data_4Z3A
# 
_entry.id   4Z3A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4Z3A         
WWPDB D_1000208472 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4XEG unspecified 
PDB . 4Z47 unspecified 
PDB . 4Z7B unspecified 
PDB . 4Z7Z unspecified 
PDB . 5CYS unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4Z3A 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pozharski, E.' 1 
'Malik, S.S.'   2 
'Drohat, A.C.'  3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            43 
_citation.language                  ? 
_citation.page_first                9541 
_citation.page_last                 9552 
_citation.title                     
'Thymine DNA glycosylase exhibits negligible affinity for nucleobases that it removes from DNA.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkv890 
_citation.pdbx_database_id_PubMed   26358812 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Malik, S.S.'   1 ? 
primary 'Coey, C.T.'    2 ? 
primary 'Varney, K.M.'  3 ? 
primary 'Pozharski, E.' 4 ? 
primary 'Drohat, A.C.'  5 ? 
# 
_cell.entry_id           4Z3A 
_cell.length_a           95.158 
_cell.length_b           53.565 
_cell.length_c           81.390 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.06 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4Z3A 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'G/T mismatch-specific thymine DNA glycosylase' 23070.670 1   3.2.2.29 ? 'UNP residues 111-308' ? 
2 polymer syn 'DNA (28-MER)'                                  8646.565  1   ?        ? ?                      ? 
3 polymer syn 'DNA (28-MER)'                                  8473.431  1   ?        ? ?                      ? 
4 water   nat water                                           18.015    185 ?        ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Thymine-DNA glycosylase,hTDG' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GSHMASFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGK
YGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTET
LCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDV
;
;GSHMASFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGK
YGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTET
LCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDV
;
A ? 
2 polydeoxyribonucleotide no no  
;(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DA)(DG)(DC)(DG)(DA)(DT)
(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DT)
;
CAGCTCTGTACGTGAGCGATGGACAGCT C ? 
3 polydeoxyribonucleotide no yes 
;(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DA)(DT)(DC)(DG)(DC)(DT)(DC)(DA)(ORP)(DG)(DT)
(DA)(DC)(DA)(DG)(DA)(DG)(DC)(DT)(DG)
;
AGCTGTCCATCGCTCAXGTACAGAGCTG D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   SER n 
1 7   PHE n 
1 8   ASN n 
1 9   GLY n 
1 10  VAL n 
1 11  SER n 
1 12  GLU n 
1 13  ALA n 
1 14  GLU n 
1 15  LEU n 
1 16  LEU n 
1 17  THR n 
1 18  LYS n 
1 19  THR n 
1 20  LEU n 
1 21  PRO n 
1 22  ASP n 
1 23  ILE n 
1 24  LEU n 
1 25  THR n 
1 26  PHE n 
1 27  ASN n 
1 28  LEU n 
1 29  ASP n 
1 30  ILE n 
1 31  VAL n 
1 32  ILE n 
1 33  ILE n 
1 34  GLY n 
1 35  ILE n 
1 36  ASN n 
1 37  PRO n 
1 38  GLY n 
1 39  LEU n 
1 40  MET n 
1 41  ALA n 
1 42  ALA n 
1 43  TYR n 
1 44  LYS n 
1 45  GLY n 
1 46  HIS n 
1 47  HIS n 
1 48  TYR n 
1 49  PRO n 
1 50  GLY n 
1 51  PRO n 
1 52  GLY n 
1 53  ASN n 
1 54  HIS n 
1 55  PHE n 
1 56  TRP n 
1 57  LYS n 
1 58  CYS n 
1 59  LEU n 
1 60  PHE n 
1 61  MET n 
1 62  SER n 
1 63  GLY n 
1 64  LEU n 
1 65  SER n 
1 66  GLU n 
1 67  VAL n 
1 68  GLN n 
1 69  LEU n 
1 70  ASN n 
1 71  HIS n 
1 72  MET n 
1 73  ASP n 
1 74  ASP n 
1 75  HIS n 
1 76  THR n 
1 77  LEU n 
1 78  PRO n 
1 79  GLY n 
1 80  LYS n 
1 81  TYR n 
1 82  GLY n 
1 83  ILE n 
1 84  GLY n 
1 85  PHE n 
1 86  THR n 
1 87  ASN n 
1 88  MET n 
1 89  VAL n 
1 90  GLU n 
1 91  ARG n 
1 92  THR n 
1 93  THR n 
1 94  PRO n 
1 95  GLY n 
1 96  SER n 
1 97  LYS n 
1 98  ASP n 
1 99  LEU n 
1 100 SER n 
1 101 SER n 
1 102 LYS n 
1 103 GLU n 
1 104 PHE n 
1 105 ARG n 
1 106 GLU n 
1 107 GLY n 
1 108 GLY n 
1 109 ARG n 
1 110 ILE n 
1 111 LEU n 
1 112 VAL n 
1 113 GLN n 
1 114 LYS n 
1 115 LEU n 
1 116 GLN n 
1 117 LYS n 
1 118 TYR n 
1 119 GLN n 
1 120 PRO n 
1 121 ARG n 
1 122 ILE n 
1 123 ALA n 
1 124 VAL n 
1 125 PHE n 
1 126 ASN n 
1 127 GLY n 
1 128 LYS n 
1 129 CYS n 
1 130 ILE n 
1 131 TYR n 
1 132 GLU n 
1 133 ILE n 
1 134 PHE n 
1 135 SER n 
1 136 LYS n 
1 137 GLU n 
1 138 VAL n 
1 139 PHE n 
1 140 GLY n 
1 141 VAL n 
1 142 LYS n 
1 143 VAL n 
1 144 LYS n 
1 145 ASN n 
1 146 LEU n 
1 147 GLU n 
1 148 PHE n 
1 149 GLY n 
1 150 LEU n 
1 151 GLN n 
1 152 PRO n 
1 153 HIS n 
1 154 LYS n 
1 155 ILE n 
1 156 PRO n 
1 157 ASP n 
1 158 THR n 
1 159 GLU n 
1 160 THR n 
1 161 LEU n 
1 162 CYS n 
1 163 TYR n 
1 164 VAL n 
1 165 MET n 
1 166 PRO n 
1 167 SER n 
1 168 SER n 
1 169 SER n 
1 170 ALA n 
1 171 ARG n 
1 172 CYS n 
1 173 ALA n 
1 174 GLN n 
1 175 PHE n 
1 176 PRO n 
1 177 ARG n 
1 178 ALA n 
1 179 GLN n 
1 180 ASP n 
1 181 LYS n 
1 182 VAL n 
1 183 HIS n 
1 184 TYR n 
1 185 TYR n 
1 186 ILE n 
1 187 LYS n 
1 188 LEU n 
1 189 LYS n 
1 190 ASP n 
1 191 LEU n 
1 192 ARG n 
1 193 ASP n 
1 194 GLN n 
1 195 LEU n 
1 196 LYS n 
1 197 GLY n 
1 198 ILE n 
1 199 GLU n 
1 200 ARG n 
1 201 ASN n 
1 202 MET n 
1 203 ASP n 
1 204 VAL n 
2 1   DC  n 
2 2   DA  n 
2 3   DG  n 
2 4   DC  n 
2 5   DT  n 
2 6   DC  n 
2 7   DT  n 
2 8   DG  n 
2 9   DT  n 
2 10  DA  n 
2 11  DC  n 
2 12  DG  n 
2 13  DT  n 
2 14  DG  n 
2 15  DA  n 
2 16  DG  n 
2 17  DC  n 
2 18  DG  n 
2 19  DA  n 
2 20  DT  n 
2 21  DG  n 
2 22  DG  n 
2 23  DA  n 
2 24  DC  n 
2 25  DA  n 
2 26  DG  n 
2 27  DC  n 
2 28  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DT  n 
3 5   DG  n 
3 6   DT  n 
3 7   DC  n 
3 8   DC  n 
3 9   DA  n 
3 10  DT  n 
3 11  DC  n 
3 12  DG  n 
3 13  DC  n 
3 14  DT  n 
3 15  DC  n 
3 16  DA  n 
3 17  ORP y 
3 17  AAB y 
3 18  DG  n 
3 19  DT  n 
3 20  DA  n 
3 21  DC  n 
3 22  DA  n 
3 23  DG  n 
3 24  DA  n 
3 25  DG  n 
3 26  DC  n 
3 27  DT  n 
3 28  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   204 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TDG 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 28 'synthetic construct' ? 32630 ? 
3 1 sample 1 28 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP TDG_HUMAN Q13569 ? 1 
;FNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFT
NMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMP
SSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDV
;
111 
2 PDB 4Z3A      4Z3A   ? 2 ? 1   
3 PDB 4Z3A      4Z3A   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4Z3A A 7 ? 204 ? Q13569 111 ? 308 ? 111 308 
2 2 4Z3A C 1 ? 28  ? 4Z3A   1   ? 28  ? 1   28  
3 3 4Z3A D 1 ? 28  ? 4Z3A   1   ? 28  ? 1   28  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4Z3A GLY A 1 ? UNP Q13569 ? ? 'expression tag' 105 1 
1 4Z3A SER A 2 ? UNP Q13569 ? ? 'expression tag' 106 2 
1 4Z3A HIS A 3 ? UNP Q13569 ? ? 'expression tag' 107 3 
1 4Z3A MET A 4 ? UNP Q13569 ? ? 'expression tag' 108 4 
1 4Z3A ALA A 5 ? UNP Q13569 ? ? 'expression tag' 109 5 
1 4Z3A SER A 6 ? UNP Q13569 ? ? 'expression tag' 110 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
AAB 'DNA linking'       . "2'-DEOXY-RIBOFURANOSE-5'-MONOPHOSPHATE" 'ABASIC DEOXYRIBOSE' 'C5 H11 O7 P'     214.110 
ALA 'L-peptide linking' y ALANINE                                  ?                    'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                    'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                    'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                    'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ?                    'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ?                    'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ?                    'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ?                    'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ?                    'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ?                    'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                    'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                    'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                ?                    'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                    ?                    'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                    'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                    'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                    'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                               ?                    'C5 H11 N O2 S'   149.211 
ORP saccharide          . 2-DEOXY-5-PHOSPHONO-RIBOSE               ?                    'C5 H11 O7 P'     214.110 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                    'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                    'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                   ?                    'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ?                    'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                    'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                 ?                    'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                   ?                    'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4Z3A 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.57 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.17 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M Ammonium chloride, 20% PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-01-24 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4Z3A 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             32.240 
_reflns.d_resolution_high            1.720 
_reflns.number_obs                   43547 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.6400 
_reflns.B_iso_Wilson_estimate        31.54 
_reflns.pdbx_redundancy              8.800 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.72 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   92.4 
_reflns_shell.Rmerge_I_obs           0.04400 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    0.570 
_reflns_shell.pdbx_redundancy        4.63 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4Z3A 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     42189 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.24 
_refine.ls_d_res_high                            1.72 
_refine.ls_percent_reflns_obs                    96.9 
_refine.ls_R_factor_obs                          0.200 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.226 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.760 
_refine.ls_number_reflns_R_free                  1732 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.942 
_refine.correlation_coeff_Fo_to_Fc_free          0.932 
_refine.B_iso_mean                               49.76 
_refine.aniso_B[1][1]                            -10.61530 
_refine.aniso_B[2][2]                            -0.05590 
_refine.aniso_B[3][3]                            10.67110 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            -0.03590 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4FNC 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.106 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.103 
_refine.pdbx_overall_SU_R_Blow_DPI               0.113 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.107 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        4Z3A 
_refine_analyze.Luzzati_coordinate_error_obs    0.357 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1550 
_refine_hist.pdbx_number_atoms_nucleic_acid   1135 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             185 
_refine_hist.number_atoms_total               2870 
_refine_hist.d_res_high                       1.72 
_refine_hist.d_res_low                        32.24 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.000  2949 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               0.99  ? 2.000  4229 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.000  861  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.000  34   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.000  297  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.000 2949 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           3.31  ? ?      ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           21.40 ? ?      ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.000  378  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.000  3136 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.72 
_refine_ls_shell.d_res_low                        1.76 
_refine_ls_shell.number_reflns_R_work             2760 
_refine_ls_shell.R_factor_R_work                  0.2627 
_refine_ls_shell.percent_reflns_obs               96.87 
_refine_ls_shell.R_factor_R_free                  0.2567 
_refine_ls_shell.R_factor_R_free_error            0.022 
_refine_ls_shell.percent_reflns_R_free            5.02 
_refine_ls_shell.number_reflns_R_free             146 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     4Z3A 
_struct.title                        
'Acetate-free structure of the enzyme-product complex resulting from TDG action on a GU mismatch' 
_struct.pdbx_descriptor              'G/T mismatch-specific thymine DNA glycosylase/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4Z3A 
_struct_keywords.text            'protein-DNA complex, Hydrolase-DNA complex' 
_struct_keywords.pdbx_keywords   Hydrolase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 HIS A 3   ? ASN A 8   ? HIS A 107 ASN A 112 5 ? 6  
HELX_P HELX_P2  AA2 SER A 11  ? THR A 17  ? SER A 115 THR A 121 1 ? 7  
HELX_P HELX_P3  AA3 GLY A 38  ? GLY A 45  ? GLY A 142 GLY A 149 1 ? 8  
HELX_P HELX_P4  AA4 HIS A 54  ? SER A 62  ? HIS A 158 SER A 166 1 ? 9  
HELX_P HELX_P5  AA5 ASN A 70  ? HIS A 75  ? ASN A 174 HIS A 179 5 ? 6  
HELX_P HELX_P6  AA6 THR A 76  ? GLY A 82  ? THR A 180 GLY A 186 1 ? 7  
HELX_P HELX_P7  AA7 GLY A 95  ? LEU A 99  ? GLY A 199 LEU A 203 5 ? 5  
HELX_P HELX_P8  AA8 SER A 100 ? GLN A 119 ? SER A 204 GLN A 223 1 ? 20 
HELX_P HELX_P9  AA9 GLY A 127 ? PHE A 139 ? GLY A 231 PHE A 243 1 ? 13 
HELX_P HELX_P10 AB1 ARG A 177 ? LYS A 196 ? ARG A 281 LYS A 300 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? C DA  16 "O3'" ? ? ? 1_555 C ORP 17 P  A ? D DA  16 D ORP 17 1_555 ? ? ? ? ? ? ?            1.591 ? 
covale2  covale one  ? C DA  16 "O3'" ? ? ? 1_555 C AAB 17 P  B ? D DA  16 D AAB 17 1_555 ? ? ? ? ? ? ?            1.489 ? 
covale3  covale one  ? C ORP 17 O3    A ? ? 1_555 C DG  18 P  ? ? D ORP 17 D DG  18 1_555 ? ? ? ? ? ? ?            1.596 ? 
covale4  covale one  ? C AAB 17 "O3'" B ? ? 1_555 C DG  18 P  ? ? D AAB 17 D DG  18 1_555 ? ? ? ? ? ? ?            1.636 ? 
hydrog1  hydrog ?    ? B DC  1  N3    ? ? ? 1_555 C DG  28 N1 ? ? C DC  1  D DG  28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? B DC  1  N4    ? ? ? 1_555 C DG  28 O6 ? ? C DC  1  D DG  28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? B DC  1  O2    ? ? ? 1_555 C DG  28 N2 ? ? C DC  1  D DG  28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? B DA  2  N1    ? ? ? 1_555 C DT  27 N3 ? ? C DA  2  D DT  27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? B DA  2  N6    ? ? ? 1_555 C DT  27 O4 ? ? C DA  2  D DT  27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? B DG  3  N1    ? ? ? 1_555 C DC  26 N3 ? ? C DG  3  D DC  26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? B DG  3  N2    ? ? ? 1_555 C DC  26 O2 ? ? C DG  3  D DC  26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? B DG  3  O6    ? ? ? 1_555 C DC  26 N4 ? ? C DG  3  D DC  26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? B DC  4  N3    ? ? ? 1_555 C DG  25 N1 ? ? C DC  4  D DG  25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? B DC  4  N4    ? ? ? 1_555 C DG  25 O6 ? ? C DC  4  D DG  25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? B DC  4  O2    ? ? ? 1_555 C DG  25 N2 ? ? C DC  4  D DG  25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? B DT  5  N3    ? ? ? 1_555 C DA  24 N1 ? ? C DT  5  D DA  24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? B DT  5  O4    ? ? ? 1_555 C DA  24 N6 ? ? C DT  5  D DA  24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? B DC  6  N3    ? ? ? 1_555 C DG  23 N1 ? ? C DC  6  D DG  23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? B DC  6  N4    ? ? ? 1_555 C DG  23 O6 ? ? C DC  6  D DG  23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? B DC  6  O2    ? ? ? 1_555 C DG  23 N2 ? ? C DC  6  D DG  23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? B DT  7  N3    ? ? ? 1_555 C DA  22 N1 ? ? C DT  7  D DA  22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? B DT  7  O4    ? ? ? 1_555 C DA  22 N6 ? ? C DT  7  D DA  22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? B DG  8  N1    ? ? ? 1_555 C DC  21 N3 ? ? C DG  8  D DC  21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? B DG  8  N2    ? ? ? 1_555 C DC  21 O2 ? ? C DG  8  D DC  21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? B DG  8  O6    ? ? ? 1_555 C DC  21 N4 ? ? C DG  8  D DC  21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? B DT  9  N3    ? ? ? 1_555 C DA  20 N1 ? ? C DT  9  D DA  20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? B DT  9  O4    ? ? ? 1_555 C DA  20 N6 ? ? C DT  9  D DA  20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? B DA  10 N1    ? ? ? 1_555 C DT  19 N3 ? ? C DA  10 D DT  19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? B DA  10 N6    ? ? ? 1_555 C DT  19 O4 ? ? C DA  10 D DT  19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? B DC  11 N3    ? ? ? 1_555 C DG  18 N1 ? ? C DC  11 D DG  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? B DC  11 N4    ? ? ? 1_555 C DG  18 O6 ? ? C DC  11 D DG  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? B DC  11 O2    ? ? ? 1_555 C DG  18 N2 ? ? C DC  11 D DG  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? B DT  13 N3    ? ? ? 1_555 C DA  16 N1 ? ? C DT  13 D DA  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? B DT  13 O4    ? ? ? 1_555 C DA  16 N6 ? ? C DT  13 D DA  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? B DG  14 N1    ? ? ? 1_555 C DC  15 N3 ? ? C DG  14 D DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? B DG  14 N2    ? ? ? 1_555 C DC  15 O2 ? ? C DG  14 D DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? B DG  14 O6    ? ? ? 1_555 C DC  15 N4 ? ? C DG  14 D DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? B DA  15 N1    ? ? ? 1_555 C DT  14 N3 ? ? C DA  15 D DT  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? B DA  15 N6    ? ? ? 1_555 C DT  14 O4 ? ? C DA  15 D DT  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? B DG  16 N1    ? ? ? 1_555 C DC  13 N3 ? ? C DG  16 D DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? B DG  16 N2    ? ? ? 1_555 C DC  13 O2 ? ? C DG  16 D DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? B DG  16 O6    ? ? ? 1_555 C DC  13 N4 ? ? C DG  16 D DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? B DC  17 N3    ? ? ? 1_555 C DG  12 N1 A ? C DC  17 D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? B DC  17 N4    ? ? ? 1_555 C DG  12 O6 A ? C DC  17 D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? B DC  17 O2    ? ? ? 1_555 C DG  12 N2 A ? C DC  17 D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? B DG  18 N1    ? ? ? 1_555 C DC  11 N3 A ? C DG  18 D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? B DG  18 N2    ? ? ? 1_555 C DC  11 O2 A ? C DG  18 D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? B DG  18 O6    ? ? ? 1_555 C DC  11 N4 A ? C DG  18 D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? B DA  19 N1    ? ? ? 1_555 C DT  10 N3 ? ? C DA  19 D DT  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? B DA  19 N6    ? ? ? 1_555 C DT  10 O4 ? ? C DA  19 D DT  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? B DT  20 N3    ? ? ? 1_555 C DA  9  N1 ? ? C DT  20 D DA  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? B DT  20 O4    ? ? ? 1_555 C DA  9  N6 ? ? C DT  20 D DA  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? B DG  21 N1    ? ? ? 1_555 C DC  8  N3 ? ? C DG  21 D DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? B DG  21 N2    ? ? ? 1_555 C DC  8  O2 ? ? C DG  21 D DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ?    ? B DG  21 O6    ? ? ? 1_555 C DC  8  N4 ? ? C DG  21 D DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ?    ? B DG  22 N1    ? ? ? 1_555 C DC  7  N3 ? ? C DG  22 D DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ?    ? B DG  22 N2    ? ? ? 1_555 C DC  7  O2 ? ? C DG  22 D DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ?    ? B DG  22 O6    ? ? ? 1_555 C DC  7  N4 ? ? C DG  22 D DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ?    ? B DA  23 N1    ? ? ? 1_555 C DT  6  N3 ? ? C DA  23 D DT  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ?    ? B DA  23 N6    ? ? ? 1_555 C DT  6  O4 ? ? C DA  23 D DT  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ?    ? B DC  24 N3    ? ? ? 1_555 C DG  5  N1 ? ? C DC  24 D DG  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ?    ? B DC  24 N4    ? ? ? 1_555 C DG  5  O6 ? ? C DC  24 D DG  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ?    ? B DC  24 O2    ? ? ? 1_555 C DG  5  N2 ? ? C DC  24 D DG  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ?    ? B DA  25 N1    ? ? ? 1_555 C DT  4  N3 ? ? C DA  25 D DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ?    ? B DA  25 N6    ? ? ? 1_555 C DT  4  O4 ? ? C DA  25 D DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ?    ? B DG  26 N1    ? ? ? 1_555 C DC  3  N3 ? ? C DG  26 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ?    ? B DG  26 N2    ? ? ? 1_555 C DC  3  O2 ? ? C DG  26 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ?    ? B DG  26 O6    ? ? ? 1_555 C DC  3  N4 ? ? C DG  26 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ?    ? B DC  27 N3    ? ? ? 1_555 C DG  2  N1 ? ? C DC  27 D DG  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ?    ? B DC  27 N4    ? ? ? 1_555 C DG  2  O6 ? ? C DC  27 D DG  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ?    ? B DC  27 O2    ? ? ? 1_555 C DG  2  N2 ? ? C DC  27 D DG  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ?    ? B DT  28 N3    ? ? ? 1_555 C DA  1  N1 ? ? C DT  28 D DA  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ?    ? B DT  28 O4    ? ? ? 1_555 C DA  1  N6 ? ? C DT  28 D DA  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 83  ? ASN A 87  ? ILE A 187 ASN A 191 
AA1 2 ILE A 30  ? GLY A 34  ? ILE A 134 GLY A 138 
AA1 3 ILE A 122 ? ASN A 126 ? ILE A 226 ASN A 230 
AA1 4 LEU A 161 ? MET A 165 ? LEU A 265 MET A 269 
AA1 5 GLY A 149 ? LYS A 154 ? GLY A 253 LYS A 258 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLY A 84  ? O GLY A 188 N ILE A 32  ? N ILE A 136 
AA1 2 3 N ILE A 33  ? N ILE A 137 O VAL A 124 ? O VAL A 228 
AA1 3 4 N ALA A 123 ? N ALA A 227 O LEU A 161 ? O LEU A 265 
AA1 4 5 O VAL A 164 ? O VAL A 268 N GLY A 149 ? N GLY A 253 
# 
_atom_sites.entry_id                    4Z3A 
_atom_sites.fract_transf_matrix[1][1]   0.010509 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000930 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018669 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012335 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLY A 1 1   ? 34.339  -1.617  40.917 1.00 66.45  ? 105 GLY A N     1 
ATOM   2    C CA    . GLY A 1 1   ? 34.349  -3.028  40.559 1.00 61.22  ? 105 GLY A CA    1 
ATOM   3    C C     . GLY A 1 1   ? 33.102  -3.504  39.836 1.00 64.77  ? 105 GLY A C     1 
ATOM   4    O O     . GLY A 1 1   ? 31.994  -3.037  40.122 1.00 63.22  ? 105 GLY A O     1 
ATOM   5    N N     . SER A 1 2   ? 33.287  -4.477  38.906 1.00 61.82  ? 106 SER A N     1 
ATOM   6    C CA    . SER A 1 2   ? 32.230  -5.103  38.098 1.00 60.32  ? 106 SER A CA    1 
ATOM   7    C C     . SER A 1 2   ? 31.272  -5.969  38.949 1.00 59.73  ? 106 SER A C     1 
ATOM   8    O O     . SER A 1 2   ? 31.562  -6.225  40.128 1.00 56.57  ? 106 SER A O     1 
ATOM   9    C CB    . SER A 1 2   ? 32.840  -5.908  36.950 1.00 65.03  ? 106 SER A CB    1 
ATOM   10   O OG    . SER A 1 2   ? 33.524  -7.060  37.412 1.00 74.32  ? 106 SER A OG    1 
ATOM   11   N N     . HIS A 1 3   ? 30.130  -6.410  38.341 1.00 55.16  ? 107 HIS A N     1 
ATOM   12   C CA    A HIS A 1 3   ? 29.097  -7.206  39.006 0.50 51.04  ? 107 HIS A CA    1 
ATOM   13   C CA    B HIS A 1 3   ? 29.108  -7.205  39.022 0.50 51.03  ? 107 HIS A CA    1 
ATOM   14   C C     . HIS A 1 3   ? 28.982  -8.639  38.484 1.00 52.55  ? 107 HIS A C     1 
ATOM   15   O O     . HIS A 1 3   ? 27.888  -9.209  38.495 1.00 49.42  ? 107 HIS A O     1 
ATOM   16   C CB    A HIS A 1 3   ? 27.730  -6.489  38.954 0.50 53.37  ? 107 HIS A CB    1 
ATOM   17   C CB    B HIS A 1 3   ? 27.750  -6.473  39.017 0.50 53.38  ? 107 HIS A CB    1 
ATOM   18   C CG    A HIS A 1 3   ? 27.781  -5.064  39.399 0.50 60.76  ? 107 HIS A CG    1 
ATOM   19   C CG    B HIS A 1 3   ? 27.834  -5.060  39.504 0.50 60.62  ? 107 HIS A CG    1 
ATOM   20   N ND1   A HIS A 1 3   ? 28.671  -4.641  40.368 0.50 62.72  ? 107 HIS A ND1   1 
ATOM   21   N ND1   B HIS A 1 3   ? 27.091  -4.054  38.923 0.50 66.95  ? 107 HIS A ND1   1 
ATOM   22   C CD2   A HIS A 1 3   ? 27.054  -4.004  38.980 0.50 67.12  ? 107 HIS A CD2   1 
ATOM   23   C CD2   B HIS A 1 3   ? 28.614  -4.524  40.471 0.50 62.90  ? 107 HIS A CD2   1 
ATOM   24   C CE1   A HIS A 1 3   ? 28.479  -3.341  40.488 0.50 66.63  ? 107 HIS A CE1   1 
ATOM   25   C CE1   B HIS A 1 3   ? 27.432  -2.948  39.564 0.50 69.65  ? 107 HIS A CE1   1 
ATOM   26   N NE2   A HIS A 1 3   ? 27.499  -2.916  39.693 0.50 70.04  ? 107 HIS A NE2   1 
ATOM   27   N NE2   B HIS A 1 3   ? 28.353  -3.182  40.492 0.50 67.46  ? 107 HIS A NE2   1 
ATOM   28   N N     . MET A 1 4   ? 30.112  -9.255  38.080 1.00 51.52  ? 108 MET A N     1 
ATOM   29   C CA    . MET A 1 4   ? 30.122  -10.646 37.591 1.00 49.82  ? 108 MET A CA    1 
ATOM   30   C C     . MET A 1 4   ? 29.612  -11.631 38.690 1.00 51.24  ? 108 MET A C     1 
ATOM   31   O O     . MET A 1 4   ? 29.134  -12.724 38.362 1.00 47.94  ? 108 MET A O     1 
ATOM   32   C CB    . MET A 1 4   ? 31.524  -11.046 37.089 1.00 53.54  ? 108 MET A CB    1 
ATOM   33   N N     . ALA A 1 5   ? 29.660  -11.202 39.982 1.00 48.33  ? 109 ALA A N     1 
ATOM   34   C CA    . ALA A 1 5   ? 29.167  -11.993 41.123 1.00 46.90  ? 109 ALA A CA    1 
ATOM   35   C C     . ALA A 1 5   ? 27.649  -12.267 40.988 1.00 47.08  ? 109 ALA A C     1 
ATOM   36   O O     . ALA A 1 5   ? 27.191  -13.320 41.399 1.00 44.88  ? 109 ALA A O     1 
ATOM   37   C CB    . ALA A 1 5   ? 29.462  -11.278 42.428 1.00 48.69  ? 109 ALA A CB    1 
ATOM   38   N N     . SER A 1 6   ? 26.894  -11.340 40.341 1.00 44.41  ? 110 SER A N     1 
ATOM   39   C CA    . SER A 1 6   ? 25.457  -11.481 40.078 1.00 44.50  ? 110 SER A CA    1 
ATOM   40   C C     . SER A 1 6   ? 25.159  -12.674 39.122 1.00 45.72  ? 110 SER A C     1 
ATOM   41   O O     . SER A 1 6   ? 23.996  -13.072 39.000 1.00 44.97  ? 110 SER A O     1 
ATOM   42   C CB    . SER A 1 6   ? 24.901  -10.196 39.484 1.00 52.21  ? 110 SER A CB    1 
ATOM   43   O OG    . SER A 1 6   ? 25.413  -10.023 38.172 1.00 60.72  ? 110 SER A OG    1 
ATOM   44   N N     . PHE A 1 7   ? 26.204  -13.231 38.448 1.00 39.80  ? 111 PHE A N     1 
ATOM   45   C CA    . PHE A 1 7   ? 26.051  -14.391 37.558 1.00 37.78  ? 111 PHE A CA    1 
ATOM   46   C C     . PHE A 1 7   ? 26.305  -15.705 38.294 1.00 39.67  ? 111 PHE A C     1 
ATOM   47   O O     . PHE A 1 7   ? 26.188  -16.788 37.709 1.00 36.91  ? 111 PHE A O     1 
ATOM   48   C CB    . PHE A 1 7   ? 26.868  -14.264 36.273 1.00 40.68  ? 111 PHE A CB    1 
ATOM   49   C CG    . PHE A 1 7   ? 26.450  -13.079 35.426 1.00 43.49  ? 111 PHE A CG    1 
ATOM   50   C CD1   . PHE A 1 7   ? 25.152  -12.971 34.940 1.00 46.53  ? 111 PHE A CD1   1 
ATOM   51   C CD2   . PHE A 1 7   ? 27.350  -12.056 35.140 1.00 48.18  ? 111 PHE A CD2   1 
ATOM   52   C CE1   . PHE A 1 7   ? 24.768  -11.872 34.156 1.00 49.96  ? 111 PHE A CE1   1 
ATOM   53   C CE2   . PHE A 1 7   ? 26.967  -10.961 34.350 1.00 53.48  ? 111 PHE A CE2   1 
ATOM   54   C CZ    . PHE A 1 7   ? 25.675  -10.869 33.881 1.00 51.30  ? 111 PHE A CZ    1 
ATOM   55   N N     . ASN A 1 8   ? 26.653  -15.603 39.604 1.00 36.32  ? 112 ASN A N     1 
ATOM   56   C CA    . ASN A 1 8   ? 26.732  -16.751 40.488 1.00 37.31  ? 112 ASN A CA    1 
ATOM   57   C C     . ASN A 1 8   ? 27.533  -17.961 39.896 1.00 43.23  ? 112 ASN A C     1 
ATOM   58   O O     . ASN A 1 8   ? 27.073  -19.100 39.924 1.00 43.95  ? 112 ASN A O     1 
ATOM   59   C CB    . ASN A 1 8   ? 25.250  -17.123 40.854 1.00 36.77  ? 112 ASN A CB    1 
ATOM   60   C CG    . ASN A 1 8   ? 25.059  -18.183 41.905 1.00 45.32  ? 112 ASN A CG    1 
ATOM   61   O OD1   . ASN A 1 8   ? 25.739  -18.213 42.932 1.00 37.99  ? 112 ASN A OD1   1 
ATOM   62   N ND2   . ASN A 1 8   ? 24.110  -19.078 41.653 1.00 44.12  ? 112 ASN A ND2   1 
ATOM   63   N N     . GLY A 1 9   ? 28.712  -17.690 39.347 1.00 41.84  ? 113 GLY A N     1 
ATOM   64   C CA    . GLY A 1 9   ? 29.600  -18.727 38.818 1.00 43.29  ? 113 GLY A CA    1 
ATOM   65   C C     . GLY A 1 9   ? 29.262  -19.293 37.453 1.00 48.23  ? 113 GLY A C     1 
ATOM   66   O O     . GLY A 1 9   ? 29.858  -20.289 37.034 1.00 49.56  ? 113 GLY A O     1 
ATOM   67   N N     . VAL A 1 10  ? 28.321  -18.656 36.739 1.00 42.95  ? 114 VAL A N     1 
ATOM   68   C CA    . VAL A 1 10  ? 27.955  -19.047 35.380 1.00 42.11  ? 114 VAL A CA    1 
ATOM   69   C C     . VAL A 1 10  ? 28.838  -18.182 34.475 1.00 47.44  ? 114 VAL A C     1 
ATOM   70   O O     . VAL A 1 10  ? 28.917  -16.965 34.679 1.00 45.50  ? 114 VAL A O     1 
ATOM   71   C CB    . VAL A 1 10  ? 26.436  -18.853 35.131 1.00 44.30  ? 114 VAL A CB    1 
ATOM   72   C CG1   . VAL A 1 10  ? 26.052  -19.177 33.683 1.00 44.35  ? 114 VAL A CG1   1 
ATOM   73   C CG2   . VAL A 1 10  ? 25.617  -19.685 36.118 1.00 43.57  ? 114 VAL A CG2   1 
ATOM   74   N N     . SER A 1 11  ? 29.522  -18.805 33.503 1.00 46.65  ? 115 SER A N     1 
ATOM   75   C CA    . SER A 1 11  ? 30.429  -18.080 32.602 1.00 48.55  ? 115 SER A CA    1 
ATOM   76   C C     . SER A 1 11  ? 29.708  -17.263 31.533 1.00 51.53  ? 115 SER A C     1 
ATOM   77   O O     . SER A 1 11  ? 28.575  -17.585 31.151 1.00 48.09  ? 115 SER A O     1 
ATOM   78   C CB    . SER A 1 11  ? 31.431  -19.038 31.954 1.00 53.97  ? 115 SER A CB    1 
ATOM   79   O OG    . SER A 1 11  ? 30.778  -19.956 31.091 1.00 61.37  ? 115 SER A OG    1 
ATOM   80   N N     . GLU A 1 12  ? 30.403  -16.223 31.019 1.00 52.22  ? 116 GLU A N     1 
ATOM   81   C CA    . GLU A 1 12  ? 29.928  -15.338 29.954 1.00 53.76  ? 116 GLU A CA    1 
ATOM   82   C C     . GLU A 1 12  ? 29.641  -16.156 28.690 1.00 58.20  ? 116 GLU A C     1 
ATOM   83   O O     . GLU A 1 12  ? 28.596  -15.955 28.075 1.00 57.15  ? 116 GLU A O     1 
ATOM   84   C CB    . GLU A 1 12  ? 30.952  -14.221 29.684 1.00 59.43  ? 116 GLU A CB    1 
ATOM   85   C CG    . GLU A 1 12  ? 30.458  -13.117 28.758 1.00 72.75  ? 116 GLU A CG    1 
ATOM   86   C CD    . GLU A 1 12  ? 31.085  -11.759 29.008 1.00 100.23 ? 116 GLU A CD    1 
ATOM   87   O OE1   . GLU A 1 12  ? 31.807  -11.260 28.115 1.00 101.28 ? 116 GLU A OE1   1 
ATOM   88   O OE2   . GLU A 1 12  ? 30.847  -11.188 30.097 1.00 95.55  ? 116 GLU A OE2   1 
ATOM   89   N N     . ALA A 1 13  ? 30.535  -17.114 28.348 1.00 60.64  ? 117 ALA A N     1 
ATOM   90   C CA    . ALA A 1 13  ? 30.410  -18.014 27.194 1.00 62.08  ? 117 ALA A CA    1 
ATOM   91   C C     . ALA A 1 13  ? 29.093  -18.813 27.210 1.00 65.09  ? 117 ALA A C     1 
ATOM   92   O O     . ALA A 1 13  ? 28.443  -18.919 26.167 1.00 65.15  ? 117 ALA A O     1 
ATOM   93   C CB    . ALA A 1 13  ? 31.603  -18.958 27.129 1.00 66.43  ? 117 ALA A CB    1 
ATOM   94   N N     . GLU A 1 14  ? 28.681  -19.328 28.397 1.00 60.19  ? 118 GLU A N     1 
ATOM   95   C CA    . GLU A 1 14  ? 27.429  -20.076 28.597 1.00 59.03  ? 118 GLU A CA    1 
ATOM   96   C C     . GLU A 1 14  ? 26.218  -19.158 28.356 1.00 58.45  ? 118 GLU A C     1 
ATOM   97   O O     . GLU A 1 14  ? 25.299  -19.529 27.621 1.00 57.59  ? 118 GLU A O     1 
ATOM   98   C CB    . GLU A 1 14  ? 27.382  -20.689 30.009 1.00 61.79  ? 118 GLU A CB    1 
ATOM   99   C CG    . GLU A 1 14  ? 26.370  -21.814 30.166 1.00 77.99  ? 118 GLU A CG    1 
ATOM   100  C CD    . GLU A 1 14  ? 26.449  -22.584 31.472 1.00 109.53 ? 118 GLU A CD    1 
ATOM   101  O OE1   . GLU A 1 14  ? 27.471  -23.272 31.701 1.00 107.97 ? 118 GLU A OE1   1 
ATOM   102  O OE2   . GLU A 1 14  ? 25.466  -22.539 32.246 1.00 107.64 ? 118 GLU A OE2   1 
ATOM   103  N N     . LEU A 1 15  ? 26.263  -17.931 28.917 1.00 51.40  ? 119 LEU A N     1 
ATOM   104  C CA    . LEU A 1 15  ? 25.202  -16.938 28.756 1.00 47.55  ? 119 LEU A CA    1 
ATOM   105  C C     . LEU A 1 15  ? 24.983  -16.529 27.303 1.00 50.42  ? 119 LEU A C     1 
ATOM   106  O O     . LEU A 1 15  ? 23.832  -16.368 26.892 1.00 49.33  ? 119 LEU A O     1 
ATOM   107  C CB    . LEU A 1 15  ? 25.455  -15.705 29.632 1.00 45.59  ? 119 LEU A CB    1 
ATOM   108  C CG    . LEU A 1 15  ? 25.513  -15.937 31.142 1.00 50.15  ? 119 LEU A CG    1 
ATOM   109  C CD1   . LEU A 1 15  ? 25.765  -14.637 31.857 1.00 48.97  ? 119 LEU A CD1   1 
ATOM   110  C CD2   . LEU A 1 15  ? 24.230  -16.563 31.665 1.00 49.90  ? 119 LEU A CD2   1 
ATOM   111  N N     . LEU A 1 16  ? 26.075  -16.401 26.516 1.00 48.23  ? 120 LEU A N     1 
ATOM   112  C CA    . LEU A 1 16  ? 26.021  -15.997 25.096 1.00 47.34  ? 120 LEU A CA    1 
ATOM   113  C C     . LEU A 1 16  ? 25.222  -16.947 24.201 1.00 51.80  ? 120 LEU A C     1 
ATOM   114  O O     . LEU A 1 16  ? 24.723  -16.512 23.155 1.00 51.35  ? 120 LEU A O     1 
ATOM   115  C CB    . LEU A 1 16  ? 27.421  -15.765 24.513 1.00 48.97  ? 120 LEU A CB    1 
ATOM   116  C CG    . LEU A 1 16  ? 28.276  -14.688 25.186 1.00 53.35  ? 120 LEU A CG    1 
ATOM   117  C CD1   . LEU A 1 16  ? 29.722  -14.765 24.713 1.00 55.60  ? 120 LEU A CD1   1 
ATOM   118  C CD2   . LEU A 1 16  ? 27.679  -13.292 25.034 1.00 53.14  ? 120 LEU A CD2   1 
ATOM   119  N N     . THR A 1 17  ? 25.062  -18.214 24.621 1.00 49.17  ? 121 THR A N     1 
ATOM   120  C CA    . THR A 1 17  ? 24.286  -19.223 23.885 1.00 50.83  ? 121 THR A CA    1 
ATOM   121  C C     . THR A 1 17  ? 22.797  -19.256 24.298 1.00 52.51  ? 121 THR A C     1 
ATOM   122  O O     . THR A 1 17  ? 21.979  -19.852 23.596 1.00 52.59  ? 121 THR A O     1 
ATOM   123  C CB    . THR A 1 17  ? 24.936  -20.613 24.001 1.00 65.27  ? 121 THR A CB    1 
ATOM   124  O OG1   . THR A 1 17  ? 24.777  -21.098 25.335 1.00 67.39  ? 121 THR A OG1   1 
ATOM   125  C CG2   . THR A 1 17  ? 26.413  -20.623 23.582 1.00 64.89  ? 121 THR A CG2   1 
ATOM   126  N N     . LYS A 1 18  ? 22.450  -18.615 25.429 1.00 47.18  ? 122 LYS A N     1 
ATOM   127  C CA    . LYS A 1 18  ? 21.076  -18.571 25.931 1.00 45.16  ? 122 LYS A CA    1 
ATOM   128  C C     . LYS A 1 18  ? 20.218  -17.565 25.165 1.00 47.25  ? 122 LYS A C     1 
ATOM   129  O O     . LYS A 1 18  ? 20.735  -16.622 24.567 1.00 44.71  ? 122 LYS A O     1 
ATOM   130  C CB    . LYS A 1 18  ? 21.024  -18.301 27.442 1.00 46.55  ? 122 LYS A CB    1 
ATOM   131  C CG    . LYS A 1 18  ? 21.531  -19.468 28.297 1.00 55.75  ? 122 LYS A CG    1 
ATOM   132  C CD    . LYS A 1 18  ? 21.347  -19.203 29.804 1.00 61.83  ? 122 LYS A CD    1 
ATOM   133  C CE    . LYS A 1 18  ? 20.031  -19.735 30.347 1.00 67.93  ? 122 LYS A CE    1 
ATOM   134  N NZ    . LYS A 1 18  ? 19.646  -19.084 31.635 1.00 65.86  ? 122 LYS A NZ    1 
ATOM   135  N N     . THR A 1 19  ? 18.908  -17.801 25.156 1.00 44.77  ? 123 THR A N     1 
ATOM   136  C CA    . THR A 1 19  ? 17.921  -16.949 24.498 1.00 43.44  ? 123 THR A CA    1 
ATOM   137  C C     . THR A 1 19  ? 16.855  -16.585 25.526 1.00 43.82  ? 123 THR A C     1 
ATOM   138  O O     . THR A 1 19  ? 16.784  -17.169 26.615 1.00 44.32  ? 123 THR A O     1 
ATOM   139  C CB    . THR A 1 19  ? 17.270  -17.651 23.268 1.00 54.74  ? 123 THR A CB    1 
ATOM   140  O OG1   . THR A 1 19  ? 16.614  -18.835 23.715 1.00 52.46  ? 123 THR A OG1   1 
ATOM   141  C CG2   . THR A 1 19  ? 18.261  -17.959 22.136 1.00 55.69  ? 123 THR A CG2   1 
ATOM   142  N N     . LEU A 1 20  ? 16.000  -15.664 25.139 1.00 37.22  ? 124 LEU A N     1 
ATOM   143  C CA    . LEU A 1 20  ? 14.933  -15.153 25.961 1.00 35.80  ? 124 LEU A CA    1 
ATOM   144  C C     . LEU A 1 20  ? 13.623  -15.405 25.202 1.00 40.59  ? 124 LEU A C     1 
ATOM   145  O O     . LEU A 1 20  ? 13.453  -14.864 24.112 1.00 41.24  ? 124 LEU A O     1 
ATOM   146  C CB    . LEU A 1 20  ? 15.195  -13.643 26.154 1.00 34.28  ? 124 LEU A CB    1 
ATOM   147  C CG    . LEU A 1 20  ? 14.369  -12.894 27.153 1.00 39.23  ? 124 LEU A CG    1 
ATOM   148  C CD1   . LEU A 1 20  ? 14.569  -13.465 28.568 1.00 40.97  ? 124 LEU A CD1   1 
ATOM   149  C CD2   . LEU A 1 20  ? 14.744  -11.406 27.115 1.00 39.98  ? 124 LEU A CD2   1 
ATOM   150  N N     . PRO A 1 21  ? 12.696  -16.242 25.701 1.00 36.11  ? 125 PRO A N     1 
ATOM   151  C CA    . PRO A 1 21  ? 11.467  -16.475 24.928 1.00 36.30  ? 125 PRO A CA    1 
ATOM   152  C C     . PRO A 1 21  ? 10.574  -15.252 24.830 1.00 37.67  ? 125 PRO A C     1 
ATOM   153  O O     . PRO A 1 21  ? 10.572  -14.414 25.733 1.00 36.37  ? 125 PRO A O     1 
ATOM   154  C CB    . PRO A 1 21  ? 10.782  -17.644 25.660 1.00 41.08  ? 125 PRO A CB    1 
ATOM   155  C CG    . PRO A 1 21  ? 11.837  -18.208 26.623 1.00 46.10  ? 125 PRO A CG    1 
ATOM   156  C CD    . PRO A 1 21  ? 12.716  -17.027 26.953 1.00 39.40  ? 125 PRO A CD    1 
ATOM   157  N N     . ASP A 1 22  ? 9.829   -15.133 23.725 1.00 34.21  ? 126 ASP A N     1 
ATOM   158  C CA    . ASP A 1 22  ? 8.876   -14.039 23.531 1.00 34.28  ? 126 ASP A CA    1 
ATOM   159  C C     . ASP A 1 22  ? 7.676   -14.280 24.455 1.00 38.85  ? 126 ASP A C     1 
ATOM   160  O O     . ASP A 1 22  ? 7.398   -15.431 24.795 1.00 38.11  ? 126 ASP A O     1 
ATOM   161  C CB    . ASP A 1 22  ? 8.335   -14.056 22.089 1.00 36.35  ? 126 ASP A CB    1 
ATOM   162  C CG    . ASP A 1 22  ? 9.287   -13.670 20.965 1.00 49.08  ? 126 ASP A CG    1 
ATOM   163  O OD1   . ASP A 1 22  ? 10.331  -13.037 21.249 1.00 48.74  ? 126 ASP A OD1   1 
ATOM   164  O OD2   . ASP A 1 22  ? 8.964   -13.964 19.796 1.00 60.43  ? 126 ASP A OD2   1 
ATOM   165  N N     . ILE A 1 23  ? 6.961   -13.204 24.843 1.00 34.39  ? 127 ILE A N     1 
ATOM   166  C CA    . ILE A 1 23  ? 5.724   -13.281 25.630 1.00 33.91  ? 127 ILE A CA    1 
ATOM   167  C C     . ILE A 1 23  ? 4.679   -12.595 24.763 1.00 35.28  ? 127 ILE A C     1 
ATOM   168  O O     . ILE A 1 23  ? 4.514   -11.378 24.831 1.00 32.30  ? 127 ILE A O     1 
ATOM   169  C CB    . ILE A 1 23  ? 5.869   -12.651 27.046 1.00 35.81  ? 127 ILE A CB    1 
ATOM   170  C CG1   . ILE A 1 23  ? 7.037   -13.318 27.814 1.00 34.08  ? 127 ILE A CG1   1 
ATOM   171  C CG2   . ILE A 1 23  ? 4.525   -12.814 27.839 1.00 37.27  ? 127 ILE A CG2   1 
ATOM   172  C CD1   . ILE A 1 23  ? 7.417   -12.588 29.087 1.00 36.22  ? 127 ILE A CD1   1 
ATOM   173  N N     . LEU A 1 24  ? 4.063   -13.358 23.868 1.00 35.87  ? 128 LEU A N     1 
ATOM   174  C CA    . LEU A 1 24  ? 3.097   -12.830 22.917 1.00 36.76  ? 128 LEU A CA    1 
ATOM   175  C C     . LEU A 1 24  ? 1.812   -13.599 22.893 1.00 41.41  ? 128 LEU A C     1 
ATOM   176  O O     . LEU A 1 24  ? 1.815   -14.820 22.963 1.00 41.36  ? 128 LEU A O     1 
ATOM   177  C CB    . LEU A 1 24  ? 3.694   -12.816 21.485 1.00 36.70  ? 128 LEU A CB    1 
ATOM   178  C CG    . LEU A 1 24  ? 4.919   -11.913 21.253 1.00 38.68  ? 128 LEU A CG    1 
ATOM   179  C CD1   . LEU A 1 24  ? 5.674   -12.292 19.987 1.00 39.31  ? 128 LEU A CD1   1 
ATOM   180  C CD2   . LEU A 1 24  ? 4.553   -10.423 21.267 1.00 39.02  ? 128 LEU A CD2   1 
ATOM   181  N N     . THR A 1 25  ? 0.705   -12.866 22.816 1.00 39.27  ? 129 THR A N     1 
ATOM   182  C CA    . THR A 1 25  ? -0.647  -13.395 22.681 1.00 43.01  ? 129 THR A CA    1 
ATOM   183  C C     . THR A 1 25  ? -1.351  -12.463 21.687 1.00 46.09  ? 129 THR A C     1 
ATOM   184  O O     . THR A 1 25  ? -0.842  -11.376 21.366 1.00 43.90  ? 129 THR A O     1 
ATOM   185  C CB    . THR A 1 25  ? -1.424  -13.458 24.048 1.00 59.16  ? 129 THR A CB    1 
ATOM   186  O OG1   . THR A 1 25  ? -1.807  -12.146 24.471 1.00 58.76  ? 129 THR A OG1   1 
ATOM   187  C CG2   . THR A 1 25  ? -0.664  -14.181 25.166 1.00 60.17  ? 129 THR A CG2   1 
ATOM   188  N N     . PHE A 1 26  ? -2.529  -12.864 21.240 1.00 43.28  ? 130 PHE A N     1 
ATOM   189  C CA    . PHE A 1 26  ? -3.353  -12.029 20.380 1.00 44.95  ? 130 PHE A CA    1 
ATOM   190  C C     . PHE A 1 26  ? -4.051  -10.995 21.283 1.00 50.82  ? 130 PHE A C     1 
ATOM   191  O O     . PHE A 1 26  ? -4.041  -11.140 22.514 1.00 51.56  ? 130 PHE A O     1 
ATOM   192  C CB    . PHE A 1 26  ? -4.412  -12.903 19.665 1.00 49.63  ? 130 PHE A CB    1 
ATOM   193  C CG    . PHE A 1 26  ? -3.802  -13.929 18.740 1.00 52.57  ? 130 PHE A CG    1 
ATOM   194  C CD1   . PHE A 1 26  ? -3.395  -13.578 17.458 1.00 56.35  ? 130 PHE A CD1   1 
ATOM   195  C CD2   . PHE A 1 26  ? -3.602  -15.236 19.161 1.00 57.24  ? 130 PHE A CD2   1 
ATOM   196  C CE1   . PHE A 1 26  ? -2.808  -14.520 16.609 1.00 58.83  ? 130 PHE A CE1   1 
ATOM   197  C CE2   . PHE A 1 26  ? -3.023  -16.181 18.309 1.00 61.71  ? 130 PHE A CE2   1 
ATOM   198  C CZ    . PHE A 1 26  ? -2.632  -15.819 17.037 1.00 59.63  ? 130 PHE A CZ    1 
ATOM   199  N N     . ASN A 1 27  ? -4.645  -9.954  20.670 1.00 47.20  ? 131 ASN A N     1 
ATOM   200  C CA    . ASN A 1 27  ? -5.421  -8.906  21.337 1.00 47.80  ? 131 ASN A CA    1 
ATOM   201  C C     . ASN A 1 27  ? -4.652  -8.105  22.399 1.00 47.69  ? 131 ASN A C     1 
ATOM   202  O O     . ASN A 1 27  ? -5.271  -7.604  23.342 1.00 49.17  ? 131 ASN A O     1 
ATOM   203  C CB    . ASN A 1 27  ? -6.724  -9.489  21.933 1.00 50.94  ? 131 ASN A CB    1 
ATOM   204  C CG    . ASN A 1 27  ? -7.645  -10.085 20.893 1.00 81.56  ? 131 ASN A CG    1 
ATOM   205  O OD1   . ASN A 1 27  ? -7.965  -11.279 20.924 1.00 78.04  ? 131 ASN A OD1   1 
ATOM   206  N ND2   . ASN A 1 27  ? -8.078  -9.270  19.936 1.00 76.49  ? 131 ASN A ND2   1 
ATOM   207  N N     . LEU A 1 28  ? -3.323  -7.973  22.248 1.00 40.37  ? 132 LEU A N     1 
ATOM   208  C CA    . LEU A 1 28  ? -2.520  -7.195  23.182 1.00 38.16  ? 132 LEU A CA    1 
ATOM   209  C C     . LEU A 1 28  ? -2.671  -5.709  22.861 1.00 42.67  ? 132 LEU A C     1 
ATOM   210  O O     . LEU A 1 28  ? -2.899  -5.347  21.704 1.00 41.11  ? 132 LEU A O     1 
ATOM   211  C CB    . LEU A 1 28  ? -1.027  -7.573  23.102 1.00 35.10  ? 132 LEU A CB    1 
ATOM   212  C CG    . LEU A 1 28  ? -0.604  -8.907  23.730 1.00 38.95  ? 132 LEU A CG    1 
ATOM   213  C CD1   . LEU A 1 28  ? 0.839   -9.170  23.488 1.00 35.95  ? 132 LEU A CD1   1 
ATOM   214  C CD2   . LEU A 1 28  ? -0.831  -8.919  25.219 1.00 43.84  ? 132 LEU A CD2   1 
ATOM   215  N N     . ASP A 1 29  ? -2.536  -4.850  23.878 1.00 39.10  ? 133 ASP A N     1 
ATOM   216  C CA    . ASP A 1 29  ? -2.586  -3.418  23.632 1.00 39.67  ? 133 ASP A CA    1 
ATOM   217  C C     . ASP A 1 29  ? -1.208  -2.996  23.193 1.00 40.49  ? 133 ASP A C     1 
ATOM   218  O O     . ASP A 1 29  ? -1.064  -2.179  22.290 1.00 40.33  ? 133 ASP A O     1 
ATOM   219  C CB    . ASP A 1 29  ? -2.972  -2.646  24.910 1.00 43.53  ? 133 ASP A CB    1 
ATOM   220  C CG    . ASP A 1 29  ? -4.407  -2.839  25.386 1.00 63.94  ? 133 ASP A CG    1 
ATOM   221  O OD1   . ASP A 1 29  ? -5.306  -2.994  24.524 1.00 68.97  ? 133 ASP A OD1   1 
ATOM   222  O OD2   . ASP A 1 29  ? -4.641  -2.765  26.622 1.00 69.45  ? 133 ASP A OD2   1 
ATOM   223  N N     . ILE A 1 30  ? -0.179  -3.559  23.837 1.00 35.86  ? 134 ILE A N     1 
ATOM   224  C CA    . ILE A 1 30  ? 1.205   -3.134  23.628 1.00 32.24  ? 134 ILE A CA    1 
ATOM   225  C C     . ILE A 1 30  ? 2.156   -4.307  23.527 1.00 33.54  ? 134 ILE A C     1 
ATOM   226  O O     . ILE A 1 30  ? 2.050   -5.235  24.319 1.00 31.47  ? 134 ILE A O     1 
ATOM   227  C CB    . ILE A 1 30  ? 1.597   -2.209  24.838 1.00 34.57  ? 134 ILE A CB    1 
ATOM   228  C CG1   . ILE A 1 30  ? 0.831   -0.828  24.820 1.00 35.86  ? 134 ILE A CG1   1 
ATOM   229  C CG2   . ILE A 1 30  ? 3.119   -2.017  24.951 1.00 32.86  ? 134 ILE A CG2   1 
ATOM   230  C CD1   . ILE A 1 30  ? 0.855   -0.036  26.141 1.00 36.66  ? 134 ILE A CD1   1 
ATOM   231  N N     . VAL A 1 31  ? 3.170   -4.206  22.640 1.00 29.51  ? 135 VAL A N     1 
ATOM   232  C CA    . VAL A 1 31  ? 4.257   -5.173  22.572 1.00 27.41  ? 135 VAL A CA    1 
ATOM   233  C C     . VAL A 1 31  ? 5.527   -4.370  22.740 1.00 28.71  ? 135 VAL A C     1 
ATOM   234  O O     . VAL A 1 31  ? 5.732   -3.424  21.985 1.00 27.94  ? 135 VAL A O     1 
ATOM   235  C CB    . VAL A 1 31  ? 4.264   -6.072  21.293 1.00 32.35  ? 135 VAL A CB    1 
ATOM   236  C CG1   . VAL A 1 31  ? 5.576   -6.832  21.169 1.00 32.04  ? 135 VAL A CG1   1 
ATOM   237  C CG2   . VAL A 1 31  ? 3.102   -7.060  21.314 1.00 32.43  ? 135 VAL A CG2   1 
ATOM   238  N N     . ILE A 1 32  ? 6.337   -4.678  23.777 1.00 25.99  ? 136 ILE A N     1 
ATOM   239  C CA    . ILE A 1 32  ? 7.610   -3.982  24.000 1.00 24.67  ? 136 ILE A CA    1 
ATOM   240  C C     . ILE A 1 32  ? 8.639   -4.762  23.170 1.00 25.94  ? 136 ILE A C     1 
ATOM   241  O O     . ILE A 1 32  ? 8.855   -5.935  23.438 1.00 25.24  ? 136 ILE A O     1 
ATOM   242  C CB    . ILE A 1 32  ? 8.064   -3.964  25.506 1.00 26.23  ? 136 ILE A CB    1 
ATOM   243  C CG1   . ILE A 1 32  ? 6.974   -3.416  26.480 1.00 26.94  ? 136 ILE A CG1   1 
ATOM   244  C CG2   . ILE A 1 32  ? 9.383   -3.202  25.660 1.00 24.29  ? 136 ILE A CG2   1 
ATOM   245  C CD1   . ILE A 1 32  ? 6.499   -1.880  26.289 1.00 32.38  ? 136 ILE A CD1   1 
ATOM   246  N N     . ILE A 1 33  ? 9.326   -4.082  22.250 1.00 23.90  ? 137 ILE A N     1 
ATOM   247  C CA    . ILE A 1 33  ? 10.341  -4.687  21.372 1.00 22.99  ? 137 ILE A CA    1 
ATOM   248  C C     . ILE A 1 33  ? 11.688  -4.216  21.857 1.00 25.57  ? 137 ILE A C     1 
ATOM   249  O O     . ILE A 1 33  ? 12.043  -3.044  21.698 1.00 24.82  ? 137 ILE A O     1 
ATOM   250  C CB    . ILE A 1 33  ? 10.119  -4.312  19.874 1.00 26.09  ? 137 ILE A CB    1 
ATOM   251  C CG1   . ILE A 1 33  ? 8.712   -4.706  19.379 1.00 27.08  ? 137 ILE A CG1   1 
ATOM   252  C CG2   . ILE A 1 33  ? 11.230  -4.893  18.969 1.00 26.93  ? 137 ILE A CG2   1 
ATOM   253  C CD1   . ILE A 1 33  ? 8.221   -3.872  18.124 1.00 27.83  ? 137 ILE A CD1   1 
ATOM   254  N N     . GLY A 1 34  ? 12.432  -5.125  22.468 1.00 22.81  ? 138 GLY A N     1 
ATOM   255  C CA    . GLY A 1 34  ? 13.759  -4.763  22.927 1.00 22.15  ? 138 GLY A CA    1 
ATOM   256  C C     . GLY A 1 34  ? 14.752  -4.956  21.803 1.00 25.07  ? 138 GLY A C     1 
ATOM   257  O O     . GLY A 1 34  ? 14.405  -5.371  20.710 1.00 25.05  ? 138 GLY A O     1 
ATOM   258  N N     . ILE A 1 35  ? 15.994  -4.598  22.058 1.00 24.18  ? 139 ILE A N     1 
ATOM   259  C CA    . ILE A 1 35  ? 17.024  -4.709  21.052 1.00 25.82  ? 139 ILE A CA    1 
ATOM   260  C C     . ILE A 1 35  ? 17.374  -6.192  20.899 1.00 30.88  ? 139 ILE A C     1 
ATOM   261  O O     . ILE A 1 35  ? 17.254  -6.748  19.810 1.00 31.20  ? 139 ILE A O     1 
ATOM   262  C CB    . ILE A 1 35  ? 18.225  -3.794  21.440 1.00 28.51  ? 139 ILE A CB    1 
ATOM   263  C CG1   . ILE A 1 35  ? 17.754  -2.304  21.422 1.00 28.89  ? 139 ILE A CG1   1 
ATOM   264  C CG2   . ILE A 1 35  ? 19.415  -4.029  20.469 1.00 29.99  ? 139 ILE A CG2   1 
ATOM   265  C CD1   . ILE A 1 35  ? 18.707  -1.263  22.191 1.00 34.59  ? 139 ILE A CD1   1 
ATOM   266  N N     . ASN A 1 36  ? 17.823  -6.803  21.993 1.00 25.71  ? 140 ASN A N     1 
ATOM   267  C CA    . ASN A 1 36  ? 18.181  -8.200  22.081 1.00 26.77  ? 140 ASN A CA    1 
ATOM   268  C C     . ASN A 1 36  ? 18.312  -8.463  23.595 1.00 32.84  ? 140 ASN A C     1 
ATOM   269  O O     . ASN A 1 36  ? 18.259  -7.497  24.369 1.00 31.40  ? 140 ASN A O     1 
ATOM   270  C CB    . ASN A 1 36  ? 19.528  -8.432  21.347 1.00 28.13  ? 140 ASN A CB    1 
ATOM   271  C CG    . ASN A 1 36  ? 20.732  -7.855  22.042 1.00 48.02  ? 140 ASN A CG    1 
ATOM   272  O OD1   . ASN A 1 36  ? 20.794  -6.657  22.366 1.00 42.30  ? 140 ASN A OD1   1 
ATOM   273  N ND2   . ASN A 1 36  ? 21.738  -8.680  22.214 1.00 35.08  ? 140 ASN A ND2   1 
ATOM   274  N N     . PRO A 1 37  ? 18.463  -9.725  24.062 1.00 30.21  ? 141 PRO A N     1 
ATOM   275  C CA    . PRO A 1 37  ? 18.663  -9.930  25.505 1.00 30.45  ? 141 PRO A CA    1 
ATOM   276  C C     . PRO A 1 37  ? 20.087  -9.545  25.888 1.00 34.06  ? 141 PRO A C     1 
ATOM   277  O O     . PRO A 1 37  ? 21.050  -9.837  25.169 1.00 33.42  ? 141 PRO A O     1 
ATOM   278  C CB    . PRO A 1 37  ? 18.442  -11.450 25.695 1.00 32.70  ? 141 PRO A CB    1 
ATOM   279  C CG    . PRO A 1 37  ? 17.963  -11.970 24.337 1.00 37.26  ? 141 PRO A CG    1 
ATOM   280  C CD    . PRO A 1 37  ? 18.489  -11.007 23.329 1.00 33.52  ? 141 PRO A CD    1 
ATOM   281  N N     . GLY A 1 38  ? 20.210  -8.928  27.049 1.00 31.21  ? 142 GLY A N     1 
ATOM   282  C CA    . GLY A 1 38  ? 21.511  -8.638  27.629 1.00 32.20  ? 142 GLY A CA    1 
ATOM   283  C C     . GLY A 1 38  ? 21.907  -9.846  28.458 1.00 35.30  ? 142 GLY A C     1 
ATOM   284  O O     . GLY A 1 38  ? 21.136  -10.806 28.554 1.00 32.31  ? 142 GLY A O     1 
ATOM   285  N N     . LEU A 1 39  ? 23.103  -9.825  29.039 1.00 30.97  ? 143 LEU A N     1 
ATOM   286  C CA    . LEU A 1 39  ? 23.608  -10.955 29.829 1.00 32.75  ? 143 LEU A CA    1 
ATOM   287  C C     . LEU A 1 39  ? 22.699  -11.347 31.020 1.00 33.74  ? 143 LEU A C     1 
ATOM   288  O O     . LEU A 1 39  ? 22.453  -12.537 31.234 1.00 29.21  ? 143 LEU A O     1 
ATOM   289  C CB    . LEU A 1 39  ? 25.051  -10.723 30.289 1.00 34.94  ? 143 LEU A CB    1 
ATOM   290  C CG    . LEU A 1 39  ? 26.164  -10.629 29.218 1.00 42.13  ? 143 LEU A CG    1 
ATOM   291  C CD1   . LEU A 1 39  ? 27.520  -10.379 29.885 1.00 43.86  ? 143 LEU A CD1   1 
ATOM   292  C CD2   . LEU A 1 39  ? 26.247  -11.891 28.375 1.00 45.47  ? 143 LEU A CD2   1 
ATOM   293  N N     . MET A 1 40  ? 22.200  -10.354 31.778 1.00 30.43  ? 144 MET A N     1 
ATOM   294  C CA    . MET A 1 40  ? 21.337  -10.662 32.916 1.00 30.84  ? 144 MET A CA    1 
ATOM   295  C C     . MET A 1 40  ? 19.995  -11.237 32.456 1.00 32.02  ? 144 MET A C     1 
ATOM   296  O O     . MET A 1 40  ? 19.451  -12.105 33.144 1.00 31.68  ? 144 MET A O     1 
ATOM   297  C CB    . MET A 1 40  ? 21.167  -9.437  33.855 1.00 33.60  ? 144 MET A CB    1 
ATOM   298  C CG    . MET A 1 40  ? 20.513  -9.796  35.216 1.00 38.62  ? 144 MET A CG    1 
ATOM   299  S SD    . MET A 1 40  ? 21.307  -11.168 36.102 1.00 46.26  ? 144 MET A SD    1 
ATOM   300  C CE    . MET A 1 40  ? 22.675  -10.311 36.742 1.00 44.58  ? 144 MET A CE    1 
ATOM   301  N N     . ALA A 1 41  ? 19.442  -10.747 31.318 1.00 27.49  ? 145 ALA A N     1 
ATOM   302  C CA    . ALA A 1 41  ? 18.194  -11.276 30.789 1.00 26.89  ? 145 ALA A CA    1 
ATOM   303  C C     . ALA A 1 41  ? 18.353  -12.732 30.336 1.00 32.13  ? 145 ALA A C     1 
ATOM   304  O O     . ALA A 1 41  ? 17.477  -13.550 30.603 1.00 32.33  ? 145 ALA A O     1 
ATOM   305  C CB    . ALA A 1 41  ? 17.690  -10.416 29.642 1.00 27.33  ? 145 ALA A CB    1 
ATOM   306  N N     . ALA A 1 42  ? 19.486  -13.067 29.693 1.00 29.58  ? 146 ALA A N     1 
ATOM   307  C CA    . ALA A 1 42  ? 19.740  -14.455 29.276 1.00 32.34  ? 146 ALA A CA    1 
ATOM   308  C C     . ALA A 1 42  ? 19.900  -15.338 30.526 1.00 35.40  ? 146 ALA A C     1 
ATOM   309  O O     . ALA A 1 42  ? 19.412  -16.475 30.573 1.00 34.52  ? 146 ALA A O     1 
ATOM   310  C CB    . ALA A 1 42  ? 21.003  -14.517 28.439 1.00 33.87  ? 146 ALA A CB    1 
ATOM   311  N N     . TYR A 1 43  ? 20.564  -14.800 31.550 1.00 31.05  ? 147 TYR A N     1 
ATOM   312  C CA    . TYR A 1 43  ? 20.785  -15.520 32.799 1.00 29.79  ? 147 TYR A CA    1 
ATOM   313  C C     . TYR A 1 43  ? 19.459  -15.885 33.532 1.00 34.41  ? 147 TYR A C     1 
ATOM   314  O O     . TYR A 1 43  ? 19.290  -17.018 33.994 1.00 35.69  ? 147 TYR A O     1 
ATOM   315  C CB    . TYR A 1 43  ? 21.699  -14.694 33.749 1.00 28.47  ? 147 TYR A CB    1 
ATOM   316  C CG    . TYR A 1 43  ? 21.950  -15.419 35.053 1.00 31.49  ? 147 TYR A CG    1 
ATOM   317  C CD1   . TYR A 1 43  ? 22.987  -16.335 35.173 1.00 35.09  ? 147 TYR A CD1   1 
ATOM   318  C CD2   . TYR A 1 43  ? 21.144  -15.193 36.172 1.00 33.08  ? 147 TYR A CD2   1 
ATOM   319  C CE1   . TYR A 1 43  ? 23.222  -17.008 36.373 1.00 36.73  ? 147 TYR A CE1   1 
ATOM   320  C CE2   . TYR A 1 43  ? 21.352  -15.890 37.372 1.00 35.36  ? 147 TYR A CE2   1 
ATOM   321  C CZ    . TYR A 1 43  ? 22.387  -16.805 37.460 1.00 38.85  ? 147 TYR A CZ    1 
ATOM   322  O OH    . TYR A 1 43  ? 22.650  -17.472 38.637 1.00 41.06  ? 147 TYR A OH    1 
ATOM   323  N N     . LYS A 1 44  ? 18.566  -14.902 33.663 1.00 30.38  ? 148 LYS A N     1 
ATOM   324  C CA    . LYS A 1 44  ? 17.300  -15.040 34.382 1.00 30.19  ? 148 LYS A CA    1 
ATOM   325  C C     . LYS A 1 44  ? 16.191  -15.721 33.601 1.00 37.21  ? 148 LYS A C     1 
ATOM   326  O O     . LYS A 1 44  ? 15.331  -16.343 34.219 1.00 38.58  ? 148 LYS A O     1 
ATOM   327  C CB    . LYS A 1 44  ? 16.822  -13.679 34.879 1.00 28.61  ? 148 LYS A CB    1 
ATOM   328  C CG    . LYS A 1 44  ? 17.741  -13.010 35.918 1.00 30.59  ? 148 LYS A CG    1 
ATOM   329  C CD    . LYS A 1 44  ? 17.663  -13.671 37.314 1.00 35.48  ? 148 LYS A CD    1 
ATOM   330  C CE    . LYS A 1 44  ? 18.450  -12.940 38.379 1.00 41.64  ? 148 LYS A CE    1 
ATOM   331  N NZ    . LYS A 1 44  ? 18.275  -13.595 39.721 1.00 43.65  ? 148 LYS A NZ    1 
ATOM   332  N N     . GLY A 1 45  ? 16.174  -15.531 32.279 1.00 33.15  ? 149 GLY A N     1 
ATOM   333  C CA    . GLY A 1 45  ? 15.101  -16.029 31.423 1.00 32.98  ? 149 GLY A CA    1 
ATOM   334  C C     . GLY A 1 45  ? 13.875  -15.138 31.517 1.00 34.88  ? 149 GLY A C     1 
ATOM   335  O O     . GLY A 1 45  ? 12.770  -15.546 31.158 1.00 35.04  ? 149 GLY A O     1 
ATOM   336  N N     . HIS A 1 46  ? 14.071  -13.904 31.991 1.00 30.84  ? 150 HIS A N     1 
ATOM   337  C CA    . HIS A 1 46  ? 13.014  -12.900 32.144 1.00 30.72  ? 150 HIS A CA    1 
ATOM   338  C C     . HIS A 1 46  ? 13.455  -11.552 31.552 1.00 30.63  ? 150 HIS A C     1 
ATOM   339  O O     . HIS A 1 46  ? 14.643  -11.270 31.489 1.00 29.24  ? 150 HIS A O     1 
ATOM   340  C CB    . HIS A 1 46  ? 12.594  -12.736 33.616 1.00 31.76  ? 150 HIS A CB    1 
ATOM   341  C CG    . HIS A 1 46  ? 11.955  -13.959 34.207 1.00 36.93  ? 150 HIS A CG    1 
ATOM   342  N ND1   . HIS A 1 46  ? 10.591  -14.190 34.099 1.00 40.02  ? 150 HIS A ND1   1 
ATOM   343  C CD2   . HIS A 1 46  ? 12.515  -14.966 34.917 1.00 40.10  ? 150 HIS A CD2   1 
ATOM   344  C CE1   . HIS A 1 46  ? 10.374  -15.357 34.703 1.00 41.56  ? 150 HIS A CE1   1 
ATOM   345  N NE2   . HIS A 1 46  ? 11.502  -15.858 35.218 1.00 41.57  ? 150 HIS A NE2   1 
ATOM   346  N N     . HIS A 1 47  ? 12.478  -10.733 31.136 1.00 27.31  ? 151 HIS A N     1 
ATOM   347  C CA    A HIS A 1 47  ? 12.714  -9.433  30.505 0.50 25.34  ? 151 HIS A CA    1 
ATOM   348  C CA    B HIS A 1 47  ? 12.726  -9.438  30.503 0.50 24.92  ? 151 HIS A CA    1 
ATOM   349  C C     . HIS A 1 47  ? 13.086  -8.318  31.468 1.00 28.11  ? 151 HIS A C     1 
ATOM   350  O O     . HIS A 1 47  ? 12.429  -8.123  32.501 1.00 26.94  ? 151 HIS A O     1 
ATOM   351  C CB    A HIS A 1 47  ? 11.514  -9.004  29.638 0.50 26.49  ? 151 HIS A CB    1 
ATOM   352  C CB    B HIS A 1 47  ? 11.540  -9.025  29.612 0.50 25.70  ? 151 HIS A CB    1 
ATOM   353  C CG    A HIS A 1 47  ? 11.255  -9.938  28.496 0.50 31.23  ? 151 HIS A CG    1 
ATOM   354  C CG    B HIS A 1 47  ? 11.242  -10.041 28.552 0.50 30.13  ? 151 HIS A CG    1 
ATOM   355  N ND1   A HIS A 1 47  ? 11.655  -9.630  27.207 0.50 33.16  ? 151 HIS A ND1   1 
ATOM   356  N ND1   B HIS A 1 47  ? 10.656  -11.256 28.862 0.50 33.06  ? 151 HIS A ND1   1 
ATOM   357  C CD2   A HIS A 1 47  ? 10.669  -11.159 28.493 0.50 34.60  ? 151 HIS A CD2   1 
ATOM   358  C CD2   B HIS A 1 47  ? 11.496  -10.004 27.223 0.50 32.60  ? 151 HIS A CD2   1 
ATOM   359  C CE1   A HIS A 1 47  ? 11.297  -10.666 26.461 0.50 34.05  ? 151 HIS A CE1   1 
ATOM   360  C CE1   B HIS A 1 47  ? 10.555  -11.912 27.714 0.50 33.97  ? 151 HIS A CE1   1 
ATOM   361  N NE2   A HIS A 1 47  ? 10.697  -11.611 27.189 0.50 35.33  ? 151 HIS A NE2   1 
ATOM   362  N NE2   B HIS A 1 47  ? 11.054  -11.204 26.701 0.50 33.71  ? 151 HIS A NE2   1 
ATOM   363  N N     . TYR A 1 48  ? 14.134  -7.570  31.084 1.00 26.38  ? 152 TYR A N     1 
ATOM   364  C CA    . TYR A 1 48  ? 14.699  -6.395  31.749 1.00 25.67  ? 152 TYR A CA    1 
ATOM   365  C C     . TYR A 1 48  ? 15.004  -6.604  33.246 1.00 30.10  ? 152 TYR A C     1 
ATOM   366  O O     . TYR A 1 48  ? 14.553  -5.811  34.062 1.00 31.08  ? 152 TYR A O     1 
ATOM   367  C CB    . TYR A 1 48  ? 13.783  -5.173  31.513 1.00 25.47  ? 152 TYR A CB    1 
ATOM   368  C CG    . TYR A 1 48  ? 13.467  -4.947  30.056 1.00 26.07  ? 152 TYR A CG    1 
ATOM   369  C CD1   . TYR A 1 48  ? 14.438  -4.475  29.180 1.00 27.95  ? 152 TYR A CD1   1 
ATOM   370  C CD2   . TYR A 1 48  ? 12.214  -5.266  29.535 1.00 27.69  ? 152 TYR A CD2   1 
ATOM   371  C CE1   . TYR A 1 48  ? 14.177  -4.328  27.819 1.00 27.87  ? 152 TYR A CE1   1 
ATOM   372  C CE2   . TYR A 1 48  ? 11.932  -5.103  28.177 1.00 27.87  ? 152 TYR A CE2   1 
ATOM   373  C CZ    . TYR A 1 48  ? 12.924  -4.638  27.324 1.00 29.74  ? 152 TYR A CZ    1 
ATOM   374  O OH    . TYR A 1 48  ? 12.663  -4.385  26.019 1.00 28.72  ? 152 TYR A OH    1 
ATOM   375  N N     . PRO A 1 49  ? 15.828  -7.603  33.617 1.00 28.71  ? 153 PRO A N     1 
ATOM   376  C CA    . PRO A 1 49  ? 16.166  -7.785  35.034 1.00 32.10  ? 153 PRO A CA    1 
ATOM   377  C C     . PRO A 1 49  ? 17.327  -6.905  35.503 1.00 41.77  ? 153 PRO A C     1 
ATOM   378  O O     . PRO A 1 49  ? 17.635  -6.902  36.699 1.00 45.77  ? 153 PRO A O     1 
ATOM   379  C CB    . PRO A 1 49  ? 16.549  -9.267  35.106 1.00 34.24  ? 153 PRO A CB    1 
ATOM   380  C CG    . PRO A 1 49  ? 17.075  -9.581  33.782 1.00 37.00  ? 153 PRO A CG    1 
ATOM   381  C CD    . PRO A 1 49  ? 16.478  -8.634  32.776 1.00 31.51  ? 153 PRO A CD    1 
ATOM   382  N N     . GLY A 1 50  ? 17.999  -6.226  34.576 1.00 37.37  ? 154 GLY A N     1 
ATOM   383  C CA    . GLY A 1 50  ? 19.143  -5.377  34.902 1.00 41.00  ? 154 GLY A CA    1 
ATOM   384  C C     . GLY A 1 50  ? 18.832  -4.503  36.099 1.00 46.19  ? 154 GLY A C     1 
ATOM   385  O O     . GLY A 1 50  ? 17.856  -3.764  36.028 1.00 45.63  ? 154 GLY A O     1 
ATOM   386  N N     . PRO A 1 51  ? 19.512  -4.656  37.272 1.00 47.10  ? 155 PRO A N     1 
ATOM   387  C CA    . PRO A 1 51  ? 19.149  -3.823  38.444 1.00 47.79  ? 155 PRO A CA    1 
ATOM   388  C C     . PRO A 1 51  ? 19.086  -2.322  38.133 1.00 49.22  ? 155 PRO A C     1 
ATOM   389  O O     . PRO A 1 51  ? 18.315  -1.578  38.760 1.00 50.90  ? 155 PRO A O     1 
ATOM   390  C CB    . PRO A 1 51  ? 20.229  -4.154  39.479 1.00 51.94  ? 155 PRO A CB    1 
ATOM   391  C CG    . PRO A 1 51  ? 21.332  -4.813  38.706 1.00 56.42  ? 155 PRO A CG    1 
ATOM   392  C CD    . PRO A 1 51  ? 20.660  -5.534  37.579 1.00 49.83  ? 155 PRO A CD    1 
ATOM   393  N N     . GLY A 1 52  ? 19.862  -1.915  37.129 1.00 40.72  ? 156 GLY A N     1 
ATOM   394  C CA    . GLY A 1 52  ? 19.930  -0.534  36.674 1.00 39.42  ? 156 GLY A CA    1 
ATOM   395  C C     . GLY A 1 52  ? 19.000  -0.249  35.508 1.00 38.34  ? 156 GLY A C     1 
ATOM   396  O O     . GLY A 1 52  ? 18.736  0.928   35.253 1.00 38.06  ? 156 GLY A O     1 
ATOM   397  N N     . ASN A 1 53  ? 18.478  -1.319  34.796 1.00 30.31  ? 157 ASN A N     1 
ATOM   398  C CA    . ASN A 1 53  ? 17.572  -1.103  33.644 1.00 27.74  ? 157 ASN A CA    1 
ATOM   399  C C     . ASN A 1 53  ? 16.338  -0.341  34.147 1.00 32.40  ? 157 ASN A C     1 
ATOM   400  O O     . ASN A 1 53  ? 15.866  -0.605  35.262 1.00 34.37  ? 157 ASN A O     1 
ATOM   401  C CB    . ASN A 1 53  ? 17.190  -2.431  32.940 1.00 23.78  ? 157 ASN A CB    1 
ATOM   402  C CG    . ASN A 1 53  ? 16.659  -2.179  31.557 1.00 32.52  ? 157 ASN A CG    1 
ATOM   403  O OD1   . ASN A 1 53  ? 15.506  -1.788  31.381 1.00 26.87  ? 157 ASN A OD1   1 
ATOM   404  N ND2   . ASN A 1 53  ? 17.470  -2.456  30.536 1.00 25.32  ? 157 ASN A ND2   1 
ATOM   405  N N     . HIS A 1 54  ? 15.890  0.664   33.388 1.00 26.03  ? 158 HIS A N     1 
ATOM   406  C CA    . HIS A 1 54  ? 14.817  1.532   33.836 1.00 25.32  ? 158 HIS A CA    1 
ATOM   407  C C     . HIS A 1 54  ? 13.433  1.044   33.501 1.00 26.95  ? 158 HIS A C     1 
ATOM   408  O O     . HIS A 1 54  ? 12.476  1.703   33.894 1.00 28.21  ? 158 HIS A O     1 
ATOM   409  C CB    . HIS A 1 54  ? 15.016  2.955   33.240 1.00 25.18  ? 158 HIS A CB    1 
ATOM   410  C CG    . HIS A 1 54  ? 16.317  3.598   33.615 1.00 27.72  ? 158 HIS A CG    1 
ATOM   411  N ND1   . HIS A 1 54  ? 16.988  4.415   32.733 1.00 28.10  ? 158 HIS A ND1   1 
ATOM   412  C CD2   . HIS A 1 54  ? 17.031  3.513   34.766 1.00 28.90  ? 158 HIS A CD2   1 
ATOM   413  C CE1   . HIS A 1 54  ? 18.066  4.845   33.380 1.00 28.99  ? 158 HIS A CE1   1 
ATOM   414  N NE2   . HIS A 1 54  ? 18.144  4.320   34.602 1.00 30.23  ? 158 HIS A NE2   1 
ATOM   415  N N     . PHE A 1 55  ? 13.298  -0.078  32.761 1.00 24.27  ? 159 PHE A N     1 
ATOM   416  C CA    . PHE A 1 55  ? 11.995  -0.512  32.297 1.00 22.39  ? 159 PHE A CA    1 
ATOM   417  C C     . PHE A 1 55  ? 10.902  -0.631  33.405 1.00 27.73  ? 159 PHE A C     1 
ATOM   418  O O     . PHE A 1 55  ? 9.867   0.026   33.287 1.00 27.73  ? 159 PHE A O     1 
ATOM   419  C CB    . PHE A 1 55  ? 12.097  -1.845  31.480 1.00 22.04  ? 159 PHE A CB    1 
ATOM   420  C CG    . PHE A 1 55  ? 10.729  -2.286  31.032 1.00 23.12  ? 159 PHE A CG    1 
ATOM   421  C CD1   . PHE A 1 55  ? 10.088  -1.647  29.962 1.00 25.66  ? 159 PHE A CD1   1 
ATOM   422  C CD2   . PHE A 1 55  ? 10.045  -3.290  31.717 1.00 26.41  ? 159 PHE A CD2   1 
ATOM   423  C CE1   . PHE A 1 55  ? 8.801   -2.025  29.576 1.00 25.94  ? 159 PHE A CE1   1 
ATOM   424  C CE2   . PHE A 1 55  ? 8.750   -3.665  31.335 1.00 28.73  ? 159 PHE A CE2   1 
ATOM   425  C CZ    . PHE A 1 55  ? 8.145   -3.040  30.264 1.00 26.50  ? 159 PHE A CZ    1 
ATOM   426  N N     . TRP A 1 56  ? 11.103  -1.515  34.407 1.00 25.84  ? 160 TRP A N     1 
ATOM   427  C CA    . TRP A 1 56  ? 10.109  -1.796  35.453 1.00 27.37  ? 160 TRP A CA    1 
ATOM   428  C C     . TRP A 1 56  ? 9.818   -0.542  36.287 1.00 31.12  ? 160 TRP A C     1 
ATOM   429  O O     . TRP A 1 56  ? 8.660   -0.283  36.609 1.00 31.25  ? 160 TRP A O     1 
ATOM   430  C CB    . TRP A 1 56  ? 10.518  -2.978  36.322 1.00 26.23  ? 160 TRP A CB    1 
ATOM   431  C CG    . TRP A 1 56  ? 10.597  -4.251  35.531 1.00 26.97  ? 160 TRP A CG    1 
ATOM   432  C CD1   . TRP A 1 56  ? 11.730  -4.841  35.064 1.00 28.80  ? 160 TRP A CD1   1 
ATOM   433  C CD2   . TRP A 1 56  ? 9.496   -4.965  34.939 1.00 27.54  ? 160 TRP A CD2   1 
ATOM   434  N NE1   . TRP A 1 56  ? 11.408  -5.953  34.318 1.00 28.74  ? 160 TRP A NE1   1 
ATOM   435  C CE2   . TRP A 1 56  ? 10.043  -6.036  34.197 1.00 31.28  ? 160 TRP A CE2   1 
ATOM   436  C CE3   . TRP A 1 56  ? 8.098   -4.854  35.034 1.00 30.68  ? 160 TRP A CE3   1 
ATOM   437  C CZ2   . TRP A 1 56  ? 9.242   -6.974  33.520 1.00 31.81  ? 160 TRP A CZ2   1 
ATOM   438  C CZ3   . TRP A 1 56  ? 7.302   -5.763  34.349 1.00 33.53  ? 160 TRP A CZ3   1 
ATOM   439  C CH2   . TRP A 1 56  ? 7.870   -6.823  33.614 1.00 33.69  ? 160 TRP A CH2   1 
ATOM   440  N N     . LYS A 1 57  ? 10.862  0.238   36.603 1.00 29.59  ? 161 LYS A N     1 
ATOM   441  C CA    . LYS A 1 57  ? 10.720  1.526   37.284 1.00 29.89  ? 161 LYS A CA    1 
ATOM   442  C C     . LYS A 1 57  ? 9.824   2.503   36.482 1.00 33.14  ? 161 LYS A C     1 
ATOM   443  O O     . LYS A 1 57  ? 8.925   3.137   37.069 1.00 35.09  ? 161 LYS A O     1 
ATOM   444  C CB    . LYS A 1 57  ? 12.117  2.145   37.529 1.00 31.30  ? 161 LYS A CB    1 
ATOM   445  C CG    . LYS A 1 57  ? 12.067  3.331   38.470 1.00 44.40  ? 161 LYS A CG    1 
ATOM   446  C CD    . LYS A 1 57  ? 13.406  3.685   39.084 1.00 50.09  ? 161 LYS A CD    1 
ATOM   447  C CE    . LYS A 1 57  ? 13.156  4.848   40.012 1.00 61.31  ? 161 LYS A CE    1 
ATOM   448  N NZ    . LYS A 1 57  ? 14.151  4.956   41.115 1.00 67.57  ? 161 LYS A NZ    1 
ATOM   449  N N     . CYS A 1 58  ? 10.093  2.677   35.173 1.00 28.41  ? 162 CYS A N     1 
ATOM   450  C CA    . CYS A 1 58  ? 9.273   3.583   34.320 1.00 29.46  ? 162 CYS A CA    1 
ATOM   451  C C     . CYS A 1 58  ? 7.852   3.104   34.146 1.00 31.17  ? 162 CYS A C     1 
ATOM   452  O O     . CYS A 1 58  ? 6.958   3.925   34.056 1.00 32.70  ? 162 CYS A O     1 
ATOM   453  C CB    . CYS A 1 58  ? 9.922   3.806   32.965 1.00 29.03  ? 162 CYS A CB    1 
ATOM   454  S SG    . CYS A 1 58  ? 11.436  4.768   33.030 1.00 32.62  ? 162 CYS A SG    1 
ATOM   455  N N     . LEU A 1 59  ? 7.633   1.781   34.060 1.00 28.03  ? 163 LEU A N     1 
ATOM   456  C CA    . LEU A 1 59  ? 6.279   1.227   33.927 1.00 28.15  ? 163 LEU A CA    1 
ATOM   457  C C     . LEU A 1 59  ? 5.449   1.611   35.194 1.00 35.31  ? 163 LEU A C     1 
ATOM   458  O O     . LEU A 1 59  ? 4.274   1.988   35.079 1.00 36.06  ? 163 LEU A O     1 
ATOM   459  C CB    . LEU A 1 59  ? 6.352   -0.322  33.750 1.00 27.68  ? 163 LEU A CB    1 
ATOM   460  C CG    . LEU A 1 59  ? 5.157   -0.988  33.043 1.00 33.43  ? 163 LEU A CG    1 
ATOM   461  C CD1   . LEU A 1 59  ? 5.268   -0.862  31.544 1.00 33.36  ? 163 LEU A CD1   1 
ATOM   462  C CD2   . LEU A 1 59  ? 5.044   -2.447  33.406 1.00 35.59  ? 163 LEU A CD2   1 
ATOM   463  N N     . PHE A 1 60  ? 6.087   1.581   36.393 1.00 32.41  ? 164 PHE A N     1 
ATOM   464  C CA    . PHE A 1 60  ? 5.417   1.974   37.644 1.00 34.99  ? 164 PHE A CA    1 
ATOM   465  C C     . PHE A 1 60  ? 5.228   3.498   37.775 1.00 40.09  ? 164 PHE A C     1 
ATOM   466  O O     . PHE A 1 60  ? 4.143   3.959   38.147 1.00 40.70  ? 164 PHE A O     1 
ATOM   467  C CB    . PHE A 1 60  ? 6.172   1.415   38.869 1.00 37.94  ? 164 PHE A CB    1 
ATOM   468  C CG    . PHE A 1 60  ? 5.675   1.929   40.201 1.00 43.57  ? 164 PHE A CG    1 
ATOM   469  C CD1   . PHE A 1 60  ? 4.345   1.762   40.581 1.00 49.48  ? 164 PHE A CD1   1 
ATOM   470  C CD2   . PHE A 1 60  ? 6.541   2.548   41.091 1.00 48.19  ? 164 PHE A CD2   1 
ATOM   471  C CE1   . PHE A 1 60  ? 3.886   2.225   41.823 1.00 54.57  ? 164 PHE A CE1   1 
ATOM   472  C CE2   . PHE A 1 60  ? 6.087   2.996   42.338 1.00 55.18  ? 164 PHE A CE2   1 
ATOM   473  C CZ    . PHE A 1 60  ? 4.763   2.825   42.700 1.00 55.47  ? 164 PHE A CZ    1 
ATOM   474  N N     . MET A 1 61  ? 6.298   4.269   37.518 1.00 36.81  ? 165 MET A N     1 
ATOM   475  C CA    . MET A 1 61  ? 6.287   5.729   37.631 1.00 39.05  ? 165 MET A CA    1 
ATOM   476  C C     . MET A 1 61  ? 5.284   6.388   36.678 1.00 39.37  ? 165 MET A C     1 
ATOM   477  O O     . MET A 1 61  ? 4.732   7.441   37.002 1.00 38.52  ? 165 MET A O     1 
ATOM   478  C CB    . MET A 1 61  ? 7.692   6.290   37.409 1.00 41.37  ? 165 MET A CB    1 
ATOM   479  C CG    . MET A 1 61  ? 8.609   6.173   38.624 1.00 48.07  ? 165 MET A CG    1 
ATOM   480  S SD    . MET A 1 61  ? 10.337  6.596   38.215 1.00 53.20  ? 165 MET A SD    1 
ATOM   481  C CE    . MET A 1 61  ? 10.153  8.217   37.637 1.00 51.28  ? 165 MET A CE    1 
ATOM   482  N N     . SER A 1 62  ? 5.031   5.747   35.528 1.00 34.47  ? 166 SER A N     1 
ATOM   483  C CA    . SER A 1 62  ? 4.107   6.226   34.497 1.00 34.43  ? 166 SER A CA    1 
ATOM   484  C C     . SER A 1 62  ? 2.646   5.863   34.777 1.00 41.18  ? 166 SER A C     1 
ATOM   485  O O     . SER A 1 62  ? 1.756   6.440   34.153 1.00 41.07  ? 166 SER A O     1 
ATOM   486  C CB    . SER A 1 62  ? 4.503   5.663   33.140 1.00 32.96  ? 166 SER A CB    1 
ATOM   487  O OG    . SER A 1 62  ? 4.344   4.251   33.108 1.00 35.86  ? 166 SER A OG    1 
ATOM   488  N N     . GLY A 1 63  ? 2.418   4.872   35.643 1.00 38.35  ? 167 GLY A N     1 
ATOM   489  C CA    . GLY A 1 63  ? 1.065   4.416   35.948 1.00 40.02  ? 167 GLY A CA    1 
ATOM   490  C C     . GLY A 1 63  ? 0.616   3.272   35.061 1.00 44.70  ? 167 GLY A C     1 
ATOM   491  O O     . GLY A 1 63  ? -0.540  2.845   35.141 1.00 47.46  ? 167 GLY A O     1 
ATOM   492  N N     . LEU A 1 64  ? 1.535   2.737   34.217 1.00 37.80  ? 168 LEU A N     1 
ATOM   493  C CA    . LEU A 1 64  ? 1.243   1.580   33.359 1.00 37.78  ? 168 LEU A CA    1 
ATOM   494  C C     . LEU A 1 64  ? 1.084   0.298   34.217 1.00 45.15  ? 168 LEU A C     1 
ATOM   495  O O     . LEU A 1 64  ? 0.405   -0.664  33.825 1.00 46.02  ? 168 LEU A O     1 
ATOM   496  C CB    . LEU A 1 64  ? 2.320   1.420   32.276 1.00 34.82  ? 168 LEU A CB    1 
ATOM   497  C CG    . LEU A 1 64  ? 2.146   2.313   31.041 1.00 38.04  ? 168 LEU A CG    1 
ATOM   498  C CD1   . LEU A 1 64  ? 3.392   2.271   30.151 1.00 34.94  ? 168 LEU A CD1   1 
ATOM   499  C CD2   . LEU A 1 64  ? 0.894   1.923   30.238 1.00 40.10  ? 168 LEU A CD2   1 
ATOM   500  N N     . SER A 1 65  ? 1.707   0.309   35.408 1.00 42.95  ? 169 SER A N     1 
ATOM   501  C CA    . SER A 1 65  ? 1.537   -0.704  36.453 1.00 43.91  ? 169 SER A CA    1 
ATOM   502  C C     . SER A 1 65  ? 1.182   0.093   37.738 1.00 48.93  ? 169 SER A C     1 
ATOM   503  O O     . SER A 1 65  ? 1.662   1.218   37.921 1.00 46.98  ? 169 SER A O     1 
ATOM   504  C CB    . SER A 1 65  ? 2.782   -1.578  36.608 1.00 43.74  ? 169 SER A CB    1 
ATOM   505  O OG    . SER A 1 65  ? 3.836   -0.976  37.342 1.00 45.19  ? 169 SER A OG    1 
ATOM   506  N N     . GLU A 1 66  ? 0.285   -0.441  38.574 1.00 47.11  ? 170 GLU A N     1 
ATOM   507  C CA    . GLU A 1 66  ? -0.171  0.256   39.788 1.00 50.01  ? 170 GLU A CA    1 
ATOM   508  C C     . GLU A 1 66  ? 0.726   0.007   41.018 1.00 51.91  ? 170 GLU A C     1 
ATOM   509  O O     . GLU A 1 66  ? 0.603   0.714   42.020 1.00 54.10  ? 170 GLU A O     1 
ATOM   510  C CB    . GLU A 1 66  ? -1.647  -0.068  40.084 1.00 55.27  ? 170 GLU A CB    1 
ATOM   511  C CG    . GLU A 1 66  ? -2.054  -1.460  39.615 1.00 69.26  ? 170 GLU A CG    1 
ATOM   512  C CD    . GLU A 1 66  ? -1.530  -2.609  40.453 1.00 99.80  ? 170 GLU A CD    1 
ATOM   513  O OE1   . GLU A 1 66  ? -1.111  -3.626  39.857 1.00 97.31  ? 170 GLU A OE1   1 
ATOM   514  O OE2   . GLU A 1 66  ? -1.541  -2.502  41.700 1.00 103.79 ? 170 GLU A OE2   1 
ATOM   515  N N     . VAL A 1 67  ? 1.623   -0.994  40.925 1.00 45.04  ? 171 VAL A N     1 
ATOM   516  C CA    . VAL A 1 67  ? 2.614   -1.359  41.940 1.00 43.62  ? 171 VAL A CA    1 
ATOM   517  C C     . VAL A 1 67  ? 3.957   -1.498  41.215 1.00 42.93  ? 171 VAL A C     1 
ATOM   518  O O     . VAL A 1 67  ? 3.976   -1.650  39.995 1.00 38.83  ? 171 VAL A O     1 
ATOM   519  C CB    . VAL A 1 67  ? 2.263   -2.663  42.724 1.00 49.52  ? 171 VAL A CB    1 
ATOM   520  C CG1   . VAL A 1 67  ? 1.142   -2.436  43.739 1.00 53.12  ? 171 VAL A CG1   1 
ATOM   521  C CG2   . VAL A 1 67  ? 1.935   -3.826  41.785 1.00 48.50  ? 171 VAL A CG2   1 
ATOM   522  N N     . GLN A 1 68  ? 5.069   -1.445  41.962 1.00 39.94  ? 172 GLN A N     1 
ATOM   523  C CA    . GLN A 1 68  ? 6.397   -1.627  41.404 1.00 38.20  ? 172 GLN A CA    1 
ATOM   524  C C     . GLN A 1 68  ? 6.593   -3.123  41.090 1.00 41.82  ? 172 GLN A C     1 
ATOM   525  O O     . GLN A 1 68  ? 6.673   -3.957  41.998 1.00 41.43  ? 172 GLN A O     1 
ATOM   526  C CB    . GLN A 1 68  ? 7.475   -1.103  42.368 1.00 40.76  ? 172 GLN A CB    1 
ATOM   527  C CG    . GLN A 1 68  ? 8.914   -1.352  41.924 1.00 43.76  ? 172 GLN A CG    1 
ATOM   528  C CD    . GLN A 1 68  ? 9.241   -0.605  40.653 1.00 51.75  ? 172 GLN A CD    1 
ATOM   529  O OE1   . GLN A 1 68  ? 9.577   0.580   40.664 1.00 48.48  ? 172 GLN A OE1   1 
ATOM   530  N NE2   . GLN A 1 68  ? 9.191   -1.301  39.537 1.00 39.20  ? 172 GLN A NE2   1 
ATOM   531  N N     . LEU A 1 69  ? 6.608   -3.455  39.794 1.00 37.03  ? 173 LEU A N     1 
ATOM   532  C CA    . LEU A 1 69  ? 6.815   -4.834  39.355 1.00 35.83  ? 173 LEU A CA    1 
ATOM   533  C C     . LEU A 1 69  ? 8.307   -5.068  39.077 1.00 38.94  ? 173 LEU A C     1 
ATOM   534  O O     . LEU A 1 69  ? 9.115   -4.138  39.109 1.00 37.61  ? 173 LEU A O     1 
ATOM   535  C CB    . LEU A 1 69  ? 5.970   -5.142  38.093 1.00 35.32  ? 173 LEU A CB    1 
ATOM   536  C CG    . LEU A 1 69  ? 4.445   -5.019  38.234 1.00 40.36  ? 173 LEU A CG    1 
ATOM   537  C CD1   . LEU A 1 69  ? 3.772   -5.198  36.902 1.00 40.54  ? 173 LEU A CD1   1 
ATOM   538  C CD2   . LEU A 1 69  ? 3.879   -6.042  39.235 1.00 44.40  ? 173 LEU A CD2   1 
ATOM   539  N N     . ASN A 1 70  ? 8.667   -6.314  38.813 1.00 36.27  ? 174 ASN A N     1 
ATOM   540  C CA    . ASN A 1 70  ? 10.044  -6.667  38.482 1.00 34.90  ? 174 ASN A CA    1 
ATOM   541  C C     . ASN A 1 70  ? 9.999   -7.714  37.372 1.00 36.33  ? 174 ASN A C     1 
ATOM   542  O O     . ASN A 1 70  ? 8.910   -8.140  36.991 1.00 36.69  ? 174 ASN A O     1 
ATOM   543  C CB    . ASN A 1 70  ? 10.786  -7.162  39.734 1.00 34.13  ? 174 ASN A CB    1 
ATOM   544  C CG    . ASN A 1 70  ? 10.205  -8.431  40.283 1.00 46.42  ? 174 ASN A CG    1 
ATOM   545  O OD1   . ASN A 1 70  ? 10.450  -9.513  39.774 1.00 47.56  ? 174 ASN A OD1   1 
ATOM   546  N ND2   . ASN A 1 70  ? 9.320   -8.311  41.240 1.00 46.03  ? 174 ASN A ND2   1 
ATOM   547  N N     . HIS A 1 71  ? 11.174  -8.119  36.856 1.00 31.78  ? 175 HIS A N     1 
ATOM   548  C CA    . HIS A 1 71  ? 11.320  -9.095  35.772 1.00 31.53  ? 175 HIS A CA    1 
ATOM   549  C C     . HIS A 1 71  ? 10.550  -10.419 35.986 1.00 38.22  ? 175 HIS A C     1 
ATOM   550  O O     . HIS A 1 71  ? 10.092  -11.003 35.007 1.00 40.04  ? 175 HIS A O     1 
ATOM   551  C CB    . HIS A 1 71  ? 12.808  -9.368  35.511 1.00 31.55  ? 175 HIS A CB    1 
ATOM   552  C CG    . HIS A 1 71  ? 13.498  -10.077 36.632 1.00 35.61  ? 175 HIS A CG    1 
ATOM   553  N ND1   . HIS A 1 71  ? 14.021  -9.379  37.714 1.00 36.19  ? 175 HIS A ND1   1 
ATOM   554  C CD2   . HIS A 1 71  ? 13.720  -11.399 36.817 1.00 38.45  ? 175 HIS A CD2   1 
ATOM   555  C CE1   . HIS A 1 71  ? 14.527  -10.297 38.526 1.00 37.87  ? 175 HIS A CE1   1 
ATOM   556  N NE2   . HIS A 1 71  ? 14.394  -11.522 38.018 1.00 40.14  ? 175 HIS A NE2   1 
ATOM   557  N N     . MET A 1 72  ? 10.375  -10.866 37.255 1.00 37.25  ? 176 MET A N     1 
ATOM   558  C CA    . MET A 1 72  ? 9.671   -12.113 37.583 1.00 42.61  ? 176 MET A CA    1 
ATOM   559  C C     . MET A 1 72  ? 8.160   -12.085 37.285 1.00 45.18  ? 176 MET A C     1 
ATOM   560  O O     . MET A 1 72  ? 7.507   -13.131 37.242 1.00 48.14  ? 176 MET A O     1 
ATOM   561  C CB    . MET A 1 72  ? 9.939   -12.505 39.054 1.00 48.86  ? 176 MET A CB    1 
ATOM   562  C CG    . MET A 1 72  ? 11.351  -12.993 39.274 1.00 56.71  ? 176 MET A CG    1 
ATOM   563  S SD    . MET A 1 72  ? 11.598  -14.494 38.295 1.00 67.97  ? 176 MET A SD    1 
ATOM   564  C CE    . MET A 1 72  ? 13.345  -14.618 38.301 1.00 66.31  ? 176 MET A CE    1 
ATOM   565  N N     . ASP A 1 73  ? 7.634   -10.887 37.034 1.00 39.16  ? 177 ASP A N     1 
ATOM   566  C CA    . ASP A 1 73  ? 6.236   -10.612 36.756 1.00 38.83  ? 177 ASP A CA    1 
ATOM   567  C C     . ASP A 1 73  ? 5.923   -10.553 35.255 1.00 39.72  ? 177 ASP A C     1 
ATOM   568  O O     . ASP A 1 73  ? 4.753   -10.430 34.896 1.00 39.83  ? 177 ASP A O     1 
ATOM   569  C CB    . ASP A 1 73  ? 5.841   -9.270  37.451 1.00 40.93  ? 177 ASP A CB    1 
ATOM   570  C CG    . ASP A 1 73  ? 5.954   -9.295  38.975 1.00 52.29  ? 177 ASP A CG    1 
ATOM   571  O OD1   . ASP A 1 73  ? 5.425   -10.246 39.594 1.00 56.05  ? 177 ASP A OD1   1 
ATOM   572  O OD2   . ASP A 1 73  ? 6.542   -8.337  39.555 1.00 48.22  ? 177 ASP A OD2   1 
ATOM   573  N N     . ASP A 1 74  ? 6.933   -10.672 34.379 1.00 34.44  ? 178 ASP A N     1 
ATOM   574  C CA    . ASP A 1 74  ? 6.736   -10.474 32.939 1.00 34.09  ? 178 ASP A CA    1 
ATOM   575  C C     . ASP A 1 74  ? 5.666   -11.397 32.278 1.00 38.42  ? 178 ASP A C     1 
ATOM   576  O O     . ASP A 1 74  ? 4.995   -10.937 31.347 1.00 36.72  ? 178 ASP A O     1 
ATOM   577  C CB    . ASP A 1 74  ? 8.067   -10.512 32.155 1.00 34.67  ? 178 ASP A CB    1 
ATOM   578  C CG    . ASP A 1 74  ? 8.852   -11.812 32.176 1.00 38.64  ? 178 ASP A CG    1 
ATOM   579  O OD1   . ASP A 1 74  ? 8.471   -12.740 32.945 1.00 38.43  ? 178 ASP A OD1   1 
ATOM   580  O OD2   . ASP A 1 74  ? 9.879   -11.878 31.494 1.00 37.97  ? 178 ASP A OD2   1 
ATOM   581  N N     . HIS A 1 75  ? 5.466   -12.647 32.777 1.00 36.02  ? 179 HIS A N     1 
ATOM   582  C CA    . HIS A 1 75  ? 4.451   -13.526 32.192 1.00 39.08  ? 179 HIS A CA    1 
ATOM   583  C C     . HIS A 1 75  ? 3.023   -13.125 32.569 1.00 42.70  ? 179 HIS A C     1 
ATOM   584  O O     . HIS A 1 75  ? 2.069   -13.511 31.886 1.00 44.26  ? 179 HIS A O     1 
ATOM   585  C CB    . HIS A 1 75  ? 4.726   -15.002 32.541 1.00 43.02  ? 179 HIS A CB    1 
ATOM   586  C CG    . HIS A 1 75  ? 5.878   -15.538 31.772 1.00 46.67  ? 179 HIS A CG    1 
ATOM   587  N ND1   . HIS A 1 75  ? 7.174   -15.120 32.033 1.00 47.81  ? 179 HIS A ND1   1 
ATOM   588  C CD2   . HIS A 1 75  ? 5.891   -16.362 30.702 1.00 49.76  ? 179 HIS A CD2   1 
ATOM   589  C CE1   . HIS A 1 75  ? 7.931   -15.721 31.134 1.00 47.05  ? 179 HIS A CE1   1 
ATOM   590  N NE2   . HIS A 1 75  ? 7.205   -16.497 30.329 1.00 48.56  ? 179 HIS A NE2   1 
ATOM   591  N N     . THR A 1 76  ? 2.882   -12.338 33.632 1.00 38.73  ? 180 THR A N     1 
ATOM   592  C CA    . THR A 1 76  ? 1.572   -11.884 34.094 1.00 41.19  ? 180 THR A CA    1 
ATOM   593  C C     . THR A 1 76  ? 1.118   -10.672 33.285 1.00 44.13  ? 180 THR A C     1 
ATOM   594  O O     . THR A 1 76  ? -0.064  -10.354 33.304 1.00 45.59  ? 180 THR A O     1 
ATOM   595  C CB    . THR A 1 76  ? 1.595   -11.552 35.622 1.00 50.84  ? 180 THR A CB    1 
ATOM   596  O OG1   . THR A 1 76  ? 2.205   -10.277 35.832 1.00 47.64  ? 180 THR A OG1   1 
ATOM   597  C CG2   . THR A 1 76  ? 2.302   -12.613 36.454 1.00 48.80  ? 180 THR A CG2   1 
ATOM   598  N N     . LEU A 1 77  ? 2.055   -9.995  32.574 1.00 38.52  ? 181 LEU A N     1 
ATOM   599  C CA    . LEU A 1 77  ? 1.766   -8.742  31.874 1.00 36.22  ? 181 LEU A CA    1 
ATOM   600  C C     . LEU A 1 77  ? 0.713   -8.853  30.742 1.00 40.81  ? 181 LEU A C     1 
ATOM   601  O O     . LEU A 1 77  ? -0.150  -7.982  30.729 1.00 41.85  ? 181 LEU A O     1 
ATOM   602  C CB    . LEU A 1 77  ? 3.036   -8.062  31.409 1.00 33.63  ? 181 LEU A CB    1 
ATOM   603  C CG    . LEU A 1 77  ? 3.388   -6.801  32.209 1.00 38.53  ? 181 LEU A CG    1 
ATOM   604  C CD1   . LEU A 1 77  ? 3.599   -7.104  33.698 1.00 40.30  ? 181 LEU A CD1   1 
ATOM   605  C CD2   . LEU A 1 77  ? 4.599   -6.128  31.649 1.00 37.85  ? 181 LEU A CD2   1 
ATOM   606  N N     . PRO A 1 78  ? 0.633   -9.900  29.882 1.00 39.42  ? 182 PRO A N     1 
ATOM   607  C CA    . PRO A 1 78  ? -0.445  -9.921  28.874 1.00 41.29  ? 182 PRO A CA    1 
ATOM   608  C C     . PRO A 1 78  ? -1.845  -9.959  29.451 1.00 50.35  ? 182 PRO A C     1 
ATOM   609  O O     . PRO A 1 78  ? -2.704  -9.216  28.982 1.00 53.39  ? 182 PRO A O     1 
ATOM   610  C CB    . PRO A 1 78  ? -0.153  -11.203 28.071 1.00 43.01  ? 182 PRO A CB    1 
ATOM   611  C CG    . PRO A 1 78  ? 1.273   -11.422 28.250 1.00 44.41  ? 182 PRO A CG    1 
ATOM   612  C CD    . PRO A 1 78  ? 1.550   -11.035 29.669 1.00 39.69  ? 182 PRO A CD    1 
ATOM   613  N N     . GLY A 1 79  ? -2.066  -10.822 30.441 1.00 48.32  ? 183 GLY A N     1 
ATOM   614  C CA    . GLY A 1 79  ? -3.380  -11.006 31.048 1.00 51.81  ? 183 GLY A CA    1 
ATOM   615  C C     . GLY A 1 79  ? -3.838  -9.845  31.901 1.00 56.66  ? 183 GLY A C     1 
ATOM   616  O O     . GLY A 1 79  ? -4.984  -9.397  31.785 1.00 59.59  ? 183 GLY A O     1 
ATOM   617  N N     . LYS A 1 80  ? -2.938  -9.360  32.771 1.00 49.94  ? 184 LYS A N     1 
ATOM   618  C CA    . LYS A 1 80  ? -3.205  -8.287  33.722 1.00 50.07  ? 184 LYS A CA    1 
ATOM   619  C C     . LYS A 1 80  ? -3.118  -6.883  33.150 1.00 51.70  ? 184 LYS A C     1 
ATOM   620  O O     . LYS A 1 80  ? -3.878  -6.022  33.572 1.00 53.24  ? 184 LYS A O     1 
ATOM   621  C CB    . LYS A 1 80  ? -2.259  -8.409  34.916 1.00 52.39  ? 184 LYS A CB    1 
ATOM   622  C CG    . LYS A 1 80  ? -2.934  -8.885  36.193 1.00 76.58  ? 184 LYS A CG    1 
ATOM   623  C CD    . LYS A 1 80  ? -2.689  -7.913  37.365 1.00 86.42  ? 184 LYS A CD    1 
ATOM   624  C CE    . LYS A 1 80  ? -3.729  -6.818  37.468 1.00 92.51  ? 184 LYS A CE    1 
ATOM   625  N NZ    . LYS A 1 80  ? -3.466  -5.917  38.619 1.00 98.98  ? 184 LYS A NZ    1 
ATOM   626  N N     . TYR A 1 81  ? -2.186  -6.630  32.225 1.00 45.16  ? 185 TYR A N     1 
ATOM   627  C CA    . TYR A 1 81  ? -1.995  -5.273  31.718 1.00 43.69  ? 185 TYR A CA    1 
ATOM   628  C C     . TYR A 1 81  ? -2.135  -5.095  30.200 1.00 45.76  ? 185 TYR A C     1 
ATOM   629  O O     . TYR A 1 81  ? -2.125  -3.959  29.745 1.00 45.15  ? 185 TYR A O     1 
ATOM   630  C CB    . TYR A 1 81  ? -0.631  -4.731  32.190 1.00 42.05  ? 185 TYR A CB    1 
ATOM   631  C CG    . TYR A 1 81  ? -0.448  -4.767  33.693 1.00 43.81  ? 185 TYR A CG    1 
ATOM   632  C CD1   . TYR A 1 81  ? -0.896  -3.720  34.497 1.00 46.58  ? 185 TYR A CD1   1 
ATOM   633  C CD2   . TYR A 1 81  ? 0.192   -5.835  34.309 1.00 43.83  ? 185 TYR A CD2   1 
ATOM   634  C CE1   . TYR A 1 81  ? -0.737  -3.752  35.881 1.00 47.55  ? 185 TYR A CE1   1 
ATOM   635  C CE2   . TYR A 1 81  ? 0.352   -5.882  35.691 1.00 45.85  ? 185 TYR A CE2   1 
ATOM   636  C CZ    . TYR A 1 81  ? -0.084  -4.820  36.470 1.00 56.14  ? 185 TYR A CZ    1 
ATOM   637  O OH    . TYR A 1 81  ? 0.065   -4.874  37.833 1.00 60.60  ? 185 TYR A OH    1 
ATOM   638  N N     . GLY A 1 82  ? -2.248  -6.184  29.439 1.00 40.96  ? 186 GLY A N     1 
ATOM   639  C CA    . GLY A 1 82  ? -2.353  -6.128  27.982 1.00 39.98  ? 186 GLY A CA    1 
ATOM   640  C C     . GLY A 1 82  ? -1.021  -5.828  27.318 1.00 39.22  ? 186 GLY A C     1 
ATOM   641  O O     . GLY A 1 82  ? -0.984  -5.277  26.217 1.00 39.29  ? 186 GLY A O     1 
ATOM   642  N N     . ILE A 1 83  ? 0.082   -6.200  27.976 1.00 32.97  ? 187 ILE A N     1 
ATOM   643  C CA    . ILE A 1 83  ? 1.440   -5.932  27.481 1.00 30.67  ? 187 ILE A CA    1 
ATOM   644  C C     . ILE A 1 83  ? 2.228   -7.210  27.194 1.00 34.73  ? 187 ILE A C     1 
ATOM   645  O O     . ILE A 1 83  ? 2.286   -8.083  28.053 1.00 36.11  ? 187 ILE A O     1 
ATOM   646  C CB    . ILE A 1 83  ? 2.221   -5.023  28.477 1.00 31.60  ? 187 ILE A CB    1 
ATOM   647  C CG1   . ILE A 1 83  ? 1.525   -3.647  28.664 1.00 33.51  ? 187 ILE A CG1   1 
ATOM   648  C CG2   . ILE A 1 83  ? 3.698   -4.864  28.052 1.00 29.40  ? 187 ILE A CG2   1 
ATOM   649  C CD1   . ILE A 1 83  ? 2.029   -2.846  29.814 1.00 34.24  ? 187 ILE A CD1   1 
ATOM   650  N N     . GLY A 1 84  ? 2.894   -7.256  26.038 1.00 29.21  ? 188 GLY A N     1 
ATOM   651  C CA    . GLY A 1 84  ? 3.725   -8.385  25.646 1.00 29.55  ? 188 GLY A CA    1 
ATOM   652  C C     . GLY A 1 84  ? 5.143   -7.973  25.343 1.00 31.55  ? 188 GLY A C     1 
ATOM   653  O O     . GLY A 1 84  ? 5.437   -6.782  25.317 1.00 27.84  ? 188 GLY A O     1 
ATOM   654  N N     . PHE A 1 85  ? 6.017   -8.961  25.094 1.00 28.44  ? 189 PHE A N     1 
ATOM   655  C CA    . PHE A 1 85  ? 7.440   -8.742  24.872 1.00 26.58  ? 189 PHE A CA    1 
ATOM   656  C C     . PHE A 1 85  ? 8.009   -9.552  23.732 1.00 29.75  ? 189 PHE A C     1 
ATOM   657  O O     . PHE A 1 85  ? 7.717   -10.730 23.584 1.00 31.38  ? 189 PHE A O     1 
ATOM   658  C CB    . PHE A 1 85  ? 8.234   -9.152  26.125 1.00 27.45  ? 189 PHE A CB    1 
ATOM   659  C CG    . PHE A 1 85  ? 7.958   -8.373  27.385 1.00 29.14  ? 189 PHE A CG    1 
ATOM   660  C CD1   . PHE A 1 85  ? 8.686   -7.227  27.685 1.00 31.02  ? 189 PHE A CD1   1 
ATOM   661  C CD2   . PHE A 1 85  ? 6.971   -8.792  28.279 1.00 32.92  ? 189 PHE A CD2   1 
ATOM   662  C CE1   . PHE A 1 85  ? 8.412   -6.484  28.832 1.00 31.87  ? 189 PHE A CE1   1 
ATOM   663  C CE2   . PHE A 1 85  ? 6.708   -8.057  29.437 1.00 36.93  ? 189 PHE A CE2   1 
ATOM   664  C CZ    . PHE A 1 85  ? 7.454   -6.926  29.723 1.00 34.83  ? 189 PHE A CZ    1 
ATOM   665  N N     . THR A 1 86  ? 8.966   -8.934  23.026 1.00 26.21  ? 190 THR A N     1 
ATOM   666  C CA    . THR A 1 86  ? 9.772   -9.550  21.991 1.00 26.72  ? 190 THR A CA    1 
ATOM   667  C C     . THR A 1 86  ? 11.058  -8.749  21.828 1.00 31.90  ? 190 THR A C     1 
ATOM   668  O O     . THR A 1 86  ? 11.257  -7.771  22.533 1.00 32.80  ? 190 THR A O     1 
ATOM   669  C CB    . THR A 1 86  ? 8.977   -9.808  20.689 1.00 35.12  ? 190 THR A CB    1 
ATOM   670  O OG1   . THR A 1 86  ? 9.777   -10.666 19.878 1.00 34.28  ? 190 THR A OG1   1 
ATOM   671  C CG2   . THR A 1 86  ? 8.639   -8.515  19.934 1.00 34.90  ? 190 THR A CG2   1 
ATOM   672  N N     . ASN A 1 87  ? 11.964  -9.209  20.986 1.00 30.84  ? 191 ASN A N     1 
ATOM   673  C CA    . ASN A 1 87  ? 13.223  -8.508  20.731 1.00 31.01  ? 191 ASN A CA    1 
ATOM   674  C C     . ASN A 1 87  ? 13.442  -8.487  19.238 1.00 33.88  ? 191 ASN A C     1 
ATOM   675  O O     . ASN A 1 87  ? 13.009  -9.409  18.543 1.00 34.05  ? 191 ASN A O     1 
ATOM   676  C CB    . ASN A 1 87  ? 14.403  -9.243  21.381 1.00 34.44  ? 191 ASN A CB    1 
ATOM   677  C CG    . ASN A 1 87  ? 14.424  -9.148  22.870 1.00 56.46  ? 191 ASN A CG    1 
ATOM   678  O OD1   . ASN A 1 87  ? 14.868  -8.157  23.446 1.00 52.77  ? 191 ASN A OD1   1 
ATOM   679  N ND2   . ASN A 1 87  ? 13.906  -10.151 23.527 1.00 46.59  ? 191 ASN A ND2   1 
ATOM   680  N N     . MET A 1 88  ? 14.153  -7.470  18.757 1.00 29.18  ? 192 MET A N     1 
ATOM   681  C CA    . MET A 1 88  ? 14.491  -7.341  17.360 1.00 30.76  ? 192 MET A CA    1 
ATOM   682  C C     . MET A 1 88  ? 15.451  -8.473  16.987 1.00 35.70  ? 192 MET A C     1 
ATOM   683  O O     . MET A 1 88  ? 15.195  -9.167  16.024 1.00 35.86  ? 192 MET A O     1 
ATOM   684  C CB    . MET A 1 88  ? 15.140  -5.966  17.118 1.00 33.91  ? 192 MET A CB    1 
ATOM   685  C CG    . MET A 1 88  ? 15.579  -5.768  15.703 1.00 39.33  ? 192 MET A CG    1 
ATOM   686  S SD    . MET A 1 88  ? 14.289  -5.013  14.712 1.00 45.56  ? 192 MET A SD    1 
ATOM   687  C CE    . MET A 1 88  ? 15.345  -4.039  13.588 1.00 43.42  ? 192 MET A CE    1 
ATOM   688  N N     . VAL A 1 89  ? 16.508  -8.696  17.791 1.00 29.99  ? 193 VAL A N     1 
ATOM   689  C CA    . VAL A 1 89  ? 17.525  -9.715  17.549 1.00 31.15  ? 193 VAL A CA    1 
ATOM   690  C C     . VAL A 1 89  ? 17.446  -10.750 18.671 1.00 35.11  ? 193 VAL A C     1 
ATOM   691  O O     . VAL A 1 89  ? 17.372  -10.389 19.843 1.00 32.72  ? 193 VAL A O     1 
ATOM   692  C CB    . VAL A 1 89  ? 18.952  -9.087  17.450 1.00 35.66  ? 193 VAL A CB    1 
ATOM   693  C CG1   . VAL A 1 89  ? 20.027  -10.166 17.367 1.00 36.83  ? 193 VAL A CG1   1 
ATOM   694  C CG2   . VAL A 1 89  ? 19.052  -8.137  16.263 1.00 35.80  ? 193 VAL A CG2   1 
ATOM   695  N N     . GLU A 1 90  ? 17.502  -12.038 18.309 1.00 33.15  ? 194 GLU A N     1 
ATOM   696  C CA    . GLU A 1 90  ? 17.406  -13.148 19.268 1.00 34.79  ? 194 GLU A CA    1 
ATOM   697  C C     . GLU A 1 90  ? 18.679  -13.381 20.100 1.00 38.53  ? 194 GLU A C     1 
ATOM   698  O O     . GLU A 1 90  ? 18.587  -13.742 21.281 1.00 39.05  ? 194 GLU A O     1 
ATOM   699  C CB    . GLU A 1 90  ? 17.037  -14.419 18.490 1.00 38.33  ? 194 GLU A CB    1 
ATOM   700  C CG    . GLU A 1 90  ? 16.754  -15.650 19.334 1.00 56.01  ? 194 GLU A CG    1 
ATOM   701  C CD    . GLU A 1 90  ? 16.239  -16.828 18.526 1.00 81.86  ? 194 GLU A CD    1 
ATOM   702  O OE1   . GLU A 1 90  ? 16.949  -17.274 17.594 1.00 62.50  ? 194 GLU A OE1   1 
ATOM   703  O OE2   . GLU A 1 90  ? 15.119  -17.300 18.826 1.00 83.20  ? 194 GLU A OE2   1 
ATOM   704  N N     . ARG A 1 91  ? 19.852  -13.242 19.463 1.00 35.15  ? 195 ARG A N     1 
ATOM   705  C CA    . ARG A 1 91  ? 21.153  -13.509 20.067 1.00 35.85  ? 195 ARG A CA    1 
ATOM   706  C C     . ARG A 1 91  ? 21.457  -12.655 21.295 1.00 37.31  ? 195 ARG A C     1 
ATOM   707  O O     . ARG A 1 91  ? 21.181  -11.464 21.296 1.00 34.49  ? 195 ARG A O     1 
ATOM   708  C CB    . ARG A 1 91  ? 22.261  -13.375 19.008 1.00 37.94  ? 195 ARG A CB    1 
ATOM   709  C CG    . ARG A 1 91  ? 23.623  -13.927 19.447 1.00 41.75  ? 195 ARG A CG    1 
ATOM   710  C CD    . ARG A 1 91  ? 24.570  -14.029 18.259 1.00 57.46  ? 195 ARG A CD    1 
ATOM   711  N NE    . ARG A 1 91  ? 24.953  -12.714 17.734 1.00 56.13  ? 195 ARG A NE    1 
ATOM   712  C CZ    . ARG A 1 91  ? 26.008  -12.019 18.151 1.00 66.77  ? 195 ARG A CZ    1 
ATOM   713  N NH1   . ARG A 1 91  ? 26.809  -12.511 19.089 1.00 53.33  ? 195 ARG A NH1   1 
ATOM   714  N NH2   . ARG A 1 91  ? 26.278  -10.833 17.624 1.00 49.40  ? 195 ARG A NH2   1 
ATOM   715  N N     . THR A 1 92  ? 22.041  -13.279 22.329 1.00 35.76  ? 196 THR A N     1 
ATOM   716  C CA    . THR A 1 92  ? 22.447  -12.598 23.555 1.00 36.42  ? 196 THR A CA    1 
ATOM   717  C C     . THR A 1 92  ? 23.826  -11.982 23.332 1.00 43.05  ? 196 THR A C     1 
ATOM   718  O O     . THR A 1 92  ? 24.683  -12.639 22.755 1.00 43.35  ? 196 THR A O     1 
ATOM   719  C CB    . THR A 1 92  ? 22.474  -13.620 24.715 1.00 39.86  ? 196 THR A CB    1 
ATOM   720  O OG1   . THR A 1 92  ? 21.128  -13.992 25.021 1.00 36.69  ? 196 THR A OG1   1 
ATOM   721  C CG2   . THR A 1 92  ? 23.161  -13.081 25.981 1.00 40.48  ? 196 THR A CG2   1 
ATOM   722  N N     . THR A 1 93  ? 24.043  -10.735 23.811 1.00 40.69  ? 197 THR A N     1 
ATOM   723  C CA    . THR A 1 93  ? 25.336  -10.022 23.760 1.00 42.28  ? 197 THR A CA    1 
ATOM   724  C C     . THR A 1 93  ? 25.422  -9.088  24.980 1.00 47.82  ? 197 THR A C     1 
ATOM   725  O O     . THR A 1 93  ? 24.371  -8.718  25.514 1.00 46.09  ? 197 THR A O     1 
ATOM   726  C CB    . THR A 1 93  ? 25.513  -9.153  22.454 1.00 47.96  ? 197 THR A CB    1 
ATOM   727  O OG1   . THR A 1 93  ? 24.483  -8.165  22.383 1.00 49.32  ? 197 THR A OG1   1 
ATOM   728  C CG2   . THR A 1 93  ? 25.586  -9.967  21.172 1.00 42.18  ? 197 THR A CG2   1 
ATOM   729  N N     . PRO A 1 94  ? 26.621  -8.622  25.409 1.00 48.33  ? 198 PRO A N     1 
ATOM   730  C CA    . PRO A 1 94  ? 26.662  -7.665  26.533 1.00 49.42  ? 198 PRO A CA    1 
ATOM   731  C C     . PRO A 1 94  ? 26.057  -6.292  26.168 1.00 54.77  ? 198 PRO A C     1 
ATOM   732  O O     . PRO A 1 94  ? 25.369  -5.690  27.002 1.00 55.40  ? 198 PRO A O     1 
ATOM   733  C CB    . PRO A 1 94  ? 28.156  -7.568  26.874 1.00 53.66  ? 198 PRO A CB    1 
ATOM   734  C CG    . PRO A 1 94  ? 28.807  -8.757  26.185 1.00 59.25  ? 198 PRO A CG    1 
ATOM   735  C CD    . PRO A 1 94  ? 27.982  -8.946  24.940 1.00 52.67  ? 198 PRO A CD    1 
ATOM   736  N N     . GLY A 1 95  ? 26.261  -5.848  24.922 1.00 65.22  ? 199 GLY A N     1 
ATOM   737  C CA    . GLY A 1 95  ? 25.745  -4.571  24.438 1.00 61.13  ? 199 GLY A CA    1 
ATOM   738  C C     . GLY A 1 95  ? 25.190  -4.568  23.025 1.00 58.41  ? 199 GLY A C     1 
ATOM   739  O O     . GLY A 1 95  ? 25.438  -5.491  22.236 1.00 56.44  ? 199 GLY A O     1 
ATOM   740  N N     . SER A 1 96  ? 24.464  -3.488  22.684 1.00 51.71  ? 200 SER A N     1 
ATOM   741  C CA    . SER A 1 96  ? 23.871  -3.314  21.360 1.00 48.23  ? 200 SER A CA    1 
ATOM   742  C C     . SER A 1 96  ? 24.943  -3.103  20.253 1.00 50.07  ? 200 SER A C     1 
ATOM   743  O O     . SER A 1 96  ? 24.635  -3.268  19.073 1.00 47.63  ? 200 SER A O     1 
ATOM   744  C CB    . SER A 1 96  ? 22.867  -2.159  21.370 1.00 51.12  ? 200 SER A CB    1 
ATOM   745  O OG    . SER A 1 96  ? 23.470  -0.902  21.643 1.00 59.43  ? 200 SER A OG    1 
ATOM   746  N N     . LYS A 1 97  ? 26.180  -2.754  20.637 1.00 48.21  ? 201 LYS A N     1 
ATOM   747  C CA    . LYS A 1 97  ? 27.285  -2.491  19.708 1.00 49.35  ? 201 LYS A CA    1 
ATOM   748  C C     . LYS A 1 97  ? 27.893  -3.771  19.093 1.00 54.93  ? 201 LYS A C     1 
ATOM   749  O O     . LYS A 1 97  ? 28.612  -3.700  18.089 1.00 54.22  ? 201 LYS A O     1 
ATOM   750  C CB    . LYS A 1 97  ? 28.360  -1.616  20.386 1.00 55.01  ? 201 LYS A CB    1 
ATOM   751  C CG    . LYS A 1 97  ? 27.943  -0.158  20.589 1.00 67.18  ? 201 LYS A CG    1 
ATOM   752  C CD    . LYS A 1 97  ? 28.352  0.712   19.394 1.00 77.92  ? 201 LYS A CD    1 
ATOM   753  C CE    . LYS A 1 97  ? 28.303  2.192   19.682 1.00 82.33  ? 201 LYS A CE    1 
ATOM   754  N NZ    . LYS A 1 97  ? 28.909  2.985   18.579 1.00 81.35  ? 201 LYS A NZ    1 
ATOM   755  N N     . ASP A 1 98  ? 27.596  -4.936  19.685 1.00 53.07  ? 202 ASP A N     1 
ATOM   756  C CA    . ASP A 1 98  ? 28.109  -6.217  19.198 1.00 55.47  ? 202 ASP A CA    1 
ATOM   757  C C     . ASP A 1 98  ? 27.268  -6.830  18.065 1.00 57.07  ? 202 ASP A C     1 
ATOM   758  O O     . ASP A 1 98  ? 27.641  -7.871  17.531 1.00 59.09  ? 202 ASP A O     1 
ATOM   759  C CB    . ASP A 1 98  ? 28.286  -7.198  20.374 1.00 60.75  ? 202 ASP A CB    1 
ATOM   760  C CG    . ASP A 1 98  ? 29.286  -6.711  21.405 1.00 77.23  ? 202 ASP A CG    1 
ATOM   761  O OD1   . ASP A 1 98  ? 30.417  -6.333  21.007 1.00 80.62  ? 202 ASP A OD1   1 
ATOM   762  O OD2   . ASP A 1 98  ? 28.933  -6.683  22.606 1.00 84.17  ? 202 ASP A OD2   1 
ATOM   763  N N     . LEU A 1 99  ? 26.149  -6.181  17.687 1.00 49.89  ? 203 LEU A N     1 
ATOM   764  C CA    . LEU A 1 99  ? 25.254  -6.684  16.644 1.00 48.50  ? 203 LEU A CA    1 
ATOM   765  C C     . LEU A 1 99  ? 25.532  -6.062  15.284 1.00 50.91  ? 203 LEU A C     1 
ATOM   766  O O     . LEU A 1 99  ? 25.662  -4.841  15.170 1.00 49.96  ? 203 LEU A O     1 
ATOM   767  C CB    . LEU A 1 99  ? 23.769  -6.503  17.030 1.00 46.31  ? 203 LEU A CB    1 
ATOM   768  C CG    . LEU A 1 99  ? 23.310  -7.105  18.364 1.00 52.82  ? 203 LEU A CG    1 
ATOM   769  C CD1   . LEU A 1 99  ? 21.938  -6.582  18.748 1.00 51.21  ? 203 LEU A CD1   1 
ATOM   770  C CD2   . LEU A 1 99  ? 23.315  -8.640  18.324 1.00 56.47  ? 203 LEU A CD2   1 
ATOM   771  N N     . SER A 1 100 ? 25.624  -6.906  14.256 1.00 47.80  ? 204 SER A N     1 
ATOM   772  C CA    . SER A 1 100 ? 25.867  -6.461  12.886 1.00 48.07  ? 204 SER A CA    1 
ATOM   773  C C     . SER A 1 100 ? 24.573  -6.025  12.202 1.00 49.15  ? 204 SER A C     1 
ATOM   774  O O     . SER A 1 100 ? 23.478  -6.382  12.646 1.00 45.90  ? 204 SER A O     1 
ATOM   775  C CB    . SER A 1 100 ? 26.552  -7.561  12.078 1.00 54.56  ? 204 SER A CB    1 
ATOM   776  O OG    . SER A 1 100 ? 25.681  -8.650  11.820 1.00 64.09  ? 204 SER A OG    1 
ATOM   777  N N     . SER A 1 101 ? 24.707  -5.263  11.108 1.00 46.90  ? 205 SER A N     1 
ATOM   778  C CA    . SER A 1 101 ? 23.593  -4.770  10.303 1.00 45.40  ? 205 SER A CA    1 
ATOM   779  C C     . SER A 1 101 ? 22.728  -5.916  9.768  1.00 47.86  ? 205 SER A C     1 
ATOM   780  O O     . SER A 1 101 ? 21.509  -5.790  9.759  1.00 46.32  ? 205 SER A O     1 
ATOM   781  C CB    . SER A 1 101 ? 24.114  -3.930  9.139  1.00 51.68  ? 205 SER A CB    1 
ATOM   782  O OG    . SER A 1 101 ? 23.061  -3.582  8.254  1.00 62.20  ? 205 SER A OG    1 
ATOM   783  N N     . LYS A 1 102 ? 23.364  -7.014  9.316  1.00 46.72  ? 206 LYS A N     1 
ATOM   784  C CA    . LYS A 1 102 ? 22.707  -8.202  8.758  1.00 46.56  ? 206 LYS A CA    1 
ATOM   785  C C     . LYS A 1 102 ? 21.786  -8.846  9.789  1.00 45.50  ? 206 LYS A C     1 
ATOM   786  O O     . LYS A 1 102 ? 20.655  -9.190  9.447  1.00 43.32  ? 206 LYS A O     1 
ATOM   787  C CB    . LYS A 1 102 ? 23.738  -9.223  8.243  1.00 52.42  ? 206 LYS A CB    1 
ATOM   788  C CG    . LYS A 1 102 ? 24.544  -8.742  7.042  1.00 62.52  ? 206 LYS A CG    1 
ATOM   789  C CD    . LYS A 1 102 ? 25.280  -9.895  6.371  1.00 71.23  ? 206 LYS A CD    1 
ATOM   790  C CE    . LYS A 1 102 ? 26.240  -9.434  5.300  1.00 86.70  ? 206 LYS A CE    1 
ATOM   791  N NZ    . LYS A 1 102 ? 25.537  -8.885  4.107  1.00 96.38  ? 206 LYS A NZ    1 
ATOM   792  N N     . GLU A 1 103 ? 22.265  -8.973  11.056 1.00 42.30  ? 207 GLU A N     1 
ATOM   793  C CA    . GLU A 1 103 ? 21.514  -9.522  12.201 1.00 39.81  ? 207 GLU A CA    1 
ATOM   794  C C     . GLU A 1 103 ? 20.292  -8.680  12.490 1.00 39.17  ? 207 GLU A C     1 
ATOM   795  O O     . GLU A 1 103 ? 19.202  -9.208  12.709 1.00 35.98  ? 207 GLU A O     1 
ATOM   796  C CB    . GLU A 1 103 ? 22.382  -9.556  13.465 1.00 41.92  ? 207 GLU A CB    1 
ATOM   797  C CG    . GLU A 1 103 ? 23.498  -10.566 13.428 1.00 55.68  ? 207 GLU A CG    1 
ATOM   798  C CD    . GLU A 1 103 ? 24.183  -10.643 14.774 1.00 79.30  ? 207 GLU A CD    1 
ATOM   799  O OE1   . GLU A 1 103 ? 25.107  -9.834  15.025 1.00 66.84  ? 207 GLU A OE1   1 
ATOM   800  O OE2   . GLU A 1 103 ? 23.730  -11.458 15.609 1.00 71.80  ? 207 GLU A OE2   1 
ATOM   801  N N     . PHE A 1 104 ? 20.461  -7.360  12.473 1.00 37.32  ? 208 PHE A N     1 
ATOM   802  C CA    . PHE A 1 104 ? 19.333  -6.472  12.706 1.00 34.93  ? 208 PHE A CA    1 
ATOM   803  C C     . PHE A 1 104 ? 18.295  -6.587  11.604 1.00 37.35  ? 208 PHE A C     1 
ATOM   804  O O     . PHE A 1 104 ? 17.103  -6.620  11.911 1.00 37.03  ? 208 PHE A O     1 
ATOM   805  C CB    . PHE A 1 104 ? 19.797  -5.031  12.822 1.00 36.32  ? 208 PHE A CB    1 
ATOM   806  C CG    . PHE A 1 104 ? 20.334  -4.653  14.175 1.00 37.40  ? 208 PHE A CG    1 
ATOM   807  C CD1   . PHE A 1 104 ? 19.513  -4.672  15.294 1.00 38.26  ? 208 PHE A CD1   1 
ATOM   808  C CD2   . PHE A 1 104 ? 21.623  -4.154  14.309 1.00 41.05  ? 208 PHE A CD2   1 
ATOM   809  C CE1   . PHE A 1 104 ? 19.995  -4.272  16.536 1.00 40.15  ? 208 PHE A CE1   1 
ATOM   810  C CE2   . PHE A 1 104 ? 22.092  -3.716  15.550 1.00 43.41  ? 208 PHE A CE2   1 
ATOM   811  C CZ    . PHE A 1 104 ? 21.270  -3.767  16.646 1.00 41.17  ? 208 PHE A CZ    1 
ATOM   812  N N     . ARG A 1 105 ? 18.737  -6.686  10.335 1.00 35.47  ? 209 ARG A N     1 
ATOM   813  C CA    . ARG A 1 105 ? 17.834  -6.776  9.179  1.00 34.72  ? 209 ARG A CA    1 
ATOM   814  C C     . ARG A 1 105 ? 17.140  -8.134  9.099  1.00 38.98  ? 209 ARG A C     1 
ATOM   815  O O     . ARG A 1 105 ? 15.971  -8.205  8.738  1.00 38.28  ? 209 ARG A O     1 
ATOM   816  C CB    . ARG A 1 105 ? 18.547  -6.368  7.894  1.00 35.49  ? 209 ARG A CB    1 
ATOM   817  C CG    . ARG A 1 105 ? 18.617  -4.841  7.828  1.00 40.53  ? 209 ARG A CG    1 
ATOM   818  C CD    . ARG A 1 105 ? 19.398  -4.281  6.657  1.00 49.86  ? 209 ARG A CD    1 
ATOM   819  N NE    . ARG A 1 105 ? 20.818  -4.618  6.739  1.00 54.74  ? 209 ARG A NE    1 
ATOM   820  C CZ    . ARG A 1 105 ? 21.514  -5.172  5.754  1.00 65.44  ? 209 ARG A CZ    1 
ATOM   821  N NH1   . ARG A 1 105 ? 20.930  -5.455  4.596  1.00 59.36  ? 209 ARG A NH1   1 
ATOM   822  N NH2   . ARG A 1 105 ? 22.799  -5.450  5.918  1.00 52.49  ? 209 ARG A NH2   1 
ATOM   823  N N     . GLU A 1 106 ? 17.819  -9.203  9.513  1.00 37.09  ? 210 GLU A N     1 
ATOM   824  C CA    . GLU A 1 106 ? 17.188  -10.522 9.633  1.00 36.57  ? 210 GLU A CA    1 
ATOM   825  C C     . GLU A 1 106 ? 16.124  -10.409 10.789 1.00 39.68  ? 210 GLU A C     1 
ATOM   826  O O     . GLU A 1 106 ? 14.984  -10.852 10.625 1.00 38.79  ? 210 GLU A O     1 
ATOM   827  C CB    . GLU A 1 106 ? 18.251  -11.567 9.991  1.00 39.36  ? 210 GLU A CB    1 
ATOM   828  C CG    . GLU A 1 106 ? 17.672  -12.913 10.396 1.00 50.08  ? 210 GLU A CG    1 
ATOM   829  C CD    . GLU A 1 106 ? 18.700  -14.008 10.580 1.00 73.58  ? 210 GLU A CD    1 
ATOM   830  O OE1   . GLU A 1 106 ? 19.700  -13.773 11.296 1.00 62.65  ? 210 GLU A OE1   1 
ATOM   831  O OE2   . GLU A 1 106 ? 18.509  -15.098 9.994  1.00 78.70  ? 210 GLU A OE2   1 
ATOM   832  N N     . GLY A 1 107 ? 16.496  -9.742  11.895 1.00 34.61  ? 211 GLY A N     1 
ATOM   833  C CA    . GLY A 1 107 ? 15.609  -9.536  13.033 1.00 33.84  ? 211 GLY A CA    1 
ATOM   834  C C     . GLY A 1 107 ? 14.330  -8.812  12.656 1.00 35.87  ? 211 GLY A C     1 
ATOM   835  O O     . GLY A 1 107 ? 13.237  -9.223  13.055 1.00 35.05  ? 211 GLY A O     1 
ATOM   836  N N     . GLY A 1 108 ? 14.488  -7.752  11.875 1.00 31.94  ? 212 GLY A N     1 
ATOM   837  C CA    . GLY A 1 108 ? 13.412  -6.924  11.341 1.00 32.44  ? 212 GLY A CA    1 
ATOM   838  C C     . GLY A 1 108 ? 12.403  -7.698  10.525 1.00 37.53  ? 212 GLY A C     1 
ATOM   839  O O     . GLY A 1 108 ? 11.193  -7.475  10.655 1.00 37.89  ? 212 GLY A O     1 
ATOM   840  N N     . ARG A 1 109 ? 12.898  -8.613  9.669  1.00 34.98  ? 213 ARG A N     1 
ATOM   841  C CA    . ARG A 1 109 ? 12.047  -9.448  8.828  1.00 35.86  ? 213 ARG A CA    1 
ATOM   842  C C     . ARG A 1 109 ? 11.182  -10.394 9.686  1.00 39.21  ? 213 ARG A C     1 
ATOM   843  O O     . ARG A 1 109 ? 9.971   -10.470 9.481  1.00 39.70  ? 213 ARG A O     1 
ATOM   844  C CB    . ARG A 1 109 ? 12.884  -10.173 7.766  1.00 34.70  ? 213 ARG A CB    1 
ATOM   845  C CG    . ARG A 1 109 ? 12.121  -11.262 7.012  1.00 40.50  ? 213 ARG A CG    1 
ATOM   846  C CD    . ARG A 1 109 ? 12.950  -11.991 5.965  1.00 47.62  ? 213 ARG A CD    1 
ATOM   847  N NE    . ARG A 1 109 ? 14.133  -12.661 6.514  1.00 47.09  ? 213 ARG A NE    1 
ATOM   848  C CZ    . ARG A 1 109 ? 14.122  -13.829 7.152  1.00 63.45  ? 213 ARG A CZ    1 
ATOM   849  N NH1   . ARG A 1 109 ? 12.983  -14.488 7.330  1.00 47.70  ? 213 ARG A NH1   1 
ATOM   850  N NH2   . ARG A 1 109 ? 15.255  -14.352 7.606  1.00 53.07  ? 213 ARG A NH2   1 
ATOM   851  N N     . ILE A 1 110 ? 11.797  -11.045 10.681 1.00 36.10  ? 214 ILE A N     1 
ATOM   852  C CA    . ILE A 1 110 ? 11.133  -11.936 11.634 1.00 37.23  ? 214 ILE A CA    1 
ATOM   853  C C     . ILE A 1 110 ? 10.103  -11.160 12.467 1.00 39.71  ? 214 ILE A C     1 
ATOM   854  O O     . ILE A 1 110 ? 8.977   -11.640 12.661 1.00 39.73  ? 214 ILE A O     1 
ATOM   855  C CB    . ILE A 1 110 ? 12.175  -12.696 12.517 1.00 40.51  ? 214 ILE A CB    1 
ATOM   856  C CG1   . ILE A 1 110 ? 12.974  -13.718 11.667 1.00 43.75  ? 214 ILE A CG1   1 
ATOM   857  C CG2   . ILE A 1 110 ? 11.493  -13.425 13.698 1.00 42.42  ? 214 ILE A CG2   1 
ATOM   858  C CD1   . ILE A 1 110 ? 14.397  -13.957 12.107 1.00 45.05  ? 214 ILE A CD1   1 
ATOM   859  N N     . LEU A 1 111 ? 10.486  -9.955  12.922 1.00 34.87  ? 215 LEU A N     1 
ATOM   860  C CA    . LEU A 1 111 ? 9.666   -9.077  13.746 1.00 33.70  ? 215 LEU A CA    1 
ATOM   861  C C     . LEU A 1 111 ? 8.392   -8.645  13.014 1.00 39.30  ? 215 LEU A C     1 
ATOM   862  O O     . LEU A 1 111 ? 7.291   -8.801  13.557 1.00 38.50  ? 215 LEU A O     1 
ATOM   863  C CB    . LEU A 1 111 ? 10.487  -7.848  14.220 1.00 32.34  ? 215 LEU A CB    1 
ATOM   864  C CG    . LEU A 1 111 ? 9.768   -6.808  15.085 1.00 35.08  ? 215 LEU A CG    1 
ATOM   865  C CD1   . LEU A 1 111 ? 9.332   -7.412  16.401 1.00 37.01  ? 215 LEU A CD1   1 
ATOM   866  C CD2   . LEU A 1 111 ? 10.673  -5.605  15.364 1.00 32.44  ? 215 LEU A CD2   1 
ATOM   867  N N     . VAL A 1 112 ? 8.522   -8.145  11.779 1.00 38.42  ? 216 VAL A N     1 
ATOM   868  C CA    . VAL A 1 112 ? 7.335   -7.682  11.060 1.00 41.23  ? 216 VAL A CA    1 
ATOM   869  C C     . VAL A 1 112 ? 6.336   -8.881  10.826 1.00 43.09  ? 216 VAL A C     1 
ATOM   870  O O     . VAL A 1 112 ? 5.132   -8.681  10.948 1.00 43.00  ? 216 VAL A O     1 
ATOM   871  C CB    . VAL A 1 112 ? 7.673   -6.832  9.803  1.00 48.27  ? 216 VAL A CB    1 
ATOM   872  C CG1   . VAL A 1 112 ? 7.971   -7.684  8.583  1.00 49.47  ? 216 VAL A CG1   1 
ATOM   873  C CG2   . VAL A 1 112 ? 6.563   -5.838  9.505  1.00 51.32  ? 216 VAL A CG2   1 
ATOM   874  N N     . GLN A 1 113 ? 6.835   -10.120 10.678 1.00 42.08  ? 217 GLN A N     1 
ATOM   875  C CA    . GLN A 1 113 ? 5.974   -11.309 10.554 1.00 43.12  ? 217 GLN A CA    1 
ATOM   876  C C     . GLN A 1 113 ? 5.224   -11.607 11.860 1.00 44.40  ? 217 GLN A C     1 
ATOM   877  O O     . GLN A 1 113 ? 4.029   -11.898 11.816 1.00 43.04  ? 217 GLN A O     1 
ATOM   878  C CB    . GLN A 1 113 ? 6.795   -12.534 10.159 1.00 45.40  ? 217 GLN A CB    1 
ATOM   879  C CG    . GLN A 1 113 ? 7.041   -12.622 8.674  1.00 60.06  ? 217 GLN A CG    1 
ATOM   880  C CD    . GLN A 1 113 ? 8.042   -13.696 8.311  1.00 82.05  ? 217 GLN A CD    1 
ATOM   881  O OE1   . GLN A 1 113 ? 8.371   -14.606 9.095  1.00 76.60  ? 217 GLN A OE1   1 
ATOM   882  N NE2   . GLN A 1 113 ? 8.561   -13.599 7.104  1.00 76.26  ? 217 GLN A NE2   1 
ATOM   883  N N     . LYS A 1 114 ? 5.929   -11.504 13.031 1.00 40.46  ? 218 LYS A N     1 
ATOM   884  C CA    . LYS A 1 114 ? 5.330   -11.703 14.347 1.00 39.76  ? 218 LYS A CA    1 
ATOM   885  C C     . LYS A 1 114 ? 4.266   -10.644 14.605 1.00 42.66  ? 218 LYS A C     1 
ATOM   886  O O     . LYS A 1 114 ? 3.201   -10.968 15.128 1.00 44.11  ? 218 LYS A O     1 
ATOM   887  C CB    . LYS A 1 114 ? 6.403   -11.665 15.459 1.00 40.69  ? 218 LYS A CB    1 
ATOM   888  C CG    . LYS A 1 114 ? 7.190   -12.967 15.553 1.00 45.13  ? 218 LYS A CG    1 
ATOM   889  C CD    . LYS A 1 114 ? 8.310   -12.820 16.546 1.00 49.26  ? 218 LYS A CD    1 
ATOM   890  C CE    . LYS A 1 114 ? 9.209   -14.026 16.543 1.00 52.48  ? 218 LYS A CE    1 
ATOM   891  N NZ    . LYS A 1 114 ? 10.383  -13.845 17.438 1.00 50.51  ? 218 LYS A NZ    1 
ATOM   892  N N     . LEU A 1 115 ? 4.528   -9.390  14.182 1.00 37.52  ? 219 LEU A N     1 
ATOM   893  C CA    . LEU A 1 115 ? 3.579   -8.297  14.376 1.00 37.40  ? 219 LEU A CA    1 
ATOM   894  C C     . LEU A 1 115 ? 2.340   -8.470  13.514 1.00 44.84  ? 219 LEU A C     1 
ATOM   895  O O     . LEU A 1 115 ? 1.237   -8.218  13.998 1.00 45.40  ? 219 LEU A O     1 
ATOM   896  C CB    . LEU A 1 115 ? 4.224   -6.931  14.157 1.00 35.37  ? 219 LEU A CB    1 
ATOM   897  C CG    . LEU A 1 115 ? 5.306   -6.550  15.181 1.00 37.89  ? 219 LEU A CG    1 
ATOM   898  C CD1   . LEU A 1 115 ? 5.959   -5.235  14.807 1.00 36.17  ? 219 LEU A CD1   1 
ATOM   899  C CD2   . LEU A 1 115 ? 4.749   -6.516  16.620 1.00 39.62  ? 219 LEU A CD2   1 
ATOM   900  N N     . GLN A 1 116 ? 2.510   -8.947  12.271 1.00 42.39  ? 220 GLN A N     1 
ATOM   901  C CA    . GLN A 1 116 ? 1.383   -9.205  11.362 1.00 45.49  ? 220 GLN A CA    1 
ATOM   902  C C     . GLN A 1 116 ? 0.526   -10.375 11.839 1.00 51.21  ? 220 GLN A C     1 
ATOM   903  O O     . GLN A 1 116 ? -0.642  -10.474 11.460 1.00 54.02  ? 220 GLN A O     1 
ATOM   904  C CB    . GLN A 1 116 ? 1.862   -9.424  9.917  1.00 48.28  ? 220 GLN A CB    1 
ATOM   905  C CG    . GLN A 1 116 ? 2.425   -8.139  9.289  1.00 53.80  ? 220 GLN A CG    1 
ATOM   906  C CD    . GLN A 1 116 ? 3.167   -8.359  7.987  1.00 71.32  ? 220 GLN A CD    1 
ATOM   907  O OE1   . GLN A 1 116 ? 3.878   -9.350  7.794  1.00 62.95  ? 220 GLN A OE1   1 
ATOM   908  N NE2   . GLN A 1 116 ? 3.072   -7.393  7.084  1.00 63.29  ? 220 GLN A NE2   1 
ATOM   909  N N     . LYS A 1 117 ? 1.090   -11.259 12.679 1.00 46.78  ? 221 LYS A N     1 
ATOM   910  C CA    . LYS A 1 117 ? 0.352   -12.415 13.205 1.00 47.72  ? 221 LYS A CA    1 
ATOM   911  C C     . LYS A 1 117 ? -0.449  -11.969 14.452 1.00 52.35  ? 221 LYS A C     1 
ATOM   912  O O     . LYS A 1 117 ? -1.672  -12.067 14.459 1.00 56.24  ? 221 LYS A O     1 
ATOM   913  C CB    . LYS A 1 117 ? 1.339   -13.544 13.556 1.00 47.78  ? 221 LYS A CB    1 
ATOM   914  C CG    . LYS A 1 117 ? 0.703   -14.791 14.144 1.00 60.78  ? 221 LYS A CG    1 
ATOM   915  C CD    . LYS A 1 117 ? 1.762   -15.714 14.719 1.00 66.36  ? 221 LYS A CD    1 
ATOM   916  C CE    . LYS A 1 117 ? 1.145   -16.935 15.354 1.00 81.01  ? 221 LYS A CE    1 
ATOM   917  N NZ    . LYS A 1 117 ? 2.157   -17.742 16.085 1.00 90.69  ? 221 LYS A NZ    1 
ATOM   918  N N     . TYR A 1 118 ? 0.250   -11.460 15.482 1.00 44.36  ? 222 TYR A N     1 
ATOM   919  C CA    . TYR A 1 118 ? -0.332  -11.064 16.772 1.00 43.91  ? 222 TYR A CA    1 
ATOM   920  C C     . TYR A 1 118 ? -1.104  -9.746  16.748 1.00 45.67  ? 222 TYR A C     1 
ATOM   921  O O     . TYR A 1 118 ? -2.068  -9.606  17.497 1.00 47.44  ? 222 TYR A O     1 
ATOM   922  C CB    . TYR A 1 118 ? 0.739   -11.069 17.875 1.00 41.52  ? 222 TYR A CB    1 
ATOM   923  C CG    . TYR A 1 118 ? 1.251   -12.478 18.133 1.00 43.12  ? 222 TYR A CG    1 
ATOM   924  C CD1   . TYR A 1 118 ? 0.450   -13.426 18.762 1.00 47.53  ? 222 TYR A CD1   1 
ATOM   925  C CD2   . TYR A 1 118 ? 2.515   -12.875 17.702 1.00 42.37  ? 222 TYR A CD2   1 
ATOM   926  C CE1   . TYR A 1 118 ? 0.897   -14.731 18.970 1.00 47.67  ? 222 TYR A CE1   1 
ATOM   927  C CE2   . TYR A 1 118 ? 2.975   -14.180 17.906 1.00 44.08  ? 222 TYR A CE2   1 
ATOM   928  C CZ    . TYR A 1 118 ? 2.165   -15.103 18.547 1.00 52.35  ? 222 TYR A CZ    1 
ATOM   929  O OH    . TYR A 1 118 ? 2.613   -16.390 18.766 1.00 50.14  ? 222 TYR A OH    1 
ATOM   930  N N     . GLN A 1 119 ? -0.716  -8.815  15.871 1.00 38.50  ? 223 GLN A N     1 
ATOM   931  C CA    . GLN A 1 119 ? -1.396  -7.528  15.652 1.00 38.99  ? 223 GLN A CA    1 
ATOM   932  C C     . GLN A 1 119 ? -1.735  -6.776  16.961 1.00 42.10  ? 223 GLN A C     1 
ATOM   933  O O     . GLN A 1 119 ? -2.913  -6.534  17.250 1.00 43.12  ? 223 GLN A O     1 
ATOM   934  C CB    . GLN A 1 119 ? -2.630  -7.713  14.750 1.00 43.91  ? 223 GLN A CB    1 
ATOM   935  C CG    . GLN A 1 119 ? -2.277  -8.422  13.451 1.00 53.04  ? 223 GLN A CG    1 
ATOM   936  C CD    . GLN A 1 119 ? -3.341  -8.375  12.393 1.00 68.67  ? 223 GLN A CD    1 
ATOM   937  O OE1   . GLN A 1 119 ? -3.998  -7.353  12.184 1.00 66.98  ? 223 GLN A OE1   1 
ATOM   938  N NE2   . GLN A 1 119 ? -3.465  -9.467  11.641 1.00 62.25  ? 223 GLN A NE2   1 
ATOM   939  N N     . PRO A 1 120 ? -0.710  -6.401  17.775 1.00 35.35  ? 224 PRO A N     1 
ATOM   940  C CA    . PRO A 1 120 ? -0.998  -5.598  18.974 1.00 34.82  ? 224 PRO A CA    1 
ATOM   941  C C     . PRO A 1 120 ? -1.491  -4.217  18.548 1.00 39.92  ? 224 PRO A C     1 
ATOM   942  O O     . PRO A 1 120 ? -1.173  -3.802  17.443 1.00 39.08  ? 224 PRO A O     1 
ATOM   943  C CB    . PRO A 1 120 ? 0.386   -5.450  19.631 1.00 33.82  ? 224 PRO A CB    1 
ATOM   944  C CG    . PRO A 1 120 ? 1.350   -5.538  18.494 1.00 36.68  ? 224 PRO A CG    1 
ATOM   945  C CD    . PRO A 1 120 ? 0.744   -6.567  17.575 1.00 33.91  ? 224 PRO A CD    1 
ATOM   946  N N     . ARG A 1 121 ? -2.184  -3.468  19.411 1.00 38.28  ? 225 ARG A N     1 
ATOM   947  C CA    . ARG A 1 121 ? -2.605  -2.120  19.011 1.00 37.75  ? 225 ARG A CA    1 
ATOM   948  C C     . ARG A 1 121 ? -1.388  -1.238  18.772 1.00 37.43  ? 225 ARG A C     1 
ATOM   949  O O     . ARG A 1 121 ? -1.397  -0.397  17.865 1.00 36.85  ? 225 ARG A O     1 
ATOM   950  C CB    . ARG A 1 121 ? -3.518  -1.466  20.066 1.00 41.00  ? 225 ARG A CB    1 
ATOM   951  C CG    . ARG A 1 121 ? -4.879  -2.127  20.239 1.00 52.30  ? 225 ARG A CG    1 
ATOM   952  C CD    . ARG A 1 121 ? -5.586  -1.445  21.393 1.00 70.28  ? 225 ARG A CD    1 
ATOM   953  N NE    . ARG A 1 121 ? -6.727  -2.215  21.891 1.00 84.64  ? 225 ARG A NE    1 
ATOM   954  C CZ    . ARG A 1 121 ? -7.982  -2.021  21.505 1.00 101.80 ? 225 ARG A CZ    1 
ATOM   955  N NH1   . ARG A 1 121 ? -8.273  -1.086  20.609 1.00 86.05  ? 225 ARG A NH1   1 
ATOM   956  N NH2   . ARG A 1 121 ? -8.959  -2.765  22.010 1.00 94.11  ? 225 ARG A NH2   1 
ATOM   957  N N     . ILE A 1 122 ? -0.341  -1.415  19.596 1.00 33.61  ? 226 ILE A N     1 
ATOM   958  C CA    . ILE A 1 122 ? 0.844   -0.579  19.488 1.00 30.77  ? 226 ILE A CA    1 
ATOM   959  C C     . ILE A 1 122 ? 2.101   -1.440  19.590 1.00 34.71  ? 226 ILE A C     1 
ATOM   960  O O     . ILE A 1 122 ? 2.257   -2.205  20.543 1.00 34.98  ? 226 ILE A O     1 
ATOM   961  C CB    . ILE A 1 122 ? 0.872   0.578   20.556 1.00 33.87  ? 226 ILE A CB    1 
ATOM   962  C CG1   . ILE A 1 122 ? -0.489  1.302   20.714 1.00 34.91  ? 226 ILE A CG1   1 
ATOM   963  C CG2   . ILE A 1 122 ? 2.011   1.577   20.259 1.00 32.34  ? 226 ILE A CG2   1 
ATOM   964  C CD1   . ILE A 1 122 ? -0.700  2.025   22.109 1.00 40.96  ? 226 ILE A CD1   1 
ATOM   965  N N     . ALA A 1 123 ? 3.010   -1.245  18.639 1.00 30.21  ? 227 ALA A N     1 
ATOM   966  C CA    . ALA A 1 123 ? 4.343   -1.841  18.602 1.00 29.26  ? 227 ALA A CA    1 
ATOM   967  C C     . ALA A 1 123 ? 5.283   -0.803  19.207 1.00 30.38  ? 227 ALA A C     1 
ATOM   968  O O     . ALA A 1 123 ? 5.462   0.272   18.632 1.00 30.78  ? 227 ALA A O     1 
ATOM   969  C CB    . ALA A 1 123 ? 4.745   -2.154  17.168 1.00 29.65  ? 227 ALA A CB    1 
ATOM   970  N N     . VAL A 1 124 ? 5.850   -1.085  20.382 1.00 25.92  ? 228 VAL A N     1 
ATOM   971  C CA    . VAL A 1 124 ? 6.714   -0.105  21.080 1.00 23.45  ? 228 VAL A CA    1 
ATOM   972  C C     . VAL A 1 124 ? 8.162   -0.476  20.900 1.00 26.24  ? 228 VAL A C     1 
ATOM   973  O O     . VAL A 1 124 ? 8.583   -1.505  21.394 1.00 26.76  ? 228 VAL A O     1 
ATOM   974  C CB    . VAL A 1 124 ? 6.345   0.050   22.582 1.00 27.70  ? 228 VAL A CB    1 
ATOM   975  C CG1   . VAL A 1 124 ? 7.308   1.000   23.316 1.00 25.34  ? 228 VAL A CG1   1 
ATOM   976  C CG2   . VAL A 1 124 ? 4.896   0.502   22.751 1.00 29.97  ? 228 VAL A CG2   1 
ATOM   977  N N     . PHE A 1 125 ? 8.933   0.370   20.239 1.00 23.38  ? 229 PHE A N     1 
ATOM   978  C CA    . PHE A 1 125 ? 10.364  0.117   20.041 1.00 23.52  ? 229 PHE A CA    1 
ATOM   979  C C     . PHE A 1 125 ? 11.098  0.694   21.216 1.00 26.70  ? 229 PHE A C     1 
ATOM   980  O O     . PHE A 1 125 ? 11.076  1.920   21.436 1.00 27.61  ? 229 PHE A O     1 
ATOM   981  C CB    . PHE A 1 125 ? 10.874  0.719   18.704 1.00 24.87  ? 229 PHE A CB    1 
ATOM   982  C CG    . PHE A 1 125 ? 10.280  0.007   17.528 1.00 25.86  ? 229 PHE A CG    1 
ATOM   983  C CD1   . PHE A 1 125 ? 8.965   0.236   17.150 1.00 27.55  ? 229 PHE A CD1   1 
ATOM   984  C CD2   . PHE A 1 125 ? 11.019  -0.937  16.821 1.00 25.98  ? 229 PHE A CD2   1 
ATOM   985  C CE1   . PHE A 1 125 ? 8.385   -0.494  16.121 1.00 29.43  ? 229 PHE A CE1   1 
ATOM   986  C CE2   . PHE A 1 125 ? 10.452  -1.632  15.758 1.00 30.00  ? 229 PHE A CE2   1 
ATOM   987  C CZ    . PHE A 1 125 ? 9.140   -1.401  15.409 1.00 30.48  ? 229 PHE A CZ    1 
ATOM   988  N N     . ASN A 1 126 ? 11.702  -0.187  21.988 1.00 24.02  ? 230 ASN A N     1 
ATOM   989  C CA    . ASN A 1 126 ? 12.479  0.159   23.159 1.00 24.71  ? 230 ASN A CA    1 
ATOM   990  C C     . ASN A 1 126 ? 13.925  0.451   22.705 1.00 29.42  ? 230 ASN A C     1 
ATOM   991  O O     . ASN A 1 126 ? 14.833  -0.355  22.878 1.00 28.17  ? 230 ASN A O     1 
ATOM   992  C CB    . ASN A 1 126 ? 12.378  -0.947  24.200 1.00 26.27  ? 230 ASN A CB    1 
ATOM   993  C CG    . ASN A 1 126 ? 13.038  -0.604  25.515 1.00 38.81  ? 230 ASN A CG    1 
ATOM   994  O OD1   . ASN A 1 126 ? 13.316  0.568   25.821 1.00 28.46  ? 230 ASN A OD1   1 
ATOM   995  N ND2   . ASN A 1 126 ? 13.261  -1.612  26.349 1.00 33.36  ? 230 ASN A ND2   1 
ATOM   996  N N     . GLY A 1 127 ? 14.088  1.598   22.069 1.00 26.79  ? 231 GLY A N     1 
ATOM   997  C CA    . GLY A 1 127 ? 15.356  2.026   21.497 1.00 27.05  ? 231 GLY A CA    1 
ATOM   998  C C     . GLY A 1 127 ? 15.189  2.647   20.129 1.00 28.94  ? 231 GLY A C     1 
ATOM   999  O O     . GLY A 1 127 ? 14.550  2.074   19.249 1.00 27.55  ? 231 GLY A O     1 
ATOM   1000 N N     . LYS A 1 128 ? 15.789  3.828   19.940 1.00 26.37  ? 232 LYS A N     1 
ATOM   1001 C CA    . LYS A 1 128 ? 15.774  4.544   18.680 1.00 26.74  ? 232 LYS A CA    1 
ATOM   1002 C C     . LYS A 1 128 ? 16.525  3.764   17.581 1.00 31.00  ? 232 LYS A C     1 
ATOM   1003 O O     . LYS A 1 128 ? 16.017  3.685   16.473 1.00 29.29  ? 232 LYS A O     1 
ATOM   1004 C CB    . LYS A 1 128 ? 16.414  5.925   18.875 1.00 30.19  ? 232 LYS A CB    1 
ATOM   1005 C CG    . LYS A 1 128 ? 15.684  6.983   18.099 1.00 34.98  ? 232 LYS A CG    1 
ATOM   1006 C CD    . LYS A 1 128 ? 16.353  8.309   18.220 1.00 37.11  ? 232 LYS A CD    1 
ATOM   1007 C CE    . LYS A 1 128 ? 15.362  9.432   18.166 1.00 40.76  ? 232 LYS A CE    1 
ATOM   1008 N NZ    . LYS A 1 128 ? 16.058  10.751  18.194 1.00 40.97  ? 232 LYS A NZ    1 
ATOM   1009 N N     . CYS A 1 129 ? 17.678  3.141   17.916 1.00 31.74  ? 233 CYS A N     1 
ATOM   1010 C CA    . CYS A 1 129 ? 18.544  2.386   16.988 1.00 34.78  ? 233 CYS A CA    1 
ATOM   1011 C C     . CYS A 1 129 ? 17.799  1.307   16.205 1.00 36.51  ? 233 CYS A C     1 
ATOM   1012 O O     . CYS A 1 129 ? 17.948  1.233   14.980 1.00 35.50  ? 233 CYS A O     1 
ATOM   1013 C CB    . CYS A 1 129 ? 19.758  1.808   17.706 1.00 37.56  ? 233 CYS A CB    1 
ATOM   1014 S SG    . CYS A 1 129 ? 19.349  0.552   18.958 1.00 41.57  ? 233 CYS A SG    1 
ATOM   1015 N N     . ILE A 1 130 ? 16.962  0.526   16.893 1.00 30.10  ? 234 ILE A N     1 
ATOM   1016 C CA    . ILE A 1 130 ? 16.199  -0.548  16.234 1.00 29.37  ? 234 ILE A CA    1 
ATOM   1017 C C     . ILE A 1 130 ? 15.078  0.011   15.364 1.00 30.24  ? 234 ILE A C     1 
ATOM   1018 O O     . ILE A 1 130 ? 14.759  -0.595  14.346 1.00 28.00  ? 234 ILE A O     1 
ATOM   1019 C CB    . ILE A 1 130 ? 15.709  -1.648  17.199 1.00 32.65  ? 234 ILE A CB    1 
ATOM   1020 C CG1   . ILE A 1 130 ? 14.943  -1.059  18.422 1.00 31.59  ? 234 ILE A CG1   1 
ATOM   1021 C CG2   . ILE A 1 130 ? 16.916  -2.529  17.634 1.00 32.39  ? 234 ILE A CG2   1 
ATOM   1022 C CD1   . ILE A 1 130 ? 14.079  -2.055  19.131 1.00 34.75  ? 234 ILE A CD1   1 
ATOM   1023 N N     . TYR A 1 131 ? 14.494  1.160   15.731 1.00 26.55  ? 235 TYR A N     1 
ATOM   1024 C CA    . TYR A 1 131 ? 13.484  1.706   14.821 1.00 27.23  ? 235 TYR A CA    1 
ATOM   1025 C C     . TYR A 1 131 ? 14.121  2.309   13.534 1.00 34.55  ? 235 TYR A C     1 
ATOM   1026 O O     . TYR A 1 131 ? 13.499  2.230   12.469 1.00 33.67  ? 235 TYR A O     1 
ATOM   1027 C CB    . TYR A 1 131 ? 12.545  2.715   15.498 1.00 26.84  ? 235 TYR A CB    1 
ATOM   1028 C CG    . TYR A 1 131 ? 11.428  3.090   14.561 1.00 27.17  ? 235 TYR A CG    1 
ATOM   1029 C CD1   . TYR A 1 131 ? 10.355  2.231   14.348 1.00 29.99  ? 235 TYR A CD1   1 
ATOM   1030 C CD2   . TYR A 1 131 ? 11.475  4.271   13.829 1.00 28.77  ? 235 TYR A CD2   1 
ATOM   1031 C CE1   . TYR A 1 131 ? 9.373   2.523   13.405 1.00 30.08  ? 235 TYR A CE1   1 
ATOM   1032 C CE2   . TYR A 1 131 ? 10.497  4.570   12.884 1.00 30.49  ? 235 TYR A CE2   1 
ATOM   1033 C CZ    . TYR A 1 131 ? 9.436   3.699   12.692 1.00 33.93  ? 235 TYR A CZ    1 
ATOM   1034 O OH    . TYR A 1 131 ? 8.429   4.014   11.811 1.00 36.48  ? 235 TYR A OH    1 
ATOM   1035 N N     . GLU A 1 132 ? 15.347  2.901   13.634 1.00 33.79  ? 236 GLU A N     1 
ATOM   1036 C CA    . GLU A 1 132 ? 16.040  3.460   12.463 1.00 36.21  ? 236 GLU A CA    1 
ATOM   1037 C C     . GLU A 1 132 ? 16.199  2.327   11.416 1.00 38.06  ? 236 GLU A C     1 
ATOM   1038 O O     . GLU A 1 132 ? 15.868  2.501   10.245 1.00 37.49  ? 236 GLU A O     1 
ATOM   1039 C CB    . GLU A 1 132 ? 17.421  4.030   12.830 1.00 38.83  ? 236 GLU A CB    1 
ATOM   1040 C CG    . GLU A 1 132 ? 17.380  5.203   13.802 1.00 53.97  ? 236 GLU A CG    1 
ATOM   1041 C CD    . GLU A 1 132 ? 18.689  5.710   14.389 1.00 86.51  ? 236 GLU A CD    1 
ATOM   1042 O OE1   . GLU A 1 132 ? 19.543  4.884   14.790 1.00 75.65  ? 236 GLU A OE1   1 
ATOM   1043 O OE2   . GLU A 1 132 ? 18.822  6.950   14.523 1.00 87.95  ? 236 GLU A OE2   1 
ATOM   1044 N N     . ILE A 1 133 ? 16.653  1.158   11.872 1.00 33.36  ? 237 ILE A N     1 
ATOM   1045 C CA    . ILE A 1 133 ? 16.832  -0.024  11.015 1.00 33.67  ? 237 ILE A CA    1 
ATOM   1046 C C     . ILE A 1 133 ? 15.483  -0.525  10.494 1.00 34.81  ? 237 ILE A C     1 
ATOM   1047 O O     . ILE A 1 133 ? 15.358  -0.779  9.308  1.00 35.36  ? 237 ILE A O     1 
ATOM   1048 C CB    . ILE A 1 133 ? 17.589  -1.145  11.789 1.00 36.68  ? 237 ILE A CB    1 
ATOM   1049 C CG1   . ILE A 1 133 ? 18.984  -0.646  12.206 1.00 38.54  ? 237 ILE A CG1   1 
ATOM   1050 C CG2   . ILE A 1 133 ? 17.691  -2.408  10.916 1.00 38.65  ? 237 ILE A CG2   1 
ATOM   1051 C CD1   . ILE A 1 133 ? 19.568  -1.317  13.398 1.00 46.15  ? 237 ILE A CD1   1 
ATOM   1052 N N     . PHE A 1 134 ? 14.491  -0.663  11.387 1.00 31.92  ? 238 PHE A N     1 
ATOM   1053 C CA    . PHE A 1 134 ? 13.146  -1.152  11.050 1.00 33.04  ? 238 PHE A CA    1 
ATOM   1054 C C     . PHE A 1 134 ? 12.493  -0.303  9.967  1.00 38.35  ? 238 PHE A C     1 
ATOM   1055 O O     . PHE A 1 134 ? 12.007  -0.849  8.972  1.00 38.38  ? 238 PHE A O     1 
ATOM   1056 C CB    . PHE A 1 134 ? 12.256  -1.204  12.321 1.00 32.88  ? 238 PHE A CB    1 
ATOM   1057 C CG    . PHE A 1 134 ? 10.961  -1.954  12.111 1.00 34.56  ? 238 PHE A CG    1 
ATOM   1058 C CD1   . PHE A 1 134 ? 10.922  -3.345  12.194 1.00 38.97  ? 238 PHE A CD1   1 
ATOM   1059 C CD2   . PHE A 1 134 ? 9.787   -1.272  11.812 1.00 37.26  ? 238 PHE A CD2   1 
ATOM   1060 C CE1   . PHE A 1 134 ? 9.725   -4.047  11.971 1.00 40.47  ? 238 PHE A CE1   1 
ATOM   1061 C CE2   . PHE A 1 134 ? 8.594   -1.970  11.575 1.00 41.23  ? 238 PHE A CE2   1 
ATOM   1062 C CZ    . PHE A 1 134 ? 8.567   -3.352  11.674 1.00 39.65  ? 238 PHE A CZ    1 
ATOM   1063 N N     . SER A 1 135 ? 12.489  1.018   10.159 1.00 33.96  ? 239 SER A N     1 
ATOM   1064 C CA    . SER A 1 135 ? 11.898  1.964   9.209  1.00 34.60  ? 239 SER A CA    1 
ATOM   1065 C C     . SER A 1 135 ? 12.476  1.856   7.800  1.00 39.86  ? 239 SER A C     1 
ATOM   1066 O O     . SER A 1 135 ? 11.707  1.852   6.843  1.00 39.63  ? 239 SER A O     1 
ATOM   1067 C CB    . SER A 1 135 ? 12.033  3.389   9.715  1.00 35.78  ? 239 SER A CB    1 
ATOM   1068 O OG    . SER A 1 135 ? 11.475  4.280   8.758  1.00 47.91  ? 239 SER A OG    1 
ATOM   1069 N N     . LYS A 1 136 ? 13.817  1.795   7.680  1.00 38.04  ? 240 LYS A N     1 
ATOM   1070 C CA    . LYS A 1 136 ? 14.551  1.711   6.409  1.00 40.67  ? 240 LYS A CA    1 
ATOM   1071 C C     . LYS A 1 136 ? 14.209  0.405   5.666  1.00 44.85  ? 240 LYS A C     1 
ATOM   1072 O O     . LYS A 1 136 ? 13.951  0.405   4.465  1.00 44.81  ? 240 LYS A O     1 
ATOM   1073 C CB    . LYS A 1 136 ? 16.062  1.800   6.693  1.00 43.40  ? 240 LYS A CB    1 
ATOM   1074 C CG    . LYS A 1 136 ? 16.939  2.139   5.488  1.00 64.14  ? 240 LYS A CG    1 
ATOM   1075 C CD    . LYS A 1 136 ? 18.444  2.116   5.819  1.00 78.73  ? 240 LYS A CD    1 
ATOM   1076 C CE    . LYS A 1 136 ? 18.894  3.183   6.803  1.00 92.81  ? 240 LYS A CE    1 
ATOM   1077 N NZ    . LYS A 1 136 ? 20.372  3.221   6.965  1.00 104.72 ? 240 LYS A NZ    1 
ATOM   1078 N N     . GLU A 1 137 ? 14.122  -0.685  6.416  1.00 40.45  ? 241 GLU A N     1 
ATOM   1079 C CA    . GLU A 1 137 ? 13.833  -2.015  5.892  1.00 40.30  ? 241 GLU A CA    1 
ATOM   1080 C C     . GLU A 1 137 ? 12.343  -2.302  5.585  1.00 45.28  ? 241 GLU A C     1 
ATOM   1081 O O     . GLU A 1 137 ? 12.052  -3.036  4.644  1.00 46.11  ? 241 GLU A O     1 
ATOM   1082 C CB    . GLU A 1 137 ? 14.338  -3.003  6.937  1.00 39.18  ? 241 GLU A CB    1 
ATOM   1083 C CG    . GLU A 1 137 ? 14.603  -4.392  6.425  1.00 46.37  ? 241 GLU A CG    1 
ATOM   1084 C CD    . GLU A 1 137 ? 14.636  -5.418  7.537  1.00 50.42  ? 241 GLU A CD    1 
ATOM   1085 O OE1   . GLU A 1 137 ? 14.725  -5.036  8.729  1.00 47.07  ? 241 GLU A OE1   1 
ATOM   1086 O OE2   . GLU A 1 137 ? 14.557  -6.617  7.205  1.00 44.33  ? 241 GLU A OE2   1 
ATOM   1087 N N     . VAL A 1 138 ? 11.411  -1.784  6.408  1.00 42.38  ? 242 VAL A N     1 
ATOM   1088 C CA    . VAL A 1 138 ? 9.973   -2.084  6.309  1.00 42.71  ? 242 VAL A CA    1 
ATOM   1089 C C     . VAL A 1 138 ? 9.200   -1.007  5.536  1.00 48.52  ? 242 VAL A C     1 
ATOM   1090 O O     . VAL A 1 138 ? 8.352   -1.323  4.699  1.00 48.53  ? 242 VAL A O     1 
ATOM   1091 C CB    . VAL A 1 138 ? 9.401   -2.350  7.733  1.00 44.09  ? 242 VAL A CB    1 
ATOM   1092 C CG1   . VAL A 1 138 ? 7.890   -2.524  7.735  1.00 44.62  ? 242 VAL A CG1   1 
ATOM   1093 C CG2   . VAL A 1 138 ? 10.086  -3.552  8.395  1.00 43.13  ? 242 VAL A CG2   1 
ATOM   1094 N N     . PHE A 1 139 ? 9.482   0.258   5.823  1.00 45.08  ? 243 PHE A N     1 
ATOM   1095 C CA    . PHE A 1 139 ? 8.775   1.349   5.162  1.00 46.47  ? 243 PHE A CA    1 
ATOM   1096 C C     . PHE A 1 139 ? 9.581   1.972   4.024  1.00 54.56  ? 243 PHE A C     1 
ATOM   1097 O O     . PHE A 1 139 ? 9.050   2.818   3.298  1.00 55.99  ? 243 PHE A O     1 
ATOM   1098 C CB    . PHE A 1 139 ? 8.384   2.411   6.211  1.00 45.54  ? 243 PHE A CB    1 
ATOM   1099 C CG    . PHE A 1 139 ? 7.628   1.833   7.381  1.00 44.03  ? 243 PHE A CG    1 
ATOM   1100 C CD1   . PHE A 1 139 ? 6.404   1.201   7.197  1.00 47.16  ? 243 PHE A CD1   1 
ATOM   1101 C CD2   . PHE A 1 139 ? 8.142   1.913   8.665  1.00 43.26  ? 243 PHE A CD2   1 
ATOM   1102 C CE1   . PHE A 1 139 ? 5.728   0.631   8.280  1.00 46.57  ? 243 PHE A CE1   1 
ATOM   1103 C CE2   . PHE A 1 139 ? 7.446   1.377   9.750  1.00 44.42  ? 243 PHE A CE2   1 
ATOM   1104 C CZ    . PHE A 1 139 ? 6.254   0.727   9.548  1.00 43.19  ? 243 PHE A CZ    1 
ATOM   1105 N N     . GLY A 1 140 ? 10.851  1.556   3.887  1.00 52.79  ? 244 GLY A N     1 
ATOM   1106 C CA    . GLY A 1 140 ? 11.784  2.110   2.906  1.00 55.37  ? 244 GLY A CA    1 
ATOM   1107 C C     . GLY A 1 140 ? 12.020  3.586   3.169  1.00 60.53  ? 244 GLY A C     1 
ATOM   1108 O O     . GLY A 1 140 ? 12.236  4.355   2.239  1.00 61.80  ? 244 GLY A O     1 
ATOM   1109 N N     . VAL A 1 141 ? 11.947  3.993   4.449  1.00 56.68  ? 245 VAL A N     1 
ATOM   1110 C CA    . VAL A 1 141 ? 12.043  5.387   4.865  1.00 57.09  ? 245 VAL A CA    1 
ATOM   1111 C C     . VAL A 1 141 ? 13.282  5.661   5.722  1.00 61.57  ? 245 VAL A C     1 
ATOM   1112 O O     . VAL A 1 141 ? 13.575  4.911   6.651  1.00 58.40  ? 245 VAL A O     1 
ATOM   1113 C CB    . VAL A 1 141 ? 10.720  5.823   5.574  1.00 60.25  ? 245 VAL A CB    1 
ATOM   1114 C CG1   . VAL A 1 141 ? 10.854  7.186   6.259  1.00 59.73  ? 245 VAL A CG1   1 
ATOM   1115 C CG2   . VAL A 1 141 ? 9.537   5.823   4.602  1.00 61.94  ? 245 VAL A CG2   1 
ATOM   1116 N N     . LYS A 1 142 ? 13.981  6.763   5.417  1.00 61.57  ? 246 LYS A N     1 
ATOM   1117 C CA    . LYS A 1 142 ? 15.126  7.249   6.178  1.00 61.75  ? 246 LYS A CA    1 
ATOM   1118 C C     . LYS A 1 142 ? 14.989  8.768   6.269  1.00 67.87  ? 246 LYS A C     1 
ATOM   1119 O O     . LYS A 1 142 ? 15.127  9.471   5.260  1.00 69.75  ? 246 LYS A O     1 
ATOM   1120 C CB    . LYS A 1 142 ? 16.461  6.832   5.529  1.00 66.28  ? 246 LYS A CB    1 
ATOM   1121 C CG    . LYS A 1 142 ? 17.574  6.563   6.545  1.00 78.25  ? 246 LYS A CG    1 
ATOM   1122 C CD    . LYS A 1 142 ? 18.387  7.800   6.917  1.00 87.72  ? 246 LYS A CD    1 
ATOM   1123 C CE    . LYS A 1 142 ? 19.309  7.537   8.082  1.00 93.04  ? 246 LYS A CE    1 
ATOM   1124 N NZ    . LYS A 1 142 ? 19.919  8.791   8.595  1.00 98.44  ? 246 LYS A NZ    1 
ATOM   1125 N N     . VAL A 1 143 ? 14.637  9.260   7.469  1.00 63.19  ? 247 VAL A N     1 
ATOM   1126 C CA    . VAL A 1 143 ? 14.473  10.694  7.755  1.00 63.39  ? 247 VAL A CA    1 
ATOM   1127 C C     . VAL A 1 143 ? 15.757  11.169  8.461  1.00 66.78  ? 247 VAL A C     1 
ATOM   1128 O O     . VAL A 1 143 ? 16.343  10.407  9.241  1.00 65.63  ? 247 VAL A O     1 
ATOM   1129 C CB    . VAL A 1 143 ? 13.172  10.979  8.575  1.00 66.29  ? 247 VAL A CB    1 
ATOM   1130 C CG1   . VAL A 1 143 ? 13.066  12.445  8.994  1.00 67.36  ? 247 VAL A CG1   1 
ATOM   1131 C CG2   . VAL A 1 143 ? 11.918  10.561  7.804  1.00 66.22  ? 247 VAL A CG2   1 
ATOM   1132 N N     . LYS A 1 144 ? 16.212  12.400  8.155  1.00 64.56  ? 248 LYS A N     1 
ATOM   1133 C CA    . LYS A 1 144 ? 17.422  12.985  8.740  1.00 65.36  ? 248 LYS A CA    1 
ATOM   1134 C C     . LYS A 1 144 ? 17.306  13.138  10.258 1.00 65.59  ? 248 LYS A C     1 
ATOM   1135 O O     . LYS A 1 144 ? 18.285  12.926  10.976 1.00 65.64  ? 248 LYS A O     1 
ATOM   1136 C CB    . LYS A 1 144 ? 17.747  14.341  8.090  1.00 71.27  ? 248 LYS A CB    1 
ATOM   1137 N N     . ASN A 1 145 ? 16.116  13.518  10.739 1.00 59.00  ? 249 ASN A N     1 
ATOM   1138 C CA    . ASN A 1 145 ? 15.871  13.709  12.162 1.00 56.60  ? 249 ASN A CA    1 
ATOM   1139 C C     . ASN A 1 145 ? 14.722  12.808  12.628 1.00 54.26  ? 249 ASN A C     1 
ATOM   1140 O O     . ASN A 1 145 ? 13.548  13.211  12.605 1.00 52.86  ? 249 ASN A O     1 
ATOM   1141 C CB    . ASN A 1 145 ? 15.624  15.202  12.484 1.00 61.05  ? 249 ASN A CB    1 
ATOM   1142 N N     . LEU A 1 146 ? 15.061  11.556  12.994 1.00 46.14  ? 250 LEU A N     1 
ATOM   1143 C CA    . LEU A 1 146 ? 14.064  10.620  13.509 1.00 42.11  ? 250 LEU A CA    1 
ATOM   1144 C C     . LEU A 1 146 ? 13.704  11.095  14.908 1.00 40.10  ? 250 LEU A C     1 
ATOM   1145 O O     . LEU A 1 146 ? 14.589  11.476  15.675 1.00 40.78  ? 250 LEU A O     1 
ATOM   1146 C CB    . LEU A 1 146 ? 14.583  9.170   13.528 1.00 41.23  ? 250 LEU A CB    1 
ATOM   1147 C CG    . LEU A 1 146 ? 13.649  8.123   14.196 1.00 45.48  ? 250 LEU A CG    1 
ATOM   1148 C CD1   . LEU A 1 146 ? 12.543  7.701   13.270 1.00 46.31  ? 250 LEU A CD1   1 
ATOM   1149 C CD2   . LEU A 1 146 ? 14.415  6.917   14.663 1.00 47.88  ? 250 LEU A CD2   1 
ATOM   1150 N N     . GLU A 1 147 ? 12.415  11.103  15.239 1.00 32.95  ? 251 GLU A N     1 
ATOM   1151 C CA    . GLU A 1 147 ? 12.018  11.550  16.579 1.00 31.74  ? 251 GLU A CA    1 
ATOM   1152 C C     . GLU A 1 147 ? 11.463  10.407  17.407 1.00 33.24  ? 251 GLU A C     1 
ATOM   1153 O O     . GLU A 1 147 ? 11.145  9.348   16.864 1.00 31.67  ? 251 GLU A O     1 
ATOM   1154 C CB    . GLU A 1 147 ? 11.019  12.697  16.468 1.00 32.98  ? 251 GLU A CB    1 
ATOM   1155 C CG    . GLU A 1 147 ? 11.684  13.920  15.873 1.00 36.35  ? 251 GLU A CG    1 
ATOM   1156 C CD    . GLU A 1 147 ? 10.784  15.118  15.708 1.00 54.34  ? 251 GLU A CD    1 
ATOM   1157 O OE1   . GLU A 1 147 ? 9.547   14.937  15.683 1.00 43.10  ? 251 GLU A OE1   1 
ATOM   1158 O OE2   . GLU A 1 147 ? 11.320  16.247  15.645 1.00 47.74  ? 251 GLU A OE2   1 
ATOM   1159 N N     . PHE A 1 148 ? 11.356  10.606  18.728 1.00 30.14  ? 252 PHE A N     1 
ATOM   1160 C CA    . PHE A 1 148 ? 10.747  9.589   19.599 1.00 28.04  ? 252 PHE A CA    1 
ATOM   1161 C C     . PHE A 1 148 ? 9.198   9.735   19.470 1.00 31.63  ? 252 PHE A C     1 
ATOM   1162 O O     . PHE A 1 148 ? 8.713   10.600  18.720 1.00 31.80  ? 252 PHE A O     1 
ATOM   1163 C CB    . PHE A 1 148 ? 11.233  9.814   21.040 1.00 30.02  ? 252 PHE A CB    1 
ATOM   1164 C CG    . PHE A 1 148 ? 12.684  9.463   21.243 1.00 30.84  ? 252 PHE A CG    1 
ATOM   1165 C CD1   . PHE A 1 148 ? 13.103  8.135   21.233 1.00 31.07  ? 252 PHE A CD1   1 
ATOM   1166 C CD2   . PHE A 1 148 ? 13.620  10.453  21.556 1.00 35.39  ? 252 PHE A CD2   1 
ATOM   1167 C CE1   . PHE A 1 148 ? 14.444  7.811   21.468 1.00 32.75  ? 252 PHE A CE1   1 
ATOM   1168 C CE2   . PHE A 1 148 ? 14.960  10.123  21.798 1.00 37.32  ? 252 PHE A CE2   1 
ATOM   1169 C CZ    . PHE A 1 148 ? 15.353  8.804   21.782 1.00 34.30  ? 252 PHE A CZ    1 
ATOM   1170 N N     . GLY A 1 149 ? 8.452   8.883   20.162 1.00 27.23  ? 253 GLY A N     1 
ATOM   1171 C CA    . GLY A 1 149 ? 6.998   8.929   20.160 1.00 27.22  ? 253 GLY A CA    1 
ATOM   1172 C C     . GLY A 1 149 ? 6.375   8.250   18.959 1.00 32.31  ? 253 GLY A C     1 
ATOM   1173 O O     . GLY A 1 149 ? 6.993   7.382   18.329 1.00 31.60  ? 253 GLY A O     1 
ATOM   1174 N N     . LEU A 1 150 ? 5.130   8.638   18.654 1.00 29.82  ? 254 LEU A N     1 
ATOM   1175 C CA    . LEU A 1 150 ? 4.358   8.052   17.570 1.00 30.85  ? 254 LEU A CA    1 
ATOM   1176 C C     . LEU A 1 150 ? 4.959   8.309   16.201 1.00 36.20  ? 254 LEU A C     1 
ATOM   1177 O O     . LEU A 1 150 ? 5.269   9.454   15.853 1.00 35.54  ? 254 LEU A O     1 
ATOM   1178 C CB    . LEU A 1 150 ? 2.887   8.517   17.633 1.00 32.10  ? 254 LEU A CB    1 
ATOM   1179 C CG    . LEU A 1 150 ? 1.914   7.802   16.680 1.00 38.32  ? 254 LEU A CG    1 
ATOM   1180 C CD1   . LEU A 1 150 ? 1.732   6.303   17.066 1.00 38.27  ? 254 LEU A CD1   1 
ATOM   1181 C CD2   . LEU A 1 150 ? 0.599   8.514   16.641 1.00 42.30  ? 254 LEU A CD2   1 
ATOM   1182 N N     . GLN A 1 151 ? 5.086   7.214   15.403 1.00 32.20  ? 255 GLN A N     1 
ATOM   1183 C CA    . GLN A 1 151 ? 5.633   7.283   14.067 1.00 32.24  ? 255 GLN A CA    1 
ATOM   1184 C C     . GLN A 1 151 ? 4.495   7.378   13.048 1.00 39.46  ? 255 GLN A C     1 
ATOM   1185 O O     . GLN A 1 151 ? 3.365   6.967   13.323 1.00 38.51  ? 255 GLN A O     1 
ATOM   1186 C CB    . GLN A 1 151 ? 6.589   6.116   13.783 1.00 31.81  ? 255 GLN A CB    1 
ATOM   1187 C CG    . GLN A 1 151 ? 7.744   5.991   14.800 1.00 25.32  ? 255 GLN A CG    1 
ATOM   1188 C CD    . GLN A 1 151 ? 8.674   7.222   14.842 1.00 31.84  ? 255 GLN A CD    1 
ATOM   1189 O OE1   . GLN A 1 151 ? 9.135   7.710   13.807 1.00 32.12  ? 255 GLN A OE1   1 
ATOM   1190 N NE2   . GLN A 1 151 ? 8.895   7.810   16.022 1.00 26.54  ? 255 GLN A NE2   1 
ATOM   1191 N N     . PRO A 1 152 ? 4.739   7.954   11.867 1.00 40.57  ? 256 PRO A N     1 
ATOM   1192 C CA    . PRO A 1 152 ? 3.619   8.157   10.938 1.00 42.06  ? 256 PRO A CA    1 
ATOM   1193 C C     . PRO A 1 152 ? 3.269   6.948   10.063 1.00 46.54  ? 256 PRO A C     1 
ATOM   1194 O O     . PRO A 1 152 ? 2.447   7.081   9.166  1.00 45.29  ? 256 PRO A O     1 
ATOM   1195 C CB    . PRO A 1 152 ? 4.048   9.390   10.147 1.00 45.44  ? 256 PRO A CB    1 
ATOM   1196 C CG    . PRO A 1 152 ? 5.529   9.439   10.254 1.00 48.56  ? 256 PRO A CG    1 
ATOM   1197 C CD    . PRO A 1 152 ? 5.987   8.567   11.365 1.00 42.75  ? 256 PRO A CD    1 
ATOM   1198 N N     . HIS A 1 153 ? 3.841   5.767   10.365 1.00 45.29  ? 257 HIS A N     1 
ATOM   1199 C CA    A HIS A 1 153 ? 3.605   4.537   9.607  0.50 46.95  ? 257 HIS A CA    1 
ATOM   1200 C CA    B HIS A 1 153 ? 3.593   4.547   9.602  0.50 47.14  ? 257 HIS A CA    1 
ATOM   1201 C C     . HIS A 1 153 ? 3.018   3.423   10.458 1.00 50.18  ? 257 HIS A C     1 
ATOM   1202 O O     . HIS A 1 153 ? 3.450   3.228   11.597 1.00 48.97  ? 257 HIS A O     1 
ATOM   1203 C CB    A HIS A 1 153 ? 4.914   4.048   8.981  0.50 47.41  ? 257 HIS A CB    1 
ATOM   1204 C CB    B HIS A 1 153 ? 4.884   4.095   8.910  0.50 47.88  ? 257 HIS A CB    1 
ATOM   1205 C CG    A HIS A 1 153 ? 5.505   5.003   7.999  0.50 51.77  ? 257 HIS A CG    1 
ATOM   1206 C CG    B HIS A 1 153 ? 5.460   5.141   8.008  0.50 52.26  ? 257 HIS A CG    1 
ATOM   1207 N ND1   A HIS A 1 153 ? 6.634   5.737   8.305  0.50 52.19  ? 257 HIS A ND1   1 
ATOM   1208 N ND1   B HIS A 1 153 ? 5.010   5.300   6.714  0.50 55.88  ? 257 HIS A ND1   1 
ATOM   1209 C CD2   A HIS A 1 153 ? 5.091   5.328   6.754  0.50 55.04  ? 257 HIS A CD2   1 
ATOM   1210 C CD2   B HIS A 1 153 ? 6.399   6.082   8.264  0.50 53.03  ? 257 HIS A CD2   1 
ATOM   1211 C CE1   A HIS A 1 153 ? 6.882   6.466   7.229  0.50 53.20  ? 257 HIS A CE1   1 
ATOM   1212 C CE1   B HIS A 1 153 ? 5.701   6.309   6.212  0.50 55.90  ? 257 HIS A CE1   1 
ATOM   1213 N NE2   A HIS A 1 153 ? 5.976   6.259   6.275  0.50 55.27  ? 257 HIS A NE2   1 
ATOM   1214 N NE2   B HIS A 1 153 ? 6.548   6.814   7.105  0.50 54.57  ? 257 HIS A NE2   1 
ATOM   1215 N N     . LYS A 1 154 ? 2.046   2.690   9.905  1.00 46.93  ? 258 LYS A N     1 
ATOM   1216 C CA    . LYS A 1 154 ? 1.443   1.542   10.588 1.00 46.61  ? 258 LYS A CA    1 
ATOM   1217 C C     . LYS A 1 154 ? 2.142   0.276   10.064 1.00 47.61  ? 258 LYS A C     1 
ATOM   1218 O O     . LYS A 1 154 ? 2.648   0.291   8.944  1.00 46.71  ? 258 LYS A O     1 
ATOM   1219 C CB    . LYS A 1 154 ? -0.065  1.438   10.297 1.00 51.77  ? 258 LYS A CB    1 
ATOM   1220 C CG    . LYS A 1 154 ? -0.934  2.468   11.003 1.00 57.98  ? 258 LYS A CG    1 
ATOM   1221 C CD    . LYS A 1 154 ? -2.378  2.310   10.539 1.00 72.09  ? 258 LYS A CD    1 
ATOM   1222 C CE    . LYS A 1 154 ? -3.354  3.157   11.316 1.00 87.73  ? 258 LYS A CE    1 
ATOM   1223 N NZ    . LYS A 1 154 ? -4.632  3.342   10.573 1.00 98.45  ? 258 LYS A NZ    1 
ATOM   1224 N N     . ILE A 1 155 ? 2.165   -0.812  10.850 1.00 43.47  ? 259 ILE A N     1 
ATOM   1225 C CA    . ILE A 1 155 ? 2.762   -2.072  10.387 1.00 43.16  ? 259 ILE A CA    1 
ATOM   1226 C C     . ILE A 1 155 ? 1.988   -2.537  9.126  1.00 50.70  ? 259 ILE A C     1 
ATOM   1227 O O     . ILE A 1 155 ? 0.752   -2.530  9.155  1.00 52.51  ? 259 ILE A O     1 
ATOM   1228 C CB    . ILE A 1 155 ? 2.773   -3.148  11.515 1.00 45.24  ? 259 ILE A CB    1 
ATOM   1229 C CG1   . ILE A 1 155 ? 3.689   -2.725  12.726 1.00 43.21  ? 259 ILE A CG1   1 
ATOM   1230 C CG2   . ILE A 1 155 ? 3.115   -4.562  10.987 1.00 45.11  ? 259 ILE A CG2   1 
ATOM   1231 C CD1   . ILE A 1 155 ? 5.137   -2.503  12.393 1.00 46.69  ? 259 ILE A CD1   1 
ATOM   1232 N N     . PRO A 1 156 ? 2.695   -2.822  7.996  1.00 48.50  ? 260 PRO A N     1 
ATOM   1233 C CA    . PRO A 1 156 ? 2.000   -3.216  6.752  1.00 51.78  ? 260 PRO A CA    1 
ATOM   1234 C C     . PRO A 1 156 ? 0.958   -4.317  6.910  1.00 57.91  ? 260 PRO A C     1 
ATOM   1235 O O     . PRO A 1 156 ? 1.218   -5.325  7.569  1.00 57.08  ? 260 PRO A O     1 
ATOM   1236 C CB    . PRO A 1 156 ? 3.140   -3.650  5.826  1.00 54.02  ? 260 PRO A CB    1 
ATOM   1237 C CG    . PRO A 1 156 ? 4.332   -2.943  6.335  1.00 55.31  ? 260 PRO A CG    1 
ATOM   1238 C CD    . PRO A 1 156 ? 4.161   -2.824  7.813  1.00 48.77  ? 260 PRO A CD    1 
ATOM   1239 N N     . ASP A 1 157 ? -0.237  -4.088  6.320  1.00 57.30  ? 261 ASP A N     1 
ATOM   1240 C CA    . ASP A 1 157 ? -1.410  -4.973  6.336  1.00 59.99  ? 261 ASP A CA    1 
ATOM   1241 C C     . ASP A 1 157 ? -2.081  -5.072  7.733  1.00 61.76  ? 261 ASP A C     1 
ATOM   1242 O O     . ASP A 1 157 ? -2.852  -5.999  7.979  1.00 63.28  ? 261 ASP A O     1 
ATOM   1243 C CB    . ASP A 1 157 ? -1.085  -6.375  5.754  1.00 64.19  ? 261 ASP A CB    1 
ATOM   1244 C CG    . ASP A 1 157 ? -0.497  -6.379  4.349  1.00 83.47  ? 261 ASP A CG    1 
ATOM   1245 O OD1   . ASP A 1 157 ? -1.068  -5.704  3.458  1.00 86.49  ? 261 ASP A OD1   1 
ATOM   1246 O OD2   . ASP A 1 157 ? 0.507   -7.097  4.130  1.00 91.92  ? 261 ASP A OD2   1 
ATOM   1247 N N     . THR A 1 158 ? -1.788  -4.124  8.651  1.00 55.36  ? 262 THR A N     1 
ATOM   1248 C CA    . THR A 1 158 ? -2.391  -4.090  9.993  1.00 54.63  ? 262 THR A CA    1 
ATOM   1249 C C     . THR A 1 158 ? -2.711  -2.633  10.406 1.00 57.79  ? 262 THR A C     1 
ATOM   1250 O O     . THR A 1 158 ? -2.298  -1.679  9.735  1.00 57.97  ? 262 THR A O     1 
ATOM   1251 C CB    . THR A 1 158 ? -1.450  -4.672  11.093 1.00 56.55  ? 262 THR A CB    1 
ATOM   1252 O OG1   . THR A 1 158 ? -0.510  -3.674  11.454 1.00 51.99  ? 262 THR A OG1   1 
ATOM   1253 C CG2   . THR A 1 158 ? -0.742  -5.967  10.702 1.00 55.63  ? 262 THR A CG2   1 
ATOM   1254 N N     . GLU A 1 159 ? -3.374  -2.485  11.567 1.00 52.11  ? 263 GLU A N     1 
ATOM   1255 C CA    . GLU A 1 159 ? -3.715  -1.210  12.180 1.00 50.08  ? 263 GLU A CA    1 
ATOM   1256 C C     . GLU A 1 159 ? -2.738  -0.900  13.331 1.00 51.23  ? 263 GLU A C     1 
ATOM   1257 O O     . GLU A 1 159 ? -2.887  0.131   13.997 1.00 51.46  ? 263 GLU A O     1 
ATOM   1258 C CB    . GLU A 1 159 ? -5.176  -1.211  12.669 1.00 53.90  ? 263 GLU A CB    1 
ATOM   1259 C CG    . GLU A 1 159 ? -6.221  -1.350  11.555 1.00 63.20  ? 263 GLU A CG    1 
ATOM   1260 C CD    . GLU A 1 159 ? -6.125  -0.375  10.394 1.00 87.78  ? 263 GLU A CD    1 
ATOM   1261 O OE1   . GLU A 1 159 ? -5.855  0.826   10.630 1.00 75.10  ? 263 GLU A OE1   1 
ATOM   1262 O OE2   . GLU A 1 159 ? -6.333  -0.817  9.240  1.00 93.51  ? 263 GLU A OE2   1 
ATOM   1263 N N     . THR A 1 160 ? -1.716  -1.778  13.536 1.00 43.14  ? 264 THR A N     1 
ATOM   1264 C CA    . THR A 1 160 ? -0.701  -1.611  14.581 1.00 38.39  ? 264 THR A CA    1 
ATOM   1265 C C     . THR A 1 160 ? 0.141   -0.345  14.378 1.00 41.53  ? 264 THR A C     1 
ATOM   1266 O O     . THR A 1 160 ? 0.822   -0.205  13.355 1.00 40.72  ? 264 THR A O     1 
ATOM   1267 C CB    . THR A 1 160 ? 0.232   -2.820  14.651 1.00 36.10  ? 264 THR A CB    1 
ATOM   1268 O OG1   . THR A 1 160 ? -0.531  -4.011  14.843 1.00 42.48  ? 264 THR A OG1   1 
ATOM   1269 C CG2   . THR A 1 160 ? 1.306   -2.657  15.752 1.00 31.79  ? 264 THR A CG2   1 
ATOM   1270 N N     . LEU A 1 161 ? 0.177   0.512   15.404 1.00 38.25  ? 265 LEU A N     1 
ATOM   1271 C CA    . LEU A 1 161 ? 0.979   1.732   15.368 1.00 36.28  ? 265 LEU A CA    1 
ATOM   1272 C C     . LEU A 1 161 ? 2.406   1.448   15.828 1.00 38.66  ? 265 LEU A C     1 
ATOM   1273 O O     . LEU A 1 161 ? 2.626   0.458   16.520 1.00 37.89  ? 265 LEU A O     1 
ATOM   1274 C CB    . LEU A 1 161 ? 0.352   2.809   16.273 1.00 37.17  ? 265 LEU A CB    1 
ATOM   1275 C CG    . LEU A 1 161 ? -1.152  3.123   16.041 1.00 43.29  ? 265 LEU A CG    1 
ATOM   1276 C CD1   . LEU A 1 161 ? -1.633  4.198   17.011 1.00 42.74  ? 265 LEU A CD1   1 
ATOM   1277 C CD2   . LEU A 1 161 ? -1.420  3.554   14.605 1.00 46.89  ? 265 LEU A CD2   1 
ATOM   1278 N N     . CYS A 1 162 ? 3.375   2.329   15.457 1.00 33.69  ? 266 CYS A N     1 
ATOM   1279 C CA    . CYS A 1 162 ? 4.785   2.226   15.878 1.00 31.47  ? 266 CYS A CA    1 
ATOM   1280 C C     . CYS A 1 162 ? 5.074   3.392   16.794 1.00 32.22  ? 266 CYS A C     1 
ATOM   1281 O O     . CYS A 1 162 ? 4.769   4.535   16.461 1.00 31.68  ? 266 CYS A O     1 
ATOM   1282 C CB    . CYS A 1 162 ? 5.735   2.206   14.686 1.00 31.99  ? 266 CYS A CB    1 
ATOM   1283 S SG    . CYS A 1 162 ? 5.443   0.833   13.545 1.00 37.63  ? 266 CYS A SG    1 
ATOM   1284 N N     . TYR A 1 163 ? 5.628   3.106   17.957 1.00 27.05  ? 267 TYR A N     1 
ATOM   1285 C CA    . TYR A 1 163 ? 5.900   4.146   18.940 1.00 25.09  ? 267 TYR A CA    1 
ATOM   1286 C C     . TYR A 1 163 ? 7.310   3.893   19.430 1.00 29.37  ? 267 TYR A C     1 
ATOM   1287 O O     . TYR A 1 163 ? 7.631   2.759   19.753 1.00 30.90  ? 267 TYR A O     1 
ATOM   1288 C CB    . TYR A 1 163 ? 4.858   4.069   20.093 1.00 26.06  ? 267 TYR A CB    1 
ATOM   1289 C CG    . TYR A 1 163 ? 4.999   5.169   21.127 1.00 25.57  ? 267 TYR A CG    1 
ATOM   1290 C CD1   . TYR A 1 163 ? 4.278   6.356   21.016 1.00 28.17  ? 267 TYR A CD1   1 
ATOM   1291 C CD2   . TYR A 1 163 ? 5.789   4.990   22.259 1.00 26.37  ? 267 TYR A CD2   1 
ATOM   1292 C CE1   . TYR A 1 163 ? 4.386   7.361   21.982 1.00 30.32  ? 267 TYR A CE1   1 
ATOM   1293 C CE2   . TYR A 1 163 ? 5.937   6.002   23.207 1.00 28.11  ? 267 TYR A CE2   1 
ATOM   1294 C CZ    . TYR A 1 163 ? 5.241   7.189   23.059 1.00 33.72  ? 267 TYR A CZ    1 
ATOM   1295 O OH    . TYR A 1 163 ? 5.400   8.175   24.004 1.00 35.19  ? 267 TYR A OH    1 
ATOM   1296 N N     . VAL A 1 164 ? 8.155   4.933   19.461 1.00 24.50  ? 268 VAL A N     1 
ATOM   1297 C CA    . VAL A 1 164 ? 9.568   4.846   19.798 1.00 22.61  ? 268 VAL A CA    1 
ATOM   1298 C C     . VAL A 1 164 ? 9.902   5.512   21.102 1.00 27.16  ? 268 VAL A C     1 
ATOM   1299 O O     . VAL A 1 164 ? 9.549   6.669   21.321 1.00 26.93  ? 268 VAL A O     1 
ATOM   1300 C CB    . VAL A 1 164 ? 10.463  5.367   18.641 1.00 26.55  ? 268 VAL A CB    1 
ATOM   1301 C CG1   . VAL A 1 164 ? 11.937  5.086   18.923 1.00 26.55  ? 268 VAL A CG1   1 
ATOM   1302 C CG2   . VAL A 1 164 ? 10.057  4.731   17.317 1.00 27.42  ? 268 VAL A CG2   1 
ATOM   1303 N N     . MET A 1 165 ? 10.655  4.791   21.960 1.00 25.20  ? 269 MET A N     1 
ATOM   1304 C CA    . MET A 1 165 ? 11.086  5.382   23.204 1.00 29.21  ? 269 MET A CA    1 
ATOM   1305 C C     . MET A 1 165 ? 12.608  5.278   23.276 1.00 32.63  ? 269 MET A C     1 
ATOM   1306 O O     . MET A 1 165 ? 13.177  4.358   22.686 1.00 30.20  ? 269 MET A O     1 
ATOM   1307 C CB    . MET A 1 165 ? 10.465  4.626   24.410 1.00 33.23  ? 269 MET A CB    1 
ATOM   1308 C CG    . MET A 1 165 ? 8.942   4.573   24.363 1.00 38.17  ? 269 MET A CG    1 
ATOM   1309 S SD    . MET A 1 165 ? 8.108   4.232   25.931 1.00 42.37  ? 269 MET A SD    1 
ATOM   1310 C CE    . MET A 1 165 ? 8.770   2.555   26.297 1.00 38.28  ? 269 MET A CE    1 
ATOM   1311 N N     . PRO A 1 166 ? 13.278  6.121   24.092 1.00 26.05  ? 270 PRO A N     1 
ATOM   1312 C CA    . PRO A 1 166 ? 14.715  5.916   24.313 1.00 25.09  ? 270 PRO A CA    1 
ATOM   1313 C C     . PRO A 1 166 ? 14.872  4.591   25.084 1.00 27.90  ? 270 PRO A C     1 
ATOM   1314 O O     . PRO A 1 166 ? 13.997  4.225   25.881 1.00 27.30  ? 270 PRO A O     1 
ATOM   1315 C CB    . PRO A 1 166 ? 15.118  7.104   25.197 1.00 28.40  ? 270 PRO A CB    1 
ATOM   1316 C CG    . PRO A 1 166 ? 13.840  7.597   25.810 1.00 33.97  ? 270 PRO A CG    1 
ATOM   1317 C CD    . PRO A 1 166 ? 12.750  7.269   24.871 1.00 28.87  ? 270 PRO A CD    1 
ATOM   1318 N N     . SER A 1 167 ? 15.928  3.832   24.783 1.00 25.25  ? 271 SER A N     1 
ATOM   1319 C CA    . SER A 1 167 ? 16.189  2.555   25.425 1.00 26.35  ? 271 SER A CA    1 
ATOM   1320 C C     . SER A 1 167 ? 16.112  2.640   26.942 1.00 27.96  ? 271 SER A C     1 
ATOM   1321 O O     . SER A 1 167 ? 16.610  3.597   27.523 1.00 23.42  ? 271 SER A O     1 
ATOM   1322 C CB    . SER A 1 167 ? 17.573  2.045   25.060 1.00 27.95  ? 271 SER A CB    1 
ATOM   1323 O OG    . SER A 1 167 ? 17.828  0.832   25.746 1.00 28.15  ? 271 SER A OG    1 
ATOM   1324 N N     . SER A 1 168 ? 15.498  1.612   27.583 1.00 25.58  ? 272 SER A N     1 
ATOM   1325 C CA    . SER A 1 168 ? 15.418  1.530   29.032 1.00 23.34  ? 272 SER A CA    1 
ATOM   1326 C C     . SER A 1 168 ? 16.793  1.240   29.617 1.00 25.45  ? 272 SER A C     1 
ATOM   1327 O O     . SER A 1 168 ? 16.970  1.305   30.828 1.00 24.99  ? 272 SER A O     1 
ATOM   1328 C CB    . SER A 1 168 ? 14.368  0.507   29.471 1.00 25.18  ? 272 SER A CB    1 
ATOM   1329 O OG    . SER A 1 168 ? 14.635  -0.792  28.956 1.00 29.91  ? 272 SER A OG    1 
ATOM   1330 N N     . SER A 1 169 ? 17.791  0.902   28.763 1.00 24.47  ? 273 SER A N     1 
ATOM   1331 C CA    . SER A 1 169 ? 19.133  0.635   29.288 1.00 24.96  ? 273 SER A CA    1 
ATOM   1332 C C     . SER A 1 169 ? 19.734  1.905   29.951 1.00 28.78  ? 273 SER A C     1 
ATOM   1333 O O     . SER A 1 169 ? 19.625  2.999   29.391 1.00 30.39  ? 273 SER A O     1 
ATOM   1334 C CB    . SER A 1 169 ? 20.050  0.163   28.176 1.00 26.70  ? 273 SER A CB    1 
ATOM   1335 O OG    . SER A 1 169 ? 21.360  0.044   28.717 1.00 23.67  ? 273 SER A OG    1 
ATOM   1336 N N     . ALA A 1 170 ? 20.440  1.752   31.096 1.00 26.20  ? 274 ALA A N     1 
ATOM   1337 C CA    . ALA A 1 170 ? 21.052  2.903   31.758 1.00 24.71  ? 274 ALA A CA    1 
ATOM   1338 C C     . ALA A 1 170 ? 22.422  3.234   31.137 1.00 26.58  ? 274 ALA A C     1 
ATOM   1339 O O     . ALA A 1 170 ? 23.084  4.176   31.558 1.00 28.14  ? 274 ALA A O     1 
ATOM   1340 C CB    . ALA A 1 170 ? 21.164  2.664   33.270 1.00 24.79  ? 274 ALA A CB    1 
ATOM   1341 N N     . ARG A 1 171 ? 22.807  2.521   30.085 1.00 22.83  ? 275 ARG A N     1 
ATOM   1342 C CA    . ARG A 1 171 ? 24.032  2.831   29.326 1.00 24.72  ? 275 ARG A CA    1 
ATOM   1343 C C     . ARG A 1 171 ? 23.825  4.214   28.640 1.00 32.10  ? 275 ARG A C     1 
ATOM   1344 O O     . ARG A 1 171 ? 24.804  4.887   28.327 1.00 33.16  ? 275 ARG A O     1 
ATOM   1345 C CB    . ARG A 1 171 ? 24.262  1.816   28.178 1.00 26.67  ? 275 ARG A CB    1 
ATOM   1346 C CG    . ARG A 1 171 ? 25.676  1.999   27.558 1.00 32.05  ? 275 ARG A CG    1 
ATOM   1347 C CD    . ARG A 1 171 ? 26.062  0.960   26.541 1.00 41.51  ? 275 ARG A CD    1 
ATOM   1348 N NE    . ARG A 1 171 ? 26.108  -0.405  27.073 1.00 44.31  ? 275 ARG A NE    1 
ATOM   1349 C CZ    . ARG A 1 171 ? 27.126  -0.935  27.742 1.00 47.87  ? 275 ARG A CZ    1 
ATOM   1350 N NH1   . ARG A 1 171 ? 28.181  -0.193  28.066 1.00 42.22  ? 275 ARG A NH1   1 
ATOM   1351 N NH2   . ARG A 1 171 ? 27.081  -2.190  28.130 1.00 38.91  ? 275 ARG A NH2   1 
ATOM   1352 N N     . CYS A 1 172 ? 22.565  4.575   28.330 1.00 28.10  ? 276 CYS A N     1 
ATOM   1353 C CA    . CYS A 1 172 ? 22.291  5.829   27.618 1.00 29.57  ? 276 CYS A CA    1 
ATOM   1354 C C     . CYS A 1 172 ? 22.450  7.092   28.494 1.00 34.42  ? 276 CYS A C     1 
ATOM   1355 O O     . CYS A 1 172 ? 21.587  7.363   29.326 1.00 35.71  ? 276 CYS A O     1 
ATOM   1356 C CB    . CYS A 1 172 ? 20.935  5.796   26.933 1.00 29.26  ? 276 CYS A CB    1 
ATOM   1357 S SG    . CYS A 1 172 ? 20.578  7.318   25.993 1.00 34.42  ? 276 CYS A SG    1 
ATOM   1358 N N     . ALA A 1 173 ? 23.512  7.877   28.257 1.00 31.65  ? 277 ALA A N     1 
ATOM   1359 C CA    . ALA A 1 173 ? 23.821  9.111   29.012 1.00 33.54  ? 277 ALA A CA    1 
ATOM   1360 C C     . ALA A 1 173 ? 22.890  10.291  28.729 1.00 37.78  ? 277 ALA A C     1 
ATOM   1361 O O     . ALA A 1 173 ? 22.821  11.200  29.557 1.00 35.77  ? 277 ALA A O     1 
ATOM   1362 C CB    . ALA A 1 173 ? 25.260  9.539   28.751 1.00 36.07  ? 277 ALA A CB    1 
ATOM   1363 N N     . GLN A 1 174 ? 22.175  10.307  27.560 1.00 34.07  ? 278 GLN A N     1 
ATOM   1364 C CA    . GLN A 1 174 ? 21.302  11.448  27.203 1.00 33.94  ? 278 GLN A CA    1 
ATOM   1365 C C     . GLN A 1 174 ? 20.009  11.521  28.022 1.00 33.45  ? 278 GLN A C     1 
ATOM   1366 O O     . GLN A 1 174 ? 19.414  12.585  28.143 1.00 33.56  ? 278 GLN A O     1 
ATOM   1367 C CB    . GLN A 1 174 ? 20.984  11.456  25.698 1.00 35.15  ? 278 GLN A CB    1 
ATOM   1368 C CG    . GLN A 1 174 ? 22.164  11.893  24.821 1.00 43.46  ? 278 GLN A CG    1 
ATOM   1369 C CD    . GLN A 1 174 ? 23.029  10.750  24.343 1.00 44.61  ? 278 GLN A CD    1 
ATOM   1370 O OE1   . GLN A 1 174 ? 22.843  9.595   24.708 1.00 39.11  ? 278 GLN A OE1   1 
ATOM   1371 N NE2   . GLN A 1 174 ? 23.974  11.042  23.473 1.00 37.62  ? 278 GLN A NE2   1 
ATOM   1372 N N     . PHE A 1 175 ? 19.575  10.387  28.570 1.00 28.54  ? 279 PHE A N     1 
ATOM   1373 C CA    . PHE A 1 175 ? 18.380  10.263  29.424 1.00 27.69  ? 279 PHE A CA    1 
ATOM   1374 C C     . PHE A 1 175 ? 18.962  9.502   30.598 1.00 28.77  ? 279 PHE A C     1 
ATOM   1375 O O     . PHE A 1 175 ? 18.835  8.299   30.659 1.00 28.88  ? 279 PHE A O     1 
ATOM   1376 C CB    . PHE A 1 175 ? 17.303  9.447   28.674 1.00 28.73  ? 279 PHE A CB    1 
ATOM   1377 C CG    . PHE A 1 175 ? 16.820  10.113  27.418 1.00 30.25  ? 279 PHE A CG    1 
ATOM   1378 C CD1   . PHE A 1 175 ? 15.772  11.027  27.456 1.00 32.90  ? 279 PHE A CD1   1 
ATOM   1379 C CD2   . PHE A 1 175 ? 17.438  9.862   26.195 1.00 33.85  ? 279 PHE A CD2   1 
ATOM   1380 C CE1   . PHE A 1 175 ? 15.346  11.693  26.288 1.00 33.18  ? 279 PHE A CE1   1 
ATOM   1381 C CE2   . PHE A 1 175 ? 16.999  10.512  25.022 1.00 35.26  ? 279 PHE A CE2   1 
ATOM   1382 C CZ    . PHE A 1 175 ? 15.985  11.456  25.094 1.00 32.68  ? 279 PHE A CZ    1 
ATOM   1383 N N     . PRO A 1 176 ? 19.787  10.168  31.437 1.00 28.18  ? 280 PRO A N     1 
ATOM   1384 C CA    . PRO A 1 176 ? 20.543  9.427   32.463 1.00 28.63  ? 280 PRO A CA    1 
ATOM   1385 C C     . PRO A 1 176 ? 19.745  8.708   33.561 1.00 30.98  ? 280 PRO A C     1 
ATOM   1386 O O     . PRO A 1 176 ? 20.288  7.797   34.192 1.00 31.73  ? 280 PRO A O     1 
ATOM   1387 C CB    . PRO A 1 176 ? 21.478  10.483  33.040 1.00 31.77  ? 280 PRO A CB    1 
ATOM   1388 C CG    . PRO A 1 176 ? 20.874  11.814  32.705 1.00 35.94  ? 280 PRO A CG    1 
ATOM   1389 C CD    . PRO A 1 176 ? 20.084  11.623  31.450 1.00 29.50  ? 280 PRO A CD    1 
ATOM   1390 N N     . ARG A 1 177 ? 18.504  9.107   33.811 1.00 28.31  ? 281 ARG A N     1 
ATOM   1391 C CA    . ARG A 1 177 ? 17.700  8.510   34.882 1.00 28.97  ? 281 ARG A CA    1 
ATOM   1392 C C     . ARG A 1 177 ? 16.385  7.949   34.346 1.00 30.53  ? 281 ARG A C     1 
ATOM   1393 O O     . ARG A 1 177 ? 15.912  8.403   33.311 1.00 28.98  ? 281 ARG A O     1 
ATOM   1394 C CB    . ARG A 1 177 ? 17.359  9.600   35.931 1.00 29.75  ? 281 ARG A CB    1 
ATOM   1395 C CG    . ARG A 1 177 ? 18.543  10.292  36.614 1.00 33.85  ? 281 ARG A CG    1 
ATOM   1396 C CD    . ARG A 1 177 ? 18.081  11.497  37.411 1.00 37.53  ? 281 ARG A CD    1 
ATOM   1397 N NE    . ARG A 1 177 ? 17.288  12.411  36.573 1.00 38.34  ? 281 ARG A NE    1 
ATOM   1398 C CZ    . ARG A 1 177 ? 16.277  13.149  37.019 1.00 52.04  ? 281 ARG A CZ    1 
ATOM   1399 N NH1   . ARG A 1 177 ? 15.927  13.104  38.298 1.00 45.64  ? 281 ARG A NH1   1 
ATOM   1400 N NH2   . ARG A 1 177 ? 15.608  13.932  36.191 1.00 40.47  ? 281 ARG A NH2   1 
ATOM   1401 N N     . ALA A 1 178 ? 15.737  7.037   35.108 1.00 28.83  ? 282 ALA A N     1 
ATOM   1402 C CA    . ALA A 1 178 ? 14.385  6.552   34.778 1.00 29.26  ? 282 ALA A CA    1 
ATOM   1403 C C     . ALA A 1 178 ? 13.444  7.799   34.629 1.00 30.89  ? 282 ALA A C     1 
ATOM   1404 O O     . ALA A 1 178 ? 12.617  7.848   33.718 1.00 29.11  ? 282 ALA A O     1 
ATOM   1405 C CB    . ALA A 1 178 ? 13.876  5.625   35.896 1.00 30.45  ? 282 ALA A CB    1 
ATOM   1406 N N     . GLN A 1 179 ? 13.621  8.817   35.484 1.00 30.84  ? 283 GLN A N     1 
ATOM   1407 C CA    . GLN A 1 179 ? 12.840  10.067  35.427 1.00 31.50  ? 283 GLN A CA    1 
ATOM   1408 C C     . GLN A 1 179 ? 12.918  10.768  34.058 1.00 33.62  ? 283 GLN A C     1 
ATOM   1409 O O     . GLN A 1 179 ? 11.994  11.491  33.669 1.00 34.29  ? 283 GLN A O     1 
ATOM   1410 C CB    . GLN A 1 179 ? 13.328  11.071  36.499 1.00 33.94  ? 283 GLN A CB    1 
ATOM   1411 C CG    . GLN A 1 179 ? 12.374  12.228  36.756 1.00 45.43  ? 283 GLN A CG    1 
ATOM   1412 C CD    . GLN A 1 179 ? 11.072  11.778  37.372 1.00 58.51  ? 283 GLN A CD    1 
ATOM   1413 O OE1   . GLN A 1 179 ? 11.048  10.997  38.325 1.00 55.42  ? 283 GLN A OE1   1 
ATOM   1414 N NE2   . GLN A 1 179 ? 9.961   12.285  36.860 1.00 42.73  ? 283 GLN A NE2   1 
ATOM   1415 N N     . ASP A 1 180 ? 14.066  10.663  33.397 1.00 29.12  ? 284 ASP A N     1 
ATOM   1416 C CA    . ASP A 1 180 ? 14.263  11.314  32.099 1.00 29.20  ? 284 ASP A CA    1 
ATOM   1417 C C     . ASP A 1 180 ? 13.547  10.608  30.950 1.00 33.09  ? 284 ASP A C     1 
ATOM   1418 O O     . ASP A 1 180 ? 13.361  11.206  29.893 1.00 34.64  ? 284 ASP A O     1 
ATOM   1419 C CB    . ASP A 1 180 ? 15.770  11.474  31.817 1.00 31.34  ? 284 ASP A CB    1 
ATOM   1420 C CG    . ASP A 1 180 ? 16.465  12.312  32.876 1.00 37.22  ? 284 ASP A CG    1 
ATOM   1421 O OD1   . ASP A 1 180 ? 15.959  13.413  33.194 1.00 37.27  ? 284 ASP A OD1   1 
ATOM   1422 O OD2   . ASP A 1 180 ? 17.492  11.859  33.411 1.00 39.38  ? 284 ASP A OD2   1 
ATOM   1423 N N     . LYS A 1 181 ? 13.134  9.349   31.163 1.00 27.33  ? 285 LYS A N     1 
ATOM   1424 C CA    . LYS A 1 181 ? 12.452  8.537   30.168 1.00 25.05  ? 285 LYS A CA    1 
ATOM   1425 C C     . LYS A 1 181 ? 10.945  8.407   30.425 1.00 30.62  ? 285 LYS A C     1 
ATOM   1426 O O     . LYS A 1 181 ? 10.205  8.079   29.497 1.00 30.12  ? 285 LYS A O     1 
ATOM   1427 C CB    . LYS A 1 181 ? 13.101  7.124   30.119 1.00 25.10  ? 285 LYS A CB    1 
ATOM   1428 C CG    . LYS A 1 181 ? 14.601  7.185   29.787 1.00 27.38  ? 285 LYS A CG    1 
ATOM   1429 C CD    . LYS A 1 181 ? 15.261  5.822   29.802 1.00 28.27  ? 285 LYS A CD    1 
ATOM   1430 C CE    . LYS A 1 181 ? 16.763  5.922   29.649 1.00 27.50  ? 285 LYS A CE    1 
ATOM   1431 N NZ    . LYS A 1 181 ? 17.440  4.624   29.944 1.00 30.54  ? 285 LYS A NZ    1 
ATOM   1432 N N     . VAL A 1 182 ? 10.489  8.652   31.657 1.00 27.26  ? 286 VAL A N     1 
ATOM   1433 C CA    . VAL A 1 182 ? 9.097   8.411   32.054 1.00 29.32  ? 286 VAL A CA    1 
ATOM   1434 C C     . VAL A 1 182 ? 8.066   9.201   31.189 1.00 32.40  ? 286 VAL A C     1 
ATOM   1435 O O     . VAL A 1 182 ? 6.966   8.693   30.974 1.00 31.44  ? 286 VAL A O     1 
ATOM   1436 C CB    . VAL A 1 182 ? 8.876   8.589   33.582 1.00 36.90  ? 286 VAL A CB    1 
ATOM   1437 C CG1   . VAL A 1 182 ? 8.856   10.051  33.990 1.00 36.50  ? 286 VAL A CG1   1 
ATOM   1438 C CG2   . VAL A 1 182 ? 7.614   7.867   34.057 1.00 38.90  ? 286 VAL A CG2   1 
ATOM   1439 N N     . HIS A 1 183 ? 8.423   10.403  30.680 1.00 30.13  ? 287 HIS A N     1 
ATOM   1440 C CA    . HIS A 1 183 ? 7.544   11.204  29.794 1.00 30.31  ? 287 HIS A CA    1 
ATOM   1441 C C     . HIS A 1 183 ? 6.977   10.342  28.643 1.00 32.94  ? 287 HIS A C     1 
ATOM   1442 O O     . HIS A 1 183 ? 5.779   10.420  28.326 1.00 32.74  ? 287 HIS A O     1 
ATOM   1443 C CB    . HIS A 1 183 ? 8.346   12.394  29.219 1.00 33.30  ? 287 HIS A CB    1 
ATOM   1444 C CG    . HIS A 1 183 ? 7.759   13.003  27.974 1.00 38.73  ? 287 HIS A CG    1 
ATOM   1445 N ND1   . HIS A 1 183 ? 6.667   13.855  28.033 1.00 43.55  ? 287 HIS A ND1   1 
ATOM   1446 C CD2   . HIS A 1 183 ? 8.158   12.899  26.686 1.00 40.63  ? 287 HIS A CD2   1 
ATOM   1447 C CE1   . HIS A 1 183 ? 6.413   14.217  26.781 1.00 42.51  ? 287 HIS A CE1   1 
ATOM   1448 N NE2   . HIS A 1 183 ? 7.280   13.663  25.933 1.00 41.73  ? 287 HIS A NE2   1 
ATOM   1449 N N     . TYR A 1 184 ? 7.846   9.508   28.033 1.00 28.81  ? 288 TYR A N     1 
ATOM   1450 C CA    . TYR A 1 184 ? 7.467   8.641   26.922 1.00 27.49  ? 288 TYR A CA    1 
ATOM   1451 C C     . TYR A 1 184 ? 6.529   7.508   27.334 1.00 30.87  ? 288 TYR A C     1 
ATOM   1452 O O     . TYR A 1 184 ? 5.709   7.104   26.523 1.00 31.95  ? 288 TYR A O     1 
ATOM   1453 C CB    . TYR A 1 184 ? 8.728   8.113   26.192 1.00 28.10  ? 288 TYR A CB    1 
ATOM   1454 C CG    . TYR A 1 184 ? 9.454   9.246   25.504 1.00 31.47  ? 288 TYR A CG    1 
ATOM   1455 C CD1   . TYR A 1 184 ? 8.919   9.858   24.375 1.00 35.34  ? 288 TYR A CD1   1 
ATOM   1456 C CD2   . TYR A 1 184 ? 10.623  9.776   26.039 1.00 33.73  ? 288 TYR A CD2   1 
ATOM   1457 C CE1   . TYR A 1 184 ? 9.516   10.984  23.810 1.00 38.48  ? 288 TYR A CE1   1 
ATOM   1458 C CE2   . TYR A 1 184 ? 11.265  10.869  25.444 1.00 35.60  ? 288 TYR A CE2   1 
ATOM   1459 C CZ    . TYR A 1 184 ? 10.715  11.456  24.317 1.00 44.47  ? 288 TYR A CZ    1 
ATOM   1460 O OH    . TYR A 1 184 ? 11.318  12.542  23.730 1.00 48.00  ? 288 TYR A OH    1 
ATOM   1461 N N     . TYR A 1 185 ? 6.660   6.982   28.572 1.00 27.47  ? 289 TYR A N     1 
ATOM   1462 C CA    . TYR A 1 185 ? 5.785   5.904   29.087 1.00 28.26  ? 289 TYR A CA    1 
ATOM   1463 C C     . TYR A 1 185 ? 4.404   6.490   29.378 1.00 31.54  ? 289 TYR A C     1 
ATOM   1464 O O     . TYR A 1 185 ? 3.395   5.856   29.093 1.00 30.92  ? 289 TYR A O     1 
ATOM   1465 C CB    . TYR A 1 185 ? 6.387   5.253   30.368 1.00 27.97  ? 289 TYR A CB    1 
ATOM   1466 C CG    . TYR A 1 185 ? 7.558   4.330   30.110 1.00 26.36  ? 289 TYR A CG    1 
ATOM   1467 C CD1   . TYR A 1 185 ? 8.786   4.834   29.687 1.00 25.82  ? 289 TYR A CD1   1 
ATOM   1468 C CD2   . TYR A 1 185 ? 7.456   2.958   30.346 1.00 27.45  ? 289 TYR A CD2   1 
ATOM   1469 C CE1   . TYR A 1 185 ? 9.866   3.988   29.434 1.00 26.55  ? 289 TYR A CE1   1 
ATOM   1470 C CE2   . TYR A 1 185 ? 8.536   2.098   30.105 1.00 27.33  ? 289 TYR A CE2   1 
ATOM   1471 C CZ    . TYR A 1 185 ? 9.750   2.628   29.678 1.00 29.87  ? 289 TYR A CZ    1 
ATOM   1472 O OH    . TYR A 1 185 ? 10.837  1.821   29.460 1.00 28.51  ? 289 TYR A OH    1 
ATOM   1473 N N     . ILE A 1 186 ? 4.363   7.732   29.881 1.00 29.94  ? 290 ILE A N     1 
ATOM   1474 C CA    . ILE A 1 186 ? 3.116   8.467   30.164 1.00 31.29  ? 290 ILE A CA    1 
ATOM   1475 C C     . ILE A 1 186 ? 2.354   8.732   28.847 1.00 35.03  ? 290 ILE A C     1 
ATOM   1476 O O     . ILE A 1 186 ? 1.143   8.542   28.783 1.00 35.28  ? 290 ILE A O     1 
ATOM   1477 C CB    . ILE A 1 186 ? 3.399   9.780   30.972 1.00 34.59  ? 290 ILE A CB    1 
ATOM   1478 C CG1   . ILE A 1 186 ? 3.938   9.465   32.387 1.00 35.13  ? 290 ILE A CG1   1 
ATOM   1479 C CG2   . ILE A 1 186 ? 2.158   10.707  31.030 1.00 37.92  ? 290 ILE A CG2   1 
ATOM   1480 C CD1   . ILE A 1 186 ? 4.629   10.599  33.056 1.00 45.28  ? 290 ILE A CD1   1 
ATOM   1481 N N     . LYS A 1 187 ? 3.065   9.185   27.813 1.00 32.35  ? 291 LYS A N     1 
ATOM   1482 C CA    . LYS A 1 187 ? 2.492   9.429   26.481 1.00 31.92  ? 291 LYS A CA    1 
ATOM   1483 C C     . LYS A 1 187 ? 2.031   8.122   25.827 1.00 33.82  ? 291 LYS A C     1 
ATOM   1484 O O     . LYS A 1 187 ? 1.039   8.109   25.081 1.00 35.27  ? 291 LYS A O     1 
ATOM   1485 C CB    . LYS A 1 187 ? 3.494   10.194  25.582 1.00 32.89  ? 291 LYS A CB    1 
ATOM   1486 C CG    . LYS A 1 187 ? 3.771   11.641  26.006 1.00 40.54  ? 291 LYS A CG    1 
ATOM   1487 C CD    . LYS A 1 187 ? 2.596   12.637  25.775 1.00 52.27  ? 291 LYS A CD    1 
ATOM   1488 C CE    . LYS A 1 187 ? 2.073   12.757  24.349 1.00 69.97  ? 291 LYS A CE    1 
ATOM   1489 N NZ    . LYS A 1 187 ? 3.140   13.016  23.340 1.00 78.59  ? 291 LYS A NZ    1 
ATOM   1490 N N     . LEU A 1 188 ? 2.736   7.012   26.128 1.00 27.50  ? 292 LEU A N     1 
ATOM   1491 C CA    . LEU A 1 188 ? 2.357   5.691   25.664 1.00 27.99  ? 292 LEU A CA    1 
ATOM   1492 C C     . LEU A 1 188 ? 1.019   5.305   26.330 1.00 36.63  ? 292 LEU A C     1 
ATOM   1493 O O     . LEU A 1 188 ? 0.093   4.887   25.629 1.00 38.50  ? 292 LEU A O     1 
ATOM   1494 C CB    . LEU A 1 188 ? 3.476   4.666   25.956 1.00 25.81  ? 292 LEU A CB    1 
ATOM   1495 C CG    . LEU A 1 188 ? 3.125   3.207   25.664 1.00 30.03  ? 292 LEU A CG    1 
ATOM   1496 C CD1   . LEU A 1 188 ? 2.599   3.033   24.227 1.00 29.04  ? 292 LEU A CD1   1 
ATOM   1497 C CD2   . LEU A 1 188 ? 4.309   2.298   25.954 1.00 30.20  ? 292 LEU A CD2   1 
ATOM   1498 N N     . LYS A 1 189 ? 0.911   5.493   27.665 1.00 34.37  ? 293 LYS A N     1 
ATOM   1499 C CA    . LYS A 1 189 ? -0.312  5.250   28.450 1.00 35.19  ? 293 LYS A CA    1 
ATOM   1500 C C     . LYS A 1 189 ? -1.459  6.104   27.890 1.00 40.59  ? 293 LYS A C     1 
ATOM   1501 O O     . LYS A 1 189 ? -2.555  5.578   27.718 1.00 42.21  ? 293 LYS A O     1 
ATOM   1502 C CB    . LYS A 1 189 ? -0.077  5.604   29.930 1.00 37.78  ? 293 LYS A CB    1 
ATOM   1503 C CG    . LYS A 1 189 ? -1.256  5.246   30.860 1.00 44.36  ? 293 LYS A CG    1 
ATOM   1504 C CD    . LYS A 1 189 ? -1.026  5.752   32.284 1.00 55.90  ? 293 LYS A CD    1 
ATOM   1505 C CE    . LYS A 1 189 ? -1.147  7.260   32.428 1.00 58.99  ? 293 LYS A CE    1 
ATOM   1506 N NZ    . LYS A 1 189 ? -0.726  7.725   33.777 1.00 63.43  ? 293 LYS A NZ    1 
ATOM   1507 N N     . ASP A 1 190 ? -1.202  7.409   27.600 1.00 36.92  ? 294 ASP A N     1 
ATOM   1508 C CA    . ASP A 1 190 ? -2.200  8.316   27.028 1.00 38.60  ? 294 ASP A CA    1 
ATOM   1509 C C     . ASP A 1 190 ? -2.622  7.837   25.646 1.00 40.48  ? 294 ASP A C     1 
ATOM   1510 O O     . ASP A 1 190 ? -3.808  7.818   25.361 1.00 39.89  ? 294 ASP A O     1 
ATOM   1511 C CB    . ASP A 1 190 ? -1.705  9.782   26.978 1.00 39.85  ? 294 ASP A CB    1 
ATOM   1512 C CG    . ASP A 1 190 ? -1.347  10.412  28.333 1.00 54.87  ? 294 ASP A CG    1 
ATOM   1513 O OD1   . ASP A 1 190 ? -1.847  9.915   29.387 1.00 56.20  ? 294 ASP A OD1   1 
ATOM   1514 O OD2   . ASP A 1 190 ? -0.593  11.412  28.342 1.00 62.89  ? 294 ASP A OD2   1 
ATOM   1515 N N     . LEU A 1 191 ? -1.657  7.412   24.798 1.00 37.37  ? 295 LEU A N     1 
ATOM   1516 C CA    . LEU A 1 191 ? -1.978  6.891   23.462 1.00 37.61  ? 295 LEU A CA    1 
ATOM   1517 C C     . LEU A 1 191 ? -2.827  5.613   23.572 1.00 45.02  ? 295 LEU A C     1 
ATOM   1518 O O     . LEU A 1 191 ? -3.782  5.454   22.808 1.00 47.48  ? 295 LEU A O     1 
ATOM   1519 C CB    . LEU A 1 191 ? -0.693  6.625   22.645 1.00 35.69  ? 295 LEU A CB    1 
ATOM   1520 C CG    . LEU A 1 191 ? -0.851  5.951   21.248 1.00 39.69  ? 295 LEU A CG    1 
ATOM   1521 C CD1   . LEU A 1 191 ? -1.725  6.795   20.289 1.00 40.25  ? 295 LEU A CD1   1 
ATOM   1522 C CD2   . LEU A 1 191 ? 0.508   5.670   20.633 1.00 39.32  ? 295 LEU A CD2   1 
ATOM   1523 N N     . ARG A 1 192 ? -2.493  4.714   24.530 1.00 40.99  ? 296 ARG A N     1 
ATOM   1524 C CA    . ARG A 1 192 ? -3.246  3.472   24.736 1.00 41.59  ? 296 ARG A CA    1 
ATOM   1525 C C     . ARG A 1 192 ? -4.690  3.755   25.165 1.00 49.10  ? 296 ARG A C     1 
ATOM   1526 O O     . ARG A 1 192 ? -5.616  3.134   24.632 1.00 49.94  ? 296 ARG A O     1 
ATOM   1527 C CB    . ARG A 1 192 ? -2.571  2.579   25.780 1.00 37.74  ? 296 ARG A CB    1 
ATOM   1528 C CG    . ARG A 1 192 ? -3.346  1.272   25.949 1.00 47.75  ? 296 ARG A CG    1 
ATOM   1529 C CD    . ARG A 1 192 ? -3.246  0.673   27.314 1.00 54.59  ? 296 ARG A CD    1 
ATOM   1530 N NE    . ARG A 1 192 ? -3.521  1.606   28.404 1.00 56.68  ? 296 ARG A NE    1 
ATOM   1531 C CZ    . ARG A 1 192 ? -3.059  1.443   29.640 1.00 67.98  ? 296 ARG A CZ    1 
ATOM   1532 N NH1   . ARG A 1 192 ? -2.317  0.382   29.944 1.00 54.25  ? 296 ARG A NH1   1 
ATOM   1533 N NH2   . ARG A 1 192 ? -3.337  2.334   30.582 1.00 51.50  ? 296 ARG A NH2   1 
ATOM   1534 N N     . ASP A 1 193 ? -4.870  4.657   26.163 1.00 46.77  ? 297 ASP A N     1 
ATOM   1535 C CA    . ASP A 1 193 ? -6.190  5.015   26.695 1.00 49.52  ? 297 ASP A CA    1 
ATOM   1536 C C     . ASP A 1 193 ? -7.075  5.597   25.588 1.00 53.94  ? 297 ASP A C     1 
ATOM   1537 O O     . ASP A 1 193 ? -8.254  5.253   25.513 1.00 55.36  ? 297 ASP A O     1 
ATOM   1538 C CB    . ASP A 1 193 ? -6.064  5.978   27.903 1.00 52.13  ? 297 ASP A CB    1 
ATOM   1539 C CG    . ASP A 1 193 ? -5.423  5.388   29.167 1.00 65.75  ? 297 ASP A CG    1 
ATOM   1540 O OD1   . ASP A 1 193 ? -5.149  4.162   29.190 1.00 65.15  ? 297 ASP A OD1   1 
ATOM   1541 O OD2   . ASP A 1 193 ? -5.215  6.152   30.142 1.00 73.92  ? 297 ASP A OD2   1 
ATOM   1542 N N     . GLN A 1 194 ? -6.480  6.414   24.696 1.00 49.63  ? 298 GLN A N     1 
ATOM   1543 C CA    . GLN A 1 194 ? -7.134  7.048   23.550 1.00 50.92  ? 298 GLN A CA    1 
ATOM   1544 C C     . GLN A 1 194 ? -7.612  6.000   22.513 1.00 56.22  ? 298 GLN A C     1 
ATOM   1545 O O     . GLN A 1 194 ? -8.730  6.118   22.002 1.00 56.52  ? 298 GLN A O     1 
ATOM   1546 C CB    . GLN A 1 194 ? -6.173  8.068   22.917 1.00 50.75  ? 298 GLN A CB    1 
ATOM   1547 C CG    . GLN A 1 194 ? -6.723  8.868   21.735 1.00 72.07  ? 298 GLN A CG    1 
ATOM   1548 C CD    . GLN A 1 194 ? -5.629  9.278   20.768 1.00 94.57  ? 298 GLN A CD    1 
ATOM   1549 O OE1   . GLN A 1 194 ? -4.604  9.874   21.140 1.00 88.90  ? 298 GLN A OE1   1 
ATOM   1550 N NE2   . GLN A 1 194 ? -5.836  8.984   19.493 1.00 88.01  ? 298 GLN A NE2   1 
ATOM   1551 N N     . LEU A 1 195 ? -6.770  4.982   22.213 1.00 52.36  ? 299 LEU A N     1 
ATOM   1552 C CA    . LEU A 1 195 ? -7.106  3.904   21.271 1.00 53.99  ? 299 LEU A CA    1 
ATOM   1553 C C     . LEU A 1 195 ? -8.232  3.006   21.798 1.00 64.16  ? 299 LEU A C     1 
ATOM   1554 O O     . LEU A 1 195 ? -9.073  2.549   21.013 1.00 66.00  ? 299 LEU A O     1 
ATOM   1555 C CB    . LEU A 1 195 ? -5.867  3.054   20.936 1.00 52.47  ? 299 LEU A CB    1 
ATOM   1556 C CG    . LEU A 1 195 ? -4.846  3.664   19.969 1.00 54.93  ? 299 LEU A CG    1 
ATOM   1557 C CD1   . LEU A 1 195 ? -3.613  2.810   19.909 1.00 53.61  ? 299 LEU A CD1   1 
ATOM   1558 C CD2   . LEU A 1 195 ? -5.415  3.772   18.546 1.00 57.74  ? 299 LEU A CD2   1 
ATOM   1559 N N     . LYS A 1 196 ? -8.260  2.785   23.131 1.00 63.17  ? 300 LYS A N     1 
ATOM   1560 C CA    . LYS A 1 196 ? -9.243  1.951   23.832 1.00 67.11  ? 300 LYS A CA    1 
ATOM   1561 C C     . LYS A 1 196 ? -10.617 2.641   24.052 1.00 79.14  ? 300 LYS A C     1 
ATOM   1562 O O     . LYS A 1 196 ? -11.552 2.012   24.566 1.00 81.25  ? 300 LYS A O     1 
ATOM   1563 C CB    . LYS A 1 196 ? -8.658  1.427   25.157 1.00 68.54  ? 300 LYS A CB    1 
ATOM   1564 C CG    . LYS A 1 196 ? -7.610  0.325   24.973 1.00 72.06  ? 300 LYS A CG    1 
ATOM   1565 C CD    . LYS A 1 196 ? -7.127  -0.278  26.296 1.00 79.57  ? 300 LYS A CD    1 
ATOM   1566 C CE    . LYS A 1 196 ? -8.009  -1.383  26.847 1.00 95.25  ? 300 LYS A CE    1 
ATOM   1567 N NZ    . LYS A 1 196 ? -8.015  -2.601  25.987 1.00 105.33 ? 300 LYS A NZ    1 
ATOM   1568 N N     . GLY A 1 197 ? -10.723 3.904   23.632 1.00 47.80  ? 301 GLY A N     1 
ATOM   1569 C CA    . GLY A 1 197 ? -11.935 4.710   23.736 1.00 81.45  ? 301 GLY A CA    1 
ATOM   1570 C C     . GLY A 1 197 ? -12.280 5.420   22.444 1.00 112.68 ? 301 GLY A C     1 
ATOM   1571 O O     . GLY A 1 197 ? -12.819 4.810   21.520 1.00 79.21  ? 301 GLY A O     1 
ATOM   1572 O "O5'" . DC  B 2 1   ? 33.687  23.909  -1.156 1.00 108.90 ? 1   DC  C "O5'" 1 
ATOM   1573 C "C5'" . DC  B 2 1   ? 33.139  25.022  -1.884 1.00 113.84 ? 1   DC  C "C5'" 1 
ATOM   1574 C "C4'" . DC  B 2 1   ? 31.696  24.754  -2.313 1.00 113.48 ? 1   DC  C "C4'" 1 
ATOM   1575 O "O4'" . DC  B 2 1   ? 31.667  23.700  -3.312 1.00 112.49 ? 1   DC  C "O4'" 1 
ATOM   1576 C "C3'" . DC  B 2 1   ? 30.735  24.326  -1.193 1.00 109.94 ? 1   DC  C "C3'" 1 
ATOM   1577 O "O3'" . DC  B 2 1   ? 29.476  25.015  -1.328 1.00 114.02 ? 1   DC  C "O3'" 1 
ATOM   1578 C "C2'" . DC  B 2 1   ? 30.586  22.818  -1.402 1.00 105.51 ? 1   DC  C "C2'" 1 
ATOM   1579 C "C1'" . DC  B 2 1   ? 30.781  22.670  -2.912 1.00 109.10 ? 1   DC  C "C1'" 1 
ATOM   1580 N N1    . DC  B 2 1   ? 31.371  21.327  -3.315 1.00 107.27 ? 1   DC  C N1    1 
ATOM   1581 C C2    . DC  B 2 1   ? 30.529  20.305  -3.815 1.00 106.13 ? 1   DC  C C2    1 
ATOM   1582 O O2    . DC  B 2 1   ? 29.318  20.525  -3.965 1.00 107.36 ? 1   DC  C O2    1 
ATOM   1583 N N3    . DC  B 2 1   ? 31.086  19.105  -4.153 1.00 104.62 ? 1   DC  C N3    1 
ATOM   1584 C C4    . DC  B 2 1   ? 32.406  18.906  -4.006 1.00 104.03 ? 1   DC  C C4    1 
ATOM   1585 N N4    . DC  B 2 1   ? 32.903  17.720  -4.359 1.00 103.41 ? 1   DC  C N4    1 
ATOM   1586 C C5    . DC  B 2 1   ? 33.270  19.919  -3.484 1.00 105.39 ? 1   DC  C C5    1 
ATOM   1587 C C6    . DC  B 2 1   ? 32.717  21.091  -3.135 1.00 106.64 ? 1   DC  C C6    1 
ATOM   1588 P P     . DA  B 2 2   ? 28.462  25.177  -0.080 1.00 113.57 ? 2   DA  C P     1 
ATOM   1589 O OP1   . DA  B 2 2   ? 27.624  26.371  -0.357 1.00 119.50 ? 2   DA  C OP1   1 
ATOM   1590 O OP2   . DA  B 2 2   ? 29.232  25.093  1.187  1.00 110.05 ? 2   DA  C OP2   1 
ATOM   1591 O "O5'" . DA  B 2 2   ? 27.549  23.861  -0.164 1.00 110.02 ? 2   DA  C "O5'" 1 
ATOM   1592 C "C5'" . DA  B 2 2   ? 26.805  23.570  -1.357 1.00 112.67 ? 2   DA  C "C5'" 1 
ATOM   1593 C "C4'" . DA  B 2 2   ? 26.073  22.237  -1.251 1.00 109.65 ? 2   DA  C "C4'" 1 
ATOM   1594 O "O4'" . DA  B 2 2   ? 26.961  21.143  -1.579 1.00 106.08 ? 2   DA  C "O4'" 1 
ATOM   1595 C "C3'" . DA  B 2 2   ? 25.460  21.912  0.103  1.00 106.81 ? 2   DA  C "C3'" 1 
ATOM   1596 O "O3'" . DA  B 2 2   ? 24.104  21.512  -0.093 1.00 111.20 ? 2   DA  C "O3'" 1 
ATOM   1597 C "C2'" . DA  B 2 2   ? 26.343  20.769  0.652  1.00 100.08 ? 2   DA  C "C2'" 1 
ATOM   1598 C "C1'" . DA  B 2 2   ? 26.847  20.110  -0.628 1.00 100.54 ? 2   DA  C "C1'" 1 
ATOM   1599 N N9    . DA  B 2 2   ? 28.167  19.470  -0.528 1.00 95.68  ? 2   DA  C N9    1 
ATOM   1600 C C8    . DA  B 2 2   ? 29.304  20.011  0.012  1.00 93.81  ? 2   DA  C C8    1 
ATOM   1601 N N7    . DA  B 2 2   ? 30.392  19.310  -0.206 1.00 92.34  ? 2   DA  C N7    1 
ATOM   1602 C C5    . DA  B 2 2   ? 29.953  18.240  -0.958 1.00 92.05  ? 2   DA  C C5    1 
ATOM   1603 C C6    . DA  B 2 2   ? 30.622  17.115  -1.501 1.00 90.87  ? 2   DA  C C6    1 
ATOM   1604 N N6    . DA  B 2 2   ? 31.932  16.894  -1.359 1.00 89.62  ? 2   DA  C N6    1 
ATOM   1605 N N1    . DA  B 2 2   ? 29.876  16.211  -2.180 1.00 92.24  ? 2   DA  C N1    1 
ATOM   1606 C C2    . DA  B 2 2   ? 28.556  16.426  -2.320 1.00 93.43  ? 2   DA  C C2    1 
ATOM   1607 N N3    . DA  B 2 2   ? 27.826  17.463  -1.898 1.00 94.10  ? 2   DA  C N3    1 
ATOM   1608 C C4    . DA  B 2 2   ? 28.586  18.334  -1.195 1.00 93.93  ? 2   DA  C C4    1 
ATOM   1609 P P     . DG  B 2 3   ? 23.039  21.545  1.111  1.00 112.47 ? 3   DG  C P     1 
ATOM   1610 O OP1   . DG  B 2 3   ? 21.748  22.026  0.551  1.00 118.21 ? 3   DG  C OP1   1 
ATOM   1611 O OP2   . DG  B 2 3   ? 23.648  22.247  2.272  1.00 111.04 ? 3   DG  C OP2   1 
ATOM   1612 O "O5'" . DG  B 2 3   ? 22.908  19.989  1.504  1.00 108.64 ? 3   DG  C "O5'" 1 
ATOM   1613 C "C5'" . DG  B 2 3   ? 22.367  19.061  0.551  1.00 110.61 ? 3   DG  C "C5'" 1 
ATOM   1614 C "C4'" . DG  B 2 3   ? 22.922  17.654  0.740  1.00 105.95 ? 3   DG  C "C4'" 1 
ATOM   1615 O "O4'" . DG  B 2 3   ? 24.368  17.645  0.676  1.00 101.99 ? 3   DG  C "O4'" 1 
ATOM   1616 C "C3'" . DG  B 2 3   ? 22.555  16.942  2.049  1.00 102.28 ? 3   DG  C "C3'" 1 
ATOM   1617 O "O3'" . DG  B 2 3   ? 21.814  15.749  1.738  1.00 105.87 ? 3   DG  C "O3'" 1 
ATOM   1618 C "C2'" . DG  B 2 3   ? 23.929  16.605  2.666  1.00 95.54  ? 3   DG  C "C2'" 1 
ATOM   1619 C "C1'" . DG  B 2 3   ? 24.784  16.540  1.413  1.00 95.98  ? 3   DG  C "C1'" 1 
ATOM   1620 N N9    . DG  B 2 3   ? 26.240  16.579  1.616  1.00 89.79  ? 3   DG  C N9    1 
ATOM   1621 C C8    . DG  B 2 3   ? 26.975  17.561  2.238  1.00 87.39  ? 3   DG  C C8    1 
ATOM   1622 N N7    . DG  B 2 3   ? 28.264  17.335  2.227  1.00 85.23  ? 3   DG  C N7    1 
ATOM   1623 C C5    . DG  B 2 3   ? 28.398  16.141  1.527  1.00 84.24  ? 3   DG  C C5    1 
ATOM   1624 C C6    . DG  B 2 3   ? 29.563  15.382  1.213  1.00 81.88  ? 3   DG  C C6    1 
ATOM   1625 O O6    . DG  B 2 3   ? 30.744  15.646  1.476  1.00 80.56  ? 3   DG  C O6    1 
ATOM   1626 N N1    . DG  B 2 3   ? 29.253  14.211  0.515  1.00 82.84  ? 3   DG  C N1    1 
ATOM   1627 C C2    . DG  B 2 3   ? 27.974  13.814  0.176  1.00 85.19  ? 3   DG  C C2    1 
ATOM   1628 N N2    . DG  B 2 3   ? 27.860  12.653  -0.481 1.00 87.03  ? 3   DG  C N2    1 
ATOM   1629 N N3    . DG  B 2 3   ? 26.879  14.510  0.471  1.00 86.81  ? 3   DG  C N3    1 
ATOM   1630 C C4    . DG  B 2 3   ? 27.163  15.665  1.138  1.00 86.80  ? 3   DG  C C4    1 
ATOM   1631 P P     . DC  B 2 4   ? 20.794  15.092  2.799  1.00 106.44 ? 4   DC  C P     1 
ATOM   1632 O OP1   . DC  B 2 4   ? 19.466  15.018  2.133  1.00 112.47 ? 4   DC  C OP1   1 
ATOM   1633 O OP2   . DC  B 2 4   ? 20.935  15.791  4.107  1.00 102.69 ? 4   DC  C OP2   1 
ATOM   1634 O "O5'" . DC  B 2 4   ? 21.380  13.602  2.990  1.00 102.63 ? 4   DC  C "O5'" 1 
ATOM   1635 C "C5'" . DC  B 2 4   ? 21.492  12.708  1.854  1.00 104.30 ? 4   DC  C "C5'" 1 
ATOM   1636 C "C4'" . DC  B 2 4   ? 22.712  11.797  1.972  1.00 99.42  ? 4   DC  C "C4'" 1 
ATOM   1637 O "O4'" . DC  B 2 4   ? 23.922  12.583  1.916  1.00 95.89  ? 4   DC  C "O4'" 1 
ATOM   1638 C "C3'" . DC  B 2 4   ? 22.843  11.018  3.278  1.00 93.99  ? 4   DC  C "C3'" 1 
ATOM   1639 O "O3'" . DC  B 2 4   ? 22.117  9.771   3.203  1.00 97.33  ? 4   DC  C "O3'" 1 
ATOM   1640 C "C2'" . DC  B 2 4   ? 24.353  10.774  3.382  1.00 89.63  ? 4   DC  C "C2'" 1 
ATOM   1641 C "C1'" . DC  B 2 4   ? 24.972  11.792  2.436  1.00 90.25  ? 4   DC  C "C1'" 1 
ATOM   1642 N N1    . DC  B 2 4   ? 26.032  12.655  3.080  1.00 82.90  ? 4   DC  C N1    1 
ATOM   1643 C C2    . DC  B 2 4   ? 27.370  12.219  3.076  1.00 79.19  ? 4   DC  C C2    1 
ATOM   1644 O O2    . DC  B 2 4   ? 27.654  11.163  2.510  1.00 80.46  ? 4   DC  C O2    1 
ATOM   1645 N N3    . DC  B 2 4   ? 28.324  13.007  3.646  1.00 75.77  ? 4   DC  C N3    1 
ATOM   1646 C C4    . DC  B 2 4   ? 27.980  14.149  4.254  1.00 74.84  ? 4   DC  C C4    1 
ATOM   1647 N N4    . DC  B 2 4   ? 28.951  14.883  4.803  1.00 73.38  ? 4   DC  C N4    1 
ATOM   1648 C C5    . DC  B 2 4   ? 26.618  14.585  4.326  1.00 76.79  ? 4   DC  C C5    1 
ATOM   1649 C C6    . DC  B 2 4   ? 25.683  13.803  3.752  1.00 80.36  ? 4   DC  C C6    1 
ATOM   1650 P P     . DT  B 2 5   ? 21.936  8.821   4.506  1.00 95.84  ? 5   DT  C P     1 
ATOM   1651 O OP1   . DT  B 2 5   ? 20.756  7.953   4.256  1.00 101.10 ? 5   DT  C OP1   1 
ATOM   1652 O OP2   . DT  B 2 5   ? 21.989  9.662   5.735  1.00 90.24  ? 5   DT  C OP2   1 
ATOM   1653 O "O5'" . DT  B 2 5   ? 23.259  7.905   4.496  1.00 93.38  ? 5   DT  C "O5'" 1 
ATOM   1654 C "C5'" . DT  B 2 5   ? 23.717  7.264   3.270  1.00 95.47  ? 5   DT  C "C5'" 1 
ATOM   1655 C "C4'" . DT  B 2 5   ? 25.108  6.661   3.464  1.00 92.05  ? 5   DT  C "C4'" 1 
ATOM   1656 O "O4'" . DT  B 2 5   ? 26.084  7.717   3.694  1.00 87.06  ? 5   DT  C "O4'" 1 
ATOM   1657 C "C3'" . DT  B 2 5   ? 25.243  5.687   4.640  1.00 89.14  ? 5   DT  C "C3'" 1 
ATOM   1658 O "O3'" . DT  B 2 5   ? 25.982  4.527   4.222  1.00 93.43  ? 5   DT  C "O3'" 1 
ATOM   1659 C "C2'" . DT  B 2 5   ? 25.981  6.507   5.711  1.00 82.11  ? 5   DT  C "C2'" 1 
ATOM   1660 C "C1'" . DT  B 2 5   ? 26.830  7.457   4.865  1.00 81.40  ? 5   DT  C "C1'" 1 
ATOM   1661 N N1    . DT  B 2 5   ? 27.177  8.807   5.532  1.00 74.17  ? 5   DT  C N1    1 
ATOM   1662 C C2    . DT  B 2 5   ? 28.508  9.177   5.676  1.00 71.13  ? 5   DT  C C2    1 
ATOM   1663 O O2    . DT  B 2 5   ? 29.443  8.463   5.372  1.00 73.30  ? 5   DT  C O2    1 
ATOM   1664 N N3    . DT  B 2 5   ? 28.704  10.432  6.197  1.00 67.02  ? 5   DT  C N3    1 
ATOM   1665 C C4    . DT  B 2 5   ? 27.739  11.342  6.593  1.00 65.50  ? 5   DT  C C4    1 
ATOM   1666 O O4    . DT  B 2 5   ? 28.088  12.428  7.055  1.00 62.94  ? 5   DT  C O4    1 
ATOM   1667 C C5    . DT  B 2 5   ? 26.366  10.885  6.461  1.00 68.36  ? 5   DT  C C5    1 
ATOM   1668 C C7    . DT  B 2 5   ? 25.227  11.762  6.902  1.00 68.26  ? 5   DT  C C7    1 
ATOM   1669 C C6    . DT  B 2 5   ? 26.155  9.657   5.941  1.00 71.61  ? 5   DT  C C6    1 
ATOM   1670 P P     . DC  B 2 6   ? 26.047  3.205   5.129  1.00 94.53  ? 6   DC  C P     1 
ATOM   1671 O OP1   . DC  B 2 6   ? 26.217  2.040   4.227  1.00 100.81 ? 6   DC  C OP1   1 
ATOM   1672 O OP2   . DC  B 2 6   ? 24.922  3.226   6.101  1.00 92.06  ? 6   DC  C OP2   1 
ATOM   1673 O "O5'" . DC  B 2 6   ? 27.399  3.424   5.955  1.00 91.18  ? 6   DC  C "O5'" 1 
ATOM   1674 C "C5'" . DC  B 2 6   ? 28.665  3.390   5.296  1.00 93.13  ? 6   DC  C "C5'" 1 
ATOM   1675 C "C4'" . DC  B 2 6   ? 29.782  3.730   6.264  1.00 89.25  ? 6   DC  C "C4'" 1 
ATOM   1676 O "O4'" . DC  B 2 6   ? 29.676  5.116   6.657  1.00 83.96  ? 6   DC  C "O4'" 1 
ATOM   1677 C "C3'" . DC  B 2 6   ? 29.805  2.912   7.557  1.00 87.87  ? 6   DC  C "C3'" 1 
ATOM   1678 O "O3'" . DC  B 2 6   ? 31.075  2.285   7.684  1.00 92.12  ? 6   DC  C "O3'" 1 
ATOM   1679 C "C2'" . DC  B 2 6   ? 29.549  3.950   8.667  1.00 80.44  ? 6   DC  C "C2'" 1 
ATOM   1680 C "C1'" . DC  B 2 6   ? 30.020  5.243   8.012  1.00 78.41  ? 6   DC  C "C1'" 1 
ATOM   1681 N N1    . DC  B 2 6   ? 29.375  6.522   8.544  1.00 70.94  ? 6   DC  C N1    1 
ATOM   1682 C C2    . DC  B 2 6   ? 30.187  7.604   8.951  1.00 66.40  ? 6   DC  C C2    1 
ATOM   1683 O O2    . DC  B 2 6   ? 31.421  7.472   8.966  1.00 67.01  ? 6   DC  C O2    1 
ATOM   1684 N N3    . DC  B 2 6   ? 29.583  8.772   9.321  1.00 61.88  ? 6   DC  C N3    1 
ATOM   1685 C C4    . DC  B 2 6   ? 28.248  8.885   9.283  1.00 60.48  ? 6   DC  C C4    1 
ATOM   1686 N N4    . DC  B 2 6   ? 27.706  10.038  9.662  1.00 57.90  ? 6   DC  C N4    1 
ATOM   1687 C C5    . DC  B 2 6   ? 27.413  7.815   8.859  1.00 63.97  ? 6   DC  C C5    1 
ATOM   1688 C C6    . DC  B 2 6   ? 28.007  6.667   8.503  1.00 68.75  ? 6   DC  C C6    1 
ATOM   1689 P P     . DT  B 2 7   ? 31.304  1.023   8.653  1.00 94.92  ? 7   DT  C P     1 
ATOM   1690 O OP1   . DT  B 2 7   ? 31.984  -0.029  7.857  1.00 101.56 ? 7   DT  C OP1   1 
ATOM   1691 O OP2   . DT  B 2 7   ? 30.034  0.708   9.374  1.00 92.80  ? 7   DT  C OP2   1 
ATOM   1692 O "O5'" . DT  B 2 7   ? 32.336  1.608   9.741  1.00 91.31  ? 7   DT  C "O5'" 1 
ATOM   1693 C "C5'" . DT  B 2 7   ? 33.391  2.500   9.319  1.00 90.54  ? 7   DT  C "C5'" 1 
ATOM   1694 C "C4'" . DT  B 2 7   ? 33.867  3.405   10.450 1.00 84.84  ? 7   DT  C "C4'" 1 
ATOM   1695 O "O4'" . DT  B 2 7   ? 33.005  4.561   10.586 1.00 78.78  ? 7   DT  C "O4'" 1 
ATOM   1696 C "C3'" . DT  B 2 7   ? 33.958  2.771   11.841 1.00 83.24  ? 7   DT  C "C3'" 1 
ATOM   1697 O "O3'" . DT  B 2 7   ? 35.243  3.027   12.358 1.00 86.19  ? 7   DT  C "O3'" 1 
ATOM   1698 C "C2'" . DT  B 2 7   ? 32.880  3.517   12.643 1.00 75.66  ? 7   DT  C "C2'" 1 
ATOM   1699 C "C1'" . DT  B 2 7   ? 32.893  4.871   11.953 1.00 72.76  ? 7   DT  C "C1'" 1 
ATOM   1700 N N1    . DT  B 2 7   ? 31.658  5.714   12.157 1.00 65.00  ? 7   DT  C N1    1 
ATOM   1701 C C2    . DT  B 2 7   ? 31.794  7.071   12.445 1.00 59.81  ? 7   DT  C C2    1 
ATOM   1702 O O2    . DT  B 2 7   ? 32.870  7.628   12.605 1.00 59.75  ? 7   DT  C O2    1 
ATOM   1703 N N3    . DT  B 2 7   ? 30.609  7.757   12.537 1.00 55.93  ? 7   DT  C N3    1 
ATOM   1704 C C4    . DT  B 2 7   ? 29.331  7.255   12.346 1.00 55.99  ? 7   DT  C C4    1 
ATOM   1705 O O4    . DT  B 2 7   ? 28.371  8.009   12.445 1.00 53.10  ? 7   DT  C O4    1 
ATOM   1706 C C5    . DT  B 2 7   ? 29.255  5.827   12.064 1.00 60.72  ? 7   DT  C C5    1 
ATOM   1707 C C7    . DT  B 2 7   ? 27.924  5.151   11.892 1.00 62.64  ? 7   DT  C C7    1 
ATOM   1708 C C6    . DT  B 2 7   ? 30.405  5.141   11.974 1.00 63.83  ? 7   DT  C C6    1 
ATOM   1709 P P     . DG  B 2 8   ? 35.902  2.096   13.479 1.00 89.21  ? 8   DG  C P     1 
ATOM   1710 O OP1   . DG  B 2 8   ? 37.005  1.348   12.823 1.00 96.38  ? 8   DG  C OP1   1 
ATOM   1711 O OP2   . DG  B 2 8   ? 34.831  1.365   14.217 1.00 86.64  ? 8   DG  C OP2   1 
ATOM   1712 O "O5'" . DG  B 2 8   ? 36.524  3.169   14.494 1.00 85.12  ? 8   DG  C "O5'" 1 
ATOM   1713 C "C5'" . DG  B 2 8   ? 37.011  4.434   14.009 1.00 82.83  ? 8   DG  C "C5'" 1 
ATOM   1714 C "C4'" . DG  B 2 8   ? 36.801  5.539   15.036 1.00 76.41  ? 8   DG  C "C4'" 1 
ATOM   1715 O "O4'" . DG  B 2 8   ? 35.467  6.085   14.924 1.00 69.92  ? 8   DG  C "O4'" 1 
ATOM   1716 C "C3'" . DG  B 2 8   ? 36.993  5.144   16.502 1.00 74.86  ? 8   DG  C "C3'" 1 
ATOM   1717 O "O3'" . DG  B 2 8   ? 37.928  6.043   17.086 1.00 77.81  ? 8   DG  C "O3'" 1 
ATOM   1718 C "C2'" . DG  B 2 8   ? 35.582  5.265   17.114 1.00 67.54  ? 8   DG  C "C2'" 1 
ATOM   1719 C "C1'" . DG  B 2 8   ? 34.926  6.299   16.207 1.00 64.13  ? 8   DG  C "C1'" 1 
ATOM   1720 N N9    . DG  B 2 8   ? 33.468  6.180   16.097 1.00 57.10  ? 8   DG  C N9    1 
ATOM   1721 C C8    . DG  B 2 8   ? 32.758  5.075   15.682 1.00 56.02  ? 8   DG  C C8    1 
ATOM   1722 N N7    . DG  B 2 8   ? 31.485  5.301   15.513 1.00 52.68  ? 8   DG  C N7    1 
ATOM   1723 C C5    . DG  B 2 8   ? 31.327  6.641   15.854 1.00 49.35  ? 8   DG  C C5    1 
ATOM   1724 C C6    . DG  B 2 8   ? 30.154  7.452   15.889 1.00 44.46  ? 8   DG  C C6    1 
ATOM   1725 O O6    . DG  B 2 8   ? 28.992  7.137   15.582 1.00 42.44  ? 8   DG  C O6    1 
ATOM   1726 N N1    . DG  B 2 8   ? 30.445  8.769   16.256 1.00 43.40  ? 8   DG  C N1    1 
ATOM   1727 C C2    . DG  B 2 8   ? 31.703  9.236   16.588 1.00 46.40  ? 8   DG  C C2    1 
ATOM   1728 N N2    . DG  B 2 8   ? 31.787  10.518  16.962 1.00 46.01  ? 8   DG  C N2    1 
ATOM   1729 N N3    . DG  B 2 8   ? 32.806  8.492   16.556 1.00 50.16  ? 8   DG  C N3    1 
ATOM   1730 C C4    . DG  B 2 8   ? 32.548  7.209   16.171 1.00 51.98  ? 8   DG  C C4    1 
ATOM   1731 P P     . DT  B 2 9   ? 38.520  5.821   18.559 1.00 80.39  ? 9   DT  C P     1 
ATOM   1732 O OP1   . DT  B 2 9   ? 39.910  6.337   18.558 1.00 85.46  ? 9   DT  C OP1   1 
ATOM   1733 O OP2   . DT  B 2 9   ? 38.247  4.427   18.994 1.00 81.30  ? 9   DT  C OP2   1 
ATOM   1734 O "O5'" . DT  B 2 9   ? 37.602  6.798   19.430 1.00 74.59  ? 9   DT  C "O5'" 1 
ATOM   1735 C "C5'" . DT  B 2 9   ? 37.544  8.181   19.085 1.00 73.46  ? 9   DT  C "C5'" 1 
ATOM   1736 C "C4'" . DT  B 2 9   ? 36.502  8.910   19.900 1.00 68.75  ? 9   DT  C "C4'" 1 
ATOM   1737 O "O4'" . DT  B 2 9   ? 35.179  8.575   19.434 1.00 64.15  ? 9   DT  C "O4'" 1 
ATOM   1738 C "C3'" . DT  B 2 9   ? 36.512  8.634   21.404 1.00 68.78  ? 9   DT  C "C3'" 1 
ATOM   1739 O "O3'" . DT  B 2 9   ? 36.539  9.880   22.077 1.00 71.92  ? 9   DT  C "O3'" 1 
ATOM   1740 C "C2'" . DT  B 2 9   ? 35.185  7.893   21.637 1.00 62.38  ? 9   DT  C "C2'" 1 
ATOM   1741 C "C1'" . DT  B 2 9   ? 34.328  8.495   20.536 1.00 58.84  ? 9   DT  C "C1'" 1 
ATOM   1742 N N1    . DT  B 2 9   ? 33.112  7.704   20.137 1.00 52.75  ? 9   DT  C N1    1 
ATOM   1743 C C2    . DT  B 2 9   ? 31.909  8.367   19.986 1.00 47.68  ? 9   DT  C C2    1 
ATOM   1744 O O2    . DT  B 2 9   ? 31.768  9.559   20.201 1.00 47.67  ? 9   DT  C O2    1 
ATOM   1745 N N3    . DT  B 2 9   ? 30.871  7.585   19.562 1.00 44.07  ? 9   DT  C N3    1 
ATOM   1746 C C4    . DT  B 2 9   ? 30.906  6.245   19.241 1.00 44.66  ? 9   DT  C C4    1 
ATOM   1747 O O4    . DT  B 2 9   ? 29.888  5.713   18.818 1.00 42.93  ? 9   DT  C O4    1 
ATOM   1748 C C5    . DT  B 2 9   ? 32.192  5.591   19.431 1.00 49.23  ? 9   DT  C C5    1 
ATOM   1749 C C7    . DT  B 2 9   ? 32.348  4.112   19.183 1.00 51.54  ? 9   DT  C C7    1 
ATOM   1750 C C6    . DT  B 2 9   ? 33.227  6.348   19.844 1.00 52.39  ? 9   DT  C C6    1 
ATOM   1751 P P     . DA  B 2 10  ? 37.139  10.037  23.559 1.00 75.30  ? 10  DA  C P     1 
ATOM   1752 O OP1   . DA  B 2 10  ? 38.476  10.665  23.434 1.00 81.00  ? 10  DA  C OP1   1 
ATOM   1753 O OP2   . DA  B 2 10  ? 36.981  8.753   24.300 1.00 74.25  ? 10  DA  C OP2   1 
ATOM   1754 O "O5'" . DA  B 2 10  ? 36.136  11.094  24.211 1.00 71.20  ? 10  DA  C "O5'" 1 
ATOM   1755 C "C5'" . DA  B 2 10  ? 35.435  12.028  23.382 1.00 68.74  ? 10  DA  C "C5'" 1 
ATOM   1756 C "C4'" . DA  B 2 10  ? 34.096  12.388  24.002 1.00 63.65  ? 10  DA  C "C4'" 1 
ATOM   1757 O "O4'" . DA  B 2 10  ? 33.057  11.508  23.503 1.00 58.57  ? 10  DA  C "O4'" 1 
ATOM   1758 C "C3'" . DA  B 2 10  ? 34.043  12.306  25.520 1.00 62.68  ? 10  DA  C "C3'" 1 
ATOM   1759 O "O3'" . DA  B 2 10  ? 33.429  13.471  26.013 1.00 64.37  ? 10  DA  C "O3'" 1 
ATOM   1760 C "C2'" . DA  B 2 10  ? 33.225  11.035  25.805 1.00 57.32  ? 10  DA  C "C2'" 1 
ATOM   1761 C "C1'" . DA  B 2 10  ? 32.338  10.936  24.571 1.00 53.53  ? 10  DA  C "C1'" 1 
ATOM   1762 N N9    . DA  B 2 10  ? 31.987  9.569   24.179 1.00 48.22  ? 10  DA  C N9    1 
ATOM   1763 C C8    . DA  B 2 10  ? 32.824  8.492   24.085 1.00 48.55  ? 10  DA  C C8    1 
ATOM   1764 N N7    . DA  B 2 10  ? 32.252  7.412   23.604 1.00 46.58  ? 10  DA  C N7    1 
ATOM   1765 C C5    . DA  B 2 10  ? 30.960  7.817   23.315 1.00 42.25  ? 10  DA  C C5    1 
ATOM   1766 C C6    . DA  B 2 10  ? 29.848  7.147   22.754 1.00 38.71  ? 10  DA  C C6    1 
ATOM   1767 N N6    . DA  B 2 10  ? 29.866  5.859   22.382 1.00 37.34  ? 10  DA  C N6    1 
ATOM   1768 N N1    . DA  B 2 10  ? 28.717  7.867   22.551 1.00 38.40  ? 10  DA  C N1    1 
ATOM   1769 C C2    . DA  B 2 10  ? 28.686  9.152   22.940 1.00 38.81  ? 10  DA  C C2    1 
ATOM   1770 N N3    . DA  B 2 10  ? 29.663  9.881   23.491 1.00 40.91  ? 10  DA  C N3    1 
ATOM   1771 C C4    . DA  B 2 10  ? 30.785  9.153   23.642 1.00 43.34  ? 10  DA  C C4    1 
ATOM   1772 P P     . DC  B 2 11  ? 33.561  13.897  27.553 1.00 66.54  ? 11  DC  C P     1 
ATOM   1773 O OP1   . DC  B 2 11  ? 33.819  15.355  27.578 1.00 71.16  ? 11  DC  C OP1   1 
ATOM   1774 O OP2   . DC  B 2 11  ? 34.487  12.959  28.249 1.00 67.01  ? 11  DC  C OP2   1 
ATOM   1775 O "O5'" . DC  B 2 11  ? 32.084  13.617  28.106 1.00 62.17  ? 11  DC  C "O5'" 1 
ATOM   1776 C "C5'" . DC  B 2 11  ? 30.948  14.151  27.404 1.00 60.04  ? 11  DC  C "C5'" 1 
ATOM   1777 C "C4'" . DC  B 2 11  ? 29.703  13.347  27.707 1.00 55.13  ? 11  DC  C "C4'" 1 
ATOM   1778 O "O4'" . DC  B 2 11  ? 29.722  12.137  26.931 1.00 51.81  ? 11  DC  C "O4'" 1 
ATOM   1779 C "C3'" . DC  B 2 11  ? 29.593  12.864  29.146 1.00 52.95  ? 11  DC  C "C3'" 1 
ATOM   1780 O "O3'" . DC  B 2 11  ? 28.908  13.826  29.927 1.00 55.31  ? 11  DC  C "O3'" 1 
ATOM   1781 C "C2'" . DC  B 2 11  ? 28.810  11.549  29.041 1.00 48.07  ? 11  DC  C "C2'" 1 
ATOM   1782 C "C1'" . DC  B 2 11  ? 28.842  11.231  27.539 1.00 46.76  ? 11  DC  C "C1'" 1 
ATOM   1783 N N1    . DC  B 2 11  ? 29.272  9.829   27.200 1.00 43.00  ? 11  DC  C N1    1 
ATOM   1784 C C2    . DC  B 2 11  ? 28.437  9.036   26.393 1.00 39.15  ? 11  DC  C C2    1 
ATOM   1785 O O2    . DC  B 2 11  ? 27.376  9.525   25.953 1.00 38.58  ? 11  DC  C O2    1 
ATOM   1786 N N3    . DC  B 2 11  ? 28.823  7.759   26.103 1.00 38.33  ? 11  DC  C N3    1 
ATOM   1787 C C4    . DC  B 2 11  ? 29.999  7.284   26.552 1.00 39.93  ? 11  DC  C C4    1 
ATOM   1788 N N4    . DC  B 2 11  ? 30.338  6.027   26.224 1.00 39.44  ? 11  DC  C N4    1 
ATOM   1789 C C5    . DC  B 2 11  ? 30.870  8.081   27.374 1.00 42.29  ? 11  DC  C C5    1 
ATOM   1790 C C6    . DC  B 2 11  ? 30.456  9.322   27.695 1.00 43.23  ? 11  DC  C C6    1 
ATOM   1791 P P     . DG  B 2 12  ? 29.106  13.864  31.521 1.00 56.02  ? 12  DG  C P     1 
ATOM   1792 O OP1   . DG  B 2 12  ? 29.261  15.279  31.937 1.00 60.14  ? 12  DG  C OP1   1 
ATOM   1793 O OP2   . DG  B 2 12  ? 30.134  12.860  31.898 1.00 55.57  ? 12  DG  C OP2   1 
ATOM   1794 O "O5'" . DG  B 2 12  ? 27.713  13.317  32.062 1.00 52.22  ? 12  DG  C "O5'" 1 
ATOM   1795 C "C5'" . DG  B 2 12  ? 26.482  13.979  31.734 1.00 49.92  ? 12  DG  C "C5'" 1 
ATOM   1796 C "C4'" . DG  B 2 12  ? 25.349  13.403  32.566 1.00 45.36  ? 12  DG  C "C4'" 1 
ATOM   1797 O "O4'" . DG  B 2 12  ? 25.107  12.020  32.190 1.00 39.62  ? 12  DG  C "O4'" 1 
ATOM   1798 C "C3'" . DG  B 2 12  ? 25.575  13.388  34.075 1.00 45.09  ? 12  DG  C "C3'" 1 
ATOM   1799 O "O3'" . DG  B 2 12  ? 24.314  13.615  34.717 1.00 47.32  ? 12  DG  C "O3'" 1 
ATOM   1800 C "C2'" . DG  B 2 12  ? 26.090  11.957  34.327 1.00 41.24  ? 12  DG  C "C2'" 1 
ATOM   1801 C "C1'" . DG  B 2 12  ? 25.267  11.159  33.307 1.00 37.33  ? 12  DG  C "C1'" 1 
ATOM   1802 N N9    . DG  B 2 12  ? 25.943  9.965   32.813 1.00 33.89  ? 12  DG  C N9    1 
ATOM   1803 C C8    . DG  B 2 12  ? 27.209  9.916   32.256 1.00 34.92  ? 12  DG  C C8    1 
ATOM   1804 N N7    . DG  B 2 12  ? 27.500  8.760   31.732 1.00 35.03  ? 12  DG  C N7    1 
ATOM   1805 C C5    . DG  B 2 12  ? 26.353  7.987   31.940 1.00 32.15  ? 12  DG  C C5    1 
ATOM   1806 C C6    . DG  B 2 12  ? 26.058  6.653   31.533 1.00 31.18  ? 12  DG  C C6    1 
ATOM   1807 O O6    . DG  B 2 12  ? 26.804  5.846   30.964 1.00 32.79  ? 12  DG  C O6    1 
ATOM   1808 N N1    . DG  B 2 12  ? 24.761  6.268   31.894 1.00 28.61  ? 12  DG  C N1    1 
ATOM   1809 C C2    . DG  B 2 12  ? 23.841  7.092   32.518 1.00 27.70  ? 12  DG  C C2    1 
ATOM   1810 N N2    . DG  B 2 12  ? 22.647  6.547   32.814 1.00 26.44  ? 12  DG  C N2    1 
ATOM   1811 N N3    . DG  B 2 12  ? 24.105  8.340   32.911 1.00 28.34  ? 12  DG  C N3    1 
ATOM   1812 C C4    . DG  B 2 12  ? 25.379  8.722   32.586 1.00 31.24  ? 12  DG  C C4    1 
ATOM   1813 P P     . DT  B 2 13  ? 24.194  14.054  36.258 1.00 51.69  ? 13  DT  C P     1 
ATOM   1814 O OP1   . DT  B 2 13  ? 23.428  15.317  36.288 1.00 58.05  ? 13  DT  C OP1   1 
ATOM   1815 O OP2   . DT  B 2 13  ? 25.536  13.967  36.903 1.00 53.38  ? 13  DT  C OP2   1 
ATOM   1816 O "O5'" . DT  B 2 13  ? 23.303  12.914  36.881 1.00 48.07  ? 13  DT  C "O5'" 1 
ATOM   1817 C "C5'" . DT  B 2 13  ? 23.794  11.685  36.929 1.00 43.14  ? 13  DT  C "C5'" 1 
ATOM   1818 C "C4'" . DT  B 2 13  ? 22.688  10.661  36.955 1.00 38.63  ? 13  DT  C "C4'" 1 
ATOM   1819 O "O4'" . DT  B 2 13  ? 23.063  9.597   36.057 1.00 32.77  ? 13  DT  C "O4'" 1 
ATOM   1820 C "C3'" . DT  B 2 13  ? 22.507  10.033  38.337 1.00 36.67  ? 13  DT  C "C3'" 1 
ATOM   1821 O "O3'" . DT  B 2 13  ? 21.122  9.941   38.702 1.00 36.15  ? 13  DT  C "O3'" 1 
ATOM   1822 C "C2'" . DT  B 2 13  ? 23.188  8.663   38.247 1.00 34.23  ? 13  DT  C "C2'" 1 
ATOM   1823 C "C1'" . DT  B 2 13  ? 23.229  8.370   36.757 1.00 32.04  ? 13  DT  C "C1'" 1 
ATOM   1824 N N1    . DT  B 2 13  ? 24.511  7.751   36.288 1.00 30.86  ? 13  DT  C N1    1 
ATOM   1825 C C2    . DT  B 2 13  ? 24.493  6.475   35.748 1.00 29.08  ? 13  DT  C C2    1 
ATOM   1826 O O2    . DT  B 2 13  ? 23.497  5.758   35.743 1.00 30.35  ? 13  DT  C O2    1 
ATOM   1827 N N3    . DT  B 2 13  ? 25.685  6.063   35.200 1.00 27.57  ? 13  DT  C N3    1 
ATOM   1828 C C4    . DT  B 2 13  ? 26.868  6.766   35.158 1.00 30.98  ? 13  DT  C C4    1 
ATOM   1829 O O4    . DT  B 2 13  ? 27.852  6.238   34.658 1.00 33.63  ? 13  DT  C O4    1 
ATOM   1830 C C5    . DT  B 2 13  ? 26.839  8.084   35.787 1.00 32.73  ? 13  DT  C C5    1 
ATOM   1831 C C7    . DT  B 2 13  ? 28.080  8.927   35.872 1.00 36.14  ? 13  DT  C C7    1 
ATOM   1832 C C6    . DT  B 2 13  ? 25.676  8.504   36.312 1.00 31.96  ? 13  DT  C C6    1 
ATOM   1833 P P     . DG  B 2 14  ? 20.705  9.749   40.244 1.00 36.62  ? 14  DG  C P     1 
ATOM   1834 O OP1   . DG  B 2 14  ? 19.272  10.108  40.370 1.00 37.49  ? 14  DG  C OP1   1 
ATOM   1835 O OP2   . DG  B 2 14  ? 21.729  10.436  41.079 1.00 38.63  ? 14  DG  C OP2   1 
ATOM   1836 O "O5'" . DG  B 2 14  ? 20.861  8.188   40.486 1.00 35.32  ? 14  DG  C "O5'" 1 
ATOM   1837 C "C5'" . DG  B 2 14  ? 19.992  7.273   39.826 1.00 37.44  ? 14  DG  C "C5'" 1 
ATOM   1838 C "C4'" . DG  B 2 14  ? 20.511  5.860   39.986 1.00 38.34  ? 14  DG  C "C4'" 1 
ATOM   1839 O "O4'" . DG  B 2 14  ? 21.804  5.721   39.340 1.00 37.55  ? 14  DG  C "O4'" 1 
ATOM   1840 C "C3'" . DG  B 2 14  ? 20.718  5.395   41.431 1.00 41.45  ? 14  DG  C "C3'" 1 
ATOM   1841 O "O3'" . DG  B 2 14  ? 20.323  4.057   41.496 1.00 44.91  ? 14  DG  C "O3'" 1 
ATOM   1842 C "C2'" . DG  B 2 14  ? 22.233  5.527   41.632 1.00 39.29  ? 14  DG  C "C2'" 1 
ATOM   1843 C "C1'" . DG  B 2 14  ? 22.704  5.099   40.251 1.00 36.75  ? 14  DG  C "C1'" 1 
ATOM   1844 N N9    . DG  B 2 14  ? 24.077  5.484   39.900 1.00 34.23  ? 14  DG  C N9    1 
ATOM   1845 C C8    . DG  B 2 14  ? 24.763  6.624   40.247 1.00 34.60  ? 14  DG  C C8    1 
ATOM   1846 N N7    . DG  B 2 14  ? 25.948  6.706   39.684 1.00 34.41  ? 14  DG  C N7    1 
ATOM   1847 C C5    . DG  B 2 14  ? 26.033  5.550   38.924 1.00 32.59  ? 14  DG  C C5    1 
ATOM   1848 C C6    . DG  B 2 14  ? 27.094  5.064   38.128 1.00 32.00  ? 14  DG  C C6    1 
ATOM   1849 O O6    . DG  B 2 14  ? 28.183  5.608   37.920 1.00 34.72  ? 14  DG  C O6    1 
ATOM   1850 N N1    . DG  B 2 14  ? 26.819  3.801   37.598 1.00 29.52  ? 14  DG  C N1    1 
ATOM   1851 C C2    . DG  B 2 14  ? 25.631  3.111   37.793 1.00 30.71  ? 14  DG  C C2    1 
ATOM   1852 N N2    . DG  B 2 14  ? 25.521  1.902   37.226 1.00 30.24  ? 14  DG  C N2    1 
ATOM   1853 N N3    . DG  B 2 14  ? 24.611  3.587   38.499 1.00 31.18  ? 14  DG  C N3    1 
ATOM   1854 C C4    . DG  B 2 14  ? 24.903  4.783   39.068 1.00 32.30  ? 14  DG  C C4    1 
ATOM   1855 P P     . DA  B 2 15  ? 19.754  3.415   42.833 1.00 47.33  ? 15  DA  C P     1 
ATOM   1856 O OP1   . DA  B 2 15  ? 18.285  3.546   42.786 1.00 51.18  ? 15  DA  C OP1   1 
ATOM   1857 O OP2   . DA  B 2 15  ? 20.514  3.905   43.997 1.00 45.31  ? 15  DA  C OP2   1 
ATOM   1858 O "O5'" . DA  B 2 15  ? 20.118  1.877   42.642 1.00 46.06  ? 15  DA  C "O5'" 1 
ATOM   1859 C "C5'" . DA  B 2 15  ? 19.943  1.240   41.378 1.00 44.75  ? 15  DA  C "C5'" 1 
ATOM   1860 C "C4'" . DA  B 2 15  ? 20.890  0.057   41.247 1.00 42.78  ? 15  DA  C "C4'" 1 
ATOM   1861 O "O4'" . DA  B 2 15  ? 22.183  0.511   40.750 1.00 41.34  ? 15  DA  C "O4'" 1 
ATOM   1862 C "C3'" . DA  B 2 15  ? 21.160  -0.708  42.541 1.00 42.75  ? 15  DA  C "C3'" 1 
ATOM   1863 O "O3'" . DA  B 2 15  ? 21.023  -2.112  42.285 1.00 44.37  ? 15  DA  C "O3'" 1 
ATOM   1864 C "C2'" . DA  B 2 15  ? 22.592  -0.309  42.930 1.00 41.48  ? 15  DA  C "C2'" 1 
ATOM   1865 C "C1'" . DA  B 2 15  ? 23.231  0.041   41.594 1.00 40.42  ? 15  DA  C "C1'" 1 
ATOM   1866 N N9    . DA  B 2 15  ? 24.264  1.093   41.684 1.00 37.96  ? 15  DA  C N9    1 
ATOM   1867 C C8    . DA  B 2 15  ? 24.164  2.305   42.342 1.00 37.74  ? 15  DA  C C8    1 
ATOM   1868 N N7    . DA  B 2 15  ? 25.222  3.080   42.204 1.00 37.51  ? 15  DA  C N7    1 
ATOM   1869 C C5    . DA  B 2 15  ? 26.041  2.364   41.330 1.00 36.46  ? 15  DA  C C5    1 
ATOM   1870 C C6    . DA  B 2 15  ? 27.333  2.620   40.805 1.00 34.89  ? 15  DA  C C6    1 
ATOM   1871 N N6    . DA  B 2 15  ? 28.040  3.725   41.071 1.00 35.12  ? 15  DA  C N6    1 
ATOM   1872 N N1    . DA  B 2 15  ? 27.904  1.657   40.067 1.00 35.48  ? 15  DA  C N1    1 
ATOM   1873 C C2    . DA  B 2 15  ? 27.231  0.519   39.836 1.00 36.29  ? 15  DA  C C2    1 
ATOM   1874 N N3    . DA  B 2 15  ? 26.019  0.168   40.260 1.00 35.94  ? 15  DA  C N3    1 
ATOM   1875 C C4    . DA  B 2 15  ? 25.488  1.118   41.045 1.00 35.92  ? 15  DA  C C4    1 
ATOM   1876 P P     . DG  B 2 16  ? 21.261  -3.226  43.420 1.00 46.43  ? 16  DG  C P     1 
ATOM   1877 O OP1   . DG  B 2 16  ? 20.520  -4.436  42.988 1.00 47.80  ? 16  DG  C OP1   1 
ATOM   1878 O OP2   . DG  B 2 16  ? 21.018  -2.660  44.760 1.00 45.16  ? 16  DG  C OP2   1 
ATOM   1879 O "O5'" . DG  B 2 16  ? 22.821  -3.518  43.276 1.00 46.22  ? 16  DG  C "O5'" 1 
ATOM   1880 C "C5'" . DG  B 2 16  ? 23.306  -4.215  42.108 1.00 46.37  ? 16  DG  C "C5'" 1 
ATOM   1881 C "C4'" . DG  B 2 16  ? 24.808  -4.350  42.163 1.00 46.35  ? 16  DG  C "C4'" 1 
ATOM   1882 O "O4'" . DG  B 2 16  ? 25.431  -3.025  42.200 1.00 43.17  ? 16  DG  C "O4'" 1 
ATOM   1883 C "C3'" . DG  B 2 16  ? 25.342  -5.098  43.391 1.00 47.93  ? 16  DG  C "C3'" 1 
ATOM   1884 O "O3'" . DG  B 2 16  ? 26.406  -5.874  42.984 1.00 52.51  ? 16  DG  C "O3'" 1 
ATOM   1885 C "C2'" . DG  B 2 16  ? 25.824  -3.956  44.301 1.00 45.77  ? 16  DG  C "C2'" 1 
ATOM   1886 C "C1'" . DG  B 2 16  ? 26.373  -3.013  43.249 1.00 42.84  ? 16  DG  C "C1'" 1 
ATOM   1887 N N9    . DG  B 2 16  ? 26.629  -1.631  43.667 1.00 39.44  ? 16  DG  C N9    1 
ATOM   1888 C C8    . DG  B 2 16  ? 25.820  -0.800  44.419 1.00 37.95  ? 16  DG  C C8    1 
ATOM   1889 N N7    . DG  B 2 16  ? 26.337  0.391   44.614 1.00 37.09  ? 16  DG  C N7    1 
ATOM   1890 C C5    . DG  B 2 16  ? 27.514  0.375   43.853 1.00 38.46  ? 16  DG  C C5    1 
ATOM   1891 C C6    . DG  B 2 16  ? 28.521  1.373   43.670 1.00 40.31  ? 16  DG  C C6    1 
ATOM   1892 O O6    . DG  B 2 16  ? 28.549  2.537   44.117 1.00 41.30  ? 16  DG  C O6    1 
ATOM   1893 N N1    . DG  B 2 16  ? 29.613  0.876   42.948 1.00 41.79  ? 16  DG  C N1    1 
ATOM   1894 C C2    . DG  B 2 16  ? 29.677  -0.382  42.380 1.00 41.03  ? 16  DG  C C2    1 
ATOM   1895 N N2    . DG  B 2 16  ? 30.773  -0.679  41.680 1.00 42.24  ? 16  DG  C N2    1 
ATOM   1896 N N3    . DG  B 2 16  ? 28.759  -1.308  42.556 1.00 40.19  ? 16  DG  C N3    1 
ATOM   1897 C C4    . DG  B 2 16  ? 27.704  -0.869  43.283 1.00 38.84  ? 16  DG  C C4    1 
ATOM   1898 P P     . DC  B 2 17  ? 26.230  -7.445  42.635 1.00 49.73  ? 17  DC  C P     1 
ATOM   1899 O OP1   . DC  B 2 17  ? 25.549  -7.552  41.329 1.00 51.51  ? 17  DC  C OP1   1 
ATOM   1900 O OP2   . DC  B 2 17  ? 25.690  -8.153  43.834 1.00 49.01  ? 17  DC  C OP2   1 
ATOM   1901 O "O5'" . DC  B 2 17  ? 27.755  -7.881  42.480 1.00 47.95  ? 17  DC  C "O5'" 1 
ATOM   1902 C "C5'" . DC  B 2 17  ? 28.605  -7.696  43.564 1.00 45.80  ? 17  DC  C "C5'" 1 
ATOM   1903 C "C4'" . DC  B 2 17  ? 29.948  -7.163  43.132 1.00 45.12  ? 17  DC  C "C4'" 1 
ATOM   1904 O "O4'" . DC  B 2 17  ? 29.848  -5.735  42.931 1.00 44.41  ? 17  DC  C "O4'" 1 
ATOM   1905 C "C3'" . DC  B 2 17  ? 31.022  -7.344  44.190 1.00 44.95  ? 17  DC  C "C3'" 1 
ATOM   1906 O "O3'" . DC  B 2 17  ? 31.672  -8.582  43.965 1.00 47.85  ? 17  DC  C "O3'" 1 
ATOM   1907 C "C2'" . DC  B 2 17  ? 31.957  -6.157  43.947 1.00 43.86  ? 17  DC  C "C2'" 1 
ATOM   1908 C "C1'" . DC  B 2 17  ? 31.031  -5.098  43.382 1.00 43.14  ? 17  DC  C "C1'" 1 
ATOM   1909 N N1    . DC  B 2 17  ? 30.660  -3.968  44.327 1.00 41.06  ? 17  DC  C N1    1 
ATOM   1910 C C2    . DC  B 2 17  ? 31.467  -2.813  44.383 1.00 39.32  ? 17  DC  C C2    1 
ATOM   1911 O O2    . DC  B 2 17  ? 32.521  -2.771  43.741 1.00 39.96  ? 17  DC  C O2    1 
ATOM   1912 N N3    . DC  B 2 17  ? 31.025  -1.747  45.077 1.00 37.89  ? 17  DC  C N3    1 
ATOM   1913 C C4    . DC  B 2 17  ? 29.856  -1.787  45.718 1.00 38.33  ? 17  DC  C C4    1 
ATOM   1914 N N4    . DC  B 2 17  ? 29.499  -0.703  46.415 1.00 38.73  ? 17  DC  C N4    1 
ATOM   1915 C C5    . DC  B 2 17  ? 29.060  -2.976  45.761 1.00 39.07  ? 17  DC  C C5    1 
ATOM   1916 C C6    . DC  B 2 17  ? 29.476  -4.020  45.033 1.00 39.72  ? 17  DC  C C6    1 
ATOM   1917 P P     . DG  B 2 18  ? 32.342  -9.392  45.157 1.00 51.86  ? 18  DG  C P     1 
ATOM   1918 O OP1   . DG  B 2 18  ? 32.516  -10.792 44.699 1.00 54.15  ? 18  DG  C OP1   1 
ATOM   1919 O OP2   . DG  B 2 18  ? 31.610  -9.113  46.432 1.00 50.11  ? 18  DG  C OP2   1 
ATOM   1920 O "O5'" . DG  B 2 18  ? 33.777  -8.708  45.311 1.00 51.49  ? 18  DG  C "O5'" 1 
ATOM   1921 C "C5'" . DG  B 2 18  ? 34.739  -8.647  44.240 1.00 51.03  ? 18  DG  C "C5'" 1 
ATOM   1922 C "C4'" . DG  B 2 18  ? 35.868  -7.697  44.655 1.00 49.90  ? 18  DG  C "C4'" 1 
ATOM   1923 O "O4'" . DG  B 2 18  ? 35.303  -6.384  44.976 1.00 46.26  ? 18  DG  C "O4'" 1 
ATOM   1924 C "C3'" . DG  B 2 18  ? 36.648  -8.118  45.909 1.00 50.01  ? 18  DG  C "C3'" 1 
ATOM   1925 O "O3'" . DG  B 2 18  ? 38.019  -7.735  45.770 1.00 53.86  ? 18  DG  C "O3'" 1 
ATOM   1926 C "C2'" . DG  B 2 18  ? 35.947  -7.346  47.029 1.00 46.21  ? 18  DG  C "C2'" 1 
ATOM   1927 C "C1'" . DG  B 2 18  ? 35.597  -6.038  46.319 1.00 44.71  ? 18  DG  C "C1'" 1 
ATOM   1928 N N9    . DG  B 2 18  ? 34.433  -5.352  46.888 1.00 41.00  ? 18  DG  C N9    1 
ATOM   1929 C C8    . DG  B 2 18  ? 33.189  -5.901  47.143 1.00 39.39  ? 18  DG  C C8    1 
ATOM   1930 N N7    . DG  B 2 18  ? 32.314  -5.032  47.572 1.00 37.72  ? 18  DG  C N7    1 
ATOM   1931 C C5    . DG  B 2 18  ? 33.014  -3.833  47.610 1.00 36.42  ? 18  DG  C C5    1 
ATOM   1932 C C6    . DG  B 2 18  ? 32.598  -2.560  48.041 1.00 35.62  ? 18  DG  C C6    1 
ATOM   1933 O O6    . DG  B 2 18  ? 31.493  -2.234  48.500 1.00 35.96  ? 18  DG  C O6    1 
ATOM   1934 N N1    . DG  B 2 18  ? 33.646  -1.631  48.004 1.00 36.74  ? 18  DG  C N1    1 
ATOM   1935 C C2    . DG  B 2 18  ? 34.918  -1.893  47.532 1.00 37.89  ? 18  DG  C C2    1 
ATOM   1936 N N2    . DG  B 2 18  ? 35.785  -0.876  47.541 1.00 40.03  ? 18  DG  C N2    1 
ATOM   1937 N N3    . DG  B 2 18  ? 35.303  -3.070  47.071 1.00 38.81  ? 18  DG  C N3    1 
ATOM   1938 C C4    . DG  B 2 18  ? 34.311  -4.002  47.163 1.00 38.43  ? 18  DG  C C4    1 
ATOM   1939 P P     . DA  B 2 19  ? 39.103  -8.059  46.920 1.00 56.49  ? 19  DA  C P     1 
ATOM   1940 O OP1   . DA  B 2 19  ? 40.367  -8.429  46.239 1.00 61.94  ? 19  DA  C OP1   1 
ATOM   1941 O OP2   . DA  B 2 19  ? 38.498  -8.989  47.899 1.00 54.70  ? 19  DA  C OP2   1 
ATOM   1942 O "O5'" . DA  B 2 19  ? 39.292  -6.640  47.645 1.00 53.98  ? 19  DA  C "O5'" 1 
ATOM   1943 C "C5'" . DA  B 2 19  ? 39.548  -5.444  46.868 1.00 53.03  ? 19  DA  C "C5'" 1 
ATOM   1944 C "C4'" . DA  B 2 19  ? 39.846  -4.247  47.775 1.00 52.25  ? 19  DA  C "C4'" 1 
ATOM   1945 O "O4'" . DA  B 2 19  ? 38.611  -3.640  48.237 1.00 47.60  ? 19  DA  C "O4'" 1 
ATOM   1946 C "C3'" . DA  B 2 19  ? 40.682  -4.530  49.025 1.00 53.95  ? 19  DA  C "C3'" 1 
ATOM   1947 O "O3'" . DA  B 2 19  ? 41.635  -3.469  49.192 1.00 60.00  ? 19  DA  C "O3'" 1 
ATOM   1948 C "C2'" . DA  B 2 19  ? 39.639  -4.580  50.160 1.00 48.34  ? 19  DA  C "C2'" 1 
ATOM   1949 C "C1'" . DA  B 2 19  ? 38.569  -3.607  49.660 1.00 45.57  ? 19  DA  C "C1'" 1 
ATOM   1950 N N9    . DA  B 2 19  ? 37.201  -3.945  50.070 1.00 40.20  ? 19  DA  C N9    1 
ATOM   1951 C C8    . DA  B 2 19  ? 36.555  -5.135  49.856 1.00 38.09  ? 19  DA  C C8    1 
ATOM   1952 N N7    . DA  B 2 19  ? 35.296  -5.123  50.197 1.00 36.11  ? 19  DA  C N7    1 
ATOM   1953 C C5    . DA  B 2 19  ? 35.068  -3.809  50.607 1.00 35.73  ? 19  DA  C C5    1 
ATOM   1954 C C6    . DA  B 2 19  ? 33.911  -3.136  51.069 1.00 34.06  ? 19  DA  C C6    1 
ATOM   1955 N N6    . DA  B 2 19  ? 32.696  -3.710  51.145 1.00 32.84  ? 19  DA  C N6    1 
ATOM   1956 N N1    . DA  B 2 19  ? 34.013  -1.803  51.293 1.00 35.89  ? 19  DA  C N1    1 
ATOM   1957 C C2    . DA  B 2 19  ? 35.211  -1.213  51.187 1.00 37.36  ? 19  DA  C C2    1 
ATOM   1958 N N3    . DA  B 2 19  ? 36.363  -1.735  50.764 1.00 38.32  ? 19  DA  C N3    1 
ATOM   1959 C C4    . DA  B 2 19  ? 36.226  -3.063  50.507 1.00 37.97  ? 19  DA  C C4    1 
ATOM   1960 P P     . DT  B 2 20  ? 42.784  -3.516  50.321 1.00 65.31  ? 20  DT  C P     1 
ATOM   1961 O OP1   . DT  B 2 20  ? 43.992  -2.865  49.756 1.00 70.77  ? 20  DT  C OP1   1 
ATOM   1962 O OP2   . DT  B 2 20  ? 42.874  -4.896  50.880 1.00 64.93  ? 20  DT  C OP2   1 
ATOM   1963 O "O5'" . DT  B 2 20  ? 42.176  -2.577  51.463 1.00 64.28  ? 20  DT  C "O5'" 1 
ATOM   1964 C "C5'" . DT  B 2 20  ? 41.538  -1.347  51.102 1.00 63.55  ? 20  DT  C "C5'" 1 
ATOM   1965 C "C4'" . DT  B 2 20  ? 40.778  -0.760  52.268 1.00 61.33  ? 20  DT  C "C4'" 1 
ATOM   1966 O "O4'" . DT  B 2 20  ? 39.498  -1.387  52.386 1.00 55.29  ? 20  DT  C "O4'" 1 
ATOM   1967 C "C3'" . DT  B 2 20  ? 41.443  -0.912  53.635 1.00 63.92  ? 20  DT  C "C3'" 1 
ATOM   1968 O "O3'" . DT  B 2 20  ? 41.811  0.369   54.097 1.00 69.92  ? 20  DT  C "O3'" 1 
ATOM   1969 C "C2'" . DT  B 2 20  ? 40.358  -1.565  54.523 1.00 58.08  ? 20  DT  C "C2'" 1 
ATOM   1970 C "C1'" . DT  B 2 20  ? 39.094  -1.293  53.718 1.00 53.20  ? 20  DT  C "C1'" 1 
ATOM   1971 N N1    . DT  B 2 20  ? 37.953  -2.264  53.926 1.00 46.78  ? 20  DT  C N1    1 
ATOM   1972 C C2    . DT  B 2 20  ? 36.690  -1.763  54.260 1.00 43.92  ? 20  DT  C C2    1 
ATOM   1973 O O2    . DT  B 2 20  ? 36.469  -0.579  54.520 1.00 46.50  ? 20  DT  C O2    1 
ATOM   1974 N N3    . DT  B 2 20  ? 35.685  -2.690  54.234 1.00 38.63  ? 20  DT  C N3    1 
ATOM   1975 C C4    . DT  B 2 20  ? 35.802  -4.050  53.982 1.00 37.21  ? 20  DT  C C4    1 
ATOM   1976 O O4    . DT  B 2 20  ? 34.799  -4.750  54.013 1.00 34.04  ? 20  DT  C O4    1 
ATOM   1977 C C5    . DT  B 2 20  ? 37.142  -4.510  53.631 1.00 40.26  ? 20  DT  C C5    1 
ATOM   1978 C C7    . DT  B 2 20  ? 37.396  -5.962  53.316 1.00 40.61  ? 20  DT  C C7    1 
ATOM   1979 C C6    . DT  B 2 20  ? 38.126  -3.600  53.581 1.00 43.47  ? 20  DT  C C6    1 
ATOM   1980 P P     . DG  B 2 21  ? 42.864  0.545   55.284 1.00 75.55  ? 21  DG  C P     1 
ATOM   1981 O OP1   . DG  B 2 21  ? 43.648  1.777   55.007 1.00 81.76  ? 21  DG  C OP1   1 
ATOM   1982 O OP2   . DG  B 2 21  ? 43.564  -0.751  55.498 1.00 75.73  ? 21  DG  C OP2   1 
ATOM   1983 O "O5'" . DG  B 2 21  ? 41.921  0.801   56.546 1.00 72.66  ? 21  DG  C "O5'" 1 
ATOM   1984 C "C5'" . DG  B 2 21  ? 40.943  1.847   56.519 1.00 70.93  ? 21  DG  C "C5'" 1 
ATOM   1985 C "C4'" . DG  B 2 21  ? 39.888  1.638   57.601 1.00 66.95  ? 21  DG  C "C4'" 1 
ATOM   1986 O "O4'" . DG  B 2 21  ? 38.993  0.566   57.213 1.00 60.89  ? 21  DG  C "O4'" 1 
ATOM   1987 C "C3'" . DG  B 2 21  ? 40.412  1.258   59.000 1.00 67.36  ? 21  DG  C "C3'" 1 
ATOM   1988 O "O3'" . DG  B 2 21  ? 39.625  1.909   59.975 1.00 69.03  ? 21  DG  C "O3'" 1 
ATOM   1989 C "C2'" . DG  B 2 21  ? 40.149  -0.242  59.046 1.00 62.63  ? 21  DG  C "C2'" 1 
ATOM   1990 C "C1'" . DG  B 2 21  ? 38.820  -0.272  58.316 1.00 58.25  ? 21  DG  C "C1'" 1 
ATOM   1991 N N9    . DG  B 2 21  ? 38.370  -1.584  57.874 1.00 53.00  ? 21  DG  C N9    1 
ATOM   1992 C C8    . DG  B 2 21  ? 39.141  -2.663  57.501 1.00 52.44  ? 21  DG  C C8    1 
ATOM   1993 N N7    . DG  B 2 21  ? 38.443  -3.725  57.226 1.00 49.08  ? 21  DG  C N7    1 
ATOM   1994 C C5    . DG  B 2 21  ? 37.133  -3.339  57.495 1.00 45.43  ? 21  DG  C C5    1 
ATOM   1995 C C6    . DG  B 2 21  ? 35.933  -4.072  57.396 1.00 41.33  ? 21  DG  C C6    1 
ATOM   1996 O O6    . DG  B 2 21  ? 35.792  -5.261  57.066 1.00 41.03  ? 21  DG  C O6    1 
ATOM   1997 N N1    . DG  B 2 21  ? 34.826  -3.307  57.784 1.00 39.05  ? 21  DG  C N1    1 
ATOM   1998 C C2    . DG  B 2 21  ? 34.886  -2.007  58.220 1.00 40.60  ? 21  DG  C C2    1 
ATOM   1999 N N2    . DG  B 2 21  ? 33.728  -1.424  58.557 1.00 40.67  ? 21  DG  C N2    1 
ATOM   2000 N N3    . DG  B 2 21  ? 36.000  -1.301  58.272 1.00 44.85  ? 21  DG  C N3    1 
ATOM   2001 C C4    . DG  B 2 21  ? 37.077  -2.025  57.879 1.00 46.81  ? 21  DG  C C4    1 
ATOM   2002 P P     . DG  B 2 22  ? 40.292  2.820   61.116 1.00 73.90  ? 22  DG  C P     1 
ATOM   2003 O OP1   . DG  B 2 22  ? 40.996  3.937   60.447 1.00 78.34  ? 22  DG  C OP1   1 
ATOM   2004 O OP2   . DG  B 2 22  ? 41.023  1.932   62.059 1.00 74.32  ? 22  DG  C OP2   1 
ATOM   2005 O "O5'" . DG  B 2 22  ? 39.021  3.393   61.895 1.00 72.49  ? 22  DG  C "O5'" 1 
ATOM   2006 C "C5'" . DG  B 2 22  ? 37.884  3.878   61.171 1.00 70.53  ? 22  DG  C "C5'" 1 
ATOM   2007 C "C4'" . DG  B 2 22  ? 36.592  3.413   61.827 1.00 67.96  ? 22  DG  C "C4'" 1 
ATOM   2008 O "O4'" . DG  B 2 22  ? 36.238  2.076   61.367 1.00 62.53  ? 22  DG  C "O4'" 1 
ATOM   2009 C "C3'" . DG  B 2 22  ? 36.611  3.352   63.349 1.00 69.92  ? 22  DG  C "C3'" 1 
ATOM   2010 O "O3'" . DG  B 2 22  ? 35.430  3.958   63.835 1.00 73.34  ? 22  DG  C "O3'" 1 
ATOM   2011 C "C2'" . DG  B 2 22  ? 36.686  1.844   63.667 1.00 64.64  ? 22  DG  C "C2'" 1 
ATOM   2012 C "C1'" . DG  B 2 22  ? 35.999  1.220   62.462 1.00 59.73  ? 22  DG  C "C1'" 1 
ATOM   2013 N N9    . DG  B 2 22  ? 36.484  -0.123  62.104 1.00 54.17  ? 22  DG  C N9    1 
ATOM   2014 C C8    . DG  B 2 22  ? 37.778  -0.496  61.792 1.00 54.06  ? 22  DG  C C8    1 
ATOM   2015 N N7    . DG  B 2 22  ? 37.881  -1.740  61.384 1.00 49.76  ? 22  DG  C N7    1 
ATOM   2016 C C5    . DG  B 2 22  ? 36.575  -2.217  61.415 1.00 45.33  ? 22  DG  C C5    1 
ATOM   2017 C C6    . DG  B 2 22  ? 36.064  -3.496  61.082 1.00 41.31  ? 22  DG  C C6    1 
ATOM   2018 O O6    . DG  B 2 22  ? 36.696  -4.496  60.717 1.00 40.60  ? 22  DG  C O6    1 
ATOM   2019 N N1    . DG  B 2 22  ? 34.674  -3.560  61.248 1.00 39.18  ? 22  DG  C N1    1 
ATOM   2020 C C2    . DG  B 2 22  ? 33.892  -2.516  61.712 1.00 41.55  ? 22  DG  C C2    1 
ATOM   2021 N N2    . DG  B 2 22  ? 32.584  -2.754  61.846 1.00 42.01  ? 22  DG  C N2    1 
ATOM   2022 N N3    . DG  B 2 22  ? 34.364  -1.324  62.032 1.00 44.45  ? 22  DG  C N3    1 
ATOM   2023 C C4    . DG  B 2 22  ? 35.705  -1.241  61.858 1.00 47.29  ? 22  DG  C C4    1 
ATOM   2024 P P     . DA  B 2 23  ? 35.164  4.169   65.401 1.00 78.23  ? 23  DA  C P     1 
ATOM   2025 O OP1   . DA  B 2 23  ? 34.417  5.448   65.549 1.00 83.40  ? 23  DA  C OP1   1 
ATOM   2026 O OP2   . DA  B 2 23  ? 36.425  3.944   66.171 1.00 79.24  ? 23  DA  C OP2   1 
ATOM   2027 O "O5'" . DA  B 2 23  ? 34.194  2.945   65.742 1.00 73.77  ? 23  DA  C "O5'" 1 
ATOM   2028 C "C5'" . DA  B 2 23  ? 32.959  2.789   65.056 1.00 70.89  ? 23  DA  C "C5'" 1 
ATOM   2029 C "C4'" . DA  B 2 23  ? 32.211  1.581   65.585 1.00 67.01  ? 23  DA  C "C4'" 1 
ATOM   2030 O "O4'" . DA  B 2 23  ? 32.783  0.369   65.031 1.00 60.04  ? 23  DA  C "O4'" 1 
ATOM   2031 C "C3'" . DA  B 2 23  ? 32.208  1.412   67.108 1.00 69.55  ? 23  DA  C "C3'" 1 
ATOM   2032 O "O3'" . DA  B 2 23  ? 30.880  1.143   67.532 1.00 73.26  ? 23  DA  C "O3'" 1 
ATOM   2033 C "C2'" . DA  B 2 23  ? 33.155  0.223   67.350 1.00 64.34  ? 23  DA  C "C2'" 1 
ATOM   2034 C "C1'" . DA  B 2 23  ? 33.016  -0.570  66.053 1.00 58.51  ? 23  DA  C "C1'" 1 
ATOM   2035 N N9    . DA  B 2 23  ? 34.200  -1.352  65.682 1.00 53.31  ? 23  DA  C N9    1 
ATOM   2036 C C8    . DA  B 2 23  ? 35.491  -0.906  65.587 1.00 53.55  ? 23  DA  C C8    1 
ATOM   2037 N N7    . DA  B 2 23  ? 36.335  -1.799  65.132 1.00 50.40  ? 23  DA  C N7    1 
ATOM   2038 C C5    . DA  B 2 23  ? 35.550  -2.926  64.928 1.00 47.09  ? 23  DA  C C5    1 
ATOM   2039 C C6    . DA  B 2 23  ? 35.848  -4.220  64.433 1.00 42.89  ? 23  DA  C C6    1 
ATOM   2040 N N6    . DA  B 2 23  ? 37.077  -4.606  64.071 1.00 42.46  ? 23  DA  C N6    1 
ATOM   2041 N N1    . DA  B 2 23  ? 34.824  -5.099  64.317 1.00 39.93  ? 23  DA  C N1    1 
ATOM   2042 C C2    . DA  B 2 23  ? 33.578  -4.699  64.629 1.00 41.64  ? 23  DA  C C2    1 
ATOM   2043 N N3    . DA  B 2 23  ? 33.174  -3.504  65.095 1.00 45.61  ? 23  DA  C N3    1 
ATOM   2044 C C4    . DA  B 2 23  ? 34.221  -2.657  65.223 1.00 48.28  ? 23  DA  C C4    1 
ATOM   2045 P P     . DC  B 2 24  ? 30.461  1.138   69.083 1.00 79.46  ? 24  DC  C P     1 
ATOM   2046 O OP1   . DC  B 2 24  ? 29.056  1.595   69.147 1.00 83.91  ? 24  DC  C OP1   1 
ATOM   2047 O OP2   . DC  B 2 24  ? 31.506  1.829   69.890 1.00 82.38  ? 24  DC  C OP2   1 
ATOM   2048 O "O5'" . DC  B 2 24  ? 30.513  -0.418  69.457 1.00 75.26  ? 24  DC  C "O5'" 1 
ATOM   2049 C "C5'" . DC  B 2 24  ? 29.920  -1.396  68.569 1.00 71.17  ? 24  DC  C "C5'" 1 
ATOM   2050 C "C4'" . DC  B 2 24  ? 30.376  -2.803  68.910 1.00 66.96  ? 24  DC  C "C4'" 1 
ATOM   2051 O "O4'" . DC  B 2 24  ? 31.628  -3.093  68.251 1.00 62.25  ? 24  DC  C "O4'" 1 
ATOM   2052 C "C3'" . DC  B 2 24  ? 30.607  -3.082  70.400 1.00 69.62  ? 24  DC  C "C3'" 1 
ATOM   2053 O "O3'" . DC  B 2 24  ? 29.872  -4.197  70.763 1.00 71.68  ? 24  DC  C "O3'" 1 
ATOM   2054 C "C2'" . DC  B 2 24  ? 32.108  -3.378  70.486 1.00 65.64  ? 24  DC  C "C2'" 1 
ATOM   2055 C "C1'" . DC  B 2 24  ? 32.369  -3.916  69.091 1.00 60.17  ? 24  DC  C "C1'" 1 
ATOM   2056 N N1    . DC  B 2 24  ? 33.811  -3.913  68.665 1.00 56.04  ? 24  DC  C N1    1 
ATOM   2057 C C2    . DC  B 2 24  ? 34.343  -5.048  68.020 1.00 51.91  ? 24  DC  C C2    1 
ATOM   2058 O O2    . DC  B 2 24  ? 33.604  -6.004  67.751 1.00 49.68  ? 24  DC  C O2    1 
ATOM   2059 N N3    . DC  B 2 24  ? 35.653  -5.042  67.665 1.00 50.92  ? 24  DC  C N3    1 
ATOM   2060 C C4    . DC  B 2 24  ? 36.432  -4.004  67.964 1.00 51.83  ? 24  DC  C C4    1 
ATOM   2061 N N4    . DC  B 2 24  ? 37.703  -4.060  67.575 1.00 51.58  ? 24  DC  C N4    1 
ATOM   2062 C C5    . DC  B 2 24  ? 35.924  -2.839  68.624 1.00 55.29  ? 24  DC  C C5    1 
ATOM   2063 C C6    . DC  B 2 24  ? 34.621  -2.832  68.951 1.00 56.96  ? 24  DC  C C6    1 
ATOM   2064 P P     . DA  B 2 25  ? 28.969  -4.220  72.084 1.00 77.09  ? 25  DA  C P     1 
ATOM   2065 O OP1   . DA  B 2 25  ? 27.639  -3.661  71.723 1.00 80.42  ? 25  DA  C OP1   1 
ATOM   2066 O OP2   . DA  B 2 25  ? 29.736  -3.650  73.225 1.00 79.32  ? 25  DA  C OP2   1 
ATOM   2067 O "O5'" . DA  B 2 25  ? 28.831  -5.792  72.316 1.00 73.81  ? 25  DA  C "O5'" 1 
ATOM   2068 C "C5'" . DA  B 2 25  ? 28.620  -6.639  71.178 1.00 69.06  ? 25  DA  C "C5'" 1 
ATOM   2069 C "C4'" . DA  B 2 25  ? 29.485  -7.880  71.248 1.00 64.57  ? 25  DA  C "C4'" 1 
ATOM   2070 O "O4'" . DA  B 2 25  ? 30.829  -7.607  70.776 1.00 60.57  ? 25  DA  C "O4'" 1 
ATOM   2071 C "C3'" . DA  B 2 25  ? 29.619  -8.493  72.631 1.00 65.87  ? 25  DA  C "C3'" 1 
ATOM   2072 O "O3'" . DA  B 2 25  ? 29.155  -9.821  72.557 1.00 66.34  ? 25  DA  C "O3'" 1 
ATOM   2073 C "C2'" . DA  B 2 25  ? 31.117  -8.391  72.951 1.00 63.50  ? 25  DA  C "C2'" 1 
ATOM   2074 C "C1'" . DA  B 2 25  ? 31.757  -8.302  71.577 1.00 59.75  ? 25  DA  C "C1'" 1 
ATOM   2075 N N9    . DA  B 2 25  ? 33.016  -7.548  71.557 1.00 57.19  ? 25  DA  C N9    1 
ATOM   2076 C C8    . DA  B 2 25  ? 33.223  -6.276  72.036 1.00 58.73  ? 25  DA  C C8    1 
ATOM   2077 N N7    . DA  B 2 25  ? 34.410  -5.789  71.764 1.00 57.29  ? 25  DA  C N7    1 
ATOM   2078 C C5    . DA  B 2 25  ? 35.038  -6.817  71.078 1.00 53.40  ? 25  DA  C C5    1 
ATOM   2079 C C6    . DA  B 2 25  ? 36.338  -6.942  70.546 1.00 50.62  ? 25  DA  C C6    1 
ATOM   2080 N N6    . DA  B 2 25  ? 37.257  -5.986  70.646 1.00 51.32  ? 25  DA  C N6    1 
ATOM   2081 N N1    . DA  B 2 25  ? 36.677  -8.119  69.989 1.00 49.55  ? 25  DA  C N1    1 
ATOM   2082 C C2    . DA  B 2 25  ? 35.761  -9.098  69.925 1.00 50.04  ? 25  DA  C C2    1 
ATOM   2083 N N3    . DA  B 2 25  ? 34.499  -9.092  70.368 1.00 51.42  ? 25  DA  C N3    1 
ATOM   2084 C C4    . DA  B 2 25  ? 34.202  -7.914  70.954 1.00 53.29  ? 25  DA  C C4    1 
ATOM   2085 P P     . DG  B 2 26  ? 29.089  -10.780 73.831 1.00 68.24  ? 26  DG  C P     1 
ATOM   2086 O OP1   . DG  B 2 26  ? 27.895  -11.645 73.680 1.00 70.56  ? 26  DG  C OP1   1 
ATOM   2087 O OP2   . DG  B 2 26  ? 29.270  -9.983  75.079 1.00 69.93  ? 26  DG  C OP2   1 
ATOM   2088 O "O5'" . DG  B 2 26  ? 30.407  -11.658 73.616 1.00 64.87  ? 26  DG  C "O5'" 1 
ATOM   2089 C "C5'" . DG  B 2 26  ? 30.584  -12.463 72.437 1.00 60.62  ? 26  DG  C "C5'" 1 
ATOM   2090 C "C4'" . DG  B 2 26  ? 31.872  -13.273 72.552 1.00 58.49  ? 26  DG  C "C4'" 1 
ATOM   2091 O "O4'" . DG  B 2 26  ? 33.024  -12.408 72.354 1.00 55.79  ? 26  DG  C "O4'" 1 
ATOM   2092 C "C3'" . DG  B 2 26  ? 32.101  -13.996 73.894 1.00 60.01  ? 26  DG  C "C3'" 1 
ATOM   2093 O "O3'" . DG  B 2 26  ? 32.585  -15.299 73.612 1.00 60.70  ? 26  DG  C "O3'" 1 
ATOM   2094 C "C2'" . DG  B 2 26  ? 33.162  -13.134 74.596 1.00 58.54  ? 26  DG  C "C2'" 1 
ATOM   2095 C "C1'" . DG  B 2 26  ? 33.958  -12.572 73.409 1.00 55.88  ? 26  DG  C "C1'" 1 
ATOM   2096 N N9    . DG  B 2 26  ? 34.577  -11.254 73.658 1.00 54.65  ? 26  DG  C N9    1 
ATOM   2097 C C8    . DG  B 2 26  ? 33.940  -10.132 74.130 1.00 55.05  ? 26  DG  C C8    1 
ATOM   2098 N N7    . DG  B 2 26  ? 34.696  -9.079  74.176 1.00 54.75  ? 26  DG  C N7    1 
ATOM   2099 C C5    . DG  B 2 26  ? 35.886  -9.482  73.596 1.00 52.63  ? 26  DG  C C5    1 
ATOM   2100 C C6    . DG  B 2 26  ? 37.096  -8.756  73.399 1.00 52.11  ? 26  DG  C C6    1 
ATOM   2101 O O6    . DG  B 2 26  ? 37.333  -7.565  73.667 1.00 52.25  ? 26  DG  C O6    1 
ATOM   2102 N N1    . DG  B 2 26  ? 38.100  -9.557  72.860 1.00 51.75  ? 26  DG  C N1    1 
ATOM   2103 C C2    . DG  B 2 26  ? 37.973  -10.897 72.581 1.00 52.22  ? 26  DG  C C2    1 
ATOM   2104 N N2    . DG  B 2 26  ? 39.053  -11.492 72.063 1.00 52.94  ? 26  DG  C N2    1 
ATOM   2105 N N3    . DG  B 2 26  ? 36.844  -11.596 72.757 1.00 52.12  ? 26  DG  C N3    1 
ATOM   2106 C C4    . DG  B 2 26  ? 35.847  -10.827 73.286 1.00 52.77  ? 26  DG  C C4    1 
ATOM   2107 P P     . DC  B 2 27  ? 32.585  -16.496 74.689 1.00 64.37  ? 27  DC  C P     1 
ATOM   2108 O OP1   . DC  B 2 27  ? 32.175  -17.717 73.931 1.00 64.29  ? 27  DC  C OP1   1 
ATOM   2109 O OP2   . DC  B 2 27  ? 31.825  -16.096 75.893 1.00 66.36  ? 27  DC  C OP2   1 
ATOM   2110 O "O5'" . DC  B 2 27  ? 34.131  -16.615 75.083 1.00 65.27  ? 27  DC  C "O5'" 1 
ATOM   2111 C "C5'" . DC  B 2 27  ? 35.137  -16.341 74.091 1.00 63.04  ? 27  DC  C "C5'" 1 
ATOM   2112 C "C4'" . DC  B 2 27  ? 36.525  -16.064 74.674 1.00 64.06  ? 27  DC  C "C4'" 1 
ATOM   2113 O "O4'" . DC  B 2 27  ? 36.795  -14.651 74.634 1.00 60.62  ? 27  DC  C "O4'" 1 
ATOM   2114 C "C3'" . DC  B 2 27  ? 36.803  -16.528 76.100 1.00 68.78  ? 27  DC  C "C3'" 1 
ATOM   2115 O "O3'" . DC  B 2 27  ? 38.030  -17.276 76.124 1.00 73.43  ? 27  DC  C "O3'" 1 
ATOM   2116 C "C2'" . DC  B 2 27  ? 36.977  -15.213 76.871 1.00 66.26  ? 27  DC  C "C2'" 1 
ATOM   2117 C "C1'" . DC  B 2 27  ? 37.503  -14.294 75.779 1.00 61.59  ? 27  DC  C "C1'" 1 
ATOM   2118 N N1    . DC  B 2 27  ? 37.299  -12.816 76.052 1.00 58.48  ? 27  DC  C N1    1 
ATOM   2119 C C2    . DC  B 2 27  ? 38.400  -11.922 75.965 1.00 59.08  ? 27  DC  C C2    1 
ATOM   2120 O O2    . DC  B 2 27  ? 39.499  -12.337 75.567 1.00 61.11  ? 27  DC  C O2    1 
ATOM   2121 N N3    . DC  B 2 27  ? 38.213  -10.614 76.294 1.00 57.75  ? 27  DC  C N3    1 
ATOM   2122 C C4    . DC  B 2 27  ? 37.023  -10.198 76.744 1.00 57.44  ? 27  DC  C C4    1 
ATOM   2123 N N4    . DC  B 2 27  ? 36.882  -8.904  77.027 1.00 57.58  ? 27  DC  C N4    1 
ATOM   2124 C C5    . DC  B 2 27  ? 35.909  -11.092 76.876 1.00 57.72  ? 27  DC  C C5    1 
ATOM   2125 C C6    . DC  B 2 27  ? 36.093  -12.376 76.535 1.00 57.37  ? 27  DC  C C6    1 
ATOM   2126 P P     . DT  B 2 28  ? 38.227  -18.526 77.100 1.00 77.84  ? 28  DT  C P     1 
ATOM   2127 O OP1   . DT  B 2 28  ? 38.566  -19.701 76.253 1.00 80.17  ? 28  DT  C OP1   1 
ATOM   2128 O OP2   . DT  B 2 28  ? 37.070  -18.599 78.029 1.00 80.20  ? 28  DT  C OP2   1 
ATOM   2129 O "O5'" . DT  B 2 28  ? 39.536  -18.139 77.976 1.00 75.96  ? 28  DT  C "O5'" 1 
ATOM   2130 C "C5'" . DT  B 2 28  ? 39.782  -16.831 78.326 1.00 74.32  ? 28  DT  C "C5'" 1 
ATOM   2131 C "C4'" . DT  B 2 28  ? 41.254  -16.450 78.148 1.00 77.20  ? 28  DT  C "C4'" 1 
ATOM   2132 O "O4'" . DT  B 2 28  ? 41.307  -15.174 77.445 1.00 73.94  ? 28  DT  C "O4'" 1 
ATOM   2133 C "C3'" . DT  B 2 28  ? 42.024  -16.232 79.466 1.00 81.38  ? 28  DT  C "C3'" 1 
ATOM   2134 O "O3'" . DT  B 2 28  ? 42.903  -17.306 79.730 1.00 86.41  ? 28  DT  C "O3'" 1 
ATOM   2135 C "C2'" . DT  B 2 28  ? 42.819  -14.950 79.235 1.00 80.82  ? 28  DT  C "C2'" 1 
ATOM   2136 C "C1'" . DT  B 2 28  ? 41.958  -14.204 78.242 1.00 76.02  ? 28  DT  C "C1'" 1 
ATOM   2137 N N1    . DT  B 2 28  ? 40.937  -13.228 78.845 1.00 73.79  ? 28  DT  C N1    1 
ATOM   2138 C C2    . DT  B 2 28  ? 41.282  -11.894 78.951 1.00 72.46  ? 28  DT  C C2    1 
ATOM   2139 O O2    . DT  B 2 28  ? 42.403  -11.464 78.716 1.00 73.98  ? 28  DT  C O2    1 
ATOM   2140 N N3    . DT  B 2 28  ? 40.260  -11.071 79.351 1.00 70.37  ? 28  DT  C N3    1 
ATOM   2141 C C4    . DT  B 2 28  ? 38.967  -11.422 79.688 1.00 69.29  ? 28  DT  C C4    1 
ATOM   2142 O O4    . DT  B 2 28  ? 38.165  -10.546 79.990 1.00 68.16  ? 28  DT  C O4    1 
ATOM   2143 C C5    . DT  B 2 28  ? 38.664  -12.830 79.593 1.00 70.88  ? 28  DT  C C5    1 
ATOM   2144 C C7    . DT  B 2 28  ? 37.286  -13.327 79.921 1.00 71.30  ? 28  DT  C C7    1 
ATOM   2145 C C6    . DT  B 2 28  ? 39.641  -13.659 79.167 1.00 72.35  ? 28  DT  C C6    1 
ATOM   2146 O "O5'" . DA  C 3 1   ? 42.666  -1.655  82.550 1.00 106.88 ? 1   DA  D "O5'" 1 
ATOM   2147 C "C5'" . DA  C 3 1   ? 43.383  -1.187  81.412 1.00 105.27 ? 1   DA  D "C5'" 1 
ATOM   2148 C "C4'" . DA  C 3 1   ? 44.280  -2.282  80.850 1.00 102.48 ? 1   DA  D "C4'" 1 
ATOM   2149 O "O4'" . DA  C 3 1   ? 43.577  -3.553  80.848 1.00 97.83  ? 1   DA  D "O4'" 1 
ATOM   2150 C "C3'" . DA  C 3 1   ? 44.766  -2.067  79.416 1.00 99.83  ? 1   DA  D "C3'" 1 
ATOM   2151 O "O3'" . DA  C 3 1   ? 46.136  -2.529  79.305 1.00 103.13 ? 1   DA  D "O3'" 1 
ATOM   2152 C "C2'" . DA  C 3 1   ? 43.787  -2.916  78.582 1.00 92.56  ? 1   DA  D "C2'" 1 
ATOM   2153 C "C1'" . DA  C 3 1   ? 43.501  -4.078  79.530 1.00 91.35  ? 1   DA  D "C1'" 1 
ATOM   2154 N N9    . DA  C 3 1   ? 42.186  -4.708  79.371 1.00 84.64  ? 1   DA  D N9    1 
ATOM   2155 C C8    . DA  C 3 1   ? 40.957  -4.094  79.401 1.00 82.99  ? 1   DA  D C8    1 
ATOM   2156 N N7    . DA  C 3 1   ? 39.939  -4.928  79.333 1.00 79.36  ? 1   DA  D N7    1 
ATOM   2157 C C5    . DA  C 3 1   ? 40.535  -6.172  79.340 1.00 76.82  ? 1   DA  D C5    1 
ATOM   2158 C C6    . DA  C 3 1   ? 40.011  -7.474  79.370 1.00 72.32  ? 1   DA  D C6    1 
ATOM   2159 N N6    . DA  C 3 1   ? 38.707  -7.745  79.394 1.00 69.86  ? 1   DA  D N6    1 
ATOM   2160 N N1    . DA  C 3 1   ? 40.885  -8.497  79.354 1.00 72.12  ? 1   DA  D N1    1 
ATOM   2161 C C2    . DA  C 3 1   ? 42.197  -8.243  79.361 1.00 75.62  ? 1   DA  D C2    1 
ATOM   2162 N N3    . DA  C 3 1   ? 42.815  -7.067  79.384 1.00 79.72  ? 1   DA  D N3    1 
ATOM   2163 C C4    . DA  C 3 1   ? 41.920  -6.057  79.390 1.00 80.49  ? 1   DA  D C4    1 
ATOM   2164 P P     . DG  C 3 2   ? 47.017  -2.254  77.985 1.00 103.63 ? 2   DG  D P     1 
ATOM   2165 O OP1   . DG  C 3 2   ? 48.441  -2.188  78.402 1.00 109.27 ? 2   DG  D OP1   1 
ATOM   2166 O OP2   . DG  C 3 2   ? 46.415  -1.122  77.228 1.00 103.42 ? 2   DG  D OP2   1 
ATOM   2167 O "O5'" . DG  C 3 2   ? 46.772  -3.591  77.112 1.00 97.06  ? 2   DG  D "O5'" 1 
ATOM   2168 C "C5'" . DG  C 3 2   ? 47.417  -4.818  77.467 1.00 96.53  ? 2   DG  D "C5'" 1 
ATOM   2169 C "C4'" . DG  C 3 2   ? 47.007  -5.947  76.534 1.00 90.73  ? 2   DG  D "C4'" 1 
ATOM   2170 O "O4'" . DG  C 3 2   ? 45.620  -6.301  76.766 1.00 85.93  ? 2   DG  D "O4'" 1 
ATOM   2171 C "C3'" . DG  C 3 2   ? 47.129  -5.658  75.026 1.00 88.28  ? 2   DG  D "C3'" 1 
ATOM   2172 O "O3'" . DG  C 3 2   ? 47.862  -6.722  74.408 1.00 89.57  ? 2   DG  D "O3'" 1 
ATOM   2173 C "C2'" . DG  C 3 2   ? 45.666  -5.618  74.549 1.00 81.87  ? 2   DG  D "C2'" 1 
ATOM   2174 C "C1'" . DG  C 3 2   ? 45.016  -6.575  75.527 1.00 80.21  ? 2   DG  D "C1'" 1 
ATOM   2175 N N9    . DG  C 3 2   ? 43.563  -6.443  75.665 1.00 74.87  ? 2   DG  D N9    1 
ATOM   2176 C C8    . DG  C 3 2   ? 42.839  -5.285  75.868 1.00 74.66  ? 2   DG  D C8    1 
ATOM   2177 N N7    . DG  C 3 2   ? 41.556  -5.490  76.005 1.00 71.94  ? 2   DG  D N7    1 
ATOM   2178 C C5    . DG  C 3 2   ? 41.420  -6.877  75.934 1.00 68.60  ? 2   DG  D C5    1 
ATOM   2179 C C6    . DG  C 3 2   ? 40.258  -7.698  76.021 1.00 64.57  ? 2   DG  D C6    1 
ATOM   2180 O O6    . DG  C 3 2   ? 39.099  -7.357  76.264 1.00 63.69  ? 2   DG  D O6    1 
ATOM   2181 N N1    . DG  C 3 2   ? 40.556  -9.050  75.850 1.00 62.61  ? 2   DG  D N1    1 
ATOM   2182 C C2    . DG  C 3 2   ? 41.830  -9.563  75.692 1.00 64.30  ? 2   DG  D C2    1 
ATOM   2183 N N2    . DG  C 3 2   ? 41.922  -10.895 75.538 1.00 63.04  ? 2   DG  D N2    1 
ATOM   2184 N N3    . DG  C 3 2   ? 42.934  -8.812  75.644 1.00 67.14  ? 2   DG  D N3    1 
ATOM   2185 C C4    . DG  C 3 2   ? 42.651  -7.479  75.748 1.00 70.02  ? 2   DG  D C4    1 
ATOM   2186 P P     . DC  C 3 3   ? 48.516  -6.583  72.947 1.00 90.56  ? 3   DC  D P     1 
ATOM   2187 O OP1   . DC  C 3 3   ? 49.949  -6.941  73.056 1.00 94.32  ? 3   DC  D OP1   1 
ATOM   2188 O OP2   . DC  C 3 3   ? 48.111  -5.279  72.342 1.00 89.80  ? 3   DC  D OP2   1 
ATOM   2189 O "O5'" . DC  C 3 3   ? 47.757  -7.729  72.124 1.00 86.51  ? 3   DC  D "O5'" 1 
ATOM   2190 C "C5'" . DC  C 3 3   ? 47.594  -9.035  72.709 1.00 86.01  ? 3   DC  D "C5'" 1 
ATOM   2191 C "C4'" . DC  C 3 3   ? 46.395  -9.757  72.120 1.00 80.07  ? 3   DC  D "C4'" 1 
ATOM   2192 O "O4'" . DC  C 3 3   ? 45.174  -9.223  72.673 1.00 76.48  ? 3   DC  D "O4'" 1 
ATOM   2193 C "C3'" . DC  C 3 3   ? 46.253  -9.658  70.599 1.00 77.87  ? 3   DC  D "C3'" 1 
ATOM   2194 O "O3'" . DC  C 3 3   ? 46.492  -10.939 70.025 1.00 79.27  ? 3   DC  D "O3'" 1 
ATOM   2195 C "C2'" . DC  C 3 3   ? 44.801  -9.175  70.375 1.00 72.23  ? 3   DC  D "C2'" 1 
ATOM   2196 C "C1'" . DC  C 3 3   ? 44.156  -9.420  71.738 1.00 71.53  ? 3   DC  D "C1'" 1 
ATOM   2197 N N1    . DC  C 3 3   ? 42.971  -8.512  72.064 1.00 67.02  ? 3   DC  D N1    1 
ATOM   2198 C C2    . DC  C 3 3   ? 41.685  -9.080  72.223 1.00 62.36  ? 3   DC  D C2    1 
ATOM   2199 O O2    . DC  C 3 3   ? 41.547  -10.305 72.115 1.00 61.86  ? 3   DC  D O2    1 
ATOM   2200 N N3    . DC  C 3 3   ? 40.635  -8.267  72.518 1.00 59.20  ? 3   DC  D N3    1 
ATOM   2201 C C4    . DC  C 3 3   ? 40.817  -6.944  72.636 1.00 60.65  ? 3   DC  D C4    1 
ATOM   2202 N N4    . DC  C 3 3   ? 39.761  -6.198  72.977 1.00 59.73  ? 3   DC  D N4    1 
ATOM   2203 C C5    . DC  C 3 3   ? 42.113  -6.341  72.488 1.00 64.40  ? 3   DC  D C5    1 
ATOM   2204 C C6    . DC  C 3 3   ? 43.150  -7.152  72.205 1.00 66.93  ? 3   DC  D C6    1 
ATOM   2205 P P     . DT  C 3 4   ? 46.744  -11.120 68.442 1.00 80.03  ? 4   DT  D P     1 
ATOM   2206 O OP1   . DT  C 3 4   ? 47.811  -12.140 68.290 1.00 83.74  ? 4   DT  D OP1   1 
ATOM   2207 O OP2   . DT  C 3 4   ? 46.894  -9.786  67.800 1.00 80.07  ? 4   DT  D OP2   1 
ATOM   2208 O "O5'" . DT  C 3 4   ? 45.361  -11.732 67.920 1.00 74.20  ? 4   DT  D "O5'" 1 
ATOM   2209 C "C5'" . DT  C 3 4   ? 44.578  -12.598 68.756 1.00 72.69  ? 4   DT  D "C5'" 1 
ATOM   2210 C "C4'" . DT  C 3 4   ? 43.154  -12.675 68.247 1.00 67.75  ? 4   DT  D "C4'" 1 
ATOM   2211 O "O4'" . DT  C 3 4   ? 42.344  -11.667 68.909 1.00 64.87  ? 4   DT  D "O4'" 1 
ATOM   2212 C "C3'" . DT  C 3 4   ? 43.012  -12.418 66.744 1.00 66.71  ? 4   DT  D "C3'" 1 
ATOM   2213 O "O3'" . DT  C 3 4   ? 42.341  -13.488 66.129 1.00 68.12  ? 4   DT  D "O3'" 1 
ATOM   2214 C "C2'" . DT  C 3 4   ? 42.216  -11.114 66.661 1.00 62.99  ? 4   DT  D "C2'" 1 
ATOM   2215 C "C1'" . DT  C 3 4   ? 41.446  -11.133 67.971 1.00 61.32  ? 4   DT  D "C1'" 1 
ATOM   2216 N N1    . DT  C 3 4   ? 40.995  -9.768  68.431 1.00 58.67  ? 4   DT  D N1    1 
ATOM   2217 C C2    . DT  C 3 4   ? 39.683  -9.587  68.837 1.00 55.27  ? 4   DT  D C2    1 
ATOM   2218 O O2    . DT  C 3 4   ? 38.859  -10.488 68.876 1.00 53.45  ? 4   DT  D O2    1 
ATOM   2219 N N3    . DT  C 3 4   ? 39.376  -8.307  69.223 1.00 54.43  ? 4   DT  D N3    1 
ATOM   2220 C C4    . DT  C 3 4   ? 40.202  -7.199  69.182 1.00 56.47  ? 4   DT  D C4    1 
ATOM   2221 O O4    . DT  C 3 4   ? 39.774  -6.123  69.555 1.00 57.12  ? 4   DT  D O4    1 
ATOM   2222 C C5    . DT  C 3 4   ? 41.558  -7.449  68.735 1.00 59.04  ? 4   DT  D C5    1 
ATOM   2223 C C7    . DT  C 3 4   ? 42.569  -6.336  68.700 1.00 61.59  ? 4   DT  D C7    1 
ATOM   2224 C C6    . DT  C 3 4   ? 41.880  -8.705  68.376 1.00 59.15  ? 4   DT  D C6    1 
ATOM   2225 P P     . DG  C 3 5   ? 42.534  -13.806 64.559 1.00 69.61  ? 5   DG  D P     1 
ATOM   2226 O OP1   . DG  C 3 5   ? 43.256  -15.100 64.480 1.00 72.52  ? 5   DG  D OP1   1 
ATOM   2227 O OP2   . DG  C 3 5   ? 43.058  -12.598 63.860 1.00 68.68  ? 5   DG  D OP2   1 
ATOM   2228 O "O5'" . DG  C 3 5   ? 41.029  -14.013 64.055 1.00 63.86  ? 5   DG  D "O5'" 1 
ATOM   2229 C "C5'" . DG  C 3 5   ? 40.122  -14.762 64.855 1.00 60.88  ? 5   DG  D "C5'" 1 
ATOM   2230 C "C4'" . DG  C 3 5   ? 38.715  -14.231 64.723 1.00 54.93  ? 5   DG  D "C4'" 1 
ATOM   2231 O "O4'" . DG  C 3 5   ? 38.565  -13.049 65.541 1.00 53.80  ? 5   DG  D "O4'" 1 
ATOM   2232 C "C3'" . DG  C 3 5   ? 38.304  -13.853 63.313 1.00 50.93  ? 5   DG  D "C3'" 1 
ATOM   2233 O "O3'" . DG  C 3 5   ? 37.192  -14.598 62.942 1.00 47.41  ? 5   DG  D "O3'" 1 
ATOM   2234 C "C2'" . DG  C 3 5   ? 37.984  -12.369 63.384 1.00 50.61  ? 5   DG  D "C2'" 1 
ATOM   2235 C "C1'" . DG  C 3 5   ? 37.798  -12.096 64.861 1.00 51.33  ? 5   DG  D "C1'" 1 
ATOM   2236 N N9    . DG  C 3 5   ? 38.285  -10.759 65.229 1.00 50.41  ? 5   DG  D N9    1 
ATOM   2237 C C8    . DG  C 3 5   ? 39.540  -10.246 64.976 1.00 51.20  ? 5   DG  D C8    1 
ATOM   2238 N N7    . DG  C 3 5   ? 39.676  -8.997  65.313 1.00 50.31  ? 5   DG  D N7    1 
ATOM   2239 C C5    . DG  C 3 5   ? 38.416  -8.627  65.751 1.00 47.89  ? 5   DG  D C5    1 
ATOM   2240 C C6    . DG  C 3 5   ? 37.964  -7.392  66.266 1.00 46.41  ? 5   DG  D C6    1 
ATOM   2241 O O6    . DG  C 3 5   ? 38.624  -6.353  66.439 1.00 48.86  ? 5   DG  D O6    1 
ATOM   2242 N N1    . DG  C 3 5   ? 36.610  -7.433  66.607 1.00 43.33  ? 5   DG  D N1    1 
ATOM   2243 C C2    . DG  C 3 5   ? 35.793  -8.541  66.476 1.00 42.18  ? 5   DG  D C2    1 
ATOM   2244 N N2    . DG  C 3 5   ? 34.523  -8.398  66.877 1.00 40.10  ? 5   DG  D N2    1 
ATOM   2245 N N3    . DG  C 3 5   ? 36.212  -9.723  66.026 1.00 44.09  ? 5   DG  D N3    1 
ATOM   2246 C C4    . DG  C 3 5   ? 37.530  -9.690  65.666 1.00 47.48  ? 5   DG  D C4    1 
ATOM   2247 P P     . DT  C 3 6   ? 36.514  -14.458 61.513 1.00 43.77  ? 6   DT  D P     1 
ATOM   2248 O OP1   . DT  C 3 6   ? 36.113  -15.812 61.078 1.00 43.77  ? 6   DT  D OP1   1 
ATOM   2249 O OP2   . DT  C 3 6   ? 37.361  -13.629 60.625 1.00 44.75  ? 6   DT  D OP2   1 
ATOM   2250 O "O5'" . DT  C 3 6   ? 35.215  -13.622 61.857 1.00 38.68  ? 6   DT  D "O5'" 1 
ATOM   2251 C "C5'" . DT  C 3 6   ? 34.280  -14.114 62.809 1.00 38.46  ? 6   DT  D "C5'" 1 
ATOM   2252 C "C4'" . DT  C 3 6   ? 33.108  -13.165 62.969 1.00 37.62  ? 6   DT  D "C4'" 1 
ATOM   2253 O "O4'" . DT  C 3 6   ? 33.579  -11.919 63.525 1.00 37.25  ? 6   DT  D "O4'" 1 
ATOM   2254 C "C3'" . DT  C 3 6   ? 32.346  -12.809 61.675 1.00 35.69  ? 6   DT  D "C3'" 1 
ATOM   2255 O "O3'" . DT  C 3 6   ? 30.944  -12.833 61.936 1.00 36.03  ? 6   DT  D "O3'" 1 
ATOM   2256 C "C2'" . DT  C 3 6   ? 32.830  -11.399 61.349 1.00 36.19  ? 6   DT  D "C2'" 1 
ATOM   2257 C "C1'" . DT  C 3 6   ? 33.131  -10.835 62.742 1.00 37.26  ? 6   DT  D "C1'" 1 
ATOM   2258 N N1    . DT  C 3 6   ? 34.208  -9.802  62.754 1.00 38.50  ? 6   DT  D N1    1 
ATOM   2259 C C2    . DT  C 3 6   ? 33.944  -8.537  63.273 1.00 38.48  ? 6   DT  D C2    1 
ATOM   2260 O O2    . DT  C 3 6   ? 32.851  -8.208  63.731 1.00 37.63  ? 6   DT  D O2    1 
ATOM   2261 N N3    . DT  C 3 6   ? 35.043  -7.690  63.293 1.00 39.07  ? 6   DT  D N3    1 
ATOM   2262 C C4    . DT  C 3 6   ? 36.315  -7.953  62.778 1.00 40.40  ? 6   DT  D C4    1 
ATOM   2263 O O4    . DT  C 3 6   ? 37.206  -7.133  62.918 1.00 42.05  ? 6   DT  D O4    1 
ATOM   2264 C C5    . DT  C 3 6   ? 36.500  -9.277  62.213 1.00 41.55  ? 6   DT  D C5    1 
ATOM   2265 C C7    . DT  C 3 6   ? 37.833  -9.676  61.645 1.00 43.90  ? 6   DT  D C7    1 
ATOM   2266 C C6    . DT  C 3 6   ? 35.457  -10.123 62.228 1.00 39.84  ? 6   DT  D C6    1 
ATOM   2267 P P     . DC  C 3 7   ? 29.835  -12.848 60.760 1.00 37.56  ? 7   DC  D P     1 
ATOM   2268 O OP1   . DC  C 3 7   ? 28.679  -13.645 61.245 1.00 36.30  ? 7   DC  D OP1   1 
ATOM   2269 O OP2   . DC  C 3 7   ? 30.498  -13.155 59.473 1.00 38.48  ? 7   DC  D OP2   1 
ATOM   2270 O "O5'" . DC  C 3 7   ? 29.400  -11.309 60.749 1.00 37.62  ? 7   DC  D "O5'" 1 
ATOM   2271 C "C5'" . DC  C 3 7   ? 29.016  -10.733 61.991 1.00 41.08  ? 7   DC  D "C5'" 1 
ATOM   2272 C "C4'" . DC  C 3 7   ? 28.846  -9.241  61.894 1.00 42.06  ? 7   DC  D "C4'" 1 
ATOM   2273 O "O4'" . DC  C 3 7   ? 30.129  -8.599  61.884 1.00 40.63  ? 7   DC  D "O4'" 1 
ATOM   2274 C "C3'" . DC  C 3 7   ? 28.083  -8.741  60.672 1.00 42.51  ? 7   DC  D "C3'" 1 
ATOM   2275 O "O3'" . DC  C 3 7   ? 27.049  -7.907  61.123 1.00 46.23  ? 7   DC  D "O3'" 1 
ATOM   2276 C "C2'" . DC  C 3 7   ? 29.146  -7.987  59.855 1.00 39.86  ? 7   DC  D "C2'" 1 
ATOM   2277 C "C1'" . DC  C 3 7   ? 30.123  -7.559  60.941 1.00 39.51  ? 7   DC  D "C1'" 1 
ATOM   2278 N N1    . DC  C 3 7   ? 31.543  -7.346  60.502 1.00 37.41  ? 7   DC  D N1    1 
ATOM   2279 C C2    . DC  C 3 7   ? 32.241  -6.204  60.954 1.00 36.91  ? 7   DC  D C2    1 
ATOM   2280 O O2    . DC  C 3 7   ? 31.650  -5.342  61.620 1.00 40.24  ? 7   DC  D O2    1 
ATOM   2281 N N3    . DC  C 3 7   ? 33.541  -6.062  60.631 1.00 36.08  ? 7   DC  D N3    1 
ATOM   2282 C C4    . DC  C 3 7   ? 34.175  -7.000  59.946 1.00 36.04  ? 7   DC  D C4    1 
ATOM   2283 N N4    . DC  C 3 7   ? 35.474  -6.808  59.710 1.00 37.67  ? 7   DC  D N4    1 
ATOM   2284 C C5    . DC  C 3 7   ? 33.512  -8.186  59.493 1.00 36.15  ? 7   DC  D C5    1 
ATOM   2285 C C6    . DC  C 3 7   ? 32.203  -8.321  59.796 1.00 35.76  ? 7   DC  D C6    1 
ATOM   2286 P P     . DC  C 3 8   ? 25.786  -7.546  60.202 1.00 49.35  ? 8   DC  D P     1 
ATOM   2287 O OP1   . DC  C 3 8   ? 24.591  -7.499  61.092 1.00 52.05  ? 8   DC  D OP1   1 
ATOM   2288 O OP2   . DC  C 3 8   ? 25.786  -8.397  58.984 1.00 47.74  ? 8   DC  D OP2   1 
ATOM   2289 O "O5'" . DC  C 3 8   ? 26.114  -6.058  59.719 1.00 48.46  ? 8   DC  D "O5'" 1 
ATOM   2290 C "C5'" . DC  C 3 8   ? 26.432  -5.050  60.668 1.00 49.21  ? 8   DC  D "C5'" 1 
ATOM   2291 C "C4'" . DC  C 3 8   ? 27.118  -3.904  59.980 1.00 49.28  ? 8   DC  D "C4'" 1 
ATOM   2292 O "O4'" . DC  C 3 8   ? 28.506  -4.236  59.716 1.00 47.01  ? 8   DC  D "O4'" 1 
ATOM   2293 C "C3'" . DC  C 3 8   ? 26.511  -3.506  58.638 1.00 50.26  ? 8   DC  D "C3'" 1 
ATOM   2294 O "O3'" . DC  C 3 8   ? 26.453  -2.140  58.606 1.00 53.75  ? 8   DC  D "O3'" 1 
ATOM   2295 C "C2'" . DC  C 3 8   ? 27.548  -4.024  57.626 1.00 47.24  ? 8   DC  D "C2'" 1 
ATOM   2296 C "C1'" . DC  C 3 8   ? 28.828  -3.818  58.425 1.00 44.83  ? 8   DC  D "C1'" 1 
ATOM   2297 N N1    . DC  C 3 8   ? 30.043  -4.586  57.932 1.00 40.59  ? 8   DC  D N1    1 
ATOM   2298 C C2    . DC  C 3 8   ? 31.314  -3.993  58.044 1.00 38.26  ? 8   DC  D C2    1 
ATOM   2299 O O2    . DC  C 3 8   ? 31.407  -2.868  58.516 1.00 37.73  ? 8   DC  D O2    1 
ATOM   2300 N N3    . DC  C 3 8   ? 32.398  -4.650  57.560 1.00 37.82  ? 8   DC  D N3    1 
ATOM   2301 C C4    . DC  C 3 8   ? 32.264  -5.857  57.024 1.00 38.23  ? 8   DC  D C4    1 
ATOM   2302 N N4    . DC  C 3 8   ? 33.374  -6.477  56.608 1.00 39.42  ? 8   DC  D N4    1 
ATOM   2303 C C5    . DC  C 3 8   ? 30.981  -6.509  56.922 1.00 39.06  ? 8   DC  D C5    1 
ATOM   2304 C C6    . DC  C 3 8   ? 29.903  -5.811  57.332 1.00 39.60  ? 8   DC  D C6    1 
ATOM   2305 P P     . DA  C 3 9   ? 25.104  -1.325  58.335 1.00 56.62  ? 9   DA  D P     1 
ATOM   2306 O OP1   . DA  C 3 9   ? 24.312  -1.290  59.586 1.00 60.04  ? 9   DA  D OP1   1 
ATOM   2307 O OP2   . DA  C 3 9   ? 24.500  -1.820  57.072 1.00 56.02  ? 9   DA  D OP2   1 
ATOM   2308 O "O5'" . DA  C 3 9   ? 25.728  0.115   58.087 1.00 54.26  ? 9   DA  D "O5'" 1 
ATOM   2309 C "C5'" . DA  C 3 9   ? 26.580  0.669   59.112 1.00 52.54  ? 9   DA  D "C5'" 1 
ATOM   2310 C "C4'" . DA  C 3 9   ? 27.702  1.514   58.533 1.00 50.18  ? 9   DA  D "C4'" 1 
ATOM   2311 O "O4'" . DA  C 3 9   ? 28.789  0.682   58.074 1.00 46.37  ? 9   DA  D "O4'" 1 
ATOM   2312 C "C3'" . DA  C 3 9   ? 27.323  2.425   57.374 1.00 49.32  ? 9   DA  D "C3'" 1 
ATOM   2313 O "O3'" . DA  C 3 9   ? 27.796  3.722   57.673 1.00 52.16  ? 9   DA  D "O3'" 1 
ATOM   2314 C "C2'" . DA  C 3 9   ? 28.029  1.799   56.154 1.00 45.51  ? 9   DA  D "C2'" 1 
ATOM   2315 C "C1'" . DA  C 3 9   ? 29.214  1.084   56.786 1.00 43.79  ? 9   DA  D "C1'" 1 
ATOM   2316 N N9    . DA  C 3 9   ? 29.638  -0.136  56.084 1.00 39.92  ? 9   DA  D N9    1 
ATOM   2317 C C8    . DA  C 3 9   ? 28.849  -1.203  55.753 1.00 38.67  ? 9   DA  D C8    1 
ATOM   2318 N N7    . DA  C 3 9   ? 29.503  -2.201  55.219 1.00 36.69  ? 9   DA  D N7    1 
ATOM   2319 C C5    . DA  C 3 9   ? 30.831  -1.816  55.287 1.00 35.75  ? 9   DA  D C5    1 
ATOM   2320 C C6    . DA  C 3 9   ? 32.033  -2.440  54.870 1.00 33.45  ? 9   DA  D C6    1 
ATOM   2321 N N6    . DA  C 3 9   ? 32.102  -3.708  54.451 1.00 33.01  ? 9   DA  D N6    1 
ATOM   2322 N N1    . DA  C 3 9   ? 33.183  -1.762  55.056 1.00 33.84  ? 9   DA  D N1    1 
ATOM   2323 C C2    . DA  C 3 9   ? 33.144  -0.528  55.570 1.00 35.29  ? 9   DA  D C2    1 
ATOM   2324 N N3    . DA  C 3 9   ? 32.085  0.168   55.992 1.00 38.38  ? 9   DA  D N3    1 
ATOM   2325 C C4    . DA  C 3 9   ? 30.941  -0.544  55.820 1.00 37.73  ? 9   DA  D C4    1 
ATOM   2326 P P     . DT  C 3 10  ? 27.444  4.983   56.754 1.00 54.73  ? 10  DT  D P     1 
ATOM   2327 O OP1   . DT  C 3 10  ? 27.535  6.179   57.609 1.00 58.93  ? 10  DT  D OP1   1 
ATOM   2328 O OP2   . DT  C 3 10  ? 26.204  4.707   55.979 1.00 55.20  ? 10  DT  D OP2   1 
ATOM   2329 O "O5'" . DT  C 3 10  ? 28.661  4.990   55.713 1.00 51.43  ? 10  DT  D "O5'" 1 
ATOM   2330 C "C5'" . DT  C 3 10  ? 29.985  5.053   56.204 1.00 50.14  ? 10  DT  D "C5'" 1 
ATOM   2331 C "C4'" . DT  C 3 10  ? 30.982  4.781   55.115 1.00 47.44  ? 10  DT  D "C4'" 1 
ATOM   2332 O "O4'" . DT  C 3 10  ? 31.048  3.368   54.839 1.00 43.66  ? 10  DT  D "O4'" 1 
ATOM   2333 C "C3'" . DT  C 3 10  ? 30.720  5.467   53.776 1.00 48.54  ? 10  DT  D "C3'" 1 
ATOM   2334 O "O3'" . DT  C 3 10  ? 31.672  6.568   53.647 1.00 52.98  ? 10  DT  D "O3'" 1 
ATOM   2335 C "C2'" . DT  C 3 10  ? 30.934  4.355   52.742 1.00 44.15  ? 10  DT  D "C2'" 1 
ATOM   2336 C "C1'" . DT  C 3 10  ? 31.577  3.237   53.555 1.00 42.40  ? 10  DT  D "C1'" 1 
ATOM   2337 N N1    . DT  C 3 10  ? 31.273  1.865   53.044 1.00 39.17  ? 10  DT  D N1    1 
ATOM   2338 C C2    . DT  C 3 10  ? 32.318  1.041   52.677 1.00 36.36  ? 10  DT  D C2    1 
ATOM   2339 O O2    . DT  C 3 10  ? 33.495  1.366   52.761 1.00 36.30  ? 10  DT  D O2    1 
ATOM   2340 N N3    . DT  C 3 10  ? 31.935  -0.219  52.284 1.00 33.58  ? 10  DT  D N3    1 
ATOM   2341 C C4    . DT  C 3 10  ? 30.633  -0.692  52.109 1.00 33.79  ? 10  DT  D C4    1 
ATOM   2342 O O4    . DT  C 3 10  ? 30.455  -1.841  51.712 1.00 32.60  ? 10  DT  D O4    1 
ATOM   2343 C C5    . DT  C 3 10  ? 29.580  0.225   52.505 1.00 36.20  ? 10  DT  D C5    1 
ATOM   2344 C C7    . DT  C 3 10  ? 28.137  -0.188  52.420 1.00 37.18  ? 10  DT  D C7    1 
ATOM   2345 C C6    . DT  C 3 10  ? 29.944  1.439   52.955 1.00 38.72  ? 10  DT  D C6    1 
ATOM   2346 P P     A DC  C 3 11  ? 31.657  7.578   52.383 0.50 55.55  ? 11  DC  D P     1 
ATOM   2347 P P     B DC  C 3 11  ? 31.931  7.392   52.289 0.50 54.42  ? 11  DC  D P     1 
ATOM   2348 O OP1   A DC  C 3 11  ? 32.005  8.928   52.884 0.50 60.04  ? 11  DC  D OP1   1 
ATOM   2349 O OP1   B DC  C 3 11  ? 32.257  8.770   52.703 0.50 58.60  ? 11  DC  D OP1   1 
ATOM   2350 O OP2   A DC  C 3 11  ? 30.405  7.382   51.607 0.50 54.83  ? 11  DC  D OP2   1 
ATOM   2351 O OP2   B DC  C 3 11  ? 30.821  7.156   51.326 0.50 53.02  ? 11  DC  D OP2   1 
ATOM   2352 O "O5'" A DC  C 3 11  ? 32.864  7.050   51.476 0.50 53.52  ? 11  DC  D "O5'" 1 
ATOM   2353 O "O5'" B DC  C 3 11  ? 33.264  6.696   51.707 0.50 52.32  ? 11  DC  D "O5'" 1 
ATOM   2354 C "C5'" A DC  C 3 11  ? 34.084  6.595   52.080 0.50 52.93  ? 11  DC  D "C5'" 1 
ATOM   2355 C "C5'" B DC  C 3 11  ? 34.367  6.403   52.598 0.50 51.96  ? 11  DC  D "C5'" 1 
ATOM   2356 C "C4'" A DC  C 3 11  ? 35.008  5.983   51.039 0.50 51.04  ? 11  DC  D "C4'" 1 
ATOM   2357 C "C4'" B DC  C 3 11  ? 35.447  5.546   51.934 0.50 49.75  ? 11  DC  D "C4'" 1 
ATOM   2358 O "O4'" A DC  C 3 11  ? 34.694  4.574   50.867 0.50 46.64  ? 11  DC  D "O4'" 1 
ATOM   2359 O "O4'" B DC  C 3 11  ? 34.949  4.211   51.646 0.50 45.80  ? 11  DC  D "O4'" 1 
ATOM   2360 C "C3'" A DC  C 3 11  ? 34.934  6.620   49.662 0.50 52.35  ? 11  DC  D "C3'" 1 
ATOM   2361 C "C3'" B DC  C 3 11  ? 36.056  6.085   50.634 0.50 50.39  ? 11  DC  D "C3'" 1 
ATOM   2362 O "O3'" A DC  C 3 11  ? 36.226  6.968   49.214 0.50 55.39  ? 11  DC  D "O3'" 1 
ATOM   2363 O "O3'" B DC  C 3 11  ? 37.488  5.938   50.700 0.50 52.38  ? 11  DC  D "O3'" 1 
ATOM   2364 C "C2'" A DC  C 3 11  ? 34.272  5.559   48.783 0.50 48.11  ? 11  DC  D "C2'" 1 
ATOM   2365 C "C2'" B DC  C 3 11  ? 35.431  5.188   49.550 0.50 46.63  ? 11  DC  D "C2'" 1 
ATOM   2366 C "C1'" A DC  C 3 11  ? 34.592  4.255   49.499 0.50 44.02  ? 11  DC  D "C1'" 1 
ATOM   2367 C "C1'" B DC  C 3 11  ? 35.211  3.875   50.298 0.50 44.04  ? 11  DC  D "C1'" 1 
ATOM   2368 N N1    A DC  C 3 11  ? 33.508  3.206   49.359 0.50 38.71  ? 11  DC  D N1    1 
ATOM   2369 N N1    B DC  C 3 11  ? 34.055  3.040   49.801 0.50 40.73  ? 11  DC  D N1    1 
ATOM   2370 C C2    A DC  C 3 11  ? 33.835  1.864   49.017 0.50 35.34  ? 11  DC  D C2    1 
ATOM   2371 C C2    B DC  C 3 11  ? 34.287  1.733   49.313 0.50 38.09  ? 11  DC  D C2    1 
ATOM   2372 O O2    A DC  C 3 11  ? 35.011  1.551   48.774 0.50 35.48  ? 11  DC  D O2    1 
ATOM   2373 O O2    B DC  C 3 11  ? 35.447  1.331   49.160 0.50 38.34  ? 11  DC  D O2    1 
ATOM   2374 N N3    A DC  C 3 11  ? 32.835  0.944   48.964 0.50 32.21  ? 11  DC  D N3    1 
ATOM   2375 N N3    B DC  C 3 11  ? 33.218  0.961   48.982 0.50 35.59  ? 11  DC  D N3    1 
ATOM   2376 C C4    A DC  C 3 11  ? 31.572  1.295   49.232 0.50 31.72  ? 11  DC  D C4    1 
ATOM   2377 C C4    B DC  C 3 11  ? 31.973  1.409   49.166 0.50 35.86  ? 11  DC  D C4    1 
ATOM   2378 N N4    A DC  C 3 11  ? 30.632  0.353   49.148 0.50 29.35  ? 11  DC  D N4    1 
ATOM   2379 N N4    B DC  C 3 11  ? 30.966  0.599   48.840 0.50 34.67  ? 11  DC  D N4    1 
ATOM   2380 C C5    A DC  C 3 11  ? 31.216  2.636   49.573 0.50 35.26  ? 11  DC  D C5    1 
ATOM   2381 C C5    B DC  C 3 11  ? 31.710  2.716   49.677 0.50 38.75  ? 11  DC  D C5    1 
ATOM   2382 C C6    A DC  C 3 11  ? 32.198  3.553   49.610 0.50 37.82  ? 11  DC  D C6    1 
ATOM   2383 C C6    B DC  C 3 11  ? 32.766  3.487   49.983 0.50 40.84  ? 11  DC  D C6    1 
ATOM   2384 P P     A DG  C 3 12  ? 36.423  7.903   47.923 0.60 58.63  ? 12  DG  D P     1 
ATOM   2385 P P     B DG  C 3 12  ? 38.472  6.713   49.702 0.40 55.52  ? 12  DG  D P     1 
ATOM   2386 O OP1   A DG  C 3 12  ? 37.467  8.900   48.244 0.60 62.12  ? 12  DG  D OP1   1 
ATOM   2387 O OP1   B DG  C 3 12  ? 39.771  6.875   50.402 0.40 58.00  ? 12  DG  D OP1   1 
ATOM   2388 O OP2   A DG  C 3 12  ? 35.095  8.352   47.430 0.60 58.20  ? 12  DG  D OP2   1 
ATOM   2389 O OP2   B DG  C 3 12  ? 37.767  7.906   49.165 0.40 56.76  ? 12  DG  D OP2   1 
ATOM   2390 O "O5'" A DG  C 3 12  ? 36.996  6.866   46.853 0.60 57.74  ? 12  DG  D "O5'" 1 
ATOM   2391 O "O5'" B DG  C 3 12  ? 38.657  5.653   48.511 0.40 54.59  ? 12  DG  D "O5'" 1 
ATOM   2392 C "C5'" A DG  C 3 12  ? 38.139  6.052   47.163 0.60 57.53  ? 12  DG  D "C5'" 1 
ATOM   2393 C "C5'" B DG  C 3 12  ? 38.757  6.099   47.166 0.40 56.52  ? 12  DG  D "C5'" 1 
ATOM   2394 C "C4'" A DG  C 3 12  ? 38.293  4.944   46.134 0.60 55.65  ? 12  DG  D "C4'" 1 
ATOM   2395 C "C4'" B DG  C 3 12  ? 38.484  4.968   46.191 0.40 55.12  ? 12  DG  D "C4'" 1 
ATOM   2396 O "O4'" A DG  C 3 12  ? 37.221  3.974   46.299 0.60 51.90  ? 12  DG  D "O4'" 1 
ATOM   2397 O "O4'" B DG  C 3 12  ? 37.266  4.263   46.561 0.40 52.23  ? 12  DG  D "O4'" 1 
ATOM   2398 C "C3'" A DG  C 3 12  ? 38.232  5.408   44.681 0.60 57.45  ? 12  DG  D "C3'" 1 
ATOM   2399 C "C3'" B DG  C 3 12  ? 38.301  5.412   44.736 0.40 57.16  ? 12  DG  D "C3'" 1 
ATOM   2400 O "O3'" A DG  C 3 12  ? 39.211  4.718   43.899 0.60 60.08  ? 12  DG  D "O3'" 1 
ATOM   2401 O "O3'" B DG  C 3 12  ? 39.217  4.703   43.898 0.40 59.81  ? 12  DG  D "O3'" 1 
ATOM   2402 C "C2'" A DG  C 3 12  ? 36.800  5.069   44.255 0.60 53.60  ? 12  DG  D "C2'" 1 
ATOM   2403 C "C2'" B DG  C 3 12  ? 36.842  5.061   44.419 0.40 53.66  ? 12  DG  D "C2'" 1 
ATOM   2404 C "C1'" A DG  C 3 12  ? 36.522  3.820   45.082 0.60 49.31  ? 12  DG  D "C1'" 1 
ATOM   2405 C "C1'" B DG  C 3 12  ? 36.582  3.915   45.385 0.40 49.95  ? 12  DG  D "C1'" 1 
ATOM   2406 N N9    A DG  C 3 12  ? 35.105  3.575   45.376 0.60 44.73  ? 12  DG  D N9    1 
ATOM   2407 N N9    B DG  C 3 12  ? 35.161  3.692   45.688 0.40 46.35  ? 12  DG  D N9    1 
ATOM   2408 C C8    A DG  C 3 12  ? 34.163  4.478   45.820 0.60 44.68  ? 12  DG  D C8    1 
ATOM   2409 C C8    B DG  C 3 12  ? 34.255  4.610   46.178 0.40 46.75  ? 12  DG  D C8    1 
ATOM   2410 N N7    A DG  C 3 12  ? 32.978  3.954   46.002 0.60 42.18  ? 12  DG  D N7    1 
ATOM   2411 N N7    B DG  C 3 12  ? 33.044  4.136   46.301 0.40 44.83  ? 12  DG  D N7    1 
ATOM   2412 C C5    A DG  C 3 12  ? 33.139  2.626   45.636 0.60 39.10  ? 12  DG  D C5    1 
ATOM   2413 C C5    B DG  C 3 12  ? 33.140  2.827   45.845 0.40 42.18  ? 12  DG  D C5    1 
ATOM   2414 C C6    A DG  C 3 12  ? 32.201  1.553   45.618 0.60 35.52  ? 12  DG  D C6    1 
ATOM   2415 C C6    B DG  C 3 12  ? 32.145  1.809   45.749 0.40 39.53  ? 12  DG  D C6    1 
ATOM   2416 O O6    A DG  C 3 12  ? 31.010  1.572   45.939 0.60 34.43  ? 12  DG  D O6    1 
ATOM   2417 O O6    B DG  C 3 12  ? 30.947  1.878   46.051 0.40 39.01  ? 12  DG  D O6    1 
ATOM   2418 N N1    A DG  C 3 12  ? 32.776  0.371   45.149 0.60 33.69  ? 12  DG  D N1    1 
ATOM   2419 N N1    B DG  C 3 12  ? 32.666  0.614   45.236 0.40 37.95  ? 12  DG  D N1    1 
ATOM   2420 C C2    A DG  C 3 12  ? 34.092  0.234   44.755 0.60 35.29  ? 12  DG  D C2    1 
ATOM   2421 C C2    B DG  C 3 12  ? 33.981  0.432   44.852 0.40 38.96  ? 12  DG  D C2    1 
ATOM   2422 N N2    A DG  C 3 12  ? 34.483  -0.991  44.369 0.60 34.03  ? 12  DG  D N2    1 
ATOM   2423 N N2    B DG  C 3 12  ? 34.308  -0.784  44.390 0.40 38.07  ? 12  DG  D N2    1 
ATOM   2424 N N3    A DG  C 3 12  ? 34.973  1.230   44.759 0.60 38.17  ? 12  DG  D N3    1 
ATOM   2425 N N3    B DG  C 3 12  ? 34.919  1.379   44.932 0.40 41.17  ? 12  DG  D N3    1 
ATOM   2426 C C4    A DG  C 3 12  ? 34.437  2.385   45.225 0.60 40.28  ? 12  DG  D C4    1 
ATOM   2427 C C4    B DG  C 3 12  ? 34.433  2.543   45.445 0.40 42.91  ? 12  DG  D C4    1 
ATOM   2428 P P     . DC  C 3 13  ? 39.611  5.251   42.438 1.00 63.93  ? 13  DC  D P     1 
ATOM   2429 O OP1   . DC  C 3 13  ? 41.035  4.906   42.212 1.00 67.25  ? 13  DC  D OP1   1 
ATOM   2430 O OP2   . DC  C 3 13  ? 39.160  6.665   42.302 1.00 66.92  ? 13  DC  D OP2   1 
ATOM   2431 O "O5'" . DC  C 3 13  ? 38.693  4.364   41.460 1.00 62.14  ? 13  DC  D "O5'" 1 
ATOM   2432 C "C5'" . DC  C 3 13  ? 38.962  2.968   41.324 1.00 60.67  ? 13  DC  D "C5'" 1 
ATOM   2433 C "C4'" . DC  C 3 13  ? 37.704  2.181   41.003 1.00 57.99  ? 13  DC  D "C4'" 1 
ATOM   2434 O "O4'" . DC  C 3 13  ? 36.634  2.544   41.887 1.00 55.35  ? 13  DC  D "O4'" 1 
ATOM   2435 C "C3'" . DC  C 3 13  ? 37.108  2.427   39.636 1.00 58.70  ? 13  DC  D "C3'" 1 
ATOM   2436 O "O3'" . DC  C 3 13  ? 37.788  1.651   38.648 1.00 61.50  ? 13  DC  D "O3'" 1 
ATOM   2437 C "C2'" . DC  C 3 13  ? 35.656  1.966   39.827 1.00 54.88  ? 13  DC  D "C2'" 1 
ATOM   2438 C "C1'" . DC  C 3 13  ? 35.474  1.974   41.334 1.00 51.94  ? 13  DC  D "C1'" 1 
ATOM   2439 N N1    . DC  C 3 13  ? 34.219  2.677   41.819 1.00 48.01  ? 13  DC  D N1    1 
ATOM   2440 C C2    . DC  C 3 13  ? 33.031  1.928   41.936 1.00 44.10  ? 13  DC  D C2    1 
ATOM   2441 O O2    . DC  C 3 13  ? 33.049  0.730   41.632 1.00 42.56  ? 13  DC  D O2    1 
ATOM   2442 N N3    . DC  C 3 13  ? 31.914  2.531   42.429 1.00 43.04  ? 13  DC  D N3    1 
ATOM   2443 C C4    . DC  C 3 13  ? 31.940  3.826   42.768 1.00 44.92  ? 13  DC  D C4    1 
ATOM   2444 N N4    . DC  C 3 13  ? 30.813  4.362   43.246 1.00 46.08  ? 13  DC  D N4    1 
ATOM   2445 C C5    . DC  C 3 13  ? 33.130  4.626   42.627 1.00 47.15  ? 13  DC  D C5    1 
ATOM   2446 C C6    . DC  C 3 13  ? 34.228  4.023   42.122 1.00 48.34  ? 13  DC  D C6    1 
ATOM   2447 P P     . DT  C 3 14  ? 37.422  1.795   37.081 1.00 64.25  ? 14  DT  D P     1 
ATOM   2448 O OP1   . DT  C 3 14  ? 38.583  1.299   36.299 1.00 67.07  ? 14  DT  D OP1   1 
ATOM   2449 O OP2   . DT  C 3 14  ? 36.892  3.167   36.834 1.00 65.52  ? 14  DT  D OP2   1 
ATOM   2450 O "O5'" . DT  C 3 14  ? 36.206  0.769   36.889 1.00 61.14  ? 14  DT  D "O5'" 1 
ATOM   2451 C "C5'" . DT  C 3 14  ? 36.318  -0.602  37.315 1.00 57.67  ? 14  DT  D "C5'" 1 
ATOM   2452 C "C4'" . DT  C 3 14  ? 34.989  -1.316  37.138 1.00 54.12  ? 14  DT  D "C4'" 1 
ATOM   2453 O "O4'" . DT  C 3 14  ? 33.988  -0.723  38.013 1.00 51.15  ? 14  DT  D "O4'" 1 
ATOM   2454 C "C3'" . DT  C 3 14  ? 34.415  -1.257  35.728 1.00 54.58  ? 14  DT  D "C3'" 1 
ATOM   2455 O "O3'" . DT  C 3 14  ? 33.979  -2.537  35.338 1.00 55.23  ? 14  DT  D "O3'" 1 
ATOM   2456 C "C2'" . DT  C 3 14  ? 33.252  -0.258  35.829 1.00 52.78  ? 14  DT  D "C2'" 1 
ATOM   2457 C "C1'" . DT  C 3 14  ? 32.812  -0.431  37.273 1.00 49.45  ? 14  DT  D "C1'" 1 
ATOM   2458 N N1    . DT  C 3 14  ? 32.156  0.787   37.880 1.00 45.57  ? 14  DT  D N1    1 
ATOM   2459 C C2    . DT  C 3 14  ? 30.896  0.671   38.446 1.00 42.64  ? 14  DT  D C2    1 
ATOM   2460 O O2    . DT  C 3 14  ? 30.245  -0.366  38.454 1.00 41.69  ? 14  DT  D O2    1 
ATOM   2461 N N3    . DT  C 3 14  ? 30.433  1.811   39.031 1.00 41.39  ? 14  DT  D N3    1 
ATOM   2462 C C4    . DT  C 3 14  ? 31.057  3.043   39.096 1.00 42.74  ? 14  DT  D C4    1 
ATOM   2463 O O4    . DT  C 3 14  ? 30.466  3.982   39.628 1.00 42.78  ? 14  DT  D O4    1 
ATOM   2464 C C5    . DT  C 3 14  ? 32.380  3.102   38.491 1.00 44.77  ? 14  DT  D C5    1 
ATOM   2465 C C7    . DT  C 3 14  ? 33.168  4.388   38.476 1.00 46.24  ? 14  DT  D C7    1 
ATOM   2466 C C6    . DT  C 3 14  ? 32.849  1.989   37.910 1.00 45.24  ? 14  DT  D C6    1 
ATOM   2467 P P     . DC  C 3 15  ? 33.821  -2.895  33.790 1.00 57.60  ? 15  DC  D P     1 
ATOM   2468 O OP1   . DC  C 3 15  ? 34.103  -4.342  33.631 1.00 58.76  ? 15  DC  D OP1   1 
ATOM   2469 O OP2   . DC  C 3 15  ? 34.580  -1.896  32.988 1.00 59.42  ? 15  DC  D OP2   1 
ATOM   2470 O "O5'" . DC  C 3 15  ? 32.266  -2.633  33.501 1.00 56.35  ? 15  DC  D "O5'" 1 
ATOM   2471 C "C5'" . DC  C 3 15  ? 31.242  -3.346  34.202 1.00 53.27  ? 15  DC  D "C5'" 1 
ATOM   2472 C "C4'" . DC  C 3 15  ? 29.891  -2.694  33.954 1.00 52.21  ? 15  DC  D "C4'" 1 
ATOM   2473 O "O4'" . DC  C 3 15  ? 29.755  -1.508  34.781 1.00 50.12  ? 15  DC  D "O4'" 1 
ATOM   2474 C "C3'" . DC  C 3 15  ? 29.644  -2.230  32.508 1.00 54.67  ? 15  DC  D "C3'" 1 
ATOM   2475 O "O3'" . DC  C 3 15  ? 28.345  -2.553  32.140 1.00 57.22  ? 15  DC  D "O3'" 1 
ATOM   2476 C "C2'" . DC  C 3 15  ? 29.809  -0.712  32.593 1.00 53.73  ? 15  DC  D "C2'" 1 
ATOM   2477 C "C1'" . DC  C 3 15  ? 29.240  -0.468  33.981 1.00 50.55  ? 15  DC  D "C1'" 1 
ATOM   2478 N N1    . DC  C 3 15  ? 29.556  0.877   34.603 1.00 47.69  ? 15  DC  D N1    1 
ATOM   2479 C C2    . DC  C 3 15  ? 28.634  1.444   35.510 1.00 46.15  ? 15  DC  D C2    1 
ATOM   2480 O O2    . DC  C 3 15  ? 27.626  0.808   35.827 1.00 44.75  ? 15  DC  D O2    1 
ATOM   2481 N N3    . DC  C 3 15  ? 28.904  2.659   36.052 1.00 47.09  ? 15  DC  D N3    1 
ATOM   2482 C C4    . DC  C 3 15  ? 30.010  3.321   35.705 1.00 48.27  ? 15  DC  D C4    1 
ATOM   2483 N N4    . DC  C 3 15  ? 30.192  4.538   36.227 1.00 49.45  ? 15  DC  D N4    1 
ATOM   2484 C C5    . DC  C 3 15  ? 30.951  2.783   34.756 1.00 48.79  ? 15  DC  D C5    1 
ATOM   2485 C C6    . DC  C 3 15  ? 30.680  1.573   34.229 1.00 47.90  ? 15  DC  D C6    1 
ATOM   2486 P P     . DA  C 3 16  ? 28.050  -3.748  31.120 1.00 41.57  ? 16  DA  D P     1 
ATOM   2487 O OP1   . DA  C 3 16  ? 28.446  -5.006  31.799 1.00 46.06  ? 16  DA  D OP1   1 
ATOM   2488 O OP2   . DA  C 3 16  ? 28.640  -3.412  29.831 1.00 45.94  ? 16  DA  D OP2   1 
ATOM   2489 O "O5'" . DA  C 3 16  ? 26.461  -3.692  31.027 1.00 36.80  ? 16  DA  D "O5'" 1 
ATOM   2490 C "C5'" . DA  C 3 16  ? 25.657  -4.122  32.115 1.00 33.02  ? 16  DA  D "C5'" 1 
ATOM   2491 C "C4'" . DA  C 3 16  ? 24.387  -3.277  32.223 1.00 29.00  ? 16  DA  D "C4'" 1 
ATOM   2492 O "O4'" . DA  C 3 16  ? 24.735  -1.939  32.710 1.00 28.51  ? 16  DA  D "O4'" 1 
ATOM   2493 C "C3'" . DA  C 3 16  ? 23.624  -3.054  30.924 1.00 29.08  ? 16  DA  D "C3'" 1 
ATOM   2494 O "O3'" . DA  C 3 16  ? 22.195  -3.105  31.158 1.00 25.98  ? 16  DA  D "O3'" 1 
ATOM   2495 C "C2'" . DA  C 3 16  ? 24.065  -1.670  30.471 1.00 27.79  ? 16  DA  D "C2'" 1 
ATOM   2496 C "C1'" . DA  C 3 16  ? 24.237  -0.952  31.812 1.00 24.67  ? 16  DA  D "C1'" 1 
ATOM   2497 N N9    . DA  C 3 16  ? 25.222  0.136   31.779 1.00 24.40  ? 16  DA  D N9    1 
ATOM   2498 C C8    . DA  C 3 16  ? 26.417  0.120   31.138 1.00 26.61  ? 16  DA  D C8    1 
ATOM   2499 N N7    . DA  C 3 16  ? 27.143  1.168   31.379 1.00 28.20  ? 16  DA  D N7    1 
ATOM   2500 C C5    . DA  C 3 16  ? 26.491  1.818   32.416 1.00 26.64  ? 16  DA  D C5    1 
ATOM   2501 C C6    . DA  C 3 16  ? 26.730  3.051   33.080 1.00 30.05  ? 16  DA  D C6    1 
ATOM   2502 N N6    . DA  C 3 16  ? 27.878  3.710   32.978 1.00 31.91  ? 16  DA  D N6    1 
ATOM   2503 N N1    . DA  C 3 16  ? 25.891  3.441   34.013 1.00 30.80  ? 16  DA  D N1    1 
ATOM   2504 C C2    . DA  C 3 16  ? 24.759  2.759   34.182 1.00 27.43  ? 16  DA  D C2    1 
ATOM   2505 N N3    . DA  C 3 16  ? 24.413  1.603   33.599 1.00 28.13  ? 16  DA  D N3    1 
ATOM   2506 C C4    . DA  C 3 16  ? 25.301  1.218   32.668 1.00 25.74  ? 16  DA  D C4    1 
HETATM 2507 C C1    A ORP C 3 17  ? 21.081  -5.428  25.142 0.50 38.19  ? 17  ORP D C1    1 
HETATM 2508 O O1    A ORP C 3 17  ? 22.253  -5.596  24.330 0.50 41.68  ? 17  ORP D O1    1 
HETATM 2509 C C2    A ORP C 3 17  ? 20.436  -4.096  24.787 0.50 35.00  ? 17  ORP D C2    1 
HETATM 2510 C C3    A ORP C 3 17  ? 21.073  -3.107  25.758 0.50 31.17  ? 17  ORP D C3    1 
HETATM 2511 O O3    A ORP C 3 17  ? 22.181  -2.475  25.085 0.50 31.35  ? 17  ORP D O3    1 
HETATM 2512 C C4    A ORP C 3 17  ? 21.639  -3.972  26.886 0.50 30.70  ? 17  ORP D C4    1 
HETATM 2513 O O4    A ORP C 3 17  ? 21.489  -5.338  26.507 0.50 35.74  ? 17  ORP D O4    1 
HETATM 2514 C C5    A ORP C 3 17  ? 20.958  -3.740  28.228 0.50 25.74  ? 17  ORP D C5    1 
HETATM 2515 O O5    A ORP C 3 17  ? 21.559  -4.596  29.213 0.50 30.04  ? 17  ORP D O5    1 
HETATM 2516 P P     A ORP C 3 17  ? 21.276  -4.346  30.775 0.50 28.88  ? 17  ORP D P     1 
HETATM 2517 O O1P   A ORP C 3 17  ? 21.951  -5.453  31.563 0.50 30.41  ? 17  ORP D O1P   1 
HETATM 2518 O O2P   A ORP C 3 17  ? 19.788  -4.169  30.958 0.50 24.88  ? 17  ORP D O2P   1 
HETATM 2519 P P     B AAB C 3 17  ? 21.288  -4.274  30.993 0.50 32.50  ? 17  AAB D P     1 
HETATM 2520 O O1P   B AAB C 3 17  ? 21.739  -5.554  31.662 0.50 35.05  ? 17  AAB D O1P   1 
HETATM 2521 O O3P   B AAB C 3 17  ? 20.059  -3.538  31.473 0.50 29.22  ? 17  AAB D O3P   1 
HETATM 2522 O "O5'" B AAB C 3 17  ? 21.210  -4.546  29.410 0.50 34.02  ? 17  AAB D "O5'" 1 
HETATM 2523 C "C5'" B AAB C 3 17  ? 21.005  -3.463  28.489 0.50 30.83  ? 17  AAB D "C5'" 1 
HETATM 2524 C "C4'" B AAB C 3 17  ? 21.437  -3.879  27.086 0.50 34.58  ? 17  AAB D "C4'" 1 
HETATM 2525 O "O4'" B AAB C 3 17  ? 20.878  -5.161  26.802 0.50 37.76  ? 17  AAB D "O4'" 1 
HETATM 2526 C "C1'" B AAB C 3 17  ? 19.722  -5.036  25.962 0.50 38.91  ? 17  AAB D "C1'" 1 
HETATM 2527 O "O1'" B AAB C 3 17  ? 18.560  -5.035  26.810 0.50 36.67  ? 17  AAB D "O1'" 1 
HETATM 2528 C "C2'" B AAB C 3 17  ? 19.857  -3.701  25.233 0.50 36.96  ? 17  AAB D "C2'" 1 
HETATM 2529 C "C3'" B AAB C 3 17  ? 20.880  -2.912  26.042 0.50 33.73  ? 17  AAB D "C3'" 1 
HETATM 2530 O "O3'" B AAB C 3 17  ? 21.957  -2.418  25.221 0.50 34.31  ? 17  AAB D "O3'" 1 
ATOM   2531 P P     . DG  C 3 18  ? 22.932  -1.146  25.550 1.00 31.32  ? 18  DG  D P     1 
ATOM   2532 O OP1   . DG  C 3 18  ? 24.020  -1.012  24.552 1.00 33.69  ? 18  DG  D OP1   1 
ATOM   2533 O OP2   . DG  C 3 18  ? 23.259  -1.173  26.990 1.00 28.17  ? 18  DG  D OP2   1 
ATOM   2534 O "O5'" . DG  C 3 18  ? 21.861  0.022   25.337 1.00 27.33  ? 18  DG  D "O5'" 1 
ATOM   2535 C "C5'" . DG  C 3 18  ? 21.491  0.455   24.055 1.00 27.89  ? 18  DG  D "C5'" 1 
ATOM   2536 C "C4'" . DG  C 3 18  ? 20.978  1.895   24.120 1.00 26.57  ? 18  DG  D "C4'" 1 
ATOM   2537 O "O4'" . DG  C 3 18  ? 21.993  2.760   24.659 1.00 25.62  ? 18  DG  D "O4'" 1 
ATOM   2538 C "C3'" . DG  C 3 18  ? 20.597  2.516   22.781 1.00 28.25  ? 18  DG  D "C3'" 1 
ATOM   2539 O "O3'" . DG  C 3 18  ? 19.592  3.519   23.015 1.00 28.72  ? 18  DG  D "O3'" 1 
ATOM   2540 C "C2'" . DG  C 3 18  ? 21.922  3.122   22.318 1.00 28.16  ? 18  DG  D "C2'" 1 
ATOM   2541 C "C1'" . DG  C 3 18  ? 22.492  3.635   23.644 1.00 26.68  ? 18  DG  D "C1'" 1 
ATOM   2542 N N9    . DG  C 3 18  ? 23.953  3.614   23.733 1.00 26.63  ? 18  DG  D N9    1 
ATOM   2543 C C8    . DG  C 3 18  ? 24.774  2.527   23.565 1.00 27.80  ? 18  DG  D C8    1 
ATOM   2544 N N7    . DG  C 3 18  ? 26.033  2.793   23.764 1.00 29.69  ? 18  DG  D N7    1 
ATOM   2545 C C5    . DG  C 3 18  ? 26.041  4.109   24.193 1.00 27.25  ? 18  DG  D C5    1 
ATOM   2546 C C6    . DG  C 3 18  ? 27.092  4.880   24.684 1.00 30.34  ? 18  DG  D C6    1 
ATOM   2547 O O6    . DG  C 3 18  ? 28.283  4.551   24.797 1.00 34.21  ? 18  DG  D O6    1 
ATOM   2548 N N1    . DG  C 3 18  ? 26.669  6.176   25.036 1.00 28.46  ? 18  DG  D N1    1 
ATOM   2549 C C2    . DG  C 3 18  ? 25.365  6.608   24.991 1.00 25.99  ? 18  DG  D C2    1 
ATOM   2550 N N2    . DG  C 3 18  ? 25.129  7.845   25.422 1.00 25.77  ? 18  DG  D N2    1 
ATOM   2551 N N3    . DG  C 3 18  ? 24.369  5.877   24.558 1.00 25.01  ? 18  DG  D N3    1 
ATOM   2552 C C4    . DG  C 3 18  ? 24.771  4.630   24.202 1.00 26.31  ? 18  DG  D C4    1 
ATOM   2553 P P     . DT  C 3 19  ? 18.760  4.201   21.833 1.00 30.13  ? 19  DT  D P     1 
ATOM   2554 O OP1   . DT  C 3 19  ? 17.394  4.474   22.334 1.00 31.44  ? 19  DT  D OP1   1 
ATOM   2555 O OP2   . DT  C 3 19  ? 18.913  3.398   20.574 1.00 31.80  ? 19  DT  D OP2   1 
ATOM   2556 O "O5'" . DT  C 3 19  ? 19.504  5.575   21.613 1.00 31.00  ? 19  DT  D "O5'" 1 
ATOM   2557 C "C5'" . DT  C 3 19  ? 19.460  6.573   22.626 1.00 28.20  ? 19  DT  D "C5'" 1 
ATOM   2558 C "C4'" . DT  C 3 19  ? 20.512  7.600   22.360 1.00 28.38  ? 19  DT  D "C4'" 1 
ATOM   2559 O "O4'" . DT  C 3 19  ? 21.795  6.990   22.434 1.00 27.75  ? 19  DT  D "O4'" 1 
ATOM   2560 C "C3'" . DT  C 3 19  ? 20.455  8.216   20.969 1.00 32.45  ? 19  DT  D "C3'" 1 
ATOM   2561 O "O3'" . DT  C 3 19  ? 19.858  9.453   21.080 1.00 35.45  ? 19  DT  D "O3'" 1 
ATOM   2562 C "C2'" . DT  C 3 19  ? 21.935  8.310   20.519 1.00 32.65  ? 19  DT  D "C2'" 1 
ATOM   2563 C "C1'" . DT  C 3 19  ? 22.685  7.837   21.762 1.00 30.12  ? 19  DT  D "C1'" 1 
ATOM   2564 N N1    . DT  C 3 19  ? 23.940  7.080   21.493 1.00 29.65  ? 19  DT  D N1    1 
ATOM   2565 C C2    . DT  C 3 19  ? 25.144  7.644   21.833 1.00 28.95  ? 19  DT  D C2    1 
ATOM   2566 O O2    . DT  C 3 19  ? 25.249  8.752   22.319 1.00 29.25  ? 19  DT  D O2    1 
ATOM   2567 N N3    . DT  C 3 19  ? 26.211  6.822   21.672 1.00 30.18  ? 19  DT  D N3    1 
ATOM   2568 C C4    . DT  C 3 19  ? 26.216  5.551   21.126 1.00 31.77  ? 19  DT  D C4    1 
ATOM   2569 O O4    . DT  C 3 19  ? 27.277  4.952   21.028 1.00 34.38  ? 19  DT  D O4    1 
ATOM   2570 C C5    . DT  C 3 19  ? 24.924  5.062   20.677 1.00 31.59  ? 19  DT  D C5    1 
ATOM   2571 C C7    . DT  C 3 19  ? 24.784  3.712   20.012 1.00 33.86  ? 19  DT  D C7    1 
ATOM   2572 C C6    . DT  C 3 19  ? 23.869  5.841   20.879 1.00 29.96  ? 19  DT  D C6    1 
ATOM   2573 P P     . DA  C 3 20  ? 19.528  10.356  19.782 1.00 40.13  ? 20  DA  D P     1 
ATOM   2574 O OP1   . DA  C 3 20  ? 18.278  11.071  20.068 1.00 41.53  ? 20  DA  D OP1   1 
ATOM   2575 O OP2   . DA  C 3 20  ? 19.637  9.539   18.544 1.00 41.37  ? 20  DA  D OP2   1 
ATOM   2576 O "O5'" . DA  C 3 20  ? 20.753  11.397  19.741 1.00 41.39  ? 20  DA  D "O5'" 1 
ATOM   2577 C "C5'" . DA  C 3 20  ? 21.192  12.067  20.910 1.00 41.74  ? 20  DA  D "C5'" 1 
ATOM   2578 C "C4'" . DA  C 3 20  ? 22.501  12.799  20.649 1.00 43.58  ? 20  DA  D "C4'" 1 
ATOM   2579 O "O4'" . DA  C 3 20  ? 23.591  11.852  20.582 1.00 41.73  ? 20  DA  D "O4'" 1 
ATOM   2580 C "C3'" . DA  C 3 20  ? 22.557  13.613  19.358 1.00 47.36  ? 20  DA  D "C3'" 1 
ATOM   2581 O "O3'" . DA  C 3 20  ? 23.103  14.868  19.652 1.00 53.01  ? 20  DA  D "O3'" 1 
ATOM   2582 C "C2'" . DA  C 3 20  ? 23.463  12.789  18.429 1.00 46.04  ? 20  DA  D "C2'" 1 
ATOM   2583 C "C1'" . DA  C 3 20  ? 24.376  12.074  19.426 1.00 43.43  ? 20  DA  D "C1'" 1 
ATOM   2584 N N9    . DA  C 3 20  ? 24.863  10.766  18.966 1.00 40.27  ? 20  DA  D N9    1 
ATOM   2585 C C8    . DA  C 3 20  ? 24.124  9.772   18.378 1.00 38.36  ? 20  DA  D C8    1 
ATOM   2586 N N7    . DA  C 3 20  ? 24.788  8.653   18.199 1.00 37.64  ? 20  DA  D N7    1 
ATOM   2587 C C5    . DA  C 3 20  ? 26.038  8.918   18.716 1.00 37.09  ? 20  DA  D C5    1 
ATOM   2588 C C6    . DA  C 3 20  ? 27.222  8.151   18.777 1.00 37.24  ? 20  DA  D C6    1 
ATOM   2589 N N6    . DA  C 3 20  ? 27.307  6.891   18.322 1.00 36.48  ? 20  DA  D N6    1 
ATOM   2590 N N1    . DA  C 3 20  ? 28.331  8.739   19.286 1.00 38.46  ? 20  DA  D N1    1 
ATOM   2591 C C2    . DA  C 3 20  ? 28.252  9.998   19.751 1.00 39.78  ? 20  DA  D C2    1 
ATOM   2592 N N3    . DA  C 3 20  ? 27.192  10.812  19.771 1.00 40.71  ? 20  DA  D N3    1 
ATOM   2593 C C4    . DA  C 3 20  ? 26.106  10.211  19.206 1.00 39.60  ? 20  DA  D C4    1 
ATOM   2594 P P     . DC  C 3 21  ? 23.119  16.072  18.583 1.00 59.22  ? 21  DC  D P     1 
ATOM   2595 O OP1   . DC  C 3 21  ? 22.932  17.317  19.360 1.00 63.17  ? 21  DC  D OP1   1 
ATOM   2596 O OP2   . DC  C 3 21  ? 22.208  15.764  17.441 1.00 59.37  ? 21  DC  D OP2   1 
ATOM   2597 O "O5'" . DC  C 3 21  ? 24.614  16.035  18.000 1.00 60.25  ? 21  DC  D "O5'" 1 
ATOM   2598 C "C5'" . DC  C 3 21  ? 25.761  16.032  18.872 1.00 59.27  ? 21  DC  D "C5'" 1 
ATOM   2599 C "C4'" . DC  C 3 21  ? 27.034  15.713  18.088 1.00 59.67  ? 21  DC  D "C4'" 1 
ATOM   2600 O "O4'" . DC  C 3 21  ? 27.192  14.271  17.973 1.00 55.92  ? 21  DC  D "O4'" 1 
ATOM   2601 C "C3'" . DC  C 3 21  ? 27.090  16.254  16.648 1.00 62.58  ? 21  DC  D "C3'" 1 
ATOM   2602 O "O3'" . DC  C 3 21  ? 28.376  16.763  16.392 1.00 67.86  ? 21  DC  D "O3'" 1 
ATOM   2603 C "C2'" . DC  C 3 21  ? 26.854  15.012  15.805 1.00 59.22  ? 21  DC  D "C2'" 1 
ATOM   2604 C "C1'" . DC  C 3 21  ? 27.583  13.987  16.661 1.00 55.66  ? 21  DC  D "C1'" 1 
ATOM   2605 N N1    . DC  C 3 21  ? 27.291  12.555  16.341 1.00 50.74  ? 21  DC  D N1    1 
ATOM   2606 C C2    . DC  C 3 21  ? 28.320  11.605  16.486 1.00 48.57  ? 21  DC  D C2    1 
ATOM   2607 O O2    . DC  C 3 21  ? 29.430  11.975  16.899 1.00 50.02  ? 21  DC  D O2    1 
ATOM   2608 N N3    . DC  C 3 21  ? 28.073  10.312  16.149 1.00 45.41  ? 21  DC  D N3    1 
ATOM   2609 C C4    . DC  C 3 21  ? 26.874  9.957   15.675 1.00 44.39  ? 21  DC  D C4    1 
ATOM   2610 N N4    . DC  C 3 21  ? 26.688  8.677   15.357 1.00 43.02  ? 21  DC  D N4    1 
ATOM   2611 C C5    . DC  C 3 21  ? 25.809  10.907  15.512 1.00 46.76  ? 21  DC  D C5    1 
ATOM   2612 C C6    . DC  C 3 21  ? 26.057  12.183  15.851 1.00 48.73  ? 21  DC  D C6    1 
ATOM   2613 P P     . DA  C 3 22  ? 28.573  18.211  15.744 1.00 72.53  ? 22  DA  D P     1 
ATOM   2614 O OP1   . DA  C 3 22  ? 28.078  19.190  16.745 1.00 74.45  ? 22  DA  D OP1   1 
ATOM   2615 O OP2   . DA  C 3 22  ? 28.019  18.187  14.373 1.00 71.57  ? 22  DA  D OP2   1 
ATOM   2616 O "O5'" . DA  C 3 22  ? 30.167  18.321  15.628 1.00 74.99  ? 22  DA  D "O5'" 1 
ATOM   2617 C "C5'" . DA  C 3 22  ? 31.010  17.833  16.702 1.00 73.79  ? 22  DA  D "C5'" 1 
ATOM   2618 C "C4'" . DA  C 3 22  ? 32.164  16.974  16.175 1.00 73.25  ? 22  DA  D "C4'" 1 
ATOM   2619 O "O4'" . DA  C 3 22  ? 31.698  15.647  15.845 1.00 68.50  ? 22  DA  D "O4'" 1 
ATOM   2620 C "C3'" . DA  C 3 22  ? 32.899  17.482  14.932 1.00 77.12  ? 22  DA  D "C3'" 1 
ATOM   2621 O "O3'" . DA  C 3 22  ? 34.279  17.229  15.105 1.00 81.46  ? 22  DA  D "O3'" 1 
ATOM   2622 C "C2'" . DA  C 3 22  ? 32.324  16.610  13.809 1.00 73.00  ? 22  DA  D "C2'" 1 
ATOM   2623 C "C1'" . DA  C 3 22  ? 32.128  15.291  14.546 1.00 67.54  ? 22  DA  D "C1'" 1 
ATOM   2624 N N9    . DA  C 3 22  ? 31.111  14.408  13.980 1.00 61.42  ? 22  DA  D N9    1 
ATOM   2625 C C8    . DA  C 3 22  ? 29.795  14.718  13.752 1.00 59.61  ? 22  DA  D C8    1 
ATOM   2626 N N7    . DA  C 3 22  ? 29.059  13.695  13.391 1.00 56.08  ? 22  DA  D N7    1 
ATOM   2627 C C5    . DA  C 3 22  ? 29.928  12.622  13.452 1.00 53.58  ? 22  DA  D C5    1 
ATOM   2628 C C6    . DA  C 3 22  ? 29.759  11.248  13.175 1.00 49.11  ? 22  DA  D C6    1 
ATOM   2629 N N6    . DA  C 3 22  ? 28.604  10.728  12.764 1.00 46.07  ? 22  DA  D N6    1 
ATOM   2630 N N1    . DA  C 3 22  ? 30.839  10.442  13.298 1.00 49.01  ? 22  DA  D N1    1 
ATOM   2631 C C2    . DA  C 3 22  ? 32.016  10.981  13.656 1.00 51.71  ? 22  DA  D C2    1 
ATOM   2632 N N3    . DA  C 3 22  ? 32.300  12.258  13.944 1.00 55.35  ? 22  DA  D N3    1 
ATOM   2633 C C4    . DA  C 3 22  ? 31.197  13.035  13.835 1.00 56.64  ? 22  DA  D C4    1 
ATOM   2634 P P     . DG  C 3 23  ? 35.389  18.124  14.400 1.00 87.80  ? 23  DG  D P     1 
ATOM   2635 O OP1   . DG  C 3 23  ? 36.483  18.280  15.388 1.00 91.02  ? 23  DG  D OP1   1 
ATOM   2636 O OP2   . DG  C 3 23  ? 34.745  19.327  13.801 1.00 90.05  ? 23  DG  D OP2   1 
ATOM   2637 O "O5'" . DG  C 3 23  ? 35.887  17.197  13.181 1.00 87.16  ? 23  DG  D "O5'" 1 
ATOM   2638 C "C5'" . DG  C 3 23  ? 36.618  15.987  13.439 1.00 85.03  ? 23  DG  D "C5'" 1 
ATOM   2639 C "C4'" . DG  C 3 23  ? 36.506  14.999  12.280 1.00 81.86  ? 23  DG  D "C4'" 1 
ATOM   2640 O "O4'" . DG  C 3 23  ? 35.172  14.428  12.232 1.00 76.05  ? 23  DG  D "O4'" 1 
ATOM   2641 C "C3'" . DG  C 3 23  ? 36.787  15.547  10.859 1.00 84.00  ? 23  DG  D "C3'" 1 
ATOM   2642 O "O3'" . DG  C 3 23  ? 37.589  14.604  10.156 1.00 86.38  ? 23  DG  D "O3'" 1 
ATOM   2643 C "C2'" . DG  C 3 23  ? 35.387  15.590  10.243 1.00 79.87  ? 23  DG  D "C2'" 1 
ATOM   2644 C "C1'" . DG  C 3 23  ? 34.810  14.337  10.880 1.00 74.64  ? 23  DG  D "C1'" 1 
ATOM   2645 N N9    . DG  C 3 23  ? 33.367  14.142  10.742 1.00 68.13  ? 23  DG  D N9    1 
ATOM   2646 C C8    . DG  C 3 23  ? 32.376  15.103  10.706 1.00 66.87  ? 23  DG  D C8    1 
ATOM   2647 N N7    . DG  C 3 23  ? 31.183  14.615  10.503 1.00 63.14  ? 23  DG  D N7    1 
ATOM   2648 C C5    . DG  C 3 23  ? 31.400  13.251  10.356 1.00 60.38  ? 23  DG  D C5    1 
ATOM   2649 C C6    . DG  C 3 23  ? 30.485  12.204  10.094 1.00 55.95  ? 23  DG  D C6    1 
ATOM   2650 O O6    . DG  C 3 23  ? 29.254  12.280  9.987  1.00 55.08  ? 23  DG  D O6    1 
ATOM   2651 N N1    . DG  C 3 23  ? 31.126  10.961  10.003 1.00 53.67  ? 23  DG  D N1    1 
ATOM   2652 C C2    . DG  C 3 23  ? 32.488  10.762  10.144 1.00 55.71  ? 23  DG  D C2    1 
ATOM   2653 N N2    . DG  C 3 23  ? 32.936  9.511   9.987  1.00 54.77  ? 23  DG  D N2    1 
ATOM   2654 N N3    . DG  C 3 23  ? 33.352  11.734  10.400 1.00 59.75  ? 23  DG  D N3    1 
ATOM   2655 C C4    . DG  C 3 23  ? 32.741  12.947  10.499 1.00 62.63  ? 23  DG  D C4    1 
ATOM   2656 P P     . DA  C 3 24  ? 38.831  15.055  9.258  1.00 92.33  ? 24  DA  D P     1 
ATOM   2657 O OP1   . DA  C 3 24  ? 39.947  15.386  10.179 1.00 96.37  ? 24  DA  D OP1   1 
ATOM   2658 O OP2   . DA  C 3 24  ? 38.368  16.050  8.256  1.00 92.76  ? 24  DA  D OP2   1 
ATOM   2659 O "O5'" . DA  C 3 24  ? 39.187  13.702  8.475  1.00 91.77  ? 24  DA  D "O5'" 1 
ATOM   2660 C "C5'" . DA  C 3 24  ? 39.234  12.442  9.189  1.00 89.10  ? 24  DA  D "C5'" 1 
ATOM   2661 C "C4'" . DA  C 3 24  ? 38.578  11.321  8.387  1.00 85.88  ? 24  DA  D "C4'" 1 
ATOM   2662 O "O4'" . DA  C 3 24  ? 37.134  11.445  8.452  1.00 80.48  ? 24  DA  D "O4'" 1 
ATOM   2663 C "C3'" . DA  C 3 24  ? 38.942  11.252  6.896  1.00 88.17  ? 24  DA  D "C3'" 1 
ATOM   2664 O "O3'" . DA  C 3 24  ? 39.297  9.907   6.552  1.00 91.60  ? 24  DA  D "O3'" 1 
ATOM   2665 C "C2'" . DA  C 3 24  ? 37.658  11.707  6.187  1.00 83.62  ? 24  DA  D "C2'" 1 
ATOM   2666 C "C1'" . DA  C 3 24  ? 36.589  11.240  7.162  1.00 78.06  ? 24  DA  D "C1'" 1 
ATOM   2667 N N9    . DA  C 3 24  ? 35.316  11.969  7.075  1.00 71.29  ? 24  DA  D N9    1 
ATOM   2668 C C8    . DA  C 3 24  ? 35.114  13.308  7.303  1.00 70.41  ? 24  DA  D C8    1 
ATOM   2669 N N7    . DA  C 3 24  ? 33.854  13.673  7.267  1.00 66.67  ? 24  DA  D N7    1 
ATOM   2670 C C5    . DA  C 3 24  ? 33.173  12.488  7.046  1.00 62.47  ? 24  DA  D C5    1 
ATOM   2671 C C6    . DA  C 3 24  ? 31.798  12.193  6.891  1.00 56.77  ? 24  DA  D C6    1 
ATOM   2672 N N6    . DA  C 3 24  ? 30.841  13.117  6.948  1.00 55.31  ? 24  DA  D N6    1 
ATOM   2673 N N1    . DA  C 3 24  ? 31.456  10.920  6.625  1.00 54.96  ? 24  DA  D N1    1 
ATOM   2674 C C2    . DA  C 3 24  ? 32.416  9.983   6.579  1.00 57.61  ? 24  DA  D C2    1 
ATOM   2675 N N3    . DA  C 3 24  ? 33.738  10.130  6.714  1.00 61.69  ? 24  DA  D N3    1 
ATOM   2676 C C4    . DA  C 3 24  ? 34.056  11.422  6.941  1.00 64.84  ? 24  DA  D C4    1 
ATOM   2677 P P     . DG  C 3 25  ? 40.087  9.557   5.188  1.00 97.80  ? 25  DG  D P     1 
ATOM   2678 O OP1   . DG  C 3 25  ? 40.974  8.404   5.485  1.00 101.20 ? 25  DG  D OP1   1 
ATOM   2679 O OP2   . DG  C 3 25  ? 40.664  10.804  4.609  1.00 99.68  ? 25  DG  D OP2   1 
ATOM   2680 O "O5'" . DG  C 3 25  ? 38.908  9.072   4.207  1.00 95.11  ? 25  DG  D "O5'" 1 
ATOM   2681 C "C5'" . DG  C 3 25  ? 38.049  7.987   4.606  1.00 91.53  ? 25  DG  D "C5'" 1 
ATOM   2682 C "C4'" . DG  C 3 25  ? 36.825  7.868   3.705  1.00 87.87  ? 25  DG  D "C4'" 1 
ATOM   2683 O "O4'" . DG  C 3 25  ? 35.832  8.856   4.073  1.00 83.13  ? 25  DG  D "O4'" 1 
ATOM   2684 C "C3'" . DG  C 3 25  ? 37.063  8.032   2.200  1.00 90.26  ? 25  DG  D "C3'" 1 
ATOM   2685 O "O3'" . DG  C 3 25  ? 36.466  6.927   1.514  1.00 92.57  ? 25  DG  D "O3'" 1 
ATOM   2686 C "C2'" . DG  C 3 25  ? 36.351  9.353   1.870  1.00 86.56  ? 25  DG  D "C2'" 1 
ATOM   2687 C "C1'" . DG  C 3 25  ? 35.236  9.339   2.900  1.00 81.01  ? 25  DG  D "C1'" 1 
ATOM   2688 N N9    . DG  C 3 25  ? 34.621  10.641  3.173  1.00 74.78  ? 25  DG  D N9    1 
ATOM   2689 C C8    . DG  C 3 25  ? 35.251  11.812  3.530  1.00 74.02  ? 25  DG  D C8    1 
ATOM   2690 N N7    . DG  C 3 25  ? 34.425  12.792  3.778  1.00 71.16  ? 25  DG  D N7    1 
ATOM   2691 C C5    . DG  C 3 25  ? 33.170  12.237  3.581  1.00 67.45  ? 25  DG  D C5    1 
ATOM   2692 C C6    . DG  C 3 25  ? 31.885  12.835  3.627  1.00 63.81  ? 25  DG  D C6    1 
ATOM   2693 O O6    . DG  C 3 25  ? 31.591  13.985  3.949  1.00 62.96  ? 25  DG  D O6    1 
ATOM   2694 N N1    . DG  C 3 25  ? 30.880  11.930  3.309  1.00 62.93  ? 25  DG  D N1    1 
ATOM   2695 C C2    . DG  C 3 25  ? 31.086  10.610  2.989  1.00 64.98  ? 25  DG  D C2    1 
ATOM   2696 N N2    . DG  C 3 25  ? 30.000  9.890   2.708  1.00 65.26  ? 25  DG  D N2    1 
ATOM   2697 N N3    . DG  C 3 25  ? 32.282  10.045  2.906  1.00 67.24  ? 25  DG  D N3    1 
ATOM   2698 C C4    . DG  C 3 25  ? 33.275  10.913  3.213  1.00 69.32  ? 25  DG  D C4    1 
ATOM   2699 P P     . DC  C 3 26  ? 36.974  6.459   0.063  1.00 97.37  ? 26  DC  D P     1 
ATOM   2700 O OP1   . DC  C 3 26  ? 37.625  5.136   0.218  1.00 101.06 ? 26  DC  D OP1   1 
ATOM   2701 O OP2   . DC  C 3 26  ? 37.719  7.572   -0.587 1.00 99.06  ? 26  DC  D OP2   1 
ATOM   2702 O "O5'" . DC  C 3 26  ? 35.590  6.265   -0.714 1.00 94.57  ? 26  DC  D "O5'" 1 
ATOM   2703 C "C5'" . DC  C 3 26  ? 34.860  7.401   -1.133 1.00 91.06  ? 26  DC  D "C5'" 1 
ATOM   2704 C "C4'" . DC  C 3 26  ? 33.360  7.148   -1.090 1.00 86.22  ? 26  DC  D "C4'" 1 
ATOM   2705 O "O4'" . DC  C 3 26  ? 32.742  8.104   -0.193 1.00 81.50  ? 26  DC  D "O4'" 1 
ATOM   2706 C "C3'" . DC  C 3 26  ? 32.657  7.319   -2.431 1.00 86.38  ? 26  DC  D "C3'" 1 
ATOM   2707 O "O3'" . DC  C 3 26  ? 31.594  6.381   -2.588 1.00 87.24  ? 26  DC  D "O3'" 1 
ATOM   2708 C "C2'" . DC  C 3 26  ? 32.150  8.754   -2.404 1.00 83.21  ? 26  DC  D "C2'" 1 
ATOM   2709 C "C1'" . DC  C 3 26  ? 31.941  9.029   -0.922 1.00 78.87  ? 26  DC  D "C1'" 1 
ATOM   2710 N N1    . DC  C 3 26  ? 32.303  10.447  -0.507 1.00 74.32  ? 26  DC  D N1    1 
ATOM   2711 C C2    . DC  C 3 26  ? 31.282  11.404  -0.332 1.00 71.72  ? 26  DC  D C2    1 
ATOM   2712 O O2    . DC  C 3 26  ? 30.106  11.082  -0.538 1.00 71.04  ? 26  DC  D O2    1 
ATOM   2713 N N3    . DC  C 3 26  ? 31.620  12.662  0.074  1.00 70.82  ? 26  DC  D N3    1 
ATOM   2714 C C4    . DC  C 3 26  ? 32.911  12.984  0.272  1.00 71.47  ? 26  DC  D C4    1 
ATOM   2715 N N4    . DC  C 3 26  ? 33.191  14.232  0.664  1.00 71.45  ? 26  DC  D N4    1 
ATOM   2716 C C5    . DC  C 3 26  ? 33.968  12.036  0.070  1.00 73.01  ? 26  DC  D C5    1 
ATOM   2717 C C6    . DC  C 3 26  ? 33.623  10.794  -0.311 1.00 73.83  ? 26  DC  D C6    1 
ATOM   2718 P P     . DT  C 3 27  ? 31.174  5.878   -4.063 1.00 91.06  ? 27  DT  D P     1 
ATOM   2719 O OP1   . DT  C 3 27  ? 30.373  4.639   -3.901 1.00 92.01  ? 27  DT  D OP1   1 
ATOM   2720 O OP2   . DT  C 3 27  ? 32.387  5.867   -4.931 1.00 93.92  ? 27  DT  D OP2   1 
ATOM   2721 O "O5'" . DT  C 3 27  ? 30.223  7.058   -4.606 1.00 89.36  ? 27  DT  D "O5'" 1 
ATOM   2722 C "C5'" . DT  C 3 27  ? 28.964  7.334   -3.968 1.00 85.66  ? 27  DT  D "C5'" 1 
ATOM   2723 C "C4'" . DT  C 3 27  ? 28.369  8.665   -4.431 1.00 83.17  ? 27  DT  D "C4'" 1 
ATOM   2724 O "O4'" . DT  C 3 27  ? 29.016  9.771   -3.748 1.00 79.74  ? 27  DT  D "O4'" 1 
ATOM   2725 C "C3'" . DT  C 3 27  ? 28.463  8.979   -5.932 1.00 85.55  ? 27  DT  D "C3'" 1 
ATOM   2726 O "O3'" . DT  C 3 27  ? 27.212  9.502   -6.365 1.00 87.57  ? 27  DT  D "O3'" 1 
ATOM   2727 C "C2'" . DT  C 3 27  ? 29.539  10.071  -5.978 1.00 83.40  ? 27  DT  D "C2'" 1 
ATOM   2728 C "C1'" . DT  C 3 27  ? 29.216  10.792  -4.678 1.00 79.02  ? 27  DT  D "C1'" 1 
ATOM   2729 N N1    . DT  C 3 27  ? 30.256  11.758  -4.173 1.00 74.67  ? 27  DT  D N1    1 
ATOM   2730 C C2    . DT  C 3 27  ? 29.839  12.988  -3.691 1.00 72.46  ? 27  DT  D C2    1 
ATOM   2731 O O2    . DT  C 3 27  ? 28.668  13.333  -3.648 1.00 71.90  ? 27  DT  D O2    1 
ATOM   2732 N N3    . DT  C 3 27  ? 30.851  13.812  -3.268 1.00 71.67  ? 27  DT  D N3    1 
ATOM   2733 C C4    . DT  C 3 27  ? 32.207  13.544  -3.264 1.00 72.17  ? 27  DT  D C4    1 
ATOM   2734 O O4    . DT  C 3 27  ? 32.980  14.401  -2.849 1.00 72.15  ? 27  DT  D O4    1 
ATOM   2735 C C5    . DT  C 3 27  ? 32.584  12.234  -3.780 1.00 73.57  ? 27  DT  D C5    1 
ATOM   2736 C C7    . DT  C 3 27  ? 34.025  11.812  -3.820 1.00 75.34  ? 27  DT  D C7    1 
ATOM   2737 C C6    . DT  C 3 27  ? 31.603  11.427  -4.227 1.00 73.92  ? 27  DT  D C6    1 
ATOM   2738 P P     . DG  C 3 28  ? 26.421  8.859   -7.591 1.00 90.75  ? 28  DG  D P     1 
ATOM   2739 O OP1   . DG  C 3 28  ? 25.660  7.695   -7.079 1.00 90.98  ? 28  DG  D OP1   1 
ATOM   2740 O OP2   . DG  C 3 28  ? 27.364  8.690   -8.723 1.00 93.61  ? 28  DG  D OP2   1 
ATOM   2741 O "O5'" . DG  C 3 28  ? 25.389  10.035  -7.971 1.00 92.01  ? 28  DG  D "O5'" 1 
ATOM   2742 C "C5'" . DG  C 3 28  ? 24.486  10.567  -6.960 1.00 90.01  ? 28  DG  D "C5'" 1 
ATOM   2743 C "C4'" . DG  C 3 28  ? 24.392  12.094  -7.017 1.00 89.54  ? 28  DG  D "C4'" 1 
ATOM   2744 O "O4'" . DG  C 3 28  ? 25.563  12.682  -6.399 1.00 86.61  ? 28  DG  D "O4'" 1 
ATOM   2745 C "C3'" . DG  C 3 28  ? 24.278  12.715  -8.413 1.00 92.14  ? 28  DG  D "C3'" 1 
ATOM   2746 O "O3'" . DG  C 3 28  ? 23.112  13.528  -8.501 1.00 95.11  ? 28  DG  D "O3'" 1 
ATOM   2747 C "C2'" . DG  C 3 28  ? 25.553  13.550  -8.563 1.00 90.07  ? 28  DG  D "C2'" 1 
ATOM   2748 C "C1'" . DG  C 3 28  ? 25.928  13.832  -7.116 1.00 85.21  ? 28  DG  D "C1'" 1 
ATOM   2749 N N9    . DG  C 3 28  ? 27.358  14.077  -6.918 1.00 79.86  ? 28  DG  D N9    1 
ATOM   2750 C C8    . DG  C 3 28  ? 28.397  13.230  -7.222 1.00 77.75  ? 28  DG  D C8    1 
ATOM   2751 N N7    . DG  C 3 28  ? 29.570  13.715  -6.936 1.00 76.48  ? 28  DG  D N7    1 
ATOM   2752 C C5    . DG  C 3 28  ? 29.298  14.965  -6.403 1.00 76.71  ? 28  DG  D C5    1 
ATOM   2753 C C6    . DG  C 3 28  ? 30.185  15.982  -5.952 1.00 76.20  ? 28  DG  D C6    1 
ATOM   2754 O O6    . DG  C 3 28  ? 31.421  15.970  -5.944 1.00 75.16  ? 28  DG  D O6    1 
ATOM   2755 N N1    . DG  C 3 28  ? 29.493  17.117  -5.511 1.00 77.18  ? 28  DG  D N1    1 
ATOM   2756 C C2    . DG  C 3 28  ? 28.121  17.264  -5.540 1.00 77.51  ? 28  DG  D C2    1 
ATOM   2757 N N2    . DG  C 3 28  ? 27.636  18.415  -5.070 1.00 78.17  ? 28  DG  D N2    1 
ATOM   2758 N N3    . DG  C 3 28  ? 27.282  16.319  -5.956 1.00 78.01  ? 28  DG  D N3    1 
ATOM   2759 C C4    . DG  C 3 28  ? 27.937  15.206  -6.388 1.00 78.04  ? 28  DG  D C4    1 
HETATM 2760 O O     . HOH D 4 .   ? 24.753  -3.273  27.673 1.00 56.70  ? 501 HOH A O     1 
HETATM 2761 O O     . HOH D 4 .   ? 10.479  12.156  31.668 1.00 32.23  ? 502 HOH A O     1 
HETATM 2762 O O     . HOH D 4 .   ? 9.109   7.207   11.239 1.00 43.38  ? 503 HOH A O     1 
HETATM 2763 O O     . HOH D 4 .   ? 22.411  -14.283 40.703 1.00 40.87  ? 504 HOH A O     1 
HETATM 2764 O O     . HOH D 4 .   ? 19.914  5.892   30.790 1.00 25.22  ? 505 HOH A O     1 
HETATM 2765 O O     . HOH D 4 .   ? 7.946   16.598  14.370 1.00 53.24  ? 506 HOH A O     1 
HETATM 2766 O O     . HOH D 4 .   ? 9.099   5.248   9.554  1.00 49.07  ? 507 HOH A O     1 
HETATM 2767 O O     . HOH D 4 .   ? 27.468  4.855   28.359 1.00 47.51  ? 508 HOH A O     1 
HETATM 2768 O O     . HOH D 4 .   ? -2.278  -1.931  28.021 1.00 55.30  ? 509 HOH A O     1 
HETATM 2769 O O     . HOH D 4 .   ? 13.498  -0.742  36.488 1.00 41.01  ? 510 HOH A O     1 
HETATM 2770 O O     . HOH D 4 .   ? 15.255  -4.117  36.536 1.00 47.46  ? 511 HOH A O     1 
HETATM 2771 O O     . HOH D 4 .   ? 13.278  -8.031  25.597 1.00 53.60  ? 512 HOH A O     1 
HETATM 2772 O O     . HOH D 4 .   ? 13.039  -10.629 15.392 1.00 34.66  ? 513 HOH A O     1 
HETATM 2773 O O     . HOH D 4 .   ? 12.287  2.626   27.339 1.00 32.07  ? 514 HOH A O     1 
HETATM 2774 O O     . HOH D 4 .   ? 17.159  -17.326 29.359 1.00 38.31  ? 515 HOH A O     1 
HETATM 2775 O O     . HOH D 4 .   ? 15.727  -6.755  25.587 1.00 44.41  ? 516 HOH A O     1 
HETATM 2776 O O     . HOH D 4 .   ? 0.446   10.123  23.379 1.00 48.54  ? 517 HOH A O     1 
HETATM 2777 O O     . HOH D 4 .   ? 9.909   18.527  15.985 1.00 51.31  ? 518 HOH A O     1 
HETATM 2778 O O     . HOH D 4 .   ? -1.458  -8.913  20.041 1.00 36.54  ? 519 HOH A O     1 
HETATM 2779 O O     . HOH D 4 .   ? 20.062  6.089   36.280 1.00 32.08  ? 520 HOH A O     1 
HETATM 2780 O O     . HOH D 4 .   ? -3.681  0.317   16.593 1.00 43.08  ? 521 HOH A O     1 
HETATM 2781 O O     . HOH D 4 .   ? 25.626  -2.552  16.651 1.00 51.94  ? 522 HOH A O     1 
HETATM 2782 O O     . HOH D 4 .   ? 11.153  -6.480  25.186 1.00 24.46  ? 523 HOH A O     1 
HETATM 2783 O O     . HOH D 4 .   ? 5.889   -10.436 6.329  1.00 57.43  ? 524 HOH A O     1 
HETATM 2784 O O     . HOH D 4 .   ? 22.225  -16.136 22.159 1.00 43.32  ? 525 HOH A O     1 
HETATM 2785 O O     . HOH D 4 .   ? 23.222  -20.111 38.924 1.00 39.49  ? 526 HOH A O     1 
HETATM 2786 O O     . HOH D 4 .   ? 23.200  13.880  29.831 1.00 53.00  ? 527 HOH A O     1 
HETATM 2787 O O     . HOH D 4 .   ? -4.553  -9.140  26.987 1.00 56.15  ? 528 HOH A O     1 
HETATM 2788 O O     B HOH D 4 .   ? 22.400  -6.549  24.563 0.50 34.16  ? 529 HOH A O     1 
HETATM 2789 O O     . HOH D 4 .   ? 29.227  -21.509 32.811 1.00 67.03  ? 530 HOH A O     1 
HETATM 2790 O O     . HOH D 4 .   ? 6.513   -1.835  37.271 1.00 35.86  ? 531 HOH A O     1 
HETATM 2791 O O     . HOH D 4 .   ? 11.686  -3.605  39.861 1.00 42.26  ? 532 HOH A O     1 
HETATM 2792 O O     . HOH D 4 .   ? 3.718   10.892  14.119 1.00 53.90  ? 533 HOH A O     1 
HETATM 2793 O O     . HOH D 4 .   ? 16.288  -14.307 22.652 1.00 38.37  ? 534 HOH A O     1 
HETATM 2794 O O     . HOH D 4 .   ? -4.790  -9.660  17.789 1.00 61.62  ? 535 HOH A O     1 
HETATM 2795 O O     . HOH D 4 .   ? 16.341  -1.338  24.983 1.00 32.85  ? 536 HOH A O     1 
HETATM 2796 O O     . HOH D 4 .   ? 2.805   -13.234 9.744  1.00 48.58  ? 537 HOH A O     1 
HETATM 2797 O O     . HOH D 4 .   ? 2.371   4.456   13.862 1.00 36.47  ? 538 HOH A O     1 
HETATM 2798 O O     . HOH D 4 .   ? 10.067  10.301  13.728 1.00 35.82  ? 539 HOH A O     1 
HETATM 2799 O O     . HOH D 4 .   ? 12.280  -12.373 23.651 1.00 47.34  ? 540 HOH A O     1 
HETATM 2800 O O     . HOH D 4 .   ? 10.624  -14.464 5.487  1.00 65.53  ? 541 HOH A O     1 
HETATM 2801 O O     . HOH D 4 .   ? 15.489  4.873   8.862  1.00 46.56  ? 542 HOH A O     1 
HETATM 2802 O O     . HOH D 4 .   ? 24.500  -6.987  29.298 1.00 50.06  ? 543 HOH A O     1 
HETATM 2803 O O     . HOH D 4 .   ? 18.772  14.149  34.329 1.00 60.74  ? 544 HOH A O     1 
HETATM 2804 O O     . HOH D 4 .   ? 6.887   13.300  23.202 1.00 43.55  ? 545 HOH A O     1 
HETATM 2805 O O     . HOH D 4 .   ? -0.639  -13.053 31.375 1.00 57.84  ? 546 HOH A O     1 
HETATM 2806 O O     . HOH D 4 .   ? 9.002   -5.283  42.788 1.00 61.15  ? 547 HOH A O     1 
HETATM 2807 O O     . HOH D 4 .   ? 18.359  -20.320 26.234 1.00 46.84  ? 548 HOH A O     1 
HETATM 2808 O O     . HOH D 4 .   ? 19.541  2.807   37.174 1.00 38.87  ? 549 HOH A O     1 
HETATM 2809 O O     . HOH D 4 .   ? 20.322  -12.730 41.433 1.00 63.95  ? 550 HOH A O     1 
HETATM 2810 O O     . HOH D 4 .   ? 4.600   15.043  22.061 1.00 38.48  ? 551 HOH A O     1 
HETATM 2811 O O     . HOH D 4 .   ? 15.513  -13.344 40.154 1.00 46.33  ? 552 HOH A O     1 
HETATM 2812 O O     . HOH D 4 .   ? 13.756  -6.588  37.856 1.00 37.27  ? 553 HOH A O     1 
HETATM 2813 O O     . HOH D 4 .   ? -2.866  2.188   33.353 1.00 59.55  ? 554 HOH A O     1 
HETATM 2814 O O     . HOH D 4 .   ? 17.479  13.710  29.861 1.00 40.54  ? 555 HOH A O     1 
HETATM 2815 O O     . HOH D 4 .   ? 21.938  -2.860  35.466 1.00 49.21  ? 556 HOH A O     1 
HETATM 2816 O O     . HOH D 4 .   ? 4.937   -0.649  44.678 1.00 48.94  ? 557 HOH A O     1 
HETATM 2817 O O     . HOH D 4 .   ? 24.657  13.782  23.189 1.00 52.69  ? 558 HOH A O     1 
HETATM 2818 O O     . HOH D 4 .   ? 19.056  -11.817 13.835 1.00 41.33  ? 559 HOH A O     1 
HETATM 2819 O O     . HOH D 4 .   ? 31.333  -6.714  24.136 1.00 61.04  ? 560 HOH A O     1 
HETATM 2820 O O     . HOH D 4 .   ? 4.933   -16.206 23.542 1.00 49.19  ? 561 HOH A O     1 
HETATM 2821 O O     . HOH D 4 .   ? 7.873   10.875  15.982 1.00 32.33  ? 562 HOH A O     1 
HETATM 2822 O O     . HOH D 4 .   ? 20.633  -0.766  32.495 1.00 30.03  ? 563 HOH A O     1 
HETATM 2823 O O     . HOH D 4 .   ? -4.856  -6.124  19.368 1.00 50.72  ? 564 HOH A O     1 
HETATM 2824 O O     . HOH D 4 .   ? 17.726  -1.183  7.673  1.00 46.09  ? 565 HOH A O     1 
HETATM 2825 O O     . HOH D 4 .   ? 18.062  -8.938  38.756 1.00 62.71  ? 566 HOH A O     1 
HETATM 2826 O O     . HOH D 4 .   ? 16.903  -19.305 32.640 1.00 52.92  ? 567 HOH A O     1 
HETATM 2827 O O     . HOH D 4 .   ? 6.985   -16.062 19.272 1.00 59.42  ? 568 HOH A O     1 
HETATM 2828 O O     . HOH D 4 .   ? 19.953  -7.934  30.670 1.00 30.58  ? 569 HOH A O     1 
HETATM 2829 O O     . HOH D 4 .   ? 15.402  -7.932  28.442 1.00 26.88  ? 570 HOH A O     1 
HETATM 2830 O O     . HOH D 4 .   ? 16.055  0.765   37.875 1.00 56.60  ? 571 HOH A O     1 
HETATM 2831 O O     . HOH D 4 .   ? 14.017  -2.760  34.377 1.00 41.99  ? 572 HOH A O     1 
HETATM 2832 O O     . HOH D 4 .   ? 22.868  -20.802 43.756 1.00 31.85  ? 573 HOH A O     1 
HETATM 2833 O O     . HOH D 4 .   ? 4.735   -7.367  4.580  1.00 57.18  ? 574 HOH A O     1 
HETATM 2834 O O     . HOH D 4 .   ? 8.543   -10.283 6.824  1.00 55.74  ? 575 HOH A O     1 
HETATM 2835 O O     . HOH D 4 .   ? 1.649   1.125   44.830 1.00 58.64  ? 576 HOH A O     1 
HETATM 2836 O O     . HOH D 4 .   ? 10.903  -10.832 16.867 1.00 35.06  ? 577 HOH A O     1 
HETATM 2837 O O     . HOH D 4 .   ? 10.664  -16.959 21.422 1.00 51.68  ? 578 HOH A O     1 
HETATM 2838 O O     . HOH D 4 .   ? 17.862  11.237  15.764 1.00 63.18  ? 579 HOH A O     1 
HETATM 2839 O O     . HOH D 4 .   ? 0.740   3.909   7.373  1.00 48.69  ? 580 HOH A O     1 
HETATM 2840 O O     . HOH D 4 .   ? 8.945   11.282  40.610 1.00 59.85  ? 581 HOH A O     1 
HETATM 2841 O O     . HOH D 4 .   ? 13.577  -16.495 21.418 1.00 57.00  ? 582 HOH A O     1 
HETATM 2842 O O     . HOH D 4 .   ? 27.042  -4.464  35.787 1.00 47.76  ? 583 HOH A O     1 
HETATM 2843 O O     . HOH D 4 .   ? 28.992  2.812   27.491 1.00 49.60  ? 584 HOH A O     1 
HETATM 2844 O O     . HOH D 4 .   ? 8.434   -14.756 12.490 1.00 57.25  ? 585 HOH A O     1 
HETATM 2845 O O     . HOH D 4 .   ? 17.005  -12.778 15.256 1.00 46.25  ? 586 HOH A O     1 
HETATM 2846 O O     . HOH D 4 .   ? 18.704  -18.723 36.627 1.00 53.89  ? 587 HOH A O     1 
HETATM 2847 O O     . HOH D 4 .   ? 4.949   13.856  30.755 1.00 56.98  ? 588 HOH A O     1 
HETATM 2848 O O     . HOH D 4 .   ? 33.335  -15.399 32.076 1.00 58.04  ? 589 HOH A O     1 
HETATM 2849 O O     . HOH D 4 .   ? 20.878  -13.149 15.861 1.00 58.64  ? 590 HOH A O     1 
HETATM 2850 O O     . HOH D 4 .   ? 3.138   6.314   40.484 1.00 66.90  ? 591 HOH A O     1 
HETATM 2851 O O     . HOH D 4 .   ? 10.302  -0.956  1.461  1.00 65.10  ? 592 HOH A O     1 
HETATM 2852 O O     . HOH D 4 .   ? 25.230  13.369  28.076 1.00 56.04  ? 593 HOH A O     1 
HETATM 2853 O O     . HOH D 4 .   ? -4.411  -3.637  15.709 1.00 67.05  ? 594 HOH A O     1 
HETATM 2854 O O     . HOH D 4 .   ? -14.869 1.043   25.784 1.00 65.24  ? 595 HOH A O     1 
HETATM 2855 O O     . HOH D 4 .   ? -3.619  8.037   16.692 1.00 76.52  ? 596 HOH A O     1 
HETATM 2856 O O     . HOH D 4 .   ? -5.972  -6.056  29.557 1.00 72.13  ? 597 HOH A O     1 
HETATM 2857 O O     . HOH D 4 .   ? -0.447  6.302   11.461 1.00 67.62  ? 598 HOH A O     1 
HETATM 2858 O O     . HOH D 4 .   ? 14.405  -12.886 15.812 1.00 41.44  ? 599 HOH A O     1 
HETATM 2859 O O     . HOH D 4 .   ? 17.082  3.316   38.147 1.00 57.15  ? 600 HOH A O     1 
HETATM 2860 O O     . HOH D 4 .   ? 15.185  -19.250 29.575 1.00 63.10  ? 601 HOH A O     1 
HETATM 2861 O O     . HOH D 4 .   ? 12.229  15.639  34.954 1.00 43.06  ? 602 HOH A O     1 
HETATM 2862 O O     . HOH D 4 .   ? 8.591   13.936  32.627 1.00 50.80  ? 603 HOH A O     1 
HETATM 2863 O O     . HOH D 4 .   ? 10.929  -7.885  5.834  1.00 55.82  ? 604 HOH A O     1 
HETATM 2864 O O     . HOH D 4 .   ? 4.056   -16.840 26.994 1.00 61.07  ? 605 HOH A O     1 
HETATM 2865 O O     . HOH D 4 .   ? 19.176  13.762  23.807 1.00 40.06  ? 606 HOH A O     1 
HETATM 2866 O O     . HOH E 4 .   ? 37.829  -8.199  50.321 1.00 59.17  ? 101 HOH C O     1 
HETATM 2867 O O     . HOH E 4 .   ? 16.719  3.995   40.692 1.00 59.45  ? 102 HOH C O     1 
HETATM 2868 O O     . HOH E 4 .   ? 31.239  -17.433 71.450 1.00 56.18  ? 103 HOH C O     1 
HETATM 2869 O O     . HOH E 4 .   ? 32.041  12.171  20.717 1.00 52.67  ? 104 HOH C O     1 
HETATM 2870 O O     . HOH E 4 .   ? 36.866  -16.740 79.959 1.00 49.51  ? 105 HOH C O     1 
HETATM 2871 O O     . HOH E 4 .   ? 23.601  9.240   42.601 1.00 48.08  ? 106 HOH C O     1 
HETATM 2872 O O     . HOH E 4 .   ? 23.185  -1.692  46.056 1.00 51.90  ? 107 HOH C O     1 
HETATM 2873 O O     . HOH E 4 .   ? 33.635  -7.252  50.489 1.00 47.37  ? 108 HOH C O     1 
HETATM 2874 O O     . HOH E 4 .   ? 32.509  -17.661 78.015 1.00 56.66  ? 109 HOH C O     1 
HETATM 2875 O O     . HOH E 4 .   ? 33.026  -9.308  48.751 1.00 56.37  ? 110 HOH C O     1 
HETATM 2876 O O     . HOH E 4 .   ? 30.336  6.990   33.733 1.00 46.48  ? 111 HOH C O     1 
HETATM 2877 O O     . HOH E 4 .   ? 33.638  -11.585 69.514 1.00 60.25  ? 112 HOH C O     1 
HETATM 2878 O O     . HOH E 4 .   ? 30.414  -3.461  65.384 1.00 56.83  ? 113 HOH C O     1 
HETATM 2879 O O     . HOH E 4 .   ? 38.140  0.328   50.226 1.00 50.66  ? 114 HOH C O     1 
HETATM 2880 O O     . HOH E 4 .   ? 24.609  -1.988  39.222 1.00 62.30  ? 115 HOH C O     1 
HETATM 2881 O O     . HOH E 4 .   ? 29.822  -5.222  48.802 1.00 42.07  ? 116 HOH C O     1 
HETATM 2882 O O     . HOH E 4 .   ? 35.306  1.379   58.704 1.00 58.53  ? 117 HOH C O     1 
HETATM 2883 O O     . HOH E 4 .   ? 36.589  -3.746  72.254 1.00 68.23  ? 118 HOH C O     1 
HETATM 2884 O O     . HOH E 4 .   ? 39.419  -1.815  68.007 1.00 52.57  ? 119 HOH C O     1 
HETATM 2885 O O     . HOH E 4 .   ? 23.101  0.139   38.067 1.00 60.60  ? 120 HOH C O     1 
HETATM 2886 O O     . HOH E 4 .   ? 24.945  2.332   46.216 1.00 54.46  ? 121 HOH C O     1 
HETATM 2887 O O     . HOH E 4 .   ? 34.363  -19.610 77.940 1.00 63.97  ? 122 HOH C O     1 
HETATM 2888 O O     . HOH E 4 .   ? 36.170  -13.634 70.813 1.00 46.80  ? 123 HOH C O     1 
HETATM 2889 O O     . HOH E 4 .   ? 26.165  5.599   43.280 1.00 52.52  ? 124 HOH C O     1 
HETATM 2890 O O     . HOH E 4 .   ? 27.214  -1.364  48.209 1.00 49.15  ? 125 HOH C O     1 
HETATM 2891 O O     . HOH E 4 .   ? 38.655  -1.117  46.549 1.00 62.26  ? 126 HOH C O     1 
HETATM 2892 O O     . HOH E 4 .   ? 31.125  -6.428  50.895 1.00 51.07  ? 127 HOH C O     1 
HETATM 2893 O O     . HOH E 4 .   ? 35.980  17.401  -3.650 1.00 54.97  ? 128 HOH C O     1 
HETATM 2894 O O     . HOH E 4 .   ? 28.238  12.750  23.923 1.00 57.09  ? 129 HOH C O     1 
HETATM 2895 O O     . HOH E 4 .   ? 39.919  -3.028  64.106 1.00 52.68  ? 130 HOH C O     1 
HETATM 2896 O O     . HOH E 4 .   ? 27.890  -6.354  46.757 1.00 50.89  ? 131 HOH C O     1 
HETATM 2897 O O     . HOH E 4 .   ? 30.667  -15.345 69.749 1.00 58.15  ? 132 HOH C O     1 
HETATM 2898 O O     . HOH E 4 .   ? 24.719  -3.364  47.812 1.00 71.10  ? 133 HOH C O     1 
HETATM 2899 O O     . HOH F 4 .   ? 17.598  12.381  22.137 1.00 49.57  ? 201 HOH D O     1 
HETATM 2900 O O     . HOH F 4 .   ? 18.042  -5.915  31.787 1.00 37.10  ? 202 HOH D O     1 
HETATM 2901 O O     . HOH F 4 .   ? 30.698  -0.682  59.770 1.00 50.24  ? 203 HOH D O     1 
HETATM 2902 O O     . HOH F 4 .   ? 25.467  -0.937  54.775 1.00 57.68  ? 204 HOH D O     1 
HETATM 2903 O O     . HOH F 4 .   ? 23.507  -7.622  31.729 1.00 48.64  ? 205 HOH D O     1 
HETATM 2904 O O     . HOH F 4 .   ? 27.227  -7.921  56.778 1.00 44.02  ? 206 HOH D O     1 
HETATM 2905 O O     . HOH F 4 .   ? 22.026  -5.309  34.328 1.00 50.64  ? 207 HOH D O     1 
HETATM 2906 O O     . HOH F 4 .   ? 26.628  -1.255  23.877 1.00 53.00  ? 208 HOH D O     1 
HETATM 2907 O O     . HOH F 4 .   ? 29.467  -4.082  62.604 1.00 56.04  ? 209 HOH D O     1 
HETATM 2908 O O     . HOH F 4 .   ? 35.562  14.882  -2.196 1.00 48.74  ? 210 HOH D O     1 
HETATM 2909 O O     . HOH F 4 .   ? 38.817  10.761  46.813 1.00 57.92  ? 211 HOH D O     1 
HETATM 2910 O O     . HOH F 4 .   ? 34.827  -15.738 58.678 1.00 42.69  ? 212 HOH D O     1 
HETATM 2911 O O     . HOH F 4 .   ? 28.847  -2.952  49.812 1.00 34.27  ? 213 HOH D O     1 
HETATM 2912 O O     . HOH F 4 .   ? 39.999  -13.082 60.139 1.00 62.98  ? 214 HOH D O     1 
HETATM 2913 O O     . HOH F 4 .   ? 28.954  3.530   46.975 1.00 42.30  ? 215 HOH D O     1 
HETATM 2914 O O     . HOH F 4 .   ? 17.937  -6.985  28.649 1.00 36.04  ? 216 HOH D O     1 
HETATM 2915 O O     . HOH F 4 .   ? 26.016  -13.696 61.985 1.00 34.77  ? 217 HOH D O     1 
HETATM 2916 O O     . HOH F 4 .   ? 28.292  -4.237  53.786 1.00 51.42  ? 218 HOH D O     1 
HETATM 2917 O O     . HOH F 4 .   ? 30.743  5.532   46.982 1.00 47.44  ? 219 HOH D O     1 
HETATM 2918 O O     . HOH F 4 .   ? 27.732  13.231  21.024 1.00 46.89  ? 220 HOH D O     1 
HETATM 2919 O O     . HOH F 4 .   ? 33.437  0.548   32.301 1.00 51.28  ? 221 HOH D O     1 
HETATM 2920 O O     . HOH F 4 .   ? 36.635  -8.983  58.412 1.00 64.70  ? 222 HOH D O     1 
HETATM 2921 O O     . HOH F 4 .   ? 26.622  3.442   53.524 1.00 45.71  ? 223 HOH D O     1 
HETATM 2922 O O     . HOH F 4 .   ? 32.155  6.484   35.712 1.00 57.80  ? 224 HOH D O     1 
HETATM 2923 O O     . HOH F 4 .   ? 24.935  5.980   17.100 1.00 54.35  ? 225 HOH D O     1 
HETATM 2924 O O     . HOH F 4 .   ? 16.621  -4.114  24.962 1.00 24.24  ? 226 HOH D O     1 
HETATM 2925 O O     . HOH F 4 .   ? 34.778  3.420   34.958 1.00 64.14  ? 227 HOH D O     1 
HETATM 2926 O O     . HOH F 4 .   ? 20.348  7.005   17.480 1.00 46.76  ? 228 HOH D O     1 
HETATM 2927 O O     . HOH F 4 .   ? 26.454  13.045  12.454 1.00 63.15  ? 229 HOH D O     1 
HETATM 2928 O O     . HOH F 4 .   ? 32.908  2.446   57.489 1.00 41.79  ? 230 HOH D O     1 
HETATM 2929 O O     . HOH F 4 .   ? 26.599  -1.844  36.057 1.00 52.55  ? 231 HOH D O     1 
HETATM 2930 O O     . HOH F 4 .   ? 33.757  8.332   -5.526 1.00 60.88  ? 232 HOH D O     1 
HETATM 2931 O O     . HOH F 4 .   ? 20.883  4.664   18.880 1.00 36.34  ? 233 HOH D O     1 
HETATM 2932 O O     . HOH F 4 .   ? 37.850  0.734   44.780 1.00 48.14  ? 234 HOH D O     1 
HETATM 2933 O O     . HOH F 4 .   ? 38.524  -17.086 59.953 1.00 47.58  ? 235 HOH D O     1 
HETATM 2934 O O     . HOH F 4 .   ? 28.095  1.877   49.147 1.00 46.68  ? 236 HOH D O     1 
HETATM 2935 O O     . HOH F 4 .   ? 30.385  -5.894  53.414 1.00 54.82  ? 237 HOH D O     1 
HETATM 2936 O O     . HOH F 4 .   ? 30.893  6.768   40.593 1.00 50.96  ? 238 HOH D O     1 
HETATM 2937 O O     . HOH F 4 .   ? 32.975  -9.400  55.952 1.00 55.45  ? 239 HOH D O     1 
HETATM 2938 O O     . HOH F 4 .   ? 17.322  -2.352  27.450 1.00 30.32  ? 240 HOH D O     1 
HETATM 2939 O O     . HOH F 4 .   ? 31.521  -10.818 57.805 1.00 50.62  ? 241 HOH D O     1 
HETATM 2940 O O     . HOH F 4 .   ? 18.462  13.787  18.203 1.00 56.42  ? 242 HOH D O     1 
HETATM 2941 O O     . HOH F 4 .   ? 41.269  -15.981 60.976 1.00 61.75  ? 243 HOH D O     1 
HETATM 2942 O O     . HOH F 4 .   ? 26.964  -3.669  51.537 1.00 50.26  ? 244 HOH D O     1 
HETATM 2943 O O     . HOH F 4 .   ? 25.079  -12.893 59.295 1.00 49.86  ? 245 HOH D O     1 
HETATM 2944 O O     . HOH F 4 .   ? 24.988  -2.032  52.329 1.00 62.33  ? 246 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . GLY A 1   ? 0.9892 0.5058 1.0298 -0.2205 0.1018  -0.0487 105 GLY A N     
2    C CA    . GLY A 1   ? 0.9135 0.5020 0.9106 -0.1973 0.0970  -0.0392 105 GLY A CA    
3    C C     . GLY A 1   ? 0.9914 0.5218 0.9476 -0.1654 0.0602  0.0182  105 GLY A C     
4    O O     . GLY A 1   ? 0.9804 0.4546 0.9669 -0.1336 0.0304  0.0297  105 GLY A O     
5    N N     . SER A 2   ? 0.9639 0.5244 0.8605 -0.1716 0.0613  0.0419  106 SER A N     
6    C CA    . SER A 2   ? 0.9692 0.4980 0.8248 -0.1437 0.0331  0.0898  106 SER A CA    
7    C C     . SER A 2   ? 0.9361 0.5081 0.8254 -0.0853 0.0128  0.0735  106 SER A C     
8    O O     . SER A 2   ? 0.8620 0.4942 0.7931 -0.0715 0.0199  0.0301  106 SER A O     
9    C CB    . SER A 2   ? 1.0321 0.6076 0.8312 -0.1721 0.0452  0.1041  106 SER A CB    
10   O OG    . SER A 2   ? 1.1059 0.7904 0.9274 -0.1544 0.0532  0.0566  106 SER A OG    
11   N N     . HIS A 3   ? 0.8959 0.4401 0.7600 -0.0573 -0.0114 0.1060  107 HIS A N     
12   C CA    A HIS A 3   ? 0.8255 0.4056 0.7081 -0.0162 -0.0267 0.0897  107 HIS A CA    
13   C CA    B HIS A 3   ? 0.8250 0.4057 0.7081 -0.0164 -0.0265 0.0891  107 HIS A CA    
14   C C     . HIS A 3   ? 0.8425 0.4680 0.6861 -0.0042 -0.0271 0.1015  107 HIS A C     
15   O O     . HIS A 3   ? 0.8032 0.4332 0.6412 0.0211  -0.0402 0.1034  107 HIS A O     
16   C CB    A HIS A 3   ? 0.8661 0.3909 0.7709 0.0106  -0.0559 0.0931  107 HIS A CB    
17   C CB    B HIS A 3   ? 0.8647 0.3912 0.7723 0.0103  -0.0553 0.0909  107 HIS A CB    
18   C CG    A HIS A 3   ? 0.9618 0.4310 0.9156 0.0043  -0.0663 0.0770  107 HIS A CG    
19   C CG    B HIS A 3   ? 0.9569 0.4314 0.9150 0.0033  -0.0644 0.0731  107 HIS A CG    
20   N ND1   A HIS A 3   ? 0.9606 0.4642 0.9581 -0.0163 -0.0440 0.0420  107 HIS A ND1   
21   N ND1   B HIS A 3   ? 1.0668 0.4469 1.0302 0.0183  -0.1004 0.0903  107 HIS A ND1   
22   C CD2   A HIS A 3   ? 1.0677 0.4472 1.0354 0.0195  -0.1016 0.0878  107 HIS A CD2   
23   C CD2   B HIS A 3   ? 0.9607 0.4627 0.9667 -0.0151 -0.0455 0.0376  107 HIS A CD2   
24   C CE1   A HIS A 3   ? 1.0184 0.4539 1.0594 -0.0180 -0.0611 0.0330  107 HIS A CE1   
25   C CE1   B HIS A 3   ? 1.0941 0.4404 1.1122 0.0071  -0.1035 0.0648  107 HIS A CE1   
26   N NE2   A HIS A 3   ? 1.0947 0.4470 1.1194 0.0055  -0.1009 0.0599  107 HIS A NE2   
27   N NE2   B HIS A 3   ? 1.0301 0.4550 1.0779 -0.0152 -0.0664 0.0315  107 HIS A NE2   
28   N N     . MET A 4   ? 0.8214 0.4901 0.6460 -0.0226 -0.0137 0.0975  108 MET A N     
29   C CA    . MET A 4   ? 0.7921 0.5069 0.5941 -0.0087 -0.0199 0.0988  108 MET A CA    
30   C C     . MET A 4   ? 0.8041 0.5351 0.6076 0.0183  -0.0331 0.0797  108 MET A C     
31   O O     . MET A 4   ? 0.7659 0.5074 0.5484 0.0330  -0.0432 0.0868  108 MET A O     
32   C CB    . MET A 4   ? 0.8200 0.5939 0.6202 -0.0316 -0.0100 0.0758  108 MET A CB    
33   N N     . ALA A 5   ? 0.7604 0.4919 0.5842 0.0182  -0.0322 0.0561  109 ALA A N     
34   C CA    . ALA A 5   ? 0.7440 0.4864 0.5515 0.0276  -0.0440 0.0418  109 ALA A CA    
35   C C     . ALA A 5   ? 0.7561 0.4834 0.5494 0.0327  -0.0473 0.0518  109 ALA A C     
36   O O     . ALA A 5   ? 0.7404 0.4695 0.4954 0.0312  -0.0551 0.0509  109 ALA A O     
37   C CB    . ALA A 5   ? 0.7502 0.5130 0.5869 0.0188  -0.0387 0.0117  109 ALA A CB    
38   N N     . SER A 6   ? 0.7202 0.4277 0.5392 0.0382  -0.0450 0.0586  110 SER A N     
39   C CA    . SER A 6   ? 0.7225 0.4295 0.5387 0.0499  -0.0508 0.0529  110 SER A CA    
40   C C     . SER A 6   ? 0.7494 0.4613 0.5265 0.0583  -0.0504 0.0740  110 SER A C     
41   O O     . SER A 6   ? 0.7381 0.4633 0.5071 0.0646  -0.0504 0.0603  110 SER A O     
42   C CB    . SER A 6   ? 0.8193 0.4929 0.6713 0.0649  -0.0623 0.0538  110 SER A CB    
43   O OG    . SER A 6   ? 0.9467 0.5849 0.7756 0.0665  -0.0640 0.0964  110 SER A OG    
44   N N     . PHE A 7   ? 0.6783 0.3933 0.4406 0.0570  -0.0497 0.0953  111 PHE A N     
45   C CA    . PHE A 7   ? 0.6537 0.3865 0.3953 0.0653  -0.0513 0.1063  111 PHE A CA    
46   C C     . PHE A 7   ? 0.6877 0.4188 0.4007 0.0617  -0.0614 0.0956  111 PHE A C     
47   O O     . PHE A 7   ? 0.6540 0.3932 0.3550 0.0687  -0.0672 0.0982  111 PHE A O     
48   C CB    . PHE A 7   ? 0.6808 0.4345 0.4303 0.0632  -0.0490 0.1242  111 PHE A CB    
49   C CG    . PHE A 7   ? 0.7235 0.4544 0.4745 0.0617  -0.0467 0.1479  111 PHE A CG    
50   C CD1   . PHE A 7   ? 0.7662 0.4886 0.5130 0.0825  -0.0528 0.1532  111 PHE A CD1   
51   C CD2   . PHE A 7   ? 0.7899 0.5005 0.5403 0.0380  -0.0425 0.1618  111 PHE A CD2   
52   C CE1   . PHE A 7   ? 0.8256 0.5085 0.5641 0.0883  -0.0650 0.1777  111 PHE A CE1   
53   C CE2   . PHE A 7   ? 0.8793 0.5401 0.6126 0.0322  -0.0498 0.1931  111 PHE A CE2   
54   C CZ    . PHE A 7   ? 0.8607 0.5016 0.5869 0.0619  -0.0662 0.2032  111 PHE A CZ    
55   N N     . ASN A 8   ? 0.6549 0.3707 0.3542 0.0500  -0.0677 0.0833  112 ASN A N     
56   C CA    . ASN A 8   ? 0.6931 0.3823 0.3424 0.0413  -0.0858 0.0806  112 ASN A CA    
57   C C     . ASN A 8   ? 0.7751 0.4530 0.4145 0.0596  -0.1119 0.0841  112 ASN A C     
58   O O     . ASN A 8   ? 0.8086 0.4524 0.4090 0.0564  -0.1258 0.0898  112 ASN A O     
59   C CB    . ASN A 8   ? 0.7004 0.3822 0.3145 0.0186  -0.0734 0.0749  112 ASN A CB    
60   C CG    . ASN A 8   ? 0.8484 0.4874 0.3859 -0.0113 -0.0879 0.0777  112 ASN A CG    
61   O OD1   . ASN A 8   ? 0.7731 0.3910 0.2794 -0.0215 -0.1059 0.0800  112 ASN A OD1   
62   N ND2   . ASN A 8   ? 0.8519 0.4742 0.3503 -0.0299 -0.0807 0.0777  112 ASN A ND2   
63   N N     . GLY A 9   ? 0.7330 0.4445 0.4123 0.0753  -0.1191 0.0722  113 GLY A N     
64   C CA    . GLY A 9   ? 0.7428 0.4674 0.4346 0.0965  -0.1503 0.0541  113 GLY A CA    
65   C C     . GLY A 9   ? 0.7827 0.5461 0.5038 0.1036  -0.1444 0.0534  113 GLY A C     
66   O O     . GLY A 9   ? 0.7871 0.5673 0.5288 0.1224  -0.1750 0.0290  113 GLY A O     
67   N N     . VAL A 10  ? 0.7064 0.4901 0.4354 0.0924  -0.1105 0.0736  114 VAL A N     
68   C CA    . VAL A 10  ? 0.6690 0.5052 0.4260 0.0977  -0.1005 0.0733  114 VAL A CA    
69   C C     . VAL A 10  ? 0.7040 0.6046 0.4940 0.0856  -0.0881 0.0678  114 VAL A C     
70   O O     . VAL A 10  ? 0.6891 0.5710 0.4688 0.0696  -0.0718 0.0841  114 VAL A O     
71   C CB    . VAL A 10  ? 0.7064 0.5309 0.4458 0.0949  -0.0765 0.0923  114 VAL A CB    
72   C CG1   . VAL A 10  ? 0.6750 0.5659 0.4443 0.1031  -0.0653 0.0907  114 VAL A CG1   
73   C CG2   . VAL A 10  ? 0.7306 0.4986 0.4265 0.0881  -0.0821 0.0893  114 VAL A CG2   
74   N N     . SER A 11  ? 0.6551 0.6333 0.4842 0.0868  -0.0967 0.0395  115 SER A N     
75   C CA    . SER A 11  ? 0.6462 0.7017 0.4970 0.0583  -0.0819 0.0260  115 SER A CA    
76   C C     . SER A 11  ? 0.6861 0.7561 0.5156 0.0360  -0.0544 0.0664  115 SER A C     
77   O O     . SER A 11  ? 0.6482 0.7086 0.4705 0.0533  -0.0505 0.0871  115 SER A O     
78   C CB    . SER A 11  ? 0.6617 0.8196 0.5695 0.0619  -0.1030 -0.0348 115 SER A CB    
79   O OG    . SER A 11  ? 0.7305 0.9352 0.6663 0.0753  -0.1063 -0.0399 115 SER A OG    
80   N N     . GLU A 12  ? 0.6922 0.7854 0.5064 -0.0055 -0.0378 0.0741  116 GLU A N     
81   C CA    . GLU A 12  ? 0.7256 0.8168 0.5003 -0.0353 -0.0211 0.1187  116 GLU A CA    
82   C C     . GLU A 12  ? 0.7415 0.9330 0.5369 -0.0361 -0.0194 0.1086  116 GLU A C     
83   O O     . GLU A 12  ? 0.7431 0.9164 0.5121 -0.0248 -0.0171 0.1462  116 GLU A O     
84   C CB    . GLU A 12  ? 0.8068 0.9008 0.5507 -0.0950 -0.0049 0.1233  116 GLU A CB    
85   C CG    . GLU A 12  ? 1.0149 1.0585 0.6907 -0.1311 0.0027  0.1849  116 GLU A CG    
86   C CD    . GLU A 12  ? 1.4042 1.3715 1.0327 -0.1816 0.0134  0.2075  116 GLU A CD    
87   O OE1   . GLU A 12  ? 1.4206 1.4238 1.0038 -0.2528 0.0298  0.2149  116 GLU A OE1   
88   O OE2   . GLU A 12  ? 1.3732 1.2485 1.0089 -0.1564 0.0069  0.2147  116 GLU A OE2   
89   N N     . ALA A 13  ? 0.7574 0.8211 0.7254 0.2112  -0.1180 0.0563  117 ALA A N     
90   C CA    . ALA A 13  ? 0.7777 0.8320 0.7491 0.2453  -0.1144 0.0332  117 ALA A CA    
91   C C     . ALA A 13  ? 0.8526 0.8222 0.7984 0.2406  -0.1179 0.0216  117 ALA A C     
92   O O     . ALA A 13  ? 0.8584 0.8179 0.7991 0.2462  -0.1091 0.0019  117 ALA A O     
93   C CB    . ALA A 13  ? 0.8173 0.8974 0.8092 0.2884  -0.1261 0.0308  117 ALA A CB    
94   N N     . GLU A 14  ? 0.8152 0.7272 0.7445 0.2272  -0.1311 0.0356  118 GLU A N     
95   C CA    . GLU A 14  ? 0.8341 0.6674 0.7415 0.2160  -0.1355 0.0308  118 GLU A CA    
96   C C     . GLU A 14  ? 0.8321 0.6597 0.7292 0.1813  -0.1192 0.0269  118 GLU A C     
97   O O     . GLU A 14  ? 0.8337 0.6293 0.7253 0.1813  -0.1160 0.0105  118 GLU A O     
98   C CB    . GLU A 14  ? 0.8902 0.6753 0.7821 0.2058  -0.1516 0.0530  118 GLU A CB    
99   C CG    . GLU A 14  ? 1.1282 0.8320 1.0029 0.2026  -0.1612 0.0505  118 GLU A CG    
100  C CD    . GLU A 14  ? 1.5491 1.2046 1.4078 0.1970  -0.1793 0.0750  118 GLU A CD    
101  O OE1   . GLU A 14  ? 1.5265 1.1826 1.3932 0.2269  -0.1966 0.0808  118 GLU A OE1   
102  O OE2   . GLU A 14  ? 1.5446 1.1623 1.3829 0.1638  -0.1764 0.0890  118 GLU A OE2   
103  N N     . LEU A 15  ? 0.7320 0.5928 0.6282 0.1538  -0.1105 0.0405  119 LEU A N     
104  C CA    . LEU A 15  ? 0.6862 0.5456 0.5751 0.1236  -0.0958 0.0374  119 LEU A CA    
105  C C     . LEU A 15  ? 0.7095 0.5974 0.6090 0.1321  -0.0846 0.0189  119 LEU A C     
106  O O     . LEU A 15  ? 0.7059 0.5696 0.5989 0.1183  -0.0778 0.0097  119 LEU A O     
107  C CB    . LEU A 15  ? 0.6531 0.5407 0.5384 0.0971  -0.0917 0.0532  119 LEU A CB    
108  C CG    . LEU A 15  ? 0.7262 0.5862 0.5930 0.0833  -0.1016 0.0715  119 LEU A CG    
109  C CD1   . LEU A 15  ? 0.7036 0.5923 0.5648 0.0587  -0.0982 0.0814  119 LEU A CD1   
110  C CD2   . LEU A 15  ? 0.7497 0.5499 0.5965 0.0684  -0.0999 0.0727  119 LEU A CD2   
111  N N     . LEU A 16  ? 0.6581 0.6001 0.5742 0.1555  -0.0829 0.0143  120 LEU A N     
112  C CA    . LEU A 16  ? 0.6326 0.6104 0.5556 0.1652  -0.0717 -0.0010 120 LEU A CA    
113  C C     . LEU A 16  ? 0.7055 0.6435 0.6189 0.1820  -0.0738 -0.0240 120 LEU A C     
114  O O     . LEU A 16  ? 0.6956 0.6488 0.6066 0.1802  -0.0651 -0.0360 120 LEU A O     
115  C CB    . LEU A 16  ? 0.6228 0.6725 0.5654 0.1876  -0.0683 0.0010  120 LEU A CB    
116  C CG    . LEU A 16  ? 0.6572 0.7563 0.6137 0.1682  -0.0672 0.0232  120 LEU A CG    
117  C CD1   . LEU A 16  ? 0.6533 0.8246 0.6347 0.1937  -0.0662 0.0263  120 LEU A CD1   
118  C CD2   . LEU A 16  ? 0.6522 0.7620 0.6048 0.1342  -0.0572 0.0302  120 LEU A CD2   
119  N N     . THR A 17  ? 0.6926 0.5766 0.5991 0.1961  -0.0874 -0.0291 121 THR A N     
120  C CA    . THR A 17  ? 0.7331 0.5684 0.6297 0.2097  -0.0943 -0.0514 121 THR A CA    
121  C C     . THR A 17  ? 0.7762 0.5567 0.6623 0.1775  -0.0956 -0.0489 121 THR A C     
122  O O     . THR A 17  ? 0.7908 0.5365 0.6710 0.1805  -0.1007 -0.0669 121 THR A O     
123  C CB    . THR A 17  ? 0.9270 0.7296 0.8234 0.2442  -0.1109 -0.0596 121 THR A CB    
124  O OG1   . THR A 17  ? 0.9712 0.7265 0.8627 0.2298  -0.1228 -0.0397 121 THR A OG1   
125  C CG2   . THR A 17  ? 0.8965 0.7610 0.8080 0.2799  -0.1087 -0.0632 121 THR A CG2   
126  N N     . LYS A 18  ? 0.7108 0.4869 0.5951 0.1471  -0.0912 -0.0276 122 LYS A N     
127  C CA    . LYS A 18  ? 0.7009 0.4365 0.5785 0.1165  -0.0893 -0.0230 122 LYS A CA    
128  C C     . LYS A 18  ? 0.7181 0.4773 0.5999 0.1005  -0.0767 -0.0315 122 LYS A C     
129  O O     . LYS A 18  ? 0.6678 0.4761 0.5549 0.1049  -0.0680 -0.0331 122 LYS A O     
130  C CB    . LYS A 18  ? 0.7247 0.4490 0.5950 0.0931  -0.0882 0.0011  122 LYS A CB    
131  C CG    . LYS A 18  ? 0.8570 0.5418 0.7194 0.1037  -0.1040 0.0128  122 LYS A CG    
132  C CD    . LYS A 18  ? 0.9425 0.6154 0.7913 0.0777  -0.1026 0.0374  122 LYS A CD    
133  C CE    . LYS A 18  ? 1.0392 0.6632 0.8785 0.0524  -0.1021 0.0444  122 LYS A CE    
134  N NZ    . LYS A 18  ? 1.0162 0.6456 0.8407 0.0240  -0.0925 0.0640  122 LYS A NZ    
135  N N     . THR A 19  ? 0.6984 0.4232 0.5794 0.0820  -0.0772 -0.0358 123 THR A N     
136  C CA    . THR A 19  ? 0.6740 0.4155 0.5611 0.0667  -0.0681 -0.0433 123 THR A CA    
137  C C     . THR A 19  ? 0.6837 0.4085 0.5727 0.0360  -0.0613 -0.0303 123 THR A C     
138  O O     . THR A 19  ? 0.7018 0.3977 0.5845 0.0261  -0.0643 -0.0170 123 THR A O     
139  C CB    . THR A 19  ? 0.8232 0.5457 0.7111 0.0772  -0.0769 -0.0658 123 THR A CB    
140  O OG1   . THR A 19  ? 0.8132 0.4803 0.6999 0.0698  -0.0891 -0.0664 123 THR A OG1   
141  C CG2   . THR A 19  ? 0.8297 0.5743 0.7119 0.1104  -0.0812 -0.0827 123 THR A CG2   
142  N N     . LEU A 20  ? 0.5910 0.3350 0.4884 0.0224  -0.0524 -0.0342 124 LEU A N     
143  C CA    . LEU A 20  ? 0.5729 0.3120 0.4753 -0.0032 -0.0431 -0.0254 124 LEU A CA    
144  C C     . LEU A 20  ? 0.6322 0.3615 0.5488 -0.0114 -0.0458 -0.0375 124 LEU A C     
145  O O     . LEU A 20  ? 0.6311 0.3820 0.5537 -0.0039 -0.0464 -0.0493 124 LEU A O     
146  C CB    . LEU A 20  ? 0.5414 0.3171 0.4440 -0.0086 -0.0315 -0.0201 124 LEU A CB    
147  C CG    . LEU A 20  ? 0.6033 0.3802 0.5071 -0.0296 -0.0199 -0.0125 124 LEU A CG    
148  C CD1   . LEU A 20  ? 0.6371 0.3932 0.5262 -0.0394 -0.0186 0.0019  124 LEU A CD1   
149  C CD2   . LEU A 20  ? 0.6031 0.4095 0.5064 -0.0306 -0.0133 -0.0112 124 LEU A CD2   
150  N N     . PRO A 21  ? 0.5836 0.2822 0.5061 -0.0276 -0.0490 -0.0338 125 PRO A N     
151  C CA    . PRO A 21  ? 0.5817 0.2756 0.5219 -0.0367 -0.0540 -0.0454 125 PRO A CA    
152  C C     . PRO A 21  ? 0.5821 0.3106 0.5384 -0.0480 -0.0417 -0.0460 125 PRO A C     
153  O O     . PRO A 21  ? 0.5607 0.3059 0.5154 -0.0563 -0.0277 -0.0352 125 PRO A O     
154  C CB    . PRO A 21  ? 0.6538 0.3087 0.5984 -0.0554 -0.0601 -0.0362 125 PRO A CB    
155  C CG    . PRO A 21  ? 0.7319 0.3638 0.6560 -0.0494 -0.0622 -0.0217 125 PRO A CG    
156  C CD    . PRO A 21  ? 0.6382 0.3067 0.5523 -0.0399 -0.0497 -0.0171 125 PRO A CD    
157  N N     . ASP A 22  ? 0.5303 0.2687 0.5009 -0.0466 -0.0486 -0.0597 126 ASP A N     
158  C CA    . ASP A 22  ? 0.5143 0.2839 0.5041 -0.0549 -0.0403 -0.0609 126 ASP A CA    
159  C C     . ASP A 22  ? 0.5659 0.3338 0.5763 -0.0785 -0.0324 -0.0523 126 ASP A C     
160  O O     . ASP A 22  ? 0.5650 0.3054 0.5776 -0.0902 -0.0390 -0.0482 126 ASP A O     
161  C CB    . ASP A 22  ? 0.5344 0.3128 0.5340 -0.0478 -0.0537 -0.0769 126 ASP A CB    
162  C CG    . ASP A 22  ? 0.6974 0.4890 0.6784 -0.0255 -0.0597 -0.0858 126 ASP A CG    
163  O OD1   . ASP A 22  ? 0.6938 0.4979 0.6604 -0.0164 -0.0511 -0.0780 126 ASP A OD1   
164  O OD2   . ASP A 22  ? 0.8408 0.6335 0.8216 -0.0184 -0.0729 -0.1000 126 ASP A OD2   
165  N N     . ILE A 23  ? 0.4943 0.2920 0.5202 -0.0852 -0.0186 -0.0492 127 ILE A N     
166  C CA    . ILE A 23  ? 0.4762 0.2862 0.5262 -0.1055 -0.0079 -0.0424 127 ILE A CA    
167  C C     . ILE A 23  ? 0.4736 0.3135 0.5536 -0.1039 -0.0109 -0.0526 127 ILE A C     
168  O O     . ILE A 23  ? 0.4256 0.2904 0.5113 -0.0962 -0.0015 -0.0543 127 ILE A O     
169  C CB    . ILE A 23  ? 0.5005 0.3208 0.5393 -0.1112 0.0127  -0.0308 127 ILE A CB    
170  C CG1   . ILE A 23  ? 0.4994 0.2900 0.5056 -0.1105 0.0116  -0.0198 127 ILE A CG1   
171  C CG2   . ILE A 23  ? 0.5036 0.3442 0.5682 -0.1319 0.0265  -0.0236 127 ILE A CG2   
172  C CD1   . ILE A 23  ? 0.5300 0.3298 0.5166 -0.1127 0.0282  -0.0109 127 ILE A CD1   
173  N N     . LEU A 24  ? 0.4774 0.3114 0.5741 -0.1091 -0.0275 -0.0604 128 LEU A N     
174  C CA    . LEU A 24  ? 0.4700 0.3318 0.5948 -0.1070 -0.0355 -0.0702 128 LEU A CA    
175  C C     . LEU A 24  ? 0.5143 0.3845 0.6746 -0.1283 -0.0421 -0.0698 128 LEU A C     
176  O O     . LEU A 24  ? 0.5244 0.3651 0.6820 -0.1417 -0.0524 -0.0679 128 LEU A O     
177  C CB    . LEU A 24  ? 0.4780 0.3311 0.5854 -0.0889 -0.0546 -0.0834 128 LEU A CB    
178  C CG    . LEU A 24  ? 0.5123 0.3674 0.5900 -0.0687 -0.0497 -0.0825 128 LEU A CG    
179  C CD1   . LEU A 24  ? 0.5317 0.3760 0.5861 -0.0530 -0.0662 -0.0937 128 LEU A CD1   
180  C CD2   . LEU A 24  ? 0.5023 0.3875 0.5926 -0.0628 -0.0407 -0.0794 128 LEU A CD2   
181  N N     . THR A 25  ? 0.4617 0.3725 0.6577 -0.1316 -0.0369 -0.0707 129 THR A N     
182  C CA    . THR A 25  ? 0.4872 0.4204 0.7267 -0.1518 -0.0437 -0.0703 129 THR A CA    
183  C C     . THR A 25  ? 0.5059 0.4747 0.7708 -0.1390 -0.0533 -0.0804 129 THR A C     
184  O O     . THR A 25  ? 0.4816 0.4562 0.7303 -0.1172 -0.0502 -0.0841 129 THR A O     
185  C CB    . THR A 25  ? 0.6743 0.6343 0.9393 -0.1719 -0.0201 -0.0552 129 THR A CB    
186  O OG1   . THR A 25  ? 0.6509 0.6516 0.9302 -0.1587 -0.0010 -0.0560 129 THR A OG1   
187  C CG2   . THR A 25  ? 0.7083 0.6352 0.9425 -0.1828 -0.0085 -0.0414 129 THR A CG2   
188  N N     . PHE A 26  ? 0.4485 0.4414 0.7544 -0.1537 -0.0660 -0.0830 130 PHE A N     
189  C CA    . PHE A 26  ? 0.4467 0.4782 0.7830 -0.1430 -0.0767 -0.0905 130 PHE A CA    
190  C C     . PHE A 26  ? 0.4951 0.5725 0.8634 -0.1385 -0.0521 -0.0836 130 PHE A C     
191  O O     . PHE A 26  ? 0.5029 0.5845 0.8716 -0.1487 -0.0286 -0.0739 130 PHE A O     
192  C CB    . PHE A 26  ? 0.4896 0.5338 0.8625 -0.1631 -0.1006 -0.0954 130 PHE A CB    
193  C CG    . PHE A 26  ? 0.5537 0.5501 0.8938 -0.1655 -0.1270 -0.1067 130 PHE A CG    
194  C CD1   . PHE A 26  ? 0.6128 0.6007 0.9276 -0.1452 -0.1470 -0.1204 130 PHE A CD1   
195  C CD2   . PHE A 26  ? 0.6286 0.5865 0.9599 -0.1866 -0.1318 -0.1038 130 PHE A CD2   
196  C CE1   . PHE A 26  ? 0.6697 0.6152 0.9503 -0.1438 -0.1698 -0.1343 130 PHE A CE1   
197  C CE2   . PHE A 26  ? 0.7119 0.6214 1.0114 -0.1848 -0.1571 -0.1179 130 PHE A CE2   
198  C CZ    . PHE A 26  ? 0.6955 0.6007 0.9693 -0.1624 -0.1751 -0.1347 130 PHE A CZ    
199  N N     . ASN A 27  ? 0.4300 0.5408 0.8224 -0.1214 -0.0581 -0.0889 131 ASN A N     
200  C CA    . ASN A 27  ? 0.4109 0.5670 0.8383 -0.1111 -0.0389 -0.0868 131 ASN A CA    
201  C C     . ASN A 27  ? 0.4243 0.5666 0.8212 -0.0977 -0.0129 -0.0841 131 ASN A C     
202  O O     . ASN A 27  ? 0.4237 0.5997 0.8450 -0.0953 0.0091  -0.0826 131 ASN A O     
203  C CB    . ASN A 27  ? 0.4159 0.6204 0.8994 -0.1337 -0.0300 -0.0811 131 ASN A CB    
204  C CG    . ASN A 27  ? 0.7832 1.0097 1.3059 -0.1469 -0.0580 -0.0845 131 ASN A CG    
205  O OD1   . ASN A 27  ? 0.7361 0.9573 1.2717 -0.1753 -0.0665 -0.0802 131 ASN A OD1   
206  N ND2   . ASN A 27  ? 0.7056 0.9540 1.2467 -0.1275 -0.0755 -0.0918 131 ASN A ND2   
207  N N     . LEU A 28  ? 0.3642 0.4607 0.7089 -0.0886 -0.0158 -0.0843 132 LEU A N     
208  C CA    . LEU A 28  ? 0.3519 0.4324 0.6657 -0.0772 0.0041  -0.0824 132 LEU A CA    
209  C C     . LEU A 28  ? 0.4028 0.4945 0.7240 -0.0524 0.0024  -0.0879 132 LEU A C     
210  O O     . LEU A 28  ? 0.3781 0.4743 0.7095 -0.0424 -0.0184 -0.0905 132 LEU A O     
211  C CB    . LEU A 28  ? 0.3469 0.3795 0.6074 -0.0770 -0.0002 -0.0795 132 LEU A CB    
212  C CG    . LEU A 28  ? 0.4088 0.4188 0.6521 -0.0972 0.0045  -0.0728 132 LEU A CG    
213  C CD1   . LEU A 28  ? 0.4000 0.3692 0.5967 -0.0910 -0.0025 -0.0717 132 LEU A CD1   
214  C CD2   . LEU A 28  ? 0.4664 0.4882 0.7113 -0.1069 0.0302  -0.0655 132 LEU A CD2   
215  N N     . ASP A 29  ? 0.3599 0.4527 0.6732 -0.0422 0.0223  -0.0897 133 ASP A N     
216  C CA    . ASP A 29  ? 0.3663 0.4586 0.6826 -0.0180 0.0186  -0.0952 133 ASP A CA    
217  C C     . ASP A 29  ? 0.4073 0.4550 0.6762 -0.0123 0.0080  -0.0913 133 ASP A C     
218  O O     . ASP A 29  ? 0.4088 0.4478 0.6757 0.0013  -0.0086 -0.0903 133 ASP A O     
219  C CB    . ASP A 29  ? 0.4076 0.5150 0.7314 -0.0076 0.0429  -0.1022 133 ASP A CB    
220  C CG    . ASP A 29  ? 0.6301 0.7934 1.0061 -0.0089 0.0573  -0.1063 133 ASP A CG    
221  O OD1   . ASP A 29  ? 0.6693 0.8635 1.0877 -0.0082 0.0427  -0.1061 133 ASP A OD1   
222  O OD2   . ASP A 29  ? 0.6945 0.8747 1.0695 -0.0096 0.0829  -0.1099 133 ASP A OD2   
223  N N     . ILE A 30  ? 0.3697 0.3914 0.6014 -0.0236 0.0171  -0.0870 134 ILE A N     
224  C CA    . ILE A 30  ? 0.3500 0.3357 0.5391 -0.0196 0.0106  -0.0823 134 ILE A CA    
225  C C     . ILE A 30  ? 0.3822 0.3492 0.5431 -0.0330 0.0077  -0.0764 134 ILE A C     
226  O O     . ILE A 30  ? 0.3558 0.3240 0.5159 -0.0462 0.0190  -0.0749 134 ILE A O     
227  C CB    . ILE A 30  ? 0.3902 0.3623 0.5610 -0.0134 0.0263  -0.0857 134 ILE A CB    
228  C CG1   . ILE A 30  ? 0.3962 0.3764 0.5898 0.0064  0.0252  -0.0940 134 ILE A CG1   
229  C CG2   . ILE A 30  ? 0.3945 0.3326 0.5215 -0.0163 0.0225  -0.0791 134 ILE A CG2   
230  C CD1   . ILE A 30  ? 0.4131 0.3851 0.5948 0.0140  0.0427  -0.1037 134 ILE A CD1   
231  N N     . VAL A 31  ? 0.3457 0.2947 0.4810 -0.0287 -0.0062 -0.0719 135 VAL A N     
232  C CA    . VAL A 31  ? 0.3348 0.2657 0.4409 -0.0357 -0.0084 -0.0677 135 VAL A CA    
233  C C     . VAL A 31  ? 0.3669 0.2812 0.4427 -0.0305 -0.0076 -0.0614 135 VAL A C     
234  O O     . VAL A 31  ? 0.3579 0.2725 0.4312 -0.0221 -0.0171 -0.0581 135 VAL A O     
235  C CB    . VAL A 31  ? 0.3971 0.3294 0.5027 -0.0357 -0.0255 -0.0703 135 VAL A CB    
236  C CG1   . VAL A 31  ? 0.4106 0.3236 0.4831 -0.0359 -0.0278 -0.0676 135 VAL A CG1   
237  C CG2   . VAL A 31  ? 0.3845 0.3284 0.5192 -0.0466 -0.0276 -0.0760 135 VAL A CG2   
238  N N     . ILE A 32  ? 0.3443 0.2447 0.3985 -0.0369 0.0028  -0.0580 136 ILE A N     
239  C CA    . ILE A 32  ? 0.3409 0.2280 0.3683 -0.0349 0.0020  -0.0512 136 ILE A CA    
240  C C     . ILE A 32  ? 0.3629 0.2492 0.3737 -0.0335 -0.0072 -0.0462 136 ILE A C     
241  O O     . ILE A 32  ? 0.3578 0.2387 0.3626 -0.0372 -0.0053 -0.0472 136 ILE A O     
242  C CB    . ILE A 32  ? 0.3705 0.2457 0.3804 -0.0419 0.0150  -0.0502 136 ILE A CB    
243  C CG1   . ILE A 32  ? 0.3733 0.2535 0.3969 -0.0419 0.0282  -0.0585 136 ILE A CG1   
244  C CG2   . ILE A 32  ? 0.3579 0.2215 0.3437 -0.0419 0.0103  -0.0431 136 ILE A CG2   
245  C CD1   . ILE A 32  ? 0.4389 0.3176 0.4738 -0.0307 0.0250  -0.0647 136 ILE A CD1   
246  N N     . ILE A 33  ? 0.3383 0.2296 0.3402 -0.0278 -0.0163 -0.0400 137 ILE A N     
247  C CA    . ILE A 33  ? 0.3296 0.2285 0.3154 -0.0232 -0.0231 -0.0359 137 ILE A CA    
248  C C     . ILE A 33  ? 0.3686 0.2665 0.3364 -0.0261 -0.0205 -0.0254 137 ILE A C     
249  O O     . ILE A 33  ? 0.3594 0.2589 0.3247 -0.0284 -0.0238 -0.0167 137 ILE A O     
250  C CB    . ILE A 33  ? 0.3633 0.2772 0.3510 -0.0158 -0.0348 -0.0345 137 ILE A CB    
251  C CG1   . ILE A 33  ? 0.3676 0.2849 0.3762 -0.0138 -0.0408 -0.0451 137 ILE A CG1   
252  C CG2   . ILE A 33  ? 0.3761 0.3037 0.3436 -0.0088 -0.0390 -0.0315 137 ILE A CG2   
253  C CD1   . ILE A 33  ? 0.3710 0.3016 0.3847 -0.0074 -0.0537 -0.0412 137 ILE A CD1   
254  N N     . GLY A 34  ? 0.3386 0.2327 0.2954 -0.0269 -0.0165 -0.0252 138 GLY A N     
255  C CA    . GLY A 34  ? 0.3334 0.2319 0.2762 -0.0299 -0.0158 -0.0148 138 GLY A CA    
256  C C     . GLY A 34  ? 0.3646 0.2872 0.3007 -0.0217 -0.0210 -0.0088 138 GLY A C     
257  O O     . GLY A 34  ? 0.3606 0.2929 0.2981 -0.0129 -0.0250 -0.0143 138 GLY A O     
258  N N     . ILE A 35  ? 0.3514 0.2873 0.2800 -0.0248 -0.0212 0.0025  139 ILE A N     
259  C CA    . ILE A 35  ? 0.3629 0.3311 0.2871 -0.0172 -0.0233 0.0100  139 ILE A CA    
260  C C     . ILE A 35  ? 0.4271 0.3997 0.3466 -0.0018 -0.0222 -0.0001 139 ILE A C     
261  O O     . ILE A 35  ? 0.4283 0.4131 0.3442 0.0111  -0.0240 -0.0079 139 ILE A O     
262  C CB    . ILE A 35  ? 0.3916 0.3767 0.3148 -0.0284 -0.0246 0.0271  139 ILE A CB    
263  C CG1   . ILE A 35  ? 0.3998 0.3715 0.3265 -0.0426 -0.0293 0.0355  139 ILE A CG1   
264  C CG2   . ILE A 35  ? 0.3960 0.4258 0.3177 -0.0202 -0.0239 0.0366  139 ILE A CG2   
265  C CD1   . ILE A 35  ? 0.4724 0.4436 0.3984 -0.0600 -0.0340 0.0499  139 ILE A CD1   
266  N N     . ASN A 36  ? 0.3664 0.3267 0.2838 -0.0025 -0.0207 -0.0001 140 ASN A N     
267  C CA    . ASN A 36  ? 0.3830 0.3379 0.2964 0.0120  -0.0219 -0.0082 140 ASN A CA    
268  C C     . ASN A 36  ? 0.4685 0.4004 0.3790 0.0031  -0.0212 -0.0035 140 ASN A C     
269  O O     . ASN A 36  ? 0.4519 0.3798 0.3616 -0.0122 -0.0193 0.0041  140 ASN A O     
270  C CB    . ASN A 36  ? 0.3876 0.3820 0.2994 0.0272  -0.0222 -0.0041 140 ASN A CB    
271  C CG    . ASN A 36  ? 0.6304 0.6483 0.5459 0.0200  -0.0218 0.0120  140 ASN A CG    
272  O OD1   . ASN A 36  ? 0.5554 0.5779 0.4738 0.0019  -0.0218 0.0238  140 ASN A OD1   
273  N ND2   . ASN A 36  ? 0.4606 0.4948 0.3774 0.0348  -0.0232 0.0124  140 ASN A ND2   
274  N N     . PRO A 37  ? 0.4427 0.3563 0.3489 0.0120  -0.0240 -0.0078 141 PRO A N     
275  C CA    . PRO A 37  ? 0.4544 0.3490 0.3537 0.0027  -0.0242 0.0002  141 PRO A CA    
276  C C     . PRO A 37  ? 0.4915 0.4133 0.3895 0.0045  -0.0274 0.0123  141 PRO A C     
277  O O     . PRO A 37  ? 0.4716 0.4228 0.3753 0.0201  -0.0301 0.0131  141 PRO A O     
278  C CB    . PRO A 37  ? 0.4937 0.3594 0.3894 0.0128  -0.0291 -0.0056 141 PRO A CB    
279  C CG    . PRO A 37  ? 0.5496 0.4154 0.4508 0.0259  -0.0319 -0.0204 141 PRO A CG    
280  C CD    . PRO A 37  ? 0.4875 0.3935 0.3924 0.0310  -0.0290 -0.0198 141 PRO A CD    
281  N N     . GLY A 38  ? 0.4603 0.3747 0.3509 -0.0111 -0.0275 0.0207  142 GLY A N     
282  C CA    . GLY A 38  ? 0.4658 0.4027 0.3552 -0.0128 -0.0337 0.0327  142 GLY A CA    
283  C C     . GLY A 38  ? 0.5130 0.4339 0.3942 -0.0038 -0.0397 0.0363  142 GLY A C     
284  O O     . GLY A 38  ? 0.4873 0.3771 0.3634 0.0010  -0.0386 0.0303  142 GLY A O     
285  N N     . LEU A 39  ? 0.4498 0.3637 0.3631 0.0604  -0.0388 0.0490  143 LEU A N     
286  C CA    . LEU A 39  ? 0.4823 0.3788 0.3834 0.0684  -0.0445 0.0490  143 LEU A CA    
287  C C     . LEU A 39  ? 0.5168 0.3751 0.3898 0.0567  -0.0497 0.0404  143 LEU A C     
288  O O     . LEU A 39  ? 0.4749 0.3067 0.3282 0.0634  -0.0471 0.0363  143 LEU A O     
289  C CB    . LEU A 39  ? 0.4912 0.4140 0.4223 0.0737  -0.0540 0.0642  143 LEU A CB    
290  C CG    . LEU A 39  ? 0.5572 0.5208 0.5230 0.0902  -0.0437 0.0788  143 LEU A CG    
291  C CD1   . LEU A 39  ? 0.5557 0.5468 0.5638 0.0914  -0.0571 0.0945  143 LEU A CD1   
292  C CD2   . LEU A 39  ? 0.6096 0.5644 0.5537 0.1143  -0.0303 0.0739  143 LEU A CD2   
293  N N     . MET A 40  ? 0.4771 0.3310 0.3482 0.0411  -0.0549 0.0389  144 MET A N     
294  C CA    . MET A 40  ? 0.5036 0.3231 0.3450 0.0337  -0.0543 0.0339  144 MET A CA    
295  C C     . MET A 40  ? 0.5274 0.3282 0.3611 0.0293  -0.0406 0.0250  144 MET A C     
296  O O     . MET A 40  ? 0.5388 0.3105 0.3543 0.0285  -0.0350 0.0252  144 MET A O     
297  C CB    . MET A 40  ? 0.5417 0.3580 0.3770 0.0228  -0.0629 0.0327  144 MET A CB    
298  C CG    . MET A 40  ? 0.6309 0.4106 0.4260 0.0220  -0.0602 0.0311  144 MET A CG    
299  S SD    . MET A 40  ? 0.7444 0.5012 0.5120 0.0365  -0.0662 0.0404  144 MET A SD    
300  C CE    . MET A 40  ? 0.7160 0.4882 0.4896 0.0401  -0.0951 0.0430  144 MET A CE    
301  N N     . ALA A 41  ? 0.4593 0.2762 0.3092 0.0264  -0.0364 0.0185  145 ALA A N     
302  C CA    . ALA A 41  ? 0.4565 0.2583 0.3068 0.0223  -0.0297 0.0084  145 ALA A CA    
303  C C     . ALA A 41  ? 0.5311 0.3147 0.3749 0.0334  -0.0302 0.0042  145 ALA A C     
304  O O     . ALA A 41  ? 0.5426 0.2998 0.3859 0.0276  -0.0270 -0.0002 145 ALA A O     
305  C CB    . ALA A 41  ? 0.4503 0.2728 0.3153 0.0205  -0.0301 0.0024  145 ALA A CB    
306  N N     . ALA A 42  ? 0.4951 0.2916 0.3371 0.0501  -0.0335 0.0068  146 ALA A N     
307  C CA    . ALA A 42  ? 0.5406 0.3157 0.3724 0.0647  -0.0349 0.0013  146 ALA A CA    
308  C C     . ALA A 42  ? 0.5922 0.3390 0.4139 0.0629  -0.0346 0.0091  146 ALA A C     
309  O O     . ALA A 42  ? 0.5935 0.3075 0.4106 0.0639  -0.0343 0.0042  146 ALA A O     
310  C CB    . ALA A 42  ? 0.5523 0.3506 0.3840 0.0865  -0.0343 0.0053  146 ALA A CB    
311  N N     . TYR A 43  ? 0.5351 0.2917 0.3531 0.0606  -0.0366 0.0216  147 TYR A N     
312  C CA    . TYR A 43  ? 0.5341 0.2638 0.3339 0.0623  -0.0375 0.0313  147 TYR A CA    
313  C C     . TYR A 43  ? 0.6066 0.3036 0.3972 0.0483  -0.0270 0.0321  147 TYR A C     
314  O O     . TYR A 43  ? 0.6368 0.3013 0.4179 0.0516  -0.0229 0.0378  147 TYR A O     
315  C CB    . TYR A 43  ? 0.5137 0.2599 0.3079 0.0632  -0.0473 0.0416  147 TYR A CB    
316  C CG    . TYR A 43  ? 0.5715 0.2876 0.3374 0.0690  -0.0506 0.0521  147 TYR A CG    
317  C CD1   . TYR A 43  ? 0.6198 0.3307 0.3830 0.0863  -0.0585 0.0595  147 TYR A CD1   
318  C CD2   . TYR A 43  ? 0.6088 0.3004 0.3476 0.0604  -0.0443 0.0562  147 TYR A CD2   
319  C CE1   . TYR A 43  ? 0.6606 0.3413 0.3936 0.0941  -0.0628 0.0710  147 TYR A CE1   
320  C CE2   . TYR A 43  ? 0.6598 0.3199 0.3637 0.0693  -0.0453 0.0685  147 TYR A CE2   
321  C CZ    . TYR A 43  ? 0.7072 0.3611 0.4079 0.0857  -0.0558 0.0760  147 TYR A CZ    
322  O OH    . TYR A 43  ? 0.7583 0.3803 0.4215 0.0970  -0.0589 0.0899  147 TYR A OH    
323  N N     . LYS A 44  ? 0.5504 0.2570 0.3469 0.0340  -0.0211 0.0288  148 LYS A N     
324  C CA    . LYS A 44  ? 0.5560 0.2403 0.3507 0.0217  -0.0068 0.0326  148 LYS A CA    
325  C C     . LYS A 44  ? 0.6391 0.3122 0.4623 0.0129  -0.0018 0.0244  148 LYS A C     
326  O O     . LYS A 44  ? 0.6624 0.3112 0.4922 0.0049  0.0111  0.0326  148 LYS A O     
327  C CB    . LYS A 44  ? 0.5324 0.2317 0.3230 0.0132  -0.0022 0.0320  148 LYS A CB    
328  C CG    . LYS A 44  ? 0.5677 0.2677 0.3269 0.0205  -0.0106 0.0384  148 LYS A CG    
329  C CD    . LYS A 44  ? 0.6539 0.3195 0.3746 0.0270  -0.0018 0.0521  148 LYS A CD    
330  C CE    . LYS A 44  ? 0.7459 0.4075 0.4285 0.0360  -0.0152 0.0546  148 LYS A CE    
331  N NZ    . LYS A 44  ? 0.7998 0.4241 0.4345 0.0464  -0.0048 0.0689  148 LYS A NZ    
332  N N     . GLY A 45  ? 0.5760 0.2668 0.4168 0.0147  -0.0121 0.0096  149 GLY A N     
333  C CA    . GLY A 45  ? 0.5676 0.2492 0.4361 0.0070  -0.0154 -0.0029 149 GLY A CA    
334  C C     . GLY A 45  ? 0.5790 0.2750 0.4713 -0.0085 -0.0081 -0.0043 149 GLY A C     
335  O O     . GLY A 45  ? 0.5728 0.2606 0.4977 -0.0190 -0.0092 -0.0105 149 GLY A O     
336  N N     . HIS A 46  ? 0.5247 0.2421 0.4050 -0.0095 -0.0026 0.0009  150 HIS A N     
337  C CA    . HIS A 46  ? 0.5120 0.2443 0.4110 -0.0204 0.0056  0.0000  150 HIS A CA    
338  C C     . HIS A 46  ? 0.5030 0.2642 0.3967 -0.0166 -0.0029 -0.0057 150 HIS A C     
339  O O     . HIS A 46  ? 0.4892 0.2588 0.3631 -0.0077 -0.0099 -0.0031 150 HIS A O     
340  C CB    . HIS A 46  ? 0.5337 0.2529 0.4203 -0.0245 0.0260  0.0146  150 HIS A CB    
341  C CG    . HIS A 46  ? 0.6037 0.2960 0.5033 -0.0298 0.0402  0.0257  150 HIS A CG    
342  N ND1   . HIS A 46  ? 0.6275 0.3203 0.5728 -0.0426 0.0511  0.0273  150 HIS A ND1   
343  C CD2   . HIS A 46  ? 0.6606 0.3255 0.5374 -0.0239 0.0452  0.0380  150 HIS A CD2   
344  C CE1   . HIS A 46  ? 0.6537 0.3190 0.6062 -0.0457 0.0633  0.0414  150 HIS A CE1   
345  N NE2   . HIS A 46  ? 0.6751 0.3209 0.5835 -0.0339 0.0607  0.0485  150 HIS A NE2   
346  N N     . HIS A 47  ? 0.4482 0.2245 0.3650 -0.0236 -0.0021 -0.0115 151 HIS A N     
347  C CA    A HIS A 47  ? 0.4152 0.2157 0.3318 -0.0208 -0.0092 -0.0150 151 HIS A CA    
348  C CA    B HIS A 47  ? 0.4100 0.2105 0.3264 -0.0207 -0.0093 -0.0150 151 HIS A CA    
349  C C     . HIS A 47  ? 0.4547 0.2583 0.3552 -0.0216 -0.0034 -0.0083 151 HIS A C     
350  O O     . HIS A 47  ? 0.4447 0.2372 0.3416 -0.0257 0.0097  -0.0047 151 HIS A O     
351  C CB    A HIS A 47  ? 0.4153 0.2286 0.3625 -0.0255 -0.0138 -0.0239 151 HIS A CB    
352  C CB    B HIS A 47  ? 0.4055 0.2188 0.3523 -0.0252 -0.0142 -0.0241 151 HIS A CB    
353  C CG    A HIS A 47  ? 0.4731 0.2821 0.4312 -0.0218 -0.0284 -0.0353 151 HIS A CG    
354  C CG    B HIS A 47  ? 0.4598 0.2669 0.4183 -0.0222 -0.0279 -0.0351 151 HIS A CG    
355  N ND1   A HIS A 47  ? 0.4973 0.3184 0.4441 -0.0101 -0.0427 -0.0426 151 HIS A ND1   
356  N ND1   B HIS A 47  ? 0.4976 0.2839 0.4745 -0.0291 -0.0264 -0.0370 151 HIS A ND1   
357  C CD2   A HIS A 47  ? 0.5161 0.3060 0.4925 -0.0269 -0.0315 -0.0404 151 HIS A CD2   
358  C CD2   B HIS A 47  ? 0.4910 0.3061 0.4416 -0.0114 -0.0439 -0.0448 151 HIS A CD2   
359  C CE1   A HIS A 47  ? 0.5115 0.3188 0.4634 -0.0064 -0.0563 -0.0553 151 HIS A CE1   
360  C CE1   B HIS A 47  ? 0.5097 0.2901 0.4908 -0.0232 -0.0456 -0.0512 151 HIS A CE1   
361  N NE2   A HIS A 47  ? 0.5269 0.3147 0.5009 -0.0178 -0.0519 -0.0552 151 HIS A NE2   
362  N NE2   B HIS A 47  ? 0.5079 0.3047 0.4683 -0.0105 -0.0562 -0.0568 151 HIS A NE2   
363  N N     . TYR A 48  ? 0.4305 0.2488 0.3230 -0.0165 -0.0133 -0.0064 152 TYR A N     
364  C CA    . TYR A 48  ? 0.4237 0.2451 0.3066 -0.0175 -0.0164 -0.0026 152 TYR A CA    
365  C C     . TYR A 48  ? 0.4969 0.2956 0.3510 -0.0163 -0.0131 0.0009  152 TYR A C     
366  O O     . TYR A 48  ? 0.5166 0.3051 0.3591 -0.0176 -0.0088 -0.0013 152 TYR A O     
367  C CB    . TYR A 48  ? 0.4131 0.2426 0.3119 -0.0220 -0.0140 -0.0067 152 TYR A CB    
368  C CG    . TYR A 48  ? 0.4071 0.2562 0.3272 -0.0202 -0.0193 -0.0090 152 TYR A CG    
369  C CD1   . TYR A 48  ? 0.4245 0.2904 0.3470 -0.0149 -0.0273 -0.0028 152 TYR A CD1   
370  C CD2   . TYR A 48  ? 0.4209 0.2718 0.3592 -0.0222 -0.0167 -0.0159 152 TYR A CD2   
371  C CE1   . TYR A 48  ? 0.4158 0.2965 0.3468 -0.0085 -0.0308 -0.0033 152 TYR A CE1   
372  C CE2   . TYR A 48  ? 0.4145 0.2800 0.3644 -0.0172 -0.0261 -0.0196 152 TYR A CE2   
373  C CZ    . TYR A 48  ? 0.4371 0.3155 0.3772 -0.0088 -0.0323 -0.0131 152 TYR A CZ    
374  O OH    . TYR A 48  ? 0.4198 0.3099 0.3615 0.0000  -0.0397 -0.0146 152 TYR A OH    
375  N N     . PRO A 49  ? 0.4879 0.2770 0.3259 -0.0108 -0.0164 0.0061  153 PRO A N     
376  C CA    . PRO A 49  ? 0.5503 0.3157 0.3536 -0.0063 -0.0162 0.0104  153 PRO A CA    
377  C C     . PRO A 49  ? 0.6749 0.4440 0.4681 -0.0035 -0.0360 0.0101  153 PRO A C     
378  O O     . PRO A 49  ? 0.7446 0.4915 0.5028 0.0025  -0.0416 0.0108  153 PRO A O     
379  C CB    . PRO A 49  ? 0.5843 0.3376 0.3792 -0.0007 -0.0138 0.0169  153 PRO A CB    
380  C CG    . PRO A 49  ? 0.6034 0.3782 0.4243 0.0011  -0.0212 0.0147  153 PRO A CG    
381  C CD    . PRO A 49  ? 0.5183 0.3145 0.3644 -0.0050 -0.0209 0.0080  153 PRO A CD    
382  N N     . GLY A 50  ? 0.6003 0.3957 0.4240 -0.0065 -0.0475 0.0105  154 GLY A N     
383  C CA    . GLY A 50  ? 0.6414 0.4442 0.4724 -0.0070 -0.0687 0.0121  154 GLY A CA    
384  C C     . GLY A 50  ? 0.7254 0.5023 0.5272 -0.0074 -0.0766 0.0035  154 GLY A C     
385  O O     . GLY A 50  ? 0.7201 0.4917 0.5220 -0.0112 -0.0670 -0.0029 154 GLY A O     
386  N N     . PRO A 51  ? 0.7548 0.5106 0.5240 -0.0003 -0.0931 0.0020  155 PRO A N     
387  C CA    . PRO A 51  ? 0.7879 0.5116 0.5163 0.0041  -0.1014 -0.0095 155 PRO A CA    
388  C C     . PRO A 51  ? 0.7960 0.5242 0.5498 -0.0043 -0.1136 -0.0183 155 PRO A C     
389  O O     . PRO A 51  ? 0.8355 0.5383 0.5602 -0.0003 -0.1101 -0.0296 155 PRO A O     
390  C CB    . PRO A 51  ? 0.8567 0.5629 0.5541 0.0138  -0.1275 -0.0099 155 PRO A CB    
391  C CG    . PRO A 51  ? 0.8879 0.6265 0.6295 0.0108  -0.1368 0.0019  155 PRO A CG    
392  C CD    . PRO A 51  ? 0.7898 0.5483 0.5552 0.0069  -0.1075 0.0095  155 PRO A CD    
393  N N     . GLY A 52  ? 0.6596 0.4193 0.4682 -0.0144 -0.1246 -0.0111 156 GLY A N     
394  C CA    . GLY A 52  ? 0.6293 0.3957 0.4729 -0.0241 -0.1358 -0.0141 156 GLY A CA    
395  C C     . GLY A 52  ? 0.6006 0.3858 0.4701 -0.0291 -0.1124 -0.0093 156 GLY A C     
396  O O     . GLY A 52  ? 0.5918 0.3741 0.4802 -0.0347 -0.1173 -0.0125 156 GLY A O     
397  N N     . ASN A 53  ? 0.4936 0.2947 0.3632 -0.0260 -0.0896 -0.0027 157 ASN A N     
398  C CA    . ASN A 53  ? 0.4482 0.2662 0.3398 -0.0287 -0.0723 0.0001  157 ASN A CA    
399  C C     . ASN A 53  ? 0.5195 0.3164 0.3950 -0.0280 -0.0645 -0.0112 157 ASN A C     
400  O O     . ASN A 53  ? 0.5655 0.3368 0.4037 -0.0219 -0.0593 -0.0193 157 ASN A O     
401  C CB    . ASN A 53  ? 0.3943 0.2249 0.2845 -0.0243 -0.0560 0.0042  157 ASN A CB    
402  C CG    . ASN A 53  ? 0.4895 0.3412 0.4048 -0.0250 -0.0478 0.0078  157 ASN A CG    
403  O OD1   . ASN A 53  ? 0.4188 0.2664 0.3359 -0.0262 -0.0400 0.0018  157 ASN A OD1   
404  N ND2   . ASN A 53  ? 0.3848 0.2596 0.3175 -0.0212 -0.0488 0.0181  157 ASN A ND2   
405  N N     . HIS A 54  ? 0.4272 0.2332 0.3288 -0.0317 -0.0634 -0.0102 158 HIS A N     
406  C CA    . HIS A 54  ? 0.4278 0.2148 0.3196 -0.0290 -0.0575 -0.0206 158 HIS A CA    
407  C C     . HIS A 54  ? 0.4452 0.2393 0.3392 -0.0254 -0.0356 -0.0222 158 HIS A C     
408  O O     . HIS A 54  ? 0.4669 0.2485 0.3565 -0.0209 -0.0273 -0.0296 158 HIS A O     
409  C CB    . HIS A 54  ? 0.4149 0.2045 0.3373 -0.0342 -0.0694 -0.0178 158 HIS A CB    
410  C CG    . HIS A 54  ? 0.4460 0.2275 0.3796 -0.0406 -0.0939 -0.0160 158 HIS A CG    
411  N ND1   . HIS A 54  ? 0.4307 0.2283 0.4085 -0.0489 -0.1032 -0.0024 158 HIS A ND1   
412  C CD2   . HIS A 54  ? 0.4767 0.2358 0.3858 -0.0394 -0.1119 -0.0251 158 HIS A CD2   
413  C CE1   . HIS A 54  ? 0.4424 0.2285 0.4307 -0.0552 -0.1273 -0.0040 158 HIS A CE1   
414  N NE2   . HIS A 54  ? 0.4800 0.2426 0.4260 -0.0492 -0.1359 -0.0191 158 HIS A NE2   
415  N N     . PHE A 55  ? 0.4015 0.2148 0.3060 -0.0264 -0.0277 -0.0162 159 PHE A N     
416  C CA    . PHE A 55  ? 0.3696 0.1921 0.2889 -0.0253 -0.0130 -0.0181 159 PHE A CA    
417  C C     . PHE A 55  ? 0.4475 0.2530 0.3532 -0.0210 0.0053  -0.0236 159 PHE A C     
418  O O     . PHE A 55  ? 0.4404 0.2495 0.3638 -0.0184 0.0134  -0.0268 159 PHE A O     
419  C CB    . PHE A 55  ? 0.3574 0.1946 0.2853 -0.0263 -0.0119 -0.0142 159 PHE A CB    
420  C CG    . PHE A 55  ? 0.3609 0.2060 0.3116 -0.0270 -0.0027 -0.0180 159 PHE A CG    
421  C CD1   . PHE A 55  ? 0.3792 0.2407 0.3551 -0.0256 -0.0086 -0.0194 159 PHE A CD1   
422  C CD2   . PHE A 55  ? 0.4055 0.2413 0.3567 -0.0288 0.0111  -0.0185 159 PHE A CD2   
423  C CE1   . PHE A 55  ? 0.3703 0.2407 0.3745 -0.0264 -0.0051 -0.0239 159 PHE A CE1   
424  C CE2   . PHE A 55  ? 0.4201 0.2658 0.4059 -0.0317 0.0179  -0.0208 159 PHE A CE2   
425  C CZ    . PHE A 55  ? 0.3765 0.2403 0.3901 -0.0307 0.0076  -0.0248 159 PHE A CZ    
426  N N     . TRP A 56  ? 0.4388 0.2276 0.3153 -0.0183 0.0138  -0.0221 160 TRP A N     
427  C CA    . TRP A 56  ? 0.4683 0.2419 0.3296 -0.0118 0.0374  -0.0219 160 TRP A CA    
428  C C     . TRP A 56  ? 0.5304 0.2843 0.3677 -0.0016 0.0407  -0.0302 160 TRP A C     
429  O O     . TRP A 56  ? 0.5292 0.2830 0.3752 0.0051  0.0619  -0.0306 160 TRP A O     
430  C CB    . TRP A 56  ? 0.4703 0.2269 0.2994 -0.0088 0.0456  -0.0151 160 TRP A CB    
431  C CG    . TRP A 56  ? 0.4661 0.2371 0.3214 -0.0171 0.0447  -0.0085 160 TRP A CG    
432  C CD1   . TRP A 56  ? 0.4899 0.2642 0.3400 -0.0194 0.0277  -0.0069 160 TRP A CD1   
433  C CD2   . TRP A 56  ? 0.4545 0.2397 0.3521 -0.0235 0.0571  -0.0052 160 TRP A CD2   
434  N NE1   . TRP A 56  ? 0.4775 0.2608 0.3536 -0.0246 0.0303  -0.0040 160 TRP A NE1   
435  C CE2   . TRP A 56  ? 0.4971 0.2867 0.4047 -0.0286 0.0455  -0.0038 160 TRP A CE2   
436  C CE3   . TRP A 56  ? 0.4804 0.2740 0.4111 -0.0247 0.0768  -0.0030 160 TRP A CE3   
437  C CZ2   . TRP A 56  ? 0.4880 0.2856 0.4351 -0.0358 0.0483  -0.0033 160 TRP A CZ2   
438  C CZ3   . TRP A 56  ? 0.4959 0.3033 0.4748 -0.0338 0.0795  -0.0002 160 TRP A CZ3   
439  C CH2   . TRP A 56  ? 0.4962 0.3028 0.4812 -0.0398 0.0636  -0.0015 160 TRP A CH2   
440  N N     . LYS A 57  ? 0.5250 0.2624 0.3367 0.0001  0.0187  -0.0370 161 LYS A N     
441  C CA    . LYS A 57  ? 0.5448 0.2575 0.3333 0.0099  0.0139  -0.0489 161 LYS A CA    
442  C C     . LYS A 57  ? 0.5677 0.2949 0.3965 0.0091  0.0181  -0.0513 161 LYS A C     
443  O O     . LYS A 57  ? 0.6009 0.3138 0.4186 0.0217  0.0332  -0.0580 161 LYS A O     
444  C CB    . LYS A 57  ? 0.5743 0.2699 0.3450 0.0070  -0.0187 -0.0556 161 LYS A CB    
445  C CG    . LYS A 57  ? 0.7647 0.4228 0.4995 0.0192  -0.0286 -0.0719 161 LYS A CG    
446  C CD    . LYS A 57  ? 0.8536 0.4871 0.5626 0.0183  -0.0633 -0.0807 161 LYS A CD    
447  C CE    . LYS A 57  ? 1.0237 0.6135 0.6925 0.0333  -0.0734 -0.1009 161 LYS A CE    
448  N NZ    . LYS A 57  ? 1.1324 0.6847 0.7501 0.0412  -0.1045 -0.1147 161 LYS A NZ    
449  N N     . CYS A 58  ? 0.4850 0.2383 0.3562 -0.0024 0.0050  -0.0453 162 CYS A N     
450  C CA    . CYS A 58  ? 0.4813 0.2484 0.3896 -0.0018 0.0062  -0.0453 162 CYS A CA    
451  C C     . CYS A 58  ? 0.4885 0.2737 0.4222 0.0025  0.0290  -0.0429 162 CYS A C     
452  O O     . CYS A 58  ? 0.5013 0.2879 0.4533 0.0100  0.0357  -0.0462 162 CYS A O     
453  C CB    . CYS A 58  ? 0.4583 0.2472 0.3975 -0.0116 -0.0113 -0.0363 162 CYS A CB    
454  S SG    . CYS A 58  ? 0.5110 0.2837 0.4449 -0.0179 -0.0371 -0.0350 162 CYS A SG    
455  N N     . LEU A 59  ? 0.4412 0.2408 0.3829 -0.0026 0.0395  -0.0366 163 LEU A N     
456  C CA    . LEU A 59  ? 0.4243 0.2429 0.4023 -0.0015 0.0594  -0.0329 163 LEU A CA    
457  C C     . LEU A 59  ? 0.5260 0.3282 0.4874 0.0128  0.0865  -0.0347 163 LEU A C     
458  O O     . LEU A 59  ? 0.5184 0.3355 0.5163 0.0190  0.1011  -0.0338 163 LEU A O     
459  C CB    . LEU A 59  ? 0.4118 0.2404 0.3995 -0.0108 0.0633  -0.0259 163 LEU A CB    
460  C CG    . LEU A 59  ? 0.4568 0.3117 0.5016 -0.0164 0.0692  -0.0224 163 LEU A CG    
461  C CD1   . LEU A 59  ? 0.4411 0.3153 0.5112 -0.0212 0.0432  -0.0262 163 LEU A CD1   
462  C CD2   . LEU A 59  ? 0.4827 0.3353 0.5341 -0.0234 0.0810  -0.0151 163 LEU A CD2   
463  N N     . PHE A 60  ? 0.5189 0.2897 0.4229 0.0211  0.0922  -0.0376 164 PHE A N     
464  C CA    . PHE A 60  ? 0.5695 0.3185 0.4413 0.0404  0.1188  -0.0402 164 PHE A CA    
465  C C     . PHE A 60  ? 0.6434 0.3753 0.5047 0.0535  0.1119  -0.0537 164 PHE A C     
466  O O     . PHE A 60  ? 0.6471 0.3804 0.5191 0.0687  0.1362  -0.0542 164 PHE A O     
467  C CB    . PHE A 60  ? 0.6405 0.3568 0.4441 0.0488  0.1238  -0.0397 164 PHE A CB    
468  C CG    . PHE A 60  ? 0.7400 0.4250 0.4903 0.0745  0.1482  -0.0446 164 PHE A CG    
469  C CD1   . PHE A 60  ? 0.8035 0.5011 0.5753 0.0868  0.1887  -0.0341 164 PHE A CD1   
470  C CD2   . PHE A 60  ? 0.8368 0.4790 0.5151 0.0881  0.1306  -0.0594 164 PHE A CD2   
471  C CE1   . PHE A 60  ? 0.8967 0.5644 0.6124 0.1156  0.2162  -0.0373 164 PHE A CE1   
472  C CE2   . PHE A 60  ? 0.9575 0.5650 0.5740 0.1168  0.1526  -0.0661 164 PHE A CE2   
473  C CZ    . PHE A 60  ? 0.9519 0.5721 0.5838 0.1319  0.1979  -0.0544 164 PHE A CZ    
474  N N     . MET A 61  ? 0.6139 0.3282 0.4566 0.0485  0.0798  -0.0636 165 MET A N     
475  C CA    . MET A 61  ? 0.6535 0.3439 0.4865 0.0588  0.0674  -0.0771 165 MET A CA    
476  C C     . MET A 61  ? 0.6299 0.3456 0.5203 0.0594  0.0722  -0.0739 165 MET A C     
477  O O     . MET A 61  ? 0.6270 0.3244 0.5124 0.0753  0.0771  -0.0832 165 MET A O     
478  C CB    . MET A 61  ? 0.6938 0.3654 0.5125 0.0478  0.0302  -0.0836 165 MET A CB    
479  C CG    . MET A 61  ? 0.8132 0.4461 0.5672 0.0551  0.0182  -0.0944 165 MET A CG    
480  S SD    . MET A 61  ? 0.8783 0.5028 0.6402 0.0363  -0.0277 -0.0967 165 MET A SD    
481  C CE    . MET A 61  ? 0.8476 0.4591 0.6419 0.0358  -0.0436 -0.1039 165 MET A CE    
482  N N     . SER A 62  ? 0.5376 0.2927 0.4792 0.0447  0.0694  -0.0618 166 SER A N     
483  C CA    . SER A 62  ? 0.5095 0.2920 0.5067 0.0450  0.0686  -0.0575 166 SER A CA    
484  C C     . SER A 62  ? 0.5758 0.3805 0.6081 0.0553  0.0987  -0.0531 166 SER A C     
485  O O     . SER A 62  ? 0.5531 0.3770 0.6305 0.0610  0.0990  -0.0517 166 SER A O     
486  C CB    . SER A 62  ? 0.4707 0.2820 0.4996 0.0281  0.0490  -0.0483 166 SER A CB    
487  O OG    . SER A 62  ? 0.4976 0.3282 0.5368 0.0196  0.0584  -0.0422 166 SER A OG    
488  N N     . GLY A 63  ? 0.5448 0.3496 0.5626 0.0572  0.1234  -0.0481 167 GLY A N     
489  C CA    . GLY A 63  ? 0.5433 0.3730 0.6044 0.0650  0.1560  -0.0390 167 GLY A CA    
490  C C     . GLY A 63  ? 0.5692 0.4375 0.6917 0.0467  0.1519  -0.0279 167 GLY A C     
491  O O     . GLY A 63  ? 0.5768 0.4722 0.7542 0.0487  0.1744  -0.0184 167 GLY A O     
492  N N     . LEU A 64  ? 0.4833 0.3538 0.5993 0.0294  0.1230  -0.0290 168 LEU A N     
493  C CA    . LEU A 64  ? 0.4578 0.3561 0.6213 0.0134  0.1136  -0.0228 168 LEU A CA    
494  C C     . LEU A 64  ? 0.5523 0.4480 0.7154 0.0083  0.1388  -0.0124 168 LEU A C     
495  O O     . LEU A 64  ? 0.5372 0.4557 0.7558 -0.0027 0.1412  -0.0052 168 LEU A O     
496  C CB    . LEU A 64  ? 0.4270 0.3234 0.5726 0.0023  0.0793  -0.0274 168 LEU A CB    
497  C CG    . LEU A 64  ? 0.4553 0.3658 0.6241 0.0048  0.0547  -0.0311 168 LEU A CG    
498  C CD1   . LEU A 64  ? 0.4287 0.3325 0.5663 -0.0015 0.0287  -0.0319 168 LEU A CD1   
499  C CD2   . LEU A 64  ? 0.4479 0.3913 0.6844 0.0027  0.0487  -0.0297 168 LEU A CD2   
500  N N     . SER A 65  ? 0.5557 0.4205 0.6559 0.0172  0.1561  -0.0112 169 SER A N     
501  C CA    . SER A 65  ? 0.5755 0.4308 0.6620 0.0188  0.1866  0.0020  169 SER A CA    
502  C C     . SER A 65  ? 0.6605 0.4946 0.7039 0.0432  0.2182  0.0025  169 SER A C     
503  O O     . SER A 65  ? 0.6579 0.4701 0.6571 0.0550  0.2055  -0.0118 169 SER A O     
504  C CB    . SER A 65  ? 0.5967 0.4301 0.6350 0.0100  0.1726  0.0026  169 SER A CB    
505  O OG    . SER A 65  ? 0.6516 0.4515 0.6140 0.0209  0.1650  -0.0058 169 SER A OG    
506  N N     . GLU A 66  ? 0.5862 0.5418 0.6619 0.0395  0.0711  -0.0114 170 GLU A N     
507  C CA    . GLU A 66  ? 0.6057 0.5881 0.7062 0.0572  0.0906  -0.0381 170 GLU A CA    
508  C C     . GLU A 66  ? 0.6490 0.6212 0.7023 0.0463  0.1137  -0.0467 170 GLU A C     
509  O O     . GLU A 66  ? 0.6673 0.6603 0.7281 0.0633  0.1272  -0.0765 170 GLU A O     
510  C CB    . GLU A 66  ? 0.6255 0.6900 0.7846 0.0599  0.1035  -0.0532 170 GLU A CB    
511  C CG    . GLU A 66  ? 0.7900 0.8840 0.9575 0.0251  0.1073  -0.0388 170 GLU A CG    
512  C CD    . GLU A 66  ? 1.1950 1.2757 1.3213 -0.0075 0.1382  -0.0240 170 GLU A CD    
513  O OE1   . GLU A 66  ? 1.1799 1.2294 1.2882 -0.0328 0.1327  -0.0070 170 GLU A OE1   
514  O OE2   . GLU A 66  ? 1.2435 1.3462 1.3538 -0.0039 0.1678  -0.0295 170 GLU A OE2   
515  N N     . VAL A 67  ? 0.5864 0.5331 0.5918 0.0230  0.1156  -0.0244 171 VAL A N     
516  C CA    . VAL A 67  ? 0.5877 0.5284 0.5411 0.0183  0.1291  -0.0247 171 VAL A CA    
517  C C     . VAL A 67  ? 0.6066 0.4960 0.5284 0.0104  0.1102  -0.0116 171 VAL A C     
518  O O     . VAL A 67  ? 0.5596 0.4247 0.4910 0.0032  0.0948  0.0033  171 VAL A O     
519  C CB    . VAL A 67  ? 0.6601 0.6308 0.5907 0.0030  0.1564  -0.0033 171 VAL A CB    
520  C CG1   . VAL A 67  ? 0.6760 0.7139 0.6285 0.0100  0.1851  -0.0188 171 VAL A CG1   
521  C CG2   . VAL A 67  ? 0.6482 0.5991 0.5954 -0.0215 0.1540  0.0224  171 VAL A CG2   
522  N N     . GLN A 68  ? 0.5818 0.4686 0.4671 0.0134  0.1113  -0.0207 172 GLN A N     
523  C CA    . GLN A 68  ? 0.5772 0.4336 0.4407 0.0063  0.0972  -0.0134 172 GLN A CA    
524  C C     . GLN A 68  ? 0.6348 0.4812 0.4729 -0.0024 0.1002  0.0166  172 GLN A C     
525  O O     . GLN A 68  ? 0.6352 0.4952 0.4437 0.0023  0.1125  0.0296  172 GLN A O     
526  C CB    . GLN A 68  ? 0.6096 0.4847 0.4543 0.0139  0.0941  -0.0415 172 GLN A CB    
527  C CG    . GLN A 68  ? 0.6556 0.5199 0.4871 0.0069  0.0814  -0.0389 172 GLN A CG    
528  C CD    . GLN A 68  ? 0.7588 0.5853 0.6220 -0.0081 0.0743  -0.0361 172 GLN A CD    
529  O OE1   . GLN A 68  ? 0.7116 0.5253 0.6052 -0.0142 0.0724  -0.0592 172 GLN A OE1   
530  N NE2   . GLN A 68  ? 0.6087 0.4165 0.4643 -0.0151 0.0721  -0.0078 172 GLN A NE2   
531  N N     . LEU A 69  ? 0.5786 0.4000 0.4282 -0.0129 0.0897  0.0278  173 LEU A N     
532  C CA    . LEU A 69  ? 0.5736 0.3775 0.4103 -0.0207 0.0910  0.0442  173 LEU A CA    
533  C C     . LEU A 69  ? 0.6248 0.4170 0.4378 -0.0148 0.0817  0.0423  173 LEU A C     
534  O O     . LEU A 69  ? 0.6045 0.4072 0.4171 -0.0119 0.0753  0.0289  173 LEU A O     
535  C CB    . LEU A 69  ? 0.5593 0.3593 0.4232 -0.0335 0.0828  0.0440  173 LEU A CB    
536  C CG    . LEU A 69  ? 0.6008 0.4291 0.5037 -0.0395 0.0890  0.0408  173 LEU A CG    
537  C CD1   . LEU A 69  ? 0.5901 0.4312 0.5190 -0.0475 0.0715  0.0328  173 LEU A CD1   
538  C CD2   . LEU A 69  ? 0.6485 0.4811 0.5574 -0.0513 0.1144  0.0524  173 LEU A CD2   
539  N N     . ASN A 70  ? 0.6011 0.3732 0.4039 -0.0137 0.0826  0.0520  174 ASN A N     
540  C CA    . ASN A 70  ? 0.5887 0.3593 0.3778 -0.0029 0.0744  0.0460  174 ASN A CA    
541  C C     . ASN A 70  ? 0.6125 0.3579 0.4101 -0.0080 0.0721  0.0421  174 ASN A C     
542  O O     . ASN A 70  ? 0.6159 0.3468 0.4311 -0.0225 0.0753  0.0425  174 ASN A O     
543  C CB    . ASN A 70  ? 0.5847 0.3636 0.3485 0.0201  0.0757  0.0564  174 ASN A CB    
544  C CG    . ASN A 70  ? 0.7561 0.4988 0.5089 0.0259  0.0884  0.0857  174 ASN A CG    
545  O OD1   . ASN A 70  ? 0.7811 0.4852 0.5407 0.0305  0.0884  0.0916  174 ASN A OD1   
546  N ND2   . ASN A 70  ? 0.7518 0.5029 0.4942 0.0223  0.1035  0.1029  174 ASN A ND2   
547  N N     . HIS A 71  ? 0.5552 0.3050 0.3472 0.0039  0.0665  0.0304  175 HIS A N     
548  C CA    . HIS A 71  ? 0.5549 0.2881 0.3550 0.0042  0.0642  0.0135  175 HIS A CA    
549  C C     . HIS A 71  ? 0.6519 0.3324 0.4679 0.0018  0.0705  0.0185  175 HIS A C     
550  O O     . HIS A 71  ? 0.6726 0.3419 0.5069 -0.0104 0.0675  -0.0055 175 HIS A O     
551  C CB    . HIS A 71  ? 0.5492 0.3039 0.3457 0.0255  0.0610  -0.0019 175 HIS A CB    
552  C CG    . HIS A 71  ? 0.6069 0.3470 0.3991 0.0553  0.0594  0.0117  175 HIS A CG    
553  N ND1   . HIS A 71  ? 0.6066 0.3817 0.3868 0.0663  0.0551  0.0226  175 HIS A ND1   
554  C CD2   . HIS A 71  ? 0.6560 0.3508 0.4541 0.0793  0.0598  0.0164  175 HIS A CD2   
555  C CE1   . HIS A 71  ? 0.6363 0.3959 0.4068 0.1000  0.0507  0.0383  175 HIS A CE1   
556  N NE2   . HIS A 71  ? 0.6796 0.3839 0.4617 0.1103  0.0544  0.0394  175 HIS A NE2   
557  N N     . MET A 72  ? 0.6516 0.3027 0.4611 0.0109  0.0806  0.0492  176 MET A N     
558  C CA    . MET A 72  ? 0.7336 0.3229 0.5624 0.0037  0.0945  0.0656  176 MET A CA    
559  C C     . MET A 72  ? 0.7546 0.3445 0.6175 -0.0338 0.1033  0.0591  176 MET A C     
560  O O     . MET A 72  ? 0.7967 0.3383 0.6941 -0.0521 0.1158  0.0603  176 MET A O     
561  C CB    . MET A 72  ? 0.8302 0.3955 0.6306 0.0264  0.1065  0.1127  176 MET A CB    
562  C CG    . MET A 72  ? 0.9388 0.4958 0.7201 0.0693  0.0944  0.1175  176 MET A CG    
563  S SD    . MET A 72  ? 1.0940 0.5724 0.9161 0.0769  0.0948  0.0962  176 MET A SD    
564  C CE    . MET A 72  ? 1.0674 0.5762 0.8761 0.1317  0.0751  0.0842  176 MET A CE    
565  N N     . ASP A 73  ? 0.6629 0.3715 0.4536 -0.0627 0.1496  0.0002  177 ASP A N     
566  C CA    . ASP A 73  ? 0.6384 0.3657 0.4712 -0.0722 0.1634  -0.0085 177 ASP A CA    
567  C C     . ASP A 73  ? 0.6281 0.3741 0.5071 -0.0776 0.1480  -0.0174 177 ASP A C     
568  O O     . ASP A 73  ? 0.6084 0.3773 0.5277 -0.0859 0.1564  -0.0233 177 ASP A O     
569  C CB    . ASP A 73  ? 0.6622 0.4032 0.4899 -0.0652 0.1708  -0.0187 177 ASP A CB    
570  C CG    . ASP A 73  ? 0.8275 0.5525 0.6067 -0.0609 0.1886  -0.0126 177 ASP A CG    
571  O OD1   . ASP A 73  ? 0.8809 0.5964 0.6524 -0.0670 0.2099  -0.0004 177 ASP A OD1   
572  O OD2   . ASP A 73  ? 0.7880 0.5090 0.5351 -0.0527 0.1817  -0.0205 177 ASP A OD2   
573  N N     . ASP A 74  ? 0.5647 0.3054 0.4384 -0.0724 0.1261  -0.0175 178 ASP A N     
574  C CA    . ASP A 74  ? 0.5420 0.3016 0.4517 -0.0750 0.1098  -0.0264 178 ASP A CA    
575  C C     . ASP A 74  ? 0.5837 0.3491 0.5272 -0.0914 0.1163  -0.0298 178 ASP A C     
576  O O     . ASP A 74  ? 0.5398 0.3350 0.5207 -0.0949 0.1073  -0.0390 178 ASP A O     
577  C CB    . ASP A 74  ? 0.5567 0.3099 0.4505 -0.0655 0.0883  -0.0244 178 ASP A CB    
578  C CG    . ASP A 74  ? 0.6256 0.3498 0.4927 -0.0630 0.0889  -0.0143 178 ASP A CG    
579  O OD1   . ASP A 74  ? 0.6354 0.3362 0.4887 -0.0688 0.1066  -0.0066 178 ASP A OD1   
580  O OD2   . ASP A 74  ? 0.6203 0.3442 0.4783 -0.0533 0.0738  -0.0123 178 ASP A OD2   
581  N N     . HIS A 75  ? 0.5667 0.3047 0.4973 -0.1024 0.1320  -0.0220 179 HIS A N     
582  C CA    . HIS A 75  ? 0.5939 0.3348 0.5561 -0.1238 0.1382  -0.0270 179 HIS A CA    
583  C C     . HIS A 75  ? 0.6140 0.3919 0.6164 -0.1360 0.1539  -0.0301 179 HIS A C     
584  O O     . HIS A 75  ? 0.6131 0.4136 0.6551 -0.1548 0.1532  -0.0374 179 HIS A O     
585  C CB    . HIS A 75  ? 0.6698 0.3612 0.6038 -0.1331 0.1510  -0.0173 179 HIS A CB    
586  C CG    . HIS A 75  ? 0.7344 0.3963 0.6424 -0.1220 0.1350  -0.0176 179 HIS A CG    
587  N ND1   . HIS A 75  ? 0.7620 0.4177 0.6371 -0.0983 0.1250  -0.0096 179 HIS A ND1   
588  C CD2   . HIS A 75  ? 0.7784 0.4214 0.6911 -0.1312 0.1270  -0.0265 179 HIS A CD2   
589  C CE1   . HIS A 75  ? 0.7630 0.3986 0.6261 -0.0913 0.1133  -0.0117 179 HIS A CE1   
590  N NE2   . HIS A 75  ? 0.7805 0.4031 0.6616 -0.1097 0.1149  -0.0225 179 HIS A NE2   
591  N N     . THR A 76  ? 0.5641 0.3512 0.5563 -0.1252 0.1677  -0.0255 180 THR A N     
592  C CA    . THR A 76  ? 0.5707 0.3952 0.5991 -0.1311 0.1865  -0.0270 180 THR A CA    
593  C C     . THR A 76  ? 0.5803 0.4494 0.6469 -0.1202 0.1721  -0.0377 180 THR A C     
594  O O     . THR A 76  ? 0.5707 0.4816 0.6801 -0.1241 0.1833  -0.0397 180 THR A O     
595  C CB    . THR A 76  ? 0.7085 0.5202 0.7031 -0.1212 0.2106  -0.0183 180 THR A CB    
596  O OG1   . THR A 76  ? 0.6743 0.4876 0.6481 -0.0995 0.2007  -0.0243 180 THR A OG1   
597  C CG2   . THR A 76  ? 0.7149 0.4790 0.6602 -0.1247 0.2215  -0.0041 180 THR A CG2   
598  N N     . LEU A 77  ? 0.5165 0.3785 0.5686 -0.1053 0.1483  -0.0424 181 LEU A N     
599  C CA    . LEU A 77  ? 0.4674 0.3622 0.5466 -0.0909 0.1357  -0.0492 181 LEU A CA    
600  C C     . LEU A 77  ? 0.4914 0.4335 0.6257 -0.1000 0.1262  -0.0544 181 LEU A C     
601  O O     . LEU A 77  ? 0.4809 0.4610 0.6483 -0.0895 0.1314  -0.0554 181 LEU A O     
602  C CB    . LEU A 77  ? 0.4514 0.3253 0.5011 -0.0765 0.1150  -0.0506 181 LEU A CB    
603  C CG    . LEU A 77  ? 0.5251 0.3874 0.5515 -0.0598 0.1209  -0.0518 181 LEU A CG    
604  C CD1   . LEU A 77  ? 0.5690 0.4052 0.5571 -0.0614 0.1409  -0.0480 181 LEU A CD1   
605  C CD2   . LEU A 77  ? 0.5293 0.3755 0.5335 -0.0510 0.0999  -0.0527 181 LEU A CD2   
606  N N     . PRO A 78  ? 0.4692 0.4131 0.6154 -0.1191 0.1144  -0.0580 182 PRO A N     
607  C CA    . PRO A 78  ? 0.4578 0.4547 0.6564 -0.1292 0.1036  -0.0644 182 PRO A CA    
608  C C     . PRO A 78  ? 0.5421 0.5844 0.7867 -0.1397 0.1239  -0.0621 182 PRO A C     
609  O O     . PRO A 78  ? 0.5476 0.6452 0.8360 -0.1307 0.1188  -0.0631 182 PRO A O     
610  C CB    . PRO A 78  ? 0.4897 0.4655 0.6791 -0.1517 0.0907  -0.0712 182 PRO A CB    
611  C CG    . PRO A 78  ? 0.5443 0.4637 0.6794 -0.1409 0.0870  -0.0678 182 PRO A CG    
612  C CD    . PRO A 78  ? 0.4995 0.3980 0.6106 -0.1299 0.1081  -0.0578 182 PRO A CD    
613  N N     . GLY A 79  ? 0.5265 0.5477 0.7617 -0.1571 0.1475  -0.0571 183 GLY A N     
614  C CA    . GLY A 79  ? 0.5413 0.6065 0.8209 -0.1710 0.1709  -0.0530 183 GLY A CA    
615  C C     . GLY A 79  ? 0.5913 0.6816 0.8800 -0.1454 0.1903  -0.0476 183 GLY A C     
616  O O     . GLY A 79  ? 0.5894 0.7428 0.9319 -0.1425 0.1973  -0.0467 183 GLY A O     
617  N N     . LYS A 80  ? 0.5402 0.5820 0.7753 -0.1260 0.1991  -0.0444 184 LYS A N     
618  C CA    . LYS A 80  ? 0.5424 0.5905 0.7697 -0.1014 0.2198  -0.0422 184 LYS A CA    
619  C C     . LYS A 80  ? 0.5553 0.6179 0.7910 -0.0724 0.2056  -0.0474 184 LYS A C     
620  O O     . LYS A 80  ? 0.5586 0.6493 0.8151 -0.0533 0.2227  -0.0467 184 LYS A O     
621  C CB    . LYS A 80  ? 0.6138 0.6022 0.7746 -0.0965 0.2334  -0.0384 184 LYS A CB    
622  C CG    . LYS A 80  ? 0.9208 0.9120 1.0767 -0.1042 0.2689  -0.0298 184 LYS A CG    
623  C CD    . LYS A 80  ? 1.0671 1.0368 1.1797 -0.0794 0.2876  -0.0314 184 LYS A CD    
624  C CE    . LYS A 80  ? 1.1170 1.1310 1.2668 -0.0585 0.3033  -0.0357 184 LYS A CE    
625  N NZ    . LYS A 80  ? 1.2259 1.2095 1.3255 -0.0354 0.3227  -0.0406 184 LYS A NZ    
626  N N     . TYR A 81  ? 0.4860 0.5265 0.7033 -0.0674 0.1771  -0.0515 185 TYR A N     
627  C CA    . TYR A 81  ? 0.4660 0.5097 0.6844 -0.0405 0.1653  -0.0540 185 TYR A CA    
628  C C     . TYR A 81  ? 0.4699 0.5471 0.7216 -0.0384 0.1373  -0.0546 185 TYR A C     
629  O O     . TYR A 81  ? 0.4586 0.5414 0.7155 -0.0147 0.1297  -0.0534 185 TYR A O     
630  C CB    . TYR A 81  ? 0.4862 0.4686 0.6430 -0.0307 0.1603  -0.0567 185 TYR A CB    
631  C CG    . TYR A 81  ? 0.5326 0.4829 0.6492 -0.0300 0.1852  -0.0571 185 TYR A CG    
632  C CD1   . TYR A 81  ? 0.5712 0.5182 0.6802 -0.0096 0.2056  -0.0608 185 TYR A CD1   
633  C CD2   . TYR A 81  ? 0.5542 0.4751 0.6360 -0.0472 0.1887  -0.0534 185 TYR A CD2   
634  C CE1   . TYR A 81  ? 0.6075 0.5256 0.6736 -0.0087 0.2284  -0.0626 185 TYR A CE1   
635  C CE2   . TYR A 81  ? 0.6022 0.4967 0.6431 -0.0454 0.2107  -0.0521 185 TYR A CE2   
636  C CZ    . TYR A 81  ? 0.7363 0.6296 0.7673 -0.0269 0.2295  -0.0578 185 TYR A CZ    
637  O OH    . TYR A 81  ? 0.8166 0.6844 0.8017 -0.0251 0.2511  -0.0578 185 TYR A OH    
638  N N     . GLY A 82  ? 0.3976 0.4921 0.6667 -0.0622 0.1228  -0.0564 186 GLY A N     
639  C CA    . GLY A 82  ? 0.3664 0.4928 0.6601 -0.0622 0.0948  -0.0584 186 GLY A CA    
640  C C     . GLY A 82  ? 0.3851 0.4689 0.6362 -0.0538 0.0742  -0.0593 186 GLY A C     
641  O O     . GLY A 82  ? 0.3756 0.4797 0.6377 -0.0423 0.0541  -0.0580 186 GLY A O     
642  N N     . ILE A 83  ? 0.3405 0.3690 0.5434 -0.0590 0.0793  -0.0598 187 ILE A N     
643  C CA    . ILE A 83  ? 0.3367 0.3282 0.5002 -0.0517 0.0626  -0.0592 187 ILE A CA    
644  C C     . ILE A 83  ? 0.4056 0.3703 0.5438 -0.0693 0.0543  -0.0618 187 ILE A C     
645  O O     . ILE A 83  ? 0.4356 0.3776 0.5587 -0.0820 0.0688  -0.0614 187 ILE A O     
646  C CB    . ILE A 83  ? 0.3737 0.3263 0.5005 -0.0377 0.0732  -0.0568 187 ILE A CB    
647  C CG1   . ILE A 83  ? 0.3868 0.3542 0.5323 -0.0163 0.0820  -0.0556 187 ILE A CG1   
648  C CG2   . ILE A 83  ? 0.3693 0.2891 0.4587 -0.0352 0.0567  -0.0550 187 ILE A CG2   
649  C CD1   . ILE A 83  ? 0.4213 0.3489 0.5307 -0.0069 0.0968  -0.0577 187 ILE A CD1   
650  N N     . GLY A 84  ? 0.3394 0.3023 0.4680 -0.0666 0.0333  -0.0631 188 GLY A N     
651  C CA    . GLY A 84  ? 0.3622 0.2969 0.4636 -0.0775 0.0258  -0.0661 188 GLY A CA    
652  C C     . GLY A 84  ? 0.4075 0.3172 0.4741 -0.0641 0.0157  -0.0612 188 GLY A C     
653  O O     . GLY A 84  ? 0.3592 0.2736 0.4248 -0.0501 0.0124  -0.0562 188 GLY A O     
654  N N     . PHE A 85  ? 0.3861 0.2690 0.4253 -0.0685 0.0120  -0.0621 189 PHE A N     
655  C CA    . PHE A 85  ? 0.3790 0.2436 0.3874 -0.0565 0.0045  -0.0558 189 PHE A CA    
656  C C     . PHE A 85  ? 0.4259 0.2841 0.4202 -0.0558 -0.0068 -0.0597 189 PHE A C     
657  O O     . PHE A 85  ? 0.4535 0.2958 0.4430 -0.0667 -0.0036 -0.0671 189 PHE A O     
658  C CB    . PHE A 85  ? 0.4100 0.2437 0.3893 -0.0556 0.0167  -0.0492 189 PHE A CB    
659  C CG    . PHE A 85  ? 0.4319 0.2643 0.4109 -0.0546 0.0287  -0.0461 189 PHE A CG    
660  C CD1   . PHE A 85  ? 0.4596 0.2918 0.4270 -0.0457 0.0244  -0.0422 189 PHE A CD1   
661  C CD2   . PHE A 85  ? 0.4775 0.3073 0.4658 -0.0639 0.0456  -0.0479 189 PHE A CD2   
662  C CE1   . PHE A 85  ? 0.4746 0.3004 0.4359 -0.0451 0.0357  -0.0429 189 PHE A CE1   
663  C CE2   . PHE A 85  ? 0.5308 0.3586 0.5139 -0.0607 0.0586  -0.0464 189 PHE A CE2   
664  C CZ    . PHE A 85  ? 0.5113 0.3344 0.4779 -0.0509 0.0532  -0.0451 189 PHE A CZ    
665  N N     . THR A 86  ? 0.3831 0.2474 0.3654 -0.0429 -0.0175 -0.0540 190 THR A N     
666  C CA    . THR A 86  ? 0.3983 0.2564 0.3605 -0.0367 -0.0258 -0.0554 190 THR A CA    
667  C C     . THR A 86  ? 0.4666 0.3302 0.4151 -0.0229 -0.0301 -0.0431 190 THR A C     
668  O O     . THR A 86  ? 0.4748 0.3427 0.4287 -0.0218 -0.0278 -0.0357 190 THR A O     
669  C CB    . THR A 86  ? 0.4947 0.3718 0.4680 -0.0415 -0.0378 -0.0668 190 THR A CB    
670  O OG1   . THR A 86  ? 0.4993 0.3592 0.4442 -0.0359 -0.0412 -0.0712 190 THR A OG1   
671  C CG2   . THR A 86  ? 0.4737 0.3866 0.4655 -0.0334 -0.0495 -0.0614 190 THR A CG2   
672  N N     . ASN A 87  ? 0.4602 0.3217 0.3897 -0.0137 -0.0346 -0.0414 191 ASN A N     
673  C CA    . ASN A 87  ? 0.4613 0.3353 0.3818 -0.0024 -0.0378 -0.0283 191 ASN A CA    
674  C C     . ASN A 87  ? 0.4947 0.3841 0.4085 0.0060  -0.0462 -0.0291 191 ASN A C     
675  O O     . ASN A 87  ? 0.5030 0.3839 0.4070 0.0055  -0.0482 -0.0413 191 ASN A O     
676  C CB    . ASN A 87  ? 0.5161 0.3762 0.4162 0.0052  -0.0307 -0.0211 191 ASN A CB    
677  C CG    . ASN A 87  ? 0.7986 0.6479 0.6986 -0.0008 -0.0238 -0.0171 191 ASN A CG    
678  O OD1   . ASN A 87  ? 0.7462 0.6077 0.6509 -0.0034 -0.0260 -0.0097 191 ASN A OD1   
679  N ND2   . ASN A 87  ? 0.6846 0.5084 0.5770 -0.0047 -0.0150 -0.0223 191 ASN A ND2   
680  N N     . MET A 88  ? 0.4279 0.3374 0.3436 0.0124  -0.0503 -0.0164 192 MET A N     
681  C CA    . MET A 88  ? 0.4455 0.3720 0.3511 0.0222  -0.0562 -0.0132 192 MET A CA    
682  C C     . MET A 88  ? 0.5192 0.4374 0.3997 0.0338  -0.0506 -0.0150 192 MET A C     
683  O O     . MET A 88  ? 0.5283 0.4421 0.3920 0.0390  -0.0532 -0.0258 192 MET A O     
684  C CB    . MET A 88  ? 0.4763 0.4221 0.3899 0.0244  -0.0580 0.0045  192 MET A CB    
685  C CG    . MET A 88  ? 0.5428 0.5078 0.4437 0.0354  -0.0615 0.0120  192 MET A CG    
686  S SD    . MET A 88  ? 0.6147 0.5928 0.5235 0.0368  -0.0729 0.0111  192 MET A SD    
687  C CE    . MET A 88  ? 0.5846 0.5835 0.4818 0.0472  -0.0714 0.0344  192 MET A CE    
688  N N     . VAL A 89  ? 0.4491 0.3646 0.3257 0.0386  -0.0430 -0.0056 193 VAL A N     
689  C CA    . VAL A 89  ? 0.4728 0.3830 0.3278 0.0550  -0.0353 -0.0035 193 VAL A CA    
690  C C     . VAL A 89  ? 0.5358 0.4150 0.3833 0.0548  -0.0277 -0.0084 193 VAL A C     
691  O O     . VAL A 89  ? 0.5018 0.3801 0.3613 0.0456  -0.0271 -0.0031 193 VAL A O     
692  C CB    . VAL A 89  ? 0.5171 0.4612 0.3765 0.0645  -0.0328 0.0164  193 VAL A CB    
693  C CG1   . VAL A 89  ? 0.5382 0.4819 0.3794 0.0858  -0.0229 0.0209  193 VAL A CG1   
694  C CG2   . VAL A 89  ? 0.5091 0.4793 0.3719 0.0652  -0.0373 0.0237  193 VAL A CG2   
695  N N     . GLU A 90  ? 0.5286 0.3788 0.3522 0.0657  -0.0206 -0.0179 194 GLU A N     
696  C CA    . GLU A 90  ? 0.5663 0.3779 0.3776 0.0674  -0.0109 -0.0209 194 GLU A CA    
697  C C     . GLU A 90  ? 0.6125 0.4330 0.4186 0.0850  -0.0037 -0.0022 194 GLU A C     
698  O O     . GLU A 90  ? 0.6255 0.4283 0.4301 0.0823  0.0009  0.0027  194 GLU A O     
699  C CB    . GLU A 90  ? 0.6342 0.4042 0.4179 0.0726  -0.0051 -0.0385 194 GLU A CB    
700  C CG    . GLU A 90  ? 0.8809 0.5988 0.6486 0.0716  0.0069  -0.0430 194 GLU A CG    
701  C CD    . GLU A 90  ? 1.2338 0.9029 0.9737 0.0699  0.0120  -0.0645 194 GLU A CD    
702  O OE1   . GLU A 90  ? 0.9997 0.6608 0.7141 0.0903  0.0161  -0.0685 194 GLU A OE1   
703  O OE2   . GLU A 90  ? 1.2598 0.8986 1.0029 0.0468  0.0127  -0.0781 194 GLU A OE2   
704  N N     . ARG A 91  ? 0.5609 0.4113 0.3636 0.1043  -0.0023 0.0090  195 ARG A N     
705  C CA    . ARG A 91  ? 0.5633 0.4343 0.3645 0.1245  0.0035  0.0281  195 ARG A CA    
706  C C     . ARG A 91  ? 0.5649 0.4659 0.3870 0.1118  -0.0040 0.0414  195 ARG A C     
707  O O     . ARG A 91  ? 0.5149 0.4390 0.3566 0.0920  -0.0135 0.0410  195 ARG A O     
708  C CB    . ARG A 91  ? 0.5779 0.4860 0.3778 0.1452  0.0069  0.0374  195 ARG A CB    
709  C CG    . ARG A 91  ? 0.6188 0.5509 0.4166 0.1730  0.0153  0.0568  195 ARG A CG    
710  C CD    . ARG A 91  ? 0.8092 0.7718 0.6021 0.1970  0.0237  0.0633  195 ARG A CD    
711  N NE    . ARG A 91  ? 0.7652 0.7834 0.5840 0.1825  0.0158  0.0727  195 ARG A NE    
712  C CZ    . ARG A 91  ? 0.8710 0.9488 0.7172 0.1813  0.0124  0.0935  195 ARG A CZ    
713  N NH1   . ARG A 91  ? 0.6923 0.7897 0.5444 0.1963  0.0143  0.1075  195 ARG A NH1   
714  N NH2   . ARG A 91  ? 0.6300 0.7493 0.4977 0.1644  0.0070  0.1014  195 ARG A NH2   
715  N N     . THR A 92  ? 0.5489 0.4469 0.3630 0.1244  0.0004  0.0532  196 THR A N     
716  C CA    . THR A 92  ? 0.5431 0.4709 0.3699 0.1141  -0.0076 0.0652  196 THR A CA    
717  C C     . THR A 92  ? 0.5999 0.5910 0.4446 0.1222  -0.0134 0.0822  196 THR A C     
718  O O     . THR A 92  ? 0.6002 0.6069 0.4402 0.1484  -0.0060 0.0917  196 THR A O     
719  C CB    . THR A 92  ? 0.6030 0.5021 0.4095 0.1266  -0.0006 0.0725  196 THR A CB    
720  O OG1   . THR A 92  ? 0.5841 0.4301 0.3798 0.1114  0.0049  0.0576  196 THR A OG1   
721  C CG2   . THR A 92  ? 0.5960 0.5333 0.4087 0.1223  -0.0100 0.0872  196 THR A CG2   
722  N N     . THR A 93  ? 0.5515 0.5781 0.4165 0.0991  -0.0255 0.0858  197 THR A N     
723  C CA    . THR A 93  ? 0.5427 0.6341 0.4296 0.0977  -0.0329 0.1020  197 THR A CA    
724  C C     . THR A 93  ? 0.6041 0.7134 0.4993 0.0719  -0.0461 0.1027  197 THR A C     
725  O O     . THR A 93  ? 0.5979 0.6686 0.4846 0.0540  -0.0479 0.0888  197 THR A O     
726  C CB    . THR A 93  ? 0.6011 0.7159 0.5054 0.0891  -0.0328 0.1022  197 THR A CB    
727  O OG1   . THR A 93  ? 0.6258 0.7141 0.5339 0.0626  -0.0382 0.0890  197 THR A OG1   
728  C CG2   . THR A 93  ? 0.5350 0.6401 0.4275 0.1147  -0.0203 0.1012  197 THR A CG2   
729  N N     . PRO A 94  ? 0.5850 0.7542 0.4973 0.0672  -0.0558 0.1172  198 PRO A N     
730  C CA    . PRO A 94  ? 0.5936 0.7752 0.5088 0.0381  -0.0699 0.1134  198 PRO A CA    
731  C C     . PRO A 94  ? 0.6640 0.8276 0.5894 0.0063  -0.0735 0.1005  198 PRO A C     
732  O O     . PRO A 94  ? 0.6854 0.8197 0.5998 -0.0138 -0.0783 0.0875  198 PRO A O     
733  C CB    . PRO A 94  ? 0.6157 0.8731 0.5501 0.0403  -0.0803 0.1321  198 PRO A CB    
734  C CG    . PRO A 94  ? 0.6788 0.9571 0.6154 0.0799  -0.0687 0.1477  198 PRO A CG    
735  C CD    . PRO A 94  ? 0.6136 0.8445 0.5433 0.0873  -0.0544 0.1369  198 PRO A CD    
736  N N     . GLY A 95  ? 0.7455 1.2304 0.5023 -0.2510 -0.1726 0.1977  199 GLY A N     
737  C CA    . GLY A 95  ? 0.7071 1.1621 0.4535 -0.2576 -0.1403 0.1327  199 GLY A CA    
738  C C     . GLY A 95  ? 0.6883 1.0701 0.4608 -0.2039 -0.1122 0.1104  199 GLY A C     
739  O O     . GLY A 95  ? 0.6611 1.0186 0.4647 -0.1566 -0.1130 0.1395  199 GLY A O     
740  N N     . SER A 96  ? 0.6174 0.9654 0.3819 -0.2130 -0.0881 0.0572  200 SER A N     
741  C CA    . SER A 96  ? 0.5881 0.8723 0.3721 -0.1718 -0.0668 0.0382  200 SER A CA    
742  C C     . SER A 96  ? 0.5947 0.8864 0.4214 -0.1399 -0.0639 0.0605  200 SER A C     
743  O O     . SER A 96  ? 0.5756 0.8237 0.4105 -0.1044 -0.0499 0.0576  200 SER A O     
744  C CB    . SER A 96  ? 0.6365 0.8888 0.4169 -0.1924 -0.0481 -0.0166 200 SER A CB    
745  O OG    . SER A 96  ? 0.7266 1.0051 0.5264 -0.2225 -0.0473 -0.0367 200 SER A OG    
746  N N     . LYS A 97  ? 0.5425 0.8954 0.3938 -0.1571 -0.0768 0.0826  201 LYS A N     
747  C CA    . LYS A 97  ? 0.5336 0.9104 0.4311 -0.1345 -0.0710 0.1040  201 LYS A CA    
748  C C     . LYS A 97  ? 0.5910 0.9768 0.5191 -0.0869 -0.0700 0.1400  201 LYS A C     
749  O O     . LYS A 97  ? 0.5661 0.9648 0.5294 -0.0609 -0.0541 0.1494  201 LYS A O     
750  C CB    . LYS A 97  ? 0.5748 1.0190 0.4963 -0.1746 -0.0859 0.1124  201 LYS A CB    
751  C CG    . LYS A 97  ? 0.7384 1.1633 0.6506 -0.2145 -0.0787 0.0691  201 LYS A CG    
752  C CD    . LYS A 97  ? 0.8669 1.2768 0.8170 -0.2024 -0.0635 0.0713  201 LYS A CD    
753  C CE    . LYS A 97  ? 0.9211 1.3212 0.8857 -0.2456 -0.0636 0.0392  201 LYS A CE    
754  N NZ    . LYS A 97  ? 0.8960 1.2929 0.9023 -0.2405 -0.0548 0.0570  201 LYS A NZ    
755  N N     . ASP A 98  ? 0.5729 0.9518 0.4918 -0.0772 -0.0847 0.1585  202 ASP A N     
756  C CA    . ASP A 98  ? 0.5894 0.9674 0.5509 -0.0308 -0.0846 0.1884  202 ASP A CA    
757  C C     . ASP A 98  ? 0.6401 0.9441 0.5843 0.0082  -0.0602 0.1638  202 ASP A C     
758  O O     . ASP A 98  ? 0.6567 0.9505 0.6380 0.0484  -0.0536 0.1761  202 ASP A O     
759  C CB    . ASP A 98  ? 0.6438 1.0484 0.6159 -0.0411 -0.1185 0.2298  202 ASP A CB    
760  C CG    . ASP A 98  ? 0.8175 1.3070 0.8098 -0.0803 -0.1480 0.2610  202 ASP A CG    
761  O OD1   . ASP A 98  ? 0.8243 1.3651 0.8739 -0.0697 -0.1453 0.2746  202 ASP A OD1   
762  O OD2   . ASP A 98  ? 0.9132 1.4234 0.8615 -0.1261 -0.1731 0.2707  202 ASP A OD2   
763  N N     . LEU A 99  ? 0.5821 0.8364 0.4771 -0.0043 -0.0476 0.1275  203 LEU A N     
764  C CA    . LEU A 99  ? 0.5944 0.7827 0.4656 0.0236  -0.0306 0.1044  203 LEU A CA    
765  C C     . LEU A 99  ? 0.6263 0.8103 0.4977 0.0382  -0.0070 0.0902  203 LEU A C     
766  O O     . LEU A 99  ? 0.6092 0.8105 0.4784 0.0147  -0.0047 0.0854  203 LEU A O     
767  C CB    . LEU A 99  ? 0.5977 0.7384 0.4235 0.0018  -0.0353 0.0793  203 LEU A CB    
768  C CG    . LEU A 99  ? 0.6828 0.8297 0.4945 -0.0217 -0.0545 0.0917  203 LEU A CG    
769  C CD1   . LEU A 99  ? 0.6836 0.8025 0.4598 -0.0496 -0.0507 0.0591  203 LEU A CD1   
770  C CD2   . LEU A 99  ? 0.7330 0.8537 0.5589 0.0063  -0.0628 0.1156  203 LEU A CD2   
771  N N     . SER A 100 ? 0.5939 0.7548 0.4674 0.0732  0.0107  0.0831  204 SER A N     
772  C CA    . SER A 100 ? 0.6013 0.7635 0.4616 0.0827  0.0355  0.0702  204 SER A CA    
773  C C     . SER A 100 ? 0.6520 0.7581 0.4572 0.0709  0.0340  0.0485  204 SER A C     
774  O O     . SER A 100 ? 0.6325 0.6943 0.4173 0.0661  0.0196  0.0373  204 SER A O     
775  C CB    . SER A 100 ? 0.6733 0.8419 0.5579 0.1215  0.0598  0.0633  204 SER A CB    
776  O OG    . SER A 100 ? 0.8230 0.9285 0.6839 0.1403  0.0597  0.0419  204 SER A OG    
777  N N     . SER A 101 ? 0.6276 0.7412 0.4130 0.0637  0.0471  0.0472  205 SER A N     
778  C CA    . SER A 101 ? 0.6382 0.7079 0.3789 0.0508  0.0404  0.0369  205 SER A CA    
779  C C     . SER A 101 ? 0.6983 0.7183 0.4020 0.0689  0.0417  0.0136  205 SER A C     
780  O O     . SER A 101 ? 0.6999 0.6779 0.3822 0.0581  0.0238  0.0052  205 SER A O     
781  C CB    . SER A 101 ? 0.7142 0.8108 0.4386 0.0381  0.0536  0.0503  205 SER A CB    
782  O OG    . SER A 101 ? 0.8753 0.9326 0.5555 0.0253  0.0417  0.0482  205 SER A OG    
783  N N     . LYS A 102 ? 0.6814 0.7074 0.3864 0.0957  0.0635  0.0007  206 LYS A N     
784  C CA    . LYS A 102 ? 0.7058 0.6826 0.3806 0.1128  0.0682  -0.0281 206 LYS A CA    
785  C C     . LYS A 102 ? 0.7030 0.6357 0.3902 0.1135  0.0445  -0.0295 206 LYS A C     
786  O O     . LYS A 102 ? 0.7025 0.5878 0.3557 0.1071  0.0331  -0.0463 206 LYS A O     
787  C CB    . LYS A 102 ? 0.7668 0.7613 0.4637 0.1441  0.1007  -0.0468 206 LYS A CB    
788  C CG    . LYS A 102 ? 0.8869 0.9286 0.5601 0.1399  0.1328  -0.0541 206 LYS A CG    
789  C CD    . LYS A 102 ? 0.9888 1.0382 0.6794 0.1715  0.1718  -0.0909 206 LYS A CD    
790  C CE    . LYS A 102 ? 1.1684 1.2827 0.8431 0.1653  0.2119  -0.0993 206 LYS A CE    
791  N NZ    . LYS A 102 ? 1.3267 1.4321 0.9030 0.1310  0.2128  -0.1086 206 LYS A NZ    
792  N N     . GLU A 103 ? 0.6394 0.5943 0.3733 0.1156  0.0351  -0.0084 207 GLU A N     
793  C CA    . GLU A 103 ? 0.6136 0.5413 0.3575 0.1080  0.0134  -0.0014 207 GLU A CA    
794  C C     . GLU A 103 ? 0.6194 0.5307 0.3380 0.0787  -0.0021 -0.0073 207 GLU A C     
795  O O     . GLU A 103 ? 0.5964 0.4687 0.3021 0.0723  -0.0131 -0.0173 207 GLU A O     
796  C CB    . GLU A 103 ? 0.6105 0.5830 0.3994 0.1048  0.0037  0.0292  207 GLU A CB    
797  C CG    . GLU A 103 ? 0.7627 0.7509 0.6022 0.1372  0.0120  0.0420  207 GLU A CG    
798  C CD    . GLU A 103 ? 1.0322 1.0656 0.9151 0.1275  -0.0093 0.0816  207 GLU A CD    
799  O OE1   . GLU A 103 ? 0.8466 0.9411 0.7518 0.1182  -0.0085 0.0975  207 GLU A OE1   
800  O OE2   . GLU A 103 ? 0.9430 0.9528 0.8324 0.1223  -0.0298 0.0994  207 GLU A OE2   
801  N N     . PHE A 104 ? 0.5851 0.5263 0.3065 0.0607  -0.0023 -0.0019 208 PHE A N     
802  C CA    . PHE A 104 ? 0.5612 0.4873 0.2787 0.0370  -0.0148 -0.0108 208 PHE A CA    
803  C C     . PHE A 104 ? 0.6148 0.4998 0.3044 0.0392  -0.0209 -0.0243 208 PHE A C     
804  O O     . PHE A 104 ? 0.6176 0.4783 0.3111 0.0284  -0.0331 -0.0350 208 PHE A O     
805  C CB    . PHE A 104 ? 0.5609 0.5195 0.2996 0.0190  -0.0144 -0.0030 208 PHE A CB    
806  C CG    . PHE A 104 ? 0.5535 0.5497 0.3176 0.0013  -0.0161 0.0014  208 PHE A CG    
807  C CD1   . PHE A 104 ? 0.5646 0.5569 0.3321 -0.0182 -0.0223 -0.0129 208 PHE A CD1   
808  C CD2   . PHE A 104 ? 0.5782 0.6201 0.3615 -0.0027 -0.0112 0.0179  208 PHE A CD2   
809  C CE1   . PHE A 104 ? 0.5714 0.6043 0.3500 -0.0432 -0.0238 -0.0127 208 PHE A CE1   
810  C CE2   . PHE A 104 ? 0.5892 0.6695 0.3908 -0.0268 -0.0171 0.0203  208 PHE A CE2   
811  C CZ    . PHE A 104 ? 0.5651 0.6401 0.3593 -0.0483 -0.0234 0.0034  208 PHE A CZ    
812  N N     . ARG A 105 ? 0.6012 0.4847 0.2619 0.0497  -0.0120 -0.0243 209 ARG A N     
813  C CA    . ARG A 105 ? 0.6146 0.4670 0.2374 0.0450  -0.0220 -0.0340 209 ARG A CA    
814  C C     . ARG A 105 ? 0.6892 0.4996 0.2921 0.0545  -0.0250 -0.0559 209 ARG A C     
815  O O     . ARG A 105 ? 0.6944 0.4768 0.2833 0.0429  -0.0434 -0.0640 209 ARG A O     
816  C CB    . ARG A 105 ? 0.6290 0.5029 0.2165 0.0430  -0.0106 -0.0263 209 ARG A CB    
817  C CG    . ARG A 105 ? 0.6776 0.5747 0.2875 0.0225  -0.0221 0.0012  209 ARG A CG    
818  C CD    . ARG A 105 ? 0.7966 0.7242 0.3737 0.0121  -0.0118 0.0200  209 ARG A CD    
819  N NE    . ARG A 105 ? 0.8427 0.8116 0.4257 0.0260  0.0202  0.0177  209 ARG A NE    
820  C CZ    . ARG A 105 ? 0.9843 0.9755 0.5265 0.0322  0.0469  0.0069  209 ARG A CZ    
821  N NH1   . ARG A 105 ? 0.9342 0.9095 0.4117 0.0207  0.0441  -0.0036 209 ARG A NH1   
822  N NH2   . ARG A 105 ? 0.7970 0.8321 0.3654 0.0478  0.0772  0.0043  209 ARG A NH2   
823  N N     . GLU A 106 ? 0.6637 0.4691 0.2767 0.0743  -0.0106 -0.0627 210 GLU A N     
824  C CA    . GLU A 106 ? 0.6742 0.4327 0.2826 0.0817  -0.0156 -0.0802 210 GLU A CA    
825  C C     . GLU A 106 ? 0.7084 0.4581 0.3411 0.0628  -0.0352 -0.0709 210 GLU A C     
826  O O     . GLU A 106 ? 0.7116 0.4278 0.3346 0.0521  -0.0490 -0.0830 210 GLU A O     
827  C CB    . GLU A 106 ? 0.7004 0.4576 0.3376 0.1082  0.0010  -0.0803 210 GLU A CB    
828  C CG    . GLU A 106 ? 0.8492 0.5538 0.4998 0.1140  -0.0082 -0.0887 210 GLU A CG    
829  C CD    . GLU A 106 ? 1.1358 0.8300 0.8298 0.1445  0.0052  -0.0878 210 GLU A CD    
830  O OE1   . GLU A 106 ? 0.9691 0.7068 0.7046 0.1545  0.0085  -0.0597 210 GLU A OE1   
831  O OE2   . GLU A 106 ? 1.2180 0.8606 0.9115 0.1579  0.0112  -0.1162 210 GLU A OE2   
832  N N     . GLY A 107 ? 0.6218 0.4085 0.2845 0.0544  -0.0346 -0.0525 211 GLY A N     
833  C CA    . GLY A 107 ? 0.6038 0.3960 0.2859 0.0320  -0.0444 -0.0497 211 GLY A CA    
834  C C     . GLY A 107 ? 0.6310 0.4142 0.3176 0.0161  -0.0552 -0.0632 211 GLY A C     
835  O O     . GLY A 107 ? 0.6224 0.3906 0.3187 0.0030  -0.0630 -0.0711 211 GLY A O     
836  N N     . GLY A 108 ? 0.5773 0.3722 0.2642 0.0165  -0.0572 -0.0615 212 GLY A N     
837  C CA    . GLY A 108 ? 0.5795 0.3684 0.2847 0.0049  -0.0733 -0.0653 212 GLY A CA    
838  C C     . GLY A 108 ? 0.6622 0.4178 0.3461 0.0030  -0.0900 -0.0739 212 GLY A C     
839  O O     . GLY A 108 ? 0.6568 0.4091 0.3738 -0.0093 -0.1047 -0.0793 212 GLY A O     
840  N N     . ARG A 109 ? 0.6540 0.3875 0.2875 0.0138  -0.0866 -0.0793 213 ARG A N     
841  C CA    . ARG A 109 ? 0.6867 0.3860 0.2897 0.0078  -0.1024 -0.0938 213 ARG A CA    
842  C C     . ARG A 109 ? 0.7290 0.4055 0.3553 0.0008  -0.1066 -0.1036 213 ARG A C     
843  O O     . ARG A 109 ? 0.7339 0.4009 0.3737 -0.0150 -0.1267 -0.1088 213 ARG A O     
844  C CB    . ARG A 109 ? 0.6970 0.3801 0.2413 0.0192  -0.0900 -0.1079 213 ARG A CB    
845  C CG    . ARG A 109 ? 0.7967 0.4380 0.3042 0.0105  -0.1025 -0.1336 213 ARG A CG    
846  C CD    . ARG A 109 ? 0.9111 0.5370 0.3611 0.0200  -0.0830 -0.1609 213 ARG A CD    
847  N NE    . ARG A 109 ? 0.8987 0.5200 0.3705 0.0483  -0.0520 -0.1687 213 ARG A NE    
848  C CZ    . ARG A 109 ? 1.1095 0.6912 0.6103 0.0607  -0.0474 -0.1804 213 ARG A CZ    
849  N NH1   . ARG A 109 ? 0.9217 0.4638 0.4270 0.0446  -0.0687 -0.1888 213 ARG A NH1   
850  N NH2   . ARG A 109 ? 0.9667 0.5497 0.4998 0.0880  -0.0242 -0.1796 213 ARG A NH2   
851  N N     . ILE A 110 ? 0.6866 0.3612 0.3239 0.0090  -0.0905 -0.1001 214 ILE A N     
852  C CA    . ILE A 110 ? 0.6994 0.3577 0.3575 -0.0027 -0.0934 -0.0994 214 ILE A CA    
853  C C     . ILE A 110 ? 0.7058 0.3971 0.4058 -0.0249 -0.0971 -0.0973 214 ILE A C     
854  O O     . ILE A 110 ? 0.7036 0.3848 0.4210 -0.0423 -0.1067 -0.1031 214 ILE A O     
855  C CB    . ILE A 110 ? 0.7401 0.3961 0.4030 0.0090  -0.0802 -0.0841 214 ILE A CB    
856  C CG1   . ILE A 110 ? 0.8016 0.4164 0.4441 0.0336  -0.0745 -0.0951 214 ILE A CG1   
857  C CG2   . ILE A 110 ? 0.7587 0.4099 0.4430 -0.0124 -0.0853 -0.0708 214 ILE A CG2   
858  C CD1   . ILE A 110 ? 0.8073 0.4375 0.4669 0.0564  -0.0601 -0.0784 214 ILE A CD1   
859  N N     . LEU A 111 ? 0.6238 0.3555 0.3456 -0.0252 -0.0873 -0.0930 215 LEU A N     
860  C CA    . LEU A 111 ? 0.5809 0.3478 0.3517 -0.0434 -0.0824 -0.1012 215 LEU A CA    
861  C C     . LEU A 111 ? 0.6408 0.4042 0.4484 -0.0492 -0.1009 -0.1102 215 LEU A C     
862  O O     . LEU A 111 ? 0.6130 0.3895 0.4604 -0.0660 -0.1004 -0.1205 215 LEU A O     
863  C CB    . LEU A 111 ? 0.5465 0.3483 0.3338 -0.0414 -0.0686 -0.1008 215 LEU A CB    
864  C CG    . LEU A 111 ? 0.5500 0.3877 0.3952 -0.0590 -0.0567 -0.1209 215 LEU A CG    
865  C CD1   . LEU A 111 ? 0.5664 0.4286 0.4113 -0.0837 -0.0401 -0.1302 215 LEU A CD1   
866  C CD2   . LEU A 111 ? 0.5042 0.3646 0.3638 -0.0575 -0.0462 -0.1240 215 LEU A CD2   
867  N N     . VAL A 112 ? 0.6376 0.3886 0.4337 -0.0385 -0.1189 -0.1028 216 VAL A N     
868  C CA    . VAL A 112 ? 0.6586 0.4117 0.4962 -0.0458 -0.1450 -0.1018 216 VAL A CA    
869  C C     . VAL A 112 ? 0.6926 0.4245 0.5202 -0.0591 -0.1603 -0.1095 216 VAL A C     
870  O O     . VAL A 112 ? 0.6653 0.4148 0.5535 -0.0715 -0.1727 -0.1136 216 VAL A O     
871  C CB    . VAL A 112 ? 0.7530 0.5034 0.5775 -0.0392 -0.1668 -0.0821 216 VAL A CB    
872  C CG1   . VAL A 112 ? 0.8048 0.5270 0.5480 -0.0400 -0.1815 -0.0785 216 VAL A CG1   
873  C CG2   . VAL A 112 ? 0.7587 0.5266 0.6646 -0.0455 -0.1929 -0.0721 216 VAL A CG2   
874  N N     . GLN A 113 ? 0.6949 0.4152 0.4888 -0.0162 -0.1775 -0.1248 217 GLN A N     
875  C CA    . GLN A 113 ? 0.7113 0.4082 0.5186 -0.0294 -0.1948 -0.1400 217 GLN A CA    
876  C C     . GLN A 113 ? 0.6973 0.4198 0.5701 -0.0500 -0.1845 -0.1364 217 GLN A C     
877  O O     . GLN A 113 ? 0.6642 0.3919 0.5792 -0.0660 -0.2033 -0.1464 217 GLN A O     
878  C CB    . GLN A 113 ? 0.7726 0.4239 0.5287 -0.0200 -0.1880 -0.1450 217 GLN A CB    
879  C CG    . GLN A 113 ? 0.9932 0.6051 0.6839 -0.0027 -0.2065 -0.1561 217 GLN A CG    
880  C CD    . GLN A 113 ? 1.3054 0.8729 0.9393 0.0127  -0.1931 -0.1588 217 GLN A CD    
881  O OE1   . GLN A 113 ? 1.2353 0.7945 0.8805 0.0079  -0.1769 -0.1561 217 GLN A OE1   
882  N NE2   . GLN A 113 ? 1.2650 0.8001 0.8324 0.0341  -0.1979 -0.1633 217 GLN A NE2   
883  N N     . LYS A 114 ? 0.6391 0.3775 0.5208 -0.0489 -0.1544 -0.1214 218 LYS A N     
884  C CA    . LYS A 114 ? 0.6068 0.3649 0.5389 -0.0645 -0.1386 -0.1150 218 LYS A CA    
885  C C     . LYS A 114 ? 0.6135 0.4108 0.5965 -0.0720 -0.1458 -0.1144 218 LYS A C     
886  O O     . LYS A 114 ? 0.6103 0.4208 0.6449 -0.0882 -0.1454 -0.1167 218 LYS A O     
887  C CB    . LYS A 114 ? 0.6220 0.3843 0.5398 -0.0566 -0.1094 -0.0996 218 LYS A CB    
888  C CG    . LYS A 114 ? 0.7020 0.4271 0.5858 -0.0519 -0.0994 -0.0993 218 LYS A CG    
889  C CD    . LYS A 114 ? 0.7569 0.4887 0.6259 -0.0407 -0.0766 -0.0847 218 LYS A CD    
890  C CE    . LYS A 114 ? 0.8217 0.5178 0.6545 -0.0306 -0.0680 -0.0838 218 LYS A CE    
891  N NZ    . LYS A 114 ? 0.7978 0.5035 0.6179 -0.0170 -0.0508 -0.0699 218 LYS A NZ    
892  N N     . LEU A 115 ? 0.5469 0.3617 0.5172 -0.0598 -0.1519 -0.1111 219 LEU A N     
893  C CA    . LEU A 115 ? 0.5195 0.3685 0.5330 -0.0626 -0.1594 -0.1105 219 LEU A CA    
894  C C     . LEU A 115 ? 0.6022 0.4548 0.6466 -0.0703 -0.1905 -0.1249 219 LEU A C     
895  O O     . LEU A 115 ? 0.5791 0.4617 0.6841 -0.0801 -0.1925 -0.1259 219 LEU A O     
896  C CB    . LEU A 115 ? 0.4988 0.3583 0.4868 -0.0477 -0.1582 -0.1025 219 LEU A CB    
897  C CG    . LEU A 115 ? 0.5342 0.3984 0.5068 -0.0425 -0.1313 -0.0886 219 LEU A CG    
898  C CD1   . LEU A 115 ? 0.5183 0.3884 0.4675 -0.0308 -0.1334 -0.0815 219 LEU A CD1   
899  C CD2   . LEU A 115 ? 0.5367 0.4196 0.5490 -0.0507 -0.1125 -0.0833 219 LEU A CD2   
900  N N     . GLN A 116 ? 0.5950 0.4164 0.5992 -0.0652 -0.2149 -0.1363 220 GLN A N     
901  C CA    . GLN A 116 ? 0.6276 0.4459 0.6551 -0.0720 -0.2520 -0.1526 220 GLN A CA    
902  C C     . GLN A 116 ? 0.6818 0.5008 0.7632 -0.0950 -0.2542 -0.1599 220 GLN A C     
903  O O     . GLN A 116 ? 0.6961 0.5294 0.8272 -0.1062 -0.2821 -0.1713 220 GLN A O     
904  C CB    . GLN A 116 ? 0.7010 0.4760 0.6574 -0.0579 -0.2775 -0.1634 220 GLN A CB    
905  C CG    . GLN A 116 ? 0.7855 0.5614 0.6973 -0.0369 -0.2792 -0.1557 220 GLN A CG    
906  C CD    . GLN A 116 ? 1.0511 0.7793 0.8795 -0.0193 -0.2915 -0.1614 220 GLN A CD    
907  O OE1   . GLN A 116 ? 0.9698 0.6643 0.7578 -0.0166 -0.2819 -0.1646 220 GLN A OE1   
908  N NE2   . GLN A 116 ? 0.9626 0.6841 0.7581 -0.0040 -0.3096 -0.1611 220 GLN A NE2   
909  N N     . LYS A 117 ? 0.6331 0.4367 0.7077 -0.1023 -0.2256 -0.1527 221 LYS A N     
910  C CA    . LYS A 117 ? 0.6309 0.4290 0.7534 -0.1255 -0.2222 -0.1566 221 LYS A CA    
911  C C     . LYS A 117 ? 0.6494 0.4940 0.8458 -0.1372 -0.1976 -0.1447 221 LYS A C     
912  O O     . LYS A 117 ? 0.6665 0.5369 0.9333 -0.1533 -0.2103 -0.1503 221 LYS A O     
913  C CB    . LYS A 117 ? 0.6618 0.4166 0.7370 -0.1249 -0.2012 -0.1526 221 LYS A CB    
914  C CG    . LYS A 117 ? 0.8180 0.5573 0.9338 -0.1489 -0.1937 -0.1541 221 LYS A CG    
915  C CD    . LYS A 117 ? 0.9185 0.6177 0.9851 -0.1436 -0.1672 -0.1457 221 LYS A CD    
916  C CE    . LYS A 117 ? 1.0991 0.7770 1.2020 -0.1675 -0.1565 -0.1445 221 LYS A CE    
917  N NZ    . LYS A 117 ? 1.2501 0.8902 1.3056 -0.1597 -0.1279 -0.1333 221 LYS A NZ    
918  N N     . TYR A 118 ? 0.5504 0.4052 0.7300 -0.1275 -0.1632 -0.1286 222 TYR A N     
919  C CA    . TYR A 118 ? 0.5163 0.4047 0.7473 -0.1337 -0.1335 -0.1160 222 TYR A CA    
920  C C     . TYR A 118 ? 0.5097 0.4428 0.7828 -0.1269 -0.1410 -0.1157 222 TYR A C     
921  O O     . TYR A 118 ? 0.5004 0.4650 0.8371 -0.1358 -0.1252 -0.1108 222 TYR A O     
922  C CB    . TYR A 118 ? 0.5057 0.3792 0.6927 -0.1239 -0.0986 -0.1008 222 TYR A CB    
923  C CG    . TYR A 118 ? 0.5488 0.3808 0.7089 -0.1319 -0.0872 -0.0990 222 TYR A CG    
924  C CD1   . TYR A 118 ? 0.5920 0.4183 0.7955 -0.1522 -0.0721 -0.0958 222 TYR A CD1   
925  C CD2   . TYR A 118 ? 0.5730 0.3706 0.6665 -0.1187 -0.0908 -0.1000 222 TYR A CD2   
926  C CE1   . TYR A 118 ? 0.6179 0.3996 0.7936 -0.1592 -0.0627 -0.0939 222 TYR A CE1   
927  C CE2   . TYR A 118 ? 0.6171 0.3734 0.6842 -0.1231 -0.0816 -0.0990 222 TYR A CE2   
928  C CZ    . TYR A 118 ? 0.7125 0.4583 0.8182 -0.1434 -0.0684 -0.0960 222 TYR A CZ    
929  O OH    . TYR A 118 ? 0.7099 0.4090 0.7863 -0.1473 -0.0591 -0.0940 222 TYR A OH    
930  N N     . GLN A 119 ? 0.4302 0.3641 0.6686 -0.1104 -0.1634 -0.1205 223 GLN A N     
931  C CA    . GLN A 119 ? 0.4146 0.3833 0.6836 -0.1005 -0.1762 -0.1214 223 GLN A CA    
932  C C     . GLN A 119 ? 0.4326 0.4315 0.7356 -0.0968 -0.1437 -0.1090 223 GLN A C     
933  O O     . GLN A 119 ? 0.4106 0.4450 0.7829 -0.1019 -0.1423 -0.1098 223 GLN A O     
934  C CB    . GLN A 119 ? 0.4526 0.4391 0.7765 -0.1094 -0.2126 -0.1356 223 GLN A CB    
935  C CG    . GLN A 119 ? 0.5967 0.5444 0.8741 -0.1101 -0.2469 -0.1496 223 GLN A CG    
936  C CD    . GLN A 119 ? 0.7786 0.7375 1.0930 -0.1133 -0.2924 -0.1655 223 GLN A CD    
937  O OE1   . GLN A 119 ? 0.7362 0.7267 1.0822 -0.1033 -0.3075 -0.1661 223 GLN A OE1   
938  N NE2   . GLN A 119 ? 0.7114 0.6389 1.0150 -0.1249 -0.3187 -0.1797 223 GLN A NE2   
939  N N     . PRO A 120 ? 0.3679 0.3523 0.6230 -0.0868 -0.1176 -0.0978 224 PRO A N     
940  C CA    . PRO A 120 ? 0.3480 0.3527 0.6224 -0.0798 -0.0897 -0.0879 224 PRO A CA    
941  C C     . PRO A 120 ? 0.3995 0.4279 0.6896 -0.0656 -0.1060 -0.0908 224 PRO A C     
942  O O     . PRO A 120 ? 0.4009 0.4203 0.6638 -0.0587 -0.1344 -0.0969 224 PRO A O     
943  C CB    . PRO A 120 ? 0.3669 0.3435 0.5747 -0.0707 -0.0716 -0.0789 224 PRO A CB    
944  C CG    . PRO A 120 ? 0.4265 0.3811 0.5859 -0.0665 -0.0951 -0.0838 224 PRO A CG    
945  C CD    . PRO A 120 ? 0.3852 0.3356 0.5676 -0.0791 -0.1155 -0.0945 224 PRO A CD    
946  N N     . ARG A 121 ? 0.3590 0.4117 0.6838 -0.0584 -0.0868 -0.0857 225 ARG A N     
947  C CA    . ARG A 121 ? 0.3432 0.4132 0.6779 -0.0420 -0.1027 -0.0883 225 ARG A CA    
948  C C     . ARG A 121 ? 0.3727 0.4138 0.6355 -0.0292 -0.1094 -0.0852 225 ARG A C     
949  O O     . ARG A 121 ? 0.3700 0.4099 0.6203 -0.0189 -0.1343 -0.0887 225 ARG A O     
950  C CB    . ARG A 121 ? 0.3599 0.4575 0.7404 -0.0331 -0.0766 -0.0832 225 ARG A CB    
951  C CG    . ARG A 121 ? 0.4606 0.5973 0.9293 -0.0447 -0.0689 -0.0848 225 ARG A CG    
952  C CD    . ARG A 121 ? 0.6700 0.8288 1.1716 -0.0318 -0.0344 -0.0773 225 ARG A CD    
953  N NE    . ARG A 121 ? 0.8127 1.0065 1.3969 -0.0448 -0.0117 -0.0738 225 ARG A NE    
954  C CZ    . ARG A 121 ? 0.9848 1.2267 1.6567 -0.0446 -0.0225 -0.0780 225 ARG A CZ    
955  N NH1   . ARG A 121 ? 0.7768 1.0339 1.4587 -0.0297 -0.0579 -0.0865 225 ARG A NH1   
956  N NH2   . ARG A 121 ? 0.8493 1.1245 1.6018 -0.0591 0.0019  -0.0729 225 ARG A NH2   
957  N N     . ILE A 122 ? 0.3477 0.3648 0.5645 -0.0297 -0.0877 -0.0778 226 ILE A N     
958  C CA    . ILE A 122 ? 0.3391 0.3325 0.4977 -0.0202 -0.0924 -0.0738 226 ILE A CA    
959  C C     . ILE A 122 ? 0.4115 0.3804 0.5268 -0.0273 -0.0859 -0.0699 226 ILE A C     
960  O O     . ILE A 122 ? 0.4175 0.3802 0.5312 -0.0327 -0.0647 -0.0659 226 ILE A O     
961  C CB    . ILE A 122 ? 0.3831 0.3733 0.5306 -0.0075 -0.0758 -0.0688 226 ILE A CB    
962  C CG1   . ILE A 122 ? 0.3709 0.3875 0.5679 0.0025  -0.0742 -0.0719 226 ILE A CG1   
963  C CG2   . ILE A 122 ? 0.3886 0.3552 0.4849 -0.0003 -0.0871 -0.0656 226 ILE A CG2   
964  C CD1   . ILE A 122 ? 0.4514 0.4628 0.6421 0.0150  -0.0466 -0.0677 226 ILE A CD1   
965  N N     . ALA A 123 ? 0.3717 0.3258 0.4504 -0.0249 -0.1023 -0.0698 227 ALA A N     
966  C CA    . ALA A 123 ? 0.3799 0.3138 0.4179 -0.0274 -0.0974 -0.0653 227 ALA A CA    
967  C C     . ALA A 123 ? 0.4063 0.3318 0.4163 -0.0205 -0.0913 -0.0579 227 ALA A C     
968  O O     . ALA A 123 ? 0.4157 0.3390 0.4149 -0.0147 -0.1029 -0.0564 227 ALA A O     
969  C CB    . ALA A 123 ? 0.3955 0.3190 0.4118 -0.0268 -0.1162 -0.0689 227 ALA A CB    
970  N N     . VAL A 124 ? 0.3566 0.2741 0.3540 -0.0210 -0.0749 -0.0532 228 VAL A N     
971  C CA    . VAL A 124 ? 0.3369 0.2443 0.3099 -0.0157 -0.0732 -0.0480 228 VAL A CA    
972  C C     . VAL A 124 ? 0.3835 0.2822 0.3313 -0.0175 -0.0753 -0.0425 228 VAL A C     
973  O O     . VAL A 124 ? 0.3944 0.2877 0.3349 -0.0191 -0.0666 -0.0409 228 VAL A O     
974  C CB    . VAL A 124 ? 0.3937 0.2944 0.3644 -0.0114 -0.0569 -0.0473 228 VAL A CB    
975  C CG1   . VAL A 124 ? 0.3796 0.2634 0.3198 -0.0064 -0.0606 -0.0443 228 VAL A CG1   
976  C CG2   . VAL A 124 ? 0.4077 0.3214 0.4094 -0.0071 -0.0509 -0.0516 228 VAL A CG2   
977  N N     . PHE A 125 ? 0.3515 0.2487 0.2882 -0.0166 -0.0854 -0.0386 229 PHE A N     
978  C CA    . PHE A 125 ? 0.3588 0.2540 0.2809 -0.0179 -0.0856 -0.0319 229 PHE A CA    
979  C C     . PHE A 125 ? 0.4037 0.2928 0.3181 -0.0176 -0.0859 -0.0286 229 PHE A C     
980  O O     . PHE A 125 ? 0.4179 0.3010 0.3304 -0.0177 -0.0929 -0.0283 229 PHE A O     
981  C CB    . PHE A 125 ? 0.3775 0.2739 0.2935 -0.0179 -0.0929 -0.0270 229 PHE A CB    
982  C CG    . PHE A 125 ? 0.3913 0.2870 0.3042 -0.0158 -0.0957 -0.0315 229 PHE A CG    
983  C CD1   . PHE A 125 ? 0.4088 0.3055 0.3323 -0.0145 -0.1045 -0.0388 229 PHE A CD1   
984  C CD2   . PHE A 125 ? 0.3983 0.2911 0.2976 -0.0137 -0.0911 -0.0294 229 PHE A CD2   
985  C CE1   . PHE A 125 ? 0.4347 0.3282 0.3552 -0.0132 -0.1123 -0.0452 229 PHE A CE1   
986  C CE2   . PHE A 125 ? 0.4555 0.3401 0.3444 -0.0109 -0.0965 -0.0358 229 PHE A CE2   
987  C CZ    . PHE A 125 ? 0.4582 0.3424 0.3573 -0.0115 -0.1091 -0.0441 229 PHE A CZ    
988  N N     . ASN A 126 ? 0.3732 0.2594 0.2802 -0.0164 -0.0804 -0.0271 230 ASN A N     
989  C CA    . ASN A 126 ? 0.3889 0.2662 0.2840 -0.0146 -0.0848 -0.0251 230 ASN A CA    
990  C C     . ASN A 126 ? 0.4424 0.3304 0.3450 -0.0179 -0.0938 -0.0179 230 ASN A C     
991  O O     . ASN A 126 ? 0.4243 0.3183 0.3278 -0.0153 -0.0930 -0.0141 230 ASN A O     
992  C CB    . ASN A 126 ? 0.4171 0.2832 0.2978 -0.0095 -0.0755 -0.0259 230 ASN A CB    
993  C CG    . ASN A 126 ? 0.5886 0.4386 0.4475 -0.0046 -0.0829 -0.0254 230 ASN A CG    
994  O OD1   . ASN A 126 ? 0.4609 0.3049 0.3158 -0.0059 -0.0953 -0.0271 230 ASN A OD1   
995  N ND2   . ASN A 126 ? 0.5301 0.3672 0.3701 0.0018  -0.0771 -0.0237 230 ASN A ND2   
996  N N     . GLY A 127 ? 0.4053 0.2963 0.3163 -0.0232 -0.1008 -0.0152 231 GLY A N     
997  C CA    . GLY A 127 ? 0.3994 0.3029 0.3254 -0.0288 -0.1055 -0.0062 231 GLY A CA    
998  C C     . GLY A 127 ? 0.4210 0.3274 0.3512 -0.0321 -0.1021 -0.0011 231 GLY A C     
999  O O     . GLY A 127 ? 0.4057 0.3127 0.3285 -0.0276 -0.0947 -0.0029 231 GLY A O     
1000 N N     . LYS A 128 ? 0.3860 0.2903 0.3255 -0.0401 -0.1087 0.0055  232 LYS A N     
1001 C CA    . LYS A 128 ? 0.3920 0.2933 0.3306 -0.0429 -0.1044 0.0135  232 LYS A CA    
1002 C C     . LYS A 128 ? 0.4395 0.3565 0.3820 -0.0399 -0.0897 0.0227  232 LYS A C     
1003 O O     . LYS A 128 ? 0.4264 0.3356 0.3509 -0.0345 -0.0832 0.0242  232 LYS A O     
1004 C CB    . LYS A 128 ? 0.4347 0.3273 0.3850 -0.0544 -0.1134 0.0203  232 LYS A CB    
1005 C CG    . LYS A 128 ? 0.5076 0.3790 0.4424 -0.0544 -0.1147 0.0229  232 LYS A CG    
1006 C CD    . LYS A 128 ? 0.5357 0.3932 0.4811 -0.0672 -0.1224 0.0308  232 LYS A CD    
1007 C CE    . LYS A 128 ? 0.5994 0.4257 0.5238 -0.0641 -0.1311 0.0268  232 LYS A CE    
1008 N NZ    . LYS A 128 ? 0.6060 0.4120 0.5386 -0.0783 -0.1385 0.0355  232 LYS A NZ    
1009 N N     . CYS A 129 ? 0.4352 0.3724 0.3984 -0.0407 -0.0853 0.0279  233 CYS A N     
1010 C CA    . CYS A 129 ? 0.4660 0.4198 0.4358 -0.0350 -0.0683 0.0373  233 CYS A CA    
1011 C C     . CYS A 129 ? 0.5012 0.4449 0.4410 -0.0225 -0.0593 0.0308  233 CYS A C     
1012 O O     . CYS A 129 ? 0.4952 0.4343 0.4195 -0.0168 -0.0466 0.0372  233 CYS A O     
1013 C CB    . CYS A 129 ? 0.4825 0.4613 0.4831 -0.0348 -0.0685 0.0413  233 CYS A CB    
1014 S SG    . CYS A 129 ? 0.5391 0.5133 0.5272 -0.0253 -0.0774 0.0280  233 CYS A SG    
1015 N N     . ILE A 130 ? 0.4262 0.3622 0.3553 -0.0185 -0.0661 0.0182  234 ILE A N     
1016 C CA    . ILE A 130 ? 0.4289 0.3529 0.3340 -0.0095 -0.0615 0.0103  234 ILE A CA    
1017 C C     . ILE A 130 ? 0.4521 0.3594 0.3375 -0.0093 -0.0675 0.0059  234 ILE A C     
1018 O O     . ILE A 130 ? 0.4353 0.3309 0.2976 -0.0017 -0.0646 0.0027  234 ILE A O     
1019 C CB    . ILE A 130 ? 0.4721 0.3922 0.3761 -0.0071 -0.0642 0.0004  234 ILE A CB    
1020 C CG1   . ILE A 130 ? 0.4578 0.3738 0.3688 -0.0137 -0.0744 -0.0054 234 ILE A CG1   
1021 C CG2   . ILE A 130 ? 0.4618 0.3938 0.3752 -0.0007 -0.0570 0.0056  234 ILE A CG2   
1022 C CD1   . ILE A 130 ? 0.5031 0.4094 0.4080 -0.0118 -0.0729 -0.0142 234 ILE A CD1   
1023 N N     . TYR A 131 ? 0.4047 0.3078 0.2962 -0.0156 -0.0776 0.0051  235 TYR A N     
1024 C CA    . TYR A 131 ? 0.4245 0.3123 0.2980 -0.0124 -0.0852 0.0019  235 TYR A CA    
1025 C C     . TYR A 131 ? 0.5269 0.4051 0.3806 -0.0092 -0.0777 0.0142  235 TYR A C     
1026 O O     . TYR A 131 ? 0.5309 0.3921 0.3563 -0.0011 -0.0818 0.0116  235 TYR A O     
1027 C CB    . TYR A 131 ? 0.4178 0.3011 0.3009 -0.0160 -0.0973 -0.0031 235 TYR A CB    
1028 C CG    . TYR A 131 ? 0.4313 0.3016 0.2994 -0.0096 -0.1078 -0.0076 235 TYR A CG    
1029 C CD1   . TYR A 131 ? 0.4662 0.3376 0.3355 -0.0054 -0.1151 -0.0195 235 TYR A CD1   
1030 C CD2   . TYR A 131 ? 0.4617 0.3169 0.3147 -0.0077 -0.1118 0.0006  235 TYR A CD2   
1031 C CE1   . TYR A 131 ? 0.4748 0.3358 0.3324 0.0016  -0.1296 -0.0243 235 TYR A CE1   
1032 C CE2   . TYR A 131 ? 0.4945 0.3352 0.3287 0.0013  -0.1243 -0.0031 235 TYR A CE2   
1033 C CZ    . TYR A 131 ? 0.5351 0.3806 0.3734 0.0063  -0.1350 -0.0163 235 TYR A CZ    
1034 O OH    . TYR A 131 ? 0.5760 0.4094 0.4007 0.0157  -0.1528 -0.0214 235 TYR A OH    
1035 N N     . GLU A 132 ? 0.5093 0.3968 0.3776 -0.0154 -0.0672 0.0281  236 GLU A N     
1036 C CA    . GLU A 132 ? 0.5482 0.4269 0.4005 -0.0133 -0.0537 0.0432  236 GLU A CA    
1037 C C     . GLU A 132 ? 0.5841 0.4559 0.4060 0.0008  -0.0412 0.0424  236 GLU A C     
1038 O O     . GLU A 132 ? 0.5979 0.4458 0.3806 0.0101  -0.0389 0.0452  236 GLU A O     
1039 C CB    . GLU A 132 ? 0.5638 0.4613 0.4502 -0.0243 -0.0420 0.0583  236 GLU A CB    
1040 C CG    . GLU A 132 ? 0.7478 0.6444 0.6586 -0.0385 -0.0564 0.0586  236 GLU A CG    
1041 C CD    . GLU A 132 ? 1.1391 1.0556 1.0921 -0.0527 -0.0529 0.0698  236 GLU A CD    
1042 O OE1   . GLU A 132 ? 0.9841 0.9274 0.9629 -0.0518 -0.0471 0.0709  236 GLU A OE1   
1043 O OE2   . GLU A 132 ? 1.1582 1.0626 1.1208 -0.0648 -0.0593 0.0764  236 GLU A OE2   
1044 N N     . ILE A 133 ? 0.5153 0.4027 0.3497 0.0042  -0.0351 0.0374  237 ILE A N     
1045 C CA    . ILE A 133 ? 0.5327 0.4097 0.3369 0.0190  -0.0239 0.0344  237 ILE A CA    
1046 C C     . ILE A 133 ? 0.5677 0.4182 0.3369 0.0255  -0.0412 0.0184  237 ILE A C     
1047 O O     . ILE A 133 ? 0.5974 0.4231 0.3231 0.0377  -0.0380 0.0178  237 ILE A O     
1048 C CB    . ILE A 133 ? 0.5559 0.4536 0.3843 0.0216  -0.0160 0.0321  237 ILE A CB    
1049 C CG1   . ILE A 133 ? 0.5556 0.4836 0.4251 0.0161  -0.0020 0.0482  237 ILE A CG1   
1050 C CG2   . ILE A 133 ? 0.5990 0.4786 0.3908 0.0388  -0.0054 0.0268  237 ILE A CG2   
1051 C CD1   . ILE A 133 ? 0.6325 0.5842 0.5368 0.0146  -0.0056 0.0454  237 ILE A CD1   
1052 N N     . PHE A 134 ? 0.5229 0.3783 0.3117 0.0177  -0.0593 0.0056  238 PHE A N     
1053 C CA    . PHE A 134 ? 0.5483 0.3866 0.3206 0.0203  -0.0780 -0.0101 238 PHE A CA    
1054 C C     . PHE A 134 ? 0.6328 0.4497 0.3746 0.0262  -0.0900 -0.0093 238 PHE A C     
1055 O O     . PHE A 134 ? 0.6534 0.4462 0.3585 0.0361  -0.0994 -0.0175 238 PHE A O     
1056 C CB    . PHE A 134 ? 0.5289 0.3822 0.3381 0.0096  -0.0897 -0.0195 238 PHE A CB    
1057 C CG    . PHE A 134 ? 0.5540 0.3974 0.3615 0.0096  -0.1061 -0.0352 238 PHE A CG    
1058 C CD1   . PHE A 134 ? 0.6136 0.4496 0.4175 0.0101  -0.1042 -0.0436 238 PHE A CD1   
1059 C CD2   . PHE A 134 ? 0.5874 0.4283 0.4001 0.0091  -0.1248 -0.0413 238 PHE A CD2   
1060 C CE1   . PHE A 134 ? 0.6344 0.4606 0.4427 0.0068  -0.1210 -0.0581 238 PHE A CE1   
1061 C CE2   . PHE A 134 ? 0.6365 0.4727 0.4572 0.0077  -0.1424 -0.0557 238 PHE A CE2   
1062 C CZ    . PHE A 134 ? 0.6189 0.4482 0.4396 0.0048  -0.1405 -0.0641 238 PHE A CZ    
1063 N N     . SER A 135 ? 0.5720 0.3932 0.3250 0.0212  -0.0916 -0.0002 239 SER A N     
1064 C CA    . SER A 135 ? 0.5979 0.3960 0.3207 0.0280  -0.1032 0.0028  239 SER A CA    
1065 C C     . SER A 135 ? 0.6922 0.4618 0.3603 0.0417  -0.0922 0.0114  239 SER A C     
1066 O O     . SER A 135 ? 0.7119 0.4540 0.3399 0.0530  -0.1089 0.0049  239 SER A O     
1067 C CB    . SER A 135 ? 0.6048 0.4077 0.3470 0.0203  -0.1024 0.0136  239 SER A CB    
1068 O OG    . SER A 135 ? 0.7787 0.5544 0.4871 0.0291  -0.1136 0.0177  239 SER A OG    
1069 N N     . LYS A 136 ? 0.6676 0.4434 0.3343 0.0418  -0.0645 0.0262  240 LYS A N     
1070 C CA    . LYS A 136 ? 0.7264 0.4767 0.3422 0.0561  -0.0445 0.0380  240 LYS A CA    
1071 C C     . LYS A 136 ? 0.8020 0.5287 0.3735 0.0715  -0.0505 0.0233  240 LYS A C     
1072 O O     . LYS A 136 ? 0.8348 0.5231 0.3446 0.0873  -0.0541 0.0229  240 LYS A O     
1073 C CB    . LYS A 136 ? 0.7433 0.5181 0.3877 0.0510  -0.0118 0.0561  240 LYS A CB    
1074 C CG    . LYS A 136 ? 1.0269 0.7803 0.6299 0.0628  0.0172  0.0757  240 LYS A CG    
1075 C CD    . LYS A 136 ? 1.1858 0.9730 0.8325 0.0570  0.0504  0.0935  240 LYS A CD    
1076 C CE    . LYS A 136 ? 1.3329 1.1504 1.0430 0.0343  0.0492  0.1043  240 LYS A CE    
1077 N NZ    . LYS A 136 ? 1.4573 1.3081 1.2134 0.0285  0.0793  0.1228  240 LYS A NZ    
1078 N N     . GLU A 137 ? 0.7310 0.4754 0.3307 0.0670  -0.0548 0.0102  241 GLU A N     
1079 C CA    . GLU A 137 ? 0.7485 0.4695 0.3132 0.0786  -0.0617 -0.0052 241 GLU A CA    
1080 C C     . GLU A 137 ? 0.8239 0.5238 0.3729 0.0787  -0.0984 -0.0255 241 GLU A C     
1081 O O     . GLU A 137 ? 0.8638 0.5275 0.3609 0.0920  -0.1089 -0.0366 241 GLU A O     
1082 C CB    . GLU A 137 ? 0.7116 0.4590 0.3178 0.0719  -0.0517 -0.0093 241 GLU A CB    
1083 C CG    . GLU A 137 ? 0.8229 0.5458 0.3930 0.0860  -0.0459 -0.0191 241 GLU A CG    
1084 C CD    . GLU A 137 ? 0.8552 0.5961 0.4644 0.0779  -0.0469 -0.0275 241 GLU A CD    
1085 O OE1   . GLU A 137 ? 0.7835 0.5589 0.4461 0.0634  -0.0461 -0.0225 241 GLU A OE1   
1086 O OE2   . GLU A 137 ? 0.7963 0.5111 0.3770 0.0870  -0.0494 -0.0395 241 GLU A OE2   
1087 N N     . VAL A 138 ? 0.7638 0.4865 0.3598 0.0644  -0.1181 -0.0312 242 VAL A N     
1088 C CA    . VAL A 138 ? 0.7683 0.4836 0.3710 0.0617  -0.1523 -0.0499 242 VAL A CA    
1089 C C     . VAL A 138 ? 0.8554 0.5539 0.4343 0.0693  -0.1743 -0.0489 242 VAL A C     
1090 O O     . VAL A 138 ? 0.8744 0.5469 0.4224 0.0778  -0.2024 -0.0624 242 VAL A O     
1091 C CB    . VAL A 138 ? 0.7504 0.5023 0.4223 0.0438  -0.1563 -0.0565 242 VAL A CB    
1092 C CG1   . VAL A 138 ? 0.7483 0.5027 0.4442 0.0386  -0.1881 -0.0731 242 VAL A CG1   
1093 C CG2   . VAL A 138 ? 0.7317 0.4907 0.4165 0.0394  -0.1386 -0.0585 242 VAL A CG2   
1094 N N     . PHE A 139 ? 0.8034 0.5137 0.3956 0.0666  -0.1643 -0.0336 243 PHE A N     
1095 C CA    . PHE A 139 ? 0.8347 0.5267 0.4041 0.0752  -0.1843 -0.0309 243 PHE A CA    
1096 C C     . PHE A 139 ? 0.9721 0.6268 0.4742 0.0900  -0.1687 -0.0142 243 PHE A C     
1097 O O     . PHE A 139 ? 1.0104 0.6390 0.4781 0.1009  -0.1854 -0.0107 243 PHE A O     
1098 C CB    . PHE A 139 ? 0.7947 0.5163 0.4192 0.0640  -0.1861 -0.0260 243 PHE A CB    
1099 C CG    . PHE A 139 ? 0.7427 0.4996 0.4305 0.0510  -0.1947 -0.0398 243 PHE A CG    
1100 C CD1   . PHE A 139 ? 0.7762 0.5360 0.4796 0.0520  -0.2228 -0.0575 243 PHE A CD1   
1101 C CD2   . PHE A 139 ? 0.7088 0.4943 0.4404 0.0378  -0.1748 -0.0345 243 PHE A CD2   
1102 C CE1   . PHE A 139 ? 0.7376 0.5299 0.5018 0.0389  -0.2250 -0.0677 243 PHE A CE1   
1103 C CE2   . PHE A 139 ? 0.6975 0.5103 0.4799 0.0277  -0.1787 -0.0453 243 PHE A CE2   
1104 C CZ    . PHE A 139 ? 0.6749 0.4916 0.4745 0.0278  -0.2010 -0.0607 243 PHE A CZ    
1105 N N     . GLY A 140 ? 0.9561 0.6084 0.4411 0.0914  -0.1355 -0.0028 244 GLY A N     
1106 C CA    . GLY A 140 ? 1.0179 0.6397 0.4464 0.1040  -0.1102 0.0170  244 GLY A CA    
1107 C C     . GLY A 140 ? 1.0752 0.7026 0.5220 0.0961  -0.1011 0.0359  244 GLY A C     
1108 O O     . GLY A 140 ? 1.1205 0.7125 0.5151 0.1074  -0.0931 0.0508  244 GLY A O     
1109 N N     . VAL A 141 ? 0.9901 0.6567 0.5067 0.0774  -0.1030 0.0351  245 VAL A N     
1110 C CA    . VAL A 141 ? 0.9869 0.6566 0.5255 0.0683  -0.1000 0.0491  245 VAL A CA    
1111 C C     . VAL A 141 ? 1.0181 0.7174 0.6038 0.0511  -0.0717 0.0632  245 VAL A C     
1112 O O     . VAL A 141 ? 0.9521 0.6850 0.5817 0.0415  -0.0680 0.0552  245 VAL A O     
1113 C CB    . VAL A 141 ? 1.0117 0.6933 0.5843 0.0647  -0.1323 0.0343  245 VAL A CB    
1114 C CG1   . VAL A 141 ? 0.9943 0.6798 0.5951 0.0543  -0.1289 0.0459  245 VAL A CG1   
1115 C CG2   . VAL A 141 ? 1.0575 0.7092 0.5866 0.0825  -0.1633 0.0237  245 VAL A CG2   
1116 N N     . LYS A 142 ? 1.0256 0.7105 0.6031 0.0468  -0.0540 0.0846  246 LYS A N     
1117 C CA    . LYS A 142 ? 1.0028 0.7136 0.6299 0.0282  -0.0322 0.0991  246 LYS A CA    
1118 C C     . LYS A 142 ? 1.0865 0.7766 0.7156 0.0198  -0.0372 0.1113  246 LYS A C     
1119 O O     . LYS A 142 ? 1.1377 0.7909 0.7216 0.0272  -0.0266 0.1278  246 LYS A O     
1120 C CB    . LYS A 142 ? 1.0616 0.7767 0.6799 0.0306  0.0044  0.1167  246 LYS A CB    
1121 C CG    . LYS A 142 ? 1.1750 0.9364 0.8618 0.0137  0.0199  0.1213  246 LYS A CG    
1122 C CD    . LYS A 142 ? 1.2794 1.0478 1.0058 -0.0062 0.0316  0.1406  246 LYS A CD    
1123 C CE    . LYS A 142 ? 1.3073 1.1223 1.1054 -0.0231 0.0349  0.1401  246 LYS A CE    
1124 N NZ    . LYS A 142 ? 1.3604 1.1792 1.2007 -0.0454 0.0358  0.1541  246 LYS A NZ    
1125 N N     . VAL A 143 ? 1.0062 0.7138 0.6808 0.0068  -0.0542 0.1024  247 VAL A N     
1126 C CA    . VAL A 143 ? 1.0142 0.7001 0.6942 -0.0016 -0.0620 0.1106  247 VAL A CA    
1127 C C     . VAL A 143 ? 1.0349 0.7395 0.7628 -0.0243 -0.0447 0.1240  247 VAL A C     
1128 O O     . VAL A 143 ? 0.9940 0.7365 0.7633 -0.0329 -0.0405 0.1176  247 VAL A O     
1129 C CB    . VAL A 143 ? 1.0463 0.7331 0.7391 0.0024  -0.0925 0.0910  247 VAL A CB    
1130 C CG1   . VAL A 143 ? 1.0664 0.7281 0.7648 -0.0050 -0.1001 0.0980  247 VAL A CG1   
1131 C CG2   . VAL A 143 ? 1.0630 0.7352 0.7179 0.0237  -0.1120 0.0790  247 VAL A CG2   
1132 N N     . LYS A 144 ? 1.0179 0.6945 0.7404 -0.0341 -0.0359 0.1429  248 LYS A N     
1133 C CA    . LYS A 144 ? 1.0067 0.6977 0.7790 -0.0585 -0.0227 0.1567  248 LYS A CA    
1134 C C     . LYS A 144 ? 0.9875 0.6988 0.8060 -0.0716 -0.0457 0.1397  248 LYS A C     
1135 O O     . LYS A 144 ? 0.9611 0.7037 0.8290 -0.0880 -0.0409 0.1416  248 LYS A O     
1136 C CB    . LYS A 144 ? 1.1022 0.7503 0.8557 -0.0670 -0.0114 0.1798  248 LYS A CB    
1137 N N     . ASN A 145 ? 0.9160 0.6085 0.7171 -0.0625 -0.0706 0.1236  249 ASN A N     
1138 C CA    . ASN A 145 ? 0.8721 0.5748 0.7038 -0.0703 -0.0909 0.1069  249 ASN A CA    
1139 C C     . ASN A 145 ? 0.8394 0.5587 0.6636 -0.0534 -0.1049 0.0848  249 ASN A C     
1140 O O     . ASN A 145 ? 0.8357 0.5350 0.6379 -0.0398 -0.1194 0.0756  249 ASN A O     
1141 C CB    . ASN A 145 ? 0.9449 0.6057 0.7689 -0.0772 -0.1041 0.1099  249 ASN A CB    
1142 N N     . LEU A 146 ? 0.7174 0.4737 0.5622 -0.0536 -0.0991 0.0775  250 LEU A N     
1143 C CA    . LEU A 146 ? 0.6611 0.4339 0.5050 -0.0413 -0.1093 0.0582  250 LEU A CA    
1144 C C     . LEU A 146 ? 0.6307 0.4011 0.4916 -0.0455 -0.1240 0.0458  250 LEU A C     
1145 O O     . LEU A 146 ? 0.6317 0.4041 0.5138 -0.0597 -0.1255 0.0486  250 LEU A O     
1146 C CB    . LEU A 146 ? 0.6346 0.4403 0.4917 -0.0405 -0.0981 0.0552  250 LEU A CB    
1147 C CG    . LEU A 146 ? 0.6815 0.5035 0.5431 -0.0317 -0.1066 0.0366  250 LEU A CG    
1148 C CD1   . LEU A 146 ? 0.7033 0.5169 0.5393 -0.0172 -0.1120 0.0302  250 LEU A CD1   
1149 C CD2   . LEU A 146 ? 0.6965 0.5459 0.5771 -0.0350 -0.0974 0.0346  250 LEU A CD2   
1150 N N     . GLU A 147 ? 0.5451 0.3100 0.3968 -0.0323 -0.1350 0.0321  251 GLU A N     
1151 C CA    . GLU A 147 ? 0.5291 0.2873 0.3896 -0.0323 -0.1450 0.0202  251 GLU A CA    
1152 C C     . GLU A 147 ? 0.5356 0.3192 0.4080 -0.0261 -0.1433 0.0064  251 GLU A C     
1153 O O     . GLU A 147 ? 0.5083 0.3120 0.3831 -0.0210 -0.1376 0.0044  251 GLU A O     
1154 C CB    . GLU A 147 ? 0.5609 0.2884 0.4038 -0.0211 -0.1557 0.0174  251 GLU A CB    
1155 C CG    . GLU A 147 ? 0.6193 0.3133 0.4486 -0.0298 -0.1571 0.0321  251 GLU A CG    
1156 C CD    . GLU A 147 ? 0.8668 0.5235 0.6742 -0.0172 -0.1682 0.0309  251 GLU A CD    
1157 O OE1   . GLU A 147 ? 0.7236 0.3863 0.5276 0.0016  -0.1742 0.0205  251 GLU A OE1   
1158 O OE2   . GLU A 147 ? 0.7984 0.4198 0.5955 -0.0263 -0.1713 0.0402  251 GLU A OE2   
1159 N N     . PHE A 148 ? 0.4970 0.2751 0.3730 -0.0262 -0.1477 -0.0030 252 PHE A N     
1160 C CA    . PHE A 148 ? 0.4621 0.2583 0.3450 -0.0192 -0.1427 -0.0144 252 PHE A CA    
1161 C C     . PHE A 148 ? 0.5076 0.3034 0.3909 -0.0035 -0.1433 -0.0225 252 PHE A C     
1162 O O     . PHE A 148 ? 0.5170 0.2981 0.3930 0.0028  -0.1504 -0.0196 252 PHE A O     
1163 C CB    . PHE A 148 ? 0.4931 0.2769 0.3708 -0.0227 -0.1468 -0.0203 252 PHE A CB    
1164 C CG    . PHE A 148 ? 0.4972 0.2903 0.3845 -0.0368 -0.1491 -0.0139 252 PHE A CG    
1165 C CD1   . PHE A 148 ? 0.4874 0.3074 0.3857 -0.0379 -0.1407 -0.0126 252 PHE A CD1   
1166 C CD2   . PHE A 148 ? 0.5609 0.3348 0.4489 -0.0486 -0.1615 -0.0101 252 PHE A CD2   
1167 C CE1   . PHE A 148 ? 0.5001 0.3321 0.4122 -0.0480 -0.1438 -0.0066 252 PHE A CE1   
1168 C CE2   . PHE A 148 ? 0.5741 0.3626 0.4812 -0.0616 -0.1659 -0.0044 252 PHE A CE2   
1169 C CZ    . PHE A 148 ? 0.5216 0.3405 0.4410 -0.0598 -0.1570 -0.0028 252 PHE A CZ    
1170 N N     . GLY A 149 ? 0.4427 0.2550 0.3369 0.0029  -0.1355 -0.0313 253 GLY A N     
1171 C CA    . GLY A 149 ? 0.4355 0.2558 0.3429 0.0167  -0.1340 -0.0387 253 GLY A CA    
1172 C C     . GLY A 149 ? 0.4878 0.3289 0.4110 0.0187  -0.1377 -0.0383 253 GLY A C     
1173 O O     . GLY A 149 ? 0.4760 0.3271 0.3974 0.0102  -0.1365 -0.0345 253 GLY A O     
1174 N N     . LEU A 150 ? 0.4491 0.2960 0.3879 0.0315  -0.1437 -0.0432 254 LEU A N     
1175 C CA    . LEU A 150 ? 0.4502 0.3158 0.4063 0.0351  -0.1533 -0.0456 254 LEU A CA    
1176 C C     . LEU A 150 ? 0.5323 0.3820 0.4612 0.0334  -0.1658 -0.0378 254 LEU A C     
1177 O O     . LEU A 150 ? 0.5401 0.3642 0.4461 0.0375  -0.1721 -0.0310 254 LEU A O     
1178 C CB    . LEU A 150 ? 0.4520 0.3302 0.4376 0.0508  -0.1594 -0.0526 254 LEU A CB    
1179 C CG    . LEU A 150 ? 0.5126 0.4158 0.5278 0.0540  -0.1734 -0.0579 254 LEU A CG    
1180 C CD1   . LEU A 150 ? 0.4936 0.4231 0.5375 0.0418  -0.1622 -0.0630 254 LEU A CD1   
1181 C CD2   . LEU A 150 ? 0.5483 0.4639 0.5949 0.0716  -0.1832 -0.0630 254 LEU A CD2   
1182 N N     . GLN A 151 ? 0.4781 0.3391 0.4063 0.0284  -0.1684 -0.0387 255 GLN A N     
1183 C CA    . GLN A 151 ? 0.4953 0.3389 0.3909 0.0293  -0.1767 -0.0315 255 GLN A CA    
1184 C C     . GLN A 151 ? 0.5866 0.4296 0.4830 0.0425  -0.1986 -0.0371 255 GLN A C     
1185 O O     . GLN A 151 ? 0.5545 0.4208 0.4880 0.0464  -0.2063 -0.0478 255 GLN A O     
1186 C CB    . GLN A 151 ? 0.4922 0.3403 0.3760 0.0194  -0.1663 -0.0291 255 GLN A CB    
1187 C CG    . GLN A 151 ? 0.4078 0.2595 0.2949 0.0080  -0.1485 -0.0236 255 GLN A CG    
1188 C CD    . GLN A 151 ? 0.5024 0.3343 0.3730 0.0043  -0.1454 -0.0117 255 GLN A CD    
1189 O OE1   . GLN A 151 ? 0.5199 0.3344 0.3660 0.0058  -0.1466 -0.0017 255 GLN A OE1   
1190 N NE2   . GLN A 151 ? 0.4325 0.2620 0.3138 -0.0001 -0.1423 -0.0126 255 GLN A NE2   
1191 N N     . PRO A 152 ? 0.6227 0.4388 0.4799 0.0501  -0.2095 -0.0294 256 PRO A N     
1192 C CA    . PRO A 152 ? 0.6440 0.4557 0.4983 0.0657  -0.2355 -0.0353 256 PRO A CA    
1193 C C     . PRO A 152 ? 0.7005 0.5182 0.5498 0.0662  -0.2500 -0.0444 256 PRO A C     
1194 O O     . PRO A 152 ? 0.6902 0.5000 0.5305 0.0794  -0.2763 -0.0495 256 PRO A O     
1195 C CB    . PRO A 152 ? 0.7160 0.4879 0.5225 0.0752  -0.2401 -0.0218 256 PRO A CB    
1196 C CG    . PRO A 152 ? 0.7688 0.5261 0.5501 0.0615  -0.2161 -0.0085 256 PRO A CG    
1197 C CD    . PRO A 152 ? 0.6741 0.4609 0.4894 0.0462  -0.1987 -0.0140 256 PRO A CD    
1198 N N     . HIS A 153 ? 0.6785 0.5084 0.5341 0.0530  -0.2356 -0.0475 257 HIS A N     
1199 C CA    A HIS A 153 ? 0.7025 0.5319 0.5496 0.0520  -0.2483 -0.0574 257 HIS A CA    
1200 C CA    B HIS A 153 ? 0.7049 0.5343 0.5521 0.0522  -0.2485 -0.0574 257 HIS A CA    
1201 C C     . HIS A 153 ? 0.7149 0.5766 0.6153 0.0401  -0.2449 -0.0693 257 HIS A C     
1202 O O     . HIS A 153 ? 0.6870 0.5639 0.6099 0.0298  -0.2215 -0.0661 257 HIS A O     
1203 C CB    A HIS A 153 ? 0.7337 0.5384 0.5292 0.0496  -0.2327 -0.0491 257 HIS A CB    
1204 C CB    B HIS A 153 ? 0.7409 0.5440 0.5342 0.0506  -0.2341 -0.0490 257 HIS A CB    
1205 C CG    A HIS A 153 ? 0.8194 0.5889 0.5588 0.0608  -0.2325 -0.0355 257 HIS A CG    
1206 C CG    B HIS A 153 ? 0.8256 0.5945 0.5655 0.0615  -0.2333 -0.0349 257 HIS A CG    
1207 N ND1   A HIS A 153 ? 0.8318 0.5929 0.5583 0.0555  -0.2081 -0.0192 257 HIS A ND1   
1208 N ND1   B HIS A 153 ? 0.8966 0.6357 0.5909 0.0772  -0.2563 -0.0366 257 HIS A ND1   
1209 C CD2   A HIS A 153 ? 0.8860 0.6251 0.5801 0.0765  -0.2541 -0.0356 257 HIS A CD2   
1210 C CD2   B HIS A 153 ? 0.8434 0.6016 0.5699 0.0582  -0.2131 -0.0187 257 HIS A CD2   
1211 C CE1   A HIS A 153 ? 0.8734 0.5995 0.5485 0.0669  -0.2115 -0.0082 257 HIS A CE1   
1212 C CE1   B HIS A 153 ? 0.9211 0.6306 0.5723 0.0837  -0.2456 -0.0197 257 HIS A CE1   
1213 N NE2   A HIS A 153 ? 0.9137 0.6232 0.5631 0.0814  -0.2389 -0.0174 257 HIS A NE2   
1214 N NE2   B HIS A 153 ? 0.8933 0.6143 0.5659 0.0712  -0.2195 -0.0084 257 HIS A NE2   
1215 N N     . LYS A 154 ? 0.6649 0.5341 0.5842 0.0411  -0.2691 -0.0825 258 LYS A N     
1216 C CA    . LYS A 154 ? 0.6344 0.5307 0.6059 0.0274  -0.2662 -0.0930 258 LYS A CA    
1217 C C     . LYS A 154 ? 0.6655 0.5408 0.6026 0.0206  -0.2640 -0.0971 258 LYS A C     
1218 O O     . LYS A 154 ? 0.6839 0.5271 0.5636 0.0300  -0.2747 -0.0962 258 LYS A O     
1219 C CB    . LYS A 154 ? 0.6750 0.5941 0.6979 0.0300  -0.2961 -0.1058 258 LYS A CB    
1220 C CG    . LYS A 154 ? 0.7273 0.6756 0.8002 0.0374  -0.2947 -0.1035 258 LYS A CG    
1221 C CD    . LYS A 154 ? 0.8790 0.8531 1.0071 0.0413  -0.3278 -0.1160 258 LYS A CD    
1222 C CE    . LYS A 154 ? 1.0441 1.0544 1.2347 0.0497  -0.3231 -0.1147 258 LYS A CE    
1223 N NZ    . LYS A 154 ? 1.1581 1.1897 1.3931 0.0604  -0.3624 -0.1248 258 LYS A NZ    
1224 N N     . ILE A 155 ? 0.5987 0.4873 0.5658 0.0061  -0.2491 -0.1011 259 ILE A N     
1225 C CA    . ILE A 155 ? 0.6129 0.4783 0.5484 0.0011  -0.2478 -0.1063 259 ILE A CA    
1226 C C     . ILE A 155 ? 0.7192 0.5663 0.6407 0.0055  -0.2851 -0.1210 259 ILE A C     
1227 O O     . ILE A 155 ? 0.7176 0.5867 0.6908 0.0013  -0.3074 -0.1305 259 ILE A O     
1228 C CB    . ILE A 155 ? 0.6221 0.5020 0.5950 -0.0148 -0.2269 -0.1077 259 ILE A CB    
1229 C CG1   . ILE A 155 ? 0.5930 0.4829 0.5658 -0.0163 -0.1936 -0.0937 259 ILE A CG1   
1230 C CG2   . ILE A 155 ? 0.6383 0.4911 0.5846 -0.0198 -0.2312 -0.1162 259 ILE A CG2   
1231 C CD1   . ILE A 155 ? 0.6618 0.5310 0.5811 -0.0087 -0.1804 -0.0837 259 ILE A CD1   
1232 N N     . PRO A 156 ? 0.7284 0.5349 0.5794 0.0163  -0.2929 -0.1225 260 PRO A N     
1233 C CA    . PRO A 156 ? 0.7876 0.5677 0.6120 0.0234  -0.3322 -0.1379 260 PRO A CA    
1234 C C     . PRO A 156 ? 0.8439 0.6355 0.7209 0.0075  -0.3546 -0.1553 260 PRO A C     
1235 O O     . PRO A 156 ? 0.8263 0.6202 0.7223 -0.0067 -0.3364 -0.1570 260 PRO A O     
1236 C CB    . PRO A 156 ? 0.8607 0.5929 0.5989 0.0358  -0.3237 -0.1357 260 PRO A CB    
1237 C CG    . PRO A 156 ? 0.8801 0.6193 0.6023 0.0393  -0.2853 -0.1156 260 PRO A CG    
1238 C CD    . PRO A 156 ? 0.7589 0.5418 0.5522 0.0234  -0.2656 -0.1104 260 PRO A CD    
1239 N N     . ASP A 157 ? 0.8246 0.6239 0.7288 0.0099  -0.3952 -0.1676 261 ASP A N     
1240 C CA    . ASP A 157 ? 0.8326 0.6476 0.7993 -0.0063 -0.4247 -0.1849 261 ASP A CA    
1241 C C     . ASP A 157 ? 0.8037 0.6736 0.8694 -0.0258 -0.4025 -0.1802 261 ASP A C     
1242 O O     . ASP A 157 ? 0.7990 0.6828 0.9225 -0.0447 -0.4137 -0.1907 261 ASP A O     
1243 C CB    . ASP A 157 ? 0.9145 0.6852 0.8393 -0.0130 -0.4361 -0.1988 261 ASP A CB    
1244 C CG    . ASP A 157 ? 1.2130 0.9241 1.0345 0.0086  -0.4571 -0.2050 261 ASP A CG    
1245 O OD1   . ASP A 157 ? 1.2617 0.9625 1.0620 0.0233  -0.4934 -0.2109 261 ASP A OD1   
1246 O OD2   . ASP A 157 ? 1.3534 1.0258 1.1133 0.0126  -0.4376 -0.2042 261 ASP A OD2   
1247 N N     . THR A 158 ? 0.7076 0.6050 0.7908 -0.0214 -0.3701 -0.1641 262 THR A N     
1248 C CA    . THR A 158 ? 0.6555 0.5996 0.8207 -0.0349 -0.3447 -0.1580 262 THR A CA    
1249 C C     . THR A 158 ? 0.6785 0.6513 0.8658 -0.0208 -0.3376 -0.1483 262 THR A C     
1250 O O     . THR A 158 ? 0.7048 0.6579 0.8400 -0.0026 -0.3480 -0.1440 262 THR A O     
1251 C CB    . THR A 158 ? 0.6854 0.6241 0.8390 -0.0452 -0.3001 -0.1471 262 THR A CB    
1252 O OG1   . THR A 158 ? 0.6430 0.5770 0.7555 -0.0320 -0.2764 -0.1330 262 THR A OG1   
1253 C CG2   . THR A 158 ? 0.7015 0.6012 0.8108 -0.0529 -0.2997 -0.1531 262 THR A CG2   
1254 N N     . GLU A 159 ? 0.5687 0.5830 0.8281 -0.0285 -0.3154 -0.1434 263 GLU A N     
1255 C CA    . GLU A 159 ? 0.5261 0.5664 0.8104 -0.0151 -0.3027 -0.1348 263 GLU A CA    
1256 C C     . GLU A 159 ? 0.5528 0.5854 0.8085 -0.0151 -0.2590 -0.1209 263 GLU A C     
1257 O O     . GLU A 159 ? 0.5470 0.5936 0.8147 -0.0043 -0.2441 -0.1137 263 GLU A O     
1258 C CB    . GLU A 159 ? 0.5241 0.6156 0.9081 -0.0199 -0.3070 -0.1392 263 GLU A CB    
1259 C CG    . GLU A 159 ? 0.6246 0.7297 1.0469 -0.0181 -0.3566 -0.1536 263 GLU A CG    
1260 C CD    . GLU A 159 ? 0.9617 1.0432 1.3305 0.0051  -0.3926 -0.1564 263 GLU A CD    
1261 O OE1   . GLU A 159 ? 0.8104 0.8887 1.1542 0.0232  -0.3802 -0.1464 263 GLU A OE1   
1262 O OE2   . GLU A 159 ? 1.0479 1.1092 1.3956 0.0058  -0.4341 -0.1687 263 GLU A OE2   
1263 N N     . THR A 160 ? 0.4725 0.4794 0.6871 -0.0254 -0.2414 -0.1180 264 THR A N     
1264 C CA    . THR A 160 ? 0.4257 0.4226 0.6104 -0.0257 -0.2056 -0.1061 264 THR A CA    
1265 C C     . THR A 160 ? 0.4883 0.4678 0.6217 -0.0105 -0.2044 -0.0978 264 THR A C     
1266 O O     . THR A 160 ? 0.5037 0.4573 0.5863 -0.0045 -0.2190 -0.0975 264 THR A O     
1267 C CB    . THR A 160 ? 0.4163 0.3884 0.5669 -0.0366 -0.1934 -0.1053 264 THR A CB    
1268 O OG1   . THR A 160 ? 0.4787 0.4605 0.6748 -0.0526 -0.1943 -0.1124 264 THR A OG1   
1269 C CG2   . THR A 160 ? 0.3743 0.3374 0.4960 -0.0355 -0.1610 -0.0934 264 THR A CG2   
1270 N N     . LEU A 161 ? 0.4405 0.4297 0.5832 -0.0050 -0.1840 -0.0904 265 LEU A N     
1271 C CA    . LEU A 161 ? 0.4363 0.4067 0.5354 0.0063  -0.1815 -0.0823 265 LEU A CA    
1272 C C     . LEU A 161 ? 0.4876 0.4375 0.5440 0.0003  -0.1621 -0.0744 265 LEU A C     
1273 O O     . LEU A 161 ? 0.4741 0.4270 0.5385 -0.0093 -0.1460 -0.0745 265 LEU A O     
1274 C CB    . LEU A 161 ? 0.4341 0.4186 0.5597 0.0162  -0.1711 -0.0799 265 LEU A CB    
1275 C CG    . LEU A 161 ? 0.4828 0.4967 0.6653 0.0246  -0.1861 -0.0868 265 LEU A CG    
1276 C CD1   . LEU A 161 ? 0.4667 0.4896 0.6675 0.0379  -0.1703 -0.0836 265 LEU A CD1   
1277 C CD2   . LEU A 161 ? 0.5363 0.5414 0.7040 0.0341  -0.2214 -0.0908 265 LEU A CD2   
1278 N N     . CYS A 162 ? 0.4458 0.3750 0.4595 0.0062  -0.1636 -0.0667 266 CYS A N     
1279 C CA    . CYS A 162 ? 0.4332 0.3479 0.4146 0.0011  -0.1476 -0.0583 266 CYS A CA    
1280 C C     . CYS A 162 ? 0.4456 0.3556 0.4232 0.0047  -0.1390 -0.0527 266 CYS A C     
1281 O O     . CYS A 162 ? 0.4429 0.3453 0.4153 0.0130  -0.1488 -0.0510 266 CYS A O     
1282 C CB    . CYS A 162 ? 0.4597 0.3552 0.4004 0.0029  -0.1543 -0.0531 266 CYS A CB    
1283 S SG    . CYS A 162 ? 0.5363 0.4261 0.4674 0.0018  -0.1669 -0.0620 266 CYS A SG    
1284 N N     . TYR A 163 ? 0.3806 0.2903 0.3571 -0.0002 -0.1225 -0.0504 267 TYR A N     
1285 C CA    . TYR A 163 ? 0.3620 0.2615 0.3300 0.0033  -0.1166 -0.0475 267 TYR A CA    
1286 C C     . TYR A 163 ? 0.4267 0.3163 0.3727 -0.0038 -0.1098 -0.0414 267 TYR A C     
1287 O O     . TYR A 163 ? 0.4438 0.3391 0.3912 -0.0085 -0.1012 -0.0417 267 TYR A O     
1288 C CB    . TYR A 163 ? 0.3631 0.2721 0.3549 0.0083  -0.1042 -0.0530 267 TYR A CB    
1289 C CG    . TYR A 163 ? 0.3682 0.2597 0.3437 0.0157  -0.0990 -0.0525 267 TYR A CG    
1290 C CD1   . TYR A 163 ? 0.4015 0.2874 0.3816 0.0274  -0.1056 -0.0547 267 TYR A CD1   
1291 C CD2   . TYR A 163 ? 0.3907 0.2677 0.3436 0.0131  -0.0889 -0.0509 267 TYR A CD2   
1292 C CE1   . TYR A 163 ? 0.4431 0.3060 0.4027 0.0357  -0.1013 -0.0559 267 TYR A CE1   
1293 C CE2   . TYR A 163 ? 0.4278 0.2817 0.3586 0.0206  -0.0878 -0.0524 267 TYR A CE2   
1294 C CZ    . TYR A 163 ? 0.5010 0.3463 0.4339 0.0315  -0.0934 -0.0553 267 TYR A CZ    
1295 O OH    . TYR A 163 ? 0.5387 0.3544 0.4440 0.0399  -0.0931 -0.0582 267 TYR A OH    
1296 N N     . VAL A 164 ? 0.3759 0.2505 0.3044 -0.0049 -0.1149 -0.0356 268 VAL A N     
1297 C CA    . VAL A 164 ? 0.3577 0.2272 0.2740 -0.0124 -0.1128 -0.0291 268 VAL A CA    
1298 C C     . VAL A 164 ? 0.4232 0.2782 0.3305 -0.0123 -0.1136 -0.0308 268 VAL A C     
1299 O O     . VAL A 164 ? 0.4279 0.2666 0.3287 -0.0083 -0.1198 -0.0326 268 VAL A O     
1300 C CB    . VAL A 164 ? 0.4119 0.2771 0.3197 -0.0169 -0.1179 -0.0194 268 VAL A CB    
1301 C CG1   . VAL A 164 ? 0.4102 0.2800 0.3187 -0.0251 -0.1141 -0.0120 268 VAL A CG1   
1302 C CG2   . VAL A 164 ? 0.4220 0.2932 0.3266 -0.0134 -0.1185 -0.0192 268 VAL A CG2   
1303 N N     . MET A 165 ? 0.3996 0.2559 0.3020 -0.0153 -0.1095 -0.0304 269 MET A N     
1304 C CA    . MET A 165 ? 0.4621 0.2994 0.3485 -0.0143 -0.1147 -0.0330 269 MET A CA    
1305 C C     . MET A 165 ? 0.5036 0.3444 0.3919 -0.0233 -0.1232 -0.0266 269 MET A C     
1306 O O     . MET A 165 ? 0.4625 0.3223 0.3624 -0.0263 -0.1181 -0.0213 269 MET A O     
1307 C CB    . MET A 165 ? 0.5190 0.3502 0.3935 -0.0061 -0.1030 -0.0390 269 MET A CB    
1308 C CG    . MET A 165 ? 0.5762 0.4126 0.4615 0.0020  -0.0905 -0.0438 269 MET A CG    
1309 S SD    . MET A 165 ? 0.6407 0.4613 0.5080 0.0139  -0.0718 -0.0489 269 MET A SD    
1310 C CE    . MET A 165 ? 0.5890 0.4149 0.4506 0.0087  -0.0629 -0.0441 269 MET A CE    
1311 N N     . PRO A 166 ? 0.3870 0.2619 0.3409 0.0208  -0.0705 -0.0413 270 PRO A N     
1312 C CA    . PRO A 166 ? 0.3776 0.2564 0.3194 0.0162  -0.0711 -0.0302 270 PRO A CA    
1313 C C     . PRO A 166 ? 0.4134 0.2899 0.3567 0.0159  -0.0626 -0.0348 270 PRO A C     
1314 O O     . PRO A 166 ? 0.4068 0.2731 0.3573 0.0154  -0.0556 -0.0417 270 PRO A O     
1315 C CB    . PRO A 166 ? 0.4288 0.2902 0.3601 0.0088  -0.0752 -0.0231 270 PRO A CB    
1316 C CG    . PRO A 166 ? 0.5038 0.3489 0.4381 0.0120  -0.0728 -0.0339 270 PRO A CG    
1317 C CD    . PRO A 166 ? 0.4303 0.2869 0.3798 0.0190  -0.0715 -0.0419 270 PRO A CD    
1318 N N     . SER A 167 ? 0.3776 0.2659 0.3158 0.0177  -0.0629 -0.0298 271 SER A N     
1319 C CA    . SER A 167 ? 0.3925 0.2769 0.3318 0.0186  -0.0565 -0.0324 271 SER A CA    
1320 C C     . SER A 167 ? 0.4201 0.2884 0.3539 0.0124  -0.0493 -0.0297 271 SER A C     
1321 O O     . SER A 167 ? 0.3685 0.2314 0.2899 0.0077  -0.0520 -0.0235 271 SER A O     
1322 C CB    . SER A 167 ? 0.4109 0.3104 0.3406 0.0225  -0.0587 -0.0246 271 SER A CB    
1323 O OG    . SER A 167 ? 0.4157 0.3079 0.3458 0.0243  -0.0532 -0.0267 271 SER A OG    
1324 N N     . SER A 168 ? 0.3892 0.2502 0.3328 0.0130  -0.0411 -0.0337 272 SER A N     
1325 C CA    . SER A 168 ? 0.3663 0.2172 0.3032 0.0103  -0.0323 -0.0291 272 SER A CA    
1326 C C     . SER A 168 ? 0.3983 0.2502 0.3183 0.0096  -0.0326 -0.0203 272 SER A C     
1327 O O     . SER A 168 ? 0.3985 0.2441 0.3070 0.0088  -0.0274 -0.0158 272 SER A O     
1328 C CB    . SER A 168 ? 0.3841 0.2318 0.3407 0.0105  -0.0230 -0.0307 272 SER A CB    
1329 O OG    . SER A 168 ? 0.4402 0.2876 0.4087 0.0118  -0.0249 -0.0317 272 SER A OG    
1330 N N     . SER A 169 ? 0.3830 0.2461 0.3006 0.0119  -0.0388 -0.0175 273 SER A N     
1331 C CA    . SER A 169 ? 0.3920 0.2606 0.2958 0.0120  -0.0395 -0.0082 273 SER A CA    
1332 C C     . SER A 169 ? 0.4456 0.3127 0.3351 0.0052  -0.0452 -0.0022 273 SER A C     
1333 O O     . SER A 169 ? 0.4651 0.3336 0.3560 0.0013  -0.0527 -0.0023 273 SER A O     
1334 C CB    . SER A 169 ? 0.4077 0.2945 0.3121 0.0182  -0.0449 -0.0059 273 SER A CB    
1335 O OG    . SER A 169 ? 0.3702 0.2663 0.2628 0.0180  -0.0459 0.0046  273 SER A OG    
1336 N N     . ALA A 170 ? 0.4184 0.2825 0.2947 0.0043  -0.0438 0.0033  274 ALA A N     
1337 C CA    . ALA A 170 ? 0.4049 0.2654 0.2684 -0.0018 -0.0530 0.0064  274 ALA A CA    
1338 C C     . ALA A 170 ? 0.4218 0.3012 0.2870 -0.0069 -0.0634 0.0175  274 ALA A C     
1339 O O     . ALA A 170 ? 0.4438 0.3217 0.3038 -0.0145 -0.0745 0.0220  274 ALA A O     
1340 C CB    . ALA A 170 ? 0.4146 0.2657 0.2616 0.0013  -0.0488 0.0062  274 ALA A CB    
1341 N N     . ARG A 171 ? 0.3649 0.2634 0.2390 -0.0021 -0.0609 0.0218  275 ARG A N     
1342 C CA    . ARG A 171 ? 0.3784 0.3038 0.2570 -0.0047 -0.0684 0.0351  275 ARG A CA    
1343 C C     . ARG A 171 ? 0.4689 0.3950 0.3557 -0.0138 -0.0779 0.0398  275 ARG A C     
1344 O O     . ARG A 171 ? 0.4742 0.4185 0.3672 -0.0214 -0.0867 0.0547  275 ARG A O     
1345 C CB    . ARG A 171 ? 0.3940 0.3413 0.2780 0.0077  -0.0632 0.0358  275 ARG A CB    
1346 C CG    . ARG A 171 ? 0.4490 0.4326 0.3361 0.0084  -0.0682 0.0529  275 ARG A CG    
1347 C CD    . ARG A 171 ? 0.5604 0.5691 0.4476 0.0256  -0.0636 0.0526  275 ARG A CD    
1348 N NE    . ARG A 171 ? 0.6021 0.5995 0.4822 0.0369  -0.0578 0.0437  275 ARG A NE    
1349 C CZ    . ARG A 171 ? 0.6456 0.6530 0.5201 0.0401  -0.0571 0.0512  275 ARG A CZ    
1350 N NH1   . ARG A 171 ? 0.5661 0.5954 0.4425 0.0310  -0.0626 0.0671  275 ARG A NH1   
1351 N NH2   . ARG A 171 ? 0.5383 0.5325 0.4075 0.0515  -0.0524 0.0438  275 ARG A NH2   
1352 N N     . CYS A 172 ? 0.4230 0.3321 0.3127 -0.0125 -0.0760 0.0293  276 CYS A N     
1353 C CA    . CYS A 172 ? 0.4394 0.3470 0.3369 -0.0190 -0.0849 0.0342  276 CYS A CA    
1354 C C     . CYS A 172 ? 0.5093 0.3950 0.4035 -0.0306 -0.0975 0.0357  276 CYS A C     
1355 O O     . CYS A 172 ? 0.5372 0.3966 0.4228 -0.0286 -0.0969 0.0220  276 CYS A O     
1356 C CB    . CYS A 172 ? 0.4368 0.3361 0.3390 -0.0120 -0.0800 0.0226  276 CYS A CB    
1357 S SG    . CYS A 172 ? 0.4996 0.3973 0.4108 -0.0176 -0.0909 0.0306  276 CYS A SG    
1358 N N     . ALA A 173 ? 0.4673 0.3650 0.3700 -0.0418 -0.1098 0.0526  277 ALA A N     
1359 C CA    . ALA A 173 ? 0.4988 0.3738 0.4019 -0.0544 -0.1271 0.0543  277 ALA A CA    
1360 C C     . ALA A 173 ? 0.5600 0.4085 0.4668 -0.0569 -0.1360 0.0493  277 ALA A C     
1361 O O     . ALA A 173 ? 0.5462 0.3650 0.4478 -0.0623 -0.1503 0.0421  277 ALA A O     
1362 C CB    . ALA A 173 ? 0.5176 0.4167 0.4361 -0.0678 -0.1390 0.0771  277 ALA A CB    
1363 N N     . GLN A 174 ? 0.5072 0.3653 0.4219 -0.0513 -0.1293 0.0520  278 GLN A N     
1364 C CA    . GLN A 174 ? 0.5119 0.3465 0.4310 -0.0523 -0.1380 0.0493  278 GLN A CA    
1365 C C     . GLN A 174 ? 0.5208 0.3245 0.4257 -0.0420 -0.1344 0.0250  278 GLN A C     
1366 O O     . GLN A 174 ? 0.5314 0.3081 0.4356 -0.0420 -0.1452 0.0194  278 GLN A O     
1367 C CB    . GLN A 174 ? 0.5156 0.3738 0.4462 -0.0479 -0.1327 0.0609  278 GLN A CB    
1368 C CG    . GLN A 174 ? 0.6053 0.4932 0.5525 -0.0583 -0.1396 0.0902  278 GLN A CG    
1369 C CD    . GLN A 174 ? 0.6055 0.5363 0.5531 -0.0526 -0.1280 0.0998  278 GLN A CD    
1370 O OE1   . GLN A 174 ? 0.5386 0.4728 0.4744 -0.0423 -0.1165 0.0842  278 GLN A OE1   
1371 N NE2   . GLN A 174 ? 0.5005 0.4665 0.4625 -0.0578 -0.1306 0.1269  278 GLN A NE2   
1372 N N     . PHE A 175 ? 0.4602 0.2692 0.3549 -0.0324 -0.1191 0.0122  279 PHE A N     
1373 C CA    . PHE A 175 ? 0.4597 0.2494 0.3429 -0.0214 -0.1118 -0.0072 279 PHE A CA    
1374 C C     . PHE A 175 ? 0.4774 0.2685 0.3472 -0.0203 -0.1067 -0.0105 279 PHE A C     
1375 O O     . PHE A 175 ? 0.4737 0.2799 0.3437 -0.0152 -0.0921 -0.0113 279 PHE A O     
1376 C CB    . PHE A 175 ? 0.4652 0.2693 0.3571 -0.0122 -0.0968 -0.0128 279 PHE A CB    
1377 C CG    . PHE A 175 ? 0.4791 0.2871 0.3831 -0.0117 -0.1020 -0.0082 279 PHE A CG    
1378 C CD1   . PHE A 175 ? 0.5193 0.3078 0.4231 -0.0061 -0.1066 -0.0171 279 PHE A CD1   
1379 C CD2   . PHE A 175 ? 0.5130 0.3462 0.4269 -0.0144 -0.1026 0.0058  279 PHE A CD2   
1380 C CE1   . PHE A 175 ? 0.5181 0.3100 0.4324 -0.0048 -0.1124 -0.0112 279 PHE A CE1   
1381 C CE2   . PHE A 175 ? 0.5258 0.3652 0.4487 -0.0122 -0.1074 0.0120  279 PHE A CE2   
1382 C CZ    . PHE A 175 ? 0.5003 0.3175 0.4238 -0.0084 -0.1130 0.0043  279 PHE A CZ    
1383 N N     . PRO A 176 ? 0.4778 0.2549 0.3380 -0.0264 -0.1211 -0.0100 280 PRO A N     
1384 C CA    . PRO A 176 ? 0.4857 0.2690 0.3330 -0.0254 -0.1179 -0.0103 280 PRO A CA    
1385 C C     . PRO A 176 ? 0.5228 0.3015 0.3529 -0.0114 -0.1034 -0.0231 280 PRO A C     
1386 O O     . PRO A 176 ? 0.5310 0.3212 0.3533 -0.0093 -0.0961 -0.0196 280 PRO A O     
1387 C CB    . PRO A 176 ? 0.5324 0.2996 0.3752 -0.0349 -0.1409 -0.0090 280 PRO A CB    
1388 C CG    . PRO A 176 ? 0.5924 0.3333 0.4397 -0.0367 -0.1554 -0.0144 280 PRO A CG    
1389 C CD    . PRO A 176 ? 0.5017 0.2552 0.3641 -0.0345 -0.1434 -0.0088 280 PRO A CD    
1390 N N     . ARG A 177 ? 0.4953 0.2604 0.3202 -0.0013 -0.0990 -0.0354 281 ARG A N     
1391 C CA    . ARG A 177 ? 0.5080 0.2742 0.3184 0.0129  -0.0842 -0.0439 281 ARG A CA    
1392 C C     . ARG A 177 ? 0.5193 0.2959 0.3449 0.0190  -0.0672 -0.0453 281 ARG A C     
1393 O O     . ARG A 177 ? 0.4951 0.2703 0.3357 0.0158  -0.0709 -0.0458 281 ARG A O     
1394 C CB    . ARG A 177 ? 0.5333 0.2764 0.3205 0.0241  -0.0955 -0.0592 281 ARG A CB    
1395 C CG    . ARG A 177 ? 0.5957 0.3233 0.3671 0.0192  -0.1173 -0.0623 281 ARG A CG    
1396 C CD    . ARG A 177 ? 0.6589 0.3581 0.4091 0.0320  -0.1330 -0.0814 281 ARG A CD    
1397 N NE    . ARG A 177 ? 0.6704 0.3534 0.4331 0.0320  -0.1395 -0.0860 281 ARG A NE    
1398 C CZ    . ARG A 177 ? 0.8544 0.5201 0.6027 0.0497  -0.1421 -0.1027 281 ARG A CZ    
1399 N NH1   . ARG A 177 ? 0.7834 0.4478 0.5030 0.0700  -0.1382 -0.1166 281 ARG A NH1   
1400 N NH2   . ARG A 177 ? 0.7081 0.3601 0.4695 0.0496  -0.1482 -0.1050 281 ARG A NH2   
1401 N N     . ALA A 178 ? 0.4951 0.2826 0.3176 0.0282  -0.0496 -0.0451 282 ALA A N     
1402 C CA    . ALA A 178 ? 0.4908 0.2896 0.3314 0.0335  -0.0346 -0.0459 282 ALA A CA    
1403 C C     . ALA A 178 ? 0.5161 0.3034 0.3544 0.0417  -0.0412 -0.0578 282 ALA A C     
1404 O O     . ALA A 178 ? 0.4849 0.2779 0.3432 0.0408  -0.0388 -0.0589 282 ALA A O     
1405 C CB    . ALA A 178 ? 0.5029 0.3149 0.3391 0.0427  -0.0164 -0.0409 282 ALA A CB    
1406 N N     . GLN A 179 ? 0.5295 0.2992 0.3429 0.0506  -0.0521 -0.0677 283 GLN A N     
1407 C CA    . GLN A 179 ? 0.5453 0.2987 0.3528 0.0611  -0.0615 -0.0806 283 GLN A CA    
1408 C C     . GLN A 179 ? 0.5698 0.3126 0.3950 0.0501  -0.0750 -0.0789 283 GLN A C     
1409 O O     . GLN A 179 ? 0.5787 0.3150 0.4090 0.0581  -0.0777 -0.0860 283 GLN A O     
1410 C CB    . GLN A 179 ? 0.5948 0.3240 0.3708 0.0714  -0.0778 -0.0936 283 GLN A CB    
1411 C CG    . GLN A 179 ? 0.7500 0.4621 0.5142 0.0895  -0.0854 -0.1101 283 GLN A CG    
1412 C CD    . GLN A 179 ? 0.9084 0.6447 0.6702 0.1095  -0.0634 -0.1129 283 GLN A CD    
1413 O OE1   . GLN A 179 ? 0.8665 0.6223 0.6168 0.1177  -0.0483 -0.1085 283 GLN A OE1   
1414 N NE2   . GLN A 179 ? 0.7040 0.4421 0.4775 0.1185  -0.0610 -0.1183 283 GLN A NE2   
1415 N N     . ASP A 180 ? 0.5108 0.2525 0.3431 0.0339  -0.0845 -0.0686 284 ASP A N     
1416 C CA    . ASP A 180 ? 0.5083 0.2447 0.3564 0.0239  -0.0965 -0.0623 284 ASP A CA    
1417 C C     . ASP A 180 ? 0.5427 0.3012 0.4134 0.0229  -0.0846 -0.0574 284 ASP A C     
1418 O O     . ASP A 180 ? 0.5591 0.3159 0.4410 0.0202  -0.0924 -0.0540 284 ASP A O     
1419 C CB    . ASP A 180 ? 0.5358 0.2700 0.3851 0.0082  -0.1101 -0.0502 284 ASP A CB    
1420 C CG    . ASP A 180 ? 0.6248 0.3341 0.4552 0.0079  -0.1275 -0.0568 284 ASP A CG    
1421 O OD1   . ASP A 180 ? 0.6373 0.3200 0.4587 0.0157  -0.1403 -0.0686 284 ASP A OD1   
1422 O OD2   . ASP A 180 ? 0.6523 0.3678 0.4761 0.0015  -0.1296 -0.0517 284 ASP A OD2   
1423 N N     . LYS A 181 ? 0.4606 0.2391 0.3386 0.0254  -0.0673 -0.0566 285 LYS A N     
1424 C CA    . LYS A 181 ? 0.4177 0.2157 0.3183 0.0245  -0.0584 -0.0546 285 LYS A CA    
1425 C C     . LYS A 181 ? 0.4821 0.2880 0.3935 0.0349  -0.0474 -0.0623 285 LYS A C     
1426 O O     . LYS A 181 ? 0.4644 0.2834 0.3966 0.0349  -0.0452 -0.0633 285 LYS A O     
1427 C CB    . LYS A 181 ? 0.4113 0.2242 0.3181 0.0182  -0.0499 -0.0472 285 LYS A CB    
1428 C CG    . LYS A 181 ? 0.4429 0.2557 0.3417 0.0095  -0.0594 -0.0380 285 LYS A CG    
1429 C CD    . LYS A 181 ? 0.4486 0.2747 0.3509 0.0069  -0.0518 -0.0321 285 LYS A CD    
1430 C CE    . LYS A 181 ? 0.4403 0.2707 0.3340 0.0003  -0.0602 -0.0222 285 LYS A CE    
1431 N NZ    . LYS A 181 ? 0.4757 0.3162 0.3685 0.0009  -0.0527 -0.0175 285 LYS A NZ    
1432 N N     . VAL A 182 ? 0.4454 0.2471 0.3434 0.0451  -0.0410 -0.0675 286 VAL A N     
1433 C CA    . VAL A 182 ? 0.4621 0.2796 0.3721 0.0561  -0.0274 -0.0711 286 VAL A CA    
1434 C C     . VAL A 182 ? 0.4962 0.3151 0.4198 0.0624  -0.0329 -0.0780 286 VAL A C     
1435 O O     . VAL A 182 ? 0.4692 0.3094 0.4160 0.0657  -0.0228 -0.0778 286 VAL A O     
1436 C CB    . VAL A 182 ? 0.5654 0.3830 0.4537 0.0700  -0.0188 -0.0742 286 VAL A CB    
1437 C CG1   . VAL A 182 ? 0.5764 0.3708 0.4396 0.0831  -0.0323 -0.0871 286 VAL A CG1   
1438 C CG2   . VAL A 182 ? 0.5750 0.4211 0.4821 0.0783  0.0009  -0.0696 286 VAL A CG2   
1439 N N     . HIS A 183 ? 0.4784 0.2758 0.3906 0.0633  -0.0494 -0.0823 287 HIS A N     
1440 C CA    . HIS A 183 ? 0.4773 0.2737 0.4007 0.0700  -0.0564 -0.0871 287 HIS A CA    
1441 C C     . HIS A 183 ? 0.4924 0.3138 0.4452 0.0639  -0.0514 -0.0833 287 HIS A C     
1442 O O     . HIS A 183 ? 0.4793 0.3155 0.4493 0.0721  -0.0477 -0.0879 287 HIS A O     
1443 C CB    . HIS A 183 ? 0.5283 0.2974 0.4395 0.0658  -0.0764 -0.0856 287 HIS A CB    
1444 C CG    . HIS A 183 ? 0.5919 0.3626 0.5170 0.0682  -0.0844 -0.0845 287 HIS A CG    
1445 N ND1   . HIS A 183 ? 0.6548 0.4196 0.5804 0.0839  -0.0870 -0.0935 287 HIS A ND1   
1446 C CD2   . HIS A 183 ? 0.6095 0.3884 0.5459 0.0592  -0.0906 -0.0749 287 HIS A CD2   
1447 C CE1   . HIS A 183 ? 0.6360 0.4047 0.5744 0.0828  -0.0948 -0.0887 287 HIS A CE1   
1448 N NE2   . HIS A 183 ? 0.6209 0.3992 0.5655 0.0685  -0.0969 -0.0773 287 HIS A NE2   
1449 N N     . TYR A 184 ? 0.4365 0.2635 0.3947 0.0510  -0.0526 -0.0762 288 TYR A N     
1450 C CA    . TYR A 184 ? 0.4051 0.2522 0.3871 0.0467  -0.0518 -0.0755 288 TYR A CA    
1451 C C     . TYR A 184 ? 0.4334 0.3003 0.4391 0.0467  -0.0386 -0.0772 288 TYR A C     
1452 O O     . TYR A 184 ? 0.4338 0.3166 0.4637 0.0470  -0.0402 -0.0809 288 TYR A O     
1453 C CB    . TYR A 184 ? 0.4145 0.2618 0.3915 0.0371  -0.0578 -0.0687 288 TYR A CB    
1454 C CG    . TYR A 184 ? 0.4654 0.3016 0.4289 0.0363  -0.0710 -0.0627 288 TYR A CG    
1455 C CD1   . TYR A 184 ? 0.5099 0.3520 0.4809 0.0415  -0.0790 -0.0631 288 TYR A CD1   
1456 C CD2   . TYR A 184 ? 0.5055 0.3255 0.4506 0.0302  -0.0764 -0.0553 288 TYR A CD2   
1457 C CE1   . TYR A 184 ? 0.5565 0.3879 0.5176 0.0405  -0.0909 -0.0537 288 TYR A CE1   
1458 C CE2   . TYR A 184 ? 0.5348 0.3446 0.4732 0.0270  -0.0897 -0.0463 288 TYR A CE2   
1459 C CZ    . TYR A 184 ? 0.6425 0.4580 0.5893 0.0320  -0.0962 -0.0441 288 TYR A CZ    
1460 O OH    . TYR A 184 ? 0.6917 0.4976 0.6347 0.0284  -0.1090 -0.0312 288 TYR A OH    
1461 N N     . TYR A 185 ? 0.3921 0.2591 0.3926 0.0459  -0.0268 -0.0730 289 TYR A N     
1462 C CA    . TYR A 185 ? 0.3867 0.2739 0.4130 0.0444  -0.0131 -0.0692 289 TYR A CA    
1463 C C     . TYR A 185 ? 0.4187 0.3218 0.4579 0.0559  -0.0070 -0.0725 289 TYR A C     
1464 O O     . TYR A 185 ? 0.3923 0.3176 0.4650 0.0537  -0.0023 -0.0710 289 TYR A O     
1465 C CB    . TYR A 185 ? 0.3881 0.2728 0.4020 0.0422  -0.0014 -0.0601 289 TYR A CB    
1466 C CG    . TYR A 185 ? 0.3719 0.2477 0.3821 0.0314  -0.0049 -0.0553 289 TYR A CG    
1467 C CD1   . TYR A 185 ? 0.3782 0.2381 0.3648 0.0289  -0.0163 -0.0569 289 TYR A CD1   
1468 C CD2   . TYR A 185 ? 0.3758 0.2598 0.4072 0.0242  0.0030  -0.0473 289 TYR A CD2   
1469 C CE1   . TYR A 185 ? 0.3899 0.2461 0.3729 0.0217  -0.0189 -0.0523 289 TYR A CE1   
1470 C CE2   . TYR A 185 ? 0.3791 0.2535 0.4058 0.0171  -0.0011 -0.0441 289 TYR A CE2   
1471 C CZ    . TYR A 185 ? 0.4239 0.2862 0.4248 0.0172  -0.0113 -0.0471 289 TYR A CZ    
1472 O OH    . TYR A 185 ? 0.4103 0.2674 0.4054 0.0130  -0.0146 -0.0436 289 TYR A OH    
1473 N N     . ILE A 186 ? 0.4107 0.3021 0.4249 0.0687  -0.0092 -0.0778 290 ILE A N     
1474 C CA    . ILE A 186 ? 0.4209 0.3263 0.4416 0.0846  -0.0045 -0.0828 290 ILE A CA    
1475 C C     . ILE A 186 ? 0.4574 0.3721 0.5016 0.0847  -0.0142 -0.0882 290 ILE A C     
1476 O O     . ILE A 186 ? 0.4424 0.3839 0.5141 0.0899  -0.0077 -0.0881 290 ILE A O     
1477 C CB    . ILE A 186 ? 0.4828 0.3655 0.4661 0.1007  -0.0092 -0.0907 290 ILE A CB    
1478 C CG1   . ILE A 186 ? 0.4978 0.3787 0.4584 0.1048  0.0013  -0.0868 290 ILE A CG1   
1479 C CG2   . ILE A 186 ? 0.5202 0.4133 0.5073 0.1207  -0.0085 -0.0988 290 ILE A CG2   
1480 C CD1   . ILE A 186 ? 0.6496 0.5000 0.5707 0.1161  -0.0099 -0.0967 290 ILE A CD1   
1481 N N     . LYS A 187 ? 0.4331 0.3290 0.4669 0.0796  -0.0297 -0.0913 291 LYS A N     
1482 C CA    . LYS A 187 ? 0.4190 0.3237 0.4702 0.0809  -0.0403 -0.0956 291 LYS A CA    
1483 C C     . LYS A 187 ? 0.4236 0.3523 0.5092 0.0708  -0.0388 -0.0949 291 LYS A C     
1484 O O     . LYS A 187 ? 0.4274 0.3752 0.5375 0.0745  -0.0434 -0.0996 291 LYS A O     
1485 C CB    . LYS A 187 ? 0.4460 0.3277 0.4758 0.0784  -0.0559 -0.0947 291 LYS A CB    
1486 C CG    . LYS A 187 ? 0.5608 0.4153 0.5640 0.0880  -0.0634 -0.0961 291 LYS A CG    
1487 C CD    . LYS A 187 ? 0.7067 0.5638 0.7154 0.1048  -0.0675 -0.1028 291 LYS A CD    
1488 C CE    . LYS A 187 ? 0.9205 0.7915 0.9464 0.1064  -0.0766 -0.1025 291 LYS A CE    
1489 N NZ    . LYS A 187 ? 1.0379 0.8958 1.0524 0.0979  -0.0890 -0.0942 291 LYS A NZ    
1490 N N     . LEU A 188 ? 0.3433 0.2699 0.4315 0.0586  -0.0340 -0.0898 292 LEU A N     
1491 C CA    . LEU A 188 ? 0.3332 0.2760 0.4544 0.0486  -0.0345 -0.0899 292 LEU A CA    
1492 C C     . LEU A 188 ? 0.4224 0.3917 0.5779 0.0496  -0.0228 -0.0857 292 LEU A C     
1493 O O     . LEU A 188 ? 0.4280 0.4170 0.6180 0.0471  -0.0287 -0.0897 292 LEU A O     
1494 C CB    . LEU A 188 ? 0.3125 0.2426 0.4258 0.0377  -0.0324 -0.0846 292 LEU A CB    
1495 C CG    . LEU A 188 ? 0.3509 0.2910 0.4991 0.0273  -0.0340 -0.0845 292 LEU A CG    
1496 C CD1   . LEU A 188 ? 0.3286 0.2781 0.4965 0.0285  -0.0506 -0.0970 292 LEU A CD1   
1497 C CD2   . LEU A 188 ? 0.3627 0.2865 0.4984 0.0197  -0.0328 -0.0797 292 LEU A CD2   
1498 N N     . LYS A 189 ? 0.3957 0.3685 0.5417 0.0546  -0.0070 -0.0773 293 LYS A N     
1499 C CA    . LYS A 189 ? 0.3858 0.3901 0.5611 0.0586  0.0077  -0.0689 293 LYS A CA    
1500 C C     . LYS A 189 ? 0.4431 0.4664 0.6329 0.0708  0.0030  -0.0765 293 LYS A C     
1501 O O     . LYS A 189 ? 0.4390 0.4934 0.6714 0.0674  0.0057  -0.0725 293 LYS A O     
1502 C CB    . LYS A 189 ? 0.4277 0.4315 0.5763 0.0689  0.0241  -0.0608 293 LYS A CB    
1503 C CG    . LYS A 189 ? 0.4882 0.5316 0.6659 0.0746  0.0431  -0.0473 293 LYS A CG    
1504 C CD    . LYS A 189 ? 0.6453 0.6903 0.7883 0.0913  0.0583  -0.0420 293 LYS A CD    
1505 C CE    . LYS A 189 ? 0.7001 0.7334 0.8077 0.1143  0.0531  -0.0570 293 LYS A CE    
1506 N NZ    . LYS A 189 ? 0.7717 0.7995 0.8390 0.1315  0.0631  -0.0564 293 LYS A NZ    
1507 N N     . ASP A 190 ? 0.4138 0.4181 0.5707 0.0846  -0.0053 -0.0863 294 ASP A N     
1508 C CA    . ASP A 190 ? 0.4276 0.4454 0.5935 0.0987  -0.0114 -0.0938 294 ASP A CA    
1509 C C     . ASP A 190 ? 0.4373 0.4672 0.6336 0.0901  -0.0256 -0.0992 294 ASP A C     
1510 O O     . ASP A 190 ? 0.4089 0.4689 0.6380 0.0947  -0.0258 -0.1003 294 ASP A O     
1511 C CB    . ASP A 190 ? 0.4675 0.4548 0.5917 0.1137  -0.0201 -0.1018 294 ASP A CB    
1512 C CG    . ASP A 190 ? 0.6738 0.6463 0.7648 0.1262  -0.0107 -0.1015 294 ASP A CG    
1513 O OD1   . ASP A 190 ? 0.6793 0.6761 0.7801 0.1307  0.0065  -0.0946 294 ASP A OD1   
1514 O OD2   . ASP A 190 ? 0.7984 0.7364 0.8546 0.1324  -0.0213 -0.1075 294 ASP A OD2   
1515 N N     . LEU A 191 ? 0.4082 0.4177 0.5940 0.0792  -0.0379 -0.1028 295 LEU A N     
1516 C CA    . LEU A 191 ? 0.3996 0.4201 0.6092 0.0739  -0.0533 -0.1105 295 LEU A CA    
1517 C C     . LEU A 191 ? 0.4682 0.5154 0.7271 0.0617  -0.0508 -0.1079 295 LEU A C     
1518 O O     . LEU A 191 ? 0.4810 0.5510 0.7721 0.0625  -0.0608 -0.1142 295 LEU A O     
1519 C CB    . LEU A 191 ? 0.3915 0.3883 0.5764 0.0679  -0.0650 -0.1141 295 LEU A CB    
1520 C CG    . LEU A 191 ? 0.4327 0.4397 0.6355 0.0654  -0.0825 -0.1244 295 LEU A CG    
1521 C CD1   . LEU A 191 ? 0.4324 0.4554 0.6414 0.0786  -0.0937 -0.1316 295 LEU A CD1   
1522 C CD2   . LEU A 191 ? 0.4440 0.4316 0.6182 0.0629  -0.0901 -0.1258 295 LEU A CD2   
1523 N N     . ARG A 192 ? 0.4152 0.4600 0.6822 0.0502  -0.0386 -0.0974 296 ARG A N     
1524 C CA    . ARG A 192 ? 0.3984 0.4657 0.7161 0.0360  -0.0362 -0.0904 296 ARG A CA    
1525 C C     . ARG A 192 ? 0.4681 0.5751 0.8223 0.0415  -0.0269 -0.0831 296 ARG A C     
1526 O O     . ARG A 192 ? 0.4545 0.5860 0.8568 0.0331  -0.0357 -0.0841 296 ARG A O     
1527 C CB    . ARG A 192 ? 0.3540 0.4101 0.6697 0.0247  -0.0231 -0.0765 296 ARG A CB    
1528 C CG    . ARG A 192 ? 0.4548 0.5315 0.8279 0.0079  -0.0227 -0.0662 296 ARG A CG    
1529 C CD    . ARG A 192 ? 0.5366 0.6198 0.9176 0.0012  -0.0021 -0.0441 296 ARG A CD    
1530 N NE    . ARG A 192 ? 0.5646 0.6654 0.9237 0.0167  0.0188  -0.0340 296 ARG A NE    
1531 C CZ    . ARG A 192 ? 0.7143 0.8139 1.0549 0.0187  0.0372  -0.0184 296 ARG A CZ    
1532 N NH1   . ARG A 192 ? 0.5452 0.6270 0.8890 0.0048  0.0382  -0.0090 296 ARG A NH1   
1533 N NH2   . ARG A 192 ? 0.5078 0.6239 0.8250 0.0369  0.0538  -0.0129 296 ARG A NH2   
1534 N N     . ASP A 193 ? 0.4433 0.5581 0.7756 0.0563  -0.0096 -0.0758 297 ASP A N     
1535 C CA    . ASP A 193 ? 0.4544 0.6112 0.8159 0.0665  0.0024  -0.0676 297 ASP A CA    
1536 C C     . ASP A 193 ? 0.4985 0.6724 0.8784 0.0749  -0.0128 -0.0801 297 ASP A C     
1537 O O     . ASP A 193 ? 0.4866 0.7010 0.9159 0.0722  -0.0116 -0.0742 297 ASP A O     
1538 C CB    . ASP A 193 ? 0.5004 0.6568 0.8235 0.0868  0.0208  -0.0624 297 ASP A CB    
1539 C CG    . ASP A 193 ? 0.6791 0.8305 0.9885 0.0818  0.0385  -0.0474 297 ASP A CG    
1540 O OD1   . ASP A 193 ? 0.6633 0.8137 0.9983 0.0613  0.0388  -0.0373 297 ASP A OD1   
1541 O OD2   . ASP A 193 ? 0.7961 0.9439 1.0687 0.1000  0.0508  -0.0462 297 ASP A OD2   
1542 N N     . GLN A 194 ? 0.4658 0.6107 0.8090 0.0837  -0.0278 -0.0953 298 GLN A N     
1543 C CA    . GLN A 194 ? 0.4759 0.6314 0.8272 0.0939  -0.0439 -0.1074 298 GLN A CA    
1544 C C     . GLN A 194 ? 0.5226 0.6949 0.9188 0.0787  -0.0614 -0.1136 298 GLN A C     
1545 O O     . GLN A 194 ? 0.5039 0.7087 0.9348 0.0834  -0.0689 -0.1171 298 GLN A O     
1546 C CB    . GLN A 194 ? 0.5039 0.6211 0.8032 0.1046  -0.0547 -0.1170 298 GLN A CB    
1547 C CG    . GLN A 194 ? 0.7716 0.8959 1.0708 0.1180  -0.0710 -0.1271 298 GLN A CG    
1548 C CD    . GLN A 194 ? 1.0801 1.1715 1.3415 0.1191  -0.0854 -0.1330 298 GLN A CD    
1549 O OE1   . GLN A 194 ? 1.0324 1.0913 1.2540 0.1211  -0.0817 -0.1292 298 GLN A OE1   
1550 N NE2   . GLN A 194 ? 0.9894 1.0914 1.2633 0.1187  -0.1028 -0.1415 298 GLN A NE2   
1551 N N     . LEU A 195 ? 0.4814 0.6315 0.8768 0.0621  -0.0694 -0.1162 299 LEU A N     
1552 C CA    . LEU A 195 ? 0.4860 0.6448 0.9206 0.0486  -0.0893 -0.1254 299 LEU A CA    
1553 C C     . LEU A 195 ? 0.5812 0.7758 1.0808 0.0340  -0.0849 -0.1139 299 LEU A C     
1554 O O     . LEU A 195 ? 0.5827 0.7993 1.1256 0.0283  -0.1027 -0.1220 299 LEU A O     
1555 C CB    . LEU A 195 ? 0.4854 0.6091 0.8992 0.0380  -0.0982 -0.1314 299 LEU A CB    
1556 C CG    . LEU A 195 ? 0.5421 0.6397 0.9054 0.0499  -0.1100 -0.1440 299 LEU A CG    
1557 C CD1   . LEU A 195 ? 0.5416 0.6101 0.8851 0.0412  -0.1135 -0.1462 299 LEU A CD1   
1558 C CD2   . LEU A 195 ? 0.5691 0.6814 0.9435 0.0584  -0.1334 -0.1609 299 LEU A CD2   
1559 N N     . LYS A 196 ? 0.5633 0.7665 1.0705 0.0287  -0.0616 -0.0938 300 LYS A N     
1560 C CA    . LYS A 196 ? 0.5800 0.8207 1.1490 0.0142  -0.0522 -0.0749 300 LYS A CA    
1561 C C     . LYS A 196 ? 0.7047 0.9968 1.3054 0.0261  -0.0435 -0.0673 300 LYS A C     
1562 O O     . LYS A 196 ? 0.6986 1.0314 1.3571 0.0146  -0.0356 -0.0490 300 LYS A O     
1563 C CB    . LYS A 196 ? 0.6039 0.8360 1.1645 0.0061  -0.0296 -0.0538 300 LYS A CB    
1564 C CG    . LYS A 196 ? 0.6636 0.8561 1.2182 -0.0112 -0.0399 -0.0567 300 LYS A CG    
1565 C CD    . LYS A 196 ? 0.7611 0.9490 1.3132 -0.0195 -0.0181 -0.0331 300 LYS A CD    
1566 C CE    . LYS A 196 ? 0.9260 1.1454 1.5476 -0.0395 -0.0124 -0.0090 300 LYS A CE    
1567 N NZ    . LYS A 196 ? 1.0456 1.2467 1.7097 -0.0612 -0.0387 -0.0173 300 LYS A NZ    
1572 O "O5'" . DC  B 1   ? 1.6646 1.6498 0.8232 -0.5543 0.0738  0.6956  1   DC  C "O5'" 
1573 C "C5'" . DC  B 1   ? 1.7731 1.6854 0.8670 -0.5529 0.0735  0.7501  1   DC  C "C5'" 
1574 C "C4'" . DC  B 1   ? 1.7683 1.6926 0.8508 -0.4992 0.0508  0.7700  1   DC  C "C4'" 
1575 O "O4'" . DC  B 1   ? 1.7220 1.7519 0.8003 -0.5033 0.0462  0.7548  1   DC  C "O4'" 
1576 C "C3'" . DC  B 1   ? 1.7130 1.6231 0.8410 -0.4527 0.0311  0.7485  1   DC  C "C3'" 
1577 O "O3'" . DC  B 1   ? 1.7886 1.6552 0.8886 -0.4051 0.0190  0.7986  1   DC  C "O3'" 
1578 C "C2'" . DC  B 1   ? 1.6104 1.6271 0.7714 -0.4485 0.0190  0.7049  1   DC  C "C2'" 
1579 C "C1'" . DC  B 1   ? 1.6538 1.7276 0.7638 -0.4713 0.0244  0.7252  1   DC  C "C1'" 
1580 N N1    . DC  B 1   ? 1.6043 1.7551 0.7165 -0.4889 0.0338  0.6770  1   DC  C N1    
1581 C C2    . DC  B 1   ? 1.5813 1.7820 0.6693 -0.4806 0.0163  0.6614  1   DC  C C2    
1582 O O2    . DC  B 1   ? 1.5977 1.8070 0.6747 -0.4629 -0.0109 0.6924  1   DC  C O2    
1583 N N3    . DC  B 1   ? 1.5564 1.7944 0.6241 -0.4939 0.0325  0.6159  1   DC  C N3    
1584 C C4    . DC  B 1   ? 1.5403 1.7874 0.6249 -0.5033 0.0653  0.5922  1   DC  C C4    
1585 N N4    . DC  B 1   ? 1.5333 1.8081 0.5878 -0.5030 0.0879  0.5521  1   DC  C N4    
1586 C C5    . DC  B 1   ? 1.5505 1.7783 0.6756 -0.5148 0.0786  0.6114  1   DC  C C5    
1587 C C6    . DC  B 1   ? 1.5834 1.7534 0.7152 -0.5125 0.0615  0.6499  1   DC  C C6    
1588 P P     . DA  B 2   ? 1.7902 1.6045 0.9203 -0.3501 0.0085  0.7990  2   DA  C P     
1589 O OP1   . DA  B 2   ? 1.9087 1.6461 0.9855 -0.3044 0.0147  0.8674  2   DA  C OP1   
1590 O OP2   . DA  B 2   ? 1.7528 1.5132 0.9155 -0.3714 0.0184  0.7514  2   DA  C OP2   
1591 O "O5'" . DA  B 2   ? 1.6890 1.6268 0.8646 -0.3287 -0.0202 0.7771  2   DA  C "O5'" 
1592 C "C5'" . DA  B 2   ? 1.7011 1.7287 0.8511 -0.3236 -0.0378 0.8111  2   DA  C "C5'" 
1593 C "C4'" . DA  B 2   ? 1.6181 1.7477 0.8005 -0.3238 -0.0643 0.7788  2   DA  C "C4'" 
1594 O "O4'" . DA  B 2   ? 1.5630 1.7272 0.7402 -0.3704 -0.0576 0.7221  2   DA  C "O4'" 
1595 C "C3'" . DA  B 2   ? 1.5674 1.6862 0.8049 -0.2907 -0.0740 0.7561  2   DA  C "C3'" 
1596 O "O3'" . DA  B 2   ? 1.5885 1.8014 0.8351 -0.2680 -0.1024 0.7849  2   DA  C "O3'" 
1597 C "C2'" . DA  B 2   ? 1.4716 1.5946 0.7365 -0.3252 -0.0680 0.6816  2   DA  C "C2'" 
1598 C "C1'" . DA  B 2   ? 1.4745 1.6521 0.6934 -0.3678 -0.0649 0.6696  2   DA  C "C1'" 
1599 N N9    . DA  B 2   ? 1.4166 1.5803 0.6386 -0.3968 -0.0410 0.6178  2   DA  C N9    
1600 C C8    . DA  B 2   ? 1.4017 1.5162 0.6465 -0.4048 -0.0175 0.6071  2   DA  C C8    
1601 N N7    . DA  B 2   ? 1.3751 1.5158 0.6174 -0.4276 0.0037  0.5717  2   DA  C N7    
1602 C C5    . DA  B 2   ? 1.3697 1.5555 0.5723 -0.4335 -0.0024 0.5535  2   DA  C C5    
1603 C C6    . DA  B 2   ? 1.3583 1.5699 0.5245 -0.4475 0.0190  0.5151  2   DA  C C6    
1604 N N6    . DA  B 2   ? 1.3345 1.5546 0.5161 -0.4495 0.0518  0.4939  2   DA  C N6    
1605 N N1    . DA  B 2   ? 1.3899 1.6188 0.4960 -0.4592 0.0077  0.5016  2   DA  C N1    
1606 C C2    . DA  B 2   ? 1.4016 1.6500 0.4983 -0.4609 -0.0276 0.5298  2   DA  C C2    
1607 N N3    . DA  B 2   ? 1.3955 1.6449 0.5349 -0.4395 -0.0494 0.5741  2   DA  C N3    
1608 C C4    . DA  B 2   ? 1.3928 1.5963 0.5799 -0.4234 -0.0328 0.5812  2   DA  C C4    
1609 P P     . DG  B 3   ? 1.5846 1.8066 0.8823 -0.2159 -0.1136 0.7953  3   DG  C P     
1610 O OP1   . DG  B 3   ? 1.6311 1.9390 0.9214 -0.1751 -0.1311 0.8709  3   DG  C OP1   
1611 O OP2   . DG  B 3   ? 1.6032 1.6985 0.9175 -0.1923 -0.0880 0.7770  3   DG  C OP2   
1612 O "O5'" . DG  B 3   ? 1.5051 1.7933 0.8294 -0.2529 -0.1328 0.7332  3   DG  C "O5'" 
1613 C "C5'" . DG  B 3   ? 1.5053 1.8992 0.7980 -0.2941 -0.1578 0.7334  3   DG  C "C5'" 
1614 C "C4'" . DG  B 3   ? 1.4534 1.8390 0.7333 -0.3429 -0.1569 0.6586  3   DG  C "C4'" 
1615 O "O4'" . DG  B 3   ? 1.4342 1.7398 0.7011 -0.3580 -0.1261 0.6186  3   DG  C "O4'" 
1616 C "C3'" . DG  B 3   ? 1.3936 1.7718 0.7206 -0.3319 -0.1637 0.6209  3   DG  C "C3'" 
1617 O "O3'" . DG  B 3   ? 1.4261 1.8763 0.7201 -0.3761 -0.1880 0.6034  3   DG  C "O3'" 
1618 C "C2'" . DG  B 3   ? 1.3358 1.6212 0.6730 -0.3381 -0.1346 0.5608  3   DG  C "C2'" 
1619 C "C1'" . DG  B 3   ? 1.3626 1.6430 0.6410 -0.3718 -0.1194 0.5564  3   DG  C "C1'" 
1620 N N9    . DG  B 3   ? 1.3029 1.5210 0.5879 -0.3748 -0.0871 0.5227  3   DG  C N9    
1621 C C8    . DG  B 3   ? 1.2771 1.4424 0.6007 -0.3556 -0.0702 0.5321  3   DG  C C8    
1622 N N7    . DG  B 3   ? 1.2565 1.4024 0.5795 -0.3712 -0.0445 0.5025  3   DG  C N7    
1623 C C5    . DG  B 3   ? 1.2495 1.4247 0.5264 -0.3915 -0.0387 0.4717  3   DG  C C5    
1624 C C6    . DG  B 3   ? 1.2281 1.4018 0.4810 -0.4020 -0.0077 0.4365  3   DG  C C6    
1625 O O6    . DG  B 3   ? 1.2027 1.3746 0.4838 -0.3989 0.0173  0.4303  3   DG  C O6    
1626 N N1    . DG  B 3   ? 1.2624 1.4407 0.4445 -0.4185 -0.0050 0.4100  3   DG  C N1    
1627 C C2    . DG  B 3   ? 1.3004 1.4948 0.4419 -0.4372 -0.0348 0.4164  3   DG  C C2    
1628 N N2    . DG  B 3   ? 1.3580 1.5371 0.4118 -0.4647 -0.0268 0.3846  3   DG  C N2    
1629 N N3    . DG  B 3   ? 1.2984 1.5235 0.4764 -0.4299 -0.0680 0.4542  3   DG  C N3    
1630 C C4    . DG  B 3   ? 1.2814 1.4902 0.5263 -0.4002 -0.0654 0.4806  3   DG  C C4    
1631 P P     . DC  B 4   ? 1.4049 1.9004 0.7390 -0.3716 -0.2092 0.5940  4   DC  C P     
1632 O OP1   . DC  B 4   ? 1.4422 2.0717 0.7596 -0.3933 -0.2442 0.6463  4   DC  C OP1   
1633 O OP2   . DC  B 4   ? 1.3522 1.7914 0.7582 -0.3117 -0.1946 0.5952  4   DC  C OP2   
1634 O "O5'" . DC  B 4   ? 1.3915 1.8294 0.6785 -0.4212 -0.2003 0.5172  4   DC  C "O5'" 
1635 C "C5'" . DC  B 4   ? 1.4433 1.8860 0.6336 -0.4847 -0.2029 0.4950  4   DC  C "C5'" 
1636 C "C4'" . DC  B 4   ? 1.4334 1.7664 0.5778 -0.4965 -0.1682 0.4268  4   DC  C "C4'" 
1637 O "O4'" . DC  B 4   ? 1.3939 1.6794 0.5701 -0.4592 -0.1381 0.4277  4   DC  C "O4'" 
1638 C "C3'" . DC  B 4   ? 1.3735 1.6501 0.5475 -0.4822 -0.1594 0.3815  4   DC  C "C3'" 
1639 O "O3'" . DC  B 4   ? 1.4418 1.7157 0.5407 -0.5376 -0.1737 0.3544  4   DC  C "O3'" 
1640 C "C2'" . DC  B 4   ? 1.3514 1.5385 0.5155 -0.4597 -0.1169 0.3402  4   DC  C "C2'" 
1641 C "C1'" . DC  B 4   ? 1.3523 1.5589 0.5180 -0.4511 -0.1062 0.3726  4   DC  C "C1'" 
1642 N N1    . DC  B 4   ? 1.2437 1.4226 0.4835 -0.4073 -0.0837 0.3763  4   DC  C N1    
1643 C C2    . DC  B 4   ? 1.2157 1.3512 0.4421 -0.3984 -0.0467 0.3424  4   DC  C C2    
1644 O O2    . DC  B 4   ? 1.2678 1.3731 0.4161 -0.4163 -0.0278 0.3103  4   DC  C O2    
1645 N N3    . DC  B 4   ? 1.1527 1.2825 0.4439 -0.3722 -0.0304 0.3500  4   DC  C N3    
1646 C C4    . DC  B 4   ? 1.1185 1.2543 0.4707 -0.3568 -0.0470 0.3821  4   DC  C C4    
1647 N N4    . DC  B 4   ? 1.0902 1.2101 0.4878 -0.3455 -0.0310 0.3860  4   DC  C N4    
1648 C C5    . DC  B 4   ? 1.1321 1.2918 0.4938 -0.3526 -0.0784 0.4143  4   DC  C C5    
1649 C C6    . DC  B 4   ? 1.1819 1.3764 0.4952 -0.3768 -0.0971 0.4124  4   DC  C C6    
1650 P P     . DT  B 5   ? 1.4356 1.6579 0.5480 -0.5348 -0.1710 0.3133  5   DT  C P     
1651 O OP1   . DT  B 5   ? 1.5128 1.7746 0.5540 -0.6052 -0.2004 0.3126  5   DT  C OP1   
1652 O OP2   . DT  B 5   ? 1.3191 1.5584 0.5513 -0.4718 -0.1721 0.3304  5   DT  C OP2   
1653 O "O5'" . DT  B 5   ? 1.4690 1.5634 0.5156 -0.5264 -0.1250 0.2542  5   DT  C "O5'" 
1654 C "C5'" . DT  B 5   ? 1.5550 1.5940 0.4783 -0.5644 -0.1032 0.2316  5   DT  C "C5'" 
1655 C "C4'" . DT  B 5   ? 1.5572 1.4905 0.4496 -0.5241 -0.0508 0.1885  5   DT  C "C4'" 
1656 O "O4'" . DT  B 5   ? 1.4480 1.4180 0.4421 -0.4671 -0.0359 0.2097  5   DT  C "O4'" 
1657 C "C3'" . DT  B 5   ? 1.5479 1.4026 0.4362 -0.5042 -0.0348 0.1499  5   DT  C "C3'" 
1658 O "O3'" . DT  B 5   ? 1.6849 1.4176 0.4475 -0.5042 0.0121  0.1064  5   DT  C "O3'" 
1659 C "C2'" . DT  B 5   ? 1.4006 1.2920 0.4271 -0.4360 -0.0282 0.1632  5   DT  C "C2'" 
1660 C "C1'" . DT  B 5   ? 1.3694 1.3021 0.4215 -0.4181 -0.0137 0.1877  5   DT  C "C1'" 
1661 N N1    . DT  B 5   ? 1.2129 1.2110 0.3943 -0.3805 -0.0250 0.2211  5   DT  C N1    
1662 C C2    . DT  B 5   ? 1.1598 1.1602 0.3825 -0.3450 0.0057  0.2206  5   DT  C C2    
1663 O O2    . DT  B 5   ? 1.2148 1.1804 0.3898 -0.3291 0.0439  0.1978  5   DT  C O2    
1664 N N3    . DT  B 5   ? 1.0620 1.1072 0.3773 -0.3293 -0.0075 0.2508  5   DT  C N3    
1665 C C4    . DT  B 5   ? 1.0168 1.0897 0.3821 -0.3325 -0.0413 0.2807  5   DT  C C4    
1666 O O4    . DT  B 5   ? 0.9604 1.0444 0.3866 -0.3172 -0.0432 0.3030  5   DT  C O4    
1667 C C5    . DT  B 5   ? 1.0600 1.1450 0.3922 -0.3557 -0.0697 0.2842  5   DT  C C5    
1668 C C7    . DT  B 5   ? 1.0261 1.1561 0.4115 -0.3476 -0.1019 0.3226  5   DT  C C7    
1669 C C6    . DT  B 5   ? 1.1404 1.1946 0.3857 -0.3847 -0.0632 0.2547  5   DT  C C6    
1670 P P     . DC  B 6   ? 1.7601 1.3732 0.4583 -0.4942 0.0371  0.0631  6   DC  C P     
1671 O OP1   . DC  B 6   ? 1.9468 1.4243 0.4592 -0.5281 0.0746  0.0258  6   DC  C OP1   
1672 O OP2   . DC  B 6   ? 1.6942 1.3521 0.4517 -0.5202 -0.0065 0.0723  6   DC  C OP2   
1673 O "O5'" . DC  B 6   ? 1.6863 1.2998 0.4782 -0.4041 0.0740  0.0617  6   DC  C "O5'" 
1674 C "C5'" . DC  B 6   ? 1.7285 1.3201 0.4902 -0.3608 0.1228  0.0581  6   DC  C "C5'" 
1675 C "C4'" . DC  B 6   ? 1.6253 1.2632 0.5026 -0.2856 0.1443  0.0682  6   DC  C "C4'" 
1676 O "O4'" . DC  B 6   ? 1.4709 1.2293 0.4898 -0.2867 0.1053  0.1041  6   DC  C "O4'" 
1677 C "C3'" . DC  B 6   ? 1.6231 1.2043 0.5113 -0.2520 0.1541  0.0481  6   DC  C "C3'" 
1678 O "O3'" . DC  B 6   ? 1.6982 1.2408 0.5612 -0.1823 0.2118  0.0399  6   DC  C "O3'" 
1679 C "C2'" . DC  B 6   ? 1.4416 1.1281 0.4866 -0.2448 0.1110  0.0734  6   DC  C "C2'" 
1680 C "C1'" . DC  B 6   ? 1.3593 1.1445 0.4756 -0.2469 0.1017  0.1061  6   DC  C "C1'" 
1681 N N1    . DC  B 6   ? 1.2001 1.0682 0.4270 -0.2649 0.0539  0.1356  6   DC  C N1    
1682 C C2    . DC  B 6   ? 1.0854 1.0250 0.4124 -0.2419 0.0531  0.1602  6   DC  C C2    
1683 O O2    . DC  B 6   ? 1.0820 1.0416 0.4226 -0.2091 0.0870  0.1601  6   DC  C O2    
1684 N N3    . DC  B 6   ? 0.9897 0.9735 0.3880 -0.2573 0.0174  0.1860  6   DC  C N3    
1685 C C4    . DC  B 6   ? 0.9768 0.9579 0.3635 -0.2836 -0.0153 0.1935  6   DC  C C4    
1686 N N4    . DC  B 6   ? 0.9105 0.9284 0.3611 -0.2843 -0.0417 0.2228  6   DC  C N4    
1687 C C5    . DC  B 6   ? 1.0634 1.0032 0.3641 -0.3119 -0.0200 0.1736  6   DC  C C5    
1688 C C6    . DC  B 6   ? 1.1739 1.0478 0.3906 -0.3068 0.0144  0.1424  6   DC  C C6    
1689 P P     . DT  B 7   ? 1.7871 1.2237 0.5959 -0.1352 0.2460  0.0155  7   DT  C P     
1690 O OP1   . DT  B 7   ? 1.9621 1.2770 0.6198 -0.0989 0.3131  -0.0046 7   DT  C OP1   
1691 O OP2   . DT  B 7   ? 1.7786 1.1710 0.5764 -0.1857 0.2045  0.0006  7   DT  C OP2   
1692 O "O5'" . DT  B 7   ? 1.6506 1.2058 0.6131 -0.0685 0.2495  0.0429  7   DT  C "O5'" 
1693 C "C5'" . DT  B 7   ? 1.5737 1.2490 0.6173 -0.0427 0.2615  0.0729  7   DT  C "C5'" 
1694 C "C4'" . DT  B 7   ? 1.4065 1.2104 0.6067 -0.0258 0.2345  0.0999  7   DT  C "C4'" 
1695 O "O4'" . DT  B 7   ? 1.2882 1.1438 0.5613 -0.0851 0.1770  0.1107  7   DT  C "O4'" 
1696 C "C3'" . DT  B 7   ? 1.3812 1.1676 0.6139 0.0141  0.2369  0.0937  7   DT  C "C3'" 
1697 O "O3'" . DT  B 7   ? 1.3527 1.2512 0.6707 0.0664  0.2581  0.1218  7   DT  C "O3'" 
1698 C "C2'" . DT  B 7   ? 1.2528 1.0625 0.5594 -0.0376 0.1761  0.0929  7   DT  C "C2'" 
1699 C "C1'" . DT  B 7   ? 1.1683 1.0633 0.5330 -0.0774 0.1504  0.1158  7   DT  C "C1'" 
1700 N N1    . DT  B 7   ? 1.0557 0.9567 0.4575 -0.1302 0.0981  0.1194  7   DT  C N1    
1701 C C2    . DT  B 7   ? 0.9332 0.9128 0.4266 -0.1471 0.0716  0.1449  7   DT  C C2    
1702 O O2    . DT  B 7   ? 0.8907 0.9404 0.4391 -0.1338 0.0833  0.1628  7   DT  C O2    
1703 N N3    . DT  B 7   ? 0.8809 0.8531 0.3910 -0.1820 0.0328  0.1515  7   DT  C N3    
1704 C C4    . DT  B 7   ? 0.9149 0.8393 0.3731 -0.2063 0.0140  0.1400  7   DT  C C4    
1705 O O4    . DT  B 7   ? 0.8614 0.8068 0.3492 -0.2284 -0.0182 0.1564  7   DT  C O4    
1706 C C5    . DT  B 7   ? 1.0318 0.8807 0.3946 -0.2028 0.0379  0.1112  7   DT  C C5    
1707 C C7    . DT  B 7   ? 1.0970 0.8938 0.3892 -0.2438 0.0178  0.0970  7   DT  C C7    
1708 C C6    . DT  B 7   ? 1.0883 0.9157 0.4213 -0.1629 0.0805  0.1009  7   DT  C C6    
1709 P P     . DG  B 8   ? 1.3882 1.2846 0.7167 0.1395  0.2884  0.1263  8   DG  C P     
1710 O OP1   . DG  B 8   ? 1.4998 1.3953 0.7668 0.2128  0.3561  0.1391  8   DG  C OP1   
1711 O OP2   . DG  B 8   ? 1.4127 1.1888 0.6904 0.1254  0.2708  0.0972  8   DG  C OP2   
1712 O "O5'" . DG  B 8   ? 1.2311 1.2916 0.7117 0.1318  0.2549  0.1580  8   DG  C "O5'" 
1713 C "C5'" . DG  B 8   ? 1.1387 1.3166 0.6920 0.0924  0.2367  0.1827  8   DG  C "C5'" 
1714 C "C4'" . DG  B 8   ? 0.9999 1.2486 0.6548 0.0446  0.1849  0.1927  8   DG  C "C4'" 
1715 O "O4'" . DG  B 8   ? 0.9502 1.1182 0.5884 -0.0115 0.1441  0.1725  8   DG  C "O4'" 
1716 C "C3'" . DG  B 8   ? 0.9547 1.2316 0.6580 0.0733  0.1768  0.1952  8   DG  C "C3'" 
1717 O "O3'" . DG  B 8   ? 0.9128 1.3342 0.7095 0.0546  0.1621  0.2264  8   DG  C "O3'" 
1718 C "C2'" . DG  B 8   ? 0.8989 1.0763 0.5909 0.0345  0.1359  0.1669  8   DG  C "C2'" 
1719 C "C1'" . DG  B 8   ? 0.8636 1.0238 0.5493 -0.0241 0.1109  0.1656  8   DG  C "C1'" 
1720 N N9    . DG  B 8   ? 0.8234 0.8827 0.4635 -0.0528 0.0862  0.1421  8   DG  C N9    
1721 C C8    . DG  B 8   ? 0.8727 0.8322 0.4235 -0.0441 0.1000  0.1183  8   DG  C C8    
1722 N N7    . DG  B 8   ? 0.8535 0.7655 0.3825 -0.0856 0.0695  0.1081  8   DG  C N7    
1723 C C5    . DG  B 8   ? 0.7649 0.7379 0.3721 -0.1118 0.0378  0.1268  8   DG  C C5    
1724 C C6    . DG  B 8   ? 0.7004 0.6647 0.3241 -0.1469 0.0024  0.1328  8   DG  C C6    
1725 O O6    . DG  B 8   ? 0.7016 0.6270 0.2839 -0.1675 -0.0128 0.1258  8   DG  C O6    
1726 N N1    . DG  B 8   ? 0.6503 0.6606 0.3380 -0.1589 -0.0130 0.1532  8   DG  C N1    
1727 C C2    . DG  B 8   ? 0.6551 0.7218 0.3862 -0.1534 -0.0015 0.1647  8   DG  C C2    
1728 N N2    . DG  B 8   ? 0.6316 0.7153 0.4011 -0.1789 -0.0184 0.1809  8   DG  C N2    
1729 N N3    . DG  B 8   ? 0.6903 0.7955 0.4202 -0.1250 0.0271  0.1636  8   DG  C N3    
1730 C C4    . DG  B 8   ? 0.7522 0.8037 0.4191 -0.0983 0.0479  0.1450  8   DG  C C4    
1731 P P     . DT  B 9   ? 0.8953 1.4021 0.7570 0.0791  0.1543  0.2426  9   DT  C P     
1732 O OP1   . DT  B 9   ? 0.8778 1.5625 0.8068 0.0770  0.1645  0.2855  9   DT  C OP1   
1733 O OP2   . DT  B 9   ? 0.9523 1.3751 0.7615 0.1468  0.1806  0.2280  9   DT  C OP2   
1734 O "O5'" . DT  B 9   ? 0.8249 1.2903 0.7187 0.0111  0.1002  0.2254  9   DT  C "O5'" 
1735 C "C5'" . DT  B 9   ? 0.7954 1.2833 0.7126 -0.0583 0.0738  0.2325  9   DT  C "C5'" 
1736 C "C4'" . DT  B 9   ? 0.7596 1.1704 0.6821 -0.1025 0.0340  0.2133  9   DT  C "C4'" 
1737 O "O4'" . DT  B 9   ? 0.7595 1.0479 0.6299 -0.0963 0.0290  0.1876  9   DT  C "O4'" 
1738 C "C3'" . DT  B 9   ? 0.7437 1.1715 0.6981 -0.0932 0.0186  0.2088  9   DT  C "C3'" 
1739 O "O3'" . DT  B 9   ? 0.7706 1.2124 0.7495 -0.1550 -0.0111 0.2131  9   DT  C "O3'" 
1740 C "C2'" . DT  B 9   ? 0.7179 1.0217 0.6307 -0.0689 0.0135  0.1783  9   DT  C "C2'" 
1741 C "C1'" . DT  B 9   ? 0.7086 0.9419 0.5853 -0.0984 0.0063  0.1705  9   DT  C "C1'" 
1742 N N1    . DT  B 9   ? 0.6827 0.8166 0.5049 -0.0826 0.0075  0.1479  9   DT  C N1    
1743 C C2    . DT  B 9   ? 0.6415 0.7181 0.4521 -0.1128 -0.0168 0.1417  9   DT  C C2    
1744 O O2    . DT  B 9   ? 0.6314 0.7132 0.4665 -0.1429 -0.0349 0.1518  9   DT  C O2    
1745 N N3    . DT  B 9   ? 0.6342 0.6456 0.3946 -0.1071 -0.0168 0.1262  9   DT  C N3    
1746 C C4    . DT  B 9   ? 0.6738 0.6447 0.3784 -0.0815 0.0064  0.1114  9   DT  C C4    
1747 O O4    . DT  B 9   ? 0.6903 0.6002 0.3406 -0.0955 0.0013  0.0982  9   DT  C O4    
1748 C C5    . DT  B 9   ? 0.7180 0.7258 0.4268 -0.0399 0.0376  0.1167  9   DT  C C5    
1749 C C7    . DT  B 9   ? 0.7949 0.7360 0.4272 0.0012  0.0733  0.1028  9   DT  C C7    
1750 C C6    . DT  B 9   ? 0.7050 0.8060 0.4795 -0.0400 0.0359  0.1374  9   DT  C C6    
1751 P P     . DA  B 10  ? 0.7754 1.2912 0.7945 -0.1731 -0.0287 0.2216  10  DA  C P     
1752 O OP1   . DA  B 10  ? 0.7903 1.4443 0.8430 -0.2142 -0.0277 0.2544  10  DA  C OP1   
1753 O OP2   . DA  B 10  ? 0.7613 1.2743 0.7855 -0.1108 -0.0193 0.2140  10  DA  C OP2   
1754 O "O5'" . DA  B 10  ? 0.7684 1.1742 0.7628 -0.2234 -0.0579 0.2006  10  DA  C "O5'" 
1755 C "C5'" . DA  B 10  ? 0.7789 1.0956 0.7373 -0.2532 -0.0618 0.1955  10  DA  C "C5'" 
1756 C "C4'" . DA  B 10  ? 0.7641 0.9598 0.6945 -0.2530 -0.0771 0.1738  10  DA  C "C4'" 
1757 O "O4'" . DA  B 10  ? 0.7215 0.8648 0.6392 -0.2055 -0.0707 0.1606  10  DA  C "O4'" 
1758 C "C3'" . DA  B 10  ? 0.7497 0.9422 0.6898 -0.2580 -0.0913 0.1624  10  DA  C "C3'" 
1759 O "O3'" . DA  B 10  ? 0.8155 0.9130 0.7174 -0.2947 -0.1024 0.1546  10  DA  C "O3'" 
1760 C "C2'" . DA  B 10  ? 0.6887 0.8544 0.6349 -0.1994 -0.0872 0.1464  10  DA  C "C2'" 
1761 C "C1'" . DA  B 10  ? 0.6686 0.7759 0.5894 -0.1824 -0.0794 0.1435  10  DA  C "C1'" 
1762 N N9    . DA  B 10  ? 0.6059 0.7083 0.5180 -0.1378 -0.0667 0.1345  10  DA  C N9    
1763 C C8    . DA  B 10  ? 0.5901 0.7459 0.5086 -0.1042 -0.0474 0.1383  10  DA  C C8    
1764 N N7    . DA  B 10  ? 0.5941 0.7000 0.4757 -0.0728 -0.0338 0.1262  10  DA  C N7    
1765 C C5    . DA  B 10  ? 0.5688 0.6076 0.4289 -0.0932 -0.0497 0.1165  10  DA  C C5    
1766 C C6    . DA  B 10  ? 0.5592 0.5369 0.3748 -0.0898 -0.0496 0.1045  10  DA  C C6    
1767 N N6    . DA  B 10  ? 0.5694 0.5127 0.3365 -0.0677 -0.0298 0.0932  10  DA  C N6    
1768 N N1    . DA  B 10  ? 0.5647 0.5166 0.3779 -0.1119 -0.0686 0.1075  10  DA  C N1    
1769 C C2    . DA  B 10  ? 0.5573 0.5172 0.4002 -0.1275 -0.0812 0.1188  10  DA  C C2    
1770 N N3    . DA  B 10  ? 0.5655 0.5537 0.4351 -0.1387 -0.0810 0.1249  10  DA  C N3    
1771 C C4    . DA  B 10  ? 0.5754 0.6140 0.4573 -0.1250 -0.0677 0.1241  10  DA  C C4    
1772 P P     . DC  B 11  ? 0.8539 0.9324 0.7420 -0.3270 -0.1168 0.1440  11  DC  C P     
1773 O OP1   . DC  B 11  ? 0.9527 0.9653 0.7856 -0.3936 -0.1194 0.1480  11  DC  C OP1   
1774 O OP2   . DC  B 11  ? 0.8039 1.0040 0.7382 -0.3172 -0.1213 0.1503  11  DC  C OP2   
1775 O "O5'" . DC  B 11  ? 0.8361 0.8171 0.7089 -0.2828 -0.1177 0.1242  11  DC  C "O5'" 
1776 C "C5'" . DC  B 11  ? 0.8497 0.7389 0.6927 -0.2643 -0.1108 0.1251  11  DC  C "C5'" 
1777 C "C4'" . DC  B 11  ? 0.7918 0.6561 0.6468 -0.2134 -0.1115 0.1146  11  DC  C "C4'" 
1778 O "O4'" . DC  B 11  ? 0.7202 0.6437 0.6044 -0.1843 -0.1082 0.1159  11  DC  C "O4'" 
1779 C "C3'" . DC  B 11  ? 0.7609 0.6274 0.6238 -0.2056 -0.1188 0.0990  11  DC  C "C3'" 
1780 O "O3'" . DC  B 11  ? 0.8353 0.6108 0.6557 -0.2129 -0.1170 0.0928  11  DC  C "O3'" 
1781 C "C2'" . DC  B 11  ? 0.6835 0.5717 0.5714 -0.1604 -0.1184 0.0933  11  DC  C "C2'" 
1782 C "C1'" . DC  B 11  ? 0.6577 0.5697 0.5494 -0.1525 -0.1114 0.1039  11  DC  C "C1'" 
1783 N N1    . DC  B 11  ? 0.5886 0.5507 0.4946 -0.1299 -0.1047 0.1001  11  DC  C N1    
1784 C C2    . DC  B 11  ? 0.5516 0.4950 0.4407 -0.1120 -0.1004 0.0974  11  DC  C C2    
1785 O O2    . DC  B 11  ? 0.5587 0.4715 0.4356 -0.1155 -0.1061 0.1030  11  DC  C O2    
1786 N N3    . DC  B 11  ? 0.5405 0.4979 0.4182 -0.0917 -0.0879 0.0913  11  DC  C N3    
1787 C C4    . DC  B 11  ? 0.5404 0.5432 0.4338 -0.0768 -0.0779 0.0940  11  DC  C C4    
1788 N N4    . DC  B 11  ? 0.5437 0.5424 0.4123 -0.0456 -0.0579 0.0912  11  DC  C N4    
1789 C C5    . DC  B 11  ? 0.5424 0.5956 0.4689 -0.0946 -0.0864 0.1024  11  DC  C C5    
1790 C C6    . DC  B 11  ? 0.5643 0.5876 0.4905 -0.1267 -0.1007 0.1020  11  DC  C C6    
1791 P P     . DG  B 12  ? 0.8549 0.6144 0.6590 -0.2293 -0.1238 0.0765  12  DG  C P     
1792 O OP1   . DG  B 12  ? 0.9632 0.6258 0.6962 -0.2718 -0.1176 0.0732  12  DG  C OP1   
1793 O OP2   . DG  B 12  ? 0.7985 0.6657 0.6471 -0.2359 -0.1346 0.0762  12  DG  C OP2   
1794 O "O5'" . DG  B 12  ? 0.8153 0.5428 0.6260 -0.1789 -0.1203 0.0693  12  DG  C "O5'" 
1795 C "C5'" . DG  B 12  ? 0.8190 0.4746 0.6032 -0.1496 -0.1075 0.0780  12  DG  C "C5'" 
1796 C "C4'" . DG  B 12  ? 0.7585 0.4115 0.5534 -0.1111 -0.1058 0.0729  12  DG  C "C4'" 
1797 O "O4'" . DG  B 12  ? 0.6433 0.3749 0.4873 -0.0942 -0.1155 0.0735  12  DG  C "O4'" 
1798 C "C3'" . DG  B 12  ? 0.7702 0.3989 0.5440 -0.1231 -0.1078 0.0541  12  DG  C "C3'" 
1799 O "O3'" . DG  B 12  ? 0.8208 0.4021 0.5751 -0.0853 -0.0945 0.0558  12  DG  C "O3'" 
1800 C "C2'" . DG  B 12  ? 0.6741 0.3941 0.4988 -0.1229 -0.1232 0.0476  12  DG  C "C2'" 
1801 C "C1'" . DG  B 12  ? 0.6020 0.3577 0.4587 -0.0926 -0.1224 0.0589  12  DG  C "C1'" 
1802 N N9    . DG  B 12  ? 0.5278 0.3463 0.4137 -0.0936 -0.1287 0.0577  12  DG  C N9    
1803 C C8    . DG  B 12  ? 0.5241 0.3824 0.4201 -0.1115 -0.1298 0.0612  12  DG  C C8    
1804 N N7    . DG  B 12  ? 0.5074 0.4052 0.4184 -0.0958 -0.1271 0.0626  12  DG  C N7    
1805 C C5    . DG  B 12  ? 0.4803 0.3560 0.3852 -0.0764 -0.1270 0.0576  12  DG  C C5    
1806 C C6    . DG  B 12  ? 0.4710 0.3481 0.3655 -0.0623 -0.1220 0.0548  12  DG  C C6    
1807 O O6    . DG  B 12  ? 0.4903 0.3796 0.3759 -0.0530 -0.1123 0.0554  12  DG  C O6    
1808 N N1    . DG  B 12  ? 0.4487 0.3052 0.3332 -0.0597 -0.1258 0.0524  12  DG  C N1    
1809 C C2    . DG  B 12  ? 0.4373 0.2855 0.3295 -0.0586 -0.1305 0.0563  12  DG  C C2    
1810 N N2    . DG  B 12  ? 0.4221 0.2733 0.3092 -0.0560 -0.1328 0.0589  12  DG  C N2    
1811 N N3    . DG  B 12  ? 0.4498 0.2821 0.3450 -0.0607 -0.1297 0.0581  12  DG  C N3    
1812 C C4    . DG  B 12  ? 0.4826 0.3241 0.3802 -0.0751 -0.1294 0.0569  12  DG  C C4    
1813 P P     . DT  B 13  ? 0.9160 0.4291 0.6189 -0.0897 -0.0858 0.0382  13  DT  C P     
1814 O OP1   . DT  B 13  ? 1.0555 0.4582 0.6919 -0.0640 -0.0576 0.0468  13  DT  C OP1   
1815 O OP2   . DT  B 13  ? 0.9357 0.4659 0.6266 -0.1439 -0.1017 0.0213  13  DT  C OP2   
1816 O "O5'" . DT  B 13  ? 0.8356 0.4088 0.5819 -0.0553 -0.0901 0.0379  13  DT  C "O5'" 
1817 C "C5'" . DT  B 13  ? 0.7315 0.3834 0.5242 -0.0662 -0.1087 0.0325  13  DT  C "C5'" 
1818 C "C4'" . DT  B 13  ? 0.6469 0.3465 0.4745 -0.0350 -0.1095 0.0405  13  DT  C "C4'" 
1819 O "O4'" . DT  B 13  ? 0.5411 0.2998 0.4042 -0.0426 -0.1216 0.0440  13  DT  C "O4'" 
1820 C "C3'" . DT  B 13  ? 0.6215 0.3268 0.4451 -0.0315 -0.1118 0.0285  13  DT  C "C3'" 
1821 O "O3'" . DT  B 13  ? 0.6124 0.3227 0.4384 -0.0001 -0.1004 0.0388  13  DT  C "O3'" 
1822 C "C2'" . DT  B 13  ? 0.5610 0.3240 0.4156 -0.0424 -0.1272 0.0248  13  DT  C "C2'" 
1823 C "C1'" . DT  B 13  ? 0.5178 0.3067 0.3930 -0.0428 -0.1291 0.0356  13  DT  C "C1'" 
1824 N N1    . DT  B 13  ? 0.4885 0.3084 0.3756 -0.0553 -0.1357 0.0333  13  DT  C N1    
1825 C C2    . DT  B 13  ? 0.4572 0.2975 0.3503 -0.0468 -0.1352 0.0356  13  DT  C C2    
1826 O O2    . DT  B 13  ? 0.4777 0.3119 0.3638 -0.0413 -0.1340 0.0368  13  DT  C O2    
1827 N N3    . DT  B 13  ? 0.4277 0.2932 0.3264 -0.0469 -0.1335 0.0380  13  DT  C N3    
1828 C C4    . DT  B 13  ? 0.4573 0.3526 0.3672 -0.0602 -0.1362 0.0417  13  DT  C C4    
1829 O O4    . DT  B 13  ? 0.4747 0.4093 0.3939 -0.0527 -0.1314 0.0494  13  DT  C O4    
1830 C C5    . DT  B 13  ? 0.4903 0.3633 0.3900 -0.0834 -0.1416 0.0373  13  DT  C C5    
1831 C C7    . DT  B 13  ? 0.5249 0.4258 0.4226 -0.1166 -0.1472 0.0407  13  DT  C C7    
1832 C C6    . DT  B 13  ? 0.5019 0.3271 0.3852 -0.0765 -0.1388 0.0319  13  DT  C C6    
1833 P P     . DG  B 14  ? 0.6305 0.3252 0.4359 0.0091  -0.0939 0.0286  14  DG  C P     
1834 O OP1   . DG  B 14  ? 0.6400 0.3403 0.4441 0.0480  -0.0742 0.0471  14  DG  C OP1   
1835 O OP2   . DG  B 14  ? 0.6906 0.3269 0.4502 -0.0162 -0.0944 0.0086  14  DG  C OP2   
1836 O "O5'" . DG  B 14  ? 0.5840 0.3373 0.4207 -0.0025 -0.1107 0.0255  14  DG  C "O5'" 
1837 C "C5'" . DG  B 14  ? 0.5854 0.3881 0.4492 0.0022  -0.1139 0.0400  14  DG  C "C5'" 
1838 C "C4'" . DG  B 14  ? 0.5903 0.4089 0.4575 -0.0138 -0.1255 0.0330  14  DG  C "C4'" 
1839 O "O4'" . DG  B 14  ? 0.5809 0.3950 0.4508 -0.0240 -0.1323 0.0270  14  DG  C "O4'" 
1840 C "C3'" . DG  B 14  ? 0.6379 0.4470 0.4900 -0.0127 -0.1264 0.0236  14  DG  C "C3'" 
1841 O "O3'" . DG  B 14  ? 0.6788 0.5004 0.5273 -0.0188 -0.1290 0.0280  14  DG  C "O3'" 
1842 C "C2'" . DG  B 14  ? 0.6145 0.4163 0.4620 -0.0220 -0.1346 0.0139  14  DG  C "C2'" 
1843 C "C1'" . DG  B 14  ? 0.5729 0.3882 0.4353 -0.0251 -0.1372 0.0197  14  DG  C "C1'" 
1844 N N9    . DG  B 14  ? 0.5341 0.3633 0.4033 -0.0331 -0.1422 0.0186  14  DG  C N9    
1845 C C8    . DG  B 14  ? 0.5422 0.3680 0.4043 -0.0503 -0.1460 0.0136  14  DG  C C8    
1846 N N7    . DG  B 14  ? 0.5243 0.3843 0.3989 -0.0617 -0.1511 0.0188  14  DG  C N7    
1847 C C5    . DG  B 14  ? 0.4904 0.3690 0.3788 -0.0411 -0.1465 0.0268  14  DG  C C5    
1848 C C6    . DG  B 14  ? 0.4655 0.3833 0.3672 -0.0329 -0.1433 0.0374  14  DG  C C6    
1849 O O6    . DG  B 14  ? 0.4795 0.4441 0.3955 -0.0465 -0.1475 0.0449  14  DG  C O6    
1850 N N1    . DG  B 14  ? 0.4453 0.3425 0.3337 -0.0083 -0.1318 0.0406  14  DG  C N1    
1851 C C2    . DG  B 14  ? 0.4839 0.3339 0.3491 -0.0054 -0.1284 0.0344  14  DG  C C2    
1852 N N2    . DG  B 14  ? 0.5005 0.3150 0.3334 0.0077  -0.1155 0.0362  14  DG  C N2    
1853 N N3    . DG  B 14  ? 0.4943 0.3307 0.3598 -0.0168 -0.1345 0.0282  14  DG  C N3    
1854 C C4    . DG  B 14  ? 0.4998 0.3499 0.3775 -0.0281 -0.1416 0.0247  14  DG  C C4    
1855 P P     . DA  B 15  ? 0.7143 0.5366 0.5475 -0.0172 -0.1263 0.0281  15  DA  C P     
1856 O OP1   . DA  B 15  ? 0.7491 0.6045 0.5909 -0.0170 -0.1191 0.0418  15  DA  C OP1   
1857 O OP2   . DA  B 15  ? 0.6978 0.5049 0.5190 -0.0109 -0.1276 0.0173  15  DA  C OP2   
1858 O "O5'" . DA  B 15  ? 0.7115 0.5155 0.5230 -0.0276 -0.1293 0.0297  15  DA  C "O5'" 
1859 C "C5'" . DA  B 15  ? 0.7022 0.4955 0.5024 -0.0427 -0.1288 0.0337  15  DA  C "C5'" 
1860 C "C4'" . DA  B 15  ? 0.7055 0.4508 0.4690 -0.0368 -0.1239 0.0314  15  DA  C "C4'" 
1861 O "O4'" . DA  B 15  ? 0.6784 0.4321 0.4601 -0.0174 -0.1242 0.0292  15  DA  C "O4'" 
1862 C "C3'" . DA  B 15  ? 0.7203 0.4441 0.4598 -0.0246 -0.1206 0.0337  15  DA  C "C3'" 
1863 O "O3'" . DA  B 15  ? 0.7830 0.4409 0.4621 -0.0328 -0.1094 0.0373  15  DA  C "O3'" 
1864 C "C2'" . DA  B 15  ? 0.6900 0.4362 0.4501 0.0035  -0.1238 0.0346  15  DA  C "C2'" 
1865 C "C1'" . DA  B 15  ? 0.6696 0.4223 0.4439 0.0066  -0.1220 0.0335  15  DA  C "C1'" 
1866 N N9    . DA  B 15  ? 0.6090 0.4124 0.4208 0.0132  -0.1305 0.0337  15  DA  C N9    
1867 C C8    . DA  B 15  ? 0.5908 0.4200 0.4230 -0.0004 -0.1406 0.0267  15  DA  C C8    
1868 N N7    . DA  B 15  ? 0.5702 0.4347 0.4202 -0.0058 -0.1474 0.0279  15  DA  C N7    
1869 C C5    . DA  B 15  ? 0.5507 0.4295 0.4050 0.0118  -0.1407 0.0390  15  DA  C C5    
1870 C C6    . DA  B 15  ? 0.5060 0.4384 0.3812 0.0166  -0.1418 0.0502  15  DA  C C6    
1871 N N6    . DA  B 15  ? 0.4867 0.4676 0.3800 -0.0096 -0.1547 0.0505  15  DA  C N6    
1872 N N1    . DA  B 15  ? 0.5158 0.4490 0.3832 0.0475  -0.1266 0.0631  15  DA  C N1    
1873 C C2    . DA  B 15  ? 0.5627 0.4261 0.3900 0.0652  -0.1115 0.0609  15  DA  C C2    
1874 N N3    . DA  B 15  ? 0.5852 0.3935 0.3867 0.0509  -0.1125 0.0500  15  DA  C N3    
1875 C C4    . DA  B 15  ? 0.5699 0.4007 0.3942 0.0277  -0.1280 0.0414  15  DA  C C4    
1876 P P     . DG  B 16  ? 0.8408 0.4504 0.4729 -0.0184 -0.1002 0.0450  16  DG  C P     
1877 O OP1   . DG  B 16  ? 0.9108 0.4387 0.4669 -0.0498 -0.0880 0.0459  16  DG  C OP1   
1878 O OP2   . DG  B 16  ? 0.7978 0.4567 0.4613 -0.0145 -0.1098 0.0464  16  DG  C OP2   
1879 O "O5'" . DG  B 16  ? 0.8436 0.4417 0.4707 0.0287  -0.0909 0.0529  16  DG  C "O5'" 
1880 C "C5'" . DG  B 16  ? 0.8816 0.4172 0.4633 0.0410  -0.0726 0.0539  16  DG  C "C5'" 
1881 C "C4'" . DG  B 16  ? 0.8698 0.4289 0.4625 0.0968  -0.0620 0.0699  16  DG  C "C4'" 
1882 O "O4'" . DG  B 16  ? 0.7662 0.4334 0.4406 0.0973  -0.0819 0.0694  16  DG  C "O4'" 
1883 C "C3'" . DG  B 16  ? 0.9002 0.4513 0.4696 0.1351  -0.0541 0.0906  16  DG  C "C3'" 
1884 O "O3'" . DG  B 16  ? 0.9810 0.5003 0.5139 0.1909  -0.0278 0.1107  16  DG  C "O3'" 
1885 C "C2'" . DG  B 16  ? 0.8061 0.4782 0.4547 0.1337  -0.0803 0.0944  16  DG  C "C2'" 
1886 C "C1'" . DG  B 16  ? 0.7345 0.4621 0.4311 0.1281  -0.0866 0.0880  16  DG  C "C1'" 
1887 N N9    . DG  B 16  ? 0.6402 0.4591 0.3992 0.1037  -0.1113 0.0818  16  DG  C N9    
1888 C C8    . DG  B 16  ? 0.6126 0.4427 0.3868 0.0692  -0.1277 0.0661  16  DG  C C8    
1889 N N7    . DG  B 16  ? 0.5697 0.4607 0.3789 0.0508  -0.1432 0.0617  16  DG  C N7    
1890 C C5    . DG  B 16  ? 0.5645 0.5028 0.3937 0.0680  -0.1402 0.0763  16  DG  C C5    
1891 C C6    . DG  B 16  ? 0.5503 0.5674 0.4139 0.0503  -0.1530 0.0815  16  DG  C C6    
1892 O O6    . DG  B 16  ? 0.5529 0.5923 0.4240 0.0106  -0.1691 0.0698  16  DG  C O6    
1893 N N1    . DG  B 16  ? 0.5469 0.6151 0.4258 0.0824  -0.1424 0.1050  16  DG  C N1    
1894 C C2    . DG  B 16  ? 0.5614 0.5841 0.4133 0.1310  -0.1172 0.1178  16  DG  C C2    
1895 N N2    . DG  B 16  ? 0.5539 0.6316 0.4196 0.1665  -0.1029 0.1419  16  DG  C N2    
1896 N N3    . DG  B 16  ? 0.5983 0.5254 0.4032 0.1433  -0.1042 0.1098  16  DG  C N3    
1897 C C4    . DG  B 16  ? 0.5922 0.4902 0.3934 0.1069  -0.1189 0.0898  16  DG  C C4    
1898 P P     . DC  B 17  ? 0.8417 0.4931 0.5547 0.0544  -0.2721 0.0787  17  DC  C P     
1899 O OP1   . DC  B 17  ? 0.8844 0.5076 0.5653 0.0423  -0.2944 0.0901  17  DC  C OP1   
1900 O OP2   . DC  B 17  ? 0.8050 0.5082 0.5488 0.0386  -0.2823 0.0938  17  DC  C OP2   
1901 O "O5'" . DC  B 17  ? 0.8479 0.4434 0.5307 0.0625  -0.2568 0.0539  17  DC  C "O5'" 
1902 C "C5'" . DC  B 17  ? 0.8035 0.4238 0.5130 0.0729  -0.2370 0.0425  17  DC  C "C5'" 
1903 C "C4'" . DC  B 17  ? 0.8048 0.4092 0.5006 0.0854  -0.2131 0.0239  17  DC  C "C4'" 
1904 O "O4'" . DC  B 17  ? 0.7938 0.4027 0.4907 0.0864  -0.1999 0.0239  17  DC  C "O4'" 
1905 C "C3'" . DC  B 17  ? 0.7854 0.4181 0.5042 0.0917  -0.1996 0.0144  17  DC  C "C3'" 
1906 O "O3'" . DC  B 17  ? 0.8381 0.4477 0.5323 0.1042  -0.2062 0.0072  17  DC  C "O3'" 
1907 C "C2'" . DC  B 17  ? 0.7673 0.4138 0.4855 0.0894  -0.1767 0.0068  17  DC  C "C2'" 
1908 C "C1'" . DC  B 17  ? 0.7721 0.3937 0.4731 0.0842  -0.1795 0.0136  17  DC  C "C1'" 
1909 N N1    . DC  B 17  ? 0.7425 0.3685 0.4489 0.0847  -0.1753 0.0171  17  DC  C N1    
1910 C C2    . DC  B 17  ? 0.7369 0.3421 0.4150 0.0717  -0.1636 0.0124  17  DC  C C2    
1911 O O2    . DC  B 17  ? 0.7473 0.3575 0.4135 0.0553  -0.1541 0.0083  17  DC  C O2    
1912 N N3    . DC  B 17  ? 0.7371 0.3129 0.3898 0.0774  -0.1645 0.0144  17  DC  C N3    
1913 C C4    . DC  B 17  ? 0.7339 0.3219 0.4006 0.1032  -0.1704 0.0205  17  DC  C C4    
1914 N N4    . DC  B 17  ? 0.7646 0.3155 0.3914 0.1200  -0.1687 0.0202  17  DC  C N4    
1915 C C5    . DC  B 17  ? 0.7107 0.3497 0.4242 0.1107  -0.1793 0.0289  17  DC  C C5    
1916 C C6    . DC  B 17  ? 0.7129 0.3580 0.4383 0.0970  -0.1846 0.0271  17  DC  C C6    
1917 P P     . DG  B 18  ? 0.8781 0.5051 0.5871 0.1144  -0.2092 0.0031  18  DG  C P     
1918 O OP1   . DG  B 18  ? 0.9459 0.5125 0.5992 0.1326  -0.2276 -0.0015 18  DG  C OP1   
1919 O OP2   . DG  B 18  ? 0.8346 0.4902 0.5792 0.0968  -0.2150 0.0136  18  DG  C OP2   
1920 O "O5'" . DG  B 18  ? 0.8469 0.5285 0.5811 0.1251  -0.1828 -0.0065 18  DG  C "O5'" 
1921 C "C5'" . DG  B 18  ? 0.8428 0.5379 0.5582 0.1419  -0.1656 -0.0142 18  DG  C "C5'" 
1922 C "C4'" . DG  B 18  ? 0.7904 0.5628 0.5428 0.1295  -0.1445 -0.0129 18  DG  C "C4'" 
1923 O "O4'" . DG  B 18  ? 0.7450 0.5079 0.5050 0.0945  -0.1437 -0.0060 18  DG  C "O4'" 
1924 C "C3'" . DG  B 18  ? 0.7633 0.5868 0.5498 0.1383  -0.1472 -0.0126 18  DG  C "C3'" 
1925 O "O3'" . DG  B 18  ? 0.7751 0.6866 0.5846 0.1385  -0.1286 -0.0100 18  DG  C "O3'" 
1926 C "C2'" . DG  B 18  ? 0.7133 0.5239 0.5184 0.1067  -0.1553 -0.0061 18  DG  C "C2'" 
1927 C "C1'" . DG  B 18  ? 0.7065 0.4981 0.4940 0.0807  -0.1460 -0.0026 18  DG  C "C1'" 
1928 N N9    . DG  B 18  ? 0.6766 0.4251 0.4559 0.0689  -0.1543 0.0015  18  DG  C N9    
1929 C C8    . DG  B 18  ? 0.6644 0.3869 0.4455 0.0800  -0.1672 0.0048  18  DG  C C8    
1930 N N7    . DG  B 18  ? 0.6513 0.3568 0.4250 0.0763  -0.1679 0.0099  18  DG  C N7    
1931 C C5    . DG  B 18  ? 0.6466 0.3398 0.3973 0.0606  -0.1584 0.0076  18  DG  C C5    
1932 C C6    . DG  B 18  ? 0.6637 0.3139 0.3760 0.0571  -0.1577 0.0093  18  DG  C C6    
1933 O O6    . DG  B 18  ? 0.6777 0.3094 0.3791 0.0781  -0.1603 0.0124  18  DG  C O6    
1934 N N1    . DG  B 18  ? 0.6960 0.3267 0.3731 0.0269  -0.1547 0.0090  18  DG  C N1    
1935 C C2    . DG  B 18  ? 0.6889 0.3674 0.3832 0.0027  -0.1492 0.0103  18  DG  C C2    
1936 N N2    . DG  B 18  ? 0.7338 0.3987 0.3883 -0.0378 -0.1501 0.0164  18  DG  C N2    
1937 N N3    . DG  B 18  ? 0.6672 0.4022 0.4053 0.0184  -0.1443 0.0078  18  DG  C N3    
1938 C C4    . DG  B 18  ? 0.6593 0.3846 0.4164 0.0479  -0.1510 0.0049  18  DG  C C4    
1939 P P     . DA  B 19  ? 0.7678 0.7602 0.6183 0.1477  -0.1308 -0.0058 19  DA  C P     
1940 O OP1   . DA  B 19  ? 0.8023 0.8877 0.6635 0.1806  -0.1127 -0.0047 19  DA  C OP1   
1941 O OP2   . DA  B 19  ? 0.7654 0.7031 0.6097 0.1656  -0.1529 -0.0104 19  DA  C OP2   
1942 O "O5'" . DA  B 19  ? 0.7201 0.7404 0.5905 0.0883  -0.1303 0.0062  19  DA  C "O5'" 
1943 C "C5'" . DA  B 19  ? 0.7085 0.7431 0.5633 0.0479  -0.1178 0.0143  19  DA  C "C5'" 
1944 C "C4'" . DA  B 19  ? 0.6988 0.7373 0.5491 -0.0087 -0.1265 0.0265  19  DA  C "C4'" 
1945 O "O4'" . DA  B 19  ? 0.6885 0.6188 0.5012 -0.0188 -0.1377 0.0213  19  DA  C "O4'" 
1946 C "C3'" . DA  B 19  ? 0.6854 0.7918 0.5726 -0.0152 -0.1371 0.0342  19  DA  C "C3'" 
1947 O "O3'" . DA  B 19  ? 0.7449 0.9078 0.6269 -0.0764 -0.1398 0.0534  19  DA  C "O3'" 
1948 C "C2'" . DA  B 19  ? 0.6503 0.6658 0.5208 -0.0109 -0.1530 0.0263  19  DA  C "C2'" 
1949 C "C1'" . DA  B 19  ? 0.6645 0.5836 0.4832 -0.0272 -0.1511 0.0228  19  DA  C "C1'" 
1950 N N9    . DA  B 19  ? 0.6242 0.4712 0.4321 0.0005  -0.1566 0.0137  19  DA  C N9    
1951 C C8    . DA  B 19  ? 0.5923 0.4349 0.4200 0.0380  -0.1584 0.0071  19  DA  C C8    
1952 N N7    . DA  B 19  ? 0.5886 0.3805 0.4031 0.0469  -0.1637 0.0059  19  DA  C N7    
1953 C C5    . DA  B 19  ? 0.6084 0.3615 0.3877 0.0267  -0.1621 0.0084  19  DA  C C5    
1954 C C6    . DA  B 19  ? 0.6155 0.3158 0.3628 0.0366  -0.1628 0.0088  19  DA  C C6    
1955 N N6    . DA  B 19  ? 0.5940 0.2970 0.3567 0.0615  -0.1641 0.0108  19  DA  C N6    
1956 N N1    . DA  B 19  ? 0.6771 0.3209 0.3658 0.0209  -0.1632 0.0092  19  DA  C N1    
1957 C C2    . DA  B 19  ? 0.7026 0.3471 0.3697 -0.0181 -0.1666 0.0128  19  DA  C C2    
1958 N N3    . DA  B 19  ? 0.6767 0.3943 0.3848 -0.0378 -0.1647 0.0170  19  DA  C N3    
1959 C C4    . DA  B 19  ? 0.6356 0.4063 0.4009 -0.0061 -0.1606 0.0128  19  DA  C C4    
1960 P P     . DT  B 20  ? 0.7667 1.0282 0.6867 -0.1020 -0.1538 0.0702  20  DT  C P     
1961 O OP1   . DT  B 20  ? 0.7923 1.1717 0.7249 -0.1530 -0.1480 0.0947  20  DT  C OP1   
1962 O OP2   . DT  B 20  ? 0.7343 1.0331 0.6996 -0.0382 -0.1566 0.0603  20  DT  C OP2   
1963 O "O5'" . DT  B 20  ? 0.8107 0.9572 0.6745 -0.1466 -0.1758 0.0706  20  DT  C "O5'" 
1964 C "C5'" . DT  B 20  ? 0.8644 0.8997 0.6507 -0.1853 -0.1788 0.0704  20  DT  C "C5'" 
1965 C "C4'" . DT  B 20  ? 0.8969 0.8108 0.6226 -0.1952 -0.1961 0.0641  20  DT  C "C4'" 
1966 O "O4'" . DT  B 20  ? 0.8382 0.6912 0.5713 -0.1353 -0.1877 0.0446  20  DT  C "O4'" 
1967 C "C3'" . DT  B 20  ? 0.9147 0.8615 0.6527 -0.2172 -0.2152 0.0732  20  DT  C "C3'" 
1968 O "O3'" . DT  B 20  ? 1.0415 0.9201 0.6952 -0.2869 -0.2368 0.0875  20  DT  C "O3'" 
1969 C "C2'" . DT  B 20  ? 0.8623 0.7423 0.6024 -0.1648 -0.2143 0.0549  20  DT  C "C2'" 
1970 C "C1'" . DT  B 20  ? 0.8394 0.6358 0.5462 -0.1330 -0.1997 0.0411  20  DT  C "C1'" 
1971 N N1    . DT  B 20  ? 0.7531 0.5337 0.4907 -0.0755 -0.1909 0.0272  20  DT  C N1    
1972 C C2    . DT  B 20  ? 0.7629 0.4547 0.4511 -0.0549 -0.1880 0.0197  20  DT  C C2    
1973 O O2    . DT  B 20  ? 0.8499 0.4571 0.4597 -0.0713 -0.1930 0.0201  20  DT  C O2    
1974 N N3    . DT  B 20  ? 0.6795 0.3841 0.4041 -0.0132 -0.1805 0.0137  20  DT  C N3    
1975 C C4    . DT  B 20  ? 0.6211 0.3867 0.4060 0.0063  -0.1807 0.0127  20  DT  C C4    
1976 O O4    . DT  B 20  ? 0.5786 0.3383 0.3764 0.0310  -0.1795 0.0111  20  DT  C O4    
1977 C C5    . DT  B 20  ? 0.6251 0.4594 0.4452 -0.0041 -0.1836 0.0161  20  DT  C C5    
1978 C C7    . DT  B 20  ? 0.6001 0.4809 0.4619 0.0286  -0.1858 0.0129  20  DT  C C7    
1979 C C6    . DT  B 20  ? 0.6649 0.5180 0.4688 -0.0424 -0.1860 0.0240  20  DT  C C6    
1980 P P     . DG  B 21  ? 1.0990 1.0228 0.7488 -0.3420 -0.2645 0.1075  21  DG  C P     
1981 O OP1   . DG  B 21  ? 1.2075 1.1148 0.7844 -0.4331 -0.2853 0.1327  21  DG  C OP1   
1982 O OP2   . DG  B 21  ? 1.0125 1.0907 0.7742 -0.3061 -0.2590 0.1113  21  DG  C OP2   
1983 O "O5'" . DG  B 21  ? 1.1355 0.9133 0.7121 -0.3230 -0.2758 0.0918  21  DG  C "O5'" 
1984 C "C5'" . DG  B 21  ? 1.2075 0.8182 0.6693 -0.3211 -0.2772 0.0804  21  DG  C "C5'" 
1985 C "C4'" . DG  B 21  ? 1.1977 0.7192 0.6268 -0.2693 -0.2733 0.0618  21  DG  C "C4'" 
1986 O "O4'" . DG  B 21  ? 1.0755 0.6499 0.5884 -0.1979 -0.2467 0.0463  21  DG  C "O4'" 
1987 C "C3'" . DG  B 21  ? 1.1949 0.7345 0.6298 -0.2863 -0.2917 0.0678  21  DG  C "C3'" 
1988 O "O3'" . DG  B 21  ? 1.3008 0.6950 0.6269 -0.2722 -0.2972 0.0569  21  DG  C "O3'" 
1989 C "C2'" . DG  B 21  ? 1.0597 0.7072 0.6129 -0.2282 -0.2734 0.0589  21  DG  C "C2'" 
1990 C "C1'" . DG  B 21  ? 1.0224 0.6207 0.5702 -0.1731 -0.2480 0.0419  21  DG  C "C1'" 
1991 N N9    . DG  B 21  ? 0.8977 0.5771 0.5392 -0.1230 -0.2309 0.0344  21  DG  C N9    
1992 C C8    . DG  B 21  ? 0.8247 0.6158 0.5521 -0.1152 -0.2312 0.0391  21  DG  C C8    
1993 N N7    . DG  B 21  ? 0.7608 0.5718 0.5323 -0.0689 -0.2202 0.0301  21  DG  C N7    
1994 C C5    . DG  B 21  ? 0.7558 0.4873 0.4832 -0.0499 -0.2112 0.0222  21  DG  C C5    
1995 C C6    . DG  B 21  ? 0.6991 0.4257 0.4454 -0.0121 -0.2008 0.0167  21  DG  C C6    
1996 O O6    . DG  B 21  ? 0.6661 0.4339 0.4588 0.0076  -0.2018 0.0161  21  DG  C O6    
1997 N N1    . DG  B 21  ? 0.7086 0.3726 0.4026 0.0021  -0.1913 0.0137  21  DG  C N1    
1998 C C2    . DG  B 21  ? 0.7800 0.3677 0.3948 -0.0107 -0.1931 0.0122  21  DG  C C2    
1999 N N2    . DG  B 21  ? 0.8162 0.3499 0.3791 0.0222  -0.1811 0.0082  21  DG  C N2    
2000 N N3    . DG  B 21  ? 0.8532 0.4178 0.4330 -0.0531 -0.2075 0.0166  21  DG  C N3    
2001 C C4    . DG  B 21  ? 0.8262 0.4783 0.4743 -0.0744 -0.2152 0.0232  21  DG  C C4    
2002 P P     . DG  B 22  ? 1.4368 0.7280 0.6430 -0.3365 -0.3333 0.0689  22  DG  C P     
2003 O OP1   . DG  B 22  ? 1.5377 0.7767 0.6621 -0.4098 -0.3566 0.0860  22  DG  C OP1   
2004 O OP2   . DG  B 22  ? 1.3857 0.7738 0.6643 -0.3513 -0.3465 0.0784  22  DG  C OP2   
2005 O "O5'" . DG  B 22  ? 1.5142 0.6398 0.6003 -0.2822 -0.3238 0.0481  22  DG  C "O5'" 
2006 C "C5'" . DG  B 22  ? 1.5286 0.5810 0.5702 -0.2251 -0.3011 0.0326  22  DG  C "C5'" 
2007 C "C4'" . DG  B 22  ? 1.4971 0.5382 0.5471 -0.1423 -0.2731 0.0152  22  DG  C "C4'" 
2008 O "O4'" . DG  B 22  ? 1.3246 0.5205 0.5309 -0.1078 -0.2492 0.0137  22  DG  C "O4'" 
2009 C "C3'" . DG  B 22  ? 1.5597 0.5464 0.5505 -0.1423 -0.2819 0.0130  22  DG  C "C3'" 
2010 O "O3'" . DG  B 22  ? 1.6757 0.5504 0.5605 -0.0753 -0.2639 -0.0022 22  DG  C "O3'" 
2011 C "C2'" . DG  B 22  ? 1.3908 0.5334 0.5317 -0.1305 -0.2698 0.0161  22  DG  C "C2'" 
2012 C "C1'" . DG  B 22  ? 1.2624 0.4999 0.5070 -0.0884 -0.2434 0.0119  22  DG  C "C1'" 
2013 N N9    . DG  B 22  ? 1.0983 0.4786 0.4812 -0.0961 -0.2421 0.0183  22  DG  C N9    
2014 C C8    . DG  B 22  ? 1.0511 0.5096 0.4934 -0.1424 -0.2608 0.0303  22  DG  C C8    
2015 N N7    . DG  B 22  ? 0.9246 0.4919 0.4740 -0.1220 -0.2536 0.0311  22  DG  C N7    
2016 C C5    . DG  B 22  ? 0.8680 0.4254 0.4288 -0.0720 -0.2322 0.0215  22  DG  C C5    
2017 C C6    . DG  B 22  ? 0.7677 0.3954 0.4066 -0.0412 -0.2226 0.0202  22  DG  C C6    
2018 O O6    . DG  B 22  ? 0.7134 0.4111 0.4182 -0.0416 -0.2306 0.0234  22  DG  C O6    
2019 N N1    . DG  B 22  ? 0.7524 0.3598 0.3764 -0.0063 -0.2042 0.0165  22  DG  C N1    
2020 C C2    . DG  B 22  ? 0.8324 0.3680 0.3781 0.0120  -0.1921 0.0122  22  DG  C C2    
2021 N N2    . DG  B 22  ? 0.8300 0.3854 0.3808 0.0502  -0.1726 0.0131  22  DG  C N2    
2022 N N3    . DG  B 22  ? 0.9273 0.3759 0.3857 -0.0053 -0.2006 0.0092  22  DG  C N3    
2023 C C4    . DG  B 22  ? 0.9555 0.4160 0.4252 -0.0541 -0.2227 0.0149  22  DG  C C4    
2024 P P     . DA  B 23  ? 1.8053 0.5836 0.5835 -0.0565 -0.2662 -0.0087 23  DA  C P     
2025 O OP1   . DA  B 23  ? 1.9903 0.5893 0.5894 -0.0063 -0.2629 -0.0219 23  DA  C OP1   
2026 O OP2   . DA  B 23  ? 1.8168 0.5998 0.5941 -0.1354 -0.3008 0.0046  23  DA  C OP2   
2027 O "O5'" . DA  B 23  ? 1.6628 0.5773 0.5629 0.0035  -0.2295 -0.0125 23  DA  C "O5'" 
2028 C "C5'" . DA  B 23  ? 1.5911 0.5637 0.5387 0.0734  -0.1959 -0.0181 23  DA  C "C5'" 
2029 C "C4'" . DA  B 23  ? 1.4650 0.5658 0.5153 0.1041  -0.1707 -0.0143 23  DA  C "C4'" 
2030 O "O4'" . DA  B 23  ? 1.2861 0.5146 0.4806 0.0632  -0.1793 -0.0046 23  DA  C "O4'" 
2031 C "C3'" . DA  B 23  ? 1.5297 0.5925 0.5204 0.1046  -0.1701 -0.0151 23  DA  C "C3'" 
2032 O "O3'" . DA  B 23  ? 1.5558 0.6742 0.5537 0.1709  -0.1339 -0.0154 23  DA  C "O3'" 
2033 C "C2'" . DA  B 23  ? 1.3980 0.5510 0.4955 0.0440  -0.1909 -0.0045 23  DA  C "C2'" 
2034 C "C1'" . DA  B 23  ? 1.2391 0.5136 0.4705 0.0446  -0.1841 0.0009  23  DA  C "C1'" 
2035 N N9    . DA  B 23  ? 1.1232 0.4618 0.4406 -0.0078 -0.2092 0.0084  23  DA  C N9    
2036 C C8    . DA  B 23  ? 1.1437 0.4511 0.4398 -0.0596 -0.2381 0.0125  23  DA  C C8    
2037 N N7    . DA  B 23  ? 1.0391 0.4422 0.4336 -0.0856 -0.2518 0.0205  23  DA  C N7    
2038 C C5    . DA  B 23  ? 0.9467 0.4241 0.4184 -0.0511 -0.2344 0.0196  23  DA  C C5    
2039 C C6    . DA  B 23  ? 0.8307 0.3997 0.3993 -0.0498 -0.2400 0.0242  23  DA  C C6    
2040 N N6    . DA  B 23  ? 0.7919 0.4129 0.4084 -0.0731 -0.2602 0.0298  23  DA  C N6    
2041 N N1    . DA  B 23  ? 0.7693 0.3738 0.3741 -0.0221 -0.2257 0.0249  23  DA  C N1    
2042 C C2    . DA  B 23  ? 0.8109 0.3933 0.3779 0.0040  -0.2029 0.0236  23  DA  C C2    
2043 N N3    . DA  B 23  ? 0.9122 0.4247 0.3961 0.0191  -0.1903 0.0180  23  DA  C N3    
2044 C C4    . DA  B 23  ? 0.9853 0.4328 0.4165 -0.0100 -0.2089 0.0146  23  DA  C C4    
2045 P P     . DC  B 24  ? 1.6752 0.7544 0.5896 0.1964  -0.1194 -0.0173 24  DC  C P     
2046 O OP1   . DC  B 24  ? 1.7390 0.8392 0.6101 0.2852  -0.0793 -0.0201 24  DC  C OP1   
2047 O OP2   . DC  B 24  ? 1.8050 0.7313 0.5939 0.1545  -0.1511 -0.0240 24  DC  C OP2   
2048 O "O5'" . DC  B 24  ? 1.5317 0.7505 0.5774 0.1587  -0.1195 -0.0028 24  DC  C "O5'" 
2049 C "C5'" . DC  B 24  ? 1.3865 0.7501 0.5676 0.1611  -0.1077 0.0089  24  DC  C "C5'" 
2050 C "C4'" . DC  B 24  ? 1.2786 0.7178 0.5477 0.1098  -0.1248 0.0207  24  DC  C "C4'" 
2051 O "O4'" . DC  B 24  ? 1.2054 0.6354 0.5242 0.0622  -0.1578 0.0189  24  DC  C "O4'" 
2052 C "C3'" . DC  B 24  ? 1.3451 0.7447 0.5556 0.0927  -0.1297 0.0227  24  DC  C "C3'" 
2053 O "O3'" . DC  B 24  ? 1.3189 0.8171 0.5874 0.0879  -0.1177 0.0381  24  DC  C "O3'" 
2054 C "C2'" . DC  B 24  ? 1.3041 0.6612 0.5289 0.0345  -0.1716 0.0211  24  DC  C "C2'" 
2055 C "C1'" . DC  B 24  ? 1.1739 0.6064 0.5059 0.0231  -0.1805 0.0243  24  DC  C "C1'" 
2056 N N1    . DC  B 24  ? 1.1184 0.5347 0.4761 -0.0184 -0.2144 0.0230  24  DC  C N1    
2057 C C2    . DC  B 24  ? 1.0079 0.5019 0.4627 -0.0354 -0.2308 0.0292  24  DC  C C2    
2058 O O2    . DC  B 24  ? 0.9429 0.4956 0.4492 -0.0227 -0.2213 0.0350  24  DC  C O2    
2059 N N3    . DC  B 24  ? 0.9832 0.4865 0.4650 -0.0645 -0.2576 0.0306  24  DC  C N3    
2060 C C4    . DC  B 24  ? 1.0353 0.4787 0.4554 -0.0915 -0.2726 0.0298  24  DC  C C4    
2061 N N4    . DC  B 24  ? 1.0055 0.4894 0.4651 -0.1244 -0.2984 0.0370  24  DC  C N4    
2062 C C5    . DC  B 24  ? 1.1520 0.4905 0.4582 -0.0844 -0.2625 0.0232  24  DC  C C5    
2063 C C6    . DC  B 24  ? 1.1869 0.5133 0.4640 -0.0405 -0.2316 0.0181  24  DC  C C6    
2064 P P     . DA  B 25  ? 1.4046 0.9162 0.6081 0.1123  -0.0891 0.0454  25  DA  C P     
2065 O OP1   . DA  B 25  ? 1.4252 1.0056 0.6248 0.1759  -0.0478 0.0498  25  DA  C OP1   
2066 O OP2   . DA  B 25  ? 1.5115 0.8975 0.6048 0.1021  -0.1027 0.0339  25  DA  C OP2   
2067 O "O5'" . DA  B 25  ? 1.3068 0.9085 0.5891 0.0639  -0.1021 0.0660  25  DA  C "O5'" 
2068 C "C5'" . DA  B 25  ? 1.1853 0.8703 0.5682 0.0444  -0.1126 0.0770  25  DA  C "C5'" 
2069 C "C4'" . DA  B 25  ? 1.1209 0.7919 0.5405 -0.0093 -0.1525 0.0825  25  DA  C "C4'" 
2070 O "O4'" . DA  B 25  ? 1.0892 0.6947 0.5174 -0.0188 -0.1811 0.0665  25  DA  C "O4'" 
2071 C "C3'" . DA  B 25  ? 1.1634 0.8064 0.5329 -0.0378 -0.1624 0.0909  25  DA  C "C3'" 
2072 O "O3'" . DA  B 25  ? 1.1383 0.8370 0.5451 -0.0741 -0.1760 0.1119  25  DA  C "O3'" 
2073 C "C2'" . DA  B 25  ? 1.1721 0.7230 0.5177 -0.0566 -0.1986 0.0766  25  DA  C "C2'" 
2074 C "C1'" . DA  B 25  ? 1.0987 0.6615 0.5102 -0.0520 -0.2132 0.0680  25  DA  C "C1'" 
2075 N N9    . DA  B 25  ? 1.0937 0.5947 0.4848 -0.0574 -0.2335 0.0546  25  DA  C N9    
2076 C C8    . DA  B 25  ? 1.1622 0.5927 0.4767 -0.0483 -0.2255 0.0445  25  DA  C C8    
2077 N N7    . DA  B 25  ? 1.1569 0.5512 0.4689 -0.0687 -0.2517 0.0391  25  DA  C N7    
2078 C C5    . DA  B 25  ? 1.0570 0.5147 0.4572 -0.0819 -0.2737 0.0446  25  DA  C C5    
2079 C C6    . DA  B 25  ? 0.9989 0.4799 0.4446 -0.1004 -0.3033 0.0456  25  DA  C C6    
2080 N N6    . DA  B 25  ? 1.0302 0.4777 0.4421 -0.1244 -0.3195 0.0449  25  DA  C N6    
2081 N N1    . DA  B 25  ? 0.9424 0.4816 0.4588 -0.0948 -0.3183 0.0500  25  DA  C N1    
2082 C C2    . DA  B 25  ? 0.9381 0.4935 0.4696 -0.0825 -0.3095 0.0539  25  DA  C C2    
2083 N N3    . DA  B 25  ? 0.9689 0.5163 0.4684 -0.0780 -0.2846 0.0576  25  DA  C N3    
2084 C C4    . DA  B 25  ? 1.0260 0.5332 0.4654 -0.0732 -0.2648 0.0522  25  DA  C C4    
2085 P P     . DG  B 26  ? 1.1844 0.8652 0.5432 -0.1155 -0.1908 0.1280  26  DG  C P     
2086 O OP1   . DG  B 26  ? 1.1756 0.9479 0.5576 -0.1444 -0.1824 0.1568  26  DG  C OP1   
2087 O OP2   . DG  B 26  ? 1.2504 0.8767 0.5298 -0.1001 -0.1750 0.1189  26  DG  C OP2   
2088 O "O5'" . DG  B 26  ? 1.1621 0.7697 0.5332 -0.1414 -0.2432 0.1209  26  DG  C "O5'" 
2089 C "C5'" . DG  B 26  ? 1.0861 0.7065 0.5106 -0.1492 -0.2671 0.1234  26  DG  C "C5'" 
2090 C "C4'" . DG  B 26  ? 1.0871 0.6346 0.5008 -0.1590 -0.3141 0.1167  26  DG  C "C4'" 
2091 O "O4'" . DG  B 26  ? 1.0535 0.5801 0.4861 -0.1331 -0.3186 0.0968  26  DG  C "O4'" 
2092 C "C3'" . DG  B 26  ? 1.1475 0.6383 0.4943 -0.1892 -0.3388 0.1267  26  DG  C "C3'" 
2093 O "O3'" . DG  B 26  ? 1.1770 0.6181 0.5113 -0.2020 -0.3834 0.1321  26  DG  C "O3'" 
2094 C "C2'" . DG  B 26  ? 1.1489 0.5990 0.4765 -0.1740 -0.3438 0.1109  26  DG  C "C2'" 
2095 C "C1'" . DG  B 26  ? 1.0868 0.5585 0.4779 -0.1445 -0.3461 0.0951  26  DG  C "C1'" 
2096 N N9    . DG  B 26  ? 1.0791 0.5374 0.4600 -0.1339 -0.3357 0.0824  26  DG  C N9    
2097 C C8    . DG  B 26  ? 1.1028 0.5495 0.4395 -0.1266 -0.3019 0.0782  26  DG  C C8    
2098 N N7    . DG  B 26  ? 1.1176 0.5291 0.4334 -0.1233 -0.3058 0.0675  26  DG  C N7    
2099 C C5    . DG  B 26  ? 1.0669 0.4967 0.4363 -0.1300 -0.3397 0.0668  26  DG  C C5    
2100 C C6    . DG  B 26  ? 1.0594 0.4839 0.4366 -0.1403 -0.3606 0.0630  26  DG  C C6    
2101 O O6    . DG  B 26  ? 1.0937 0.4730 0.4187 -0.1519 -0.3568 0.0585  26  DG  C O6    
2102 N N1    . DG  B 26  ? 1.0163 0.4913 0.4586 -0.1377 -0.3909 0.0673  26  DG  C N1    
2103 C C2    . DG  B 26  ? 1.0041 0.5007 0.4793 -0.1215 -0.4031 0.0711  26  DG  C C2    
2104 N N2    . DG  B 26  ? 0.9822 0.5225 0.5067 -0.1061 -0.4311 0.0732  26  DG  C N2    
2105 N N3    . DG  B 26  ? 1.0166 0.4939 0.4700 -0.1204 -0.3896 0.0747  26  DG  C N3    
2106 C C4    . DG  B 26  ? 1.0466 0.5034 0.4549 -0.1284 -0.3571 0.0740  26  DG  C C4    
2107 P P     . DC  B 27  ? 1.2749 0.6430 0.5279 -0.2410 -0.4202 0.1489  27  DC  C P     
2108 O OP1   . DC  B 27  ? 1.2907 0.6280 0.5238 -0.2614 -0.4484 0.1622  27  DC  C OP1   
2109 O OP2   . DC  B 27  ? 1.3083 0.6955 0.5177 -0.2688 -0.3934 0.1611  27  DC  C OP2   
2110 O "O5'" . DC  B 27  ? 1.3104 0.6169 0.5528 -0.2151 -0.4583 0.1342  27  DC  C "O5'" 
2111 C "C5'" . DC  B 27  ? 1.2546 0.5823 0.5584 -0.1716 -0.4667 0.1174  27  DC  C "C5'" 
2112 C "C4'" . DC  B 27  ? 1.2712 0.5848 0.5778 -0.1525 -0.4925 0.1090  27  DC  C "C4'" 
2113 O "O4'" . DC  B 27  ? 1.1979 0.5614 0.5441 -0.1476 -0.4638 0.0993  27  DC  C "O4'" 
2114 C "C3'" . DC  B 27  ? 1.3777 0.6251 0.6107 -0.1761 -0.5221 0.1182  27  DC  C "C3'" 
2115 O "O3'" . DC  B 27  ? 1.4479 0.6660 0.6760 -0.1465 -0.5703 0.1166  27  DC  C "O3'" 
2116 C "C2'" . DC  B 27  ? 1.3398 0.6066 0.5712 -0.1883 -0.4994 0.1134  27  DC  C "C2'" 
2117 C "C1'" . DC  B 27  ? 1.2323 0.5662 0.5416 -0.1613 -0.4822 0.1008  27  DC  C "C1'" 
2118 N N1    . DC  B 27  ? 1.1917 0.5370 0.4931 -0.1717 -0.4493 0.0942  27  DC  C N1    
2119 C C2    . DC  B 27  ? 1.1864 0.5495 0.5091 -0.1715 -0.4619 0.0894  27  DC  C C2    
2120 O O2    . DC  B 27  ? 1.1839 0.5850 0.5532 -0.1584 -0.4936 0.0919  27  DC  C O2    
2121 N N3    . DC  B 27  ? 1.1908 0.5292 0.4742 -0.1852 -0.4398 0.0841  27  DC  C N3    
2122 C C4    . DC  B 27  ? 1.2166 0.5211 0.4447 -0.1852 -0.4031 0.0814  27  DC  C C4    
2123 N N4    . DC  B 27  ? 1.2515 0.5134 0.4230 -0.1872 -0.3837 0.0739  27  DC  C N4    
2124 C C5    . DC  B 27  ? 1.2184 0.5340 0.4407 -0.1825 -0.3856 0.0884  27  DC  C C5    
2125 C C6    . DC  B 27  ? 1.1974 0.5284 0.4539 -0.1833 -0.4121 0.0959  27  DC  C C6    
2126 P P     . DT  B 28  ? 1.5680 0.6860 0.7037 -0.1575 -0.6196 0.1283  28  DT  C P     
2127 O OP1   . DT  B 28  ? 1.6177 0.6918 0.7365 -0.1178 -0.6534 0.1265  28  DT  C OP1   
2128 O OP2   . DT  B 28  ? 1.6347 0.7108 0.7017 -0.2135 -0.6034 0.1415  28  DT  C OP2   
2129 O "O5'" . DT  B 28  ? 1.5395 0.6668 0.6797 -0.1451 -0.6491 0.1275  28  DT  C "O5'" 
2130 C "C5'" . DT  B 28  ? 1.4895 0.6702 0.6642 -0.1619 -0.6255 0.1238  28  DT  C "C5'" 
2131 C "C4'" . DT  B 28  ? 1.4843 0.7313 0.7175 -0.1337 -0.6523 0.1228  28  DT  C "C4'" 
2132 O "O4'" . DT  B 28  ? 1.3954 0.7197 0.6942 -0.1393 -0.6164 0.1155  28  DT  C "O4'" 
2133 C "C3'" . DT  B 28  ? 1.5607 0.7809 0.7505 -0.1573 -0.6876 0.1326  28  DT  C "C3'" 
2134 O "O3'" . DT  B 28  ? 1.6348 0.8388 0.8094 -0.1234 -0.7403 0.1403  28  DT  C "O3'" 
2135 C "C2'" . DT  B 28  ? 1.5058 0.8100 0.7550 -0.1687 -0.6806 0.1328  28  DT  C "C2'" 
2136 C "C1'" . DT  B 28  ? 1.4231 0.7561 0.7091 -0.1702 -0.6271 0.1207  28  DT  C "C1'" 
2137 N N1    . DT  B 28  ? 1.4343 0.7101 0.6591 -0.2086 -0.5891 0.1157  28  DT  C N1    
2138 C C2    . DT  B 28  ? 1.4173 0.7010 0.6348 -0.2329 -0.5801 0.1140  28  DT  C C2    
2139 O O2    . DT  B 28  ? 1.4045 0.7439 0.6624 -0.2402 -0.6059 0.1207  28  DT  C O2    
2140 N N3    . DT  B 28  ? 1.4329 0.6564 0.5843 -0.2488 -0.5416 0.1063  28  DT  C N3    
2141 C C4    . DT  B 28  ? 1.4469 0.6318 0.5538 -0.2445 -0.5087 0.1035  28  DT  C C4    
2142 O O4    . DT  B 28  ? 1.4629 0.6121 0.5146 -0.2477 -0.4721 0.0970  28  DT  C O4    
2143 C C5    . DT  B 28  ? 1.4591 0.6510 0.5831 -0.2343 -0.5217 0.1102  28  DT  C C5    
2144 C C7    . DT  B 28  ? 1.4867 0.6557 0.5667 -0.2432 -0.4916 0.1148  28  DT  C C7    
2145 C C6    . DT  B 28  ? 1.4512 0.6731 0.6245 -0.2161 -0.5623 0.1143  28  DT  C C6    
2146 O "O5'" . DA  C 1   ? 2.3455 1.0561 0.6592 -0.5000 -0.5641 -0.0110 1   DA  D "O5'" 
2147 C "C5'" . DA  C 1   ? 2.2772 1.0502 0.6721 -0.5223 -0.5786 -0.0075 1   DA  D "C5'" 
2148 C "C4'" . DA  C 1   ? 2.1390 1.0728 0.6818 -0.5158 -0.6113 0.0217  1   DA  D "C4'" 
2149 O "O4'" . DA  C 1   ? 2.0433 1.0233 0.6503 -0.4561 -0.5867 0.0316  1   DA  D "O4'" 
2150 C "C3'" . DA  C 1   ? 2.0385 1.0593 0.6954 -0.5160 -0.6097 0.0274  1   DA  D "C3'" 
2151 O "O3'" . DA  C 1   ? 2.0114 1.1576 0.7495 -0.5462 -0.6623 0.0548  1   DA  D "O3'" 
2152 C "C2'" . DA  C 1   ? 1.9022 0.9641 0.6505 -0.4452 -0.5624 0.0270  1   DA  D "C2'" 
2153 C "C1'" . DA  C 1   ? 1.8861 0.9589 0.6259 -0.4189 -0.5679 0.0389  1   DA  D "C1'" 
2154 N N9    . DA  C 1   ? 1.8037 0.8533 0.5588 -0.3619 -0.5188 0.0331  1   DA  D N9    
2155 C C8    . DA  C 1   ? 1.8355 0.7926 0.5250 -0.3405 -0.4701 0.0131  1   DA  D C8    
2156 N N7    . DA  C 1   ? 1.7751 0.7433 0.4969 -0.2938 -0.4360 0.0172  1   DA  D N7    
2157 C C5    . DA  C 1   ? 1.6878 0.7436 0.4873 -0.2856 -0.4652 0.0390  1   DA  D C5    
2158 C C6    . DA  C 1   ? 1.6011 0.6953 0.4516 -0.2488 -0.4545 0.0537  1   DA  D C6    
2159 N N6    . DA  C 1   ? 1.5856 0.6459 0.4230 -0.2170 -0.4108 0.0501  1   DA  D N6    
2160 N N1    . DA  C 1   ? 1.5515 0.7220 0.4669 -0.2461 -0.4908 0.0745  1   DA  D N1    
2161 C C2    . DA  C 1   ? 1.5731 0.7926 0.5075 -0.2771 -0.5349 0.0828  1   DA  D C2    
2162 N N3    . DA  C 1   ? 1.6450 0.8449 0.5389 -0.3196 -0.5517 0.0728  1   DA  D N3    
2163 C C4    . DA  C 1   ? 1.7099 0.8178 0.5305 -0.3232 -0.5153 0.0494  1   DA  D C4    
2164 P P     . DG  C 2   ? 1.9441 1.1991 0.7945 -0.5622 -0.6740 0.0675  2   DG  D P     
2165 O OP1   . DG  C 2   ? 1.9831 1.3206 0.8482 -0.6200 -0.7354 0.0925  2   DG  D OP1   
2166 O OP2   . DG  C 2   ? 1.9812 1.1538 0.7945 -0.5682 -0.6382 0.0442  2   DG  D OP2   
2167 O "O5'" . DG  C 2   ? 1.7788 1.1422 0.7667 -0.4913 -0.6508 0.0807  2   DG  D "O5'" 
2168 C "C5'" . DG  C 2   ? 1.7170 1.1796 0.7710 -0.4711 -0.6803 0.1072  2   DG  D "C5'" 
2169 C "C4'" . DG  C 2   ? 1.5852 1.1150 0.7470 -0.4029 -0.6504 0.1129  2   DG  D "C4'" 
2170 O "O4'" . DG  C 2   ? 1.5688 1.0096 0.6865 -0.3632 -0.6085 0.0951  2   DG  D "O4'" 
2171 C "C3'" . DG  C 2   ? 1.5048 1.0943 0.7551 -0.3895 -0.6281 0.1098  2   DG  D "C3'" 
2172 O "O3'" . DG  C 2   ? 1.4419 1.1564 0.8049 -0.3543 -0.6400 0.1331  2   DG  D "O3'" 
2173 C "C2'" . DG  C 2   ? 1.4581 0.9644 0.6882 -0.3499 -0.5739 0.0853  2   DG  D "C2'" 
2174 C "C1'" . DG  C 2   ? 1.4634 0.9289 0.6554 -0.3211 -0.5702 0.0876  2   DG  D "C1'" 
2175 N N9    . DG  C 2   ? 1.4469 0.8157 0.5822 -0.2967 -0.5255 0.0675  2   DG  D N9    
2176 C C8    . DG  C 2   ? 1.5065 0.7755 0.5548 -0.3141 -0.5007 0.0461  2   DG  D C8    
2177 N N7    . DG  C 2   ? 1.5014 0.7123 0.5198 -0.2803 -0.4608 0.0360  2   DG  D N7    
2178 C C5    . DG  C 2   ? 1.4179 0.6867 0.5019 -0.2452 -0.4621 0.0509  2   DG  D C5    
2179 C C6    . DG  C 2   ? 1.3722 0.6209 0.4604 -0.2068 -0.4306 0.0517  2   DG  D C6    
2180 O O6    . DG  C 2   ? 1.3996 0.5842 0.4362 -0.1940 -0.3941 0.0412  2   DG  D O6    
2181 N N1    . DG  C 2   ? 1.3033 0.6154 0.4603 -0.1827 -0.4457 0.0693  2   DG  D N1    
2182 C C2    . DG  C 2   ? 1.2807 0.6686 0.4936 -0.1876 -0.4847 0.0851  2   DG  D C2    
2183 N N2    . DG  C 2   ? 1.2335 0.6625 0.4994 -0.1553 -0.4919 0.1006  2   DG  D N2    
2184 N N3    . DG  C 2   ? 1.3039 0.7263 0.5209 -0.2213 -0.5139 0.0873  2   DG  D N3    
2185 C C4    . DG  C 2   ? 1.3836 0.7421 0.5347 -0.2523 -0.5014 0.0693  2   DG  D C4    
2186 P P     . DC  C 3   ? 1.3848 1.2031 0.8529 -0.3456 -0.6324 0.1411  3   DC  D P     
2187 O OP1   . DC  C 3   ? 1.3680 1.3148 0.9009 -0.3592 -0.6754 0.1737  3   DC  D OP1   
2188 O OP2   . DC  C 3   ? 1.4074 1.1654 0.8394 -0.3780 -0.6102 0.1208  3   DC  D OP2   
2189 O "O5'" . DC  C 3   ? 1.3090 1.1386 0.8395 -0.2731 -0.5952 0.1356  3   DC  D "O5'" 
2190 C "C5'" . DC  C 3   ? 1.2993 1.1320 0.8368 -0.2317 -0.6014 0.1463  3   DC  D "C5'" 
2191 C "C4'" . DC  C 3   ? 1.2373 1.0197 0.7855 -0.1817 -0.5600 0.1306  3   DC  D "C4'" 
2192 O "O4'" . DC  C 3   ? 1.2573 0.9277 0.7210 -0.1949 -0.5363 0.1097  3   DC  D "O4'" 
2193 C "C3'" . DC  C 3   ? 1.1738 0.9949 0.7901 -0.1585 -0.5308 0.1216  3   DC  D "C3'" 
2194 O "O3'" . DC  C 3   ? 1.1516 1.0269 0.8333 -0.1063 -0.5279 0.1325  3   DC  D "O3'" 
2195 C "C2'" . DC  C 3   ? 1.1509 0.8749 0.7187 -0.1563 -0.4914 0.0963  3   DC  D "C2'" 
2196 C "C1'" . DC  C 3   ? 1.1949 0.8399 0.6829 -0.1627 -0.4962 0.0948  3   DC  D "C1'" 
2197 N N1    . DC  C 3   ? 1.1966 0.7425 0.6071 -0.1783 -0.4670 0.0743  3   DC  D N1    
2198 C C2    . DC  C 3   ? 1.1633 0.6547 0.5513 -0.1501 -0.4373 0.0675  3   DC  D C2    
2199 O O2    . DC  C 3   ? 1.1372 0.6516 0.5618 -0.1191 -0.4381 0.0771  3   DC  D O2    
2200 N N3    . DC  C 3   ? 1.1709 0.5848 0.4937 -0.1577 -0.4085 0.0525  3   DC  D N3    
2201 C C4    . DC  C 3   ? 1.2191 0.5938 0.4915 -0.1895 -0.4080 0.0417  3   DC  D C4    
2202 N N4    . DC  C 3   ? 1.2584 0.5507 0.4602 -0.1884 -0.3769 0.0279  3   DC  D N4    
2203 C C5    . DC  C 3   ? 1.2481 0.6646 0.5344 -0.2250 -0.4405 0.0468  3   DC  D C5    
2204 C C6    . DC  C 3   ? 1.2246 0.7338 0.5847 -0.2191 -0.4691 0.0643  3   DC  D C6    
2205 P P     . DT  C 4   ? 1.1122 1.0540 0.8746 -0.0749 -0.5062 0.1301  4   DT  D P     
2206 O OP1   . DT  C 4   ? 1.1091 1.1402 0.9326 -0.0375 -0.5253 0.1534  4   DT  D OP1   
2207 O OP2   . DT  C 4   ? 1.1060 1.0628 0.8737 -0.1132 -0.4975 0.1216  4   DT  D OP2   
2208 O "O5'" . DT  C 4   ? 1.0686 0.9347 0.8161 -0.0413 -0.4703 0.1107  4   DT  D "O5'" 
2209 C "C5'" . DT  C 4   ? 1.0876 0.8845 0.7897 -0.0257 -0.4696 0.1104  4   DT  D "C5'" 
2210 C "C4'" . DT  C 4   ? 1.0545 0.7833 0.7366 -0.0155 -0.4346 0.0916  4   DT  D "C4'" 
2211 O "O4'" . DT  C 4   ? 1.0596 0.7253 0.6798 -0.0492 -0.4233 0.0806  4   DT  D "O4'" 
2212 C "C3'" . DT  C 4   ? 1.0145 0.7743 0.7458 -0.0018 -0.4107 0.0802  4   DT  D "C3'" 
2213 O "O3'" . DT  C 4   ? 1.0364 0.7724 0.7796 0.0327  -0.3951 0.0757  4   DT  D "O3'" 
2214 C "C2'" . DT  C 4   ? 0.9927 0.7107 0.6900 -0.0331 -0.3902 0.0654  4   DT  D "C2'" 
2215 C "C1'" . DT  C 4   ? 1.0189 0.6644 0.6468 -0.0467 -0.3912 0.0650  4   DT  D "C1'" 
2216 N N1    . DT  C 4   ? 1.0202 0.6168 0.5922 -0.0800 -0.3805 0.0548  4   DT  D N1    
2217 C C2    . DT  C 4   ? 1.0160 0.5451 0.5389 -0.0780 -0.3549 0.0467  4   DT  D C2    
2218 O O2    . DT  C 4   ? 0.9978 0.5101 0.5230 -0.0570 -0.3427 0.0492  4   DT  D O2    
2219 N N3    . DT  C 4   ? 1.0404 0.5207 0.5070 -0.1021 -0.3440 0.0373  4   DT  D N3    
2220 C C4    . DT  C 4   ? 1.0705 0.5538 0.5215 -0.1330 -0.3572 0.0339  4   DT  D C4    
2221 O O4    . DT  C 4   ? 1.1214 0.5408 0.5082 -0.1510 -0.3443 0.0241  4   DT  D O4    
2222 C C5    . DT  C 4   ? 1.0567 0.6200 0.5664 -0.1413 -0.3863 0.0447  4   DT  D C5    
2223 C C7    . DT  C 4   ? 1.0868 0.6673 0.5859 -0.1828 -0.4060 0.0464  4   DT  D C7    
2224 C C6    . DT  C 4   ? 1.0194 0.6393 0.5889 -0.1112 -0.3947 0.0548  4   DT  D C6    
2225 P P     . DG  C 5   ? 1.0230 0.8010 0.8210 0.0619  -0.3789 0.0688  5   DG  D P     
2226 O OP1   . DG  C 5   ? 1.0455 0.8450 0.8649 0.1022  -0.3925 0.0800  5   DG  D OP1   
2227 O OP2   . DG  C 5   ? 0.9836 0.8146 0.8114 0.0415  -0.3731 0.0654  5   DG  D OP2   
2228 O "O5'" . DG  C 5   ? 0.9787 0.6935 0.7542 0.0641  -0.3524 0.0543  5   DG  D "O5'" 
2229 C "C5'" . DG  C 5   ? 0.9765 0.6271 0.7095 0.0642  -0.3525 0.0569  5   DG  D "C5'" 
2230 C "C4'" . DG  C 5   ? 0.9223 0.5329 0.6319 0.0464  -0.3279 0.0477  5   DG  D "C4'" 
2231 O "O4'" . DG  C 5   ? 0.9224 0.5211 0.6009 0.0187  -0.3249 0.0470  5   DG  D "O4'" 
2232 C "C3'" . DG  C 5   ? 0.8543 0.4855 0.5954 0.0516  -0.3074 0.0362  5   DG  D "C3'" 
2233 O "O3'" . DG  C 5   ? 0.8245 0.4211 0.5557 0.0568  -0.2958 0.0341  5   DG  D "O3'" 
2234 C "C2'" . DG  C 5   ? 0.8527 0.4867 0.5836 0.0276  -0.2933 0.0312  5   DG  D "C2'" 
2235 C "C1'" . DG  C 5   ? 0.8912 0.4868 0.5724 0.0098  -0.3003 0.0372  5   DG  D "C1'" 
2236 N N9    . DG  C 5   ? 0.8848 0.4831 0.5474 -0.0134 -0.3021 0.0343  5   DG  D N9    
2237 C C8    . DG  C 5   ? 0.8718 0.5150 0.5585 -0.0233 -0.3187 0.0360  5   DG  D C8    
2238 N N7    . DG  C 5   ? 0.8770 0.5024 0.5323 -0.0504 -0.3174 0.0324  5   DG  D N7    
2239 C C5    . DG  C 5   ? 0.8824 0.4467 0.4905 -0.0514 -0.2948 0.0267  5   DG  D C5    
2240 C C6    . DG  C 5   ? 0.9011 0.4114 0.4510 -0.0700 -0.2815 0.0203  5   DG  D C6    
2241 O O6    . DG  C 5   ? 0.9454 0.4425 0.4685 -0.0958 -0.2904 0.0172  5   DG  D O6    
2242 N N1    . DG  C 5   ? 0.8873 0.3538 0.4051 -0.0565 -0.2553 0.0189  5   DG  D N1    
2243 C C2    . DG  C 5   ? 0.8611 0.3390 0.4024 -0.0360 -0.2464 0.0246  5   DG  D C2    
2244 N N2    . DG  C 5   ? 0.8566 0.3013 0.3659 -0.0281 -0.2206 0.0268  5   DG  D N2    
2245 N N3    . DG  C 5   ? 0.8570 0.3733 0.4448 -0.0246 -0.2620 0.0294  5   DG  D N3    
2246 C C4    . DG  C 5   ? 0.8764 0.4328 0.4949 -0.0294 -0.2844 0.0292  5   DG  D C4    
2247 P P     . DT  C 6   ? 0.7663 0.3756 0.5213 0.0609  -0.2769 0.0242  6   DT  D P     
2248 O OP1   . DT  C 6   ? 0.7795 0.3573 0.5264 0.0738  -0.2814 0.0238  6   DT  D OP1   
2249 O OP2   . DT  C 6   ? 0.7503 0.4099 0.5401 0.0657  -0.2732 0.0177  6   DT  D OP2   
2250 O "O5'" . DT  C 6   ? 0.7138 0.3066 0.4492 0.0401  -0.2572 0.0261  6   DT  D "O5'" 
2251 C "C5'" . DT  C 6   ? 0.7344 0.2901 0.4368 0.0301  -0.2551 0.0356  6   DT  D "C5'" 
2252 C "C4'" . DT  C 6   ? 0.7276 0.2832 0.4187 0.0183  -0.2309 0.0388  6   DT  D "C4'" 
2253 O "O4'" . DT  C 6   ? 0.7288 0.2833 0.4032 0.0131  -0.2261 0.0352  6   DT  D "O4'" 
2254 C "C3'" . DT  C 6   ? 0.6842 0.2675 0.4044 0.0205  -0.2141 0.0356  6   DT  D "C3'" 
2255 O "O3'" . DT  C 6   ? 0.6925 0.2739 0.4027 0.0123  -0.1976 0.0474  6   DT  D "O3'" 
2256 C "C2'" . DT  C 6   ? 0.6821 0.2831 0.4098 0.0223  -0.2041 0.0283  6   DT  D "C2'" 
2257 C "C1'" . DT  C 6   ? 0.7191 0.2903 0.4062 0.0142  -0.2060 0.0307  6   DT  D "C1'" 
2258 N N1    . DT  C 6   ? 0.7348 0.3099 0.4180 0.0083  -0.2120 0.0232  6   DT  D N1    
2259 C C2    . DT  C 6   ? 0.7568 0.3033 0.4021 0.0005  -0.1975 0.0216  6   DT  D C2    
2260 O O2    . DT  C 6   ? 0.7635 0.2858 0.3805 0.0049  -0.1764 0.0263  6   DT  D O2    
2261 N N3    . DT  C 6   ? 0.7673 0.3127 0.4045 -0.0129 -0.2089 0.0158  6   DT  D N3    
2262 C C4    . DT  C 6   ? 0.7583 0.3448 0.4319 -0.0174 -0.2305 0.0143  6   DT  D C4    
2263 O O4    . DT  C 6   ? 0.7822 0.3704 0.4452 -0.0356 -0.2407 0.0127  6   DT  D O4    
2264 C C5    . DT  C 6   ? 0.7472 0.3684 0.4632 -0.0003 -0.2402 0.0163  6   DT  D C5    
2265 C C7    . DT  C 6   ? 0.7466 0.4180 0.5032 0.0049  -0.2591 0.0168  6   DT  D C7    
2266 C C6    . DT  C 6   ? 0.7312 0.3374 0.4451 0.0107  -0.2315 0.0192  6   DT  D C6    
2267 P P     . DC  C 7   ? 0.6918 0.3055 0.4298 0.0099  -0.1848 0.0522  7   DC  D P     
2268 O OP1   . DC  C 7   ? 0.6804 0.2910 0.4079 -0.0047 -0.1821 0.0691  7   DC  D OP1   
2269 O OP2   . DC  C 7   ? 0.6909 0.3174 0.4539 0.0165  -0.1959 0.0397  7   DC  D OP2   
2270 O "O5'" . DC  C 7   ? 0.6865 0.3183 0.4248 0.0178  -0.1596 0.0542  7   DC  D "O5'" 
2271 C "C5'" . DC  C 7   ? 0.7487 0.3598 0.4525 0.0189  -0.1450 0.0616  7   DC  D "C5'" 
2272 C "C4'" . DC  C 7   ? 0.7651 0.3751 0.4579 0.0314  -0.1226 0.0595  7   DC  D "C4'" 
2273 O "O4'" . DC  C 7   ? 0.7584 0.3457 0.4396 0.0297  -0.1340 0.0443  7   DC  D "O4'" 
2274 C "C3'" . DC  C 7   ? 0.7463 0.3967 0.4724 0.0409  -0.1076 0.0652  7   DC  D "C3'" 
2275 O "O3'" . DC  C 7   ? 0.7983 0.4515 0.5067 0.0556  -0.0789 0.0783  7   DC  D "O3'" 
2276 C "C2'" . DC  C 7   ? 0.7116 0.3568 0.4460 0.0436  -0.1142 0.0501  7   DC  D "C2'" 
2277 C "C1'" . DC  C 7   ? 0.7362 0.3353 0.4299 0.0375  -0.1217 0.0407  7   DC  D "C1'" 
2278 N N1    . DC  C 7   ? 0.7065 0.3051 0.4099 0.0291  -0.1407 0.0277  7   DC  D N1    
2279 C C2    . DC  C 7   ? 0.7232 0.2875 0.3915 0.0217  -0.1397 0.0215  7   DC  D C2    
2280 O O2    . DC  C 7   ? 0.7937 0.3179 0.4173 0.0266  -0.1211 0.0238  7   DC  D O2    
2281 N N3    . DC  C 7   ? 0.7047 0.2802 0.3858 0.0090  -0.1587 0.0141  7   DC  D N3    
2282 C C4    . DC  C 7   ? 0.6755 0.2934 0.4006 0.0108  -0.1751 0.0122  7   DC  D C4    
2283 N N4    . DC  C 7   ? 0.6843 0.3229 0.4238 0.0004  -0.1914 0.0084  7   DC  D N4    
2284 C C5    . DC  C 7   ? 0.6608 0.2999 0.4127 0.0224  -0.1755 0.0152  7   DC  D C5    
2285 C C6    . DC  C 7   ? 0.6636 0.2916 0.4033 0.0273  -0.1600 0.0232  7   DC  D C6    
2286 P P     . DC  C 8   ? 0.8081 0.5166 0.5504 0.0690  -0.0590 0.0960  8   DC  D P     
2287 O OP1   . DC  C 8   ? 0.8409 0.5664 0.5702 0.0794  -0.0349 0.1171  8   DC  D OP1   
2288 O OP2   . DC  C 8   ? 0.7599 0.5078 0.5461 0.0547  -0.0788 0.0955  8   DC  D OP2   
2289 O "O5'" . DC  C 8   ? 0.8093 0.4956 0.5363 0.0886  -0.0437 0.0887  8   DC  D "O5'" 
2290 C "C5'" . DC  C 8   ? 0.8577 0.4836 0.5286 0.1000  -0.0289 0.0818  8   DC  D "C5'" 
2291 C "C4'" . DC  C 8   ? 0.8730 0.4688 0.5306 0.1052  -0.0271 0.0709  8   DC  D "C4'" 
2292 O "O4'" . DC  C 8   ? 0.8454 0.4297 0.5111 0.0808  -0.0558 0.0536  8   DC  D "O4'" 
2293 C "C3'" . DC  C 8   ? 0.8573 0.4987 0.5537 0.1196  -0.0176 0.0818  8   DC  D "C3'" 
2294 O "O3'" . DC  C 8   ? 0.9294 0.5262 0.5867 0.1396  0.0030  0.0823  8   DC  D "O3'" 
2295 C "C2'" . DC  C 8   ? 0.8007 0.4620 0.5321 0.0977  -0.0450 0.0687  8   DC  D "C2'" 
2296 C "C1'" . DC  C 8   ? 0.8007 0.4073 0.4951 0.0811  -0.0590 0.0514  8   DC  D "C1'" 
2297 N N1    . DC  C 8   ? 0.7308 0.3569 0.4545 0.0604  -0.0873 0.0389  8   DC  D N1    
2298 C C2    . DC  C 8   ? 0.7168 0.3151 0.4219 0.0455  -0.0991 0.0277  8   DC  D C2    
2299 O O2    . DC  C 8   ? 0.7422 0.2903 0.4012 0.0447  -0.0886 0.0263  8   DC  D O2    
2300 N N3    . DC  C 8   ? 0.6907 0.3191 0.4274 0.0327  -0.1211 0.0201  8   DC  D N3    
2301 C C4    . DC  C 8   ? 0.6701 0.3380 0.4446 0.0368  -0.1309 0.0201  8   DC  D C4    
2302 N N4    . DC  C 8   ? 0.6688 0.3612 0.4677 0.0312  -0.1493 0.0128  8   DC  D N4    
2303 C C5    . DC  C 8   ? 0.6717 0.3553 0.4572 0.0463  -0.1223 0.0292  8   DC  D C5    
2304 C C6    . DC  C 8   ? 0.6895 0.3601 0.4548 0.0567  -0.1007 0.0399  8   DC  D C6    
2305 P P     . DA  C 9   ? 0.9602 0.5760 0.6153 0.1788  0.0365  0.1047  9   DA  D P     
2306 O OP1   . DA  C 9   ? 1.0202 0.6205 0.6406 0.1987  0.0600  0.1142  9   DA  D OP1   
2307 O OP2   . DA  C 9   ? 0.9029 0.6018 0.6239 0.1791  0.0299  0.1195  9   DA  D OP2   
2308 O "O5'" . DA  C 9   ? 0.9732 0.5123 0.5760 0.1883  0.0456  0.0952  9   DA  D "O5'" 
2309 C "C5'" . DA  C 9   ? 1.0053 0.4536 0.5373 0.1760  0.0433  0.0771  9   DA  D "C5'" 
2310 C "C4'" . DA  C 9   ? 1.0008 0.3979 0.5079 0.1557  0.0301  0.0640  9   DA  D "C4'" 
2311 O "O4'" . DA  C 9   ? 0.9234 0.3617 0.4767 0.1190  -0.0027 0.0530  9   DA  D "O4'" 
2312 C "C3'" . DA  C 9   ? 0.9874 0.3861 0.5006 0.1767  0.0445  0.0757  9   DA  D "C3'" 
2313 O "O3'" . DA  C 9   ? 1.0844 0.3797 0.5176 0.1767  0.0534  0.0682  9   DA  D "O3'" 
2314 C "C2'" . DA  C 9   ? 0.8948 0.3599 0.4743 0.1498  0.0186  0.0727  9   DA  D "C2'" 
2315 C "C1'" . DA  C 9   ? 0.8748 0.3338 0.4554 0.1123  -0.0088 0.0546  9   DA  D "C1'" 
2316 N N9    . DA  C 9   ? 0.7771 0.3136 0.4263 0.0950  -0.0317 0.0516  9   DA  D N9    
2317 C C8    . DA  C 9   ? 0.7228 0.3252 0.4215 0.1042  -0.0332 0.0597  9   DA  D C8    
2318 N N7    . DA  C 9   ? 0.6696 0.3149 0.4096 0.0859  -0.0555 0.0520  9   DA  D N7    
2319 C C5    . DA  C 9   ? 0.6720 0.2899 0.3964 0.0654  -0.0689 0.0398  9   DA  D C5    
2320 C C6    . DA  C 9   ? 0.6235 0.2710 0.3766 0.0459  -0.0910 0.0299  9   DA  D C6    
2321 N N6    . DA  C 9   ? 0.5887 0.2832 0.3822 0.0464  -0.1040 0.0269  9   DA  D N6    
2322 N N1    . DA  C 9   ? 0.6433 0.2662 0.3762 0.0256  -0.0998 0.0242  9   DA  D N1    
2323 C C2    . DA  C 9   ? 0.7010 0.2600 0.3800 0.0209  -0.0892 0.0256  9   DA  D C2    
2324 N N3    . DA  C 9   ? 0.7695 0.2809 0.4077 0.0415  -0.0670 0.0316  9   DA  D N3    
2325 C C4    . DA  C 9   ? 0.7379 0.2893 0.4065 0.0658  -0.0566 0.0396  9   DA  D C4    
2326 P P     . DT  C 10  ? 1.1390 0.3951 0.5454 0.2023  0.0728  0.0803  10  DT  D P     
2327 O OP1   . DT  C 10  ? 1.2703 0.3983 0.5705 0.2129  0.0901  0.0730  10  DT  D OP1   
2328 O OP2   . DT  C 10  ? 1.0975 0.4374 0.5623 0.2407  0.0896  0.1038  10  DT  D OP2   
2329 O "O5'" . DT  C 10  ? 1.0804 0.3558 0.5179 0.1598  0.0447  0.0731  10  DT  D "O5'" 
2330 C "C5'" . DT  C 10  ? 1.0882 0.3206 0.4964 0.1139  0.0209  0.0553  10  DT  D "C5'" 
2331 C "C4'" . DT  C 10  ? 1.0173 0.3061 0.4790 0.0804  -0.0024 0.0540  10  DT  D "C4'" 
2332 O "O4'" . DT  C 10  ? 0.9095 0.2984 0.4509 0.0753  -0.0181 0.0520  10  DT  D "O4'" 
2333 C "C3'" . DT  C 10  ? 1.0236 0.3230 0.4978 0.0936  0.0080  0.0682  10  DT  D "C3'" 
2334 O "O3'" . DT  C 10  ? 1.1242 0.3471 0.5417 0.0623  0.0017  0.0653  10  DT  D "O3'" 
2335 C "C2'" . DT  C 10  ? 0.9009 0.3124 0.4642 0.0849  -0.0077 0.0701  10  DT  D "C2'" 
2336 C "C1'" . DT  C 10  ? 0.8593 0.3034 0.4482 0.0623  -0.0284 0.0555  10  DT  D "C1'" 
2337 N N1    . DT  C 10  ? 0.7636 0.3001 0.4247 0.0695  -0.0374 0.0559  10  DT  D N1    
2338 C C2    . DT  C 10  ? 0.6974 0.2843 0.3997 0.0454  -0.0592 0.0469  10  DT  D C2    
2339 O O2    . DT  C 10  ? 0.7043 0.2787 0.3963 0.0176  -0.0719 0.0412  10  DT  D O2    
2340 N N3    . DT  C 10  ? 0.6238 0.2754 0.3766 0.0547  -0.0661 0.0459  10  DT  D N3    
2341 C C4    . DT  C 10  ? 0.6115 0.2904 0.3822 0.0780  -0.0562 0.0552  10  DT  D C4    
2342 O O4    . DT  C 10  ? 0.5670 0.2959 0.3759 0.0773  -0.0670 0.0530  10  DT  D O4    
2343 C C5    . DT  C 10  ? 0.6657 0.3072 0.4024 0.1018  -0.0334 0.0680  10  DT  D C5    
2344 C C7    . DT  C 10  ? 0.6569 0.3397 0.4161 0.1270  -0.0213 0.0838  10  DT  D C7    
2345 C C6    . DT  C 10  ? 0.7399 0.3092 0.4220 0.1002  -0.0237 0.0669  10  DT  D C6    
2346 P P     A DC  C 11  ? 1.1680 0.3698 0.5727 0.0663  0.0110  0.0804  11  DC  D P     
2347 P P     B DC  C 11  ? 1.1431 0.3629 0.5618 0.0559  0.0046  0.0786  11  DC  D P     
2348 O OP1   A DC  C 11  ? 1.3022 0.3728 0.6061 0.0518  0.0168  0.0787  11  DC  D OP1   
2349 O OP1   B DC  C 11  ? 1.2711 0.3634 0.5920 0.0418  0.0107  0.0782  11  DC  D OP1   
2350 O OP2   A DC  C 11  ? 1.1275 0.3835 0.5722 0.1141  0.0298  0.0970  11  DC  D OP2   
2351 O OP2   B DC  C 11  ? 1.0892 0.3708 0.5545 0.0983  0.0204  0.0948  11  DC  D OP2   
2352 O "O5'" A DC  C 11  ? 1.0952 0.3768 0.5614 0.0236  -0.0135 0.0785  11  DC  D "O5'" 
2353 O "O5'" B DC  C 11  ? 1.0696 0.3692 0.5489 0.0096  -0.0231 0.0727  11  DC  D "O5'" 
2354 C "C5'" A DC  C 11  ? 1.0791 0.3772 0.5550 -0.0204 -0.0381 0.0655  11  DC  D "C5'" 
2355 C "C5'" B DC  C 11  ? 1.0704 0.3632 0.5408 -0.0315 -0.0456 0.0594  11  DC  D "C5'" 
2356 C "C4'" A DC  C 11  ? 0.9993 0.3942 0.5456 -0.0444 -0.0538 0.0681  11  DC  D "C4'" 
2357 C "C4'" B DC  C 11  ? 0.9837 0.3784 0.5282 -0.0594 -0.0667 0.0582  11  DC  D "C4'" 
2358 O "O4'" A DC  C 11  ? 0.8896 0.3757 0.5068 -0.0237 -0.0584 0.0627  11  DC  D "O4'" 
2359 O "O4'" B DC  C 11  ? 0.8817 0.3631 0.4955 -0.0319 -0.0671 0.0549  11  DC  D "O4'" 
2360 C "C3'" A DC  C 11  ? 1.0099 0.4165 0.5629 -0.0409 -0.0438 0.0831  11  DC  D "C3'" 
2361 C "C3'" B DC  C 11  ? 0.9767 0.3997 0.5383 -0.0783 -0.0670 0.0702  11  DC  D "C3'" 
2362 O "O3'" A DC  C 11  ? 1.0408 0.4651 0.5987 -0.0862 -0.0578 0.0870  11  DC  D "O3'" 
2363 O "O3'" B DC  C 11  ? 0.9812 0.4454 0.5636 -0.1243 -0.0889 0.0692  11  DC  D "O3'" 
2364 C "C2'" A DC  C 11  ? 0.9014 0.4019 0.5247 -0.0093 -0.0397 0.0853  11  DC  D "C2'" 
2365 C "C2'" B DC  C 11  ? 0.8773 0.3881 0.5065 -0.0449 -0.0592 0.0739  11  DC  D "C2'" 
2366 C "C1'" A DC  C 11  ? 0.8175 0.3717 0.4832 -0.0132 -0.0549 0.0705  11  DC  D "C1'" 
2367 C "C1'" B DC  C 11  ? 0.8173 0.3724 0.4839 -0.0309 -0.0679 0.0612  11  DC  D "C1'" 
2368 N N1    A DC  C 11  ? 0.7206 0.3242 0.4262 0.0215  -0.0499 0.0691  11  DC  D N1    
2369 N N1    B DC  C 11  ? 0.7472 0.3487 0.4519 0.0071  -0.0583 0.0629  11  DC  D N1    
2370 C C2    A DC  C 11  ? 0.6333 0.3140 0.3953 0.0207  -0.0630 0.0607  11  DC  D C2    
2371 C C2    B DC  C 11  ? 0.6676 0.3491 0.4307 0.0106  -0.0692 0.0565  11  DC  D C2    
2372 O O2    A DC  C 11  ? 0.6158 0.3321 0.4000 -0.0013 -0.0755 0.0556  11  DC  D O2    
2373 O O2    B DC  C 11  ? 0.6497 0.3697 0.4372 -0.0102 -0.0826 0.0512  11  DC  D O2    
2374 N N3    A DC  C 11  ? 0.5743 0.2875 0.3621 0.0445  -0.0611 0.0601  11  DC  D N3    
2375 N N3    B DC  C 11  ? 0.6166 0.3306 0.4049 0.0370  -0.0644 0.0579  11  DC  D N3    
2376 C C4    A DC  C 11  ? 0.5820 0.2711 0.3521 0.0688  -0.0466 0.0700  11  DC  D C4    
2377 C C4    B DC  C 11  ? 0.6360 0.3222 0.4041 0.0607  -0.0493 0.0680  11  DC  D C4    
2378 N N4    A DC  C 11  ? 0.5279 0.2596 0.3277 0.0849  -0.0475 0.0724  11  DC  D N4    
2379 N N4    B DC  C 11  ? 0.5965 0.3266 0.3943 0.0799  -0.0481 0.0723  11  DC  D N4    
2380 C C5    A DC  C 11  ? 0.6673 0.2867 0.3855 0.0780  -0.0301 0.0794  11  DC  D C5    
2381 C C5    B DC  C 11  ? 0.7162 0.3271 0.4291 0.0660  -0.0347 0.0754  11  DC  D C5    
2382 C C6    A DC  C 11  ? 0.7277 0.2987 0.4105 0.0538  -0.0326 0.0774  11  DC  D C6    
2383 C C6    B DC  C 11  ? 0.7703 0.3331 0.4482 0.0381  -0.0401 0.0710  11  DC  D C6    
2384 P P     A DG  C 12  ? 1.0890 0.5047 0.6341 -0.0970 -0.0493 0.1048  12  DG  D P     
2385 P P     B DG  C 12  ? 1.0144 0.4964 0.5986 -0.1626 -0.0930 0.0838  12  DG  D P     
2386 O OP1   A DG  C 12  ? 1.1713 0.5255 0.6636 -0.1499 -0.0604 0.1097  12  DG  D OP1   
2387 O OP1   B DG  C 12  ? 1.0468 0.5347 0.6224 -0.2154 -0.1167 0.0840  12  DG  D OP1   
2388 O OP2   A DG  C 12  ? 1.1034 0.4818 0.6262 -0.0513 -0.0276 0.1147  12  DG  D OP2   
2389 O OP2   B DG  C 12  ? 1.0775 0.4758 0.6034 -0.1525 -0.0746 0.0945  12  DG  D OP2   
2390 O "O5'" A DG  C 12  ? 1.0074 0.5500 0.6367 -0.0989 -0.0557 0.1059  12  DG  D "O5'" 
2391 O "O5'" B DG  C 12  ? 0.9335 0.5372 0.6035 -0.1432 -0.0908 0.0863  12  DG  D "O5'" 
2392 C "C5'" A DG  C 12  ? 0.9656 0.5796 0.6405 -0.1252 -0.0737 0.0982  12  DG  D "C5'" 
2393 C "C5'" B DG  C 12  ? 0.9450 0.5761 0.6266 -0.1449 -0.0802 0.1001  12  DG  D "C5'" 
2394 C "C4'" A DG  C 12  ? 0.8830 0.6034 0.6281 -0.1060 -0.0724 0.0966  12  DG  D "C4'" 
2395 C "C4'" B DG  C 12  ? 0.8751 0.5983 0.6209 -0.1120 -0.0744 0.0968  12  DG  D "C4'" 
2396 O "O4'" A DG  C 12  ? 0.8242 0.5579 0.5899 -0.0651 -0.0685 0.0856  12  DG  D "O4'" 
2397 O "O4'" B DG  C 12  ? 0.8408 0.5522 0.5917 -0.0715 -0.0691 0.0864  12  DG  D "O4'" 
2398 C "C3'" A DG  C 12  ? 0.8962 0.6408 0.6459 -0.1031 -0.0599 0.1110  12  DG  D "C3'" 
2399 C "C3'" B DG  C 12  ? 0.8926 0.6371 0.6422 -0.1054 -0.0608 0.1108  12  DG  D "C3'" 
2400 O "O3'" A DG  C 12  ? 0.8803 0.7206 0.6818 -0.1120 -0.0632 0.1120  12  DG  D "O3'" 
2401 O "O3'" B DG  C 12  ? 0.8763 0.7176 0.6785 -0.1119 -0.0633 0.1119  12  DG  D "O3'" 
2402 C "C2'" A DG  C 12  ? 0.8494 0.5865 0.6006 -0.0582 -0.0483 0.1094  12  DG  D "C2'" 
2403 C "C2'" B DG  C 12  ? 0.8521 0.5850 0.6017 -0.0599 -0.0495 0.1082  12  DG  D "C2'" 
2404 C "C1'" A DG  C 12  ? 0.7757 0.5402 0.5576 -0.0403 -0.0571 0.0918  12  DG  D "C1'" 
2405 C "C1'" B DG  C 12  ? 0.7906 0.5420 0.5654 -0.0442 -0.0587 0.0908  12  DG  D "C1'" 
2406 N N9    A DG  C 12  ? 0.7292 0.4679 0.5026 -0.0061 -0.0500 0.0901  12  DG  D N9    
2407 N N9    B DG  C 12  ? 0.7573 0.4812 0.5225 -0.0095 -0.0509 0.0891  12  DG  D N9    
2408 C C8    A DG  C 12  ? 0.7675 0.4344 0.4957 0.0092  -0.0383 0.0986  12  DG  D C8    
2409 C C8    B DG  C 12  ? 0.8032 0.4521 0.5209 0.0050  -0.0391 0.0970  12  DG  D C8    
2410 N N7    A DG  C 12  ? 0.7287 0.4058 0.4683 0.0407  -0.0330 0.0988  12  DG  D N7    
2411 N N7    B DG  C 12  ? 0.7722 0.4306 0.5005 0.0379  -0.0325 0.0980  12  DG  D N7    
2412 C C5    A DG  C 12  ? 0.6486 0.3988 0.4381 0.0417  -0.0442 0.0883  12  DG  D C5    
2413 C C5    B DG  C 12  ? 0.6956 0.4308 0.4761 0.0406  -0.0430 0.0889  12  DG  D C5    
2414 C C6    A DG  C 12  ? 0.5807 0.3700 0.3988 0.0623  -0.0474 0.0850  12  DG  D C6    
2415 C C6    B DG  C 12  ? 0.6389 0.4146 0.4484 0.0629  -0.0449 0.0870  12  DG  D C6    
2416 O O6    A DG  C 12  ? 0.5713 0.3520 0.3848 0.0839  -0.0402 0.0932  12  DG  D O6    
2417 O O6    B DG  C 12  ? 0.6375 0.4035 0.4411 0.0857  -0.0368 0.0958  12  DG  D O6    
2418 N N1    A DG  C 12  ? 0.5279 0.3716 0.3807 0.0553  -0.0599 0.0724  12  DG  D N1    
2419 N N1    B DG  C 12  ? 0.5875 0.4208 0.4338 0.0563  -0.0574 0.0750  12  DG  D N1    
2420 C C2    A DG  C 12  ? 0.5359 0.4044 0.4006 0.0375  -0.0654 0.0655  12  DG  D C2    
2421 C C2    B DG  C 12  ? 0.5875 0.4463 0.4465 0.0378  -0.0638 0.0675  12  DG  D C2    
2422 N N2    A DG  C 12  ? 0.4956 0.4098 0.3877 0.0410  -0.0743 0.0532  12  DG  D N2    
2423 N N2    B DG  C 12  ? 0.5507 0.4575 0.4382 0.0417  -0.0725 0.0559  12  DG  D N2    
2424 N N3    A DG  C 12  ? 0.5844 0.4334 0.4324 0.0171  -0.0622 0.0717  12  DG  D N3    
2425 N N3    B DG  C 12  ? 0.6280 0.4661 0.4702 0.0163  -0.0616 0.0725  12  DG  D N3    
2426 C C4    A DG  C 12  ? 0.6457 0.4308 0.4539 0.0174  -0.0531 0.0822  12  DG  D C4    
2427 C C4    B DG  C 12  ? 0.6859 0.4578 0.4867 0.0157  -0.0527 0.0825  12  DG  D C4    
2428 P P     . DC  C 13  ? 0.9154 0.7928 0.7209 -0.1226 -0.0519 0.1293  13  DC  D P     
2429 O OP1   . DC  C 13  ? 0.9157 0.8774 0.7619 -0.1487 -0.0574 0.1339  13  DC  D OP1   
2430 O OP2   . DC  C 13  ? 1.0028 0.7921 0.7479 -0.1362 -0.0445 0.1450  13  DC  D OP2   
2431 O "O5'" . DC  C 13  ? 0.8717 0.7888 0.7006 -0.0789 -0.0428 0.1226  13  DC  D "O5'" 
2432 C "C5'" . DC  C 13  ? 0.8146 0.8020 0.6887 -0.0593 -0.0470 0.1071  13  DC  D "C5'" 
2433 C "C4'" . DC  C 13  ? 0.7814 0.7645 0.6574 -0.0229 -0.0454 0.0969  13  DC  D "C4'" 
2434 O "O4'" . DC  C 13  ? 0.7782 0.6958 0.6292 -0.0135 -0.0470 0.0967  13  DC  D "O4'" 
2435 C "C3'" . DC  C 13  ? 0.7901 0.7854 0.6548 -0.0104 -0.0353 0.1069  13  DC  D "C3'" 
2436 O "O3'" . DC  C 13  ? 0.7959 0.8583 0.6826 -0.0049 -0.0317 0.1013  13  DC  D "O3'" 
2437 C "C2'" . DC  C 13  ? 0.7516 0.7229 0.6106 0.0166  -0.0387 0.1018  13  DC  D "C2'" 
2438 C "C1'" . DC  C 13  ? 0.7302 0.6580 0.5855 0.0144  -0.0452 0.0948  13  DC  D "C1'" 
2439 N N1    . DC  C 13  ? 0.7082 0.5797 0.5361 0.0292  -0.0400 0.1049  13  DC  D N1    
2440 C C2    . DC  C 13  ? 0.6509 0.5342 0.4906 0.0529  -0.0430 0.1019  13  DC  D C2    
2441 O O2    . DC  C 13  ? 0.6084 0.5354 0.4732 0.0568  -0.0519 0.0894  13  DC  D O2    
2442 N N3    . DC  C 13  ? 0.6566 0.5017 0.4771 0.0707  -0.0357 0.1139  13  DC  D N3    
2443 C C4    . DC  C 13  ? 0.7138 0.4971 0.4958 0.0696  -0.0248 0.1259  13  DC  D C4    
2444 N N4    . DC  C 13  ? 0.7477 0.4943 0.5087 0.0954  -0.0143 0.1380  13  DC  D N4    
2445 C C5    . DC  C 13  ? 0.7586 0.5142 0.5188 0.0413  -0.0237 0.1275  13  DC  D C5    
2446 C C6    . DC  C 13  ? 0.7465 0.5553 0.5350 0.0202  -0.0317 0.1185  13  DC  D C6    
2447 P P     . DT  C 14  ? 0.8278 0.9137 0.6996 0.0046  -0.0217 0.1107  14  DT  D P     
2448 O OP1   . DT  C 14  ? 0.8360 0.9875 0.7250 0.0026  -0.0135 0.1076  14  DT  D OP1   
2449 O OP2   . DT  C 14  ? 0.8701 0.9093 0.7100 -0.0055 -0.0158 0.1329  14  DT  D OP2   
2450 O "O5'" . DT  C 14  ? 0.7902 0.8726 0.6602 0.0318  -0.0299 0.0971  14  DT  D "O5'" 
2451 C "C5'" . DT  C 14  ? 0.7351 0.8336 0.6226 0.0448  -0.0387 0.0748  14  DT  D "C5'" 
2452 C "C4'" . DT  C 14  ? 0.6984 0.7826 0.5755 0.0599  -0.0488 0.0683  14  DT  D "C4'" 
2453 O "O4'" . DT  C 14  ? 0.6739 0.7204 0.5492 0.0598  -0.0528 0.0789  14  DT  D "O4'" 
2454 C "C3'" . DT  C 14  ? 0.7059 0.8068 0.5609 0.0650  -0.0469 0.0757  14  DT  D "C3'" 
2455 O "O3'" . DT  C 14  ? 0.7152 0.8226 0.5606 0.0745  -0.0577 0.0584  14  DT  D "O3'" 
2456 C "C2'" . DT  C 14  ? 0.6943 0.7708 0.5405 0.0655  -0.0478 0.0977  14  DT  D "C2'" 
2457 C "C1'" . DT  C 14  ? 0.6567 0.7043 0.5181 0.0678  -0.0542 0.0928  14  DT  D "C1'" 
2458 N N1    . DT  C 14  ? 0.6225 0.6335 0.4755 0.0709  -0.0477 0.1129  14  DT  D N1    
2459 C C2    . DT  C 14  ? 0.5869 0.5890 0.4442 0.0843  -0.0524 0.1199  14  DT  D C2    
2460 O O2    . DT  C 14  ? 0.5631 0.5884 0.4325 0.0874  -0.0643 0.1123  14  DT  D O2    
2461 N N3    . DT  C 14  ? 0.5888 0.5515 0.4322 0.0934  -0.0420 0.1373  14  DT  D N3    
2462 C C4    . DT  C 14  ? 0.6286 0.5485 0.4469 0.0869  -0.0301 0.1472  14  DT  D C4    
2463 O O4    . DT  C 14  ? 0.6518 0.5254 0.4482 0.1004  -0.0207 0.1620  14  DT  D O4    
2464 C C5    . DT  C 14  ? 0.6502 0.5838 0.4672 0.0646  -0.0290 0.1406  14  DT  D C5    
2465 C C7    . DT  C 14  ? 0.6925 0.5834 0.4809 0.0469  -0.0190 0.1532  14  DT  D C7    
2466 C C6    . DT  C 14  ? 0.6325 0.6165 0.4699 0.0603  -0.0363 0.1249  14  DT  D C6    
2467 P P     . DC  C 15  ? 0.7491 0.8769 0.5627 0.0784  -0.0571 0.0563  15  DC  D P     
2468 O OP1   . DC  C 15  ? 0.7706 0.8934 0.5685 0.0878  -0.0636 0.0299  15  DC  D OP1   
2469 O OP2   . DC  C 15  ? 0.7667 0.9169 0.5742 0.0738  -0.0400 0.0714  15  DC  D OP2   
2470 O "O5'" . DC  C 15  ? 0.7387 0.8606 0.5418 0.0754  -0.0707 0.0723  15  DC  D "O5'" 
2471 C "C5'" . DC  C 15  ? 0.7013 0.8106 0.5122 0.0739  -0.0878 0.0681  15  DC  D "C5'" 
2472 C "C4'" . DC  C 15  ? 0.6830 0.8054 0.4954 0.0730  -0.0954 0.0941  15  DC  D "C4'" 
2473 O "O4'" . DC  C 15  ? 0.6541 0.7636 0.4864 0.0800  -0.0836 0.1132  15  DC  D "O4'" 
2474 C "C3'" . DC  C 15  ? 0.7154 0.8607 0.5010 0.0720  -0.0956 0.1086  15  DC  D "C3'" 
2475 O "O3'" . DC  C 15  ? 0.7425 0.9085 0.5232 0.0669  -0.1148 0.1209  15  DC  D "O3'" 
2476 C "C2'" . DC  C 15  ? 0.7028 0.8426 0.4963 0.0792  -0.0787 0.1335  15  DC  D "C2'" 
2477 C "C1'" . DC  C 15  ? 0.6596 0.7806 0.4805 0.0858  -0.0788 0.1396  15  DC  D "C1'" 
2478 N N1    . DC  C 15  ? 0.6333 0.7222 0.4565 0.0927  -0.0615 0.1553  15  DC  D N1    
2479 C C2    . DC  C 15  ? 0.6161 0.6877 0.4497 0.1071  -0.0588 0.1717  15  DC  D C2    
2480 O O2    . DC  C 15  ? 0.5850 0.6803 0.4351 0.1122  -0.0700 0.1745  15  DC  D O2    
2481 N N3    . DC  C 15  ? 0.6473 0.6736 0.4684 0.1140  -0.0431 0.1841  15  DC  D N3    
2482 C C4    . DC  C 15  ? 0.6761 0.6793 0.4787 0.1009  -0.0333 0.1832  15  DC  D C4    
2483 N N4    . DC  C 15  ? 0.7171 0.6645 0.4975 0.1035  -0.0205 0.1965  15  DC  D N4    
2484 C C5    . DC  C 15  ? 0.6726 0.7078 0.4735 0.0847  -0.0353 0.1705  15  DC  D C5    
2485 C C6    . DC  C 15  ? 0.6451 0.7204 0.4545 0.0846  -0.0480 0.1561  15  DC  D C6    
2486 P P     . DA  C 16  ? 0.3638 0.7145 0.5010 0.1188  0.0353  0.1505  16  DA  D P     
2487 O OP1   . DA  C 16  ? 0.4242 0.7806 0.5453 0.1696  0.0579  0.1701  16  DA  D OP1   
2488 O OP2   . DA  C 16  ? 0.4399 0.7738 0.5319 0.1362  0.0536  0.1580  16  DA  D OP2   
2489 O "O5'" . DA  C 16  ? 0.3481 0.5854 0.4646 0.0785  -0.0056 0.1133  16  DA  D "O5'" 
2490 C "C5'" . DA  C 16  ? 0.2936 0.5226 0.4383 0.0592  -0.0283 0.1004  16  DA  D "C5'" 
2491 C "C4'" . DA  C 16  ? 0.2421 0.4455 0.4144 0.0036  -0.0691 0.0726  16  DA  D "C4'" 
2492 O "O4'" . DA  C 16  ? 0.1769 0.4792 0.4270 -0.0317 -0.0715 0.0767  16  DA  D "O4'" 
2493 C "C3'" . DA  C 16  ? 0.2965 0.4040 0.4043 -0.0054 -0.0830 0.0567  16  DA  D "C3'" 
2494 O "O3'" . DA  C 16  ? 0.2751 0.3345 0.3774 -0.0391 -0.1200 0.0338  16  DA  D "O3'" 
2495 C "C2'" . DA  C 16  ? 0.2500 0.4117 0.3942 -0.0234 -0.0786 0.0629  16  DA  D "C2'" 
2496 C "C1'" . DA  C 16  ? 0.1477 0.4088 0.3810 -0.0541 -0.0836 0.0654  16  DA  D "C1'" 
2497 N N9    . DA  C 16  ? 0.1059 0.4474 0.3740 -0.0700 -0.0634 0.0795  16  DA  D N9    
2498 C C8    . DA  C 16  ? 0.1278 0.5085 0.3750 -0.0460 -0.0336 0.1002  16  DA  D C8    
2499 N N7    . DA  C 16  ? 0.1085 0.5714 0.3915 -0.0776 -0.0205 0.1097  16  DA  D N7    
2500 C C5    . DA  C 16  ? 0.0696 0.5453 0.3971 -0.1209 -0.0379 0.0956  16  DA  D C5    
2501 C C6    . DA  C 16  ? 0.0912 0.6098 0.4406 -0.1700 -0.0321 0.0937  16  DA  D C6    
2502 N N6    . DA  C 16  ? 0.0968 0.6823 0.4333 -0.1880 -0.0085 0.1095  16  DA  D N6    
2503 N N1    . DA  C 16  ? 0.1083 0.5945 0.4675 -0.1921 -0.0475 0.0779  16  DA  D N1    
2504 C C2    . DA  C 16  ? 0.1041 0.5025 0.4357 -0.1643 -0.0682 0.0653  16  DA  D C2    
2505 N N3    . DA  C 16  ? 0.0979 0.5059 0.4649 -0.1466 -0.0866 0.0617  16  DA  D N3    
2506 C C4    . DA  C 16  ? 0.0793 0.4903 0.4084 -0.1149 -0.0654 0.0776  16  DA  D C4    
2507 C C1    A ORP C 17  ? 0.7292 0.3485 0.3734 -0.0160 -0.0912 0.0057  17  ORP D C1    
2508 O O1    A ORP C 17  ? 0.7950 0.3896 0.3989 0.0268  -0.0516 0.0191  17  ORP D O1    
2509 C C2    A ORP C 17  ? 0.6479 0.3310 0.3510 -0.0464 -0.1218 0.0060  17  ORP D C2    
2510 C C3    A ORP C 17  ? 0.5265 0.3144 0.3433 -0.0365 -0.1199 0.0184  17  ORP D C3    
2511 O O3    A ORP C 17  ? 0.5159 0.3322 0.3429 -0.0126 -0.0939 0.0337  17  ORP D O3    
2512 C C4    A ORP C 17  ? 0.5111 0.3105 0.3446 -0.0150 -0.1037 0.0215  17  ORP D C4    
2513 O O4    A ORP C 17  ? 0.6449 0.3388 0.3743 -0.0033 -0.0900 0.0134  17  ORP D O4    
2514 C C5    A ORP C 17  ? 0.4048 0.2606 0.3126 -0.0416 -0.1311 0.0142  17  ORP D C5    
2515 O O5    A ORP C 17  ? 0.4513 0.3193 0.3708 -0.0186 -0.1133 0.0203  17  ORP D O5    
2516 P P     A ORP C 17  ? 0.3789 0.3279 0.3906 -0.0391 -0.1324 0.0180  17  ORP D P     
2517 O O1P   A ORP C 17  ? 0.4026 0.3491 0.4036 -0.0074 -0.1090 0.0283  17  ORP D O1P   
2518 O O2P   A ORP C 17  ? 0.3336 0.2650 0.3469 -0.0823 -0.1736 -0.0020 17  ORP D O2P   
2519 P P     B AAB C 17  ? 0.4148 0.3785 0.4417 -0.0412 -0.1338 0.0185  17  AAB D P     
2520 O O1P   B AAB C 17  ? 0.4654 0.4036 0.4630 -0.0126 -0.1141 0.0248  17  AAB D O1P   
2521 O O3P   B AAB C 17  ? 0.3476 0.3399 0.4226 -0.0852 -0.1733 0.0032  17  AAB D O3P   
2522 O "O5'" B AAB C 17  ? 0.4978 0.3686 0.4261 -0.0303 -0.1242 0.0156  17  AAB D "O5'" 
2523 C "C5'" B AAB C 17  ? 0.4505 0.3337 0.3870 -0.0445 -0.1334 0.0159  17  AAB D "C5'" 
2524 C "C4'" B AAB C 17  ? 0.5527 0.3615 0.3995 -0.0225 -0.1110 0.0193  17  AAB D "C4'" 
2525 O "O4'" B AAB C 17  ? 0.6598 0.3663 0.4085 -0.0257 -0.1104 0.0064  17  AAB D "O4'" 
2526 C "C1'" B AAB C 17  ? 0.7061 0.3692 0.4033 -0.0641 -0.1376 -0.0072 17  AAB D "C1'" 
2527 O "O1'" B AAB C 17  ? 0.6582 0.3486 0.3865 -0.1019 -0.1740 -0.0190 17  AAB D "O1'" 
2528 C "C2'" B AAB C 17  ? 0.6476 0.3658 0.3910 -0.0658 -0.1431 0.0028  17  AAB D "C2'" 
2529 C "C3'" B AAB C 17  ? 0.5453 0.3515 0.3848 -0.0440 -0.1279 0.0173  17  AAB D "C3'" 
2530 O "O3'" B AAB C 17  ? 0.5500 0.3693 0.3843 -0.0194 -0.1007 0.0315  17  AAB D "O3'" 
2531 P P     . DG  C 18  ? 0.4525 0.3680 0.3695 -0.0154 -0.0871 0.0475  18  DG  D P     
2532 O OP1   . DG  C 18  ? 0.4937 0.4088 0.3777 0.0098  -0.0577 0.0610  18  DG  D OP1   
2533 O OP2   . DG  C 18  ? 0.3656 0.3513 0.3534 -0.0175 -0.0853 0.0510  18  DG  D OP2   
2534 O "O5'" . DG  C 18  ? 0.3910 0.3130 0.3345 -0.0491 -0.1170 0.0417  18  DG  D "O5'" 
2535 C "C5'" . DG  C 18  ? 0.4263 0.3094 0.3238 -0.0530 -0.1222 0.0435  18  DG  D "C5'" 
2536 C "C4'" . DG  C 18  ? 0.3832 0.2993 0.3271 -0.0714 -0.1355 0.0489  18  DG  D "C4'" 
2537 O "O4'" . DG  C 18  ? 0.3375 0.3050 0.3311 -0.0731 -0.1140 0.0575  18  DG  D "O4'" 
2538 C "C3'" . DG  C 18  ? 0.4290 0.3140 0.3303 -0.0724 -0.1400 0.0563  18  DG  D "C3'" 
2539 O "O3'" . DG  C 18  ? 0.4191 0.3210 0.3513 -0.0845 -0.1589 0.0612  18  DG  D "O3'" 
2540 C "C2'" . DG  C 18  ? 0.4226 0.3222 0.3252 -0.0621 -0.1101 0.0670  18  DG  D "C2'" 
2541 C "C1'" . DG  C 18  ? 0.3618 0.3197 0.3323 -0.0720 -0.0998 0.0680  18  DG  D "C1'" 
2542 N N9    . DG  C 18  ? 0.3438 0.3454 0.3227 -0.0644 -0.0698 0.0767  18  DG  D N9    
2543 C C8    . DG  C 18  ? 0.3642 0.3732 0.3188 -0.0374 -0.0523 0.0804  18  DG  D C8    
2544 N N7    . DG  C 18  ? 0.3596 0.4347 0.3340 -0.0339 -0.0264 0.0937  18  DG  D N7    
2545 C C5    . DG  C 18  ? 0.3054 0.4130 0.3171 -0.0697 -0.0273 0.0950  18  DG  D C5    
2546 C C6    . DG  C 18  ? 0.3095 0.4938 0.3496 -0.0936 -0.0057 0.1058  18  DG  D C6    
2547 O O6    . DG  C 18  ? 0.3313 0.5913 0.3773 -0.0840 0.0172  0.1204  18  DG  D O6    
2548 N N1    . DG  C 18  ? 0.2856 0.4556 0.3400 -0.1335 -0.0094 0.1007  18  DG  D N1    
2549 C C2    . DG  C 18  ? 0.2791 0.3788 0.3295 -0.1373 -0.0310 0.0904  18  DG  D C2    
2550 N N2    . DG  C 18  ? 0.2792 0.3635 0.3365 -0.1695 -0.0250 0.0889  18  DG  D N2    
2551 N N3    . DG  C 18  ? 0.2887 0.3390 0.3226 -0.1125 -0.0542 0.0839  18  DG  D N3    
2552 C C4    . DG  C 18  ? 0.3104 0.3654 0.3240 -0.0845 -0.0517 0.0847  18  DG  D C4    
2553 P P     . DT  C 19  ? 0.4550 0.3387 0.3513 -0.0836 -0.1710 0.0741  19  DT  D P     
2554 O OP1   . DT  C 19  ? 0.4556 0.3646 0.3743 -0.0899 -0.1974 0.0775  19  DT  D OP1   
2555 O OP2   . DT  C 19  ? 0.5123 0.3580 0.3378 -0.0818 -0.1692 0.0727  19  DT  D OP2   
2556 O "O5'" . DT  C 19  ? 0.4603 0.3444 0.3731 -0.0785 -0.1473 0.0870  19  DT  D "O5'" 
2557 C "C5'" . DT  C 19  ? 0.4032 0.3043 0.3641 -0.0847 -0.1399 0.0894  19  DT  D "C5'" 
2558 C "C4'" . DT  C 19  ? 0.4117 0.3009 0.3659 -0.0903 -0.1102 0.0972  19  DT  D "C4'" 
2559 O "O4'" . DT  C 19  ? 0.3952 0.3083 0.3509 -0.0950 -0.0931 0.0911  19  DT  D "O4'" 
2560 C "C3'" . DT  C 19  ? 0.4915 0.3451 0.3964 -0.0801 -0.1051 0.1123  19  DT  D "C3'" 
2561 O "O3'" . DT  C 19  ? 0.5380 0.3669 0.4422 -0.0764 -0.0991 0.1252  19  DT  D "O3'" 
2562 C "C2'" . DT  C 19  ? 0.4990 0.3558 0.3858 -0.0886 -0.0788 0.1121  19  DT  D "C2'" 
2563 C "C1'" . DT  C 19  ? 0.4368 0.3402 0.3675 -0.1018 -0.0696 0.1006  19  DT  D "C1'" 
2564 N N1    . DT  C 19  ? 0.4228 0.3596 0.3441 -0.0972 -0.0534 0.0999  19  DT  D N1    
2565 C C2    . DT  C 19  ? 0.3960 0.3757 0.3282 -0.1170 -0.0277 0.1049  19  DT  D C2    
2566 O O2    . DT  C 19  ? 0.3978 0.3757 0.3380 -0.1451 -0.0160 0.1067  19  DT  D O2    
2567 N N3    . DT  C 19  ? 0.3971 0.4243 0.3254 -0.1039 -0.0135 0.1086  19  DT  D N3    
2568 C C4    . DT  C 19  ? 0.4299 0.4435 0.3335 -0.0703 -0.0177 0.1067  19  DT  D C4    
2569 O O4    . DT  C 19  ? 0.4504 0.5083 0.3476 -0.0534 0.0024  0.1143  19  DT  D O4    
2570 C C5    . DT  C 19  ? 0.4578 0.4057 0.3369 -0.0594 -0.0435 0.0977  19  DT  D C5    
2571 C C7    . DT  C 19  ? 0.5158 0.4244 0.3461 -0.0337 -0.0460 0.0922  19  DT  D C7    
2572 C C6    . DT  C 19  ? 0.4404 0.3643 0.3335 -0.0743 -0.0616 0.0960  19  DT  D C6    
2573 P P     . DA  C 20  ? 0.6269 0.4157 0.4820 -0.0604 -0.0930 0.1475  20  DA  D P     
2574 O OP1   . DA  C 20  ? 0.6459 0.4253 0.5066 -0.0402 -0.0999 0.1635  20  DA  D OP1   
2575 O OP2   . DA  C 20  ? 0.6521 0.4469 0.4728 -0.0552 -0.1052 0.1490  20  DA  D OP2   
2576 O "O5'" . DA  C 20  ? 0.6614 0.4159 0.4955 -0.0796 -0.0573 0.1491  20  DA  D "O5'" 
2577 C "C5'" . DA  C 20  ? 0.6623 0.4085 0.5152 -0.1030 -0.0361 0.1412  20  DA  D "C5'" 
2578 C "C4'" . DA  C 20  ? 0.7031 0.4308 0.5221 -0.1334 -0.0045 0.1414  20  DA  D "C4'" 
2579 O "O4'" . DA  C 20  ? 0.6531 0.4435 0.4889 -0.1461 -0.0054 0.1315  20  DA  D "O4'" 
2580 C "C3'" . DA  C 20  ? 0.7894 0.4618 0.5482 -0.1245 0.0076  0.1589  20  DA  D "C3'" 
2581 O "O3'" . DA  C 20  ? 0.8928 0.5099 0.6112 -0.1544 0.0418  0.1614  20  DA  D "O3'" 
2582 C "C2'" . DA  C 20  ? 0.7613 0.4761 0.5121 -0.1269 0.0021  0.1558  20  DA  D "C2'" 
2583 C "C1'" . DA  C 20  ? 0.6921 0.4737 0.4844 -0.1496 0.0066  0.1396  20  DA  D "C1'" 
2584 N N9    . DA  C 20  ? 0.6312 0.4640 0.4347 -0.1337 -0.0050 0.1346  20  DA  D N9    
2585 C C8    . DA  C 20  ? 0.6097 0.4373 0.4105 -0.1045 -0.0290 0.1331  20  DA  D C8    
2586 N N7    . DA  C 20  ? 0.5888 0.4511 0.3901 -0.0946 -0.0283 0.1268  20  DA  D N7    
2587 C C5    . DA  C 20  ? 0.5611 0.4721 0.3762 -0.1139 -0.0045 0.1277  20  DA  D C5    
2588 C C6    . DA  C 20  ? 0.5404 0.5136 0.3608 -0.1074 0.0110  0.1288  20  DA  D C6    
2589 N N6    . DA  C 20  ? 0.5356 0.5094 0.3411 -0.0748 0.0075  0.1264  20  DA  D N6    
2590 N N1    . DA  C 20  ? 0.5316 0.5661 0.3638 -0.1360 0.0338  0.1349  20  DA  D N1    
2591 C C2    . DA  C 20  ? 0.5549 0.5715 0.3852 -0.1753 0.0421  0.1351  20  DA  D C2    
2592 N N3    . DA  C 20  ? 0.5960 0.5358 0.4148 -0.1809 0.0334  0.1326  20  DA  D N3    
2593 C C4    . DA  C 20  ? 0.5974 0.4941 0.4132 -0.1447 0.0089  0.1310  20  DA  D C4    
2594 P P     . DC  C 21  ? 1.0253 0.5572 0.6675 -0.1502 0.0644  0.1810  21  DC  D P     
2595 O OP1   . DC  C 21  ? 1.1170 0.5643 0.7189 -0.1671 0.0974  0.1832  21  DC  D OP1   
2596 O OP2   . DC  C 21  ? 1.0294 0.5604 0.6658 -0.1035 0.0410  0.1994  21  DC  D OP2   
2597 O "O5'" . DC  C 21  ? 1.0373 0.5988 0.6531 -0.1895 0.0785  0.1752  21  DC  D "O5'" 
2598 C "C5'" . DC  C 21  ? 1.0059 0.6144 0.6318 -0.2408 0.0960  0.1603  21  DC  D "C5'" 
2599 C "C4'" . DC  C 21  ? 0.9965 0.6638 0.6068 -0.2619 0.1010  0.1610  21  DC  D "C4'" 
2600 O "O4'" . DC  C 21  ? 0.9013 0.6562 0.5673 -0.2333 0.0762  0.1558  21  DC  D "O4'" 
2601 C "C3'" . DC  C 21  ? 1.0709 0.6851 0.6216 -0.2515 0.1058  0.1755  21  DC  D "C3'" 
2602 O "O3'" . DC  C 21  ? 1.1454 0.7800 0.6529 -0.3008 0.1295  0.1754  21  DC  D "O3'" 
2603 C "C2'" . DC  C 21  ? 0.9996 0.6662 0.5844 -0.2079 0.0760  0.1771  21  DC  D "C2'" 
2604 C "C1'" . DC  C 21  ? 0.9045 0.6671 0.5432 -0.2176 0.0721  0.1637  21  DC  D "C1'" 
2605 N N1    . DC  C 21  ? 0.8155 0.6221 0.4903 -0.1766 0.0472  0.1595  21  DC  D N1    
2606 C C2    . DC  C 21  ? 0.7531 0.6426 0.4496 -0.1753 0.0521  0.1554  21  DC  D C2    
2607 O O2    . DC  C 21  ? 0.7534 0.6987 0.4484 -0.2092 0.0733  0.1576  21  DC  D O2    
2608 N N3    . DC  C 21  ? 0.7031 0.6090 0.4133 -0.1375 0.0363  0.1513  21  DC  D N3    
2609 C C4    . DC  C 21  ? 0.7103 0.5633 0.4131 -0.1126 0.0136  0.1495  21  DC  D C4    
2610 N N4    . DC  C 21  ? 0.6917 0.5508 0.3922 -0.0855 0.0022  0.1432  21  DC  D N4    
2611 C C5    . DC  C 21  ? 0.7649 0.5570 0.4547 -0.1148 0.0046  0.1564  21  DC  D C5    
2612 C C6    . DC  C 21  ? 0.8030 0.5694 0.4792 -0.1416 0.0234  0.1621  21  DC  D C6    
2613 P P     . DA  C 22  ? 1.2701 0.8021 0.6836 -0.3317 0.1586  0.1860  22  DA  D P     
2614 O OP1   . DA  C 22  ? 1.3356 0.7776 0.7154 -0.3542 0.1827  0.1827  22  DA  D OP1   
2615 O OP2   . DA  C 22  ? 1.2778 0.7708 0.6707 -0.2873 0.1444  0.2013  22  DA  D OP2   
2616 O "O5'" . DA  C 22  ? 1.2850 0.8929 0.6713 -0.3931 0.1767  0.1821  22  DA  D "O5'" 
2617 C "C5'" . DA  C 22  ? 1.2197 0.9361 0.6478 -0.4306 0.1814  0.1718  22  DA  D "C5'" 
2618 C "C4'" . DA  C 22  ? 1.1605 1.0086 0.6143 -0.4309 0.1750  0.1763  22  DA  D "C4'" 
2619 O "O4'" . DA  C 22  ? 1.0644 0.9557 0.5825 -0.3623 0.1465  0.1765  22  DA  D "O4'" 
2620 C "C3'" . DA  C 22  ? 1.2329 1.0742 0.6232 -0.4509 0.1856  0.1861  22  DA  D "C3'" 
2621 O "O3'" . DA  C 22  ? 1.2421 1.2167 0.6364 -0.4918 0.1975  0.1897  22  DA  D "O3'" 
2622 C "C2'" . DA  C 22  ? 1.1742 1.0077 0.5918 -0.3796 0.1593  0.1912  22  DA  D "C2'" 
2623 C "C1'" . DA  C 22  ? 1.0519 0.9642 0.5503 -0.3398 0.1413  0.1847  22  DA  D "C1'" 
2624 N N9    . DA  C 22  ? 0.9763 0.8538 0.5034 -0.2760 0.1149  0.1835  22  DA  D N9    
2625 C C8    . DA  C 22  ? 0.9877 0.7697 0.5076 -0.2499 0.1009  0.1847  22  DA  D C8    
2626 N N7    . DA  C 22  ? 0.9320 0.7173 0.4815 -0.2029 0.0768  0.1827  22  DA  D N7    
2627 C C5    . DA  C 22  ? 0.8631 0.7346 0.4382 -0.1932 0.0779  0.1781  22  DA  D C5    
2628 C C6    . DA  C 22  ? 0.7906 0.6885 0.3867 -0.1517 0.0639  0.1732  22  DA  D C6    
2629 N N6    . DA  C 22  ? 0.7697 0.6161 0.3649 -0.1225 0.0418  0.1700  22  DA  D N6    
2630 N N1    . DA  C 22  ? 0.7583 0.7373 0.3665 -0.1426 0.0768  0.1740  22  DA  D N1    
2631 C C2    . DA  C 22  ? 0.7688 0.8203 0.3757 -0.1764 0.0984  0.1811  22  DA  D C2    
2632 N N3    . DA  C 22  ? 0.8248 0.8672 0.4110 -0.2281 0.1107  0.1841  22  DA  D N3    
2633 C C4    . DA  C 22  ? 0.8819 0.8205 0.4496 -0.2329 0.1009  0.1810  22  DA  D C4    
2634 P P     . DG  C 23  ? 1.3430 1.3360 0.6570 -0.5562 0.2201  0.1975  23  DG  D P     
2635 O OP1   . DG  C 23  ? 1.3444 1.4573 0.6567 -0.6266 0.2395  0.1983  23  DG  D OP1   
2636 O OP2   . DG  C 23  ? 1.4535 1.2830 0.6851 -0.5723 0.2314  0.1971  23  DG  D OP2   
2637 O "O5'" . DG  C 23  ? 1.3005 1.3734 0.6378 -0.5056 0.2051  0.2079  23  DG  D "O5'" 
2638 C "C5'" . DG  C 23  ? 1.2019 1.4261 0.6027 -0.4751 0.2000  0.2144  23  DG  D "C5'" 
2639 C "C4'" . DG  C 23  ? 1.1527 1.3855 0.5720 -0.4034 0.1843  0.2192  23  DG  D "C4'" 
2640 O "O4'" . DG  C 23  ? 1.1004 1.2374 0.5516 -0.3452 0.1621  0.2097  23  DG  D "O4'" 
2641 C "C3'" . DG  C 23  ? 1.2139 1.4064 0.5713 -0.4130 0.1869  0.2251  23  DG  D "C3'" 
2642 O "O3'" . DG  C 23  ? 1.2048 1.4997 0.5775 -0.3754 0.1876  0.2348  23  DG  D "O3'" 
2643 C "C2'" . DG  C 23  ? 1.2110 1.2609 0.5629 -0.3703 0.1674  0.2184  23  DG  D "C2'" 
2644 C "C1'" . DG  C 23  ? 1.1130 1.1886 0.5344 -0.3140 0.1518  0.2119  23  DG  D "C1'" 
2645 N N9    . DG  C 23  ? 1.0613 1.0316 0.4957 -0.2746 0.1305  0.2051  23  DG  D N9    
2646 C C8    . DG  C 23  ? 1.0913 0.9509 0.4986 -0.2848 0.1266  0.2054  23  DG  D C8    
2647 N N7    . DG  C 23  ? 1.0548 0.8610 0.4832 -0.2405 0.1052  0.2035  23  DG  D N7    
2648 C C5    . DG  C 23  ? 0.9874 0.8568 0.4500 -0.2045 0.0952  0.1983  23  DG  D C5    
2649 C C6    . DG  C 23  ? 0.9318 0.7792 0.4148 -0.1598 0.0739  0.1929  23  DG  D C6    
2650 O O6    . DG  C 23  ? 0.9405 0.7268 0.4253 -0.1440 0.0559  0.1935  23  DG  D O6    
2651 N N1    . DG  C 23  ? 0.8783 0.7863 0.3745 -0.1337 0.0776  0.1881  23  DG  D N1    
2652 C C2    . DG  C 23  ? 0.8742 0.8702 0.3724 -0.1412 0.0988  0.1930  23  DG  D C2    
2653 N N2    . DG  C 23  ? 0.8466 0.8845 0.3499 -0.1019 0.1052  0.1919  23  DG  D N2    
2654 N N3    . DG  C 23  ? 0.9142 0.9543 0.4016 -0.1852 0.1153  0.2003  23  DG  D N3    
2655 C C4    . DG  C 23  ? 0.9824 0.9483 0.4490 -0.2191 0.1124  0.2003  23  DG  D C4    
2656 P P     . DA  C 24  ? 1.2704 1.6454 0.5924 -0.4123 0.2029  0.2479  24  DA  D P     
2657 O OP1   . DA  C 24  ? 1.2763 1.7870 0.5985 -0.4718 0.2224  0.2577  24  DA  D OP1   
2658 O OP2   . DA  C 24  ? 1.3383 1.5901 0.5961 -0.4370 0.1991  0.2444  24  DA  D OP2   
2659 O "O5'" . DA  C 24  ? 1.2315 1.6743 0.5810 -0.3365 0.2000  0.2554  24  DA  D "O5'" 
2660 C "C5'" . DA  C 24  ? 1.1557 1.6664 0.5635 -0.2794 0.2014  0.2584  24  DA  D "C5'" 
2661 C "C4'" . DA  C 24  ? 1.1366 1.5772 0.5492 -0.2035 0.1911  0.2518  24  DA  D "C4'" 
2662 O "O4'" . DA  C 24  ? 1.1133 1.4134 0.5310 -0.1963 0.1687  0.2346  24  DA  D "O4'" 
2663 C "C3'" . DA  C 24  ? 1.1847 1.6143 0.5509 -0.1884 0.1943  0.2558  24  DA  D "C3'" 
2664 O "O3'" . DA  C 24  ? 1.2127 1.6826 0.5850 -0.1186 0.2062  0.2614  24  DA  D "O3'" 
2665 C "C2'" . DA  C 24  ? 1.1866 1.4628 0.5279 -0.1931 0.1719  0.2412  24  DA  D "C2'" 
2666 C "C1'" . DA  C 24  ? 1.1218 1.3390 0.5050 -0.1709 0.1581  0.2298  24  DA  D "C1'" 
2667 N N9    . DA  C 24  ? 1.0793 1.1765 0.4531 -0.1881 0.1381  0.2210  24  DA  D N9    
2668 C C8    . DA  C 24  ? 1.0900 1.1424 0.4429 -0.2389 0.1386  0.2229  24  DA  D C8    
2669 N N7    . DA  C 24  ? 1.0779 1.0270 0.4283 -0.2317 0.1225  0.2188  24  DA  D N7    
2670 C C5    . DA  C 24  ? 1.0218 0.9560 0.3959 -0.1815 0.1071  0.2121  24  DA  D C5    
2671 C C6    . DA  C 24  ? 0.9724 0.8308 0.3537 -0.1558 0.0854  0.2078  24  DA  D C6    
2672 N N6    . DA  C 24  ? 0.9805 0.7680 0.3530 -0.1671 0.0760  0.2133  24  DA  D N6    
2673 N N1    . DA  C 24  ? 0.9469 0.8057 0.3357 -0.1185 0.0765  0.1999  24  DA  D N1    
2674 C C2    . DA  C 24  ? 0.9602 0.8793 0.3492 -0.0982 0.0920  0.1972  24  DA  D C2    
2675 N N3    . DA  C 24  ? 0.9841 0.9864 0.3734 -0.1083 0.1137  0.2047  24  DA  D N3    
2676 C C4    . DA  C 24  ? 1.0225 1.0350 0.4060 -0.1550 0.1182  0.2116  24  DA  D C4    
2677 P P     . DG  C 25  ? 1.2941 1.8000 0.6220 -0.0921 0.2207  0.2707  25  DG  D P     
2678 O OP1   . DG  C 25  ? 1.2970 1.9092 0.6390 -0.0305 0.2474  0.2876  25  DG  D OP1   
2679 O OP2   . DG  C 25  ? 1.3173 1.8576 0.6125 -0.1566 0.2201  0.2770  25  DG  D OP2   
2680 O "O5'" . DG  C 25  ? 1.3206 1.6743 0.6188 -0.0623 0.2041  0.2519  25  DG  D "O5'" 
2681 C "C5'" . DG  C 25  ? 1.2957 1.5756 0.6066 -0.0155 0.1995  0.2398  25  DG  D "C5'" 
2682 C "C4'" . DG  C 25  ? 1.3053 1.4504 0.5829 -0.0147 0.1785  0.2229  25  DG  D "C4'" 
2683 O "O4'" . DG  C 25  ? 1.2586 1.3441 0.5557 -0.0576 0.1524  0.2167  25  DG  D "O4'" 
2684 C "C3'" . DG  C 25  ? 1.3607 1.4834 0.5853 -0.0192 0.1810  0.2238  25  DG  D "C3'" 
2685 O "O3'" . DG  C 25  ? 1.4311 1.4704 0.6158 0.0176  0.1830  0.2115  25  DG  D "O3'" 
2686 C "C2'" . DG  C 25  ? 1.3323 1.4022 0.5543 -0.0729 0.1560  0.2227  25  DG  D "C2'" 
2687 C "C1'" . DG  C 25  ? 1.2680 1.2828 0.5271 -0.0746 0.1379  0.2141  25  DG  D "C1'" 
2688 N N9    . DG  C 25  ? 1.1985 1.1755 0.4675 -0.1179 0.1215  0.2173  25  DG  D N9    
2689 C C8    . DG  C 25  ? 1.1764 1.1907 0.4451 -0.1618 0.1293  0.2262  25  DG  D C8    
2690 N N7    . DG  C 25  ? 1.1641 1.1093 0.4305 -0.1883 0.1174  0.2274  25  DG  D N7    
2691 C C5    . DG  C 25  ? 1.1370 1.0139 0.4120 -0.1582 0.0978  0.2216  25  DG  D C5    
2692 C C6    . DG  C 25  ? 1.1168 0.9157 0.3922 -0.1610 0.0801  0.2253  25  DG  D C6    
2693 O O6    . DG  C 25  ? 1.1222 0.8810 0.3888 -0.1851 0.0819  0.2336  25  DG  D O6    
2694 N N1    . DG  C 25  ? 1.1142 0.8820 0.3950 -0.1312 0.0621  0.2198  25  DG  D N1    
2695 C C2    . DG  C 25  ? 1.1360 0.9224 0.4105 -0.1057 0.0642  0.2086  25  DG  D C2    
2696 N N2    . DG  C 25  ? 1.1561 0.9011 0.4226 -0.0909 0.0469  0.2030  25  DG  D N2    
2697 N N3    . DG  C 25  ? 1.1486 0.9899 0.4163 -0.0956 0.0848  0.2052  25  DG  D N3    
2698 C C4    . DG  C 25  ? 1.1554 1.0494 0.4291 -0.1211 0.0993  0.2136  25  DG  D C4    
2699 P P     . DC  C 26  ? 1.5176 1.5435 0.6385 0.0365  0.2000  0.2114  26  DC  D P     
2700 O OP1   . DC  C 26  ? 1.5676 1.6083 0.6638 0.0982  0.2343  0.2131  26  DC  D OP1   
2701 O OP2   . DC  C 26  ? 1.5187 1.6093 0.6359 -0.0001 0.1985  0.2237  26  DC  D OP2   
2702 O "O5'" . DC  C 26  ? 1.5349 1.4389 0.6194 0.0206  0.1767  0.1950  26  DC  D "O5'" 
2703 C "C5'" . DC  C 26  ? 1.4962 1.3740 0.5895 -0.0258 0.1477  0.1976  26  DC  D "C5'" 
2704 C "C4'" . DC  C 26  ? 1.4648 1.2577 0.5537 -0.0354 0.1227  0.1873  26  DC  D "C4'" 
2705 O "O4'" . DC  C 26  ? 1.3859 1.1838 0.5269 -0.0581 0.1016  0.1938  26  DC  D "O4'" 
2706 C "C3'" . DC  C 26  ? 1.4990 1.2417 0.5414 -0.0581 0.1077  0.1868  26  DC  D "C3'" 
2707 O "O3'" . DC  C 26  ? 1.5432 1.2185 0.5530 -0.0565 0.0987  0.1737  26  DC  D "O3'" 
2708 C "C2'" . DC  C 26  ? 1.4459 1.1962 0.5195 -0.0910 0.0845  0.2022  26  DC  D "C2'" 
2709 C "C1'" . DC  C 26  ? 1.3673 1.1319 0.4974 -0.0872 0.0798  0.2027  26  DC  D "C1'" 
2710 N N1    . DC  C 26  ? 1.2919 1.0837 0.4482 -0.1131 0.0788  0.2168  26  DC  D N1    
2711 C C2    . DC  C 26  ? 1.2688 1.0192 0.4370 -0.1295 0.0601  0.2276  26  DC  D C2    
2712 O O2    . DC  C 26  ? 1.2734 0.9866 0.4392 -0.1220 0.0415  0.2282  26  DC  D O2    
2713 N N3    . DC  C 26  ? 1.2546 1.0071 0.4291 -0.1538 0.0660  0.2388  26  DC  D N3    
2714 C C4    . DC  C 26  ? 1.2468 1.0519 0.4169 -0.1716 0.0858  0.2386  26  DC  D C4    
2715 N N4    . DC  C 26  ? 1.2531 1.0478 0.4140 -0.2058 0.0935  0.2477  26  DC  D N4    
2716 C C5    . DC  C 26  ? 1.2454 1.1165 0.4122 -0.1552 0.1015  0.2310  26  DC  D C5    
2717 C C6    . DC  C 26  ? 1.2632 1.1193 0.4228 -0.1215 0.0991  0.2208  26  DC  D C6    
2718 P P     . DT  C 27  ? 1.6332 1.2589 0.5677 -0.0732 0.0982  0.1672  27  DT  D P     
2719 O OP1   . DT  C 27  ? 1.6828 1.2408 0.5723 -0.0712 0.1002  0.1493  27  DT  D OP1   
2720 O OP2   . DT  C 27  ? 1.6719 1.3233 0.5735 -0.0622 0.1231  0.1689  27  DT  D OP2   
2721 O "O5'" . DT  C 27  ? 1.6026 1.2375 0.5552 -0.1099 0.0652  0.1847  27  DT  D "O5'" 
2722 C "C5'" . DT  C 27  ? 1.5479 1.1739 0.5329 -0.1210 0.0385  0.1911  27  DT  D "C5'" 
2723 C "C4'" . DT  C 27  ? 1.5029 1.1492 0.5080 -0.1407 0.0167  0.2165  27  DT  D "C4'" 
2724 O "O4'" . DT  C 27  ? 1.4364 1.1068 0.4867 -0.1346 0.0223  0.2277  27  DT  D "O4'" 
2725 C "C3'" . DT  C 27  ? 1.5471 1.1968 0.5066 -0.1610 0.0149  0.2264  27  DT  D "C3'" 
2726 O "O3'" . DT  C 27  ? 1.5703 1.2271 0.5301 -0.1778 -0.0106 0.2478  27  DT  D "O3'" 
2727 C "C2'" . DT  C 27  ? 1.5049 1.1803 0.4836 -0.1594 0.0265  0.2376  27  DT  D "C2'" 
2728 C "C1'" . DT  C 27  ? 1.4304 1.1080 0.4639 -0.1507 0.0200  0.2461  27  DT  D "C1'" 
2729 N N1    . DT  C 27  ? 1.3622 1.0590 0.4158 -0.1545 0.0350  0.2516  27  DT  D N1    
2730 C C2    . DT  C 27  ? 1.3339 1.0129 0.4062 -0.1620 0.0294  0.2699  27  DT  D C2    
2731 O O2    . DT  C 27  ? 1.3321 0.9878 0.4120 -0.1563 0.0131  0.2850  27  DT  D O2    
2732 N N3    . DT  C 27  ? 1.3197 1.0100 0.3935 -0.1771 0.0465  0.2718  27  DT  D N3    
2733 C C4    . DT  C 27  ? 1.3122 1.0505 0.3794 -0.1849 0.0653  0.2607  27  DT  D C4    
2734 O O4    . DT  C 27  ? 1.3080 1.0616 0.3719 -0.2083 0.0785  0.2653  27  DT  D O4    
2735 C C5    . DT  C 27  ? 1.3248 1.0900 0.3804 -0.1653 0.0707  0.2457  27  DT  D C5    
2736 C C7    . DT  C 27  ? 1.3286 1.1577 0.3763 -0.1607 0.0942  0.2384  27  DT  D C7    
2737 C C6    . DT  C 27  ? 1.3440 1.0765 0.3883 -0.1523 0.0569  0.2405  27  DT  D C6    
2738 P P     . DG  C 28  ? 1.6305 1.2861 0.5317 -0.2067 -0.0219 0.2489  28  DG  D P     
2739 O OP1   . DG  C 28  ? 1.6466 1.2815 0.5287 -0.2144 -0.0269 0.2309  28  DG  D OP1   
2740 O OP2   . DG  C 28  ? 1.6847 1.3333 0.5388 -0.2169 -0.0047 0.2408  28  DG  D OP2   
2741 O "O5'" . DG  C 28  ? 1.6264 1.3200 0.5494 -0.2135 -0.0463 0.2878  28  DG  D "O5'" 
2742 C "C5'" . DG  C 28  ? 1.5798 1.2881 0.5521 -0.1960 -0.0611 0.3057  28  DG  D "C5'" 
2743 C "C4'" . DG  C 28  ? 1.5628 1.2789 0.5605 -0.1794 -0.0629 0.3407  28  DG  D "C4'" 
2744 O "O4'" . DG  C 28  ? 1.5300 1.2144 0.5463 -0.1677 -0.0424 0.3301  28  DG  D "O4'" 
2745 C "C3'" . DG  C 28  ? 1.5999 1.3370 0.5638 -0.1931 -0.0675 0.3674  28  DG  D "C3'" 
2746 O "O3'" . DG  C 28  ? 1.6224 1.3916 0.5998 -0.1781 -0.0824 0.4095  28  DG  D "O3'" 
2747 C "C2'" . DG  C 28  ? 1.5862 1.2910 0.5453 -0.1901 -0.0473 0.3648  28  DG  D "C2'" 
2748 C "C1'" . DG  C 28  ? 1.5208 1.1970 0.5199 -0.1706 -0.0361 0.3532  28  DG  D "C1'" 
2749 N N9    . DG  C 28  ? 1.4603 1.1190 0.4550 -0.1775 -0.0145 0.3352  28  DG  D N9    
2750 C C8    . DG  C 28  ? 1.4349 1.1064 0.4129 -0.1872 -0.0023 0.3081  28  DG  D C8    
2751 N N7    . DG  C 28  ? 1.4178 1.0910 0.3969 -0.1925 0.0159  0.3018  28  DG  D N7    
2752 C C5    . DG  C 28  ? 1.4265 1.0718 0.4164 -0.1924 0.0170  0.3223  28  DG  D C5    
2753 C C6    . DG  C 28  ? 1.4282 1.0571 0.4099 -0.2079 0.0350  0.3254  28  DG  D C6    
2754 O O6    . DG  C 28  ? 1.4095 1.0656 0.3805 -0.2258 0.0505  0.3123  28  DG  D O6    
2755 N N1    . DG  C 28  ? 1.4593 1.0360 0.4372 -0.2028 0.0364  0.3484  28  DG  D N1    
2756 C C2    . DG  C 28  ? 1.4659 1.0247 0.4543 -0.1774 0.0215  0.3705  28  DG  D C2    
2757 N N2    . DG  C 28  ? 1.4973 0.9993 0.4735 -0.1666 0.0313  0.3940  28  DG  D N2    
2758 N N3    . DG  C 28  ? 1.4549 1.0506 0.4585 -0.1648 0.0011  0.3704  28  DG  D N3    
2759 C C4    . DG  C 28  ? 1.4449 1.0761 0.4443 -0.1775 0.0001  0.3439  28  DG  D C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   105 105 GLY GLY A . n 
A 1 2   SER 2   106 106 SER SER A . n 
A 1 3   HIS 3   107 107 HIS HIS A . n 
A 1 4   MET 4   108 108 MET MET A . n 
A 1 5   ALA 5   109 109 ALA ALA A . n 
A 1 6   SER 6   110 110 SER SER A . n 
A 1 7   PHE 7   111 111 PHE PHE A . n 
A 1 8   ASN 8   112 112 ASN ASN A . n 
A 1 9   GLY 9   113 113 GLY GLY A . n 
A 1 10  VAL 10  114 114 VAL VAL A . n 
A 1 11  SER 11  115 115 SER SER A . n 
A 1 12  GLU 12  116 116 GLU GLU A . n 
A 1 13  ALA 13  117 117 ALA ALA A . n 
A 1 14  GLU 14  118 118 GLU GLU A . n 
A 1 15  LEU 15  119 119 LEU LEU A . n 
A 1 16  LEU 16  120 120 LEU LEU A . n 
A 1 17  THR 17  121 121 THR THR A . n 
A 1 18  LYS 18  122 122 LYS LYS A . n 
A 1 19  THR 19  123 123 THR THR A . n 
A 1 20  LEU 20  124 124 LEU LEU A . n 
A 1 21  PRO 21  125 125 PRO PRO A . n 
A 1 22  ASP 22  126 126 ASP ASP A . n 
A 1 23  ILE 23  127 127 ILE ILE A . n 
A 1 24  LEU 24  128 128 LEU LEU A . n 
A 1 25  THR 25  129 129 THR THR A . n 
A 1 26  PHE 26  130 130 PHE PHE A . n 
A 1 27  ASN 27  131 131 ASN ASN A . n 
A 1 28  LEU 28  132 132 LEU LEU A . n 
A 1 29  ASP 29  133 133 ASP ASP A . n 
A 1 30  ILE 30  134 134 ILE ILE A . n 
A 1 31  VAL 31  135 135 VAL VAL A . n 
A 1 32  ILE 32  136 136 ILE ILE A . n 
A 1 33  ILE 33  137 137 ILE ILE A . n 
A 1 34  GLY 34  138 138 GLY GLY A . n 
A 1 35  ILE 35  139 139 ILE ILE A . n 
A 1 36  ASN 36  140 140 ASN ASN A . n 
A 1 37  PRO 37  141 141 PRO PRO A . n 
A 1 38  GLY 38  142 142 GLY GLY A . n 
A 1 39  LEU 39  143 143 LEU LEU A . n 
A 1 40  MET 40  144 144 MET MET A . n 
A 1 41  ALA 41  145 145 ALA ALA A . n 
A 1 42  ALA 42  146 146 ALA ALA A . n 
A 1 43  TYR 43  147 147 TYR TYR A . n 
A 1 44  LYS 44  148 148 LYS LYS A . n 
A 1 45  GLY 45  149 149 GLY GLY A . n 
A 1 46  HIS 46  150 150 HIS HIS A . n 
A 1 47  HIS 47  151 151 HIS HIS A . n 
A 1 48  TYR 48  152 152 TYR TYR A . n 
A 1 49  PRO 49  153 153 PRO PRO A . n 
A 1 50  GLY 50  154 154 GLY GLY A . n 
A 1 51  PRO 51  155 155 PRO PRO A . n 
A 1 52  GLY 52  156 156 GLY GLY A . n 
A 1 53  ASN 53  157 157 ASN ASN A . n 
A 1 54  HIS 54  158 158 HIS HIS A . n 
A 1 55  PHE 55  159 159 PHE PHE A . n 
A 1 56  TRP 56  160 160 TRP TRP A . n 
A 1 57  LYS 57  161 161 LYS LYS A . n 
A 1 58  CYS 58  162 162 CYS CYS A . n 
A 1 59  LEU 59  163 163 LEU LEU A . n 
A 1 60  PHE 60  164 164 PHE PHE A . n 
A 1 61  MET 61  165 165 MET MET A . n 
A 1 62  SER 62  166 166 SER SER A . n 
A 1 63  GLY 63  167 167 GLY GLY A . n 
A 1 64  LEU 64  168 168 LEU LEU A . n 
A 1 65  SER 65  169 169 SER SER A . n 
A 1 66  GLU 66  170 170 GLU GLU A . n 
A 1 67  VAL 67  171 171 VAL VAL A . n 
A 1 68  GLN 68  172 172 GLN GLN A . n 
A 1 69  LEU 69  173 173 LEU LEU A . n 
A 1 70  ASN 70  174 174 ASN ASN A . n 
A 1 71  HIS 71  175 175 HIS HIS A . n 
A 1 72  MET 72  176 176 MET MET A . n 
A 1 73  ASP 73  177 177 ASP ASP A . n 
A 1 74  ASP 74  178 178 ASP ASP A . n 
A 1 75  HIS 75  179 179 HIS HIS A . n 
A 1 76  THR 76  180 180 THR THR A . n 
A 1 77  LEU 77  181 181 LEU LEU A . n 
A 1 78  PRO 78  182 182 PRO PRO A . n 
A 1 79  GLY 79  183 183 GLY GLY A . n 
A 1 80  LYS 80  184 184 LYS LYS A . n 
A 1 81  TYR 81  185 185 TYR TYR A . n 
A 1 82  GLY 82  186 186 GLY GLY A . n 
A 1 83  ILE 83  187 187 ILE ILE A . n 
A 1 84  GLY 84  188 188 GLY GLY A . n 
A 1 85  PHE 85  189 189 PHE PHE A . n 
A 1 86  THR 86  190 190 THR THR A . n 
A 1 87  ASN 87  191 191 ASN ASN A . n 
A 1 88  MET 88  192 192 MET MET A . n 
A 1 89  VAL 89  193 193 VAL VAL A . n 
A 1 90  GLU 90  194 194 GLU GLU A . n 
A 1 91  ARG 91  195 195 ARG ARG A . n 
A 1 92  THR 92  196 196 THR THR A . n 
A 1 93  THR 93  197 197 THR THR A . n 
A 1 94  PRO 94  198 198 PRO PRO A . n 
A 1 95  GLY 95  199 199 GLY GLY A . n 
A 1 96  SER 96  200 200 SER SER A . n 
A 1 97  LYS 97  201 201 LYS LYS A . n 
A 1 98  ASP 98  202 202 ASP ASP A . n 
A 1 99  LEU 99  203 203 LEU LEU A . n 
A 1 100 SER 100 204 204 SER SER A . n 
A 1 101 SER 101 205 205 SER SER A . n 
A 1 102 LYS 102 206 206 LYS LYS A . n 
A 1 103 GLU 103 207 207 GLU GLU A . n 
A 1 104 PHE 104 208 208 PHE PHE A . n 
A 1 105 ARG 105 209 209 ARG ARG A . n 
A 1 106 GLU 106 210 210 GLU GLU A . n 
A 1 107 GLY 107 211 211 GLY GLY A . n 
A 1 108 GLY 108 212 212 GLY GLY A . n 
A 1 109 ARG 109 213 213 ARG ARG A . n 
A 1 110 ILE 110 214 214 ILE ILE A . n 
A 1 111 LEU 111 215 215 LEU LEU A . n 
A 1 112 VAL 112 216 216 VAL VAL A . n 
A 1 113 GLN 113 217 217 GLN GLN A . n 
A 1 114 LYS 114 218 218 LYS LYS A . n 
A 1 115 LEU 115 219 219 LEU LEU A . n 
A 1 116 GLN 116 220 220 GLN GLN A . n 
A 1 117 LYS 117 221 221 LYS LYS A . n 
A 1 118 TYR 118 222 222 TYR TYR A . n 
A 1 119 GLN 119 223 223 GLN GLN A . n 
A 1 120 PRO 120 224 224 PRO PRO A . n 
A 1 121 ARG 121 225 225 ARG ARG A . n 
A 1 122 ILE 122 226 226 ILE ILE A . n 
A 1 123 ALA 123 227 227 ALA ALA A . n 
A 1 124 VAL 124 228 228 VAL VAL A . n 
A 1 125 PHE 125 229 229 PHE PHE A . n 
A 1 126 ASN 126 230 230 ASN ASN A . n 
A 1 127 GLY 127 231 231 GLY GLY A . n 
A 1 128 LYS 128 232 232 LYS LYS A . n 
A 1 129 CYS 129 233 233 CYS CYS A . n 
A 1 130 ILE 130 234 234 ILE ILE A . n 
A 1 131 TYR 131 235 235 TYR TYR A . n 
A 1 132 GLU 132 236 236 GLU GLU A . n 
A 1 133 ILE 133 237 237 ILE ILE A . n 
A 1 134 PHE 134 238 238 PHE PHE A . n 
A 1 135 SER 135 239 239 SER SER A . n 
A 1 136 LYS 136 240 240 LYS LYS A . n 
A 1 137 GLU 137 241 241 GLU GLU A . n 
A 1 138 VAL 138 242 242 VAL VAL A . n 
A 1 139 PHE 139 243 243 PHE PHE A . n 
A 1 140 GLY 140 244 244 GLY GLY A . n 
A 1 141 VAL 141 245 245 VAL VAL A . n 
A 1 142 LYS 142 246 246 LYS LYS A . n 
A 1 143 VAL 143 247 247 VAL VAL A . n 
A 1 144 LYS 144 248 248 LYS LYS A . n 
A 1 145 ASN 145 249 249 ASN ASN A . n 
A 1 146 LEU 146 250 250 LEU LEU A . n 
A 1 147 GLU 147 251 251 GLU GLU A . n 
A 1 148 PHE 148 252 252 PHE PHE A . n 
A 1 149 GLY 149 253 253 GLY GLY A . n 
A 1 150 LEU 150 254 254 LEU LEU A . n 
A 1 151 GLN 151 255 255 GLN GLN A . n 
A 1 152 PRO 152 256 256 PRO PRO A . n 
A 1 153 HIS 153 257 257 HIS HIS A . n 
A 1 154 LYS 154 258 258 LYS LYS A . n 
A 1 155 ILE 155 259 259 ILE ILE A . n 
A 1 156 PRO 156 260 260 PRO PRO A . n 
A 1 157 ASP 157 261 261 ASP ASP A . n 
A 1 158 THR 158 262 262 THR THR A . n 
A 1 159 GLU 159 263 263 GLU GLU A . n 
A 1 160 THR 160 264 264 THR THR A . n 
A 1 161 LEU 161 265 265 LEU LEU A . n 
A 1 162 CYS 162 266 266 CYS CYS A . n 
A 1 163 TYR 163 267 267 TYR TYR A . n 
A 1 164 VAL 164 268 268 VAL VAL A . n 
A 1 165 MET 165 269 269 MET MET A . n 
A 1 166 PRO 166 270 270 PRO PRO A . n 
A 1 167 SER 167 271 271 SER SER A . n 
A 1 168 SER 168 272 272 SER SER A . n 
A 1 169 SER 169 273 273 SER SER A . n 
A 1 170 ALA 170 274 274 ALA ALA A . n 
A 1 171 ARG 171 275 275 ARG ARG A . n 
A 1 172 CYS 172 276 276 CYS CYS A . n 
A 1 173 ALA 173 277 277 ALA ALA A . n 
A 1 174 GLN 174 278 278 GLN GLN A . n 
A 1 175 PHE 175 279 279 PHE PHE A . n 
A 1 176 PRO 176 280 280 PRO PRO A . n 
A 1 177 ARG 177 281 281 ARG ARG A . n 
A 1 178 ALA 178 282 282 ALA ALA A . n 
A 1 179 GLN 179 283 283 GLN GLN A . n 
A 1 180 ASP 180 284 284 ASP ASP A . n 
A 1 181 LYS 181 285 285 LYS LYS A . n 
A 1 182 VAL 182 286 286 VAL VAL A . n 
A 1 183 HIS 183 287 287 HIS HIS A . n 
A 1 184 TYR 184 288 288 TYR TYR A . n 
A 1 185 TYR 185 289 289 TYR TYR A . n 
A 1 186 ILE 186 290 290 ILE ILE A . n 
A 1 187 LYS 187 291 291 LYS LYS A . n 
A 1 188 LEU 188 292 292 LEU LEU A . n 
A 1 189 LYS 189 293 293 LYS LYS A . n 
A 1 190 ASP 190 294 294 ASP ASP A . n 
A 1 191 LEU 191 295 295 LEU LEU A . n 
A 1 192 ARG 192 296 296 ARG ARG A . n 
A 1 193 ASP 193 297 297 ASP ASP A . n 
A 1 194 GLN 194 298 298 GLN GLN A . n 
A 1 195 LEU 195 299 299 LEU LEU A . n 
A 1 196 LYS 196 300 300 LYS LYS A . n 
A 1 197 GLY 197 301 301 GLY GLY A . n 
A 1 198 ILE 198 302 ?   ?   ?   A . n 
A 1 199 GLU 199 303 ?   ?   ?   A . n 
A 1 200 ARG 200 304 ?   ?   ?   A . n 
A 1 201 ASN 201 305 ?   ?   ?   A . n 
A 1 202 MET 202 306 ?   ?   ?   A . n 
A 1 203 ASP 203 307 ?   ?   ?   A . n 
A 1 204 VAL 204 308 ?   ?   ?   A . n 
B 2 1   DC  1   1   1   DC  DC  C . n 
B 2 2   DA  2   2   2   DA  DA  C . n 
B 2 3   DG  3   3   3   DG  DG  C . n 
B 2 4   DC  4   4   4   DC  DC  C . n 
B 2 5   DT  5   5   5   DT  DT  C . n 
B 2 6   DC  6   6   6   DC  DC  C . n 
B 2 7   DT  7   7   7   DT  DT  C . n 
B 2 8   DG  8   8   8   DG  DG  C . n 
B 2 9   DT  9   9   9   DT  DT  C . n 
B 2 10  DA  10  10  10  DA  DA  C . n 
B 2 11  DC  11  11  11  DC  DC  C . n 
B 2 12  DG  12  12  12  DG  DG  C . n 
B 2 13  DT  13  13  13  DT  DT  C . n 
B 2 14  DG  14  14  14  DG  DG  C . n 
B 2 15  DA  15  15  15  DA  DA  C . n 
B 2 16  DG  16  16  16  DG  DG  C . n 
B 2 17  DC  17  17  17  DC  DC  C . n 
B 2 18  DG  18  18  18  DG  DG  C . n 
B 2 19  DA  19  19  19  DA  DA  C . n 
B 2 20  DT  20  20  20  DT  DT  C . n 
B 2 21  DG  21  21  21  DG  DG  C . n 
B 2 22  DG  22  22  22  DG  DG  C . n 
B 2 23  DA  23  23  23  DA  DA  C . n 
B 2 24  DC  24  24  24  DC  DC  C . n 
B 2 25  DA  25  25  25  DA  DA  C . n 
B 2 26  DG  26  26  26  DG  DG  C . n 
B 2 27  DC  27  27  27  DC  DC  C . n 
B 2 28  DT  28  28  28  DT  DT  C . n 
C 3 1   DA  1   1   1   DA  DA  D . n 
C 3 2   DG  2   2   2   DG  DG  D . n 
C 3 3   DC  3   3   3   DC  DC  D . n 
C 3 4   DT  4   4   4   DT  DT  D . n 
C 3 5   DG  5   5   5   DG  DG  D . n 
C 3 6   DT  6   6   6   DT  DT  D . n 
C 3 7   DC  7   7   7   DC  DC  D . n 
C 3 8   DC  8   8   8   DC  DC  D . n 
C 3 9   DA  9   9   9   DA  DA  D . n 
C 3 10  DT  10  10  10  DT  DT  D . n 
C 3 11  DC  11  11  11  DC  DC  D . n 
C 3 12  DG  12  12  12  DG  DG  D . n 
C 3 13  DC  13  13  13  DC  DC  D . n 
C 3 14  DT  14  14  14  DT  DT  D . n 
C 3 15  DC  15  15  15  DC  DC  D . n 
C 3 16  DA  16  16  16  DA  DA  D . n 
C 3 17  ORP 17  17  17  ORP ORP D . y 
C 3 17  AAB 17  17  17  AAB AAB D . y 
C 3 18  DG  18  18  18  DG  DG  D . n 
C 3 19  DT  19  19  19  DT  DT  D . n 
C 3 20  DA  20  20  20  DA  DA  D . n 
C 3 21  DC  21  21  21  DC  DC  D . n 
C 3 22  DA  22  22  22  DA  DA  D . n 
C 3 23  DG  23  23  23  DG  DG  D . n 
C 3 24  DA  24  24  24  DA  DA  D . n 
C 3 25  DG  25  25  25  DG  DG  D . n 
C 3 26  DC  26  26  26  DC  DC  D . n 
C 3 27  DT  27  27  27  DT  DT  D . n 
C 3 28  DG  28  28  28  DG  DG  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   501 501 HOH HOH A . 
D 4 HOH 2   502 502 HOH HOH A . 
D 4 HOH 3   503 503 HOH HOH A . 
D 4 HOH 4   504 504 HOH HOH A . 
D 4 HOH 5   505 505 HOH HOH A . 
D 4 HOH 6   506 506 HOH HOH A . 
D 4 HOH 7   507 507 HOH HOH A . 
D 4 HOH 8   508 508 HOH HOH A . 
D 4 HOH 9   509 509 HOH HOH A . 
D 4 HOH 10  510 510 HOH HOH A . 
D 4 HOH 11  511 511 HOH HOH A . 
D 4 HOH 12  512 512 HOH HOH A . 
D 4 HOH 13  513 513 HOH HOH A . 
D 4 HOH 14  514 514 HOH HOH A . 
D 4 HOH 15  515 515 HOH HOH A . 
D 4 HOH 16  516 516 HOH HOH A . 
D 4 HOH 17  517 517 HOH HOH A . 
D 4 HOH 18  518 518 HOH HOH A . 
D 4 HOH 19  519 519 HOH HOH A . 
D 4 HOH 20  520 520 HOH HOH A . 
D 4 HOH 21  521 521 HOH HOH A . 
D 4 HOH 22  522 522 HOH HOH A . 
D 4 HOH 23  523 523 HOH HOH A . 
D 4 HOH 24  524 524 HOH HOH A . 
D 4 HOH 25  525 525 HOH HOH A . 
D 4 HOH 26  526 526 HOH HOH A . 
D 4 HOH 27  527 527 HOH HOH A . 
D 4 HOH 28  528 528 HOH HOH A . 
D 4 HOH 29  529 529 HOH HOH A . 
D 4 HOH 30  530 530 HOH HOH A . 
D 4 HOH 31  531 531 HOH HOH A . 
D 4 HOH 32  532 532 HOH HOH A . 
D 4 HOH 33  533 533 HOH HOH A . 
D 4 HOH 34  534 534 HOH HOH A . 
D 4 HOH 35  535 535 HOH HOH A . 
D 4 HOH 36  536 536 HOH HOH A . 
D 4 HOH 37  537 537 HOH HOH A . 
D 4 HOH 38  538 538 HOH HOH A . 
D 4 HOH 39  539 539 HOH HOH A . 
D 4 HOH 40  540 540 HOH HOH A . 
D 4 HOH 41  541 541 HOH HOH A . 
D 4 HOH 42  542 542 HOH HOH A . 
D 4 HOH 43  543 543 HOH HOH A . 
D 4 HOH 44  544 544 HOH HOH A . 
D 4 HOH 45  545 545 HOH HOH A . 
D 4 HOH 46  546 546 HOH HOH A . 
D 4 HOH 47  547 547 HOH HOH A . 
D 4 HOH 48  548 548 HOH HOH A . 
D 4 HOH 49  549 549 HOH HOH A . 
D 4 HOH 50  550 550 HOH HOH A . 
D 4 HOH 51  551 551 HOH HOH A . 
D 4 HOH 52  552 552 HOH HOH A . 
D 4 HOH 53  553 553 HOH HOH A . 
D 4 HOH 54  554 554 HOH HOH A . 
D 4 HOH 55  555 555 HOH HOH A . 
D 4 HOH 56  556 556 HOH HOH A . 
D 4 HOH 57  557 557 HOH HOH A . 
D 4 HOH 58  558 558 HOH HOH A . 
D 4 HOH 59  559 559 HOH HOH A . 
D 4 HOH 60  560 560 HOH HOH A . 
D 4 HOH 61  561 561 HOH HOH A . 
D 4 HOH 62  562 562 HOH HOH A . 
D 4 HOH 63  563 563 HOH HOH A . 
D 4 HOH 64  564 564 HOH HOH A . 
D 4 HOH 65  565 565 HOH HOH A . 
D 4 HOH 66  566 566 HOH HOH A . 
D 4 HOH 67  567 567 HOH HOH A . 
D 4 HOH 68  568 568 HOH HOH A . 
D 4 HOH 69  569 569 HOH HOH A . 
D 4 HOH 70  570 570 HOH HOH A . 
D 4 HOH 71  571 571 HOH HOH A . 
D 4 HOH 72  572 572 HOH HOH A . 
D 4 HOH 73  573 573 HOH HOH A . 
D 4 HOH 74  574 574 HOH HOH A . 
D 4 HOH 75  575 575 HOH HOH A . 
D 4 HOH 76  576 576 HOH HOH A . 
D 4 HOH 77  577 577 HOH HOH A . 
D 4 HOH 78  578 578 HOH HOH A . 
D 4 HOH 79  579 579 HOH HOH A . 
D 4 HOH 80  580 580 HOH HOH A . 
D 4 HOH 81  581 581 HOH HOH A . 
D 4 HOH 82  582 582 HOH HOH A . 
D 4 HOH 83  583 583 HOH HOH A . 
D 4 HOH 84  584 584 HOH HOH A . 
D 4 HOH 85  585 585 HOH HOH A . 
D 4 HOH 86  586 586 HOH HOH A . 
D 4 HOH 87  587 587 HOH HOH A . 
D 4 HOH 88  588 588 HOH HOH A . 
D 4 HOH 89  589 589 HOH HOH A . 
D 4 HOH 90  590 590 HOH HOH A . 
D 4 HOH 91  591 591 HOH HOH A . 
D 4 HOH 92  592 592 HOH HOH A . 
D 4 HOH 93  593 593 HOH HOH A . 
D 4 HOH 94  594 594 HOH HOH A . 
D 4 HOH 95  595 595 HOH HOH A . 
D 4 HOH 96  596 596 HOH HOH A . 
D 4 HOH 97  597 597 HOH HOH A . 
D 4 HOH 98  598 598 HOH HOH A . 
D 4 HOH 99  599 599 HOH HOH A . 
D 4 HOH 100 600 600 HOH HOH A . 
D 4 HOH 101 601 601 HOH HOH A . 
D 4 HOH 102 602 602 HOH HOH A . 
D 4 HOH 103 603 603 HOH HOH A . 
D 4 HOH 104 604 604 HOH HOH A . 
D 4 HOH 105 605 605 HOH HOH A . 
D 4 HOH 106 606 606 HOH HOH A . 
E 4 HOH 1   101 101 HOH HOH C . 
E 4 HOH 2   102 102 HOH HOH C . 
E 4 HOH 3   103 103 HOH HOH C . 
E 4 HOH 4   104 104 HOH HOH C . 
E 4 HOH 5   105 105 HOH HOH C . 
E 4 HOH 6   106 106 HOH HOH C . 
E 4 HOH 7   107 107 HOH HOH C . 
E 4 HOH 8   108 108 HOH HOH C . 
E 4 HOH 9   109 109 HOH HOH C . 
E 4 HOH 10  110 110 HOH HOH C . 
E 4 HOH 11  111 111 HOH HOH C . 
E 4 HOH 12  112 112 HOH HOH C . 
E 4 HOH 13  113 113 HOH HOH C . 
E 4 HOH 14  114 114 HOH HOH C . 
E 4 HOH 15  115 115 HOH HOH C . 
E 4 HOH 16  116 116 HOH HOH C . 
E 4 HOH 17  117 117 HOH HOH C . 
E 4 HOH 18  118 118 HOH HOH C . 
E 4 HOH 19  119 119 HOH HOH C . 
E 4 HOH 20  120 120 HOH HOH C . 
E 4 HOH 21  121 121 HOH HOH C . 
E 4 HOH 22  122 122 HOH HOH C . 
E 4 HOH 23  123 123 HOH HOH C . 
E 4 HOH 24  124 124 HOH HOH C . 
E 4 HOH 25  125 125 HOH HOH C . 
E 4 HOH 26  126 126 HOH HOH C . 
E 4 HOH 27  127 127 HOH HOH C . 
E 4 HOH 28  128 128 HOH HOH C . 
E 4 HOH 29  129 129 HOH HOH C . 
E 4 HOH 30  130 130 HOH HOH C . 
E 4 HOH 31  131 131 HOH HOH C . 
E 4 HOH 32  132 132 HOH HOH C . 
E 4 HOH 33  133 133 HOH HOH C . 
F 4 HOH 1   201 201 HOH HOH D . 
F 4 HOH 2   202 202 HOH HOH D . 
F 4 HOH 3   203 203 HOH HOH D . 
F 4 HOH 4   204 204 HOH HOH D . 
F 4 HOH 5   205 205 HOH HOH D . 
F 4 HOH 6   206 206 HOH HOH D . 
F 4 HOH 7   207 207 HOH HOH D . 
F 4 HOH 8   208 208 HOH HOH D . 
F 4 HOH 9   209 209 HOH HOH D . 
F 4 HOH 10  210 210 HOH HOH D . 
F 4 HOH 11  211 211 HOH HOH D . 
F 4 HOH 12  212 212 HOH HOH D . 
F 4 HOH 13  213 213 HOH HOH D . 
F 4 HOH 14  214 214 HOH HOH D . 
F 4 HOH 15  215 215 HOH HOH D . 
F 4 HOH 16  216 216 HOH HOH D . 
F 4 HOH 17  217 217 HOH HOH D . 
F 4 HOH 18  218 218 HOH HOH D . 
F 4 HOH 19  219 219 HOH HOH D . 
F 4 HOH 20  220 220 HOH HOH D . 
F 4 HOH 21  221 221 HOH HOH D . 
F 4 HOH 22  222 222 HOH HOH D . 
F 4 HOH 23  223 223 HOH HOH D . 
F 4 HOH 24  224 224 HOH HOH D . 
F 4 HOH 25  225 225 HOH HOH D . 
F 4 HOH 26  226 226 HOH HOH D . 
F 4 HOH 27  227 227 HOH HOH D . 
F 4 HOH 28  228 228 HOH HOH D . 
F 4 HOH 29  229 229 HOH HOH D . 
F 4 HOH 30  230 230 HOH HOH D . 
F 4 HOH 31  231 231 HOH HOH D . 
F 4 HOH 32  232 232 HOH HOH D . 
F 4 HOH 33  233 233 HOH HOH D . 
F 4 HOH 34  234 234 HOH HOH D . 
F 4 HOH 35  235 235 HOH HOH D . 
F 4 HOH 36  236 236 HOH HOH D . 
F 4 HOH 37  237 237 HOH HOH D . 
F 4 HOH 38  238 238 HOH HOH D . 
F 4 HOH 39  239 239 HOH HOH D . 
F 4 HOH 40  240 240 HOH HOH D . 
F 4 HOH 41  241 241 HOH HOH D . 
F 4 HOH 42  242 242 HOH HOH D . 
F 4 HOH 43  243 243 HOH HOH D . 
F 4 HOH 44  244 244 HOH HOH D . 
F 4 HOH 45  245 245 HOH HOH D . 
F 4 HOH 46  246 246 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6140  ? 
1 MORE         -27   ? 
1 'SSA (A^2)'  17500 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-09-16 
2 'Structure model' 1 1 2015-09-30 
3 'Structure model' 1 2 2015-11-11 
4 'Structure model' 1 3 2017-09-13 
5 'Structure model' 1 4 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' pdbx_audit_support    
3 4 'Structure model' pdbx_struct_oper_list 
4 5 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_pdbx_audit_support.funding_organization'  
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 5 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 28.6568 -12.4548 37.0737 0.4579 0.1910  0.2329 0.0305  -0.0390 0.1141  9.5868  3.4374 9.6659  
3.5335  3.7274  9.4204  0.0213  0.4206  0.9440  -0.2345 0.2831  -0.1405 -0.7212 0.5797  -0.3044 
'X-RAY DIFFRACTION' 2  ? refined 11.8307 -11.4054 24.3755 0.2578 0.0728  0.2062 -0.0312 -0.0192 -0.0418 3.7934  2.7974 4.0453  
-0.0988 1.5269  -0.4402 0.2635  0.1214  -0.4288 0.0926  -0.2224 0.3649  0.4843  0.0646  -0.0411 
'X-RAY DIFFRACTION' 3  ? refined 13.1978 -4.5254  34.0760 0.2523 0.0435  0.1092 -0.0212 0.0011  -0.0080 3.7940  5.7949 2.6263  
-2.4354 0.7074  -0.9943 -0.1499 -0.1899 -0.0239 0.6854  0.0259  0.2829  0.0816  0.0139  0.1240  
'X-RAY DIFFRACTION' 4  ? refined 6.9640  -5.8110  39.4347 0.3624 0.1528  0.1890 -0.0229 0.0959  0.0551  13.5469 6.3907 8.8057  
-1.9185 -0.9909 2.7809  -0.2350 -0.6457 -0.3133 0.3691  0.1603  0.5712  0.4606  -0.2039 0.0747  
'X-RAY DIFFRACTION' 5  ? refined 9.5899  -9.4531  26.9492 0.2853 0.0936  0.2281 -0.0483 0.0202  -0.0396 3.4249  2.9928 5.2321  
-0.4663 -1.0411 -0.7462 -0.0529 0.0218  -0.1898 0.2667  -0.1335 0.5352  0.4251  -0.1890 0.1864  
'X-RAY DIFFRACTION' 6  ? refined 19.4153 -7.3952  12.9549 0.3034 0.2203  0.0192 0.0476  -0.0141 -0.0102 10.8689 6.7444 4.4930  
4.3669  0.7970  -0.5581 0.1768  0.0600  -0.3450 -0.4480 -0.4067 -0.3091 0.4901  0.7733  0.2299  
'X-RAY DIFFRACTION' 7  ? refined 7.5010  0.5603   13.9443 0.2269 0.1060  0.1243 -0.0022 -0.1406 -0.0483 1.8872  5.5736 3.3207  
-1.4484 0.2280  -0.3341 0.0447  0.2654  -0.0303 -0.5813 -0.2292 0.4998  -0.0208 -0.1588 0.1845  
'X-RAY DIFFRACTION' 8  ? refined 8.6485  6.8646   28.3123 0.1483 -0.0031 0.1234 0.0353  -0.0366 -0.0667 3.6692  1.8399 2.7277  
-1.7355 1.3728  -0.8636 -0.1505 -0.1318 -0.0676 0.2428  -0.0340 0.3877  -0.2658 -0.2412 0.1845  
'X-RAY DIFFRACTION' 9  ? refined 28.1257 9.2292   19.4267 0.3864 0.3451  0.1496 -0.1541 -0.0701 0.1407  3.3620  3.4266 14.5585 
1.3770  -2.9488 -4.1232 -0.3050 0.8210  0.3500  -0.7167 0.1943  -0.2702 0.2595  0.4740  0.1107  
'X-RAY DIFFRACTION' 10 ? refined 35.5904 -5.7162  62.1753 0.4783 0.1646  0.1803 -0.0190 -0.2304 0.0243  1.1975  4.4745 15.0205 
0.2974  3.0794  -2.8056 0.2534  -0.1284 -0.0933 0.7695  -0.1634 -0.3104 -0.9310 0.4086  -0.0900 
'X-RAY DIFFRACTION' 11 ? refined 35.7086 -3.4182  57.5504 0.4899 0.1176  0.2172 -0.0179 -0.1579 0.0085  2.2761  3.5270 8.1248  
0.2478  0.1455  -2.4809 0.2606  0.0462  0.0731  0.8483  -0.0945 -0.2829 -0.8591 0.5135  -0.1660 
'X-RAY DIFFRACTION' 12 ? refined 28.6634 9.2171   12.2948 0.5966 0.4593  0.1876 -0.0875 0.0353  0.1632  1.9870  0.0958 11.0460 
1.7257  -3.1768 -2.3664 0.1624  0.3417  0.2071  -0.9689 -0.1581 0.0580  -0.2930 1.2237  -0.0043 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? '{ A|105 - A|116 }' 
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? '{ A|117 - A|142 }' 
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? '{ A|143 - A|169 }' 
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? '{ A|170 - A|176 }' 
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? '{ A|177 - A|198 }' 
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? '{ A|199 - A|216 }' 
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? '{ A|217 - A|269 }' 
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? '{ A|270 - A|300 }' 
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? '{ C|1 - C|16 }'    
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '{ C|17 - C|28 }'   
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? '{ D|1 - D|15 }'    
'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? '{ D|16 - D|28 }'   
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? BUSTER-TNT  ? ? ? 2.10.2 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.5.4  2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15   3 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? Blu-Ice     ? ? ? .      4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .      5 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot        ? ? ? .      6 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .      7 
# 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.entry_id             4Z3A 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;Microheterogeneity at residues 17 in chain D, this structure contains both anomeric forms of the abasic nucleotide, ORP and AAB at 0.5 occupancy.
;
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" C DG 16 ? ? "C3'" C DG  16 ? ? 1.378 1.419 -0.041 0.006 N 
2 1 "O3'" D DC 8  ? ? "C3'" D DC  8  ? ? 1.368 1.419 -0.051 0.006 N 
3 1 "O3'" D DA 16 ? ? P     D AAB 17 ? B 1.489 1.607 -0.118 0.012 Y 
4 1 "O3'" D DT 19 ? ? "C3'" D DT  19 ? ? 1.378 1.419 -0.041 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DG 3  ? ? "C1'" C DG 3  ? ? N9 C DG  3  ? ? 110.36 108.30 2.06 0.30 N 
2 1 "O4'" C DC 4  ? ? "C1'" C DC 4  ? ? N1 C DC  4  ? ? 110.99 108.30 2.69 0.30 N 
3 1 "O4'" C DT 28 ? ? "C1'" C DT 28 ? ? N1 C DT  28 ? ? 110.56 108.30 2.26 0.30 N 
4 1 "O4'" D DC 13 ? ? "C1'" D DC 13 ? ? N1 D DC  13 ? ? 111.64 108.30 3.34 0.30 N 
5 1 "O4'" D DC 15 ? ? "C1'" D DC 15 ? ? N1 D DC  15 ? ? 110.23 108.30 1.93 0.30 N 
6 1 "C3'" D DA 16 ? ? "O3'" D DA 16 ? ? P  D AAB 17 ? B 127.63 119.70 7.93 1.20 Y 
7 1 "O4'" D DG 23 ? ? "C1'" D DG 23 ? ? N9 D DG  23 ? ? 110.75 108.30 2.45 0.30 N 
8 1 "O4'" D DT 27 ? ? "C1'" D DT 27 ? ? N1 D DT  27 ? ? 110.16 108.30 1.86 0.30 N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A MET 108 ? CG  ? A MET 4   CG  
2  1 Y 1 A MET 108 ? SD  ? A MET 4   SD  
3  1 Y 1 A MET 108 ? CE  ? A MET 4   CE  
4  1 Y 1 A LYS 248 ? CG  ? A LYS 144 CG  
5  1 Y 1 A LYS 248 ? CD  ? A LYS 144 CD  
6  1 Y 1 A LYS 248 ? CE  ? A LYS 144 CE  
7  1 Y 1 A LYS 248 ? NZ  ? A LYS 144 NZ  
8  1 Y 1 A ASN 249 ? CG  ? A ASN 145 CG  
9  1 Y 1 A ASN 249 ? OD1 ? A ASN 145 OD1 
10 1 Y 1 A ASN 249 ? ND2 ? A ASN 145 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ILE 302 ? A ILE 198 
2 1 Y 1 A GLU 303 ? A GLU 199 
3 1 Y 1 A ARG 304 ? A ARG 200 
4 1 Y 1 A ASN 305 ? A ASN 201 
5 1 Y 1 A MET 306 ? A MET 202 
6 1 Y 1 A ASP 307 ? A ASP 203 
7 1 Y 1 A VAL 308 ? A VAL 204 
# 
_ndb_struct_conf_na.entry_id   4Z3A 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1  1_555 C DG 28 1_555 0.046  -0.178 0.408  0.302   -6.969  -4.713 1  C_DC1:DG28_D  C 1  ? D 28 ? 19 1 
1 B DA 2  1_555 C DT 27 1_555 -0.059 -0.092 0.155  6.818   -7.551  5.076  2  C_DA2:DT27_D  C 2  ? D 27 ? 20 1 
1 B DG 3  1_555 C DC 26 1_555 -0.499 -0.193 0.224  10.537  -8.794  0.857  3  C_DG3:DC26_D  C 3  ? D 26 ? 19 1 
1 B DC 4  1_555 C DG 25 1_555 0.401  -0.267 0.275  -1.537  -15.402 0.931  4  C_DC4:DG25_D  C 4  ? D 25 ? 19 1 
1 B DT 5  1_555 C DA 24 1_555 0.213  -0.195 -0.115 -0.629  -15.055 -1.633 5  C_DT5:DA24_D  C 5  ? D 24 ? 20 1 
1 B DC 6  1_555 C DG 23 1_555 0.011  -0.249 0.182  -8.110  -8.770  -2.134 6  C_DC6:DG23_D  C 6  ? D 23 ? 19 1 
1 B DT 7  1_555 C DA 22 1_555 0.003  -0.197 -0.113 -3.133  -10.063 -3.681 7  C_DT7:DA22_D  C 7  ? D 22 ? 20 1 
1 B DG 8  1_555 C DC 21 1_555 -0.478 -0.256 -0.188 -8.437  -4.919  -1.370 8  C_DG8:DC21_D  C 8  ? D 21 ? 19 1 
1 B DT 9  1_555 C DA 20 1_555 -0.217 -0.137 -0.056 -0.339  -7.538  0.120  9  C_DT9:DA20_D  C 9  ? D 20 ? 20 1 
1 B DA 10 1_555 C DT 19 1_555 0.072  -0.064 0.137  6.635   -10.294 3.138  10 C_DA10:DT19_D C 10 ? D 19 ? 20 1 
1 B DC 11 1_555 C DG 18 1_555 0.438  -0.180 -0.337 14.282  -13.578 0.040  11 C_DC11:DG18_D C 11 ? D 18 ? 19 1 
1 B DT 13 1_555 C DA 16 1_555 -0.269 -0.033 -0.043 -13.003 -12.057 2.646  12 C_DT13:DA16_D C 13 ? D 16 ? 20 1 
1 B DG 14 1_555 C DC 15 1_555 -0.242 -0.203 -0.291 -4.362  -5.036  -0.278 13 C_DG14:DC15_D C 14 ? D 15 ? 19 1 
1 B DA 15 1_555 C DT 14 1_555 0.069  -0.210 -0.057 2.143   -8.477  1.379  14 C_DA15:DT14_D C 15 ? D 14 ? 20 1 
1 B DG 16 1_555 C DC 13 1_555 -0.067 -0.058 0.252  9.081   -9.921  3.681  15 C_DG16:DC13_D C 16 ? D 13 ? 19 1 
1 B DC 17 1_555 C DG 12 1_555 0.282  -0.300 0.055  0.397   -16.240 -0.290 16 C_DC17:DG12_D C 17 ? D 12 ? 19 1 
1 B DG 18 1_555 C DC 11 1_555 -0.313 -0.217 -0.194 -1.600  -8.371  -2.152 17 C_DG18:DC11_D C 18 ? D 11 ? 19 1 
1 B DA 19 1_555 C DT 10 1_555 0.016  -0.138 -0.068 -2.968  -12.439 2.450  18 C_DA19:DT10_D C 19 ? D 10 ? 20 1 
1 B DT 20 1_555 C DA 9  1_555 -0.051 -0.145 0.013  -1.434  -12.865 1.429  19 C_DT20:DA9_D  C 20 ? D 9  ? 20 1 
1 B DG 21 1_555 C DC 8  1_555 -0.238 -0.270 0.037  -1.948  -7.528  -1.363 20 C_DG21:DC8_D  C 21 ? D 8  ? 19 1 
1 B DG 22 1_555 C DC 7  1_555 -0.257 -0.226 -0.156 -4.655  -11.330 -0.329 21 C_DG22:DC7_D  C 22 ? D 7  ? 19 1 
1 B DA 23 1_555 C DT 6  1_555 0.274  -0.156 0.069  -2.398  -7.292  -3.590 22 C_DA23:DT6_D  C 23 ? D 6  ? 20 1 
1 B DC 24 1_555 C DG 5  1_555 0.250  -0.272 -0.095 6.209   -5.506  -1.956 23 C_DC24:DG5_D  C 24 ? D 5  ? 19 1 
1 B DA 25 1_555 C DT 4  1_555 -0.210 -0.231 -0.023 6.277   -8.250  -3.890 24 C_DA25:DT4_D  C 25 ? D 4  ? 20 1 
1 B DG 26 1_555 C DC 3  1_555 -0.225 -0.154 0.110  6.525   -8.785  -0.470 25 C_DG26:DC3_D  C 26 ? D 3  ? 19 1 
1 B DC 27 1_555 C DG 2  1_555 0.417  -0.245 0.275  -0.059  -12.814 -2.669 26 C_DC27:DG2_D  C 27 ? D 2  ? 19 1 
1 B DT 28 1_555 C DA 1  1_555 -0.078 -0.291 0.347  -5.088  -18.018 3.065  27 C_DT28:DA1_D  C 28 ? D 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1  1_555 C DG 28 1_555 B DA 2  1_555 C DT 27 1_555 0.694  0.139  3.108 5.796  -0.353 39.163 0.245  -0.368 3.173 -0.524 
-8.589 39.574 1  CC_DC1DA2:DT27DG28_DD   C 1  ? D 28 ? C 2  ? D 27 ? 
1 B DA 2  1_555 C DT 27 1_555 B DG 3  1_555 C DC 26 1_555 -0.109 -0.157 3.252 -2.475 4.315  26.839 -1.400 -0.380 3.185 9.197  
5.274  27.287 2  CC_DA2DG3:DC26DT27_DD   C 2  ? D 27 ? C 3  ? D 26 ? 
1 B DG 3  1_555 C DC 26 1_555 B DC 4  1_555 C DG 25 1_555 0.025  -0.554 3.510 -0.779 -0.093 41.042 -0.779 -0.126 3.510 -0.132 
1.110  41.049 3  CC_DG3DC4:DG25DC26_DD   C 3  ? D 26 ? C 4  ? D 25 ? 
1 B DC 4  1_555 C DG 25 1_555 B DT 5  1_555 C DA 24 1_555 -0.368 -0.352 3.188 4.672  6.141  34.022 -1.481 1.294  3.006 10.332 
-7.860 34.861 4  CC_DC4DT5:DA24DG25_DD   C 4  ? D 25 ? C 5  ? D 24 ? 
1 B DT 5  1_555 C DA 24 1_555 B DC 6  1_555 C DG 23 1_555 0.351  0.042  3.405 -1.045 4.752  39.092 -0.524 -0.650 3.376 7.069  
1.554  39.382 5  CC_DT5DC6:DG23DA24_DD   C 5  ? D 24 ? C 6  ? D 23 ? 
1 B DC 6  1_555 C DG 23 1_555 B DT 7  1_555 C DA 22 1_555 -0.366 0.091  3.144 2.246  3.179  30.355 -0.430 1.120  3.102 6.039  
-4.268 30.597 6  CC_DC6DT7:DA22DG23_DD   C 6  ? D 23 ? C 7  ? D 22 ? 
1 B DT 7  1_555 C DA 22 1_555 B DG 8  1_555 C DC 21 1_555 0.487  0.655  3.427 -0.189 5.933  38.215 0.213  -0.761 3.483 8.996  
0.287  38.657 7  CC_DT7DG8:DC21DA22_DD   C 7  ? D 22 ? C 8  ? D 21 ? 
1 B DG 8  1_555 C DC 21 1_555 B DT 9  1_555 C DA 20 1_555 -0.234 -0.216 3.120 -0.688 3.769  28.584 -1.232 0.325  3.072 7.591  
1.385  28.834 8  CC_DG8DT9:DA20DC21_DD   C 8  ? D 21 ? C 9  ? D 20 ? 
1 B DT 9  1_555 C DA 20 1_555 B DA 10 1_555 C DT 19 1_555 -0.087 0.706  3.156 -2.243 3.673  39.461 0.622  -0.128 3.206 5.420  
3.310  39.686 9  CC_DT9DA10:DT19DA20_DD  C 9  ? D 20 ? C 10 ? D 19 ? 
1 B DA 10 1_555 C DT 19 1_555 B DC 11 1_555 C DG 18 1_555 0.060  0.046  3.075 4.472  -3.224 32.982 0.581  0.591  3.039 -5.630 
-7.809 33.427 10 CC_DA10DC11:DG18DT19_DD C 10 ? D 19 ? C 11 ? D 18 ? 
1 B DT 13 1_555 C DA 16 1_555 B DG 14 1_555 C DC 15 1_555 0.747  1.545  3.184 1.298  5.122  37.099 1.728  -0.992 3.383 8.000  
-2.028 37.460 11 CC_DT13DG14:DC15DA16_DD C 13 ? D 16 ? C 14 ? D 15 ? 
1 B DG 14 1_555 C DC 15 1_555 B DA 15 1_555 C DT 14 1_555 -0.802 0.481  3.165 -4.997 5.500  35.394 0.002  0.590  3.280 8.925  
8.109  36.141 12 CC_DG14DA15:DT14DC15_DD C 14 ? D 15 ? C 15 ? D 14 ? 
1 B DA 15 1_555 C DT 14 1_555 B DG 16 1_555 C DC 13 1_555 0.585  -0.170 3.178 -2.673 4.377  31.902 -1.050 -1.508 3.070 7.899  
4.825  32.301 13 CC_DA15DG16:DC13DT14_DD C 15 ? D 14 ? C 16 ? D 13 ? 
1 B DG 16 1_555 C DC 13 1_555 B DC 17 1_555 C DG 12 1_555 -1.145 -0.188 3.352 -0.727 -0.528 37.605 -0.222 1.678  3.375 -0.819 
1.128  37.615 14 CC_DG16DC17:DG12DC13_DD C 16 ? D 13 ? C 17 ? D 12 ? 
1 B DC 17 1_555 C DG 12 1_555 B DG 18 1_555 C DC 11 1_555 -0.092 0.655  3.407 3.502  10.321 32.793 -0.612 0.737  3.424 17.683 
-6.000 34.510 15 CC_DC17DG18:DC11DG12_DD C 17 ? D 12 ? C 18 ? D 11 ? 
1 B DG 18 1_555 C DC 11 1_555 B DA 19 1_555 C DT 10 1_555 0.095  -0.085 3.231 -2.143 6.134  39.598 -0.814 -0.380 3.174 8.981  
3.137  40.107 16 CC_DG18DA19:DT10DC11_DD C 18 ? D 11 ? C 19 ? D 10 ? 
1 B DA 19 1_555 C DT 10 1_555 B DT 20 1_555 C DA 9  1_555 -0.292 -0.533 3.210 -0.412 -0.034 28.752 -1.066 0.497  3.214 -0.069 
0.829  28.754 17 CC_DA19DT20:DA9DT10_DD  C 19 ? D 10 ? C 20 ? D 9  ? 
1 B DT 20 1_555 C DA 9  1_555 B DG 21 1_555 C DC 8  1_555 0.727  0.756  3.320 1.292  3.989  35.185 0.638  -0.999 3.407 6.569  
-2.128 35.426 18 CC_DT20DG21:DC8DA9_DD   C 20 ? D 9  ? C 21 ? D 8  ? 
1 B DG 21 1_555 C DC 8  1_555 B DG 22 1_555 C DC 7  1_555 -0.922 0.595  3.346 -2.428 4.092  36.825 0.366  1.110  3.441 6.445  
3.824  37.120 19 CC_DG21DG22:DC7DC8_DD   C 21 ? D 8  ? C 22 ? D 7  ? 
1 B DG 22 1_555 C DC 7  1_555 B DA 23 1_555 C DT 6  1_555 -0.408 0.018  3.233 -3.872 0.353  37.717 -0.017 0.135  3.257 0.545  
5.969  37.909 20 CC_DG22DA23:DT6DC7_DD   C 22 ? D 7  ? C 23 ? D 6  ? 
1 B DA 23 1_555 C DT 6  1_555 B DC 24 1_555 C DG 5  1_555 0.877  -0.368 3.139 1.184  0.836  30.759 -0.851 -1.429 3.159 1.575  
-2.231 30.793 21 CC_DA23DC24:DG5DT6_DD   C 23 ? D 6  ? C 24 ? D 5  ? 
1 B DC 24 1_555 C DG 5  1_555 B DA 25 1_555 C DT 4  1_555 -0.296 0.509  3.364 0.905  5.243  35.180 0.039  0.622  3.394 8.613  
-1.487 35.567 22 CC_DC24DA25:DT4DG5_DD   C 24 ? D 5  ? C 25 ? D 4  ? 
1 B DA 25 1_555 C DT 4  1_555 B DG 26 1_555 C DC 3  1_555 -0.348 -0.212 3.307 -3.910 5.834  33.792 -1.274 -0.027 3.245 9.903  
6.637  34.493 23 CC_DA25DG26:DC3DT4_DD   C 25 ? D 4  ? C 26 ? D 3  ? 
1 B DG 26 1_555 C DC 3  1_555 B DC 27 1_555 C DG 2  1_555 0.053  -0.506 3.440 -1.270 3.338  32.539 -1.500 -0.323 3.369 5.935  
2.258  32.729 24 CC_DG26DC27:DG2DC3_DD   C 26 ? D 3  ? C 27 ? D 2  ? 
1 B DC 27 1_555 C DG 2  1_555 B DT 28 1_555 C DA 1  1_555 0.134  -0.420 3.377 2.140  5.026  33.585 -1.541 0.121  3.284 8.626  
-3.673 34.013 25 CC_DC27DT28:DA1DG2_DD   C 27 ? D 2  ? C 28 ? D 1  ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           R01-GM72711 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#