP D CB    1 
ATOM   8590  N  N     . SER D 2 57  ? 88.728  15.749  306.360 1.00 104.05 ? 436 SER D N     1 
ATOM   8591  C  CA    . SER D 2 57  ? 88.756  15.145  305.036 1.00 107.01 ? 436 SER D CA    1 
ATOM   8592  C  C     . SER D 2 57  ? 87.703  15.801  304.147 1.00 118.89 ? 436 SER D C     1 
ATOM   8593  O  O     . SER D 2 57  ? 87.957  16.103  302.979 1.00 131.03 ? 436 SER D O     1 
ATOM   8594  C  CB    . SER D 2 57  ? 88.524  13.635  305.130 1.00 106.61 ? 436 SER D CB    1 
ATOM   8595  O  OG    . SER D 2 57  ? 89.610  12.997  305.783 1.00 112.16 ? 436 SER D OG    1 
ATOM   8596  N  N     . ALA D 2 58  ? 86.519  16.023  304.709 1.00 110.59 ? 437 ALA D N     1 
ATOM   8597  C  CA    . ALA D 2 58  ? 85.478  16.769  304.016 1.00 107.44 ? 437 ALA D CA    1 
ATOM   8598  C  C     . ALA D 2 58  ? 85.781  18.255  304.132 1.00 111.89 ? 437 ALA D C     1 
ATOM   8599  O  O     . ALA D 2 58  ? 85.447  19.044  303.246 1.00 110.82 ? 437 ALA D O     1 
ATOM   8600  C  CB    . ALA D 2 58  ? 84.111  16.453  304.603 1.00 102.77 ? 437 ALA D CB    1 
ATOM   8601  N  N     . GLY D 2 59  ? 86.428  18.622  305.234 1.00 113.48 ? 438 GLY D N     1 
ATOM   8602  C  CA    . GLY D 2 59  ? 86.814  19.998  305.479 1.00 113.85 ? 438 GLY D CA    1 
ATOM   8603  C  C     . GLY D 2 59  ? 87.702  20.563  304.388 1.00 119.97 ? 438 GLY D C     1 
ATOM   8604  O  O     . GLY D 2 59  ? 87.525  21.709  303.975 1.00 124.68 ? 438 GLY D O     1 
ATOM   8605  N  N     . GLY D 2 60  ? 88.650  19.756  303.918 1.00 118.81 ? 439 GLY D N     1 
ATOM   8606  C  CA    . GLY D 2 60  ? 89.566  20.173  302.872 1.00 117.76 ? 439 GLY D CA    1 
ATOM   8607  C  C     . GLY D 2 60  ? 88.857  20.601  301.601 1.00 116.30 ? 439 GLY D C     1 
ATOM   8608  O  O     . GLY D 2 60  ? 89.068  21.708  301.108 1.00 114.07 ? 439 GLY D O     1 
ATOM   8609  N  N     . SER D 2 61  ? 88.009  19.722  301.076 1.00 122.00 ? 440 SER D N     1 
ATOM   8610  C  CA    . SER D 2 61  ? 87.264  19.998  299.853 1.00 122.63 ? 440 SER D CA    1 
ATOM   8611  C  C     . SER D 2 61  ? 86.271  21.139  300.052 1.00 117.75 ? 440 SER D C     1 
ATOM   8612  O  O     . SER D 2 61  ? 86.244  22.101  299.269 1.00 120.64 ? 440 SER D O     1 
ATOM   8613  C  CB    . SER D 2 61  ? 86.531  18.738  299.385 1.00 119.98 ? 440 SER D CB    1 
ATOM   8614  N  N     . ALA D 2 62  ? 85.464  21.025  301.106 1.00 115.38 ? 441 ALA D N     1 
ATOM   8615  C  CA    . ALA D 2 62  ? 84.433  22.015  301.398 1.00 116.73 ? 441 ALA D CA    1 
ATOM   8616  C  C     . ALA D 2 62  ? 85.018  23.417  301.510 1.00 117.45 ? 441 ALA D C     1 
ATOM   8617  O  O     . ALA D 2 62  ? 84.453  24.368  300.979 1.00 114.98 ? 441 ALA D O     1 
ATOM   8618  C  CB    . ALA D 2 62  ? 83.679  21.649  302.668 1.00 112.57 ? 441 ALA D CB    1 
ATOM   8619  N  N     . LYS D 2 63  ? 86.157  23.533  302.186 1.00 120.91 ? 442 LYS D N     1 
ATOM   8620  C  CA    . LYS D 2 63  ? 86.826  24.818  302.348 1.00 117.13 ? 442 LYS D CA    1 
ATOM   8621  C  C     . LYS D 2 63  ? 87.497  25.267  301.052 1.00 128.35 ? 442 LYS D C     1 
ATOM   8622  O  O     . LYS D 2 63  ? 87.493  26.453  300.721 1.00 127.35 ? 442 LYS D O     1 
ATOM   8623  C  CB    . LYS D 2 63  ? 87.860  24.751  303.474 1.00 102.73 ? 442 LYS D CB    1 
ATOM   8624  N  N     . SER D 2 64  ? 88.070  24.315  300.321 1.00 127.21 ? 443 SER D N     1 
ATOM   8625  C  CA    . SER D 2 64  ? 88.761  24.624  299.072 1.00 126.50 ? 443 SER D CA    1 
ATOM   8626  C  C     . SER D 2 64  ? 87.810  25.209  298.032 1.00 133.05 ? 443 SER D C     1 
ATOM   8627  O  O     . SER D 2 64  ? 88.193  26.084  297.253 1.00 137.67 ? 443 SER D O     1 
ATOM   8628  C  CB    . SER D 2 64  ? 89.461  23.385  298.509 1.00 125.16 ? 443 SER D CB    1 
ATOM   8629  N  N     . GLY D 2 65  ? 86.570  24.729  298.023 1.00 138.07 ? 444 GLY D N     1 
ATOM   8630  C  CA    . GLY D 2 65  ? 85.562  25.286  297.137 1.00 148.02 ? 444 GLY D CA    1 
ATOM   8631  C  C     . GLY D 2 65  ? 84.339  25.762  297.898 1.00 156.62 ? 444 GLY D C     1 
ATOM   8632  O  O     . GLY D 2 65  ? 83.383  25.008  298.068 1.00 163.01 ? 444 GLY D O     1 
ATOM   8633  N  N     . ARG D 2 66  ? 84.354  27.014  298.348 1.00 154.00 ? 445 ARG D N     1 
ATOM   8634  C  CA    . ARG D 2 66  ? 83.295  27.484  299.238 1.00 149.50 ? 445 ARG D CA    1 
ATOM   8635  C  C     . ARG D 2 66  ? 82.826  28.925  299.048 1.00 159.93 ? 445 ARG D C     1 
ATOM   8636  O  O     . ARG D 2 66  ? 81.868  29.334  299.696 1.00 169.94 ? 445 ARG D O     1 
ATOM   8637  C  CB    . ARG D 2 66  ? 83.716  27.299  300.697 1.00 141.82 ? 445 ARG D CB    1 
ATOM   8638  C  CG    . ARG D 2 66  ? 84.683  28.355  301.212 1.00 141.54 ? 445 ARG D CG    1 
ATOM   8639  C  CD    . ARG D 2 66  ? 84.982  28.137  302.687 1.00 138.31 ? 445 ARG D CD    1 
ATOM   8640  N  NE    . ARG D 2 66  ? 85.526  29.329  303.333 1.00 133.83 ? 445 ARG D NE    1 
ATOM   8641  C  CZ    . ARG D 2 66  ? 86.823  29.569  303.495 1.00 133.04 ? 445 ARG D CZ    1 
ATOM   8642  N  NH1   . ARG D 2 66  ? 87.722  28.698  303.058 1.00 132.03 ? 445 ARG D NH1   1 
ATOM   8643  N  NH2   . ARG D 2 66  ? 87.222  30.681  304.096 1.00 135.64 ? 445 ARG D NH2   1 
ATOM   8644  N  N     . ASN D 2 67  ? 83.489  29.689  298.181 1.00 154.97 ? 446 ASN D N     1 
ATOM   8645  C  CA    . ASN D 2 67  ? 83.203  31.121  298.043 1.00 146.87 ? 446 ASN D CA    1 
ATOM   8646  C  C     . ASN D 2 67  ? 83.392  31.838  299.380 1.00 136.43 ? 446 ASN D C     1 
ATOM   8647  O  O     . ASN D 2 67  ? 82.444  32.000  300.149 1.00 119.57 ? 446 ASN D O     1 
ATOM   8648  C  CB    . ASN D 2 67  ? 81.786  31.352  297.494 1.00 149.25 ? 446 ASN D CB    1 
ATOM   8649  C  CG    . ASN D 2 67  ? 81.448  32.827  297.321 1.00 155.09 ? 446 ASN D CG    1 
ATOM   8650  O  OD1   . ASN D 2 67  ? 81.096  33.516  298.280 1.00 125.20 ? 446 ASN D OD1   1 
ATOM   8651  N  ND2   . ASN D 2 67  ? 81.533  33.310  296.087 1.00 162.12 ? 446 ASN D ND2   1 
ATOM   8652  N  N     . ARG D 2 68  ? 84.623  32.258  299.656 1.00 132.11 ? 447 ARG D N     1 
ATOM   8653  C  CA    . ARG D 2 68  ? 84.949  32.856  300.949 1.00 135.26 ? 447 ARG D CA    1 
ATOM   8654  C  C     . ARG D 2 68  ? 84.450  34.291  301.101 1.00 150.78 ? 447 ARG D C     1 
ATOM   8655  O  O     . ARG D 2 68  ? 85.240  35.230  301.206 1.00 161.30 ? 447 ARG D O     1 
ATOM   8656  C  CB    . ARG D 2 68  ? 86.453  32.777  301.224 1.00 133.29 ? 447 ARG D CB    1 
ATOM   8657  C  CG    . ARG D 2 68  ? 87.328  33.085  300.026 1.00 141.54 ? 447 ARG D CG    1 
ATOM   8658  C  CD    . ARG D 2 68  ? 88.182  31.884  299.672 1.00 146.86 ? 447 ARG D CD    1 
ATOM   8659  N  NE    . ARG D 2 68  ? 89.008  31.457  300.796 1.00 150.36 ? 447 ARG D NE    1 
ATOM   8660  C  CZ    . ARG D 2 68  ? 90.255  31.865  301.001 1.00 152.69 ? 447 ARG D CZ    1 
ATOM   8661  N  NH1   . ARG D 2 68  ? 90.822  32.708  300.151 1.00 155.50 ? 447 ARG D NH1   1 
ATOM   8662  N  NH2   . ARG D 2 68  ? 90.936  31.429  302.051 1.00 149.65 ? 447 ARG D NH2   1 
ATOM   8663  N  N     . GLU D 2 69  ? 83.132  34.450  301.115 1.00 147.79 ? 448 GLU D N     1 
ATOM   8664  C  CA    . GLU D 2 69  ? 82.512  35.726  301.442 1.00 141.63 ? 448 GLU D CA    1 
ATOM   8665  C  C     . GLU D 2 69  ? 81.330  35.501  302.377 1.00 146.49 ? 448 GLU D C     1 
ATOM   8666  O  O     . GLU D 2 69  ? 81.266  36.082  303.460 1.00 154.74 ? 448 GLU D O     1 
ATOM   8667  C  CB    . GLU D 2 69  ? 82.066  36.468  300.180 1.00 142.88 ? 448 GLU D CB    1 
ATOM   8668  C  CG    . GLU D 2 69  ? 81.224  37.706  300.474 1.00 150.33 ? 448 GLU D CG    1 
ATOM   8669  C  CD    . GLU D 2 69  ? 80.929  38.530  299.237 1.00 156.22 ? 448 GLU D CD    1 
ATOM   8670  O  OE1   . GLU D 2 69  ? 80.072  39.437  299.312 1.00 155.73 ? 448 GLU D OE1   1 
ATOM   8671  O  OE2   . GLU D 2 69  ? 81.558  38.274  298.190 1.00 159.68 ? 448 GLU D OE2   1 
ATOM   8672  N  N     . PHE D 2 70  ? 80.404  34.645  301.960 1.00 148.64 ? 449 PHE D N     1 
ATOM   8673  C  CA    . PHE D 2 70  ? 79.234  34.334  302.779 1.00 151.69 ? 449 PHE D CA    1 
ATOM   8674  C  C     . PHE D 2 70  ? 79.098  32.846  303.121 1.00 136.18 ? 449 PHE D C     1 
ATOM   8675  O  O     . PHE D 2 70  ? 78.001  32.361  303.396 1.00 124.60 ? 449 PHE D O     1 
ATOM   8676  C  CB    . PHE D 2 70  ? 77.941  34.891  302.152 1.00 158.30 ? 449 PHE D CB    1 
ATOM   8677  C  CG    . PHE D 2 70  ? 77.455  34.135  300.935 1.00 157.64 ? 449 PHE D CG    1 
ATOM   8678  C  CD1   . PHE D 2 70  ? 78.344  33.533  300.058 1.00 150.59 ? 449 PHE D CD1   1 
ATOM   8679  C  CD2   . PHE D 2 70  ? 76.098  34.040  300.670 1.00 153.56 ? 449 PHE D CD2   1 
ATOM   8680  C  CE1   . PHE D 2 70  ? 77.892  32.847  298.950 1.00 136.78 ? 449 PHE D CE1   1 
ATOM   8681  C  CE2   . PHE D 2 70  ? 75.639  33.355  299.559 1.00 140.14 ? 449 PHE D CE2   1 
ATOM   8682  C  CZ    . PHE D 2 70  ? 76.538  32.757  298.698 1.00 132.02 ? 449 PHE D CZ    1 
ATOM   8683  N  N     . GLN D 2 71  ? 80.218  32.128  303.106 1.00 134.70 ? 450 GLN D N     1 
ATOM   8684  C  CA    . GLN D 2 71  ? 80.221  30.711  303.463 1.00 137.98 ? 450 GLN D CA    1 
ATOM   8685  C  C     . GLN D 2 71  ? 81.462  30.314  304.263 1.00 137.12 ? 450 GLN D C     1 
ATOM   8686  O  O     . GLN D 2 71  ? 82.590  30.434  303.788 1.00 142.52 ? 450 GLN D O     1 
ATOM   8687  C  CB    . GLN D 2 71  ? 80.102  29.831  302.216 1.00 128.50 ? 450 GLN D CB    1 
ATOM   8688  C  CG    . GLN D 2 71  ? 78.765  29.923  301.496 1.00 125.54 ? 450 GLN D CG    1 
ATOM   8689  C  CD    . GLN D 2 71  ? 78.621  28.886  300.401 1.00 122.21 ? 450 GLN D CD    1 
ATOM   8690  O  OE1   . GLN D 2 71  ? 79.484  28.027  300.228 1.00 121.28 ? 450 GLN D OE1   1 
ATOM   8691  N  NE2   . GLN D 2 71  ? 77.525  28.958  299.655 1.00 119.71 ? 450 GLN D NE2   1 
ATOM   8692  N  N     . ALA D 2 72  ? 81.236  29.838  305.482 1.00 121.54 ? 451 ALA D N     1 
ATOM   8693  C  CA    . ALA D 2 72  ? 82.305  29.353  306.342 1.00 112.54 ? 451 ALA D CA    1 
ATOM   8694  C  C     . ALA D 2 72  ? 82.054  27.891  306.685 1.00 111.80 ? 451 ALA D C     1 
ATOM   8695  O  O     . ALA D 2 72  ? 80.912  27.437  306.677 1.00 111.86 ? 451 ALA D O     1 
ATOM   8696  C  CB    . ALA D 2 72  ? 82.386  30.186  307.605 1.00 114.47 ? 451 ALA D CB    1 
ATOM   8697  N  N     . ILE D 2 73  ? 83.120  27.156  306.983 1.00 108.53 ? 452 ILE D N     1 
ATOM   8698  C  CA    . ILE D 2 73  ? 83.007  25.724  307.244 1.00 103.02 ? 452 ILE D CA    1 
ATOM   8699  C  C     . ILE D 2 73  ? 83.422  25.364  308.667 1.00 105.24 ? 452 ILE D C     1 
ATOM   8700  O  O     . ILE D 2 73  ? 84.392  25.904  309.195 1.00 107.69 ? 452 ILE D O     1 
ATOM   8701  C  CB    . ILE D 2 73  ? 83.875  24.907  306.267 1.00 99.86  ? 452 ILE D CB    1 
ATOM   8702  C  CG1   . ILE D 2 73  ? 83.710  25.423  304.838 1.00 102.17 ? 452 ILE D CG1   1 
ATOM   8703  C  CG2   . ILE D 2 73  ? 83.522  23.428  306.344 1.00 104.44 ? 452 ILE D CG2   1 
ATOM   8704  C  CD1   . ILE D 2 73  ? 82.308  25.265  304.287 1.00 102.64 ? 452 ILE D CD1   1 
ATOM   8705  N  N     . LEU D 2 74  ? 82.690  24.440  309.280 1.00 106.64 ? 453 LEU D N     1 
ATOM   8706  C  CA    . LEU D 2 74  ? 83.042  23.960  310.609 1.00 108.09 ? 453 LEU D CA    1 
ATOM   8707  C  C     . LEU D 2 74  ? 83.081  22.435  310.633 1.00 105.97 ? 453 LEU D C     1 
ATOM   8708  O  O     . LEU D 2 74  ? 82.050  21.778  310.455 1.00 111.53 ? 453 LEU D O     1 
ATOM   8709  C  CB    . LEU D 2 74  ? 82.052  24.491  311.649 1.00 114.12 ? 453 LEU D CB    1 
ATOM   8710  C  CG    . LEU D 2 74  ? 82.530  24.676  313.096 1.00 111.08 ? 453 LEU D CG    1 
ATOM   8711  C  CD1   . LEU D 2 74  ? 81.821  23.706  314.028 1.00 92.39  ? 453 LEU D CD1   1 
ATOM   8712  C  CD2   . LEU D 2 74  ? 84.044  24.536  313.221 1.00 105.17 ? 453 LEU D CD2   1 
ATOM   8713  N  N     . PRO D 2 75  ? 84.284  21.868  310.819 1.00 105.54 ? 454 PRO D N     1 
ATOM   8714  C  CA    . PRO D 2 75  ? 84.465  20.423  310.987 1.00 103.70 ? 454 PRO D CA    1 
ATOM   8715  C  C     . PRO D 2 75  ? 83.855  19.908  312.288 1.00 113.96 ? 454 PRO D C     1 
ATOM   8716  O  O     . PRO D 2 75  ? 83.834  20.623  313.289 1.00 116.38 ? 454 PRO D O     1 
ATOM   8717  C  CB    . PRO D 2 75  ? 85.988  20.263  311.029 1.00 92.19  ? 454 PRO D CB    1 
ATOM   8718  C  CG    . PRO D 2 75  ? 86.515  21.449  310.306 1.00 102.05 ? 454 PRO D CG    1 
ATOM   8719  C  CD    . PRO D 2 75  ? 85.571  22.563  310.649 1.00 109.84 ? 454 PRO D CD    1 
ATOM   8720  N  N     . ILE D 2 76  ? 83.362  18.675  312.261 1.00 117.86 ? 455 ILE D N     1 
ATOM   8721  C  CA    . ILE D 2 76  ? 82.831  18.022  313.449 1.00 115.68 ? 455 ILE D CA    1 
ATOM   8722  C  C     . ILE D 2 76  ? 83.534  16.685  313.622 1.00 119.09 ? 455 ILE D C     1 
ATOM   8723  O  O     . ILE D 2 76  ? 83.041  15.651  313.173 1.00 117.97 ? 455 ILE D O     1 
ATOM   8724  C  CB    . ILE D 2 76  ? 81.314  17.787  313.338 1.00 112.43 ? 455 ILE D CB    1 
ATOM   8725  N  N     . ARG D 2 77  ? 84.695  16.718  314.267 1.00 123.80 ? 456 ARG D N     1 
ATOM   8726  C  CA    . ARG D 2 77  ? 85.525  15.529  314.420 1.00 125.50 ? 456 ARG D CA    1 
ATOM   8727  C  C     . ARG D 2 77  ? 84.855  14.455  315.273 1.00 124.06 ? 456 ARG D C     1 
ATOM   8728  O  O     . ARG D 2 77  ? 84.610  14.653  316.464 1.00 120.52 ? 456 ARG D O     1 
ATOM   8729  C  CB    . ARG D 2 77  ? 86.885  15.904  315.013 1.00 80.84  ? 456 ARG D CB    1 
ATOM   8730  N  N     . GLY D 2 78  ? 84.559  13.318  314.652 1.00 130.34 ? 457 GLY D N     1 
ATOM   8731  C  CA    . GLY D 2 78  ? 83.974  12.193  315.357 1.00 134.07 ? 457 GLY D CA    1 
ATOM   8732  C  C     . GLY D 2 78  ? 82.478  12.327  315.550 1.00 134.19 ? 457 GLY D C     1 
ATOM   8733  O  O     . GLY D 2 78  ? 81.880  13.341  315.190 1.00 150.14 ? 457 GLY D O     1 
ATOM   8734  N  N     . LYS D 2 79  ? 81.871  11.292  316.121 1.00 115.16 ? 458 LYS D N     1 
ATOM   8735  C  CA    . LYS D 2 79  ? 80.442  11.301  316.397 1.00 102.96 ? 458 LYS D CA    1 
ATOM   8736  C  C     . LYS D 2 79  ? 80.111  12.231  317.558 1.00 100.45 ? 458 LYS D C     1 
ATOM   8737  O  O     . LYS D 2 79  ? 80.587  12.037  318.676 1.00 90.67  ? 458 LYS D O     1 
ATOM   8738  C  CB    . LYS D 2 79  ? 79.948  9.888   316.697 1.00 99.96  ? 458 LYS D CB    1 
ATOM   8739  C  CG    . LYS D 2 79  ? 80.007  8.954   315.507 1.00 115.52 ? 458 LYS D CG    1 
ATOM   8740  C  CD    . LYS D 2 79  ? 79.358  7.621   315.835 1.00 116.19 ? 458 LYS D CD    1 
ATOM   8741  C  CE    . LYS D 2 79  ? 79.261  6.741   314.604 1.00 103.07 ? 458 LYS D CE    1 
ATOM   8742  N  NZ    . LYS D 2 79  ? 78.444  7.388   313.543 1.00 90.31  ? 458 LYS D NZ    1 
ATOM   8743  N  N     . ILE D 2 80  ? 79.293  13.241  317.278 1.00 104.62 ? 459 ILE D N     1 
ATOM   8744  C  CA    . ILE D 2 80  ? 78.901  14.216  318.286 1.00 106.61 ? 459 ILE D CA    1 
ATOM   8745  C  C     . ILE D 2 80  ? 78.169  13.543  319.441 1.00 101.90 ? 459 ILE D C     1 
ATOM   8746  O  O     . ILE D 2 80  ? 77.568  12.481  319.277 1.00 92.19  ? 459 ILE D O     1 
ATOM   8747  C  CB    . ILE D 2 80  ? 78.014  15.330  317.691 1.00 82.15  ? 459 ILE D CB    1 
ATOM   8748  N  N     . LEU D 2 81  ? 78.238  14.167  320.611 1.00 102.18 ? 460 LEU D N     1 
ATOM   8749  C  CA    . LEU D 2 81  ? 77.628  13.621  321.814 1.00 108.67 ? 460 LEU D CA    1 
ATOM   8750  C  C     . LEU D 2 81  ? 76.105  13.650  321.751 1.00 116.48 ? 460 LEU D C     1 
ATOM   8751  O  O     . LEU D 2 81  ? 75.507  14.652  321.354 1.00 122.49 ? 460 LEU D O     1 
ATOM   8752  C  CB    . LEU D 2 81  ? 78.116  14.383  323.049 1.00 107.96 ? 460 LEU D CB    1 
ATOM   8753  N  N     . ASN D 2 82  ? 75.487  12.538  322.137 1.00 116.99 ? 461 ASN D N     1 
ATOM   8754  C  CA    . ASN D 2 82  ? 74.038  12.467  322.263 1.00 113.55 ? 461 ASN D CA    1 
ATOM   8755  C  C     . ASN D 2 82  ? 73.611  13.171  323.546 1.00 110.15 ? 461 ASN D C     1 
ATOM   8756  O  O     . ASN D 2 82  ? 73.827  12.662  324.646 1.00 106.70 ? 461 ASN D O     1 
ATOM   8757  C  CB    . ASN D 2 82  ? 73.581  11.006  322.274 1.00 111.81 ? 461 ASN D CB    1 
ATOM   8758  C  CG    . ASN D 2 82  ? 72.075  10.857  322.132 1.00 105.57 ? 461 ASN D CG    1 
ATOM   8759  O  OD1   . ASN D 2 82  ? 71.305  11.660  322.654 1.00 103.76 ? 461 ASN D OD1   1 
ATOM   8760  N  ND2   . ASN D 2 82  ? 71.651  9.821   321.420 1.00 99.23  ? 461 ASN D ND2   1 
ATOM   8761  N  N     . VAL D 2 83  ? 73.001  14.343  323.397 1.00 112.64 ? 462 VAL D N     1 
ATOM   8762  C  CA    . VAL D 2 83  ? 72.647  15.172  324.545 1.00 109.74 ? 462 VAL D CA    1 
ATOM   8763  C  C     . VAL D 2 83  ? 71.384  14.692  325.258 1.00 117.80 ? 462 VAL D C     1 
ATOM   8764  O  O     . VAL D 2 83  ? 71.167  15.008  326.428 1.00 131.29 ? 462 VAL D O     1 
ATOM   8765  C  CB    . VAL D 2 83  ? 72.478  16.650  324.141 1.00 101.91 ? 462 VAL D CB    1 
ATOM   8766  C  CG1   . VAL D 2 83  ? 73.812  17.244  323.713 1.00 92.82  ? 462 VAL D CG1   1 
ATOM   8767  C  CG2   . VAL D 2 83  ? 71.443  16.783  323.037 1.00 105.37 ? 462 VAL D CG2   1 
ATOM   8768  N  N     . GLU D 2 84  ? 70.557  13.924  324.553 1.00 112.82 ? 463 GLU D N     1 
ATOM   8769  C  CA    . GLU D 2 84  ? 69.330  13.378  325.130 1.00 114.86 ? 463 GLU D CA    1 
ATOM   8770  C  C     . GLU D 2 84  ? 69.614  12.252  326.124 1.00 118.70 ? 463 GLU D C     1 
ATOM   8771  O  O     . GLU D 2 84  ? 68.701  11.751  326.780 1.00 124.98 ? 463 GLU D O     1 
ATOM   8772  C  CB    . GLU D 2 84  ? 68.394  12.878  324.026 1.00 104.58 ? 463 GLU D CB    1 
ATOM   8773  C  CG    . GLU D 2 84  ? 67.445  13.934  323.474 1.00 108.55 ? 463 GLU D CG    1 
ATOM   8774  C  CD    . GLU D 2 84  ? 66.138  14.004  324.242 1.00 122.85 ? 463 GLU D CD    1 
ATOM   8775  O  OE1   . GLU D 2 84  ? 65.839  13.051  324.991 1.00 124.85 ? 463 GLU D OE1   1 
ATOM   8776  O  OE2   . GLU D 2 84  ? 65.410  15.009  324.100 1.00 131.14 ? 463 GLU D OE2   1 
ATOM   8777  N  N     . LYS D 2 85  ? 70.878  11.854  326.226 1.00 111.87 ? 464 LYS D N     1 
ATOM   8778  C  CA    . LYS D 2 85  ? 71.265  10.766  327.115 1.00 109.49 ? 464 LYS D CA    1 
ATOM   8779  C  C     . LYS D 2 85  ? 72.468  11.136  327.983 1.00 108.00 ? 464 LYS D C     1 
ATOM   8780  O  O     . LYS D 2 85  ? 72.934  10.330  328.789 1.00 103.84 ? 464 LYS D O     1 
ATOM   8781  C  CB    . LYS D 2 85  ? 71.569  9.503   326.304 1.00 105.73 ? 464 LYS D CB    1 
ATOM   8782  N  N     . ALA D 2 86  ? 72.967  12.356  327.818 1.00 106.87 ? 465 ALA D N     1 
ATOM   8783  C  CA    . ALA D 2 86  ? 74.169  12.783  328.526 1.00 100.41 ? 465 ALA D CA    1 
ATOM   8784  C  C     . ALA D 2 86  ? 73.861  13.785  329.634 1.00 114.76 ? 465 ALA D C     1 
ATOM   8785  O  O     . ALA D 2 86  ? 72.873  14.515  329.569 1.00 117.86 ? 465 ALA D O     1 
ATOM   8786  C  CB    . ALA D 2 86  ? 75.180  13.366  327.551 1.00 94.18  ? 465 ALA D CB    1 
ATOM   8787  N  N     . SER D 2 87  ? 74.716  13.813  330.651 1.00 121.08 ? 466 SER D N     1 
ATOM   8788  C  CA    . SER D 2 87  ? 74.560  14.752  331.754 1.00 113.23 ? 466 SER D CA    1 
ATOM   8789  C  C     . SER D 2 87  ? 75.032  16.135  331.328 1.00 119.44 ? 466 SER D C     1 
ATOM   8790  O  O     . SER D 2 87  ? 75.891  16.261  330.455 1.00 131.33 ? 466 SER D O     1 
ATOM   8791  C  CB    . SER D 2 87  ? 75.353  14.283  332.973 1.00 106.29 ? 466 SER D CB    1 
ATOM   8792  N  N     . MET D 2 88  ? 74.466  17.168  331.947 1.00 116.44 ? 467 MET D N     1 
ATOM   8793  C  CA    . MET D 2 88  ? 74.847  18.548  331.659 1.00 115.94 ? 467 MET D CA    1 
ATOM   8794  C  C     . MET D 2 88  ? 76.343  18.759  331.868 1.00 122.63 ? 467 MET D C     1 
ATOM   8795  O  O     . MET D 2 88  ? 76.985  19.514  331.134 1.00 120.09 ? 467 MET D O     1 
ATOM   8796  C  CB    . MET D 2 88  ? 74.051  19.520  332.534 1.00 110.81 ? 467 MET D CB    1 
ATOM   8797  C  CG    . MET D 2 88  ? 72.671  19.855  331.995 1.00 116.21 ? 467 MET D CG    1 
ATOM   8798  S  SD    . MET D 2 88  ? 72.757  20.755  330.435 1.00 159.63 ? 467 MET D SD    1 
ATOM   8799  C  CE    . MET D 2 88  ? 73.835  22.108  330.896 1.00 93.02  ? 467 MET D CE    1 
ATOM   8800  N  N     . ASP D 2 89  ? 76.887  18.077  332.871 1.00 129.24 ? 468 ASP D N     1 
ATOM   8801  C  CA    . ASP D 2 89  ? 78.309  18.147  333.186 1.00 126.43 ? 468 ASP D CA    1 
ATOM   8802  C  C     . ASP D 2 89  ? 79.163  17.683  332.011 1.00 120.12 ? 468 ASP D C     1 
ATOM   8803  O  O     . ASP D 2 89  ? 80.235  18.232  331.756 1.00 122.83 ? 468 ASP D O     1 
ATOM   8804  C  CB    . ASP D 2 89  ? 78.616  17.307  334.427 1.00 122.88 ? 468 ASP D CB    1 
ATOM   8805  N  N     . LYS D 2 90  ? 78.680  16.673  331.293 1.00 113.95 ? 469 LYS D N     1 
ATOM   8806  C  CA    . LYS D 2 90  ? 79.408  16.146  330.144 1.00 112.22 ? 469 LYS D CA    1 
ATOM   8807  C  C     . LYS D 2 90  ? 79.091  16.944  328.881 1.00 105.46 ? 469 LYS D C     1 
ATOM   8808  O  O     . LYS D 2 90  ? 79.915  17.034  327.972 1.00 103.48 ? 469 LYS D O     1 
ATOM   8809  C  CB    . LYS D 2 90  ? 79.100  14.659  329.942 1.00 101.82 ? 469 LYS D CB    1 
ATOM   8810  C  CG    . LYS D 2 90  ? 80.050  13.951  328.985 1.00 91.24  ? 469 LYS D CG    1 
ATOM   8811  C  CD    . LYS D 2 90  ? 79.825  12.447  328.980 1.00 85.20  ? 469 LYS D CD    1 
ATOM   8812  N  N     . ILE D 2 91  ? 77.897  17.528  328.833 1.00 97.26  ? 470 ILE D N     1 
ATOM   8813  C  CA    . ILE D 2 91  ? 77.509  18.363  327.703 1.00 97.59  ? 470 ILE D CA    1 
ATOM   8814  C  C     . ILE D 2 91  ? 78.367  19.625  327.644 1.00 103.34 ? 470 ILE D C     1 
ATOM   8815  O  O     . ILE D 2 91  ? 78.913  19.971  326.595 1.00 110.80 ? 470 ILE D O     1 
ATOM   8816  C  CB    . ILE D 2 91  ? 76.021  18.763  327.768 1.00 97.51  ? 470 ILE D CB    1 
ATOM   8817  C  CG1   . ILE D 2 91  ? 75.121  17.537  327.588 1.00 94.45  ? 470 ILE D CG1   1 
ATOM   8818  C  CG2   . ILE D 2 91  ? 75.706  19.795  326.701 1.00 99.99  ? 470 ILE D CG2   1 
ATOM   8819  C  CD1   . ILE D 2 91  ? 73.635  17.863  327.587 1.00 95.75  ? 470 ILE D CD1   1 
ATOM   8820  N  N     . LEU D 2 92  ? 78.489  20.303  328.781 1.00 98.89  ? 471 LEU D N     1 
ATOM   8821  C  CA    . LEU D 2 92  ? 79.293  21.517  328.875 1.00 100.58 ? 471 LEU D CA    1 
ATOM   8822  C  C     . LEU D 2 92  ? 80.776  21.210  328.693 1.00 105.36 ? 471 LEU D C     1 
ATOM   8823  O  O     . LEU D 2 92  ? 81.564  22.088  328.341 1.00 108.87 ? 471 LEU D O     1 
ATOM   8824  C  CB    . LEU D 2 92  ? 79.061  22.200  330.224 1.00 105.68 ? 471 LEU D CB    1 
ATOM   8825  C  CG    . LEU D 2 92  ? 77.626  22.642  330.524 1.00 111.24 ? 471 LEU D CG    1 
ATOM   8826  C  CD1   . LEU D 2 92  ? 77.469  22.993  331.994 1.00 116.75 ? 471 LEU D CD1   1 
ATOM   8827  C  CD2   . LEU D 2 92  ? 77.227  23.818  329.644 1.00 107.82 ? 471 LEU D CD2   1 
ATOM   8828  N  N     . ALA D 2 93  ? 81.151  19.957  328.933 1.00 103.22 ? 472 ALA D N     1 
ATOM   8829  C  CA    . ALA D 2 93  ? 82.545  19.541  328.828 1.00 95.48  ? 472 ALA D CA    1 
ATOM   8830  C  C     . ALA D 2 93  ? 82.977  19.337  327.379 1.00 101.66 ? 472 ALA D C     1 
ATOM   8831  O  O     . ALA D 2 93  ? 84.112  19.643  327.017 1.00 105.01 ? 472 ALA D O     1 
ATOM   8832  C  CB    . ALA D 2 93  ? 82.783  18.273  329.637 1.00 89.68  ? 472 ALA D CB    1 
ATOM   8833  N  N     . ASN D 2 94  ? 82.065  18.821  326.558 1.00 106.25 ? 473 ASN D N     1 
ATOM   8834  C  CA    . ASN D 2 94  ? 82.362  18.505  325.159 1.00 107.55 ? 473 ASN D CA    1 
ATOM   8835  C  C     . ASN D 2 94  ? 82.873  19.701  324.357 1.00 104.14 ? 473 ASN D C     1 
ATOM   8836  O  O     . ASN D 2 94  ? 82.239  20.756  324.323 1.00 104.59 ? 473 ASN D O     1 
ATOM   8837  C  CB    . ASN D 2 94  ? 81.137  17.899  324.470 1.00 114.06 ? 473 ASN D CB    1 
ATOM   8838  C  CG    . ASN D 2 94  ? 81.435  17.426  323.059 1.00 119.70 ? 473 ASN D CG    1 
ATOM   8839  O  OD1   . ASN D 2 94  ? 81.266  18.170  322.092 1.00 131.00 ? 473 ASN D OD1   1 
ATOM   8840  N  ND2   . ASN D 2 94  ? 81.881  16.181  322.935 1.00 111.67 ? 473 ASN D ND2   1 
ATOM   8841  N  N     . GLU D 2 95  ? 84.019  19.520  323.705 1.00 102.97 ? 474 GLU D N     1 
ATOM   8842  C  CA    . GLU D 2 95  ? 84.677  20.599  322.972 1.00 104.65 ? 474 GLU D CA    1 
ATOM   8843  C  C     . GLU D 2 95  ? 84.006  20.923  321.638 1.00 108.45 ? 474 GLU D C     1 
ATOM   8844  O  O     . GLU D 2 95  ? 84.024  22.070  321.193 1.00 116.98 ? 474 GLU D O     1 
ATOM   8845  C  CB    . GLU D 2 95  ? 86.152  20.261  322.743 1.00 100.98 ? 474 GLU D CB    1 
ATOM   8846  N  N     . GLU D 2 96  ? 83.424  19.910  321.001 1.00 100.16 ? 475 GLU D N     1 
ATOM   8847  C  CA    . GLU D 2 96  ? 82.777  20.094  319.705 1.00 97.84  ? 475 GLU D CA    1 
ATOM   8848  C  C     . GLU D 2 96  ? 81.543  20.984  319.819 1.00 101.15 ? 475 GLU D C     1 
ATOM   8849  O  O     . GLU D 2 96  ? 81.362  21.918  319.034 1.00 115.33 ? 475 GLU D O     1 
ATOM   8850  C  CB    . GLU D 2 96  ? 82.398  18.743  319.093 1.00 102.87 ? 475 GLU D CB    1 
ATOM   8851  C  CG    . GLU D 2 96  ? 83.573  17.803  318.879 1.00 118.05 ? 475 GLU D CG    1 
ATOM   8852  C  CD    . GLU D 2 96  ? 84.549  18.311  317.835 1.00 131.99 ? 475 GLU D CD    1 
ATOM   8853  O  OE1   . GLU D 2 96  ? 84.154  19.159  317.008 1.00 140.56 ? 475 GLU D OE1   1 
ATOM   8854  O  OE2   . GLU D 2 96  ? 85.713  17.860  317.843 1.00 132.08 ? 475 GLU D OE2   1 
ATOM   8855  N  N     . ILE D 2 97  ? 80.697  20.682  320.798 1.00 90.17  ? 476 ILE D N     1 
ATOM   8856  C  CA    . ILE D 2 97  ? 79.514  21.488  321.070 1.00 98.68  ? 476 ILE D CA    1 
ATOM   8857  C  C     . ILE D 2 97  ? 79.917  22.921  321.406 1.00 108.75 ? 476 ILE D C     1 
ATOM   8858  O  O     . ILE D 2 97  ? 79.283  23.879  320.956 1.00 110.79 ? 476 ILE D O     1 
ATOM   8859  C  CB    . ILE D 2 97  ? 78.684  20.893  322.227 1.00 96.22  ? 476 ILE D CB    1 
ATOM   8860  C  CG1   . ILE D 2 97  ? 78.295  19.446  321.915 1.00 89.73  ? 476 ILE D CG1   1 
ATOM   8861  C  CG2   . ILE D 2 97  ? 77.443  21.730  322.485 1.00 88.77  ? 476 ILE D CG2   1 
ATOM   8862  C  CD1   . ILE D 2 97  ? 77.486  18.784  323.008 1.00 95.58  ? 476 ILE D CD1   1 
ATOM   8863  N  N     . ARG D 2 98  ? 80.987  23.058  322.185 1.00 112.99 ? 477 ARG D N     1 
ATOM   8864  C  CA    . ARG D 2 98  ? 81.509  24.372  322.545 1.00 120.49 ? 477 ARG D CA    1 
ATOM   8865  C  C     . ARG D 2 98  ? 82.005  25.121  321.309 1.00 122.62 ? 477 ARG D C     1 
ATOM   8866  O  O     . ARG D 2 98  ? 81.929  26.346  321.243 1.00 130.43 ? 477 ARG D O     1 
ATOM   8867  C  CB    . ARG D 2 98  ? 82.632  24.251  323.585 1.00 115.06 ? 477 ARG D CB    1 
ATOM   8868  C  CG    . ARG D 2 98  ? 83.180  25.594  324.059 1.00 116.79 ? 477 ARG D CG    1 
ATOM   8869  C  CD    . ARG D 2 98  ? 84.362  25.439  325.012 1.00 126.84 ? 477 ARG D CD    1 
ATOM   8870  N  NE    . ARG D 2 98  ? 83.967  24.917  326.317 1.00 139.84 ? 477 ARG D NE    1 
ATOM   8871  C  CZ    . ARG D 2 98  ? 84.248  23.692  326.748 1.00 137.59 ? 477 ARG D CZ    1 
ATOM   8872  N  NH1   . ARG D 2 98  ? 84.932  22.857  325.979 1.00 136.64 ? 477 ARG D NH1   1 
ATOM   8873  N  NH2   . ARG D 2 98  ? 83.849  23.303  327.950 1.00 129.11 ? 477 ARG D NH2   1 
ATOM   8874  N  N     . SER D 2 99  ? 82.504  24.377  320.326 1.00 114.34 ? 478 SER D N     1 
ATOM   8875  C  CA    . SER D 2 99  ? 82.999  24.980  319.093 1.00 112.26 ? 478 SER D CA    1 
ATOM   8876  C  C     . SER D 2 99  ? 81.844  25.436  318.210 1.00 107.51 ? 478 SER D C     1 
ATOM   8877  O  O     . SER D 2 99  ? 81.914  26.485  317.570 1.00 111.55 ? 478 SER D O     1 
ATOM   8878  C  CB    . SER D 2 99  ? 83.892  24.001  318.329 1.00 109.90 ? 478 SER D CB    1 
ATOM   8879  O  OG    . SER D 2 99  ? 83.150  22.893  317.852 1.00 113.68 ? 478 SER D OG    1 
ATOM   8880  N  N     . LEU D 2 100 ? 80.782  24.638  318.180 1.00 101.61 ? 479 LEU D N     1 
ATOM   8881  C  CA    . LEU D 2 100 ? 79.593  24.990  317.415 1.00 106.35 ? 479 LEU D CA    1 
ATOM   8882  C  C     . LEU D 2 100 ? 78.914  26.219  318.021 1.00 111.44 ? 479 LEU D C     1 
ATOM   8883  O  O     . LEU D 2 100 ? 78.470  27.115  317.299 1.00 110.31 ? 479 LEU D O     1 
ATOM   8884  C  CB    . LEU D 2 100 ? 78.619  23.811  317.359 1.00 106.03 ? 479 LEU D CB    1 
ATOM   8885  C  CG    . LEU D 2 100 ? 77.506  23.887  316.310 1.00 103.93 ? 479 LEU D CG    1 
ATOM   8886  N  N     . PHE D 2 101 ? 78.849  26.262  319.348 1.00 115.14 ? 480 PHE D N     1 
ATOM   8887  C  CA    . PHE D 2 101 ? 78.251  27.395  320.046 1.00 109.61 ? 480 PHE D CA    1 
ATOM   8888  C  C     . PHE D 2 101 ? 79.128  28.645  319.977 1.00 113.56 ? 480 PHE D C     1 
ATOM   8889  O  O     . PHE D 2 101 ? 78.623  29.768  319.983 1.00 116.53 ? 480 PHE D O     1 
ATOM   8890  C  CB    . PHE D 2 101 ? 77.948  27.033  321.500 1.00 104.69 ? 480 PHE D CB    1 
ATOM   8891  C  CG    . PHE D 2 101 ? 76.595  26.413  321.700 1.00 95.59  ? 480 PHE D CG    1 
ATOM   8892  C  CD1   . PHE D 2 101 ? 75.485  27.209  321.918 1.00 97.26  ? 480 PHE D CD1   1 
ATOM   8893  C  CD2   . PHE D 2 101 ? 76.432  25.037  321.670 1.00 101.28 ? 480 PHE D CD2   1 
ATOM   8894  C  CE1   . PHE D 2 101 ? 74.236  26.649  322.105 1.00 115.21 ? 480 PHE D CE1   1 
ATOM   8895  C  CE2   . PHE D 2 101 ? 75.184  24.470  321.856 1.00 93.54  ? 480 PHE D CE2   1 
ATOM   8896  C  CZ    . PHE D 2 101 ? 74.084  25.280  322.074 1.00 95.24  ? 480 PHE D CZ    1 
ATOM   8897  N  N     . THR D 2 102 ? 80.441  28.446  319.911 1.00 115.16 ? 481 THR D N     1 
ATOM   8898  C  CA    . THR D 2 102 ? 81.375  29.559  319.769 1.00 116.90 ? 481 THR D CA    1 
ATOM   8899  C  C     . THR D 2 102 ? 81.253  30.157  318.375 1.00 115.01 ? 481 THR D C     1 
ATOM   8900  O  O     . THR D 2 102 ? 81.233  31.377  318.209 1.00 118.75 ? 481 THR D O     1 
ATOM   8901  C  CB    . THR D 2 102 ? 82.836  29.118  320.002 1.00 117.75 ? 481 THR D CB    1 
ATOM   8902  O  OG1   . THR D 2 102 ? 82.966  28.559  321.315 1.00 119.98 ? 481 THR D OG1   1 
ATOM   8903  C  CG2   . THR D 2 102 ? 83.783  30.302  319.866 1.00 117.18 ? 481 THR D CG2   1 
ATOM   8904  N  N     . ALA D 2 103 ? 81.164  29.285  317.375 1.00 116.11 ? 482 ALA D N     1 
ATOM   8905  C  CA    . ALA D 2 103 ? 81.032  29.716  315.989 1.00 101.15 ? 482 ALA D CA    1 
ATOM   8906  C  C     . ALA D 2 103 ? 79.701  30.419  315.745 1.00 107.37 ? 482 ALA D C     1 
ATOM   8907  O  O     . ALA D 2 103 ? 79.665  31.497  315.153 1.00 112.33 ? 482 ALA D O     1 
ATOM   8908  C  CB    . ALA D 2 103 ? 81.187  28.533  315.051 1.00 99.55  ? 482 ALA D CB    1 
ATOM   8909  N  N     . MET D 2 104 ? 78.611  29.807  316.202 1.00 109.29 ? 483 MET D N     1 
ATOM   8910  C  CA    . MET D 2 104 ? 77.282  30.383  316.007 1.00 114.23 ? 483 MET D CA    1 
ATOM   8911  C  C     . MET D 2 104 ? 77.117  31.728  316.713 1.00 120.87 ? 483 MET D C     1 
ATOM   8912  O  O     . MET D 2 104 ? 76.319  32.564  316.288 1.00 126.38 ? 483 MET D O     1 
ATOM   8913  C  CB    . MET D 2 104 ? 76.193  29.407  316.455 1.00 111.02 ? 483 MET D CB    1 
ATOM   8914  C  CG    . MET D 2 104 ? 75.775  28.418  315.380 1.00 115.85 ? 483 MET D CG    1 
ATOM   8915  S  SD    . MET D 2 104 ? 75.104  29.234  313.915 1.00 127.28 ? 483 MET D SD    1 
ATOM   8916  C  CE    . MET D 2 104 ? 73.782  30.204  314.636 1.00 104.94 ? 483 MET D CE    1 
ATOM   8917  N  N     . GLY D 2 105 ? 77.877  31.929  317.786 1.00 120.25 ? 484 GLY D N     1 
ATOM   8918  C  CA    . GLY D 2 105 ? 77.859  33.185  318.515 1.00 124.37 ? 484 GLY D CA    1 
ATOM   8919  C  C     . GLY D 2 105 ? 76.532  33.467  319.191 1.00 129.18 ? 484 GLY D C     1 
ATOM   8920  O  O     . GLY D 2 105 ? 76.189  34.621  319.454 1.00 127.77 ? 484 GLY D O     1 
ATOM   8921  N  N     . THR D 2 106 ? 75.785  32.406  319.474 1.00 134.15 ? 485 THR D N     1 
ATOM   8922  C  CA    . THR D 2 106 ? 74.469  32.537  320.086 1.00 134.98 ? 485 THR D CA    1 
ATOM   8923  C  C     . THR D 2 106 ? 74.573  32.700  321.599 1.00 136.38 ? 485 THR D C     1 
ATOM   8924  O  O     . THR D 2 106 ? 73.911  33.553  322.189 1.00 108.27 ? 485 THR D O     1 
ATOM   8925  C  CB    . THR D 2 106 ? 73.588  31.308  319.783 1.00 129.81 ? 485 THR D CB    1 
ATOM   8926  O  OG1   . THR D 2 106 ? 73.530  31.095  318.368 1.00 141.41 ? 485 THR D OG1   1 
ATOM   8927  C  CG2   . THR D 2 106 ? 72.181  31.512  320.321 1.00 122.71 ? 485 THR D CG2   1 
ATOM   8928  N  N     . GLY D 2 107 ? 75.420  31.884  322.215 1.00 127.25 ? 486 GLY D N     1 
ATOM   8929  C  CA    . GLY D 2 107 ? 75.467  31.782  323.660 1.00 128.10 ? 486 GLY D CA    1 
ATOM   8930  C  C     . GLY D 2 107 ? 74.795  30.482  324.049 1.00 134.37 ? 486 GLY D C     1 
ATOM   8931  O  O     . GLY D 2 107 ? 74.238  29.796  323.193 1.00 137.33 ? 486 GLY D O     1 
ATOM   8932  N  N     . PHE D 2 108 ? 74.837  30.135  325.331 1.00 136.23 ? 487 PHE D N     1 
ATOM   8933  C  CA    . PHE D 2 108 ? 74.281  28.862  325.776 1.00 124.92 ? 487 PHE D CA    1 
ATOM   8934  C  C     . PHE D 2 108 ? 73.279  29.039  326.914 1.00 118.47 ? 487 PHE D C     1 
ATOM   8935  O  O     . PHE D 2 108 ? 73.473  29.870  327.802 1.00 117.90 ? 487 PHE D O     1 
ATOM   8936  C  CB    . PHE D 2 108 ? 75.407  27.911  326.195 1.00 112.80 ? 487 PHE D CB    1 
ATOM   8937  C  CG    . PHE D 2 108 ? 74.957  26.496  326.431 1.00 105.78 ? 487 PHE D CG    1 
ATOM   8938  C  CD1   . PHE D 2 108 ? 75.038  25.554  325.419 1.00 108.39 ? 487 PHE D CD1   1 
ATOM   8939  C  CD2   . PHE D 2 108 ? 74.463  26.104  327.665 1.00 103.55 ? 487 PHE D CD2   1 
ATOM   8940  C  CE1   . PHE D 2 108 ? 74.629  24.250  325.629 1.00 105.90 ? 487 PHE D CE1   1 
ATOM   8941  C  CE2   . PHE D 2 108 ? 74.050  24.802  327.881 1.00 105.95 ? 487 PHE D CE2   1 
ATOM   8942  C  CZ    . PHE D 2 108 ? 74.134  23.874  326.863 1.00 105.82 ? 487 PHE D CZ    1 
ATOM   8943  N  N     . GLY D 2 109 ? 72.207  28.252  326.873 1.00 115.40 ? 488 GLY D N     1 
ATOM   8944  C  CA    . GLY D 2 109 ? 71.219  28.225  327.936 1.00 111.88 ? 488 GLY D CA    1 
ATOM   8945  C  C     . GLY D 2 109 ? 70.521  29.549  328.170 1.00 118.45 ? 488 GLY D C     1 
ATOM   8946  O  O     . GLY D 2 109 ? 69.689  29.977  327.371 1.00 127.06 ? 488 GLY D O     1 
ATOM   8947  N  N     . ALA D 2 110 ? 70.866  30.200  329.277 1.00 124.04 ? 489 ALA D N     1 
ATOM   8948  C  CA    . ALA D 2 110 ? 70.269  31.481  329.637 1.00 126.21 ? 489 ALA D CA    1 
ATOM   8949  C  C     . ALA D 2 110 ? 70.986  32.649  328.962 1.00 128.77 ? 489 ALA D C     1 
ATOM   8950  O  O     . ALA D 2 110 ? 71.020  33.758  329.494 1.00 128.39 ? 489 ALA D O     1 
ATOM   8951  C  CB    . ALA D 2 110 ? 70.269  31.657  331.146 1.00 130.37 ? 489 ALA D CB    1 
ATOM   8952  N  N     . GLU D 2 111 ? 71.561  32.388  327.792 1.00 134.05 ? 490 GLU D N     1 
ATOM   8953  C  CA    . GLU D 2 111 ? 72.224  33.420  326.999 1.00 136.10 ? 490 GLU D CA    1 
ATOM   8954  C  C     . GLU D 2 111 ? 71.874  33.280  325.526 1.00 136.29 ? 490 GLU D C     1 
ATOM   8955  O  O     . GLU D 2 111 ? 72.270  34.112  324.709 1.00 134.88 ? 490 GLU D O     1 
ATOM   8956  C  CB    . GLU D 2 111 ? 73.742  33.341  327.161 1.00 138.33 ? 490 GLU D CB    1 
ATOM   8957  C  CG    . GLU D 2 111 ? 74.326  34.306  328.173 1.00 146.77 ? 490 GLU D CG    1 
ATOM   8958  C  CD    . GLU D 2 111 ? 74.528  33.671  329.528 1.00 150.65 ? 490 GLU D CD    1 
ATOM   8959  O  OE1   . GLU D 2 111 ? 73.835  32.678  329.824 1.00 151.07 ? 490 GLU D OE1   1 
ATOM   8960  O  OE2   . GLU D 2 111 ? 75.387  34.160  330.291 1.00 150.57 ? 490 GLU D OE2   1 
ATOM   8961  N  N     . PHE D 2 112 ? 71.140  32.220  325.197 1.00 139.63 ? 491 PHE D N     1 
ATOM   8962  C  CA    . PHE D 2 112 ? 70.778  31.916  323.814 1.00 141.19 ? 491 PHE D CA    1 
ATOM   8963  C  C     . PHE D 2 112 ? 70.102  33.097  323.120 1.00 153.11 ? 491 PHE D C     1 
ATOM   8964  O  O     . PHE D 2 112 ? 68.891  33.096  322.897 1.00 164.62 ? 491 PHE D O     1 
ATOM   8965  C  CB    . PHE D 2 112 ? 69.876  30.682  323.758 1.00 131.54 ? 491 PHE D CB    1 
ATOM   8966  N  N     . ASP D 2 113 ? 70.902  34.103  322.787 1.00 147.11 ? 492 ASP D N     1 
ATOM   8967  C  CA    . ASP D 2 113 ? 70.411  35.299  322.121 1.00 140.14 ? 492 ASP D CA    1 
ATOM   8968  C  C     . ASP D 2 113 ? 70.391  35.077  320.614 1.00 134.32 ? 492 ASP D C     1 
ATOM   8969  O  O     . ASP D 2 113 ? 71.412  35.223  319.944 1.00 139.07 ? 492 ASP D O     1 
ATOM   8970  C  CB    . ASP D 2 113 ? 71.299  36.495  322.475 1.00 141.27 ? 492 ASP D CB    1 
ATOM   8971  C  CG    . ASP D 2 113 ? 70.797  37.796  321.880 1.00 145.65 ? 492 ASP D CG    1 
ATOM   8972  O  OD1   . ASP D 2 113 ? 69.593  37.887  321.556 1.00 145.17 ? 492 ASP D OD1   1 
ATOM   8973  O  OD2   . ASP D 2 113 ? 71.608  38.735  321.744 1.00 148.80 ? 492 ASP D OD2   1 
ATOM   8974  N  N     . VAL D 2 114 ? 69.221  34.723  320.088 1.00 127.77 ? 493 VAL D N     1 
ATOM   8975  C  CA    . VAL D 2 114 ? 69.074  34.422  318.666 1.00 125.45 ? 493 VAL D CA    1 
ATOM   8976  C  C     . VAL D 2 114 ? 69.323  35.657  317.796 1.00 138.49 ? 493 VAL D C     1 
ATOM   8977  O  O     . VAL D 2 114 ? 69.655  35.541  316.615 1.00 138.17 ? 493 VAL D O     1 
ATOM   8978  C  CB    . VAL D 2 114 ? 67.682  33.821  318.354 1.00 122.78 ? 493 VAL D CB    1 
ATOM   8979  C  CG1   . VAL D 2 114 ? 66.600  34.889  318.432 1.00 129.06 ? 493 VAL D CG1   1 
ATOM   8980  C  CG2   . VAL D 2 114 ? 67.681  33.152  316.987 1.00 127.61 ? 493 VAL D CG2   1 
ATOM   8981  N  N     . SER D 2 115 ? 69.179  36.837  318.391 1.00 148.30 ? 494 SER D N     1 
ATOM   8982  C  CA    . SER D 2 115 ? 69.414  38.087  317.680 1.00 145.65 ? 494 SER D CA    1 
ATOM   8983  C  C     . SER D 2 115 ? 70.896  38.454  317.700 1.00 144.23 ? 494 SER D C     1 
ATOM   8984  O  O     . SER D 2 115 ? 71.271  39.586  317.397 1.00 152.54 ? 494 SER D O     1 
ATOM   8985  C  CB    . SER D 2 115 ? 68.580  39.214  318.290 1.00 143.81 ? 494 SER D CB    1 
ATOM   8986  N  N     . LYS D 2 116 ? 71.733  37.485  318.061 1.00 134.39 ? 495 LYS D N     1 
ATOM   8987  C  CA    . LYS D 2 116 ? 73.177  37.670  318.060 1.00 130.43 ? 495 LYS D CA    1 
ATOM   8988  C  C     . LYS D 2 116 ? 73.856  36.564  317.259 1.00 126.02 ? 495 LYS D C     1 
ATOM   8989  O  O     . LYS D 2 116 ? 75.075  36.401  317.316 1.00 119.12 ? 495 LYS D O     1 
ATOM   8990  C  CB    . LYS D 2 116 ? 73.716  37.689  319.492 1.00 116.58 ? 495 LYS D CB    1 
ATOM   8991  N  N     . ALA D 2 117 ? 73.056  35.805  316.516 1.00 129.06 ? 496 ALA D N     1 
ATOM   8992  C  CA    . ALA D 2 117 ? 73.576  34.730  315.679 1.00 130.23 ? 496 ALA D CA    1 
ATOM   8993  C  C     . ALA D 2 117 ? 74.470  35.295  314.582 1.00 136.62 ? 496 ALA D C     1 
ATOM   8994  O  O     . ALA D 2 117 ? 74.250  36.407  314.102 1.00 149.17 ? 496 ALA D O     1 
ATOM   8995  C  CB    . ALA D 2 117 ? 72.436  33.923  315.077 1.00 124.94 ? 496 ALA D CB    1 
ATOM   8996  N  N     . ARG D 2 118 ? 75.480  34.526  314.189 1.00 128.38 ? 497 ARG D N     1 
ATOM   8997  C  CA    . ARG D 2 118 ? 76.455  34.993  313.208 1.00 128.25 ? 497 ARG D CA    1 
ATOM   8998  C  C     . ARG D 2 118 ? 76.176  34.485  311.795 1.00 132.24 ? 497 ARG D C     1 
ATOM   8999  O  O     . ARG D 2 118 ? 76.702  35.026  310.821 1.00 134.93 ? 497 ARG D O     1 
ATOM   9000  C  CB    . ARG D 2 118 ? 77.873  34.604  313.632 1.00 123.06 ? 497 ARG D CB    1 
ATOM   9001  C  CG    . ARG D 2 118 ? 78.360  35.300  314.892 1.00 119.42 ? 497 ARG D CG    1 
ATOM   9002  C  CD    . ARG D 2 118 ? 79.789  34.899  315.212 1.00 114.11 ? 497 ARG D CD    1 
ATOM   9003  N  NE    . ARG D 2 118 ? 80.673  35.119  314.072 1.00 119.19 ? 497 ARG D NE    1 
ATOM   9004  C  CZ    . ARG D 2 118 ? 81.642  34.285  313.707 1.00 127.10 ? 497 ARG D CZ    1 
ATOM   9005  N  NH1   . ARG D 2 118 ? 81.856  33.172  314.397 1.00 129.62 ? 497 ARG D NH1   1 
ATOM   9006  N  NH2   . ARG D 2 118 ? 82.396  34.563  312.653 1.00 130.21 ? 497 ARG D NH2   1 
ATOM   9007  N  N     . TYR D 2 119 ? 75.352  33.448  311.683 1.00 130.70 ? 498 TYR D N     1 
ATOM   9008  C  CA    . TYR D 2 119 ? 75.048  32.863  310.380 1.00 124.18 ? 498 TYR D CA    1 
ATOM   9009  C  C     . TYR D 2 119 ? 73.549  32.697  310.150 1.00 126.13 ? 498 TYR D C     1 
ATOM   9010  O  O     . TYR D 2 119 ? 72.817  32.243  311.030 1.00 117.54 ? 498 TYR D O     1 
ATOM   9011  C  CB    . TYR D 2 119 ? 75.770  31.525  310.208 1.00 113.07 ? 498 TYR D CB    1 
ATOM   9012  C  CG    . TYR D 2 119 ? 77.274  31.633  310.324 1.00 114.84 ? 498 TYR D CG    1 
ATOM   9013  C  CD1   . TYR D 2 119 ? 77.928  31.279  311.497 1.00 121.37 ? 498 TYR D CD1   1 
ATOM   9014  C  CD2   . TYR D 2 119 ? 78.041  32.096  309.262 1.00 116.27 ? 498 TYR D CD2   1 
ATOM   9015  C  CE1   . TYR D 2 119 ? 79.303  31.378  311.608 1.00 106.90 ? 498 TYR D CE1   1 
ATOM   9016  C  CE2   . TYR D 2 119 ? 79.416  32.200  309.364 1.00 110.10 ? 498 TYR D CE2   1 
ATOM   9017  C  CZ    . TYR D 2 119 ? 80.041  31.840  310.538 1.00 118.43 ? 498 TYR D CZ    1 
ATOM   9018  O  OH    . TYR D 2 119 ? 81.410  31.942  310.641 1.00 117.57 ? 498 TYR D OH    1 
ATOM   9019  N  N     . GLN D 2 120 ? 73.103  33.067  308.954 1.00 139.73 ? 499 GLN D N     1 
ATOM   9020  C  CA    . GLN D 2 120 ? 71.690  32.996  308.600 1.00 146.18 ? 499 GLN D CA    1 
ATOM   9021  C  C     . GLN D 2 120 ? 71.264  31.591  308.191 1.00 145.56 ? 499 GLN D C     1 
ATOM   9022  O  O     . GLN D 2 120 ? 70.074  31.283  308.144 1.00 144.64 ? 499 GLN D O     1 
ATOM   9023  C  CB    . GLN D 2 120 ? 71.376  33.974  307.469 1.00 151.81 ? 499 GLN D CB    1 
ATOM   9024  N  N     . LYS D 2 121 ? 72.241  30.744  307.889 1.00 141.34 ? 500 LYS D N     1 
ATOM   9025  C  CA    . LYS D 2 121 ? 71.952  29.385  307.455 1.00 132.12 ? 500 LYS D CA    1 
ATOM   9026  C  C     . LYS D 2 121 ? 72.925  28.381  308.058 1.00 123.21 ? 500 LYS D C     1 
ATOM   9027  O  O     . LYS D 2 121 ? 74.094  28.332  307.681 1.00 122.74 ? 500 LYS D O     1 
ATOM   9028  C  CB    . LYS D 2 121 ? 71.981  29.294  305.928 1.00 110.96 ? 500 LYS D CB    1 
ATOM   9029  N  N     . LEU D 2 122 ? 72.437  27.588  309.004 1.00 119.90 ? 501 LEU D N     1 
ATOM   9030  C  CA    . LEU D 2 122 ? 73.234  26.514  309.576 1.00 119.88 ? 501 LEU D CA    1 
ATOM   9031  C  C     . LEU D 2 122 ? 72.949  25.225  308.817 1.00 124.93 ? 501 LEU D C     1 
ATOM   9032  O  O     . LEU D 2 122 ? 71.955  24.546  309.077 1.00 132.75 ? 501 LEU D O     1 
ATOM   9033  C  CB    . LEU D 2 122 ? 72.919  26.338  311.061 1.00 122.02 ? 501 LEU D CB    1 
ATOM   9034  C  CG    . LEU D 2 122 ? 73.837  25.377  311.817 1.00 119.42 ? 501 LEU D CG    1 
ATOM   9035  C  CD1   . LEU D 2 122 ? 75.285  25.833  311.717 1.00 99.16  ? 501 LEU D CD1   1 
ATOM   9036  C  CD2   . LEU D 2 122 ? 73.411  25.261  313.270 1.00 116.81 ? 501 LEU D CD2   1 
ATOM   9037  N  N     . VAL D 2 123 ? 73.824  24.899  307.872 1.00 121.32 ? 502 VAL D N     1 
ATOM   9038  C  CA    . VAL D 2 123 ? 73.614  23.753  306.997 1.00 114.10 ? 502 VAL D CA    1 
ATOM   9039  C  C     . VAL D 2 123 ? 74.289  22.491  307.523 1.00 112.83 ? 502 VAL D C     1 
ATOM   9040  O  O     . VAL D 2 123 ? 75.492  22.480  307.777 1.00 105.76 ? 502 VAL D O     1 
ATOM   9041  C  CB    . VAL D 2 123 ? 74.139  24.035  305.579 1.00 109.67 ? 502 VAL D CB    1 
ATOM   9042  C  CG1   . VAL D 2 123 ? 73.843  22.858  304.660 1.00 108.60 ? 502 VAL D CG1   1 
ATOM   9043  C  CG2   . VAL D 2 123 ? 73.531  25.319  305.032 1.00 108.63 ? 502 VAL D CG2   1 
ATOM   9044  N  N     . LEU D 2 124 ? 73.507  21.428  307.678 1.00 112.94 ? 503 LEU D N     1 
ATOM   9045  C  CA    . LEU D 2 124 ? 74.046  20.138  308.089 1.00 109.25 ? 503 LEU D CA    1 
ATOM   9046  C  C     . LEU D 2 124 ? 74.534  19.361  306.872 1.00 113.79 ? 503 LEU D C     1 
ATOM   9047  O  O     . LEU D 2 124 ? 73.741  18.772  306.136 1.00 113.33 ? 503 LEU D O     1 
ATOM   9048  C  CB    . LEU D 2 124 ? 72.996  19.331  308.850 1.00 106.85 ? 503 LEU D CB    1 
ATOM   9049  C  CG    . LEU D 2 124 ? 72.434  20.011  310.099 1.00 102.24 ? 503 LEU D CG    1 
ATOM   9050  C  CD1   . LEU D 2 124 ? 71.555  19.045  310.871 1.00 93.51  ? 503 LEU D CD1   1 
ATOM   9051  C  CD2   . LEU D 2 124 ? 73.558  20.534  310.975 1.00 96.71  ? 503 LEU D CD2   1 
ATOM   9052  N  N     . MET D 2 125 ? 75.845  19.368  306.664 1.00 111.62 ? 504 MET D N     1 
ATOM   9053  C  CA    . MET D 2 125 ? 76.430  18.753  305.484 1.00 100.56 ? 504 MET D CA    1 
ATOM   9054  C  C     . MET D 2 125 ? 77.257  17.531  305.865 1.00 106.11 ? 504 MET D C     1 
ATOM   9055  O  O     . MET D 2 125 ? 78.481  17.533  305.748 1.00 117.45 ? 504 MET D O     1 
ATOM   9056  C  CB    . MET D 2 125 ? 77.288  19.775  304.738 1.00 105.68 ? 504 MET D CB    1 
ATOM   9057  C  CG    . MET D 2 125 ? 77.707  19.361  303.342 1.00 112.81 ? 504 MET D CG    1 
ATOM   9058  S  SD    . MET D 2 125 ? 78.528  20.712  302.485 1.00 123.67 ? 504 MET D SD    1 
ATOM   9059  C  CE    . MET D 2 125 ? 79.325  19.822  301.158 1.00 112.24 ? 504 MET D CE    1 
ATOM   9060  N  N     . THR D 2 126 ? 76.576  16.490  306.333 1.00 106.13 ? 505 THR D N     1 
ATOM   9061  C  CA    . THR D 2 126 ? 77.238  15.255  306.731 1.00 107.67 ? 505 THR D CA    1 
ATOM   9062  C  C     . THR D 2 126 ? 77.561  14.380  305.522 1.00 109.82 ? 505 THR D C     1 
ATOM   9063  O  O     . THR D 2 126 ? 77.110  14.655  304.409 1.00 109.53 ? 505 THR D O     1 
ATOM   9064  C  CB    . THR D 2 126 ? 76.373  14.455  307.720 1.00 103.79 ? 505 THR D CB    1 
ATOM   9065  O  OG1   . THR D 2 126 ? 75.016  14.433  307.259 1.00 106.60 ? 505 THR D OG1   1 
ATOM   9066  C  CG2   . THR D 2 126 ? 76.414  15.094  309.096 1.00 107.80 ? 505 THR D CG2   1 
ATOM   9067  N  N     . ASP D 2 127 ? 78.347  13.328  305.746 1.00 108.82 ? 506 ASP D N     1 
ATOM   9068  C  CA    . ASP D 2 127 ? 78.692  12.382  304.685 1.00 106.03 ? 506 ASP D CA    1 
ATOM   9069  C  C     . ASP D 2 127 ? 77.450  11.689  304.140 1.00 112.91 ? 506 ASP D C     1 
ATOM   9070  O  O     . ASP D 2 127 ? 76.394  11.695  304.773 1.00 111.53 ? 506 ASP D O     1 
ATOM   9071  C  CB    . ASP D 2 127 ? 79.698  11.337  305.180 1.00 107.24 ? 506 ASP D CB    1 
ATOM   9072  C  CG    . ASP D 2 127 ? 81.120  11.864  305.215 1.00 111.27 ? 506 ASP D CG    1 
ATOM   9073  O  OD1   . ASP D 2 127 ? 81.374  12.933  304.626 1.00 101.76 ? 506 ASP D OD1   1 
ATOM   9074  O  OD2   . ASP D 2 127 ? 81.986  11.201  305.826 1.00 119.10 ? 506 ASP D OD2   1 
ATOM   9075  N  N     . ALA D 2 128 ? 77.585  11.079  302.967 1.00 117.33 ? 507 ALA D N     1 
ATOM   9076  C  CA    . ALA D 2 128 ? 76.454  10.435  302.309 1.00 112.48 ? 507 ALA D CA    1 
ATOM   9077  C  C     . ALA D 2 128 ? 76.310  8.958   302.665 1.00 110.96 ? 507 ALA D C     1 
ATOM   9078  O  O     . ALA D 2 128 ? 75.656  8.205   301.944 1.00 110.29 ? 507 ALA D O     1 
ATOM   9079  C  CB    . ALA D 2 128 ? 76.548  10.611  300.802 1.00 115.63 ? 507 ALA D CB    1 
ATOM   9080  N  N     . ASP D 2 129 ? 76.918  8.545   303.773 1.00 114.28 ? 508 ASP D N     1 
ATOM   9081  C  CA    . ASP D 2 129 ? 76.744  7.180   304.260 1.00 115.63 ? 508 ASP D CA    1 
ATOM   9082  C  C     . ASP D 2 129 ? 75.787  7.150   305.446 1.00 118.44 ? 508 ASP D C     1 
ATOM   9083  O  O     . ASP D 2 129 ? 75.249  8.185   305.843 1.00 115.06 ? 508 ASP D O     1 
ATOM   9084  C  CB    . ASP D 2 129 ? 78.090  6.524   304.608 1.00 119.84 ? 508 ASP D CB    1 
ATOM   9085  C  CG    . ASP D 2 129 ? 78.911  7.337   305.598 1.00 126.20 ? 508 ASP D CG    1 
ATOM   9086  O  OD1   . ASP D 2 129 ? 78.355  7.808   306.612 1.00 137.19 ? 508 ASP D OD1   1 
ATOM   9087  O  OD2   . ASP D 2 129 ? 80.127  7.498   305.359 1.00 119.70 ? 508 ASP D OD2   1 
ATOM   9088  N  N     . VAL D 2 130 ? 75.580  5.966   306.011 1.00 119.67 ? 509 VAL D N     1 
ATOM   9089  C  CA    . VAL D 2 130 ? 74.666  5.813   307.136 1.00 110.46 ? 509 VAL D CA    1 
ATOM   9090  C  C     . VAL D 2 130 ? 75.190  6.466   308.413 1.00 110.14 ? 509 VAL D C     1 
ATOM   9091  O  O     . VAL D 2 130 ? 74.416  7.001   309.205 1.00 118.09 ? 509 VAL D O     1 
ATOM   9092  C  CB    . VAL D 2 130 ? 74.336  4.333   307.398 1.00 101.60 ? 509 VAL D CB    1 
ATOM   9093  C  CG1   . VAL D 2 130 ? 73.225  3.873   306.469 1.00 112.45 ? 509 VAL D CG1   1 
ATOM   9094  C  CG2   . VAL D 2 130 ? 75.580  3.471   307.234 1.00 89.57  ? 509 VAL D CG2   1 
ATOM   9095  N  N     . ASP D 2 131 ? 76.503  6.417   308.609 1.00 99.97  ? 510 ASP D N     1 
ATOM   9096  C  CA    . ASP D 2 131 ? 77.119  7.075   309.752 1.00 103.50 ? 510 ASP D CA    1 
ATOM   9097  C  C     . ASP D 2 131 ? 76.902  8.582   309.660 1.00 108.46 ? 510 ASP D C     1 
ATOM   9098  O  O     . ASP D 2 131 ? 76.751  9.262   310.676 1.00 115.94 ? 510 ASP D O     1 
ATOM   9099  C  CB    . ASP D 2 131 ? 78.608  6.741   309.833 1.00 107.08 ? 510 ASP D CB    1 
ATOM   9100  C  CG    . ASP D 2 131 ? 78.862  5.271   310.127 1.00 114.77 ? 510 ASP D CG    1 
ATOM   9101  O  OD1   . ASP D 2 131 ? 78.735  4.864   311.301 1.00 109.25 ? 510 ASP D OD1   1 
ATOM   9102  O  OD2   . ASP D 2 131 ? 79.196  4.526   309.183 1.00 126.97 ? 510 ASP D OD2   1 
ATOM   9103  N  N     . GLY D 2 132 ? 76.869  9.093   308.432 1.00 107.68 ? 511 GLY D N     1 
ATOM   9104  C  CA    . GLY D 2 132 ? 76.569  10.492  308.193 1.00 104.74 ? 511 GLY D CA    1 
ATOM   9105  C  C     . GLY D 2 132 ? 75.140  10.820  308.579 1.00 99.36  ? 511 GLY D C     1 
ATOM   9106  O  O     . GLY D 2 132 ? 74.861  11.899  309.099 1.00 101.45 ? 511 GLY D O     1 
ATOM   9107  N  N     . ALA D 2 133 ? 74.232  9.884   308.323 1.00 92.43  ? 512 ALA D N     1 
ATOM   9108  C  CA    . ALA D 2 133 ? 72.841  10.046  308.730 1.00 100.76 ? 512 ALA D CA    1 
ATOM   9109  C  C     . ALA D 2 133 ? 72.734  10.043  310.253 1.00 101.04 ? 512 ALA D C     1 
ATOM   9110  O  O     . ALA D 2 133 ? 71.953  10.797  310.834 1.00 93.88  ? 512 ALA D O     1 
ATOM   9111  C  CB    . ALA D 2 133 ? 71.975  8.948   308.128 1.00 102.59 ? 512 ALA D CB    1 
ATOM   9112  N  N     . HIS D 2 134 ? 73.532  9.191   310.890 1.00 101.62 ? 513 HIS D N     1 
ATOM   9113  C  CA    . HIS D 2 134 ? 73.594  9.118   312.345 1.00 95.25  ? 513 HIS D CA    1 
ATOM   9114  C  C     . HIS D 2 134 ? 74.055  10.455  312.920 1.00 101.90 ? 513 HIS D C     1 
ATOM   9115  O  O     . HIS D 2 134 ? 73.439  10.994  313.848 1.00 115.22 ? 513 HIS D O     1 
ATOM   9116  C  CB    . HIS D 2 134 ? 74.551  8.005   312.775 1.00 80.87  ? 513 HIS D CB    1 
ATOM   9117  C  CG    . HIS D 2 134 ? 74.577  7.762   314.252 1.00 84.42  ? 513 HIS D CG    1 
ATOM   9118  N  ND1   . HIS D 2 134 ? 75.674  7.236   314.899 1.00 83.08  ? 513 HIS D ND1   1 
ATOM   9119  C  CD2   . HIS D 2 134 ? 73.638  7.966   315.206 1.00 85.53  ? 513 HIS D CD2   1 
ATOM   9120  C  CE1   . HIS D 2 134 ? 75.411  7.131   316.190 1.00 87.53  ? 513 HIS D CE1   1 
ATOM   9121  N  NE2   . HIS D 2 134 ? 74.183  7.567   316.402 1.00 87.64  ? 513 HIS D NE2   1 
ATOM   9122  N  N     . ILE D 2 135 ? 75.136  10.988  312.357 1.00 89.59  ? 514 ILE D N     1 
ATOM   9123  C  CA    . ILE D 2 135 ? 75.659  12.280  312.780 1.00 87.63  ? 514 ILE D CA    1 
ATOM   9124  C  C     . ILE D 2 135 ? 74.624  13.377  312.532 1.00 87.07  ? 514 ILE D C     1 
ATOM   9125  O  O     . ILE D 2 135 ? 74.523  14.336  313.298 1.00 86.09  ? 514 ILE D O     1 
ATOM   9126  C  CB    . ILE D 2 135 ? 76.988  12.612  312.071 1.00 93.23  ? 514 ILE D CB    1 
ATOM   9127  C  CG1   . ILE D 2 135 ? 78.057  11.577  312.432 1.00 97.17  ? 514 ILE D CG1   1 
ATOM   9128  C  CG2   . ILE D 2 135 ? 77.466  14.001  312.450 1.00 99.20  ? 514 ILE D CG2   1 
ATOM   9129  C  CD1   . ILE D 2 135 ? 79.431  11.885  311.871 1.00 96.04  ? 514 ILE D CD1   1 
ATOM   9130  N  N     . ARG D 2 136 ? 73.842  13.217  311.469 1.00 92.67  ? 515 ARG D N     1 
ATOM   9131  C  CA    . ARG D 2 136 ? 72.757  14.146  311.178 1.00 104.59 ? 515 ARG D CA    1 
ATOM   9132  C  C     . ARG D 2 136 ? 71.716  14.115  312.294 1.00 104.11 ? 515 ARG D C     1 
ATOM   9133  O  O     . ARG D 2 136 ? 71.240  15.163  312.739 1.00 105.63 ? 515 ARG D O     1 
ATOM   9134  C  CB    . ARG D 2 136 ? 72.106  13.819  309.833 1.00 103.55 ? 515 ARG D CB    1 
ATOM   9135  N  N     . THR D 2 137 ? 71.374  12.911  312.746 1.00 95.80  ? 516 THR D N     1 
ATOM   9136  C  CA    . THR D 2 137 ? 70.419  12.750  313.837 1.00 94.49  ? 516 THR D CA    1 
ATOM   9137  C  C     . THR D 2 137 ? 70.948  13.397  315.113 1.00 109.04 ? 516 THR D C     1 
ATOM   9138  O  O     . THR D 2 137 ? 70.257  14.198  315.739 1.00 122.27 ? 516 THR D O     1 
ATOM   9139  C  CB    . THR D 2 137 ? 70.092  11.264  314.111 1.00 92.53  ? 516 THR D CB    1 
ATOM   9140  O  OG1   . THR D 2 137 ? 71.296  10.554  314.426 1.00 94.51  ? 516 THR D OG1   1 
ATOM   9141  C  CG2   . THR D 2 137 ? 69.434  10.625  312.894 1.00 98.50  ? 516 THR D CG2   1 
ATOM   9142  N  N     . LEU D 2 138 ? 72.182  13.057  315.479 1.00 101.87 ? 517 LEU D N     1 
ATOM   9143  C  CA    . LEU D 2 138 ? 72.818  13.605  316.678 1.00 95.23  ? 517 LEU D CA    1 
ATOM   9144  C  C     . LEU D 2 138 ? 72.847  15.133  316.665 1.00 105.21 ? 517 LEU D C     1 
ATOM   9145  O  O     . LEU D 2 138 ? 72.440  15.787  317.633 1.00 115.03 ? 517 LEU D O     1 
ATOM   9146  C  CB    . LEU D 2 138 ? 74.243  13.064  316.808 1.00 92.00  ? 517 LEU D CB    1 
ATOM   9147  C  CG    . LEU D 2 138 ? 74.373  11.551  316.992 1.00 91.21  ? 517 LEU D CG    1 
ATOM   9148  C  CD1   . LEU D 2 138 ? 75.750  11.074  316.562 1.00 80.33  ? 517 LEU D CD1   1 
ATOM   9149  C  CD2   . LEU D 2 138 ? 74.107  11.172  318.439 1.00 89.32  ? 517 LEU D CD2   1 
ATOM   9150  N  N     . LEU D 2 139 ? 73.332  15.690  315.559 1.00 104.75 ? 518 LEU D N     1 
ATOM   9151  C  CA    . LEU D 2 139 ? 73.387  17.136  315.379 1.00 100.03 ? 518 LEU D CA    1 
ATOM   9152  C  C     . LEU D 2 139 ? 71.998  17.755  315.465 1.00 109.64 ? 518 LEU D C     1 
ATOM   9153  O  O     . LEU D 2 139 ? 71.834  18.847  316.006 1.00 107.99 ? 518 LEU D O     1 
ATOM   9154  C  CB    . LEU D 2 139 ? 74.044  17.487  314.042 1.00 92.84  ? 518 LEU D CB    1 
ATOM   9155  C  CG    . LEU D 2 139 ? 75.565  17.333  313.960 1.00 97.42  ? 518 LEU D CG    1 
ATOM   9156  C  CD1   . LEU D 2 139 ? 76.050  17.518  312.530 1.00 96.69  ? 518 LEU D CD1   1 
ATOM   9157  C  CD2   . LEU D 2 139 ? 76.257  18.318  314.893 1.00 100.71 ? 518 LEU D CD2   1 
ATOM   9158  N  N     . LEU D 2 140 ? 70.998  17.056  314.935 1.00 117.45 ? 519 LEU D N     1 
ATOM   9159  C  CA    . LEU D 2 140 ? 69.625  17.555  314.985 1.00 107.17 ? 519 LEU D CA    1 
ATOM   9160  C  C     . LEU D 2 140 ? 69.043  17.515  316.400 1.00 101.99 ? 519 LEU D C     1 
ATOM   9161  O  O     . LEU D 2 140 ? 68.185  18.327  316.746 1.00 99.85  ? 519 LEU D O     1 
ATOM   9162  C  CB    . LEU D 2 140 ? 68.727  16.798  314.003 1.00 101.01 ? 519 LEU D CB    1 
ATOM   9163  C  CG    . LEU D 2 140 ? 68.741  17.311  312.561 1.00 108.81 ? 519 LEU D CG    1 
ATOM   9164  C  CD1   . LEU D 2 140 ? 67.883  16.434  311.666 1.00 116.01 ? 519 LEU D CD1   1 
ATOM   9165  C  CD2   . LEU D 2 140 ? 68.275  18.761  312.495 1.00 95.08  ? 519 LEU D CD2   1 
ATOM   9166  N  N     . THR D 2 141 ? 69.511  16.574  317.214 1.00 98.12  ? 520 THR D N     1 
ATOM   9167  C  CA    . THR D 2 141 ? 69.110  16.519  318.614 1.00 104.47 ? 520 THR D CA    1 
ATOM   9168  C  C     . THR D 2 141 ? 69.756  17.668  319.370 1.00 104.35 ? 520 THR D C     1 
ATOM   9169  O  O     . THR D 2 141 ? 69.103  18.347  320.165 1.00 104.46 ? 520 THR D O     1 
ATOM   9170  C  CB    . THR D 2 141 ? 69.529  15.200  319.280 1.00 116.85 ? 520 THR D CB    1 
ATOM   9171  O  OG1   . THR D 2 141 ? 70.955  15.075  319.238 1.00 141.58 ? 520 THR D OG1   1 
ATOM   9172  C  CG2   . THR D 2 141 ? 68.903  14.023  318.571 1.00 110.02 ? 520 THR D CG2   1 
ATOM   9173  N  N     . LEU D 2 142 ? 71.046  17.873  319.119 1.00 109.62 ? 521 LEU D N     1 
ATOM   9174  C  CA    . LEU D 2 142 ? 71.777  18.982  319.723 1.00 107.35 ? 521 LEU D CA    1 
ATOM   9175  C  C     . LEU D 2 142 ? 71.110  20.316  319.406 1.00 102.72 ? 521 LEU D C     1 
ATOM   9176  O  O     . LEU D 2 142 ? 70.888  21.142  320.295 1.00 104.73 ? 521 LEU D O     1 
ATOM   9177  C  CB    . LEU D 2 142 ? 73.226  18.999  319.237 1.00 99.83  ? 521 LEU D CB    1 
ATOM   9178  C  CG    . LEU D 2 142 ? 74.044  20.246  319.582 1.00 91.36  ? 521 LEU D CG    1 
ATOM   9179  C  CD1   . LEU D 2 142 ? 74.210  20.390  321.088 1.00 89.13  ? 521 LEU D CD1   1 
ATOM   9180  C  CD2   . LEU D 2 142 ? 75.396  20.216  318.888 1.00 90.28  ? 521 LEU D CD2   1 
ATOM   9181  N  N     . ILE D 2 143 ? 70.782  20.511  318.133 1.00 104.82 ? 522 ILE D N     1 
ATOM   9182  C  CA    . ILE D 2 143 ? 70.165  21.750  317.672 1.00 108.69 ? 522 ILE D CA    1 
ATOM   9183  C  C     . ILE D 2 143 ? 68.737  21.919  318.192 1.00 109.04 ? 522 ILE D C     1 
ATOM   9184  O  O     . ILE D 2 143 ? 68.370  22.996  318.648 1.00 110.16 ? 522 ILE D O     1 
ATOM   9185  C  CB    . ILE D 2 143 ? 70.181  21.846  316.131 1.00 103.59 ? 522 ILE D CB    1 
ATOM   9186  C  CG1   . ILE D 2 143 ? 71.613  22.021  315.626 1.00 94.27  ? 522 ILE D CG1   1 
ATOM   9187  C  CG2   . ILE D 2 143 ? 69.326  23.008  315.650 1.00 108.22 ? 522 ILE D CG2   1 
ATOM   9188  C  CD1   . ILE D 2 143 ? 71.726  22.085  314.120 1.00 102.92 ? 522 ILE D CD1   1 
ATOM   9189  N  N     . TYR D 2 144 ? 67.933  20.863  318.133 1.00 106.39 ? 523 TYR D N     1 
ATOM   9190  C  CA    . TYR D 2 144 ? 66.548  20.969  318.589 1.00 113.11 ? 523 TYR D CA    1 
ATOM   9191  C  C     . TYR D 2 144 ? 66.449  21.191  320.096 1.00 120.07 ? 523 TYR D C     1 
ATOM   9192  O  O     . TYR D 2 144 ? 65.583  21.926  320.567 1.00 125.18 ? 523 TYR D O     1 
ATOM   9193  C  CB    . TYR D 2 144 ? 65.730  19.740  318.186 1.00 115.16 ? 523 TYR D CB    1 
ATOM   9194  C  CG    . TYR D 2 144 ? 64.307  19.764  318.706 1.00 121.24 ? 523 TYR D CG    1 
ATOM   9195  C  CD1   . TYR D 2 144 ? 63.354  20.600  318.138 1.00 128.08 ? 523 TYR D CD1   1 
ATOM   9196  C  CD2   . TYR D 2 144 ? 63.919  18.955  319.768 1.00 121.53 ? 523 TYR D CD2   1 
ATOM   9197  C  CE1   . TYR D 2 144 ? 62.055  20.628  318.611 1.00 132.21 ? 523 TYR D CE1   1 
ATOM   9198  C  CE2   . TYR D 2 144 ? 62.622  18.977  320.246 1.00 126.16 ? 523 TYR D CE2   1 
ATOM   9199  C  CZ    . TYR D 2 144 ? 61.694  19.815  319.664 1.00 132.50 ? 523 TYR D CZ    1 
ATOM   9200  O  OH    . TYR D 2 144 ? 60.402  19.839  320.139 1.00 140.28 ? 523 TYR D OH    1 
ATOM   9201  N  N     . ARG D 2 145 ? 67.343  20.556  320.846 1.00 117.95 ? 524 ARG D N     1 
ATOM   9202  C  CA    . ARG D 2 145 ? 67.288  20.615  322.303 1.00 116.20 ? 524 ARG D CA    1 
ATOM   9203  C  C     . ARG D 2 145 ? 67.974  21.848  322.893 1.00 117.79 ? 524 ARG D C     1 
ATOM   9204  O  O     . ARG D 2 145 ? 67.457  22.455  323.832 1.00 125.83 ? 524 ARG D O     1 
ATOM   9205  C  CB    . ARG D 2 145 ? 67.875  19.343  322.922 1.00 93.22  ? 524 ARG D CB    1 
ATOM   9206  N  N     . TYR D 2 146 ? 69.128  22.221  322.346 1.00 111.05 ? 525 TYR D N     1 
ATOM   9207  C  CA    . TYR D 2 146 ? 69.916  23.302  322.939 1.00 110.02 ? 525 TYR D CA    1 
ATOM   9208  C  C     . TYR D 2 146 ? 70.143  24.502  322.017 1.00 111.34 ? 525 TYR D C     1 
ATOM   9209  O  O     . TYR D 2 146 ? 70.889  25.419  322.357 1.00 110.97 ? 525 TYR D O     1 
ATOM   9210  C  CB    . TYR D 2 146 ? 71.245  22.767  323.478 1.00 113.14 ? 525 TYR D CB    1 
ATOM   9211  C  CG    . TYR D 2 146 ? 71.083  21.817  324.645 1.00 117.10 ? 525 TYR D CG    1 
ATOM   9212  C  CD1   . TYR D 2 146 ? 71.208  20.445  324.472 1.00 124.61 ? 525 TYR D CD1   1 
ATOM   9213  C  CD2   . TYR D 2 146 ? 70.790  22.292  325.917 1.00 109.79 ? 525 TYR D CD2   1 
ATOM   9214  C  CE1   . TYR D 2 146 ? 71.056  19.574  325.535 1.00 120.83 ? 525 TYR D CE1   1 
ATOM   9215  C  CE2   . TYR D 2 146 ? 70.637  21.429  326.985 1.00 107.37 ? 525 TYR D CE2   1 
ATOM   9216  C  CZ    . TYR D 2 146 ? 70.770  20.071  326.788 1.00 111.40 ? 525 TYR D CZ    1 
ATOM   9217  O  OH    . TYR D 2 146 ? 70.618  19.206  327.846 1.00 117.07 ? 525 TYR D OH    1 
ATOM   9218  N  N     . MET D 2 147 ? 69.499  24.490  320.855 1.00 115.29 ? 526 MET D N     1 
ATOM   9219  C  CA    . MET D 2 147 ? 69.513  25.635  319.947 1.00 120.66 ? 526 MET D CA    1 
ATOM   9220  C  C     . MET D 2 147 ? 68.130  25.792  319.330 1.00 119.89 ? 526 MET D C     1 
ATOM   9221  O  O     . MET D 2 147 ? 67.990  26.106  318.148 1.00 101.43 ? 526 MET D O     1 
ATOM   9222  C  CB    . MET D 2 147 ? 70.572  25.458  318.857 1.00 123.59 ? 526 MET D CB    1 
ATOM   9223  C  CG    . MET D 2 147 ? 71.983  25.805  319.301 1.00 125.99 ? 526 MET D CG    1 
ATOM   9224  S  SD    . MET D 2 147 ? 73.205  25.592  317.991 1.00 138.57 ? 526 MET D SD    1 
ATOM   9225  C  CE    . MET D 2 147 ? 72.482  26.598  316.696 1.00 132.18 ? 526 MET D CE    1 
ATOM   9226  N  N     . LYS D 2 148 ? 67.114  25.554  320.152 1.00 118.15 ? 527 LYS D N     1 
ATOM   9227  C  CA    . LYS D 2 148 ? 65.720  25.545  319.712 1.00 115.35 ? 527 LYS D CA    1 
ATOM   9228  C  C     . LYS D 2 148 ? 65.241  26.807  318.971 1.00 117.33 ? 527 LYS D C     1 
ATOM   9229  O  O     . LYS D 2 148 ? 64.535  26.686  317.970 1.00 124.51 ? 527 LYS D O     1 
ATOM   9230  C  CB    . LYS D 2 148 ? 64.795  25.211  320.890 1.00 115.59 ? 527 LYS D CB    1 
ATOM   9231  C  CG    . LYS D 2 148 ? 63.483  24.559  320.493 1.00 113.45 ? 527 LYS D CG    1 
ATOM   9232  C  CD    . LYS D 2 148 ? 62.800  23.940  321.701 1.00 109.85 ? 527 LYS D CD    1 
ATOM   9233  N  N     . PRO D 2 149 ? 65.615  28.013  319.449 1.00 117.00 ? 528 PRO D N     1 
ATOM   9234  C  CA    . PRO D 2 149 ? 65.195  29.199  318.689 1.00 125.08 ? 528 PRO D CA    1 
ATOM   9235  C  C     . PRO D 2 149 ? 65.755  29.237  317.267 1.00 130.36 ? 528 PRO D C     1 
ATOM   9236  O  O     . PRO D 2 149 ? 65.097  29.756  316.364 1.00 136.36 ? 528 PRO D O     1 
ATOM   9237  C  CB    . PRO D 2 149 ? 65.777  30.358  319.503 1.00 124.66 ? 528 PRO D CB    1 
ATOM   9238  C  CG    . PRO D 2 149 ? 65.870  29.830  320.886 1.00 120.43 ? 528 PRO D CG    1 
ATOM   9239  C  CD    . PRO D 2 149 ? 66.239  28.387  320.732 1.00 120.13 ? 528 PRO D CD    1 
ATOM   9240  N  N     . ILE D 2 150 ? 66.956  28.700  317.076 1.00 127.88 ? 529 ILE D N     1 
ATOM   9241  C  CA    . ILE D 2 150 ? 67.590  28.690  315.762 1.00 127.70 ? 529 ILE D CA    1 
ATOM   9242  C  C     . ILE D 2 150 ? 66.784  27.866  314.759 1.00 129.32 ? 529 ILE D C     1 
ATOM   9243  O  O     . ILE D 2 150 ? 66.545  28.300  313.631 1.00 129.59 ? 529 ILE D O     1 
ATOM   9244  C  CB    . ILE D 2 150 ? 69.040  28.166  315.840 1.00 124.10 ? 529 ILE D CB    1 
ATOM   9245  C  CG1   . ILE D 2 150 ? 69.948  29.220  316.472 1.00 121.49 ? 529 ILE D CG1   1 
ATOM   9246  C  CG2   . ILE D 2 150 ? 69.560  27.822  314.459 1.00 127.94 ? 529 ILE D CG2   1 
ATOM   9247  C  CD1   . ILE D 2 150 ? 70.021  30.507  315.679 1.00 107.13 ? 529 ILE D CD1   1 
ATOM   9248  N  N     . LEU D 2 151 ? 66.352  26.683  315.185 1.00 128.40 ? 530 LEU D N     1 
ATOM   9249  C  CA    . LEU D 2 151 ? 65.554  25.807  314.335 1.00 122.18 ? 530 LEU D CA    1 
ATOM   9250  C  C     . LEU D 2 151 ? 64.116  26.302  314.233 1.00 127.34 ? 530 LEU D C     1 
ATOM   9251  O  O     . LEU D 2 151 ? 63.410  25.988  313.276 1.00 129.05 ? 530 LEU D O     1 
ATOM   9252  C  CB    . LEU D 2 151 ? 65.580  24.372  314.868 1.00 108.43 ? 530 LEU D CB    1 
ATOM   9253  N  N     . GLU D 2 152 ? 63.688  27.078  315.223 1.00 129.65 ? 531 GLU D N     1 
ATOM   9254  C  CA    . GLU D 2 152 ? 62.329  27.605  315.250 1.00 134.36 ? 531 GLU D CA    1 
ATOM   9255  C  C     . GLU D 2 152 ? 62.190  28.857  314.392 1.00 137.92 ? 531 GLU D C     1 
ATOM   9256  O  O     . GLU D 2 152 ? 61.091  29.388  314.231 1.00 141.82 ? 531 GLU D O     1 
ATOM   9257  C  CB    . GLU D 2 152 ? 61.897  27.910  316.687 1.00 134.41 ? 531 GLU D CB    1 
ATOM   9258  N  N     . ALA D 2 153 ? 63.306  29.329  313.845 1.00 135.42 ? 532 ALA D N     1 
ATOM   9259  C  CA    . ALA D 2 153 ? 63.298  30.542  313.036 1.00 136.94 ? 532 ALA D CA    1 
ATOM   9260  C  C     . ALA D 2 153 ? 63.805  30.299  311.614 1.00 146.55 ? 532 ALA D C     1 
ATOM   9261  O  O     . ALA D 2 153 ? 64.158  31.239  310.902 1.00 149.75 ? 532 ALA D O     1 
ATOM   9262  C  CB    . ALA D 2 153 ? 64.102  31.639  313.717 1.00 125.20 ? 532 ALA D CB    1 
ATOM   9263  N  N     . GLY D 2 154 ? 63.837  29.032  311.210 1.00 144.91 ? 533 GLY D N     1 
ATOM   9264  C  CA    . GLY D 2 154 ? 64.200  28.667  309.852 1.00 143.70 ? 533 GLY D CA    1 
ATOM   9265  C  C     . GLY D 2 154 ? 65.633  28.985  309.470 1.00 143.25 ? 533 GLY D C     1 
ATOM   9266  O  O     . GLY D 2 154 ? 65.899  29.454  308.364 1.00 154.52 ? 533 GLY D O     1 
ATOM   9267  N  N     . TYR D 2 155 ? 66.561  28.725  310.384 1.00 130.99 ? 534 TYR D N     1 
ATOM   9268  C  CA    . TYR D 2 155 ? 67.977  28.952  310.120 1.00 132.37 ? 534 TYR D CA    1 
ATOM   9269  C  C     . TYR D 2 155 ? 68.703  27.649  309.788 1.00 125.84 ? 534 TYR D C     1 
ATOM   9270  O  O     . TYR D 2 155 ? 69.780  27.664  309.197 1.00 119.33 ? 534 TYR D O     1 
ATOM   9271  C  CB    . TYR D 2 155 ? 68.647  29.631  311.318 1.00 143.80 ? 534 TYR D CB    1 
ATOM   9272  C  CG    . TYR D 2 155 ? 68.358  31.111  311.439 1.00 157.53 ? 534 TYR D CG    1 
ATOM   9273  C  CD1   . TYR D 2 155 ? 67.179  31.566  312.012 1.00 162.05 ? 534 TYR D CD1   1 
ATOM   9274  C  CD2   . TYR D 2 155 ? 69.272  32.055  310.991 1.00 161.86 ? 534 TYR D CD2   1 
ATOM   9275  C  CE1   . TYR D 2 155 ? 66.914  32.919  312.127 1.00 164.65 ? 534 TYR D CE1   1 
ATOM   9276  C  CE2   . TYR D 2 155 ? 69.016  33.409  311.100 1.00 165.35 ? 534 TYR D CE2   1 
ATOM   9277  C  CZ    . TYR D 2 155 ? 67.836  33.835  311.669 1.00 166.62 ? 534 TYR D CZ    1 
ATOM   9278  O  OH    . TYR D 2 155 ? 67.576  35.182  311.783 1.00 169.49 ? 534 TYR D OH    1 
ATOM   9279  N  N     . VAL D 2 156 ? 68.106  26.524  310.168 1.00 123.03 ? 535 VAL D N     1 
ATOM   9280  C  CA    . VAL D 2 156 ? 68.744  25.223  309.995 1.00 116.50 ? 535 VAL D CA    1 
ATOM   9281  C  C     . VAL D 2 156 ? 68.379  24.568  308.667 1.00 121.67 ? 535 VAL D C     1 
ATOM   9282  O  O     . VAL D 2 156 ? 67.203  24.422  308.338 1.00 123.59 ? 535 VAL D O     1 
ATOM   9283  C  CB    . VAL D 2 156 ? 68.382  24.263  311.146 1.00 107.42 ? 535 VAL D CB    1 
ATOM   9284  C  CG1   . VAL D 2 156 ? 69.039  22.908  310.939 1.00 105.64 ? 535 VAL D CG1   1 
ATOM   9285  C  CG2   . VAL D 2 156 ? 68.796  24.856  312.479 1.00 108.67 ? 535 VAL D CG2   1 
ATOM   9286  N  N     . TYR D 2 157 ? 69.398  24.172  307.910 1.00 116.63 ? 536 TYR D N     1 
ATOM   9287  C  CA    . TYR D 2 157 ? 69.191  23.487  306.639 1.00 107.83 ? 536 TYR D CA    1 
ATOM   9288  C  C     . TYR D 2 157 ? 69.907  22.141  306.590 1.00 111.35 ? 536 TYR D C     1 
ATOM   9289  O  O     . TYR D 2 157 ? 70.811  21.870  307.383 1.00 114.29 ? 536 TYR D O     1 
ATOM   9290  C  CB    . TYR D 2 157 ? 69.656  24.357  305.467 1.00 109.08 ? 536 TYR D CB    1 
ATOM   9291  C  CG    . TYR D 2 157 ? 68.902  25.660  305.318 1.00 115.64 ? 536 TYR D CG    1 
ATOM   9292  C  CD1   . TYR D 2 157 ? 67.684  25.709  304.653 1.00 115.03 ? 536 TYR D CD1   1 
ATOM   9293  C  CD2   . TYR D 2 157 ? 69.413  26.841  305.836 1.00 123.11 ? 536 TYR D CD2   1 
ATOM   9294  C  CE1   . TYR D 2 157 ? 66.994  26.901  304.514 1.00 123.77 ? 536 TYR D CE1   1 
ATOM   9295  C  CE2   . TYR D 2 157 ? 68.731  28.037  305.702 1.00 129.20 ? 536 TYR D CE2   1 
ATOM   9296  C  CZ    . TYR D 2 157 ? 67.524  28.061  305.041 1.00 130.68 ? 536 TYR D CZ    1 
ATOM   9297  O  OH    . TYR D 2 157 ? 66.851  29.254  304.910 1.00 135.30 ? 536 TYR D OH    1 
ATOM   9298  N  N     . ILE D 2 158 ? 69.488  21.305  305.647 1.00 101.96 ? 537 ILE D N     1 
ATOM   9299  C  CA    . ILE D 2 158 ? 70.156  20.044  305.380 1.00 114.78 ? 537 ILE D CA    1 
ATOM   9300  C  C     . ILE D 2 158 ? 70.591  20.005  303.919 1.00 114.21 ? 537 ILE D C     1 
ATOM   9301  O  O     . ILE D 2 158 ? 69.758  20.089  303.012 1.00 123.54 ? 537 ILE D O     1 
ATOM   9302  C  CB    . ILE D 2 158 ? 69.238  18.847  305.676 1.00 107.36 ? 537 ILE D CB    1 
ATOM   9303  C  CG1   . ILE D 2 158 ? 68.870  18.808  307.160 1.00 105.78 ? 537 ILE D CG1   1 
ATOM   9304  C  CG2   . ILE D 2 158 ? 69.912  17.548  305.267 1.00 107.54 ? 537 ILE D CG2   1 
ATOM   9305  C  CD1   . ILE D 2 158 ? 67.971  17.655  307.531 1.00 108.01 ? 537 ILE D CD1   1 
ATOM   9306  N  N     . ALA D 2 159 ? 71.899  19.897  303.702 1.00 108.68 ? 538 ALA D N     1 
ATOM   9307  C  CA    . ALA D 2 159 ? 72.452  19.806  302.356 1.00 125.46 ? 538 ALA D CA    1 
ATOM   9308  C  C     . ALA D 2 159 ? 72.054  18.480  301.719 1.00 131.41 ? 538 ALA D C     1 
ATOM   9309  O  O     . ALA D 2 159 ? 71.840  17.490  302.419 1.00 137.48 ? 538 ALA D O     1 
ATOM   9310  C  CB    . ALA D 2 159 ? 73.968  19.949  302.387 1.00 126.18 ? 538 ALA D CB    1 
ATOM   9311  N  N     . GLN D 2 160 ? 71.955  18.459  300.394 1.00 122.08 ? 539 GLN D N     1 
ATOM   9312  C  CA    . GLN D 2 160 ? 71.494  17.268  299.690 1.00 125.15 ? 539 GLN D CA    1 
ATOM   9313  C  C     . GLN D 2 160 ? 72.511  16.781  298.659 1.00 142.12 ? 539 GLN D C     1 
ATOM   9314  O  O     . GLN D 2 160 ? 72.345  17.020  297.463 1.00 153.86 ? 539 GLN D O     1 
ATOM   9315  C  CB    . GLN D 2 160 ? 70.157  17.550  299.001 1.00 123.96 ? 539 GLN D CB    1 
ATOM   9316  C  CG    . GLN D 2 160 ? 69.066  18.067  299.930 1.00 120.49 ? 539 GLN D CG    1 
ATOM   9317  C  CD    . GLN D 2 160 ? 68.220  16.953  300.510 1.00 124.34 ? 539 GLN D CD    1 
ATOM   9318  O  OE1   . GLN D 2 160 ? 68.179  15.846  299.975 1.00 126.40 ? 539 GLN D OE1   1 
ATOM   9319  N  NE2   . GLN D 2 160 ? 67.538  17.240  301.610 1.00 119.53 ? 539 GLN D NE2   1 
ATOM   9320  N  N     . PRO D 2 161 ? 73.571  16.096  299.120 1.00 141.44 ? 540 PRO D N     1 
ATOM   9321  C  CA    . PRO D 2 161 ? 74.588  15.555  298.211 1.00 139.61 ? 540 PRO D CA    1 
ATOM   9322  C  C     . PRO D 2 161 ? 74.034  14.413  297.365 1.00 146.21 ? 540 PRO D C     1 
ATOM   9323  O  O     . PRO D 2 161 ? 73.070  13.771  297.779 1.00 154.96 ? 540 PRO D O     1 
ATOM   9324  C  CB    . PRO D 2 161 ? 75.665  15.022  299.165 1.00 138.59 ? 540 PRO D CB    1 
ATOM   9325  C  CG    . PRO D 2 161 ? 75.413  15.714  300.471 1.00 142.70 ? 540 PRO D CG    1 
ATOM   9326  C  CD    . PRO D 2 161 ? 73.929  15.876  300.531 1.00 144.30 ? 540 PRO D CD    1 
ATOM   9327  N  N     . PRO D 2 162 ? 74.633  14.167  296.188 1.00 140.69 ? 541 PRO D N     1 
ATOM   9328  C  CA    . PRO D 2 162 ? 74.205  13.074  295.311 1.00 128.53 ? 541 PRO D CA    1 
ATOM   9329  C  C     . PRO D 2 162 ? 74.850  11.751  295.710 1.00 121.49 ? 541 PRO D C     1 
ATOM   9330  O  O     . PRO D 2 162 ? 75.433  11.091  294.849 1.00 119.18 ? 541 PRO D O     1 
ATOM   9331  C  CB    . PRO D 2 162 ? 74.727  13.516  293.949 1.00 113.97 ? 541 PRO D CB    1 
ATOM   9332  C  CG    . PRO D 2 162 ? 75.975  14.245  294.275 1.00 112.68 ? 541 PRO D CG    1 
ATOM   9333  C  CD    . PRO D 2 162 ? 75.710  14.964  295.575 1.00 130.86 ? 541 PRO D CD    1 
ATOM   9334  N  N     . LEU D 2 208 ? 82.272  11.941  301.528 1.00 88.89  ? 587 LEU D N     1 
ATOM   9335  C  CA    . LEU D 2 208 ? 82.240  13.253  300.894 1.00 124.82 ? 587 LEU D CA    1 
ATOM   9336  C  C     . LEU D 2 208 ? 83.650  13.803  300.705 1.00 129.12 ? 587 LEU D C     1 
ATOM   9337  O  O     . LEU D 2 208 ? 83.844  14.848  300.082 1.00 124.42 ? 587 LEU D O     1 
ATOM   9338  C  CB    . LEU D 2 208 ? 81.400  14.228  301.719 1.00 117.02 ? 587 LEU D CB    1 
ATOM   9339  N  N     . GLY D 2 209 ? 84.632  13.098  301.258 1.00 135.40 ? 588 GLY D N     1 
ATOM   9340  C  CA    . GLY D 2 209 ? 86.026  13.439  301.043 1.00 141.64 ? 588 GLY D CA    1 
ATOM   9341  C  C     . GLY D 2 209 ? 86.455  12.966  299.668 1.00 137.92 ? 588 GLY D C     1 
ATOM   9342  O  O     . GLY D 2 209 ? 87.454  13.428  299.112 1.00 133.88 ? 588 GLY D O     1 
ATOM   9343  N  N     . GLU D 2 210 ? 85.681  12.033  299.123 1.00 131.84 ? 589 GLU D N     1 
ATOM   9344  C  CA    . GLU D 2 210 ? 85.903  11.518  297.780 1.00 128.74 ? 589 GLU D CA    1 
ATOM   9345  C  C     . GLU D 2 210 ? 85.262  12.441  296.758 1.00 130.21 ? 589 GLU D C     1 
ATOM   9346  O  O     . GLU D 2 210 ? 84.339  12.047  296.046 1.00 137.11 ? 589 GLU D O     1 
ATOM   9347  C  CB    . GLU D 2 210 ? 85.315  10.110  297.645 1.00 124.45 ? 589 GLU D CB    1 
ATOM   9348  N  N     . MET D 2 211 ? 85.749  13.674  296.695 1.00 126.16 ? 590 MET D N     1 
ATOM   9349  C  CA    . MET D 2 211 ? 85.162  14.673  295.816 1.00 123.85 ? 590 MET D CA    1 
ATOM   9350  C  C     . MET D 2 211 ? 86.107  15.850  295.643 1.00 130.76 ? 590 MET D C     1 
ATOM   9351  O  O     . MET D 2 211 ? 86.688  16.339  296.611 1.00 135.17 ? 590 MET D O     1 
ATOM   9352  C  CB    . MET D 2 211 ? 83.832  15.161  296.389 1.00 125.20 ? 590 MET D CB    1 
ATOM   9353  C  CG    . MET D 2 211 ? 82.717  15.284  295.369 1.00 138.06 ? 590 MET D CG    1 
ATOM   9354  S  SD    . MET D 2 211 ? 81.156  15.732  296.150 1.00 124.96 ? 590 MET D SD    1 
ATOM   9355  C  CE    . MET D 2 211 ? 80.066  15.791  294.731 1.00 103.16 ? 590 MET D CE    1 
ATOM   9356  N  N     . ASP D 2 212 ? 86.262  16.301  294.404 1.00 136.11 ? 591 ASP D N     1 
ATOM   9357  C  CA    . ASP D 2 212 ? 87.067  17.481  294.123 1.00 137.25 ? 591 ASP D CA    1 
ATOM   9358  C  C     . ASP D 2 212 ? 86.352  18.720  294.648 1.00 147.75 ? 591 ASP D C     1 
ATOM   9359  O  O     . ASP D 2 212 ? 85.135  18.710  294.833 1.00 148.66 ? 591 ASP D O     1 
ATOM   9360  C  CB    . ASP D 2 212 ? 87.328  17.611  292.623 1.00 121.74 ? 591 ASP D CB    1 
ATOM   9361  N  N     . ASP D 2 213 ? 87.111  19.782  294.895 1.00 150.43 ? 592 ASP D N     1 
ATOM   9362  C  CA    . ASP D 2 213 ? 86.538  21.027  295.394 1.00 148.80 ? 592 ASP D CA    1 
ATOM   9363  C  C     . ASP D 2 213 ? 85.546  21.625  294.398 1.00 141.33 ? 592 ASP D C     1 
ATOM   9364  O  O     . ASP D 2 213 ? 84.494  22.142  294.784 1.00 143.86 ? 592 ASP D O     1 
ATOM   9365  C  CB    . ASP D 2 213 ? 87.642  22.030  295.731 1.00 157.19 ? 592 ASP D CB    1 
ATOM   9366  C  CG    . ASP D 2 213 ? 88.772  22.016  294.721 1.00 166.94 ? 592 ASP D CG    1 
ATOM   9367  O  OD1   . ASP D 2 213 ? 89.665  21.150  294.836 1.00 172.45 ? 592 ASP D OD1   1 
ATOM   9368  O  OD2   . ASP D 2 213 ? 88.770  22.875  293.816 1.00 169.88 ? 592 ASP D OD2   1 
ATOM   9369  N  N     . HIS D 2 214 ? 85.883  21.538  293.115 1.00 131.08 ? 593 HIS D N     1 
ATOM   9370  C  CA    . HIS D 2 214 ? 85.007  22.021  292.056 1.00 134.45 ? 593 HIS D CA    1 
ATOM   9371  C  C     . HIS D 2 214 ? 83.747  21.171  291.980 1.00 126.12 ? 593 HIS D C     1 
ATOM   9372  O  O     . HIS D 2 214 ? 82.662  21.673  291.684 1.00 136.06 ? 593 HIS D O     1 
ATOM   9373  C  CB    . HIS D 2 214 ? 85.733  22.003  290.709 1.00 145.10 ? 593 HIS D CB    1 
ATOM   9374  N  N     . GLN D 2 215 ? 83.902  19.880  292.253 1.00 113.83 ? 594 GLN D N     1 
ATOM   9375  C  CA    . GLN D 2 215 ? 82.775  18.957  292.277 1.00 120.25 ? 594 GLN D CA    1 
ATOM   9376  C  C     . GLN D 2 215 ? 81.799  19.349  293.379 1.00 126.20 ? 594 GLN D C     1 
ATOM   9377  O  O     . GLN D 2 215 ? 80.597  19.465  293.141 1.00 130.66 ? 594 GLN D O     1 
ATOM   9378  C  CB    . GLN D 2 215 ? 83.263  17.522  292.490 1.00 108.06 ? 594 GLN D CB    1 
ATOM   9379  N  N     . LEU D 2 216 ? 82.326  19.560  294.581 1.00 128.91 ? 595 LEU D N     1 
ATOM   9380  C  CA    . LEU D 2 216 ? 81.504  19.943  295.723 1.00 130.22 ? 595 LEU D CA    1 
ATOM   9381  C  C     . LEU D 2 216 ? 80.819  21.281  295.489 1.00 129.89 ? 595 LEU D C     1 
ATOM   9382  O  O     . LEU D 2 216 ? 79.618  21.426  295.728 1.00 127.70 ? 595 LEU D O     1 
ATOM   9383  C  CB    . LEU D 2 216 ? 82.347  20.014  296.998 1.00 129.92 ? 595 LEU D CB    1 
ATOM   9384  C  CG    . LEU D 2 216 ? 82.056  18.942  298.047 1.00 123.78 ? 595 LEU D CG    1 
ATOM   9385  C  CD1   . LEU D 2 216 ? 82.554  19.385  299.416 1.00 120.19 ? 595 LEU D CD1   1 
ATOM   9386  C  CD2   . LEU D 2 216 ? 80.570  18.627  298.080 1.00 118.03 ? 595 LEU D CD2   1 
ATOM   9387  N  N     . TRP D 2 217 ? 81.597  22.253  295.021 1.00 132.49 ? 596 TRP D N     1 
ATOM   9388  C  CA    . TRP D 2 217 ? 81.087  23.585  294.726 1.00 143.39 ? 596 TRP D CA    1 
ATOM   9389  C  C     . TRP D 2 217 ? 79.934  23.516  293.728 1.00 141.95 ? 596 TRP D C     1 
ATOM   9390  O  O     . TRP D 2 217 ? 78.861  24.066  293.966 1.00 142.45 ? 596 TRP D O     1 
ATOM   9391  C  CB    . TRP D 2 217 ? 82.211  24.465  294.171 1.00 164.96 ? 596 TRP D CB    1 
ATOM   9392  C  CG    . TRP D 2 217 ? 81.881  25.930  294.106 1.00 184.71 ? 596 TRP D CG    1 
ATOM   9393  C  CD1   . TRP D 2 217 ? 80.684  26.519  294.399 1.00 193.64 ? 596 TRP D CD1   1 
ATOM   9394  C  CD2   . TRP D 2 217 ? 82.768  26.992  293.731 1.00 187.60 ? 596 TRP D CD2   1 
ATOM   9395  N  NE1   . TRP D 2 217 ? 80.770  27.878  294.225 1.00 194.14 ? 596 TRP D NE1   1 
ATOM   9396  C  CE2   . TRP D 2 217 ? 82.038  28.194  293.817 1.00 193.09 ? 596 TRP D CE2   1 
ATOM   9397  C  CE3   . TRP D 2 217 ? 84.106  27.042  293.331 1.00 183.34 ? 596 TRP D CE3   1 
ATOM   9398  C  CZ2   . TRP D 2 217 ? 82.602  29.432  293.516 1.00 193.72 ? 596 TRP D CZ2   1 
ATOM   9399  C  CZ3   . TRP D 2 217 ? 84.664  28.273  293.033 1.00 187.17 ? 596 TRP D CZ3   1 
ATOM   9400  C  CH2   . TRP D 2 217 ? 83.913  29.451  293.127 1.00 191.65 ? 596 TRP D CH2   1 
ATOM   9401  N  N     . GLU D 2 218 ? 80.162  22.821  292.619 1.00 142.92 ? 597 GLU D N     1 
ATOM   9402  C  CA    . GLU D 2 218 ? 79.167  22.714  291.558 1.00 139.51 ? 597 GLU D CA    1 
ATOM   9403  C  C     . GLU D 2 218 ? 77.940  21.910  291.981 1.00 138.12 ? 597 GLU D C     1 
ATOM   9404  O  O     . GLU D 2 218 ? 76.840  22.136  291.477 1.00 148.83 ? 597 GLU D O     1 
ATOM   9405  C  CB    . GLU D 2 218 ? 79.785  22.086  290.306 1.00 133.33 ? 597 GLU D CB    1 
ATOM   9406  N  N     . THR D 2 219 ? 78.124  20.977  292.908 1.00 130.74 ? 598 THR D N     1 
ATOM   9407  C  CA    . THR D 2 219 ? 77.045  20.058  293.246 1.00 124.52 ? 598 THR D CA    1 
ATOM   9408  C  C     . THR D 2 219 ? 76.170  20.517  294.410 1.00 119.42 ? 598 THR D C     1 
ATOM   9409  O  O     . THR D 2 219 ? 74.953  20.615  294.269 1.00 115.87 ? 598 THR D O     1 
ATOM   9410  C  CB    . THR D 2 219 ? 77.572  18.646  293.543 1.00 126.22 ? 598 THR D CB    1 
ATOM   9411  O  OG1   . THR D 2 219 ? 78.700  18.366  292.704 1.00 141.23 ? 598 THR D OG1   1 
ATOM   9412  C  CG2   . THR D 2 219 ? 76.488  17.619  293.283 1.00 118.20 ? 598 THR D CG2   1 
ATOM   9413  N  N     . THR D 2 220 ? 76.785  20.801  295.555 1.00 128.24 ? 599 THR D N     1 
ATOM   9414  C  CA    . THR D 2 220 ? 76.021  20.996  296.787 1.00 129.15 ? 599 THR D CA    1 
ATOM   9415  C  C     . THR D 2 220 ? 76.227  22.342  297.478 1.00 122.35 ? 599 THR D C     1 
ATOM   9416  O  O     . THR D 2 220 ? 75.498  22.675  298.410 1.00 120.31 ? 599 THR D O     1 
ATOM   9417  C  CB    . THR D 2 220 ? 76.347  19.896  297.812 1.00 134.11 ? 599 THR D CB    1 
ATOM   9418  O  OG1   . THR D 2 220 ? 77.645  20.133  298.369 1.00 138.95 ? 599 THR D OG1   1 
ATOM   9419  C  CG2   . THR D 2 220 ? 76.327  18.528  297.155 1.00 137.94 ? 599 THR D CG2   1 
ATOM   9420  N  N     . MET D 2 221 ? 77.217  23.108  297.034 1.00 121.84 ? 600 MET D N     1 
ATOM   9421  C  CA    . MET D 2 221 ? 77.562  24.352  297.719 1.00 124.14 ? 600 MET D CA    1 
ATOM   9422  C  C     . MET D 2 221 ? 77.164  25.620  296.959 1.00 140.48 ? 600 MET D C     1 
ATOM   9423  O  O     . MET D 2 221 ? 77.211  26.717  297.515 1.00 150.01 ? 600 MET D O     1 
ATOM   9424  C  CB    . MET D 2 221 ? 79.056  24.385  298.070 1.00 118.92 ? 600 MET D CB    1 
ATOM   9425  C  CG    . MET D 2 221 ? 79.498  23.275  299.017 1.00 119.45 ? 600 MET D CG    1 
ATOM   9426  S  SD    . MET D 2 221 ? 81.084  23.611  299.810 1.00 126.38 ? 600 MET D SD    1 
ATOM   9427  C  CE    . MET D 2 221 ? 80.658  25.018  300.831 1.00 190.95 ? 600 MET D CE    1 
ATOM   9428  N  N     . ASP D 2 222 ? 76.764  25.474  295.700 1.00 141.97 ? 601 ASP D N     1 
ATOM   9429  C  CA    . ASP D 2 222 ? 76.422  26.638  294.883 1.00 147.62 ? 601 ASP D CA    1 
ATOM   9430  C  C     . ASP D 2 222 ? 74.954  27.030  295.032 1.00 153.01 ? 601 ASP D C     1 
ATOM   9431  O  O     . ASP D 2 222 ? 74.064  26.227  294.760 1.00 154.99 ? 601 ASP D O     1 
ATOM   9432  C  CB    . ASP D 2 222 ? 76.749  26.388  293.410 1.00 154.64 ? 601 ASP D CB    1 
ATOM   9433  C  CG    . ASP D 2 222 ? 76.901  27.675  292.621 1.00 162.32 ? 601 ASP D CG    1 
ATOM   9434  O  OD1   . ASP D 2 222 ? 75.877  28.205  292.144 1.00 164.86 ? 601 ASP D OD1   1 
ATOM   9435  O  OD2   . ASP D 2 222 ? 78.045  28.157  292.480 1.00 165.65 ? 601 ASP D OD2   1 
ATOM   9436  N  N     . PRO D 2 223 ? 74.705  28.281  295.454 1.00 156.39 ? 602 PRO D N     1 
ATOM   9437  C  CA    . PRO D 2 223 ? 73.369  28.828  295.728 1.00 157.61 ? 602 PRO D CA    1 
ATOM   9438  C  C     . PRO D 2 223 ? 72.430  28.790  294.525 1.00 164.68 ? 602 PRO D C     1 
ATOM   9439  O  O     . PRO D 2 223 ? 71.290  28.346  294.665 1.00 124.53 ? 602 PRO D O     1 
ATOM   9440  C  CB    . PRO D 2 223 ? 73.663  30.283  296.108 1.00 159.84 ? 602 PRO D CB    1 
ATOM   9441  C  CG    . PRO D 2 223 ? 75.064  30.271  296.594 1.00 157.98 ? 602 PRO D CG    1 
ATOM   9442  C  CD    . PRO D 2 223 ? 75.765  29.262  295.741 1.00 157.18 ? 602 PRO D CD    1 
ATOM   9443  N  N     . GLU D 2 224 ? 72.902  29.249  293.368 1.00 169.77 ? 603 GLU D N     1 
ATOM   9444  C  CA    . GLU D 2 224 ? 72.082  29.301  292.156 1.00 169.78 ? 603 GLU D CA    1 
ATOM   9445  C  C     . GLU D 2 224 ? 71.737  27.906  291.645 1.00 169.50 ? 603 GLU D C     1 
ATOM   9446  O  O     . GLU D 2 224 ? 70.891  27.745  290.763 1.00 165.68 ? 603 GLU D O     1 
ATOM   9447  C  CB    . GLU D 2 224 ? 72.782  30.109  291.060 1.00 166.53 ? 603 GLU D CB    1 
ATOM   9448  N  N     . HIS D 2 225 ? 72.407  26.902  292.200 1.00 173.55 ? 604 HIS D N     1 
ATOM   9449  C  CA    . HIS D 2 225 ? 72.082  25.510  291.931 1.00 175.67 ? 604 HIS D CA    1 
ATOM   9450  C  C     . HIS D 2 225 ? 71.792  24.836  293.268 1.00 170.06 ? 604 HIS D C     1 
ATOM   9451  O  O     . HIS D 2 225 ? 71.315  25.491  294.194 1.00 176.33 ? 604 HIS D O     1 
ATOM   9452  C  CB    . HIS D 2 225 ? 73.238  24.819  291.207 1.00 179.86 ? 604 HIS D CB    1 
ATOM   9453  C  CG    . HIS D 2 225 ? 73.626  25.483  289.922 1.00 189.32 ? 604 HIS D CG    1 
ATOM   9454  N  ND1   . HIS D 2 225 ? 74.238  26.717  289.877 1.00 190.22 ? 604 HIS D ND1   1 
ATOM   9455  C  CD2   . HIS D 2 225 ? 73.485  25.086  288.636 1.00 188.73 ? 604 HIS D CD2   1 
ATOM   9456  C  CE1   . HIS D 2 225 ? 74.458  27.051  288.618 1.00 186.97 ? 604 HIS D CE1   1 
ATOM   9457  N  NE2   . HIS D 2 225 ? 74.011  26.078  287.845 1.00 186.68 ? 604 HIS D NE2   1 
ATOM   9458  N  N     . ARG D 2 226 ? 72.074  23.538  293.358 1.00 158.79 ? 605 ARG D N     1 
ATOM   9459  C  CA    . ARG D 2 226 ? 71.936  22.764  294.599 1.00 154.92 ? 605 ARG D CA    1 
ATOM   9460  C  C     . ARG D 2 226 ? 70.515  22.683  295.166 1.00 156.84 ? 605 ARG D C     1 
ATOM   9461  O  O     . ARG D 2 226 ? 69.667  23.535  294.904 1.00 166.72 ? 605 ARG D O     1 
ATOM   9462  C  CB    . ARG D 2 226 ? 72.920  23.258  295.672 1.00 149.53 ? 605 ARG D CB    1 
ATOM   9463  C  CG    . ARG D 2 226 ? 72.312  24.170  296.740 1.00 157.99 ? 605 ARG D CG    1 
ATOM   9464  C  CD    . ARG D 2 226 ? 73.400  24.869  297.540 1.00 165.86 ? 605 ARG D CD    1 
ATOM   9465  N  NE    . ARG D 2 226 ? 72.873  25.934  298.393 1.00 167.41 ? 605 ARG D NE    1 
ATOM   9466  C  CZ    . ARG D 2 226 ? 73.632  26.770  299.095 1.00 164.47 ? 605 ARG D CZ    1 
ATOM   9467  N  NH1   . ARG D 2 226 ? 74.952  26.668  299.046 1.00 161.09 ? 605 ARG D NH1   1 
ATOM   9468  N  NH2   . ARG D 2 226 ? 73.072  27.707  299.846 1.00 114.90 ? 605 ARG D NH2   1 
ATOM   9469  N  N     . LEU D 2 227 ? 70.268  21.636  295.943 1.00 151.05 ? 606 LEU D N     1 
ATOM   9470  C  CA    . LEU D 2 227 ? 68.993  21.471  296.627 1.00 149.46 ? 606 LEU D CA    1 
ATOM   9471  C  C     . LEU D 2 227 ? 69.212  21.449  298.137 1.00 149.32 ? 606 LEU D C     1 
ATOM   9472  O  O     . LEU D 2 227 ? 70.136  20.804  298.633 1.00 151.20 ? 606 LEU D O     1 
ATOM   9473  C  CB    . LEU D 2 227 ? 68.290  20.194  296.158 1.00 113.36 ? 606 LEU D CB    1 
ATOM   9474  N  N     . MET D 2 228 ? 68.371  22.175  298.864 1.00 143.90 ? 607 MET D N     1 
ATOM   9475  C  CA    . MET D 2 228 ? 68.487  22.246  300.315 1.00 137.52 ? 607 MET D CA    1 
ATOM   9476  C  C     . MET D 2 228 ? 67.162  21.902  300.968 1.00 139.52 ? 607 MET D C     1 
ATOM   9477  O  O     . MET D 2 228 ? 66.097  22.181  300.414 1.00 148.18 ? 607 MET D O     1 
ATOM   9478  C  CB    . MET D 2 228 ? 68.918  23.646  300.747 1.00 129.06 ? 607 MET D CB    1 
ATOM   9479  C  CG    . MET D 2 228 ? 70.378  23.963  300.508 1.00 131.46 ? 607 MET D CG    1 
ATOM   9480  S  SD    . MET D 2 228 ? 71.356  23.732  302.003 1.00 147.30 ? 607 MET D SD    1 
ATOM   9481  C  CE    . MET D 2 228 ? 72.924  24.420  301.486 1.00 113.82 ? 607 MET D CE    1 
ATOM   9482  N  N     . ALA D 2 229 ? 67.227  21.294  302.146 1.00 133.26 ? 608 ALA D N     1 
ATOM   9483  C  CA    . ALA D 2 229 ? 66.018  21.009  302.907 1.00 136.78 ? 608 ALA D CA    1 
ATOM   9484  C  C     . ALA D 2 229 ? 65.906  21.960  304.090 1.00 139.52 ? 608 ALA D C     1 
ATOM   9485  O  O     . ALA D 2 229 ? 66.807  22.033  304.919 1.00 149.66 ? 608 ALA D O     1 
ATOM   9486  C  CB    . ALA D 2 229 ? 66.019  19.569  303.383 1.00 138.65 ? 608 ALA D CB    1 
ATOM   9487  N  N     . ARG D 2 230 ? 64.805  22.697  304.163 1.00 135.17 ? 609 ARG D N     1 
ATOM   9488  C  CA    . ARG D 2 230 ? 64.554  23.558  305.312 1.00 133.48 ? 609 ARG D CA    1 
ATOM   9489  C  C     . ARG D 2 230 ? 63.928  22.747  306.439 1.00 126.19 ? 609 ARG D C     1 
ATOM   9490  O  O     . ARG D 2 230 ? 62.814  22.238  306.305 1.00 129.21 ? 609 ARG D O     1 
ATOM   9491  C  CB    . ARG D 2 230 ? 63.634  24.720  304.934 1.00 143.82 ? 609 ARG D CB    1 
ATOM   9492  C  CG    . ARG D 2 230 ? 63.132  25.517  306.128 1.00 147.42 ? 609 ARG D CG    1 
ATOM   9493  C  CD    . ARG D 2 230 ? 63.851  26.850  306.264 1.00 148.60 ? 609 ARG D CD    1 
ATOM   9494  N  NE    . ARG D 2 230 ? 63.471  27.779  305.203 1.00 155.41 ? 609 ARG D NE    1 
ATOM   9495  C  CZ    . ARG D 2 230 ? 63.875  29.043  305.136 1.00 155.98 ? 609 ARG D CZ    1 
ATOM   9496  N  NH1   . ARG D 2 230 ? 64.679  29.535  306.070 1.00 152.89 ? 609 ARG D NH1   1 
ATOM   9497  N  NH2   . ARG D 2 230 ? 63.478  29.814  304.134 1.00 157.41 ? 609 ARG D NH2   1 
ATOM   9498  N  N     . VAL D 2 231 ? 64.651  22.623  307.547 1.00 119.66 ? 610 VAL D N     1 
ATOM   9499  C  CA    . VAL D 2 231 ? 64.156  21.891  308.703 1.00 117.16 ? 610 VAL D CA    1 
ATOM   9500  C  C     . VAL D 2 231 ? 62.998  22.646  309.343 1.00 119.26 ? 610 VAL D C     1 
ATOM   9501  O  O     . VAL D 2 231 ? 63.197  23.679  309.979 1.00 118.08 ? 610 VAL D O     1 
ATOM   9502  C  CB    . VAL D 2 231 ? 65.263  21.680  309.752 1.00 102.89 ? 610 VAL D CB    1 
ATOM   9503  N  N     . SER D 2 232 ? 61.786  22.131  309.161 1.00 122.58 ? 611 SER D N     1 
ATOM   9504  C  CA    . SER D 2 232 ? 60.601  22.743  309.750 1.00 124.75 ? 611 SER D CA    1 
ATOM   9505  C  C     . SER D 2 232 ? 59.999  21.850  310.834 1.00 135.45 ? 611 SER D C     1 
ATOM   9506  O  O     . SER D 2 232 ? 59.910  20.633  310.671 1.00 145.64 ? 611 SER D O     1 
ATOM   9507  C  CB    . SER D 2 232 ? 59.558  23.050  308.671 1.00 112.36 ? 611 SER D CB    1 
ATOM   9508  N  N     . VAL D 2 233 ? 59.595  22.461  311.943 1.00 132.03 ? 612 VAL D N     1 
ATOM   9509  C  CA    . VAL D 2 233 ? 58.980  21.725  313.041 1.00 136.58 ? 612 VAL D CA    1 
ATOM   9510  C  C     . VAL D 2 233 ? 57.470  21.931  313.046 1.00 151.81 ? 612 VAL D C     1 
ATOM   9511  O  O     . VAL D 2 233 ? 56.988  23.064  313.013 1.00 153.95 ? 612 VAL D O     1 
ATOM   9512  C  CB    . VAL D 2 233 ? 59.557  22.149  314.407 1.00 126.50 ? 612 VAL D CB    1 
ATOM   9513  N  N     . ASP D 2 234 ? 56.729  20.829  313.077 1.00 157.69 ? 613 ASP D N     1 
ATOM   9514  C  CA    . ASP D 2 234 ? 55.274  20.885  313.137 1.00 161.54 ? 613 ASP D CA    1 
ATOM   9515  C  C     . ASP D 2 234 ? 54.813  20.851  314.588 1.00 163.70 ? 613 ASP D C     1 
ATOM   9516  O  O     . ASP D 2 234 ? 55.025  21.805  315.339 1.00 165.22 ? 613 ASP D O     1 
ATOM   9517  C  CB    . ASP D 2 234 ? 54.660  19.719  312.359 1.00 158.31 ? 613 ASP D CB    1 
ATOM   9518  N  N     . ASP D 2 235 ? 54.184  19.748  314.977 1.00 162.76 ? 614 ASP D N     1 
ATOM   9519  C  CA    . ASP D 2 235 ? 53.762  19.554  316.357 1.00 156.81 ? 614 ASP D CA    1 
ATOM   9520  C  C     . ASP D 2 235 ? 54.979  19.284  317.233 1.00 151.40 ? 614 ASP D C     1 
ATOM   9521  O  O     . ASP D 2 235 ? 55.611  18.233  317.121 1.00 149.27 ? 614 ASP D O     1 
ATOM   9522  C  CB    . ASP D 2 235 ? 52.773  18.391  316.457 1.00 154.15 ? 614 ASP D CB    1 
ATOM   9523  N  N     . ALA D 2 236 ? 55.302  20.239  318.101 1.00 149.20 ? 615 ALA D N     1 
ATOM   9524  C  CA    . ALA D 2 236 ? 56.465  20.131  318.979 1.00 138.20 ? 615 ALA D CA    1 
ATOM   9525  C  C     . ALA D 2 236 ? 56.347  18.947  319.934 1.00 143.23 ? 615 ALA D C     1 
ATOM   9526  O  O     . ALA D 2 236 ? 57.352  18.429  320.422 1.00 144.13 ? 615 ALA D O     1 
ATOM   9527  C  CB    . ALA D 2 236 ? 56.667  21.424  319.755 1.00 130.18 ? 615 ALA D CB    1 
ATOM   9528  N  N     . ALA D 2 237 ? 55.115  18.527  320.199 1.00 150.86 ? 616 ALA D N     1 
ATOM   9529  C  CA    . ALA D 2 237 ? 54.868  17.357  321.031 1.00 158.64 ? 616 ALA D CA    1 
ATOM   9530  C  C     . ALA D 2 237 ? 55.358  16.101  320.320 1.00 157.46 ? 616 ALA D C     1 
ATOM   9531  O  O     . ALA D 2 237 ? 55.970  15.226  320.935 1.00 153.65 ? 616 ALA D O     1 
ATOM   9532  C  CB    . ALA D 2 237 ? 53.391  17.242  321.355 1.00 165.48 ? 616 ALA D CB    1 
ATOM   9533  N  N     . GLU D 2 238 ? 55.082  16.024  319.021 1.00 154.90 ? 617 GLU D N     1 
ATOM   9534  C  CA    . GLU D 2 238 ? 55.522  14.905  318.197 1.00 148.80 ? 617 GLU D CA    1 
ATOM   9535  C  C     . GLU D 2 238 ? 57.042  14.891  318.092 1.00 147.34 ? 617 GLU D C     1 
ATOM   9536  O  O     . GLU D 2 238 ? 57.670  13.829  318.120 1.00 156.05 ? 617 GLU D O     1 
ATOM   9537  C  CB    . GLU D 2 238 ? 54.898  14.996  316.803 1.00 142.39 ? 617 GLU D CB    1 
ATOM   9538  N  N     . ALA D 2 239 ? 57.626  16.080  317.974 1.00 135.87 ? 618 ALA D N     1 
ATOM   9539  C  CA    . ALA D 2 239 ? 59.075  16.222  317.920 1.00 122.07 ? 618 ALA D CA    1 
ATOM   9540  C  C     . ALA D 2 239 ? 59.701  15.698  319.206 1.00 127.91 ? 618 ALA D C     1 
ATOM   9541  O  O     . ALA D 2 239 ? 60.538  14.799  319.174 1.00 132.60 ? 618 ALA D O     1 
ATOM   9542  C  CB    . ALA D 2 239 ? 59.462  17.675  317.693 1.00 109.64 ? 618 ALA D CB    1 
ATOM   9543  N  N     . ASP D 2 240 ? 59.275  16.259  320.335 1.00 127.38 ? 619 ASP D N     1 
ATOM   9544  C  CA    . ASP D 2 240 ? 59.766  15.841  321.645 1.00 127.42 ? 619 ASP D CA    1 
ATOM   9545  C  C     . ASP D 2 240 ? 59.596  14.337  321.849 1.00 121.88 ? 619 ASP D C     1 
ATOM   9546  O  O     . ASP D 2 240 ? 60.481  13.669  322.393 1.00 118.45 ? 619 ASP D O     1 
ATOM   9547  C  CB    . ASP D 2 240 ? 59.041  16.608  322.754 1.00 127.27 ? 619 ASP D CB    1 
ATOM   9548  N  N     . LYS D 2 241 ? 58.464  13.811  321.390 1.00 116.69 ? 620 LYS D N     1 
ATOM   9549  C  CA    . LYS D 2 241 ? 58.177  12.386  321.491 1.00 116.66 ? 620 LYS D CA    1 
ATOM   9550  C  C     . LYS D 2 241 ? 59.204  11.561  320.723 1.00 121.96 ? 620 LYS D C     1 
ATOM   9551  O  O     . LYS D 2 241 ? 59.814  10.641  321.273 1.00 117.52 ? 620 LYS D O     1 
ATOM   9552  C  CB    . LYS D 2 241 ? 56.769  12.092  320.968 1.00 112.41 ? 620 LYS D CB    1 
ATOM   9553  N  N     . ILE D 2 242 ? 59.394  11.905  319.451 1.00 126.31 ? 621 ILE D N     1 
ATOM   9554  C  CA    . ILE D 2 242 ? 60.317  11.180  318.580 1.00 123.36 ? 621 ILE D CA    1 
ATOM   9555  C  C     . ILE D 2 242 ? 61.761  11.262  319.074 1.00 117.22 ? 621 ILE D C     1 
ATOM   9556  O  O     . ILE D 2 242 ? 62.500  10.281  319.007 1.00 110.94 ? 621 ILE D O     1 
ATOM   9557  C  CB    . ILE D 2 242 ? 60.247  11.691  317.126 1.00 97.80  ? 621 ILE D CB    1 
ATOM   9558  N  N     . PHE D 2 243 ? 62.157  12.430  319.572 1.00 117.97 ? 622 PHE D N     1 
ATOM   9559  C  CA    . PHE D 2 243 ? 63.497  12.608  320.122 1.00 121.63 ? 622 PHE D CA    1 
ATOM   9560  C  C     . PHE D 2 243 ? 63.683  11.780  321.390 1.00 135.95 ? 622 PHE D C     1 
ATOM   9561  O  O     . PHE D 2 243 ? 64.743  11.193  321.608 1.00 136.95 ? 622 PHE D O     1 
ATOM   9562  C  CB    . PHE D 2 243 ? 63.782  14.086  320.406 1.00 113.37 ? 622 PHE D CB    1 
ATOM   9563  C  CG    . PHE D 2 243 ? 64.193  14.869  319.190 1.00 111.23 ? 622 PHE D CG    1 
ATOM   9564  C  CD1   . PHE D 2 243 ? 63.300  15.713  318.556 1.00 126.85 ? 622 PHE D CD1   1 
ATOM   9565  C  CD2   . PHE D 2 243 ? 65.475  14.758  318.679 1.00 114.29 ? 622 PHE D CD2   1 
ATOM   9566  C  CE1   . PHE D 2 243 ? 63.672  16.431  317.435 1.00 133.35 ? 622 PHE D CE1   1 
ATOM   9567  C  CE2   . PHE D 2 243 ? 65.855  15.476  317.556 1.00 125.02 ? 622 PHE D CE2   1 
ATOM   9568  C  CZ    . PHE D 2 243 ? 64.951  16.313  316.936 1.00 128.42 ? 622 PHE D CZ    1 
ATOM   9569  N  N     . ASP D 2 244 ? 62.642  11.729  322.216 1.00 138.93 ? 623 ASP D N     1 
ATOM   9570  C  CA    . ASP D 2 244 ? 62.689  10.953  323.448 1.00 136.02 ? 623 ASP D CA    1 
ATOM   9571  C  C     . ASP D 2 244 ? 62.657  9.455   323.161 1.00 143.55 ? 623 ASP D C     1 
ATOM   9572  O  O     . ASP D 2 244 ? 63.068  8.648   323.993 1.00 152.92 ? 623 ASP D O     1 
ATOM   9573  C  CB    . ASP D 2 244 ? 61.529  11.332  324.369 1.00 132.71 ? 623 ASP D CB    1 
ATOM   9574  N  N     . MET D 2 245 ? 62.167  9.089   321.980 1.00 138.45 ? 624 MET D N     1 
ATOM   9575  C  CA    . MET D 2 245 ? 62.058  7.684   321.601 1.00 130.64 ? 624 MET D CA    1 
ATOM   9576  C  C     . MET D 2 245 ? 63.332  7.157   320.949 1.00 125.78 ? 624 MET D C     1 
ATOM   9577  O  O     . MET D 2 245 ? 63.871  6.130   321.362 1.00 125.01 ? 624 MET D O     1 
ATOM   9578  C  CB    . MET D 2 245 ? 60.867  7.469   320.663 1.00 131.67 ? 624 MET D CB    1 
ATOM   9579  C  CG    . MET D 2 245 ? 60.724  6.041   320.149 1.00 134.06 ? 624 MET D CG    1 
ATOM   9580  S  SD    . MET D 2 245 ? 59.387  5.866   318.952 1.00 163.30 ? 624 MET D SD    1 
ATOM   9581  C  CE    . MET D 2 245 ? 57.990  6.396   319.939 1.00 115.06 ? 624 MET D CE    1 
ATOM   9582  N  N     . LEU D 2 246 ? 63.809  7.864   319.929 1.00 120.21 ? 625 LEU D N     1 
ATOM   9583  C  CA    . LEU D 2 246 ? 64.975  7.424   319.168 1.00 106.29 ? 625 LEU D CA    1 
ATOM   9584  C  C     . LEU D 2 246 ? 66.273  7.604   319.945 1.00 104.90 ? 625 LEU D C     1 
ATOM   9585  O  O     . LEU D 2 246 ? 67.085  6.685   320.042 1.00 105.52 ? 625 LEU D O     1 
ATOM   9586  C  CB    . LEU D 2 246 ? 65.066  8.186   317.845 1.00 106.01 ? 625 LEU D CB    1 
ATOM   9587  C  CG    . LEU D 2 246 ? 63.829  8.172   316.945 1.00 113.89 ? 625 LEU D CG    1 
ATOM   9588  C  CD1   . LEU D 2 246 ? 64.073  9.009   315.700 1.00 111.71 ? 625 LEU D CD1   1 
ATOM   9589  C  CD2   . LEU D 2 246 ? 63.442  6.750   316.578 1.00 119.72 ? 625 LEU D CD2   1 
ATOM   9590  N  N     . MET D 2 247 ? 66.462  8.796   320.499 1.00 105.22 ? 626 MET D N     1 
ATOM   9591  C  CA    . MET D 2 247 ? 67.727  9.152   321.130 1.00 98.32  ? 626 MET D CA    1 
ATOM   9592  C  C     . MET D 2 247 ? 67.604  9.197   322.649 1.00 107.26 ? 626 MET D C     1 
ATOM   9593  O  O     . MET D 2 247 ? 68.482  9.720   323.337 1.00 107.84 ? 626 MET D O     1 
ATOM   9594  C  CB    . MET D 2 247 ? 68.198  10.506  320.603 1.00 94.17  ? 626 MET D CB    1 
ATOM   9595  C  CG    . MET D 2 247 ? 67.850  10.741  319.143 1.00 86.91  ? 626 MET D CG    1 
ATOM   9596  S  SD    . MET D 2 247 ? 68.933  9.871   317.996 1.00 112.09 ? 626 MET D SD    1 
ATOM   9597  C  CE    . MET D 2 247 ? 70.490  10.691  318.317 1.00 87.09  ? 626 MET D CE    1 
ATOM   9598  N  N     . GLY D 2 248 ? 66.514  8.637   323.166 1.00 115.03 ? 627 GLY D N     1 
ATOM   9599  C  CA    . GLY D 2 248 ? 66.241  8.660   324.591 1.00 115.28 ? 627 GLY D CA    1 
ATOM   9600  C  C     . GLY D 2 248 ? 67.052  7.658   325.389 1.00 113.42 ? 627 GLY D C     1 
ATOM   9601  O  O     . GLY D 2 248 ? 67.830  6.884   324.831 1.00 108.71 ? 627 GLY D O     1 
ATOM   9602  N  N     . ASP D 2 249 ? 66.868  7.680   326.706 1.00 120.00 ? 628 ASP D N     1 
ATOM   9603  C  CA    . ASP D 2 249 ? 67.567  6.763   327.600 1.00 115.62 ? 628 ASP D CA    1 
ATOM   9604  C  C     . ASP D 2 249 ? 66.986  5.358   327.497 1.00 115.91 ? 628 ASP D C     1 
ATOM   9605  O  O     . ASP D 2 249 ? 67.712  4.367   327.586 1.00 109.09 ? 628 ASP D O     1 
ATOM   9606  C  CB    . ASP D 2 249 ? 67.483  7.258   329.046 1.00 107.94 ? 628 ASP D CB    1 
ATOM   9607  N  N     . ARG D 2 250 ? 65.672  5.280   327.305 1.00 121.31 ? 629 ARG D N     1 
ATOM   9608  C  CA    . ARG D 2 250 ? 64.986  3.998   327.194 1.00 124.08 ? 629 ARG D CA    1 
ATOM   9609  C  C     . ARG D 2 250 ? 65.370  3.273   325.907 1.00 128.19 ? 629 ARG D C     1 
ATOM   9610  O  O     . ARG D 2 250 ? 65.400  3.872   324.833 1.00 134.30 ? 629 ARG D O     1 
ATOM   9611  C  CB    . ARG D 2 250 ? 63.471  4.201   327.254 1.00 116.86 ? 629 ARG D CB    1 
ATOM   9612  C  CG    . ARG D 2 250 ? 62.990  4.937   328.497 1.00 108.73 ? 629 ARG D CG    1 
ATOM   9613  C  CD    . ARG D 2 250 ? 61.489  5.183   328.448 1.00 94.79  ? 629 ARG D CD    1 
ATOM   9614  N  N     . VAL D 2 251 ? 65.660  1.982   326.025 1.00 122.47 ? 630 VAL D N     1 
ATOM   9615  C  CA    . VAL D 2 251 ? 66.061  1.172   324.879 1.00 118.48 ? 630 VAL D CA    1 
ATOM   9616  C  C     . VAL D 2 251 ? 64.881  0.439   324.236 1.00 131.46 ? 630 VAL D C     1 
ATOM   9617  O  O     . VAL D 2 251 ? 64.769  0.384   323.011 1.00 137.91 ? 630 VAL D O     1 
ATOM   9618  C  CB    . VAL D 2 251 ? 67.176  0.170   325.266 1.00 110.97 ? 630 VAL D CB    1 
ATOM   9619  C  CG1   . VAL D 2 251 ? 67.178  -1.039  324.340 1.00 109.27 ? 630 VAL D CG1   1 
ATOM   9620  C  CG2   . VAL D 2 251 ? 68.530  0.862   325.263 1.00 114.22 ? 630 VAL D CG2   1 
ATOM   9621  N  N     . GLU D 2 252 ? 64.000  -0.110  325.068 1.00 133.62 ? 631 GLU D N     1 
ATOM   9622  C  CA    . GLU D 2 252 ? 62.847  -0.884  324.594 1.00 135.42 ? 631 GLU D CA    1 
ATOM   9623  C  C     . GLU D 2 252 ? 61.972  -0.216  323.515 1.00 134.47 ? 631 GLU D C     1 
ATOM   9624  O  O     . GLU D 2 252 ? 61.647  -0.858  322.510 1.00 138.04 ? 631 GLU D O     1 
ATOM   9625  C  CB    . GLU D 2 252 ? 61.987  -1.362  325.772 1.00 143.18 ? 631 GLU D CB    1 
ATOM   9626  C  CG    . GLU D 2 252 ? 61.921  -2.873  325.916 1.00 147.61 ? 631 GLU D CG    1 
ATOM   9627  C  CD    . GLU D 2 252 ? 61.254  -3.544  324.730 1.00 148.23 ? 631 GLU D CD    1 
ATOM   9628  O  OE1   . GLU D 2 252 ? 60.198  -3.049  324.282 1.00 144.71 ? 631 GLU D OE1   1 
ATOM   9629  O  OE2   . GLU D 2 252 ? 61.788  -4.562  324.242 1.00 151.83 ? 631 GLU D OE2   1 
ATOM   9630  N  N     . PRO D 2 253 ? 61.581  1.063   323.710 1.00 134.47 ? 632 PRO D N     1 
ATOM   9631  C  CA    . PRO D 2 253 ? 60.771  1.695   322.659 1.00 134.79 ? 632 PRO D CA    1 
ATOM   9632  C  C     . PRO D 2 253 ? 61.527  1.805   321.339 1.00 128.26 ? 632 PRO D C     1 
ATOM   9633  O  O     . PRO D 2 253 ? 60.911  1.811   320.273 1.00 127.96 ? 632 PRO D O     1 
ATOM   9634  C  CB    . PRO D 2 253 ? 60.503  3.096   323.217 1.00 138.23 ? 632 PRO D CB    1 
ATOM   9635  C  CG    . PRO D 2 253 ? 60.660  2.960   324.686 1.00 141.79 ? 632 PRO D CG    1 
ATOM   9636  C  CD    . PRO D 2 253 ? 61.751  1.956   324.871 1.00 136.27 ? 632 PRO D CD    1 
ATOM   9637  N  N     . ARG D 2 254 ? 62.850  1.892   321.419 1.00 124.63 ? 633 ARG D N     1 
ATOM   9638  C  CA    . ARG D 2 254 ? 63.687  1.974   320.232 1.00 123.11 ? 633 ARG D CA    1 
ATOM   9639  C  C     . ARG D 2 254 ? 63.688  0.634   319.501 1.00 132.82 ? 633 ARG D C     1 
ATOM   9640  O  O     . ARG D 2 254 ? 63.661  0.583   318.269 1.00 138.51 ? 633 ARG D O     1 
ATOM   9641  C  CB    . ARG D 2 254 ? 65.110  2.379   320.619 1.00 108.39 ? 633 ARG D CB    1 
ATOM   9642  C  CG    . ARG D 2 254 ? 65.946  2.911   319.476 1.00 100.54 ? 633 ARG D CG    1 
ATOM   9643  C  CD    . ARG D 2 254 ? 67.283  3.439   319.976 1.00 95.75  ? 633 ARG D CD    1 
ATOM   9644  N  NE    . ARG D 2 254 ? 67.123  4.483   320.984 1.00 103.32 ? 633 ARG D NE    1 
ATOM   9645  C  CZ    . ARG D 2 254 ? 67.497  4.360   322.254 1.00 110.95 ? 633 ARG D CZ    1 
ATOM   9646  N  NH1   . ARG D 2 254 ? 68.058  3.235   322.679 1.00 109.00 ? 633 ARG D NH1   1 
ATOM   9647  N  NH2   . ARG D 2 254 ? 67.317  5.363   323.103 1.00 112.98 ? 633 ARG D NH2   1 
ATOM   9648  N  N     . ARG D 2 255 ? 63.715  -0.448  320.275 1.00 131.34 ? 634 ARG D N     1 
ATOM   9649  C  CA    . ARG D 2 255 ? 63.672  -1.800  319.730 1.00 124.46 ? 634 ARG D CA    1 
ATOM   9650  C  C     . ARG D 2 255 ? 62.325  -2.067  319.074 1.00 121.92 ? 634 ARG D C     1 
ATOM   9651  O  O     . ARG D 2 255 ? 62.253  -2.675  318.006 1.00 127.68 ? 634 ARG D O     1 
ATOM   9652  C  CB    . ARG D 2 255 ? 63.929  -2.832  320.829 1.00 89.44  ? 634 ARG D CB    1 
ATOM   9653  N  N     . GLU D 2 256 ? 61.258  -1.609  319.722 1.00 118.44 ? 635 GLU D N     1 
ATOM   9654  C  CA    . GLU D 2 256 ? 59.919  -1.744  319.161 1.00 125.58 ? 635 GLU D CA    1 
ATOM   9655  C  C     . GLU D 2 256 ? 59.772  -0.939  317.872 1.00 129.21 ? 635 GLU D C     1 
ATOM   9656  O  O     . GLU D 2 256 ? 59.206  -1.420  316.887 1.00 136.62 ? 635 GLU D O     1 
ATOM   9657  C  CB    . GLU D 2 256 ? 58.858  -1.306  320.172 1.00 131.81 ? 635 GLU D CB    1 
ATOM   9658  C  CG    . GLU D 2 256 ? 58.787  -2.166  321.421 1.00 139.52 ? 635 GLU D CG    1 
ATOM   9659  C  CD    . GLU D 2 256 ? 57.590  -1.823  322.286 1.00 149.77 ? 635 GLU D CD    1 
ATOM   9660  O  OE1   . GLU D 2 256 ? 56.624  -1.234  321.756 1.00 153.78 ? 635 GLU D OE1   1 
ATOM   9661  O  OE2   . GLU D 2 256 ? 57.615  -2.139  323.495 1.00 152.67 ? 635 GLU D OE2   1 
ATOM   9662  N  N     . PHE D 2 257 ? 60.286  0.287   317.886 1.00 119.85 ? 636 PHE D N     1 
ATOM   9663  C  CA    . PHE D 2 257 ? 60.242  1.153   316.712 1.00 115.94 ? 636 PHE D CA    1 
ATOM   9664  C  C     . PHE D 2 257 ? 61.001  0.520   315.553 1.00 122.43 ? 636 PHE D C     1 
ATOM   9665  O  O     . PHE D 2 257 ? 60.548  0.555   314.407 1.00 132.00 ? 636 PHE D O     1 
ATOM   9666  C  CB    . PHE D 2 257 ? 60.830  2.527   317.037 1.00 116.50 ? 636 PHE D CB    1 
ATOM   9667  C  CG    . PHE D 2 257 ? 60.940  3.439   315.847 1.00 114.00 ? 636 PHE D CG    1 
ATOM   9668  C  CD1   . PHE D 2 257 ? 59.838  4.143   315.392 1.00 105.50 ? 636 PHE D CD1   1 
ATOM   9669  C  CD2   . PHE D 2 257 ? 62.151  3.602   315.192 1.00 113.02 ? 636 PHE D CD2   1 
ATOM   9670  C  CE1   . PHE D 2 257 ? 59.940  4.986   314.298 1.00 104.83 ? 636 PHE D CE1   1 
ATOM   9671  C  CE2   . PHE D 2 257 ? 62.259  4.442   314.099 1.00 105.59 ? 636 PHE D CE2   1 
ATOM   9672  C  CZ    . PHE D 2 257 ? 61.150  5.136   313.652 1.00 107.56 ? 636 PHE D CZ    1 
ATOM   9673  N  N     . ILE D 2 258 ? 62.160  -0.052  315.866 1.00 118.29 ? 637 ILE D N     1 
ATOM   9674  C  CA    . ILE D 2 258 ? 62.967  -0.754  314.877 1.00 114.85 ? 637 ILE D CA    1 
ATOM   9675  C  C     . ILE D 2 258 ? 62.208  -1.948  314.317 1.00 125.53 ? 637 ILE D C     1 
ATOM   9676  O  O     . ILE D 2 258 ? 62.240  -2.210  313.119 1.00 138.44 ? 637 ILE D O     1 
ATOM   9677  C  CB    . ILE D 2 258 ? 64.292  -1.251  315.482 1.00 97.19  ? 637 ILE D CB    1 
ATOM   9678  N  N     . GLU D 2 259 ? 61.521  -2.670  315.195 1.00 119.72 ? 638 GLU D N     1 
ATOM   9679  C  CA    . GLU D 2 259 ? 60.784  -3.860  314.790 1.00 112.02 ? 638 GLU D CA    1 
ATOM   9680  C  C     . GLU D 2 259 ? 59.581  -3.514  313.920 1.00 116.65 ? 638 GLU D C     1 
ATOM   9681  O  O     . GLU D 2 259 ? 59.167  -4.309  313.075 1.00 119.22 ? 638 GLU D O     1 
ATOM   9682  C  CB    . GLU D 2 259 ? 60.328  -4.655  316.017 1.00 102.48 ? 638 GLU D CB    1 
ATOM   9683  N  N     . GLU D 2 260 ? 59.026  -2.323  314.127 1.00 123.46 ? 639 GLU D N     1 
ATOM   9684  C  CA    . GLU D 2 260 ? 57.803  -1.922  313.437 1.00 135.28 ? 639 GLU D CA    1 
ATOM   9685  C  C     . GLU D 2 260 ? 58.048  -1.204  312.110 1.00 145.55 ? 639 GLU D C     1 
ATOM   9686  O  O     . GLU D 2 260 ? 57.442  -1.543  311.093 1.00 151.48 ? 639 GLU D O     1 
ATOM   9687  C  CB    . GLU D 2 260 ? 56.940  -1.046  314.349 1.00 138.36 ? 639 GLU D CB    1 
ATOM   9688  N  N     . ASN D 2 261 ? 58.933  -0.213  312.121 1.00 146.32 ? 640 ASN D N     1 
ATOM   9689  C  CA    . ASN D 2 261 ? 59.124  0.648   310.956 1.00 145.73 ? 640 ASN D CA    1 
ATOM   9690  C  C     . ASN D 2 261 ? 60.280  0.246   310.038 1.00 145.02 ? 640 ASN D C     1 
ATOM   9691  O  O     . ASN D 2 261 ? 60.849  1.088   309.342 1.00 145.53 ? 640 ASN D O     1 
ATOM   9692  C  CB    . ASN D 2 261 ? 59.288  2.105   311.398 1.00 137.77 ? 640 ASN D CB    1 
ATOM   9693  N  N     . ALA D 2 262 ? 60.618  -1.038  310.020 1.00 142.27 ? 641 ALA D N     1 
ATOM   9694  C  CA    . ALA D 2 262 ? 61.731  -1.499  309.200 1.00 138.65 ? 641 ALA D CA    1 
ATOM   9695  C  C     . ALA D 2 262 ? 61.355  -2.675  308.309 1.00 148.99 ? 641 ALA D C     1 
ATOM   9696  O  O     . ALA D 2 262 ? 60.759  -3.651  308.764 1.00 159.06 ? 641 ALA D O     1 
ATOM   9697  C  CB    . ALA D 2 262 ? 62.917  -1.857  310.073 1.00 127.97 ? 641 ALA D CB    1 
ATOM   9698  N  N     . VAL D 2 263 ? 61.716  -2.571  307.035 1.00 147.27 ? 642 VAL D N     1 
ATOM   9699  C  CA    . VAL D 2 263 ? 61.503  -3.650  306.081 1.00 141.46 ? 642 VAL D CA    1 
ATOM   9700  C  C     . VAL D 2 263 ? 62.837  -4.303  305.730 1.00 143.99 ? 642 VAL D C     1 
ATOM   9701  O  O     . VAL D 2 263 ? 63.669  -3.707  305.046 1.00 142.24 ? 642 VAL D O     1 
ATOM   9702  C  CB    . VAL D 2 263 ? 60.833  -3.138  304.795 1.00 129.23 ? 642 VAL D CB    1 
ATOM   9703  N  N     . TYR D 2 264 ? 63.035  -5.527  306.209 1.00 147.56 ? 643 TYR D N     1 
ATOM   9704  C  CA    . TYR D 2 264 ? 64.284  -6.248  305.988 1.00 149.33 ? 643 TYR D CA    1 
ATOM   9705  C  C     . TYR D 2 264 ? 64.261  -7.024  304.675 1.00 154.24 ? 643 TYR D C     1 
ATOM   9706  O  O     . TYR D 2 264 ? 65.003  -6.712  303.744 1.00 156.03 ? 643 TYR D O     1 
ATOM   9707  C  CB    . TYR D 2 264 ? 64.566  -7.199  307.153 1.00 143.88 ? 643 TYR D CB    1 
ATOM   9708  C  CG    . TYR D 2 264 ? 64.866  -6.501  308.462 1.00 132.62 ? 643 TYR D CG    1 
ATOM   9709  C  CD1   . TYR D 2 264 ? 66.161  -6.120  308.785 1.00 124.34 ? 643 TYR D CD1   1 
ATOM   9710  C  CD2   . TYR D 2 264 ? 63.856  -6.229  309.376 1.00 131.30 ? 643 TYR D CD2   1 
ATOM   9711  C  CE1   . TYR D 2 264 ? 66.445  -5.485  309.978 1.00 118.70 ? 643 TYR D CE1   1 
ATOM   9712  C  CE2   . TYR D 2 264 ? 64.130  -5.592  310.576 1.00 129.62 ? 643 TYR D CE2   1 
ATOM   9713  C  CZ    . TYR D 2 264 ? 65.428  -5.223  310.870 1.00 120.45 ? 643 TYR D CZ    1 
ATOM   9714  O  OH    . TYR D 2 264 ? 65.713  -4.589  312.058 1.00 110.57 ? 643 TYR D OH    1 
ATOM   9715  N  N     . SER D 2 265 ? 63.402  -8.035  304.607 1.00 152.16 ? 644 SER D N     1 
ATOM   9716  C  CA    . SER D 2 265 ? 63.297  -8.868  303.417 1.00 152.49 ? 644 SER D CA    1 
ATOM   9717  C  C     . SER D 2 265 ? 61.846  -9.004  302.959 1.00 161.79 ? 644 SER D C     1 
ATOM   9718  O  O     . SER D 2 265 ? 61.130  -8.011  302.827 1.00 160.94 ? 644 SER D O     1 
ATOM   9719  C  CB    . SER D 2 265 ? 63.902  -10.249 303.678 1.00 142.30 ? 644 SER D CB    1 
ATOM   9720  P  P     . DA  E 3 7   ? 73.454  13.163  336.683 1.00 209.79 ? 7   DA  E P     1 
ATOM   9721  O  OP1   . DA  E 3 7   ? 74.461  14.187  336.326 1.00 205.33 ? 7   DA  E OP1   1 
ATOM   9722  O  OP2   . DA  E 3 7   ? 72.373  12.833  335.728 1.00 207.12 ? 7   DA  E OP2   1 
ATOM   9723  O  "O5'" . DA  E 3 7   ? 74.204  11.803  337.061 1.00 189.21 ? 7   DA  E "O5'" 1 
ATOM   9724  C  "C5'" . DA  E 3 7   ? 74.972  11.144  336.066 1.00 190.44 ? 7   DA  E "C5'" 1 
ATOM   9725  C  "C4'" . DA  E 3 7   ? 76.457  11.242  336.363 1.00 197.16 ? 7   DA  E "C4'" 1 
ATOM   9726  O  "O4'" . DA  E 3 7   ? 76.852  10.147  337.225 1.00 203.80 ? 7   DA  E "O4'" 1 
ATOM   9727  C  "C3'" . DA  E 3 7   ? 77.354  11.122  335.140 1.00 200.15 ? 7   DA  E "C3'" 1 
ATOM   9728  O  "O3'" . DA  E 3 7   ? 78.563  11.847  335.342 1.00 207.09 ? 7   DA  E "O3'" 1 
ATOM   9729  C  "C2'" . DA  E 3 7   ? 77.598  9.620   335.031 1.00 197.28 ? 7   DA  E "C2'" 1 
ATOM   9730  C  "C1'" . DA  E 3 7   ? 77.431  9.107   336.460 1.00 203.16 ? 7   DA  E "C1'" 1 
ATOM   9731  N  N9    . DA  E 3 7   ? 76.563  7.934   336.535 1.00 206.94 ? 7   DA  E N9    1 
ATOM   9732  C  C8    . DA  E 3 7   ? 75.332  7.791   335.958 1.00 204.93 ? 7   DA  E C8    1 
ATOM   9733  N  N7    . DA  E 3 7   ? 74.767  6.630   336.184 1.00 205.83 ? 7   DA  E N7    1 
ATOM   9734  C  C5    . DA  E 3 7   ? 75.693  5.961   336.966 1.00 209.70 ? 7   DA  E C5    1 
ATOM   9735  C  C6    . DA  E 3 7   ? 75.693  4.674   337.542 1.00 210.30 ? 7   DA  E C6    1 
ATOM   9736  N  N6    . DA  E 3 7   ? 74.679  3.816   337.400 1.00 208.87 ? 7   DA  E N6    1 
ATOM   9737  N  N1    . DA  E 3 7   ? 76.772  4.307   338.268 1.00 213.25 ? 7   DA  E N1    1 
ATOM   9738  C  C2    . DA  E 3 7   ? 77.777  5.181   338.402 1.00 216.04 ? 7   DA  E C2    1 
ATOM   9739  N  N3    . DA  E 3 7   ? 77.893  6.414   337.908 1.00 214.16 ? 7   DA  E N3    1 
ATOM   9740  C  C4    . DA  E 3 7   ? 76.807  6.748   337.193 1.00 210.97 ? 7   DA  E C4    1 
ATOM   9741  P  P     . DC  E 3 8   ? 79.718  11.821  334.224 1.00 270.84 ? 8   DC  E P     1 
ATOM   9742  O  OP1   . DC  E 3 8   ? 80.501  13.067  334.365 1.00 273.92 ? 8   DC  E OP1   1 
ATOM   9743  O  OP2   . DC  E 3 8   ? 79.092  11.490  332.924 1.00 260.38 ? 8   DC  E OP2   1 
ATOM   9744  O  "O5'" . DC  E 3 8   ? 80.636  10.587  334.658 1.00 225.54 ? 8   DC  E "O5'" 1 
ATOM   9745  C  "C5'" . DC  E 3 8   ? 81.446  9.901   333.713 1.00 213.53 ? 8   DC  E "C5'" 1 
ATOM   9746  C  "C4'" . DC  E 3 8   ? 82.160  8.753   334.401 1.00 206.89 ? 8   DC  E "C4'" 1 
ATOM   9747  O  "O4'" . DC  E 3 8   ? 81.281  8.207   335.418 1.00 208.44 ? 8   DC  E "O4'" 1 
ATOM   9748  C  "C3'" . DC  E 3 8   ? 82.508  7.561   333.517 1.00 195.43 ? 8   DC  E "C3'" 1 
ATOM   9749  O  "O3'" . DC  E 3 8   ? 83.701  7.809   332.735 1.00 191.92 ? 8   DC  E "O3'" 1 
ATOM   9750  C  "C2'" . DC  E 3 8   ? 82.590  6.440   334.554 1.00 196.00 ? 8   DC  E "C2'" 1 
ATOM   9751  C  "C1'" . DC  E 3 8   ? 81.463  6.807   335.514 1.00 200.90 ? 8   DC  E "C1'" 1 
ATOM   9752  N  N1    . DC  E 3 8   ? 80.179  6.114   335.197 1.00 191.08 ? 8   DC  E N1    1 
ATOM   9753  C  C2    . DC  E 3 8   ? 79.915  4.868   335.774 1.00 189.18 ? 8   DC  E C2    1 
ATOM   9754  O  O2    . DC  E 3 8   ? 80.752  4.372   336.539 1.00 191.42 ? 8   DC  E O2    1 
ATOM   9755  N  N3    . DC  E 3 8   ? 78.747  4.244   335.479 1.00 182.15 ? 8   DC  E N3    1 
ATOM   9756  C  C4    . DC  E 3 8   ? 77.872  4.817   334.649 1.00 168.38 ? 8   DC  E C4    1 
ATOM   9757  N  N4    . DC  E 3 8   ? 76.734  4.168   334.385 1.00 158.75 ? 8   DC  E N4    1 
ATOM   9758  C  C5    . DC  E 3 8   ? 78.124  6.085   334.050 1.00 168.58 ? 8   DC  E C5    1 
ATOM   9759  C  C6    . DC  E 3 8   ? 79.277  6.688   334.349 1.00 179.21 ? 8   DC  E C6    1 
ATOM   9760  P  P     . DG  E 3 9   ? 85.166  7.385   333.255 1.00 235.48 ? 9   DG  E P     1 
ATOM   9761  O  OP1   . DG  E 3 9   ? 85.324  7.803   334.665 1.00 243.69 ? 9   DG  E OP1   1 
ATOM   9762  O  OP2   . DG  E 3 9   ? 86.126  7.887   332.247 1.00 230.94 ? 9   DG  E OP2   1 
ATOM   9763  O  "O5'" . DG  E 3 9   ? 85.172  5.784   333.189 1.00 203.54 ? 9   DG  E "O5'" 1 
ATOM   9764  C  "C5'" . DG  E 3 9   ? 85.889  5.042   334.173 1.00 205.29 ? 9   DG  E "C5'" 1 
ATOM   9765  C  "C4'" . DG  E 3 9   ? 85.487  3.576   334.171 1.00 198.40 ? 9   DG  E "C4'" 1 
ATOM   9766  O  "O4'" . DG  E 3 9   ? 84.042  3.447   334.198 1.00 192.23 ? 9   DG  E "O4'" 1 
ATOM   9767  C  "C3'" . DG  E 3 9   ? 85.962  2.778   332.959 1.00 189.26 ? 9   DG  E "C3'" 1 
ATOM   9768  O  "O3'" . DG  E 3 9   ? 86.734  1.671   333.411 1.00 197.13 ? 9   DG  E "O3'" 1 
ATOM   9769  C  "C2'" . DG  E 3 9   ? 84.678  2.329   332.262 1.00 176.24 ? 9   DG  E "C2'" 1 
ATOM   9770  C  "C1'" . DG  E 3 9   ? 83.673  2.338   333.406 1.00 177.37 ? 9   DG  E "C1'" 1 
ATOM   9771  N  N9    . DG  E 3 9   ? 82.288  2.514   332.976 1.00 165.11 ? 9   DG  E N9    1 
ATOM   9772  C  C8    . DG  E 3 9   ? 81.716  3.678   332.525 1.00 134.14 ? 9   DG  E C8    1 
ATOM   9773  N  N7    . DG  E 3 9   ? 80.460  3.553   332.206 1.00 132.31 ? 9   DG  E N7    1 
ATOM   9774  C  C5    . DG  E 3 9   ? 80.177  2.218   332.462 1.00 150.06 ? 9   DG  E C5    1 
ATOM   9775  C  C6    . DG  E 3 9   ? 78.967  1.505   332.304 1.00 142.17 ? 9   DG  E C6    1 
ATOM   9776  O  O6    . DG  E 3 9   ? 77.883  1.937   331.894 1.00 135.65 ? 9   DG  E O6    1 
ATOM   9777  N  N1    . DG  E 3 9   ? 79.096  0.167   332.676 1.00 134.55 ? 9   DG  E N1    1 
ATOM   9778  C  C2    . DG  E 3 9   ? 80.260  -0.401  333.142 1.00 139.77 ? 9   DG  E C2    1 
ATOM   9779  N  N2    . DG  E 3 9   ? 80.199  -1.705  333.452 1.00 139.41 ? 9   DG  E N2    1 
ATOM   9780  N  N3    . DG  E 3 9   ? 81.403  0.259   333.295 1.00 137.81 ? 9   DG  E N3    1 
ATOM   9781  C  C4    . DG  E 3 9   ? 81.291  1.562   332.937 1.00 158.84 ? 9   DG  E C4    1 
ATOM   9782  P  P     . DT  E 3 10  ? 87.938  1.101   332.512 1.00 190.71 ? 10  DT  E P     1 
ATOM   9783  O  OP1   . DT  E 3 10  ? 88.995  0.616   333.428 1.00 192.31 ? 10  DT  E OP1   1 
ATOM   9784  O  OP2   . DT  E 3 10  ? 88.255  2.119   331.486 1.00 181.83 ? 10  DT  E OP2   1 
ATOM   9785  O  "O5'" . DT  E 3 10  ? 87.293  -0.150  331.755 1.00 191.41 ? 10  DT  E "O5'" 1 
ATOM   9786  C  "C5'" . DT  E 3 10  ? 86.578  -1.151  332.471 1.00 183.58 ? 10  DT  E "C5'" 1 
ATOM   9787  C  "C4'" . DT  E 3 10  ? 85.902  -2.089  331.488 1.00 163.24 ? 10  DT  E "C4'" 1 
ATOM   9788  O  "O4'" . DT  E 3 10  ? 84.492  -1.769  331.374 1.00 151.35 ? 10  DT  E "O4'" 1 
ATOM   9789  C  "C3'" . DT  E 3 10  ? 86.470  -2.011  330.074 1.00 145.73 ? 10  DT  E "C3'" 1 
ATOM   9790  O  "O3'" . DT  E 3 10  ? 86.598  -3.314  329.516 1.00 146.33 ? 10  DT  E "O3'" 1 
ATOM   9791  C  "C2'" . DT  E 3 10  ? 85.424  -1.194  329.328 1.00 128.53 ? 10  DT  E "C2'" 1 
ATOM   9792  C  "C1'" . DT  E 3 10  ? 84.161  -1.702  330.004 1.00 130.18 ? 10  DT  E "C1'" 1 
ATOM   9793  N  N1    . DT  E 3 10  ? 82.993  -0.805  329.821 1.00 125.16 ? 10  DT  E N1    1 
ATOM   9794  C  C2    . DT  E 3 10  ? 81.732  -1.338  329.931 1.00 128.07 ? 10  DT  E C2    1 
ATOM   9795  O  O2    . DT  E 3 10  ? 81.518  -2.511  330.176 1.00 122.46 ? 10  DT  E O2    1 
ATOM   9796  N  N3    . DT  E 3 10  ? 80.723  -0.435  329.743 1.00 128.69 ? 10  DT  E N3    1 
ATOM   9797  C  C4    . DT  E 3 10  ? 80.838  0.912   329.461 1.00 128.06 ? 10  DT  E C4    1 
ATOM   9798  O  O4    . DT  E 3 10  ? 79.857  1.634   329.311 1.00 116.07 ? 10  DT  E O4    1 
ATOM   9799  C  C5    . DT  E 3 10  ? 82.189  1.403   329.358 1.00 126.68 ? 10  DT  E C5    1 
ATOM   9800  C  C7    . DT  E 3 10  ? 82.443  2.850   329.056 1.00 124.20 ? 10  DT  E C7    1 
ATOM   9801  C  C6    . DT  E 3 10  ? 83.190  0.532   329.540 1.00 124.96 ? 10  DT  E C6    1 
ATOM   9802  P  P     . DT  E 3 11  ? 87.651  -3.579  328.332 1.00 142.60 ? 11  DT  E P     1 
ATOM   9803  O  OP1   . DT  E 3 11  ? 88.704  -4.472  328.859 1.00 129.02 ? 11  DT  E OP1   1 
ATOM   9804  O  OP2   . DT  E 3 11  ? 88.019  -2.271  327.750 1.00 133.70 ? 11  DT  E OP2   1 
ATOM   9805  O  "O5'" . DT  E 3 11  ? 86.806  -4.370  327.229 1.00 123.81 ? 11  DT  E "O5'" 1 
ATOM   9806  C  "C5'" . DT  E 3 11  ? 86.127  -5.570  327.564 1.00 126.46 ? 11  DT  E "C5'" 1 
ATOM   9807  C  "C4'" . DT  E 3 11  ? 84.998  -5.808  326.583 1.00 123.35 ? 11  DT  E "C4'" 1 
ATOM   9808  O  "O4'" . DT  E 3 11  ? 83.892  -4.945  326.928 1.00 113.35 ? 11  DT  E "O4'" 1 
ATOM   9809  C  "C3'" . DT  E 3 11  ? 85.358  -5.491  325.136 1.00 123.81 ? 11  DT  E "C3'" 1 
ATOM   9810  O  "O3'" . DT  E 3 11  ? 85.633  -6.700  324.434 1.00 125.48 ? 11  DT  E "O3'" 1 
ATOM   9811  C  "C2'" . DT  E 3 11  ? 84.142  -4.758  324.571 1.00 104.69 ? 11  DT  E "C2'" 1 
ATOM   9812  C  "C1'" . DT  E 3 11  ? 83.201  -4.563  325.759 1.00 107.38 ? 11  DT  E "C1'" 1 
ATOM   9813  N  N1    . DT  E 3 11  ? 82.733  -3.159  325.937 1.00 105.35 ? 11  DT  E N1    1 
ATOM   9814  C  C2    . DT  E 3 11  ? 81.401  -2.932  326.194 1.00 105.11 ? 11  DT  E C2    1 
ATOM   9815  O  O2    . DT  E 3 11  ? 80.575  -3.822  326.286 1.00 125.10 ? 11  DT  E O2    1 
ATOM   9816  N  N3    . DT  E 3 11  ? 81.064  -1.613  326.343 1.00 104.10 ? 11  DT  E N3    1 
ATOM   9817  C  C4    . DT  E 3 11  ? 81.899  -0.520  326.263 1.00 103.24 ? 11  DT  E C4    1 
ATOM   9818  O  O4    . DT  E 3 11  ? 81.479  0.624   326.414 1.00 117.11 ? 11  DT  E O4    1 
ATOM   9819  C  C5    . DT  E 3 11  ? 83.281  -0.826  325.991 1.00 103.37 ? 11  DT  E C5    1 
ATOM   9820  C  C7    . DT  E 3 11  ? 84.285  0.282   325.882 1.00 110.37 ? 11  DT  E C7    1 
ATOM   9821  C  C6    . DT  E 3 11  ? 83.630  -2.113  325.844 1.00 125.19 ? 11  DT  E C6    1 
ATOM   9822  P  P     . DG  E 3 12  ? 86.725  -6.717  323.256 1.00 113.92 ? 12  DG  E P     1 
ATOM   9823  O  OP1   . DG  E 3 12  ? 87.255  -8.094  323.149 1.00 114.35 ? 12  DG  E OP1   1 
ATOM   9824  O  OP2   . DG  E 3 12  ? 87.654  -5.591  323.490 1.00 116.57 ? 12  DG  E OP2   1 
ATOM   9825  O  "O5'" . DG  E 3 12  ? 85.875  -6.360  321.945 1.00 103.38 ? 12  DG  E "O5'" 1 
ATOM   9826  C  "C5'" . DG  E 3 12  ? 84.923  -7.291  321.439 1.00 106.34 ? 12  DG  E "C5'" 1 
ATOM   9827  C  "C4'" . DG  E 3 12  ? 84.055  -6.695  320.344 1.00 106.76 ? 12  DG  E "C4'" 1 
ATOM   9828  O  "O4'" . DG  E 3 12  ? 83.420  -5.492  320.842 1.00 107.65 ? 12  DG  E "O4'" 1 
ATOM   9829  C  "C3'" . DG  E 3 12  ? 84.784  -6.270  319.073 1.00 114.70 ? 12  DG  E "C3'" 1 
ATOM   9830  O  "O3'" . DG  E 3 12  ? 83.909  -6.379  317.977 1.00 119.16 ? 12  DG  E "O3'" 1 
ATOM   9831  C  "C2'" . DG  E 3 12  ? 85.082  -4.806  319.358 1.00 106.41 ? 12  DG  E "C2'" 1 
ATOM   9832  C  "C1'" . DG  E 3 12  ? 83.752  -4.418  319.988 1.00 101.77 ? 12  DG  E "C1'" 1 
ATOM   9833  N  N9    . DG  E 3 12  ? 83.798  -3.201  320.789 1.00 99.14  ? 12  DG  E N9    1 
ATOM   9834  C  C8    . DG  E 3 12  ? 84.799  -2.791  321.639 1.00 113.74 ? 12  DG  E C8    1 
ATOM   9835  N  N7    . DG  E 3 12  ? 84.547  -1.647  322.215 1.00 112.06 ? 12  DG  E N7    1 
ATOM   9836  C  C5    . DG  E 3 12  ? 83.306  -1.277  321.718 1.00 89.35  ? 12  DG  E C5    1 
ATOM   9837  C  C6    . DG  E 3 12  ? 82.526  -0.129  321.985 1.00 105.15 ? 12  DG  E C6    1 
ATOM   9838  O  O6    . DG  E 3 12  ? 82.793  0.816   322.740 1.00 110.40 ? 12  DG  E O6    1 
ATOM   9839  N  N1    . DG  E 3 12  ? 81.331  -0.146  321.270 1.00 97.77  ? 12  DG  E N1    1 
ATOM   9840  C  C2    . DG  E 3 12  ? 80.951  -1.148  320.409 1.00 93.96  ? 12  DG  E C2    1 
ATOM   9841  N  N2    . DG  E 3 12  ? 79.766  -0.989  319.811 1.00 90.92  ? 12  DG  E N2    1 
ATOM   9842  N  N3    . DG  E 3 12  ? 81.672  -2.230  320.149 1.00 84.96  ? 12  DG  E N3    1 
ATOM   9843  C  C4    . DG  E 3 12  ? 82.834  -2.224  320.838 1.00 87.72  ? 12  DG  E C4    1 
ATOM   9844  P  P     . DT  E 3 13  ? 84.292  -7.312  316.728 1.00 106.59 ? 13  DT  E P     1 
ATOM   9845  O  OP1   . DT  E 3 13  ? 83.601  -8.610  316.897 1.00 103.77 ? 13  DT  E OP1   1 
ATOM   9846  O  OP2   . DT  E 3 13  ? 85.765  -7.314  316.604 1.00 104.02 ? 13  DT  E OP2   1 
ATOM   9847  O  "O5'" . DT  E 3 13  ? 83.671  -6.539  315.473 1.00 95.85  ? 13  DT  E "O5'" 1 
ATOM   9848  C  "C5'" . DT  E 3 13  ? 84.283  -5.332  315.051 1.00 85.75  ? 13  DT  E "C5'" 1 
ATOM   9849  C  "C4'" . DT  E 3 13  ? 83.258  -4.408  314.435 1.00 87.13  ? 13  DT  E "C4'" 1 
ATOM   9850  O  "O4'" . DT  E 3 13  ? 82.723  -3.541  315.469 1.00 89.45  ? 13  DT  E "O4'" 1 
ATOM   9851  C  "C3'" . DT  E 3 13  ? 83.817  -3.500  313.346 1.00 90.84  ? 13  DT  E "C3'" 1 
ATOM   9852  O  "O3'" . DT  E 3 13  ? 82.875  -3.411  312.277 1.00 99.04  ? 13  DT  E "O3'" 1 
ATOM   9853  C  "C2'" . DT  E 3 13  ? 84.015  -2.181  314.083 1.00 87.75  ? 13  DT  E "C2'" 1 
ATOM   9854  C  "C1'" . DT  E 3 13  ? 82.852  -2.194  315.064 1.00 86.20  ? 13  DT  E "C1'" 1 
ATOM   9855  N  N1    . DT  E 3 13  ? 83.109  -1.335  316.258 1.00 93.17  ? 13  DT  E N1    1 
ATOM   9856  C  C2    . DT  E 3 13  ? 82.200  -0.362  316.610 1.00 100.36 ? 13  DT  E C2    1 
ATOM   9857  O  O2    . DT  E 3 13  ? 81.164  -0.159  316.002 1.00 104.07 ? 13  DT  E O2    1 
ATOM   9858  N  N3    . DT  E 3 13  ? 82.550  0.372   317.717 1.00 106.81 ? 13  DT  E N3    1 
ATOM   9859  C  C4    . DT  E 3 13  ? 83.695  0.235   318.486 1.00 105.42 ? 13  DT  E C4    1 
ATOM   9860  O  O4    . DT  E 3 13  ? 83.923  0.941   319.465 1.00 98.08  ? 13  DT  E O4    1 
ATOM   9861  C  C5    . DT  E 3 13  ? 84.604  -0.798  318.057 1.00 105.00 ? 13  DT  E C5    1 
ATOM   9862  C  C7    . DT  E 3 13  ? 85.877  -1.038  318.811 1.00 85.61  ? 13  DT  E C7    1 
ATOM   9863  C  C6    . DT  E 3 13  ? 84.273  -1.519  316.977 1.00 104.12 ? 13  DT  E C6    1 
ATOM   9864  P  P     . DA  E 3 14  ? 83.170  -2.477  311.002 1.00 105.62 ? 14  DA  E P     1 
ATOM   9865  O  OP1   . DA  E 3 14  ? 82.186  -2.836  309.956 1.00 107.88 ? 14  DA  E OP1   1 
ATOM   9866  O  OP2   . DA  E 3 14  ? 84.623  -2.526  310.718 1.00 108.78 ? 14  DA  E OP2   1 
ATOM   9867  O  "O5'" . DA  E 3 14  ? 82.820  -1.015  311.533 1.00 88.05  ? 14  DA  E "O5'" 1 
ATOM   9868  C  "C5'" . DA  E 3 14  ? 83.274  0.163   310.897 1.00 88.55  ? 14  DA  E "C5'" 1 
ATOM   9869  C  "C4'" . DA  E 3 14  ? 82.484  1.297   311.518 1.00 95.30  ? 14  DA  E "C4'" 1 
ATOM   9870  O  "O4'" . DA  E 3 14  ? 82.339  1.047   312.935 1.00 101.87 ? 14  DA  E "O4'" 1 
ATOM   9871  C  "C3'" . DA  E 3 14  ? 83.111  2.676   311.463 1.00 97.35  ? 14  DA  E "C3'" 1 
ATOM   9872  O  "O3'" . DA  E 3 14  ? 82.885  3.251   310.186 1.00 88.14  ? 14  DA  E "O3'" 1 
ATOM   9873  C  "C2'" . DA  E 3 14  ? 82.323  3.389   312.556 1.00 103.76 ? 14  DA  E "C2'" 1 
ATOM   9874  C  "C1'" . DA  E 3 14  ? 82.171  2.284   313.600 1.00 107.24 ? 14  DA  E "C1'" 1 
ATOM   9875  N  N9    . DA  E 3 14  ? 83.139  2.399   314.685 1.00 107.55 ? 14  DA  E N9    1 
ATOM   9876  C  C8    . DA  E 3 14  ? 84.211  1.600   314.970 1.00 100.79 ? 14  DA  E C8    1 
ATOM   9877  N  N7    . DA  E 3 14  ? 84.891  1.987   316.026 1.00 98.34  ? 14  DA  E N7    1 
ATOM   9878  C  C5    . DA  E 3 14  ? 84.219  3.120   316.459 1.00 99.89  ? 14  DA  E C5    1 
ATOM   9879  C  C6    . DA  E 3 14  ? 84.420  4.016   317.530 1.00 100.65 ? 14  DA  E C6    1 
ATOM   9880  N  N6    . DA  E 3 14  ? 85.408  3.927   318.429 1.00 107.53 ? 14  DA  E N6    1 
ATOM   9881  N  N1    . DA  E 3 14  ? 83.547  5.033   317.649 1.00 99.32  ? 14  DA  E N1    1 
ATOM   9882  C  C2    . DA  E 3 14  ? 82.543  5.163   316.778 1.00 106.61 ? 14  DA  E C2    1 
ATOM   9883  N  N3    . DA  E 3 14  ? 82.255  4.389   315.738 1.00 109.67 ? 14  DA  E N3    1 
ATOM   9884  C  C4    . DA  E 3 14  ? 83.138  3.383   315.639 1.00 105.20 ? 14  DA  E C4    1 
ATOM   9885  P  P     . DT  E 3 15  ? 83.913  4.335   309.598 1.00 108.29 ? 15  DT  E P     1 
ATOM   9886  O  OP1   . DT  E 3 15  ? 83.610  4.496   308.159 1.00 123.21 ? 15  DT  E OP1   1 
ATOM   9887  O  OP2   . DT  E 3 15  ? 85.277  3.947   310.020 1.00 91.72  ? 15  DT  E OP2   1 
ATOM   9888  O  "O5'" . DT  E 3 15  ? 83.514  5.688   310.355 1.00 86.25  ? 15  DT  E "O5'" 1 
ATOM   9889  C  "C5'" . DT  E 3 15  ? 82.174  6.159   310.273 1.00 92.11  ? 15  DT  E "C5'" 1 
ATOM   9890  C  "C4'" . DT  E 3 15  ? 81.950  7.374   311.156 1.00 105.25 ? 15  DT  E "C4'" 1 
ATOM   9891  O  "O4'" . DT  E 3 15  ? 82.357  7.084   312.519 1.00 107.69 ? 15  DT  E "O4'" 1 
ATOM   9892  C  "C3'" . DT  E 3 15  ? 82.720  8.620   310.740 1.00 105.03 ? 15  DT  E "C3'" 1 
ATOM   9893  O  "O3'" . DT  E 3 15  ? 81.877  9.757   310.854 1.00 122.15 ? 15  DT  E "O3'" 1 
ATOM   9894  C  "C2'" . DT  E 3 15  ? 83.868  8.686   311.740 1.00 100.19 ? 15  DT  E "C2'" 1 
ATOM   9895  C  "C1'" . DT  E 3 15  ? 83.207  8.107   312.984 1.00 102.38 ? 15  DT  E "C1'" 1 
ATOM   9896  N  N1    . DT  E 3 15  ? 84.176  7.505   313.930 1.00 108.78 ? 15  DT  E N1    1 
ATOM   9897  C  C2    . DT  E 3 15  ? 84.301  8.034   315.193 1.00 107.52 ? 15  DT  E C2    1 
ATOM   9898  O  O2    . DT  E 3 15  ? 83.652  8.988   315.586 1.00 109.73 ? 15  DT  E O2    1 
ATOM   9899  N  N3    . DT  E 3 15  ? 85.222  7.399   315.983 1.00 108.25 ? 15  DT  E N3    1 
ATOM   9900  C  C4    . DT  E 3 15  ? 86.012  6.316   315.649 1.00 115.68 ? 15  DT  E C4    1 
ATOM   9901  O  O4    . DT  E 3 15  ? 86.810  5.824   316.440 1.00 126.47 ? 15  DT  E O4    1 
ATOM   9902  C  C5    . DT  E 3 15  ? 85.828  5.812   314.312 1.00 108.75 ? 15  DT  E C5    1 
ATOM   9903  C  C7    . DT  E 3 15  ? 86.629  4.637   313.835 1.00 103.57 ? 15  DT  E C7    1 
ATOM   9904  C  C6    . DT  E 3 15  ? 84.930  6.422   313.526 1.00 108.90 ? 15  DT  E C6    1 
ATOM   9905  O  "O5'" . DG  F 4 1   ? 105.575 3.149   313.174 1.00 213.48 ? 1   DG  F "O5'" 1 
ATOM   9906  C  "C5'" . DG  F 4 1   ? 104.465 3.004   314.053 1.00 202.71 ? 1   DG  F "C5'" 1 
ATOM   9907  C  "C4'" . DG  F 4 1   ? 104.569 3.970   315.218 1.00 195.81 ? 1   DG  F "C4'" 1 
ATOM   9908  O  "O4'" . DG  F 4 1   ? 104.348 5.321   314.740 1.00 187.67 ? 1   DG  F "O4'" 1 
ATOM   9909  C  "C3'" . DG  F 4 1   ? 103.549 3.777   316.333 1.00 189.16 ? 1   DG  F "C3'" 1 
ATOM   9910  O  "O3'" . DG  F 4 1   ? 104.144 4.190   317.554 1.00 199.95 ? 1   DG  F "O3'" 1 
ATOM   9911  C  "C2'" . DG  F 4 1   ? 102.441 4.736   315.914 1.00 173.13 ? 1   DG  F "C2'" 1 
ATOM   9912  C  "C1'" . DG  F 4 1   ? 103.314 5.912   315.498 1.00 180.16 ? 1   DG  F "C1'" 1 
ATOM   9913  N  N9    . DG  F 4 1   ? 102.684 6.935   314.669 1.00 181.49 ? 1   DG  F N9    1 
ATOM   9914  C  C8    . DG  F 4 1   ? 102.259 6.800   313.370 1.00 180.68 ? 1   DG  F C8    1 
ATOM   9915  N  N7    . DG  F 4 1   ? 101.745 7.892   312.877 1.00 178.40 ? 1   DG  F N7    1 
ATOM   9916  C  C5    . DG  F 4 1   ? 101.843 8.811   313.914 1.00 180.61 ? 1   DG  F C5    1 
ATOM   9917  C  C6    . DG  F 4 1   ? 101.449 10.169  313.967 1.00 180.56 ? 1   DG  F C6    1 
ATOM   9918  O  O6    . DG  F 4 1   ? 100.919 10.852  313.080 1.00 178.12 ? 1   DG  F O6    1 
ATOM   9919  N  N1    . DG  F 4 1   ? 101.727 10.735  315.209 1.00 179.87 ? 1   DG  F N1    1 
ATOM   9920  C  C2    . DG  F 4 1   ? 102.314 10.079  316.265 1.00 178.99 ? 1   DG  F C2    1 
ATOM   9921  N  N2    . DG  F 4 1   ? 102.500 10.802  317.379 1.00 177.39 ? 1   DG  F N2    1 
ATOM   9922  N  N3    . DG  F 4 1   ? 102.688 8.807   316.226 1.00 184.44 ? 1   DG  F N3    1 
ATOM   9923  C  C4    . DG  F 4 1   ? 102.423 8.239   315.024 1.00 182.50 ? 1   DG  F C4    1 
ATOM   9924  P  P     . DA  F 4 2   ? 104.200 3.196   318.815 1.00 239.47 ? 2   DA  F P     1 
ATOM   9925  O  OP1   . DA  F 4 2   ? 105.607 2.770   318.984 1.00 243.62 ? 2   DA  F OP1   1 
ATOM   9926  O  OP2   . DA  F 4 2   ? 103.139 2.180   318.636 1.00 235.50 ? 2   DA  F OP2   1 
ATOM   9927  O  "O5'" . DA  F 4 2   ? 103.785 4.129   320.048 1.00 211.20 ? 2   DA  F "O5'" 1 
ATOM   9928  C  "C5'" . DA  F 4 2   ? 102.894 5.207   319.795 1.00 202.97 ? 2   DA  F "C5'" 1 
ATOM   9929  C  "C4'" . DA  F 4 2   ? 102.410 5.879   321.065 1.00 200.21 ? 2   DA  F "C4'" 1 
ATOM   9930  O  "O4'" . DA  F 4 2   ? 101.723 7.097   320.697 1.00 193.20 ? 2   DA  F "O4'" 1 
ATOM   9931  C  "C3'" . DA  F 4 2   ? 101.349 5.125   321.845 1.00 198.60 ? 2   DA  F "C3'" 1 
ATOM   9932  O  "O3'" . DA  F 4 2   ? 101.171 5.747   323.115 1.00 204.21 ? 2   DA  F "O3'" 1 
ATOM   9933  C  "C2'" . DA  F 4 2   ? 100.145 5.350   320.939 1.00 188.68 ? 2   DA  F "C2'" 1 
ATOM   9934  C  "C1'" . DA  F 4 2   ? 100.345 6.810   320.544 1.00 187.64 ? 2   DA  F "C1'" 1 
ATOM   9935  N  N9    . DA  F 4 2   ? 99.968  7.103   319.166 1.00 183.35 ? 2   DA  F N9    1 
ATOM   9936  C  C8    . DA  F 4 2   ? 99.776  6.221   318.139 1.00 178.45 ? 2   DA  F C8    1 
ATOM   9937  N  N7    . DA  F 4 2   ? 99.440  6.797   317.008 1.00 172.46 ? 2   DA  F N7    1 
ATOM   9938  C  C5    . DA  F 4 2   ? 99.415  8.147   317.316 1.00 173.42 ? 2   DA  F C5    1 
ATOM   9939  C  C6    . DA  F 4 2   ? 99.127  9.298   316.555 1.00 168.96 ? 2   DA  F C6    1 
ATOM   9940  N  N6    . DA  F 4 2   ? 98.797  9.278   315.258 1.00 164.99 ? 2   DA  F N6    1 
ATOM   9941  N  N1    . DA  F 4 2   ? 99.195  10.488  317.185 1.00 173.17 ? 2   DA  F N1    1 
ATOM   9942  C  C2    . DA  F 4 2   ? 99.522  10.529  318.480 1.00 180.65 ? 2   DA  F C2    1 
ATOM   9943  N  N3    . DA  F 4 2   ? 99.811  9.520   319.296 1.00 185.29 ? 2   DA  F N3    1 
ATOM   9944  C  C4    . DA  F 4 2   ? 99.737  8.350   318.644 1.00 181.76 ? 2   DA  F C4    1 
ATOM   9945  P  P     . DT  F 4 3   ? 100.059 5.204   324.143 1.00 188.90 ? 3   DT  F P     1 
ATOM   9946  O  OP1   . DT  F 4 3   ? 100.636 5.302   325.501 1.00 191.07 ? 3   DT  F OP1   1 
ATOM   9947  O  OP2   . DT  F 4 3   ? 99.554  3.905   323.645 1.00 184.27 ? 3   DT  F OP2   1 
ATOM   9948  O  "O5'" . DT  F 4 3   ? 98.870  6.268   324.026 1.00 197.43 ? 3   DT  F "O5'" 1 
ATOM   9949  C  "C5'" . DT  F 4 3   ? 98.925  7.464   324.797 1.00 200.68 ? 3   DT  F "C5'" 1 
ATOM   9950  C  "C4'" . DT  F 4 3   ? 97.784  8.401   324.442 1.00 192.98 ? 3   DT  F "C4'" 1 
ATOM   9951  O  "O4'" . DT  F 4 3   ? 97.923  8.822   323.066 1.00 185.67 ? 3   DT  F "O4'" 1 
ATOM   9952  C  "C3'" . DT  F 4 3   ? 96.388  7.789   324.522 1.00 188.80 ? 3   DT  F "C3'" 1 
ATOM   9953  O  "O3'" . DT  F 4 3   ? 95.789  7.862   325.853 1.00 193.10 ? 3   DT  F "O3'" 1 
ATOM   9954  C  "C2'" . DT  F 4 3   ? 95.595  8.498   323.421 1.00 180.38 ? 3   DT  F "C2'" 1 
ATOM   9955  C  "C1'" . DT  F 4 3   ? 96.654  9.194   322.570 1.00 180.46 ? 3   DT  F "C1'" 1 
ATOM   9956  N  N1    . DT  F 4 3   ? 96.569  8.825   321.131 1.00 175.01 ? 3   DT  F N1    1 
ATOM   9957  C  C2    . DT  F 4 3   ? 96.497  9.828   320.194 1.00 175.72 ? 3   DT  F C2    1 
ATOM   9958  O  O2    . DT  F 4 3   ? 96.502  11.014  320.475 1.00 181.43 ? 3   DT  F O2    1 
ATOM   9959  N  N3    . DT  F 4 3   ? 96.420  9.387   318.902 1.00 170.81 ? 3   DT  F N3    1 
ATOM   9960  C  C4    . DT  F 4 3   ? 96.403  8.081   318.451 1.00 168.21 ? 3   DT  F C4    1 
ATOM   9961  O  O4    . DT  F 4 3   ? 96.331  7.803   317.255 1.00 164.63 ? 3   DT  F O4    1 
ATOM   9962  C  C5    . DT  F 4 3   ? 96.482  7.081   319.487 1.00 170.45 ? 3   DT  F C5    1 
ATOM   9963  C  C7    . DT  F 4 3   ? 96.474  5.624   319.129 1.00 169.11 ? 3   DT  F C7    1 
ATOM   9964  C  C6    . DT  F 4 3   ? 96.558  7.495   320.760 1.00 173.37 ? 3   DT  F C6    1 
ATOM   9965  P  P     . DC  F 4 4   ? 95.443  9.262   326.580 1.00 155.42 ? 4   DC  F P     1 
ATOM   9966  O  OP1   . DC  F 4 4   ? 96.641  10.128  326.645 1.00 160.43 ? 4   DC  F OP1   1 
ATOM   9967  O  OP2   . DC  F 4 4   ? 94.768  8.901   327.843 1.00 159.60 ? 4   DC  F OP2   1 
ATOM   9968  O  "O5'" . DC  F 4 4   ? 94.329  9.943   325.657 1.00 131.69 ? 4   DC  F "O5'" 1 
ATOM   9969  C  "C5'" . DC  F 4 4   ? 94.222  11.358  325.611 1.00 133.57 ? 4   DC  F "C5'" 1 
ATOM   9970  C  "C4'" . DC  F 4 4   ? 93.208  11.779  324.565 1.00 128.25 ? 4   DC  F "C4'" 1 
ATOM   9971  O  "O4'" . DC  F 4 4   ? 93.621  11.288  323.272 1.00 129.55 ? 4   DC  F "O4'" 1 
ATOM   9972  C  "C3'" . DC  F 4 4   ? 91.815  11.211  324.779 1.00 128.36 ? 4   DC  F "C3'" 1 
ATOM   9973  O  "O3'" . DC  F 4 4   ? 91.036  12.140  325.521 1.00 134.18 ? 4   DC  F "O3'" 1 
ATOM   9974  C  "C2'" . DC  F 4 4   ? 91.261  11.011  323.370 1.00 125.18 ? 4   DC  F "C2'" 1 
ATOM   9975  C  "C1'" . DC  F 4 4   ? 92.481  11.109  322.458 1.00 131.54 ? 4   DC  F "C1'" 1 
ATOM   9976  N  N1    . DC  F 4 4   ? 92.700  9.906   321.600 1.00 141.83 ? 4   DC  F N1    1 
ATOM   9977  C  C2    . DC  F 4 4   ? 93.238  10.072  320.320 1.00 148.30 ? 4   DC  F C2    1 
ATOM   9978  O  O2    . DC  F 4 4   ? 93.523  11.211  319.930 1.00 153.73 ? 4   DC  F O2    1 
ATOM   9979  N  N3    . DC  F 4 4   ? 93.435  8.978   319.547 1.00 146.82 ? 4   DC  F N3    1 
ATOM   9980  C  C4    . DC  F 4 4   ? 93.115  7.765   319.999 1.00 147.08 ? 4   DC  F C4    1 
ATOM   9981  N  N4    . DC  F 4 4   ? 93.331  6.727   319.181 1.00 150.12 ? 4   DC  F N4    1 
ATOM   9982  C  C5    . DC  F 4 4   ? 92.563  7.577   321.302 1.00 144.33 ? 4   DC  F C5    1 
ATOM   9983  C  C6    . DC  F 4 4   ? 92.374  8.664   322.060 1.00 143.49 ? 4   DC  F C6    1 
ATOM   9984  P  P     . DA  F 4 5   ? 89.654  11.676  326.193 1.00 140.07 ? 5   DA  F P     1 
ATOM   9985  O  OP1   . DA  F 4 5   ? 89.379  12.578  327.334 1.00 132.68 ? 5   DA  F OP1   1 
ATOM   9986  O  OP2   . DA  F 4 5   ? 89.725  10.213  326.403 1.00 139.74 ? 5   DA  F OP2   1 
ATOM   9987  O  "O5'" . DA  F 4 5   ? 88.570  11.942  325.053 1.00 113.09 ? 5   DA  F "O5'" 1 
ATOM   9988  C  "C5'" . DA  F 4 5   ? 88.219  13.271  324.695 1.00 113.85 ? 5   DA  F "C5'" 1 
ATOM   9989  C  "C4'" . DA  F 4 5   ? 86.876  13.287  323.990 1.00 125.94 ? 5   DA  F "C4'" 1 
ATOM   9990  O  "O4'" . DA  F 4 5   ? 87.009  12.560  322.741 1.00 102.98 ? 5   DA  F "O4'" 1 
ATOM   9991  C  "C3'" . DA  F 4 5   ? 85.745  12.610  324.761 1.00 123.59 ? 5   DA  F "C3'" 1 
ATOM   9992  O  "O3'" . DA  F 4 5   ? 84.515  13.311  324.589 1.00 109.72 ? 5   DA  F "O3'" 1 
ATOM   9993  C  "C2'" . DA  F 4 5   ? 85.674  11.221  324.139 1.00 109.90 ? 5   DA  F "C2'" 1 
ATOM   9994  C  "C1'" . DA  F 4 5   ? 86.064  11.511  322.695 1.00 106.41 ? 5   DA  F "C1'" 1 
ATOM   9995  N  N9    . DA  F 4 5   ? 86.633  10.344  322.025 1.00 109.19 ? 5   DA  F N9    1 
ATOM   9996  C  C8    . DA  F 4 5   ? 87.625  9.518   322.476 1.00 107.09 ? 5   DA  F C8    1 
ATOM   9997  N  N7    . DA  F 4 5   ? 87.918  8.542   321.648 1.00 106.98 ? 5   DA  F N7    1 
ATOM   9998  C  C5    . DA  F 4 5   ? 87.057  8.744   320.583 1.00 108.63 ? 5   DA  F C5    1 
ATOM   9999  C  C6    . DA  F 4 5   ? 86.863  8.051   319.372 1.00 106.37 ? 5   DA  F C6    1 
ATOM   10000 N  N6    . DA  F 4 5   ? 87.554  6.961   319.013 1.00 106.19 ? 5   DA  F N6    1 
ATOM   10001 N  N1    . DA  F 4 5   ? 85.919  8.524   318.536 1.00 111.29 ? 5   DA  F N1    1 
ATOM   10002 C  C2    . DA  F 4 5   ? 85.221  9.612   318.879 1.00 110.34 ? 5   DA  F C2    1 
ATOM   10003 N  N3    . DA  F 4 5   ? 85.312  10.341  319.987 1.00 115.41 ? 5   DA  F N3    1 
ATOM   10004 C  C4    . DA  F 4 5   ? 86.258  9.849   320.801 1.00 114.04 ? 5   DA  F C4    1 
ATOM   10005 P  P     . DT  F 4 6   ? 83.194  12.820  325.363 1.00 139.55 ? 6   DT  F P     1 
ATOM   10006 O  OP1   . DT  F 4 6   ? 82.343  14.009  325.589 1.00 115.46 ? 6   DT  F OP1   1 
ATOM   10007 O  OP2   . DT  F 4 6   ? 83.619  12.017  326.529 1.00 142.66 ? 6   DT  F OP2   1 
ATOM   10008 O  "O5'" . DT  F 4 6   ? 82.481  11.838  324.319 1.00 104.48 ? 6   DT  F "O5'" 1 
ATOM   10009 C  "C5'" . DT  F 4 6   ? 81.739  12.394  323.246 1.00 101.33 ? 6   DT  F "C5'" 1 
ATOM   10010 C  "C4'" . DT  F 4 6   ? 81.333  11.360  322.213 1.00 125.57 ? 6   DT  F "C4'" 1 
ATOM   10011 O  "O4'" . DT  F 4 6   ? 82.501  10.648  321.740 1.00 92.26  ? 6   DT  F "O4'" 1 
ATOM   10012 C  "C3'" . DT  F 4 6   ? 80.438  10.224  322.690 1.00 94.93  ? 6   DT  F "C3'" 1 
ATOM   10013 O  "O3'" . DT  F 4 6   ? 79.061  10.605  322.733 1.00 96.42  ? 6   DT  F "O3'" 1 
ATOM   10014 C  "C2'" . DT  F 4 6   ? 80.660  9.181   321.601 1.00 89.25  ? 6   DT  F "C2'" 1 
ATOM   10015 C  "C1'" . DT  F 4 6   ? 82.014  9.549   321.002 1.00 87.87  ? 6   DT  F "C1'" 1 
ATOM   10016 N  N1    . DT  F 4 6   ? 82.954  8.397   321.044 1.00 96.94  ? 6   DT  F N1    1 
ATOM   10017 C  C2    . DT  F 4 6   ? 82.974  7.558   319.958 1.00 100.25 ? 6   DT  F C2    1 
ATOM   10018 O  O2    . DT  F 4 6   ? 82.275  7.727   318.976 1.00 106.06 ? 6   DT  F O2    1 
ATOM   10019 N  N3    . DT  F 4 6   ? 83.852  6.518   320.053 1.00 105.58 ? 6   DT  F N3    1 
ATOM   10020 C  C4    . DT  F 4 6   ? 84.694  6.217   321.097 1.00 116.79 ? 6   DT  F C4    1 
ATOM   10021 O  O4    . DT  F 4 6   ? 85.438  5.239   321.053 1.00 125.83 ? 6   DT  F O4    1 
ATOM   10022 C  C5    . DT  F 4 6   ? 84.621  7.132   322.211 1.00 112.66 ? 6   DT  F C5    1 
ATOM   10023 C  C7    . DT  F 4 6   ? 85.488  6.915   323.412 1.00 95.55  ? 6   DT  F C7    1 
ATOM   10024 C  C6    . DT  F 4 6   ? 83.764  8.164   322.137 1.00 104.03 ? 6   DT  F C6    1 
ATOM   10025 P  P     . DA  F 4 7   ? 77.938  9.541   323.178 1.00 108.54 ? 7   DA  F P     1 
ATOM   10026 O  OP1   . DA  F 4 7   ? 76.722  10.294  323.551 1.00 101.22 ? 7   DA  F OP1   1 
ATOM   10027 O  OP2   . DA  F 4 7   ? 78.565  8.619   324.148 1.00 114.86 ? 7   DA  F OP2   1 
ATOM   10028 O  "O5'" . DA  F 4 7   ? 77.643  8.689   321.856 1.00 104.20 ? 7   DA  F "O5'" 1 
ATOM   10029 C  "C5'" . DA  F 4 7   ? 77.156  9.318   320.689 1.00 111.51 ? 7   DA  F "C5'" 1 
ATOM   10030 C  "C4'" . DA  F 4 7   ? 76.563  8.296   319.738 1.00 103.18 ? 7   DA  F "C4'" 1 
ATOM   10031 O  "O4'" . DA  F 4 7   ? 77.619  7.459   319.209 1.00 88.74  ? 7   DA  F "O4'" 1 
ATOM   10032 C  "C3'" . DA  F 4 7   ? 75.534  7.363   320.364 1.00 109.12 ? 7   DA  F "C3'" 1 
ATOM   10033 O  "O3'" . DA  F 4 7   ? 74.468  7.158   319.451 1.00 84.68  ? 7   DA  F "O3'" 1 
ATOM   10034 C  "C2'" . DA  F 4 7   ? 76.306  6.071   320.617 1.00 84.80  ? 7   DA  F "C2'" 1 
ATOM   10035 C  "C1'" . DA  F 4 7   ? 77.417  6.106   319.571 1.00 88.17  ? 7   DA  F "C1'" 1 
ATOM   10036 N  N9    . DA  F 4 7   ? 78.686  5.570   320.062 1.00 86.12  ? 7   DA  F N9    1 
ATOM   10037 C  C8    . DA  F 4 7   ? 79.420  6.045   321.115 1.00 94.76  ? 7   DA  F C8    1 
ATOM   10038 N  N7    . DA  F 4 7   ? 80.523  5.370   321.339 1.00 97.74  ? 7   DA  F N7    1 
ATOM   10039 C  C5    . DA  F 4 7   ? 80.510  4.385   320.367 1.00 88.24  ? 7   DA  F C5    1 
ATOM   10040 C  C6    . DA  F 4 7   ? 81.413  3.342   320.073 1.00 93.86  ? 7   DA  F C6    1 
ATOM   10041 N  N6    . DA  F 4 7   ? 82.538  3.131   320.768 1.00 94.22  ? 7   DA  F N6    1 
ATOM   10042 N  N1    . DA  F 4 7   ? 81.115  2.526   319.039 1.00 93.95  ? 7   DA  F N1    1 
ATOM   10043 C  C2    . DA  F 4 7   ? 79.989  2.751   318.356 1.00 97.49  ? 7   DA  F C2    1 
ATOM   10044 N  N3    . DA  F 4 7   ? 79.066  3.694   318.538 1.00 96.40  ? 7   DA  F N3    1 
ATOM   10045 C  C4    . DA  F 4 7   ? 79.387  4.489   319.570 1.00 88.86  ? 7   DA  F C4    1 
ATOM   10046 P  P     . DC  F 4 8   ? 72.997  6.807   319.994 1.00 109.57 ? 8   DC  F P     1 
ATOM   10047 O  OP1   . DC  F 4 8   ? 72.061  7.043   318.877 1.00 111.28 ? 8   DC  F OP1   1 
ATOM   10048 O  OP2   . DC  F 4 8   ? 72.779  7.509   321.280 1.00 108.08 ? 8   DC  F OP2   1 
ATOM   10049 O  "O5'" . DC  F 4 8   ? 73.067  5.236   320.283 1.00 89.70  ? 8   DC  F "O5'" 1 
ATOM   10050 C  "C5'" . DC  F 4 8   ? 73.409  4.342   319.223 1.00 83.23  ? 8   DC  F "C5'" 1 
ATOM   10051 C  "C4'" . DC  F 4 8   ? 73.774  2.989   319.802 1.00 104.35 ? 8   DC  F "C4'" 1 
ATOM   10052 O  "O4'" . DC  F 4 8   ? 75.200  2.906   320.016 1.00 103.85 ? 8   DC  F "O4'" 1 
ATOM   10053 C  "C3'" . DC  F 4 8   ? 73.143  2.696   321.158 1.00 88.89  ? 8   DC  F "C3'" 1 
ATOM   10054 O  "O3'" . DC  F 4 8   ? 72.091  1.761   320.979 1.00 90.04  ? 8   DC  F "O3'" 1 
ATOM   10055 C  "C2'" . DC  F 4 8   ? 74.279  2.108   321.998 1.00 89.83  ? 8   DC  F "C2'" 1 
ATOM   10056 C  "C1'" . DC  F 4 8   ? 75.403  1.909   320.992 1.00 85.19  ? 8   DC  F "C1'" 1 
ATOM   10057 N  N1    . DC  F 4 8   ? 76.759  2.066   321.588 1.00 85.82  ? 8   DC  F N1    1 
ATOM   10058 C  C2    . DC  F 4 8   ? 77.879  1.586   320.901 1.00 102.13 ? 8   DC  F C2    1 
ATOM   10059 O  O2    . DC  F 4 8   ? 77.720  1.049   319.798 1.00 100.73 ? 8   DC  F O2    1 
ATOM   10060 N  N3    . DC  F 4 8   ? 79.105  1.729   321.461 1.00 106.16 ? 8   DC  F N3    1 
ATOM   10061 C  C4    . DC  F 4 8   ? 79.225  2.320   322.652 1.00 106.49 ? 8   DC  F C4    1 
ATOM   10062 N  N4    . DC  F 4 8   ? 80.451  2.447   323.173 1.00 110.33 ? 8   DC  F N4    1 
ATOM   10063 C  C5    . DC  F 4 8   ? 78.094  2.810   323.368 1.00 108.13 ? 8   DC  F C5    1 
ATOM   10064 C  C6    . DC  F 4 8   ? 76.892  2.661   322.805 1.00 89.84  ? 8   DC  F C6    1 
ATOM   10065 P  P     . DA  F 4 9   ? 70.906  1.660   322.056 1.00 109.00 ? 9   DA  F P     1 
ATOM   10066 O  OP1   . DA  F 4 9   ? 69.645  1.977   321.360 1.00 109.22 ? 9   DA  F OP1   1 
ATOM   10067 O  OP2   . DA  F 4 9   ? 71.308  2.433   323.251 1.00 115.28 ? 9   DA  F OP2   1 
ATOM   10068 O  "O5'" . DA  F 4 9   ? 70.885  0.112   322.443 1.00 105.14 ? 9   DA  F "O5'" 1 
ATOM   10069 C  "C5'" . DA  F 4 9   ? 72.114  -0.548  322.674 1.00 96.06  ? 9   DA  F "C5'" 1 
ATOM   10070 C  "C4'" . DA  F 4 9   ? 71.904  -1.958  323.174 1.00 99.02  ? 9   DA  F "C4'" 1 
ATOM   10071 O  "O4'" . DA  F 4 9   ? 73.165  -2.459  323.671 1.00 107.88 ? 9   DA  F "O4'" 1 
ATOM   10072 C  "C3'" . DA  F 4 9   ? 70.980  -2.081  324.372 1.00 105.36 ? 9   DA  F "C3'" 1 
ATOM   10073 O  "O3'" . DA  F 4 9   ? 70.577  -3.440  324.464 1.00 107.67 ? 9   DA  F "O3'" 1 
ATOM   10074 C  "C2'" . DA  F 4 9   ? 71.898  -1.646  325.512 1.00 116.45 ? 9   DA  F "C2'" 1 
ATOM   10075 C  "C1'" . DA  F 4 9   ? 73.255  -2.184  325.058 1.00 108.99 ? 9   DA  F "C1'" 1 
ATOM   10076 N  N9    . DA  F 4 9   ? 74.374  -1.266  325.272 1.00 105.62 ? 9   DA  F N9    1 
ATOM   10077 C  C8    . DA  F 4 9   ? 74.388  0.098   325.165 1.00 107.99 ? 9   DA  F C8    1 
ATOM   10078 N  N7    . DA  F 4 9   ? 75.557  0.642   325.416 1.00 110.63 ? 9   DA  F N7    1 
ATOM   10079 C  C5    . DA  F 4 9   ? 76.369  -0.443  325.703 1.00 104.69 ? 9   DA  F C5    1 
ATOM   10080 C  C6    . DA  F 4 9   ? 77.730  -0.556  326.053 1.00 105.42 ? 9   DA  F C6    1 
ATOM   10081 N  N6    . DA  F 4 9   ? 78.567  0.485   326.181 1.00 106.53 ? 9   DA  F N6    1 
ATOM   10082 N  N1    . DA  F 4 9   ? 78.203  -1.802  326.270 1.00 108.33 ? 9   DA  F N1    1 
ATOM   10083 C  C2    . DA  F 4 9   ? 77.386  -2.853  326.147 1.00 109.60 ? 9   DA  F C2    1 
ATOM   10084 N  N3    . DA  F 4 9   ? 76.099  -2.867  325.825 1.00 107.58 ? 9   DA  F N3    1 
ATOM   10085 C  C4    . DA  F 4 9   ? 75.653  -1.622  325.616 1.00 104.89 ? 9   DA  F C4    1 
ATOM   10086 P  P     . DA  F 4 10  ? 69.763  -3.973  325.742 1.00 115.13 ? 10  DA  F P     1 
ATOM   10087 O  OP1   . DA  F 4 10  ? 69.005  -5.168  325.314 1.00 119.11 ? 10  DA  F OP1   1 
ATOM   10088 O  OP2   . DA  F 4 10  ? 69.042  -2.834  326.348 1.00 169.13 ? 10  DA  F OP2   1 
ATOM   10089 O  "O5'" . DA  F 4 10  ? 70.907  -4.430  326.759 1.00 117.42 ? 10  DA  F "O5'" 1 
ATOM   10090 C  "C5'" . DA  F 4 10  ? 71.876  -5.394  326.361 1.00 115.07 ? 10  DA  F "C5'" 1 
ATOM   10091 C  "C4'" . DA  F 4 10  ? 72.754  -5.747  327.546 1.00 119.22 ? 10  DA  F "C4'" 1 
ATOM   10092 O  "O4'" . DA  F 4 10  ? 73.828  -4.780  327.653 1.00 137.18 ? 10  DA  F "O4'" 1 
ATOM   10093 C  "C3'" . DA  F 4 10  ? 72.021  -5.735  328.884 1.00 126.61 ? 10  DA  F "C3'" 1 
ATOM   10094 O  "O3'" . DA  F 4 10  ? 72.355  -6.890  329.642 1.00 131.45 ? 10  DA  F "O3'" 1 
ATOM   10095 C  "C2'" . DA  F 4 10  ? 72.511  -4.459  329.564 1.00 127.53 ? 10  DA  F "C2'" 1 
ATOM   10096 C  "C1'" . DA  F 4 10  ? 73.911  -4.319  328.985 1.00 141.96 ? 10  DA  F "C1'" 1 
ATOM   10097 N  N9    . DA  F 4 10  ? 74.404  -2.946  328.971 1.00 120.27 ? 10  DA  F N9    1 
ATOM   10098 C  C8    . DA  F 4 10  ? 73.696  -1.805  328.713 1.00 119.29 ? 10  DA  F C8    1 
ATOM   10099 N  N7    . DA  F 4 10  ? 74.418  -0.711  328.774 1.00 145.47 ? 10  DA  F N7    1 
ATOM   10100 C  C5    . DA  F 4 10  ? 75.686  -1.168  329.093 1.00 138.66 ? 10  DA  F C5    1 
ATOM   10101 C  C6    . DA  F 4 10  ? 76.914  -0.510  329.304 1.00 134.61 ? 10  DA  F C6    1 
ATOM   10102 N  N6    . DA  F 4 10  ? 77.072  0.815   329.220 1.00 136.93 ? 10  DA  F N6    1 
ATOM   10103 N  N1    . DA  F 4 10  ? 77.982  -1.274  329.608 1.00 131.86 ? 10  DA  F N1    1 
ATOM   10104 C  C2    . DA  F 4 10  ? 77.840  -2.599  329.695 1.00 133.22 ? 10  DA  F C2    1 
ATOM   10105 N  N3    . DA  F 4 10  ? 76.741  -3.327  329.519 1.00 136.64 ? 10  DA  F N3    1 
ATOM   10106 C  C4    . DA  F 4 10  ? 75.694  -2.543  329.218 1.00 137.36 ? 10  DA  F C4    1 
ATOM   10107 P  P     . DC  F 4 11  ? 71.445  -7.317  330.894 1.00 148.74 ? 11  DC  F P     1 
ATOM   10108 O  OP1   . DC  F 4 11  ? 71.225  -8.778  330.804 1.00 154.13 ? 11  DC  F OP1   1 
ATOM   10109 O  OP2   . DC  F 4 11  ? 70.284  -6.400  330.937 1.00 144.42 ? 11  DC  F OP2   1 
ATOM   10110 O  "O5'" . DC  F 4 11  ? 72.372  -7.012  332.162 1.00 160.72 ? 11  DC  F "O5'" 1 
ATOM   10111 C  "C5'" . DC  F 4 11  ? 73.586  -7.740  332.299 1.00 158.27 ? 11  DC  F "C5'" 1 
ATOM   10112 C  "C4'" . DC  F 4 11  ? 74.671  -6.949  333.010 1.00 156.66 ? 11  DC  F "C4'" 1 
ATOM   10113 O  "O4'" . DC  F 4 11  ? 74.864  -5.653  332.394 1.00 149.37 ? 11  DC  F "O4'" 1 
ATOM   10114 C  "C3'" . DC  F 4 11  ? 74.418  -6.649  334.485 1.00 166.43 ? 11  DC  F "C3'" 1 
ATOM   10115 O  "O3'" . DC  F 4 11  ? 75.158  -7.576  335.276 1.00 178.31 ? 11  DC  F "O3'" 1 
ATOM   10116 C  "C2'" . DC  F 4 11  ? 74.911  -5.212  334.676 1.00 161.98 ? 11  DC  F "C2'" 1 
ATOM   10117 C  "C1'" . DC  F 4 11  ? 75.567  -4.880  333.341 1.00 153.42 ? 11  DC  F "C1'" 1 
ATOM   10118 N  N1    . DC  F 4 11  ? 75.499  -3.434  332.972 1.00 151.68 ? 11  DC  F N1    1 
ATOM   10119 C  C2    . DC  F 4 11  ? 76.679  -2.683  332.910 1.00 152.81 ? 11  DC  F C2    1 
ATOM   10120 O  O2    . DC  F 4 11  ? 77.756  -3.238  333.159 1.00 155.21 ? 11  DC  F O2    1 
ATOM   10121 N  N3    . DC  F 4 11  ? 76.612  -1.369  332.576 1.00 150.22 ? 11  DC  F N3    1 
ATOM   10122 C  C4    . DC  F 4 11  ? 75.425  -0.816  332.316 1.00 145.98 ? 11  DC  F C4    1 
ATOM   10123 N  N4    . DC  F 4 11  ? 75.394  0.480   331.990 1.00 141.50 ? 11  DC  F N4    1 
ATOM   10124 C  C5    . DC  F 4 11  ? 74.213  -1.564  332.377 1.00 138.01 ? 11  DC  F C5    1 
ATOM   10125 C  C6    . DC  F 4 11  ? 74.294  -2.856  332.707 1.00 140.37 ? 11  DC  F C6    1 
ATOM   10126 P  P     . DG  F 4 12  ? 75.092  -7.516  336.882 1.00 187.31 ? 12  DG  F P     1 
ATOM   10127 O  OP1   . DG  F 4 12  ? 75.431  -8.862  337.391 1.00 189.61 ? 12  DG  F OP1   1 
ATOM   10128 O  OP2   . DG  F 4 12  ? 73.805  -6.889  337.264 1.00 188.76 ? 12  DG  F OP2   1 
ATOM   10129 O  "O5'" . DG  F 4 12  ? 76.273  -6.511  337.276 1.00 206.64 ? 12  DG  F "O5'" 1 
ATOM   10130 C  "C5'" . DG  F 4 12  ? 77.603  -6.741  336.817 1.00 200.37 ? 12  DG  F "C5'" 1 
ATOM   10131 C  "C4'" . DG  F 4 12  ? 78.510  -5.599  337.241 1.00 199.56 ? 12  DG  F "C4'" 1 
ATOM   10132 O  "O4'" . DG  F 4 12  ? 78.241  -4.433  336.421 1.00 188.22 ? 12  DG  F "O4'" 1 
ATOM   10133 C  "C3'" . DG  F 4 12  ? 78.326  -5.168  338.695 1.00 210.34 ? 12  DG  F "C3'" 1 
ATOM   10134 O  "O3'" . DG  F 4 12  ? 79.546  -5.282  339.422 1.00 215.65 ? 12  DG  F "O3'" 1 
ATOM   10135 C  "C2'" . DG  F 4 12  ? 77.861  -3.717  338.613 1.00 206.57 ? 12  DG  F "C2'" 1 
ATOM   10136 C  "C1'" . DG  F 4 12  ? 78.295  -3.274  337.224 1.00 190.64 ? 12  DG  F "C1'" 1 
ATOM   10137 N  N9    . DG  F 4 12  ? 77.399  -2.266  336.665 1.00 183.99 ? 12  DG  F N9    1 
ATOM   10138 C  C8    . DG  F 4 12  ? 76.063  -2.420  336.383 1.00 183.24 ? 12  DG  F C8    1 
ATOM   10139 N  N7    . DG  F 4 12  ? 75.506  -1.348  335.893 1.00 158.01 ? 12  DG  F N7    1 
ATOM   10140 C  C5    . DG  F 4 12  ? 76.538  -0.420  335.848 1.00 174.89 ? 12  DG  F C5    1 
ATOM   10141 C  C6    . DG  F 4 12  ? 76.532  0.924   335.406 1.00 173.89 ? 12  DG  F C6    1 
ATOM   10142 O  O6    . DG  F 4 12  ? 75.581  1.577   334.954 1.00 152.31 ? 12  DG  F O6    1 
ATOM   10143 N  N1    . DG  F 4 12  ? 77.791  1.508   335.530 1.00 168.10 ? 12  DG  F N1    1 
ATOM   10144 C  C2    . DG  F 4 12  ? 78.910  0.875   336.018 1.00 170.10 ? 12  DG  F C2    1 
ATOM   10145 N  N2    . DG  F 4 12  ? 80.035  1.603   336.061 1.00 169.74 ? 12  DG  F N2    1 
ATOM   10146 N  N3    . DG  F 4 12  ? 78.928  -0.385  336.435 1.00 158.26 ? 12  DG  F N3    1 
ATOM   10147 C  C4    . DG  F 4 12  ? 77.710  -0.969  336.321 1.00 158.39 ? 12  DG  F C4    1 
ATOM   10148 P  P     . DT  F 4 13  ? 79.519  -5.451  341.021 1.00 207.24 ? 13  DT  F P     1 
ATOM   10149 O  OP1   . DT  F 4 13  ? 79.645  -6.894  341.318 1.00 214.09 ? 13  DT  F OP1   1 
ATOM   10150 O  OP2   . DT  F 4 13  ? 78.361  -4.699  341.551 1.00 206.71 ? 13  DT  F OP2   1 
ATOM   10151 O  "O5'" . DT  F 4 13  ? 80.851  -4.713  341.508 1.00 226.16 ? 13  DT  F "O5'" 1 
ATOM   10152 C  "C5'" . DT  F 4 13  ? 81.513  -3.817  340.626 1.00 214.15 ? 13  DT  F "C5'" 1 
ATOM   10153 C  "C4'" . DT  F 4 13  ? 81.421  -2.375  341.099 1.00 218.38 ? 13  DT  F "C4'" 1 
ATOM   10154 O  "O4'" . DT  F 4 13  ? 80.621  -1.592  340.181 1.00 210.09 ? 13  DT  F "O4'" 1 
ATOM   10155 C  "C3'" . DT  F 4 13  ? 80.758  -2.168  342.458 1.00 227.83 ? 13  DT  F "C3'" 1 
ATOM   10156 O  "O3'" . DT  F 4 13  ? 81.739  -2.180  343.495 1.00 221.10 ? 13  DT  F "O3'" 1 
ATOM   10157 C  "C2'" . DT  F 4 13  ? 80.068  -0.805  342.335 1.00 231.55 ? 13  DT  F "C2'" 1 
ATOM   10158 C  "C1'" . DT  F 4 13  ? 80.217  -0.422  340.860 1.00 219.93 ? 13  DT  F "C1'" 1 
ATOM   10159 N  N1    . DT  F 4 13  ? 78.959  0.080   340.235 1.00 214.63 ? 13  DT  F N1    1 
ATOM   10160 C  C2    . DT  F 4 13  ? 78.952  1.309   339.605 1.00 204.69 ? 13  DT  F C2    1 
ATOM   10161 O  O2    . DT  F 4 13  ? 79.933  2.028   339.524 1.00 202.25 ? 13  DT  F O2    1 
ATOM   10162 N  N3    . DT  F 4 13  ? 77.740  1.667   339.066 1.00 196.76 ? 13  DT  F N3    1 
ATOM   10163 C  C4    . DT  F 4 13  ? 76.570  0.929   339.099 1.00 179.86 ? 13  DT  F C4    1 
ATOM   10164 O  O4    . DT  F 4 13  ? 75.529  1.325   338.590 1.00 177.78 ? 13  DT  F O4    1 
ATOM   10165 C  C5    . DT  F 4 13  ? 76.649  -0.343  339.772 1.00 213.46 ? 13  DT  F C5    1 
ATOM   10166 C  C7    . DT  F 4 13  ? 75.439  -1.226  339.869 1.00 186.61 ? 13  DT  F C7    1 
ATOM   10167 C  C6    . DT  F 4 13  ? 77.824  -0.701  340.303 1.00 216.38 ? 13  DT  F C6    1 
ATOM   10168 O  "O5'" . DG  G 4 1   ? 89.863  8.533   308.893 1.00 146.69 ? 1   DG  H "O5'" 1 
ATOM   10169 C  "C5'" . DG  G 4 1   ? 90.596  9.751   308.982 1.00 154.62 ? 1   DG  H "C5'" 1 
ATOM   10170 C  "C4'" . DG  G 4 1   ? 90.155  10.556  310.188 1.00 149.41 ? 1   DG  H "C4'" 1 
ATOM   10171 O  "O4'" . DG  G 4 1   ? 90.280  9.727   311.368 1.00 144.82 ? 1   DG  H "O4'" 1 
ATOM   10172 C  "C3'" . DG  G 4 1   ? 91.001  11.775  310.517 1.00 149.77 ? 1   DG  H "C3'" 1 
ATOM   10173 O  "O3'" . DG  G 4 1   ? 90.292  12.556  311.460 1.00 154.21 ? 1   DG  H "O3'" 1 
ATOM   10174 C  "C2'" . DG  G 4 1   ? 92.155  11.081  311.219 1.00 142.43 ? 1   DG  H "C2'" 1 
ATOM   10175 C  "C1'" . DG  G 4 1   ? 91.286  10.290  312.186 1.00 141.95 ? 1   DG  H "C1'" 1 
ATOM   10176 N  N9    . DG  G 4 1   ? 91.940  9.226   312.938 1.00 140.34 ? 1   DG  H N9    1 
ATOM   10177 C  C8    . DG  G 4 1   ? 92.326  7.986   312.489 1.00 131.36 ? 1   DG  H C8    1 
ATOM   10178 N  N7    . DG  G 4 1   ? 92.878  7.251   313.414 1.00 140.98 ? 1   DG  H N7    1 
ATOM   10179 C  C5    . DG  G 4 1   ? 92.850  8.054   314.547 1.00 128.02 ? 1   DG  H C5    1 
ATOM   10180 C  C6    . DG  G 4 1   ? 93.308  7.799   315.861 1.00 125.12 ? 1   DG  H C6    1 
ATOM   10181 O  O6    . DG  G 4 1   ? 93.850  6.778   316.310 1.00 137.68 ? 1   DG  H O6    1 
ATOM   10182 N  N1    . DG  G 4 1   ? 93.082  8.889   316.696 1.00 128.60 ? 1   DG  H N1    1 
ATOM   10183 C  C2    . DG  G 4 1   ? 92.492  10.071  316.321 1.00 134.32 ? 1   DG  H C2    1 
ATOM   10184 N  N2    . DG  G 4 1   ? 92.362  11.001  317.279 1.00 159.97 ? 1   DG  H N2    1 
ATOM   10185 N  N3    . DG  G 4 1   ? 92.058  10.322  315.094 1.00 137.11 ? 1   DG  H N3    1 
ATOM   10186 C  C4    . DG  G 4 1   ? 92.272  9.271   314.268 1.00 137.40 ? 1   DG  H C4    1 
ATOM   10187 P  P     . DA  G 4 2   ? 89.692  13.991  311.055 1.00 180.47 ? 2   DA  H P     1 
ATOM   10188 O  OP1   . DA  G 4 2   ? 88.260  13.987  311.430 1.00 184.69 ? 2   DA  H OP1   1 
ATOM   10189 O  OP2   . DA  G 4 2   ? 90.080  14.276  309.657 1.00 178.94 ? 2   DA  H OP2   1 
ATOM   10190 O  "O5'" . DA  G 4 2   ? 90.469  15.012  312.011 1.00 162.86 ? 2   DA  H "O5'" 1 
ATOM   10191 C  "C5'" . DA  G 4 2   ? 91.880  15.160  311.911 1.00 158.25 ? 2   DA  H "C5'" 1 
ATOM   10192 C  "C4'" . DA  G 4 2   ? 92.426  15.900  313.117 1.00 164.67 ? 2   DA  H "C4'" 1 
ATOM   10193 O  "O4'" . DA  G 4 2   ? 92.925  14.939  314.081 1.00 152.74 ? 2   DA  H "O4'" 1 
ATOM   10194 C  "C3'" . DA  G 4 2   ? 93.630  16.782  312.844 1.00 168.11 ? 2   DA  H "C3'" 1 
ATOM   10195 O  "O3'" . DA  G 4 2   ? 93.828  17.642  313.954 1.00 174.22 ? 2   DA  H "O3'" 1 
ATOM   10196 C  "C2'" . DA  G 4 2   ? 94.718  15.722  312.773 1.00 156.88 ? 2   DA  H "C2'" 1 
ATOM   10197 C  "C1'" . DA  G 4 2   ? 94.334  14.856  313.968 1.00 153.08 ? 2   DA  H "C1'" 1 
ATOM   10198 N  N9    . DA  G 4 2   ? 94.694  13.451  313.821 1.00 157.62 ? 2   DA  H N9    1 
ATOM   10199 C  C8    . DA  G 4 2   ? 94.766  12.720  312.669 1.00 162.50 ? 2   DA  H C8    1 
ATOM   10200 N  N7    . DA  G 4 2   ? 95.114  11.469  312.857 1.00 155.47 ? 2   DA  H N7    1 
ATOM   10201 C  C5    . DA  G 4 2   ? 95.280  11.372  314.228 1.00 148.60 ? 2   DA  H C5    1 
ATOM   10202 C  C6    . DA  G 4 2   ? 95.647  10.305  315.070 1.00 147.67 ? 2   DA  H C6    1 
ATOM   10203 N  N6    . DA  G 4 2   ? 95.928  9.067   314.645 1.00 151.98 ? 2   DA  H N6    1 
ATOM   10204 N  N1    . DA  G 4 2   ? 95.715  10.562  316.388 1.00 148.86 ? 2   DA  H N1    1 
ATOM   10205 C  C2    . DA  G 4 2   ? 95.438  11.791  316.837 1.00 152.73 ? 2   DA  H C2    1 
ATOM   10206 N  N3    . DA  G 4 2   ? 95.083  12.870  316.146 1.00 152.87 ? 2   DA  H N3    1 
ATOM   10207 C  C4    . DA  G 4 2   ? 95.023  12.587  314.836 1.00 151.33 ? 2   DA  H C4    1 
ATOM   10208 P  P     . DT  G 4 3   ? 94.732  18.964  313.813 1.00 183.37 ? 3   DT  H P     1 
ATOM   10209 O  OP1   . DT  G 4 3   ? 93.933  19.979  313.092 1.00 188.33 ? 3   DT  H OP1   1 
ATOM   10210 O  OP2   . DT  G 4 3   ? 96.053  18.565  313.281 1.00 176.32 ? 3   DT  H OP2   1 
ATOM   10211 O  "O5'" . DT  G 4 3   ? 94.933  19.449  315.324 1.00 172.75 ? 3   DT  H "O5'" 1 
ATOM   10212 C  "C5'" . DT  G 4 3   ? 94.808  18.505  316.381 1.00 164.13 ? 3   DT  H "C5'" 1 
ATOM   10213 C  "C4'" . DT  G 4 3   ? 96.158  18.111  316.954 1.00 160.57 ? 3   DT  H "C4'" 1 
ATOM   10214 O  "O4'" . DT  G 4 3   ? 96.350  16.685  316.821 1.00 149.89 ? 3   DT  H "O4'" 1 
ATOM   10215 C  "C3'" . DT  G 4 3   ? 97.377  18.739  316.282 1.00 163.61 ? 3   DT  H "C3'" 1 
ATOM   10216 O  "O3'" . DT  G 4 3   ? 97.758  19.965  316.948 1.00 176.27 ? 3   DT  H "O3'" 1 
ATOM   10217 C  "C2'" . DT  G 4 3   ? 98.450  17.644  316.287 1.00 151.35 ? 3   DT  H "C2'" 1 
ATOM   10218 C  "C1'" . DT  G 4 3   ? 97.735  16.408  316.826 1.00 149.60 ? 3   DT  H "C1'" 1 
ATOM   10219 N  N1    . DT  G 4 3   ? 97.944  15.170  316.022 1.00 149.11 ? 3   DT  H N1    1 
ATOM   10220 C  C2    . DT  G 4 3   ? 98.161  13.984  316.686 1.00 143.80 ? 3   DT  H C2    1 
ATOM   10221 O  O2    . DT  G 4 3   ? 98.197  13.894  317.899 1.00 142.42 ? 3   DT  H O2    1 
ATOM   10222 N  N3    . DT  G 4 3   ? 98.337  12.896  315.872 1.00 145.99 ? 3   DT  H N3    1 
ATOM   10223 C  C4    . DT  G 4 3   ? 98.319  12.867  314.494 1.00 150.52 ? 3   DT  H C4    1 
ATOM   10224 O  O4    . DT  G 4 3   ? 98.488  11.827  313.864 1.00 146.59 ? 3   DT  H O4    1 
ATOM   10225 C  C5    . DT  G 4 3   ? 98.086  14.141  313.861 1.00 154.12 ? 3   DT  H C5    1 
ATOM   10226 C  C7    . DT  G 4 3   ? 98.044  14.233  312.365 1.00 153.39 ? 3   DT  H C7    1 
ATOM   10227 C  C6    . DT  G 4 3   ? 97.910  15.218  314.642 1.00 155.42 ? 3   DT  H C6    1 
ATOM   10228 P  P     . DC  G 4 4   ? 98.536  19.961  318.361 1.00 182.99 ? 4   DC  H P     1 
ATOM   10229 O  OP1   . DC  G 4 4   ? 98.011  18.893  319.240 1.00 186.65 ? 4   DC  H OP1   1 
ATOM   10230 O  OP2   . DC  G 4 4   ? 98.521  21.357  318.850 1.00 185.34 ? 4   DC  H OP2   1 
ATOM   10231 O  "O5'" . DC  G 4 4   ? 100.049 19.616  317.980 1.00 156.50 ? 4   DC  H "O5'" 1 
ATOM   10232 C  "C5'" . DC  G 4 4   ? 101.052 19.713  318.978 1.00 155.94 ? 4   DC  H "C5'" 1 
ATOM   10233 C  "C4'" . DC  G 4 4   ? 101.540 18.346  319.419 1.00 148.22 ? 4   DC  H "C4'" 1 
ATOM   10234 O  "O4'" . DC  G 4 4   ? 100.891 17.287  318.676 1.00 152.48 ? 4   DC  H "O4'" 1 
ATOM   10235 C  "C3'" . DC  G 4 4   ? 103.018 18.107  319.168 1.00 144.17 ? 4   DC  H "C3'" 1 
ATOM   10236 O  "O3'" . DC  G 4 4   ? 103.767 18.695  320.223 1.00 147.40 ? 4   DC  H "O3'" 1 
ATOM   10237 C  "C2'" . DC  G 4 4   ? 103.113 16.582  319.159 1.00 136.59 ? 4   DC  H "C2'" 1 
ATOM   10238 C  "C1'" . DC  G 4 4   ? 101.717 16.136  318.718 1.00 147.38 ? 4   DC  H "C1'" 1 
ATOM   10239 N  N1    . DC  G 4 4   ? 101.679 15.466  317.381 1.00 150.74 ? 4   DC  H N1    1 
ATOM   10240 C  C2    . DC  G 4 4   ? 101.610 14.069  317.302 1.00 150.71 ? 4   DC  H C2    1 
ATOM   10241 O  O2    . DC  G 4 4   ? 101.585 13.397  318.341 1.00 161.06 ? 4   DC  H O2    1 
ATOM   10242 N  N3    . DC  G 4 4   ? 101.574 13.484  316.081 1.00 141.82 ? 4   DC  H N3    1 
ATOM   10243 C  C4    . DC  G 4 4   ? 101.604 14.228  314.975 1.00 145.79 ? 4   DC  H C4    1 
ATOM   10244 N  N4    . DC  G 4 4   ? 101.565 13.594  313.797 1.00 150.31 ? 4   DC  H N4    1 
ATOM   10245 C  C5    . DC  G 4 4   ? 101.674 15.651  315.035 1.00 150.08 ? 4   DC  H C5    1 
ATOM   10246 C  C6    . DC  G 4 4   ? 101.709 16.221  316.245 1.00 154.79 ? 4   DC  H C6    1 
ATOM   10247 P  P     . DA  G 4 5   ? 105.083 19.554  319.893 1.00 158.75 ? 5   DA  H P     1 
ATOM   10248 O  OP1   . DA  G 4 5   ? 105.353 20.444  321.043 1.00 159.11 ? 5   DA  H OP1   1 
ATOM   10249 O  OP2   . DA  G 4 5   ? 104.910 20.139  318.546 1.00 161.87 ? 5   DA  H OP2   1 
ATOM   10250 O  "O5'" . DA  G 4 5   ? 106.233 18.449  319.807 1.00 150.24 ? 5   DA  H "O5'" 1 
ATOM   10251 C  "C5'" . DA  G 4 5   ? 106.377 17.527  320.878 1.00 146.84 ? 5   DA  H "C5'" 1 
ATOM   10252 C  "C4'" . DA  G 4 5   ? 107.703 16.807  320.764 1.00 134.54 ? 5   DA  H "C4'" 1 
ATOM   10253 O  "O4'" . DA  G 4 5   ? 107.573 15.735  319.802 1.00 129.79 ? 5   DA  H "O4'" 1 
ATOM   10254 C  "C3'" . DA  G 4 5   ? 108.849 17.687  320.283 1.00 137.16 ? 5   DA  H "C3'" 1 
ATOM   10255 O  "O3'" . DA  G 4 5   ? 110.006 17.414  321.053 1.00 136.60 ? 5   DA  H "O3'" 1 
ATOM   10256 C  "C2'" . DA  G 4 5   ? 109.031 17.282  318.823 1.00 132.89 ? 5   DA  H "C2'" 1 
ATOM   10257 C  "C1'" . DA  G 4 5   ? 108.617 15.818  318.854 1.00 133.10 ? 5   DA  H "C1'" 1 
ATOM   10258 N  N9    . DA  G 4 5   ? 108.125 15.310  317.576 1.00 133.02 ? 5   DA  H N9    1 
ATOM   10259 C  C8    . DA  G 4 5   ? 107.102 15.812  316.819 1.00 132.20 ? 5   DA  H C8    1 
ATOM   10260 N  N7    . DA  G 4 5   ? 106.886 15.141  315.713 1.00 127.86 ? 5   DA  H N7    1 
ATOM   10261 C  C5    . DA  G 4 5   ? 107.831 14.129  315.749 1.00 122.44 ? 5   DA  H C5    1 
ATOM   10262 C  C6    . DA  G 4 5   ? 108.124 13.074  314.862 1.00 122.61 ? 5   DA  H C6    1 
ATOM   10263 N  N6    . DA  G 4 5   ? 107.464 12.861  313.716 1.00 126.31 ? 5   DA  H N6    1 
ATOM   10264 N  N1    . DA  G 4 5   ? 109.132 12.242  315.199 1.00 123.72 ? 5   DA  H N1    1 
ATOM   10265 C  C2    . DA  G 4 5   ? 109.793 12.453  316.345 1.00 127.44 ? 5   DA  H C2    1 
ATOM   10266 N  N3    . DA  G 4 5   ? 109.609 13.410  317.253 1.00 132.65 ? 5   DA  H N3    1 
ATOM   10267 C  C4    . DA  G 4 5   ? 108.