data_4Z4Q
# 
_entry.id   4Z4Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4Z4Q         
WWPDB D_1000208523 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'Quinolone(Trovafloxacin)-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'             4KOE unspecified 
PDB 'Quinolone-stabilized cleavage complex of topoisomerase IV from Klebsiella pneumoniae'                  4PXP unspecified 
PDB 'Quinolone(Clinafloxacin)-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'             3RAD unspecified 
PDB 'Quinolone(Levofloxacin)-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'              3RAE unspecified 
PDB 'Quinazolinedione-DNA cleavage complex of type IV topoisomerase from S. pneumoniae'                     3RAF unspecified 
PDB 'Detailed structural insight into the DNA cleavage complex of type IIA topoisomerases (re-sealed form)' 3KSB unspecified 
PDB 'Detailed structural insight into the DNA cleavage complex of type IIA topoisomerases (cleaved form)'   3KSA unspecified 
PDB 'A three-gate structure of topoisomerase IV from Streptococcus pneumoniae'                              4I3H unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4Z4Q 
_pdbx_database_status.recvd_initial_deposition_date   2015-04-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Laponogov, I.'   1 
'Veselkov, D.A.'  2 
'Pan, X.-S.'      3 
'Selvarajah, J.'  4 
'Crevel, I.M.-T.' 5 
'Fisher, L.M.'    6 
'Sanderson, M.R.' 7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Structural studies of the drug-stabilized cleavage complexes of topoisomerase IV and gyrase from Streptococcus pneumoniae' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Laponogov, I.'   1 
primary 'Veselkov, D.A.'  2 
primary 'Pan, X.-S.'      3 
primary 'Selvarajah, J.'  4 
primary 'Crevel, I.M.-T.' 5 
primary 'Fisher, L.M.'    6 
primary 'Sanderson, M.R.' 7 
# 
_cell.entry_id           4Z4Q 
_cell.length_a           158.020 
_cell.length_b           158.020 
_cell.length_c           211.220 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4Z4Q 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA topoisomerase 4 subunit B,DNA topoisomerase 4 subunit A' 84211.422 2 5.99.1.3,5.99.1.3 ? ? ? 
2 polymer     syn 'V-site DNA' 2121.436  1 ?                 ? ? ? 
3 polymer     syn 'V-site DNA' 3317.199  1 ?                 ? ? ? 
4 polymer     syn 'V-site DNA' 2168.445  1 ?                 ? ? ? 
5 polymer     syn 'V-site DNA' 3333.198  1 ?                 ? ? ? 
6 non-polymer syn 'MAGNESIUM ION' 24.305    4 ?                 ? ? ? 
7 non-polymer syn 
'3-amino-7-{(3R)-3-[(1S)-1-aminoethyl]pyrrolidin-1-yl}-1-cyclopropyl-6-fluoro-8-methylquinazoline-2,4(1H,3H)-dione' 361.414   2 ? 
? ? ? 
8 water       nat water 18.015    8 ?                 ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Topoisomerase IV subunit B,Topoisomerase IV subunit A' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYT
IGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKGKGKKEEVAYAWTDG
ELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFTLE
EATVFHMSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFH
PHGDSSIYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTV
LPAAFPNLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKG
RVVVRSKTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNY
LFKYTDLQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRA
SENKADAKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKF
ATPRLSSLEDTAKALEHHHHHH
;
;MKNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVINTAKAKMADILKNEEINTMIYT
IGAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKGKGKKEEVAYAWTDG
ELEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFTLE
EATVFHMSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFH
PHGDSSIYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTV
LPAAFPNLLVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKG
RVVVRSKTEIEKLKGGKEQIVITEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNY
LFKYTDLQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRA
SENKADAKENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKF
ATPRLSSLEDTAKALEHHHHHH
;
A,B ? 
2 polydeoxyribonucleotide no no '(DG)(DT)(DA)(DA)(DT)(DA)(DC)' GTAATAC E   ? 
3 polydeoxyribonucleotide no no '(DA)(DA)(DC)(DC)(DG)(DT)(DA)(DT)(DT)(DA)(DC)' AACCGTATTAC F   ? 
4 polydeoxyribonucleotide no no '(DT)(DG)(DT)(DG)(DG)(DA)(DT)' TGTGGAT G   ? 
5 polydeoxyribonucleotide no no '(DG)(DG)(DT)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DA)' GGTTATCCACA H   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   ASN n 
1 4   LYS n 
1 5   LYS n 
1 6   ASP n 
1 7   LYS n 
1 8   GLY n 
1 9   LEU n 
1 10  LEU n 
1 11  SER n 
1 12  GLY n 
1 13  LYS n 
1 14  LEU n 
1 15  THR n 
1 16  PRO n 
1 17  ALA n 
1 18  GLN n 
1 19  SER n 
1 20  LYS n 
1 21  ASN n 
1 22  PRO n 
1 23  ALA n 
1 24  LYS n 
1 25  ASN n 
1 26  GLU n 
1 27  LEU n 
1 28  TYR n 
1 29  LEU n 
1 30  VAL n 
1 31  GLU n 
1 32  GLY n 
1 33  ASP n 
1 34  SER n 
1 35  ALA n 
1 36  GLY n 
1 37  GLY n 
1 38  SER n 
1 39  ALA n 
1 40  LYS n 
1 41  GLN n 
1 42  GLY n 
1 43  ARG n 
1 44  ASP n 
1 45  ARG n 
1 46  LYS n 
1 47  PHE n 
1 48  GLN n 
1 49  ALA n 
1 50  ILE n 
1 51  LEU n 
1 52  PRO n 
1 53  LEU n 
1 54  ARG n 
1 55  GLY n 
1 56  LYS n 
1 57  VAL n 
1 58  ILE n 
1 59  ASN n 
1 60  THR n 
1 61  ALA n 
1 62  LYS n 
1 63  ALA n 
1 64  LYS n 
1 65  MET n 
1 66  ALA n 
1 67  ASP n 
1 68  ILE n 
1 69  LEU n 
1 70  LYS n 
1 71  ASN n 
1 72  GLU n 
1 73  GLU n 
1 74  ILE n 
1 75  ASN n 
1 76  THR n 
1 77  MET n 
1 78  ILE n 
1 79  TYR n 
1 80  THR n 
1 81  ILE n 
1 82  GLY n 
1 83  ALA n 
1 84  GLY n 
1 85  VAL n 
1 86  GLY n 
1 87  ALA n 
1 88  ASP n 
1 89  PHE n 
1 90  SER n 
1 91  ILE n 
1 92  GLU n 
1 93  ASP n 
1 94  ALA n 
1 95  ASN n 
1 96  TYR n 
1 97  ASP n 
1 98  LYS n 
1 99  ILE n 
1 100 ILE n 
1 101 ILE n 
1 102 MET n 
1 103 THR n 
1 104 ASP n 
1 105 ALA n 
1 106 ASP n 
1 107 THR n 
1 108 ASP n 
1 109 GLY n 
1 110 ALA n 
1 111 HIS n 
1 112 ILE n 
1 113 GLN n 
1 114 THR n 
1 115 LEU n 
1 116 LEU n 
1 117 LEU n 
1 118 THR n 
1 119 PHE n 
1 120 PHE n 
1 121 TYR n 
1 122 ARG n 
1 123 TYR n 
1 124 MET n 
1 125 ARG n 
1 126 PRO n 
1 127 LEU n 
1 128 VAL n 
1 129 GLU n 
1 130 ALA n 
1 131 GLY n 
1 132 HIS n 
1 133 VAL n 
1 134 TYR n 
1 135 ILE n 
1 136 ALA n 
1 137 LEU n 
1 138 PRO n 
1 139 PRO n 
1 140 LEU n 
1 141 TYR n 
1 142 LYS n 
1 143 MET n 
1 144 SER n 
1 145 LYS n 
1 146 GLY n 
1 147 LYS n 
1 148 GLY n 
1 149 LYS n 
1 150 LYS n 
1 151 GLU n 
1 152 GLU n 
1 153 VAL n 
1 154 ALA n 
1 155 TYR n 
1 156 ALA n 
1 157 TRP n 
1 158 THR n 
1 159 ASP n 
1 160 GLY n 
1 161 GLU n 
1 162 LEU n 
1 163 GLU n 
1 164 GLU n 
1 165 LEU n 
1 166 ARG n 
1 167 LYS n 
1 168 GLN n 
1 169 PHE n 
1 170 GLY n 
1 171 LYS n 
1 172 GLY n 
1 173 ALA n 
1 174 THR n 
1 175 LEU n 
1 176 GLN n 
1 177 ARG n 
1 178 TYR n 
1 179 LYS n 
1 180 GLY n 
1 181 LEU n 
1 182 GLY n 
1 183 GLU n 
1 184 MET n 
1 185 ASN n 
1 186 ALA n 
1 187 ASP n 
1 188 GLN n 
1 189 LEU n 
1 190 TRP n 
1 191 GLU n 
1 192 THR n 
1 193 THR n 
1 194 MET n 
1 195 ASN n 
1 196 PRO n 
1 197 GLU n 
1 198 THR n 
1 199 ARG n 
1 200 THR n 
1 201 LEU n 
1 202 ILE n 
1 203 ARG n 
1 204 VAL n 
1 205 THR n 
1 206 ILE n 
1 207 GLU n 
1 208 ASP n 
1 209 LEU n 
1 210 ALA n 
1 211 ARG n 
1 212 ALA n 
1 213 GLU n 
1 214 ARG n 
1 215 ARG n 
1 216 VAL n 
1 217 ASN n 
1 218 VAL n 
1 219 LEU n 
1 220 MET n 
1 221 GLY n 
1 222 ASP n 
1 223 LYS n 
1 224 VAL n 
1 225 GLU n 
1 226 PRO n 
1 227 ARG n 
1 228 ARG n 
1 229 LYS n 
1 230 TRP n 
1 231 ILE n 
1 232 GLU n 
1 233 ASP n 
1 234 ASN n 
1 235 VAL n 
1 236 LYS n 
1 237 PHE n 
1 238 THR n 
1 239 LEU n 
1 240 GLU n 
1 241 GLU n 
1 242 ALA n 
1 243 THR n 
1 244 VAL n 
1 245 PHE n 
1 246 HIS n 
1 247 MET n 
1 248 SER n 
1 249 ASN n 
1 250 ILE n 
1 251 GLN n 
1 252 ASN n 
1 253 MET n 
1 254 SER n 
1 255 LEU n 
1 256 GLU n 
1 257 ASP n 
1 258 ILE n 
1 259 MET n 
1 260 GLY n 
1 261 GLU n 
1 262 ARG n 
1 263 PHE n 
1 264 GLY n 
1 265 ARG n 
1 266 TYR n 
1 267 SER n 
1 268 LYS n 
1 269 TYR n 
1 270 ILE n 
1 271 ILE n 
1 272 GLN n 
1 273 ASP n 
1 274 ARG n 
1 275 ALA n 
1 276 LEU n 
1 277 PRO n 
1 278 ASP n 
1 279 ILE n 
1 280 ARG n 
1 281 ASP n 
1 282 GLY n 
1 283 LEU n 
1 284 LYS n 
1 285 PRO n 
1 286 VAL n 
1 287 GLN n 
1 288 ARG n 
1 289 ARG n 
1 290 ILE n 
1 291 LEU n 
1 292 TYR n 
1 293 SER n 
1 294 MET n 
1 295 ASN n 
1 296 LYS n 
1 297 ASP n 
1 298 SER n 
1 299 ASN n 
1 300 THR n 
1 301 PHE n 
1 302 ASP n 
1 303 LYS n 
1 304 SER n 
1 305 TYR n 
1 306 ARG n 
1 307 LYS n 
1 308 SER n 
1 309 ALA n 
1 310 LYS n 
1 311 SER n 
1 312 VAL n 
1 313 GLY n 
1 314 ASN n 
1 315 ILE n 
1 316 MET n 
1 317 GLY n 
1 318 ASN n 
1 319 PHE n 
1 320 HIS n 
1 321 PRO n 
1 322 HIS n 
1 323 GLY n 
1 324 ASP n 
1 325 SER n 
1 326 SER n 
1 327 ILE n 
1 328 TYR n 
1 329 ASP n 
1 330 ALA n 
1 331 MET n 
1 332 VAL n 
1 333 ARG n 
1 334 MET n 
1 335 SER n 
1 336 GLN n 
1 337 ASN n 
1 338 TRP n 
1 339 LYS n 
1 340 ASN n 
1 341 ARG n 
1 342 GLU n 
1 343 ILE n 
1 344 LEU n 
1 345 VAL n 
1 346 GLU n 
1 347 MET n 
1 348 HIS n 
1 349 GLY n 
1 350 ASN n 
1 351 ASN n 
1 352 GLY n 
1 353 SER n 
1 354 MET n 
1 355 ASP n 
1 356 GLY n 
1 357 ASP n 
1 358 PRO n 
1 359 PRO n 
1 360 ALA n 
1 361 ALA n 
1 362 MET n 
1 363 ARG n 
1 364 TYR n 
1 365 THR n 
1 366 GLU n 
1 367 ALA n 
1 368 ARG n 
1 369 LEU n 
1 370 SER n 
1 371 GLU n 
1 372 ILE n 
1 373 ALA n 
1 374 GLY n 
1 375 TYR n 
1 376 LEU n 
1 377 LEU n 
1 378 GLN n 
1 379 ASP n 
1 380 ILE n 
1 381 GLU n 
1 382 LYS n 
1 383 LYS n 
1 384 THR n 
1 385 VAL n 
1 386 PRO n 
1 387 PHE n 
1 388 ALA n 
1 389 TRP n 
1 390 ASN n 
1 391 PHE n 
1 392 ASP n 
1 393 ASP n 
1 394 THR n 
1 395 GLU n 
1 396 LYS n 
1 397 GLU n 
1 398 PRO n 
1 399 THR n 
1 400 VAL n 
1 401 LEU n 
1 402 PRO n 
1 403 ALA n 
1 404 ALA n 
1 405 PHE n 
1 406 PRO n 
1 407 ASN n 
1 408 LEU n 
1 409 LEU n 
1 410 VAL n 
1 411 ASN n 
1 412 GLY n 
1 413 SER n 
1 414 THR n 
1 415 GLY n 
1 416 ILE n 
1 417 SER n 
1 418 ALA n 
1 419 GLY n 
1 420 TYR n 
1 421 ALA n 
1 422 THR n 
1 423 ASP n 
1 424 ILE n 
1 425 PRO n 
1 426 PRO n 
1 427 HIS n 
1 428 ASN n 
1 429 LEU n 
1 430 ALA n 
1 431 GLU n 
1 432 VAL n 
1 433 ILE n 
1 434 ASP n 
1 435 ALA n 
1 436 ALA n 
1 437 VAL n 
1 438 TYR n 
1 439 MET n 
1 440 ILE n 
1 441 ASP n 
1 442 HIS n 
1 443 PRO n 
1 444 THR n 
1 445 ALA n 
1 446 LYS n 
1 447 ILE n 
1 448 ASP n 
1 449 LYS n 
1 450 LEU n 
1 451 MET n 
1 452 GLU n 
1 453 PHE n 
1 454 LEU n 
1 455 PRO n 
1 456 GLY n 
1 457 PRO n 
1 458 ASP n 
1 459 PHE n 
1 460 PRO n 
1 461 THR n 
1 462 GLY n 
1 463 ALA n 
1 464 ILE n 
1 465 ILE n 
1 466 GLN n 
1 467 GLY n 
1 468 ARG n 
1 469 ASP n 
1 470 GLU n 
1 471 ILE n 
1 472 LYS n 
1 473 LYS n 
1 474 ALA n 
1 475 TYR n 
1 476 GLU n 
1 477 THR n 
1 478 GLY n 
1 479 LYS n 
1 480 GLY n 
1 481 ARG n 
1 482 VAL n 
1 483 VAL n 
1 484 VAL n 
1 485 ARG n 
1 486 SER n 
1 487 LYS n 
1 488 THR n 
1 489 GLU n 
1 490 ILE n 
1 491 GLU n 
1 492 LYS n 
1 493 LEU n 
1 494 LYS n 
1 495 GLY n 
1 496 GLY n 
1 497 LYS n 
1 498 GLU n 
1 499 GLN n 
1 500 ILE n 
1 501 VAL n 
1 502 ILE n 
1 503 THR n 
1 504 GLU n 
1 505 ILE n 
1 506 PRO n 
1 507 TYR n 
1 508 GLU n 
1 509 ILE n 
1 510 ASN n 
1 511 LYS n 
1 512 ALA n 
1 513 ASN n 
1 514 LEU n 
1 515 VAL n 
1 516 LYS n 
1 517 LYS n 
1 518 ILE n 
1 519 ASP n 
1 520 ASP n 
1 521 VAL n 
1 522 ARG n 
1 523 VAL n 
1 524 ASN n 
1 525 ASN n 
1 526 LYS n 
1 527 VAL n 
1 528 ALA n 
1 529 GLY n 
1 530 ILE n 
1 531 ALA n 
1 532 GLU n 
1 533 VAL n 
1 534 ARG n 
1 535 ASP n 
1 536 GLU n 
1 537 SER n 
1 538 ASP n 
1 539 ARG n 
1 540 ASP n 
1 541 GLY n 
1 542 LEU n 
1 543 ARG n 
1 544 ILE n 
1 545 ALA n 
1 546 ILE n 
1 547 GLU n 
1 548 LEU n 
1 549 LYS n 
1 550 LYS n 
1 551 ASP n 
1 552 ALA n 
1 553 ASN n 
1 554 THR n 
1 555 GLU n 
1 556 LEU n 
1 557 VAL n 
1 558 LEU n 
1 559 ASN n 
1 560 TYR n 
1 561 LEU n 
1 562 PHE n 
1 563 LYS n 
1 564 TYR n 
1 565 THR n 
1 566 ASP n 
1 567 LEU n 
1 568 GLN n 
1 569 ILE n 
1 570 ASN n 
1 571 TYR n 
1 572 ASN n 
1 573 PHE n 
1 574 ASN n 
1 575 MET n 
1 576 VAL n 
1 577 ALA n 
1 578 ILE n 
1 579 ASP n 
1 580 ASN n 
1 581 PHE n 
1 582 THR n 
1 583 PRO n 
1 584 ARG n 
1 585 GLN n 
1 586 VAL n 
1 587 GLY n 
1 588 ILE n 
1 589 VAL n 
1 590 PRO n 
1 591 ILE n 
1 592 LEU n 
1 593 SER n 
1 594 SER n 
1 595 TYR n 
1 596 ILE n 
1 597 ALA n 
1 598 HIS n 
1 599 ARG n 
1 600 ARG n 
1 601 GLU n 
1 602 VAL n 
1 603 ILE n 
1 604 LEU n 
1 605 ALA n 
1 606 ARG n 
1 607 SER n 
1 608 ARG n 
1 609 PHE n 
1 610 ASP n 
1 611 LYS n 
1 612 GLU n 
1 613 LYS n 
1 614 ALA n 
1 615 GLU n 
1 616 LYS n 
1 617 ARG n 
1 618 LEU n 
1 619 HIS n 
1 620 ILE n 
1 621 VAL n 
1 622 GLU n 
1 623 GLY n 
1 624 LEU n 
1 625 ILE n 
1 626 ARG n 
1 627 VAL n 
1 628 ILE n 
1 629 SER n 
1 630 ILE n 
1 631 LEU n 
1 632 ASP n 
1 633 GLU n 
1 634 VAL n 
1 635 ILE n 
1 636 ALA n 
1 637 LEU n 
1 638 ILE n 
1 639 ARG n 
1 640 ALA n 
1 641 SER n 
1 642 GLU n 
1 643 ASN n 
1 644 LYS n 
1 645 ALA n 
1 646 ASP n 
1 647 ALA n 
1 648 LYS n 
1 649 GLU n 
1 650 ASN n 
1 651 LEU n 
1 652 LYS n 
1 653 VAL n 
1 654 SER n 
1 655 TYR n 
1 656 ASP n 
1 657 PHE n 
1 658 THR n 
1 659 GLU n 
1 660 GLU n 
1 661 GLN n 
1 662 ALA n 
1 663 GLU n 
1 664 ALA n 
1 665 ILE n 
1 666 VAL n 
1 667 THR n 
1 668 LEU n 
1 669 GLN n 
1 670 LEU n 
1 671 TYR n 
1 672 ARG n 
1 673 LEU n 
1 674 THR n 
1 675 ASN n 
1 676 THR n 
1 677 ASP n 
1 678 VAL n 
1 679 VAL n 
1 680 VAL n 
1 681 LEU n 
1 682 GLN n 
1 683 GLU n 
1 684 GLU n 
1 685 GLU n 
1 686 ALA n 
1 687 GLU n 
1 688 LEU n 
1 689 ARG n 
1 690 GLU n 
1 691 LYS n 
1 692 ILE n 
1 693 ALA n 
1 694 MET n 
1 695 LEU n 
1 696 ALA n 
1 697 ALA n 
1 698 ILE n 
1 699 ILE n 
1 700 GLY n 
1 701 ASP n 
1 702 GLU n 
1 703 ARG n 
1 704 THR n 
1 705 MET n 
1 706 TYR n 
1 707 ASN n 
1 708 LEU n 
1 709 MET n 
1 710 LYS n 
1 711 LYS n 
1 712 GLU n 
1 713 LEU n 
1 714 ARG n 
1 715 GLU n 
1 716 VAL n 
1 717 LYS n 
1 718 LYS n 
1 719 LYS n 
1 720 PHE n 
1 721 ALA n 
1 722 THR n 
1 723 PRO n 
1 724 ARG n 
1 725 LEU n 
1 726 SER n 
1 727 SER n 
1 728 LEU n 
1 729 GLU n 
1 730 ASP n 
1 731 THR n 
1 732 ALA n 
1 733 LYS n 
1 734 ALA n 
1 735 LEU n 
1 736 GLU n 
1 737 HIS n 
1 738 HIS n 
1 739 HIS n 
1 740 HIS n 
1 741 HIS n 
1 742 HIS n 
2 1   DG  n 
2 2   DT  n 
2 3   DA  n 
2 4   DA  n 
2 5   DT  n 
2 6   DA  n 
2 7   DC  n 
3 1   DA  n 
3 2   DA  n 
3 3   DC  n 
3 4   DC  n 
3 5   DG  n 
3 6   DT  n 
3 7   DA  n 
3 8   DT  n 
3 9   DT  n 
3 10  DA  n 
3 11  DC  n 
4 1   DT  n 
4 2   DG  n 
4 3   DT  n 
4 4   DG  n 
4 5   DG  n 
4 6   DA  n 
4 7   DT  n 
5 1   DG  n 
5 2   DG  n 
5 3   DT  n 
5 4   DT  n 
5 5   DA  n 
5 6   DT  n 
5 7   DC  n 
5 8   DC  n 
5 9   DA  n 
5 10  DC  n 
5 11  DA  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 2   241 ? ? 'parE, SP_0852' ? 'ATCC BAA-334 / TIGR4' ? ? ? ? 
'Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)' 170187 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 249 730 ? ? 'parC, SP_0855' ? 'ATCC BAA-334 / TIGR4' ? ? ? ? 
'Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)' 170187 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 7  'pBR322 based IG-lambda expression vector' ? 588180 ? 
3 1 sample 1 11 'pBR322 based IG-lambda expression vector' ? 588180 ? 
4 1 sample 1 7  'pBR322 based IG-lambda expression vector' ? 588180 ? 
5 1 sample 1 11 'pBR322 based IG-lambda expression vector' ? 588180 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PARE_STRPN Q59961 ? 1 
;KNKKDKGLLSGKLTPAQSKNPAKNELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVVNTAKAKMADILKNEEINTMIYTI
GAGVGADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALPPLYKMSKGKGKKEEVAYAWTDGE
LEELRKQFGKGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIEDNVKFTLEE

;
404 
2 UNP PARC_STRPN P72525 ? 1 
;NIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYRKSAKSVGNIMGNFHPHGDSSIY
DAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTEARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFPNL
LVNGSTGISAGYATDIPPHNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRSKT
EIEKLKGGKEQIVIIEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAIELKKDANTELVLNYLFKYTDLQ
INYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILARSRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKADAK
ENLKVSYDFTEEQAEAIVTLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLSSL
ED
;
3   
3 PDB 4Z4Q       4Z4Q   ? 2 ? 1   
4 PDB 4Z4Q       4Z4Q   ? 3 ? 1   
5 PDB 4Z4Q       4Z4Q   ? 4 ? 1   
6 PDB 4Z4Q       4Z4Q   ? 5 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4Z4Q A 2   ? 241 ? Q59961 404 ? 643 ? 404  995  
2 2 4Z4Q A 249 ? 730 ? P72525 3   ? 484 ? 1003 1484 
3 1 4Z4Q B 2   ? 241 ? Q59961 404 ? 643 ? 404  995  
4 2 4Z4Q B 249 ? 730 ? P72525 3   ? 484 ? 1003 1484 
5 3 4Z4Q E 1   ? 7   ? 4Z4Q   9   ? 15  ? 9    15   
6 4 4Z4Q F 1   ? 11  ? 4Z4Q   1   ? 11  ? 1    11   
7 5 4Z4Q G 1   ? 7   ? 4Z4Q   9   ? 15  ? 9    15   
8 6 4Z4Q H 1   ? 11  ? 4Z4Q   1   ? 11  ? 1    11   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4Z4Q MET A 1   ? UNP Q59961 ?   ?   'expression tag' 403  1  
1 4Z4Q ILE A 58  ? UNP Q59961 VAL 460 conflict         460  2  
1 4Z4Q ALA A 242 ? UNP Q59961 ?   ?   linker           996  3  
1 4Z4Q THR A 243 ? UNP Q59961 ?   ?   linker           997  4  
1 4Z4Q VAL A 244 ? UNP Q59961 ?   ?   linker           998  5  
1 4Z4Q PHE A 245 ? UNP Q59961 ?   ?   linker           999  6  
1 4Z4Q HIS A 246 ? UNP Q59961 ?   ?   linker           1000 7  
1 4Z4Q MET A 247 ? UNP Q59961 ?   ?   linker           1001 8  
1 4Z4Q SER A 248 ? UNP Q59961 ?   ?   linker           1002 9  
2 4Z4Q THR A 503 ? UNP P72525 ILE 257 conflict         1257 10 
2 4Z4Q THR A 731 ? UNP P72525 ?   ?   'expression tag' 1485 11 
2 4Z4Q ALA A 732 ? UNP P72525 ?   ?   'expression tag' 1486 12 
2 4Z4Q LYS A 733 ? UNP P72525 ?   ?   'expression tag' 1487 13 
2 4Z4Q ALA A 734 ? UNP P72525 ?   ?   'expression tag' 1488 14 
2 4Z4Q LEU A 735 ? UNP P72525 ?   ?   'expression tag' 1489 15 
2 4Z4Q GLU A 736 ? UNP P72525 ?   ?   'expression tag' 1490 16 
2 4Z4Q HIS A 737 ? UNP P72525 ?   ?   'expression tag' 1491 17 
2 4Z4Q HIS A 738 ? UNP P72525 ?   ?   'expression tag' 1492 18 
2 4Z4Q HIS A 739 ? UNP P72525 ?   ?   'expression tag' 1493 19 
2 4Z4Q HIS A 740 ? UNP P72525 ?   ?   'expression tag' 1494 20 
2 4Z4Q HIS A 741 ? UNP P72525 ?   ?   'expression tag' 1495 21 
2 4Z4Q HIS A 742 ? UNP P72525 ?   ?   'expression tag' 1496 22 
3 4Z4Q MET B 1   ? UNP Q59961 ?   ?   'expression tag' 403  23 
3 4Z4Q ILE B 58  ? UNP Q59961 VAL 460 conflict         460  24 
3 4Z4Q ALA B 242 ? UNP Q59961 ?   ?   linker           996  25 
3 4Z4Q THR B 243 ? UNP Q59961 ?   ?   linker           997  26 
3 4Z4Q VAL B 244 ? UNP Q59961 ?   ?   linker           998  27 
3 4Z4Q PHE B 245 ? UNP Q59961 ?   ?   linker           999  28 
3 4Z4Q HIS B 246 ? UNP Q59961 ?   ?   linker           1000 29 
3 4Z4Q MET B 247 ? UNP Q59961 ?   ?   linker           1001 30 
3 4Z4Q SER B 248 ? UNP Q59961 ?   ?   linker           1002 31 
4 4Z4Q THR B 503 ? UNP P72525 ILE 257 conflict         1257 32 
4 4Z4Q THR B 731 ? UNP P72525 ?   ?   'expression tag' 1485 33 
4 4Z4Q ALA B 732 ? UNP P72525 ?   ?   'expression tag' 1486 34 
4 4Z4Q LYS B 733 ? UNP P72525 ?   ?   'expression tag' 1487 35 
4 4Z4Q ALA B 734 ? UNP P72525 ?   ?   'expression tag' 1488 36 
4 4Z4Q LEU B 735 ? UNP P72525 ?   ?   'expression tag' 1489 37 
4 4Z4Q GLU B 736 ? UNP P72525 ?   ?   'expression tag' 1490 38 
4 4Z4Q HIS B 737 ? UNP P72525 ?   ?   'expression tag' 1491 39 
4 4Z4Q HIS B 738 ? UNP P72525 ?   ?   'expression tag' 1492 40 
4 4Z4Q HIS B 739 ? UNP P72525 ?   ?   'expression tag' 1493 41 
4 4Z4Q HIS B 740 ? UNP P72525 ?   ?   'expression tag' 1494 42 
4 4Z4Q HIS B 741 ? UNP P72525 ?   ?   'expression tag' 1495 43 
4 4Z4Q HIS B 742 ? UNP P72525 ?   ?   'expression tag' 1496 44 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'            24.305  
PDQ non-polymer         . 
'3-amino-7-{(3R)-3-[(1S)-1-aminoethyl]pyrrolidin-1-yl}-1-cyclopropyl-6-fluoro-8-methylquinazoline-2,4(1H,3H)-dione' ? 
'C18 H24 F N5 O2' 361.414 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4Z4Q 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.81 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         74.44 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            297 
_exptl_crystal_grow.temp_details    incubator 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50 mM Na cacodylate, 100-150 mM NaCl, 4-7% isopropanol' 
_exptl_crystal_grow.pdbx_pH_range   6.0-7.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-07-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.96860 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.96860 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4Z4Q 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.88 
_reflns.d_resolution_low                 44.59 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       69416 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.88 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.45 
_reflns.pdbx_Rmerge_I_obs                0.087 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.5980 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.88 
_reflns_shell.d_res_low                   2.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.11 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.89 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.68 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.79 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4Z4Q 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     59072 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             44.588 
_refine.ls_d_res_high                            3.040 
_refine.ls_percent_reflns_obs                    99.87 
_refine.ls_R_factor_obs                          0.1639 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1617 
_refine.ls_R_factor_R_free                       0.2047 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.96 
_refine.ls_number_reflns_R_free                  2932 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3K9F 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.29 
_refine.pdbx_overall_phase_error                 21.18 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10507 
_refine_hist.pdbx_number_atoms_nucleic_acid   719 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             8 
_refine_hist.number_atoms_total               11290 
_refine_hist.d_res_high                       3.040 
_refine_hist.d_res_low                        44.588 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.011  ? ? 11551 'X-RAY DIFFRACTION' ? 
f_angle_d          1.410  ? ? 15839 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.755 ? ? 4246  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.086  ? ? 1818  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 1942  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.0400 3.0899  2602 0.2320 100.00 0.3051 . . 148 . . . . 
'X-RAY DIFFRACTION' . 3.0899 3.1431  2700 0.2307 100.00 0.3039 . . 120 . . . . 
'X-RAY DIFFRACTION' . 3.1431 3.2003  2594 0.2141 100.00 0.3030 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.2003 3.2618  2659 0.2155 100.00 0.2807 . . 130 . . . . 
'X-RAY DIFFRACTION' . 3.2618 3.3284  2638 0.1909 100.00 0.2533 . . 136 . . . . 
'X-RAY DIFFRACTION' . 3.3284 3.4007  2647 0.1913 100.00 0.2645 . . 137 . . . . 
'X-RAY DIFFRACTION' . 3.4007 3.4798  2636 0.1826 100.00 0.2372 . . 137 . . . . 
'X-RAY DIFFRACTION' . 3.4798 3.5668  2690 0.1748 100.00 0.2780 . . 109 . . . . 
'X-RAY DIFFRACTION' . 3.5668 3.6632  2670 0.1695 100.00 0.2232 . . 125 . . . . 
'X-RAY DIFFRACTION' . 3.6632 3.7709  2686 0.1625 100.00 0.2165 . . 126 . . . . 
'X-RAY DIFFRACTION' . 3.7709 3.8926  2618 0.1532 100.00 0.1850 . . 152 . . . . 
'X-RAY DIFFRACTION' . 3.8926 4.0316  2666 0.1439 100.00 0.1955 . . 133 . . . . 
'X-RAY DIFFRACTION' . 4.0316 4.1929  2660 0.1363 100.00 0.1895 . . 155 . . . . 
'X-RAY DIFFRACTION' . 4.1929 4.3836  2686 0.1300 100.00 0.1620 . . 123 . . . . 
'X-RAY DIFFRACTION' . 4.3836 4.6145  2646 0.1176 100.00 0.1591 . . 144 . . . . 
'X-RAY DIFFRACTION' . 4.6145 4.9032  2675 0.1322 100.00 0.1423 . . 163 . . . . 
'X-RAY DIFFRACTION' . 4.9032 5.2813  2678 0.1377 100.00 0.1776 . . 164 . . . . 
'X-RAY DIFFRACTION' . 5.2813 5.8117  2685 0.1597 100.00 0.2162 . . 136 . . . . 
'X-RAY DIFFRACTION' . 5.8117 6.6503  2716 0.1777 100.00 0.2101 . . 154 . . . . 
'X-RAY DIFFRACTION' . 6.6503 8.3696  2759 0.1656 100.00 0.1925 . . 129 . . . . 
'X-RAY DIFFRACTION' . 8.3696 44.5932 2829 0.1772 100.00 0.2107 . . 171 . . . . 
# 
_struct.entry_id                     4Z4Q 
_struct.title                        'Quinazolinedione(PD 0305970)-DNA cleavage complex of topoisomerase IV from S. pneumoniae' 
_struct.pdbx_descriptor              
'GyrA59 subunit of gyrase from Streptococcus pneumoniae, GyrB30 subunit of gyrase from Streptococcus pneumoniae/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4Z4Q 
_struct_keywords.text            'Topoisomerase IV, Cleavage complex, DNA, quinolone, isomerase' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
K N N 7 ? 
L N N 7 ? 
M N N 8 ? 
N N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 32  ? ARG A 43  ? GLY A 434  ARG A 445  1 ? 12 
HELX_P HELX_P2  AA2 LYS A 64  ? ASN A 71  ? LYS A 466  ASN A 473  1 ? 8  
HELX_P HELX_P3  AA3 ASN A 71  ? ILE A 81  ? ASN A 473  ILE A 483  1 ? 11 
HELX_P HELX_P4  AA4 VAL A 85  ? PHE A 89  ? VAL A 487  PHE A 491  5 ? 5  
HELX_P HELX_P5  AA5 SER A 90  ? ALA A 94  ? SER A 492  ALA A 496  5 ? 5  
HELX_P HELX_P6  AA6 ASP A 106 ? TYR A 123 ? ASP A 508  TYR A 525  1 ? 18 
HELX_P HELX_P7  AA7 MET A 124 ? ALA A 130 ? MET A 526  ALA A 532  1 ? 7  
HELX_P HELX_P8  AA8 GLY A 160 ? ARG A 166 ? GLY A 562  ARG A 568  1 ? 7  
HELX_P HELX_P9  AA9 GLY A 180 ? MET A 184 ? GLY A 582  MET A 586  5 ? 5  
HELX_P HELX_P10 AB1 ASN A 185 ? MET A 194 ? ASN A 587  MET A 596  1 ? 10 
HELX_P HELX_P11 AB2 ASP A 208 ? GLY A 221 ? ASP A 610  GLY A 623  1 ? 14 
HELX_P HELX_P12 AB3 LYS A 223 ? VAL A 235 ? LYS A 625  VAL A 637  1 ? 13 
HELX_P HELX_P13 AB4 LEU A 255 ? ASP A 273 ? LEU A 1009 ASP A 1027 1 ? 19 
HELX_P HELX_P14 AB5 LYS A 284 ? ASP A 297 ? LYS A 1038 ASP A 1051 1 ? 14 
HELX_P HELX_P15 AB6 SER A 308 ? PHE A 319 ? SER A 1062 PHE A 1073 1 ? 12 
HELX_P HELX_P16 AB7 GLY A 323 ? MET A 334 ? GLY A 1077 MET A 1088 1 ? 12 
HELX_P HELX_P17 AB8 SER A 370 ? LEU A 377 ? SER A 1124 LEU A 1131 1 ? 8  
HELX_P HELX_P18 AB9 GLN A 378 ? LYS A 383 ? GLN A 1132 LYS A 1137 5 ? 6  
HELX_P HELX_P19 AC1 PRO A 406 ? GLY A 412 ? PRO A 1160 GLY A 1166 1 ? 7  
HELX_P HELX_P20 AC2 ASN A 428 ? HIS A 442 ? ASN A 1182 HIS A 1196 1 ? 15 
HELX_P HELX_P21 AC3 LYS A 446 ? LEU A 454 ? LYS A 1200 LEU A 1208 1 ? 9  
HELX_P HELX_P22 AC4 GLY A 467 ? GLY A 478 ? GLY A 1221 GLY A 1232 1 ? 12 
HELX_P HELX_P23 AC5 ASN A 510 ? ASN A 525 ? ASN A 1264 ASN A 1279 1 ? 16 
HELX_P HELX_P24 AC6 ASN A 553 ? THR A 565 ? ASN A 1307 THR A 1319 1 ? 13 
HELX_P HELX_P25 AC7 GLY A 587 ? ILE A 630 ? GLY A 1341 ILE A 1384 1 ? 44 
HELX_P HELX_P26 AC8 ILE A 630 ? SER A 641 ? ILE A 1384 SER A 1395 1 ? 12 
HELX_P HELX_P27 AC9 ASN A 643 ? ASP A 656 ? ASN A 1397 ASP A 1410 1 ? 14 
HELX_P HELX_P28 AD1 THR A 658 ? THR A 667 ? THR A 1412 THR A 1421 1 ? 10 
HELX_P HELX_P29 AD2 LEU A 668 ? ASN A 675 ? LEU A 1422 ASN A 1429 5 ? 8  
HELX_P HELX_P30 AD3 ASP A 677 ? ASP A 701 ? ASP A 1431 ASP A 1455 1 ? 25 
HELX_P HELX_P31 AD4 ASP A 701 ? ALA A 721 ? ASP A 1455 ALA A 1475 1 ? 21 
HELX_P HELX_P32 AD5 GLY B 32  ? ARG B 43  ? GLY B 434  ARG B 445  1 ? 12 
HELX_P HELX_P33 AD6 LYS B 64  ? LYS B 70  ? LYS B 466  LYS B 472  1 ? 7  
HELX_P HELX_P34 AD7 ASN B 71  ? TYR B 79  ? ASN B 473  TYR B 481  1 ? 9  
HELX_P HELX_P35 AD8 VAL B 85  ? PHE B 89  ? VAL B 487  PHE B 491  5 ? 5  
HELX_P HELX_P36 AD9 SER B 90  ? ALA B 94  ? SER B 492  ALA B 496  5 ? 5  
HELX_P HELX_P37 AE1 ASP B 106 ? MET B 124 ? ASP B 508  MET B 526  1 ? 19 
HELX_P HELX_P38 AE2 MET B 124 ? ALA B 130 ? MET B 526  ALA B 532  1 ? 7  
HELX_P HELX_P39 AE3 LYS B 147 ? GLU B 151 ? LYS B 549  GLU B 553  5 ? 5  
HELX_P HELX_P40 AE4 THR B 158 ? GLN B 168 ? THR B 560  GLN B 570  1 ? 11 
HELX_P HELX_P41 AE5 GLY B 180 ? MET B 184 ? GLY B 582  MET B 586  5 ? 5  
HELX_P HELX_P42 AE6 ASN B 185 ? MET B 194 ? ASN B 587  MET B 596  1 ? 10 
HELX_P HELX_P43 AE7 ASP B 208 ? GLY B 221 ? ASP B 610  GLY B 623  1 ? 14 
HELX_P HELX_P44 AE8 LYS B 223 ? VAL B 235 ? LYS B 625  VAL B 637  1 ? 13 
HELX_P HELX_P45 AE9 LEU B 255 ? ASP B 273 ? LEU B 1009 ASP B 1027 1 ? 19 
HELX_P HELX_P46 AF1 LYS B 284 ? ASP B 297 ? LYS B 1038 ASP B 1051 1 ? 14 
HELX_P HELX_P47 AF2 LYS B 307 ? PHE B 319 ? LYS B 1061 PHE B 1073 1 ? 13 
HELX_P HELX_P48 AF3 GLY B 323 ? MET B 334 ? GLY B 1077 MET B 1088 1 ? 12 
HELX_P HELX_P49 AF4 SER B 370 ? LEU B 377 ? SER B 1124 LEU B 1131 1 ? 8  
HELX_P HELX_P50 AF5 ASP B 379 ? LYS B 383 ? ASP B 1133 LYS B 1137 5 ? 5  
HELX_P HELX_P51 AF6 PRO B 406 ? GLY B 412 ? PRO B 1160 GLY B 1166 1 ? 7  
HELX_P HELX_P52 AF7 ASN B 428 ? HIS B 442 ? ASN B 1182 HIS B 1196 1 ? 15 
HELX_P HELX_P53 AF8 LYS B 446 ? LEU B 454 ? LYS B 1200 LEU B 1208 1 ? 9  
HELX_P HELX_P54 AF9 GLY B 467 ? GLY B 478 ? GLY B 1221 GLY B 1232 1 ? 12 
HELX_P HELX_P55 AG1 ASN B 510 ? ASN B 524 ? ASN B 1264 ASN B 1278 1 ? 15 
HELX_P HELX_P56 AG2 ASN B 553 ? THR B 565 ? ASN B 1307 THR B 1319 1 ? 13 
HELX_P HELX_P57 AG3 GLY B 587 ? ILE B 630 ? GLY B 1341 ILE B 1384 1 ? 44 
HELX_P HELX_P58 AG4 ILE B 630 ? ALA B 640 ? ILE B 1384 ALA B 1394 1 ? 11 
HELX_P HELX_P59 AG5 ASN B 643 ? ASP B 656 ? ASN B 1397 ASP B 1410 1 ? 14 
HELX_P HELX_P60 AG6 THR B 658 ? THR B 667 ? THR B 1412 THR B 1421 1 ? 10 
HELX_P HELX_P61 AG7 LEU B 668 ? THR B 674 ? LEU B 1422 THR B 1428 5 ? 7  
HELX_P HELX_P62 AG8 ASP B 677 ? GLY B 700 ? ASP B 1431 GLY B 1454 1 ? 24 
HELX_P HELX_P63 AG9 ASP B 701 ? ALA B 721 ? ASP B 1455 ALA B 1475 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?   ? A ASP 104 OD2 ? ? ? 1_555 H MG .  MG ? ? A ASP 506  A MG 1502 1_555 ? ? ? ? ? ? ?            1.815 ? 
metalc2  metalc ?   ? A ASP 106 OD2 ? ? ? 1_555 H MG .  MG ? ? A ASP 508  A MG 1502 1_555 ? ? ? ? ? ? ?            2.021 ? 
covale1  covale one ? A TYR 364 OH  ? ? ? 1_555 D DA 1  P  ? ? A TYR 1118 F DA 1    1_555 ? ? ? ? ? ? ?            1.594 ? 
metalc3  metalc ?   ? A PHE 562 O   ? ? ? 1_555 G MG .  MG ? ? A PHE 1316 A MG 1501 1_555 ? ? ? ? ? ? ?            2.762 ? 
metalc4  metalc ?   ? A THR 565 O   ? ? ? 1_555 G MG .  MG ? ? A THR 1319 A MG 1501 1_555 ? ? ? ? ? ? ?            2.560 ? 
metalc5  metalc ?   ? A GLN 568 O   ? ? ? 1_555 G MG .  MG ? ? A GLN 1322 A MG 1501 1_555 ? ? ? ? ? ? ?            2.013 ? 
metalc6  metalc ?   ? B ASP 104 OD2 ? ? ? 1_555 J MG .  MG ? ? B ASP 506  B MG 1502 1_555 ? ? ? ? ? ? ?            1.758 ? 
metalc7  metalc ?   ? B ASP 106 OD2 ? ? ? 1_555 J MG .  MG ? ? B ASP 508  B MG 1502 1_555 ? ? ? ? ? ? ?            2.020 ? 
covale2  covale one ? B TYR 364 OH  ? ? ? 1_555 F DG 1  P  ? ? B TYR 1118 H DG 1    1_555 ? ? ? ? ? ? ?            1.582 ? 
metalc8  metalc ?   ? B THR 565 O   ? ? ? 1_555 I MG .  MG ? ? B THR 1319 B MG 1501 1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc9  metalc ?   ? B GLN 568 O   ? ? ? 1_555 I MG .  MG ? ? B GLN 1322 B MG 1501 1_555 ? ? ? ? ? ? ?            1.977 ? 
hydrog1  hydrog ?   ? C DG  1   N1  ? ? ? 1_555 D DC 11 N3 ? ? E DG  9    F DC 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?   ? C DG  1   N2  ? ? ? 1_555 D DC 11 O2 ? ? E DG  9    F DC 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?   ? C DG  1   O6  ? ? ? 1_555 D DC 11 N4 ? ? E DG  9    F DC 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?   ? C DT  2   N3  ? ? ? 1_555 D DA 10 N1 ? ? E DT  10   F DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?   ? C DT  2   O4  ? ? ? 1_555 D DA 10 N6 ? ? E DT  10   F DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?   ? C DA  3   N1  ? ? ? 1_555 D DT 9  N3 ? ? E DA  11   F DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?   ? C DA  3   N6  ? ? ? 1_555 D DT 9  O4 ? ? E DA  11   F DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?   ? C DA  4   N1  ? ? ? 1_555 D DT 8  N3 ? ? E DA  12   F DT 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?   ? C DA  4   N6  ? ? ? 1_555 D DT 8  O4 ? ? E DA  12   F DT 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?   ? C DT  5   N3  ? ? ? 1_555 D DA 7  N1 ? ? E DT  13   F DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?   ? C DT  5   O4  ? ? ? 1_555 D DA 7  N6 ? ? E DT  13   F DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?   ? C DA  6   N1  ? ? ? 1_555 D DT 6  N3 ? ? E DA  14   F DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?   ? C DA  6   N6  ? ? ? 1_555 D DT 6  O4 ? ? E DA  14   F DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?   ? C DC  7   N3  ? ? ? 1_555 D DG 5  N1 ? ? E DC  15   F DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?   ? C DC  7   N4  ? ? ? 1_555 D DG 5  O6 ? ? E DC  15   F DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?   ? C DC  7   O2  ? ? ? 1_555 D DG 5  N2 ? ? E DC  15   F DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?   ? D DA  1   N1  ? ? ? 1_555 F DT 4  N3 ? ? F DA  1    H DT 4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?   ? D DA  1   N6  ? ? ? 1_555 F DT 4  O4 ? ? F DA  1    H DT 4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?   ? D DA  2   N1  ? ? ? 1_555 F DT 3  N3 ? ? F DA  2    H DT 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?   ? D DA  2   N6  ? ? ? 1_555 F DT 3  O4 ? ? F DA  2    H DT 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?   ? D DC  3   N3  ? ? ? 1_555 F DG 2  N1 ? ? F DC  3    H DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?   ? D DC  3   N4  ? ? ? 1_555 F DG 2  O6 ? ? F DC  3    H DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?   ? D DC  3   O2  ? ? ? 1_555 F DG 2  N2 ? ? F DC  3    H DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?   ? D DC  4   N3  ? ? ? 1_555 F DG 1  N1 ? ? F DC  4    H DG 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?   ? D DC  4   N4  ? ? ? 1_555 F DG 1  O6 ? ? F DC  4    H DG 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?   ? D DC  4   O2  ? ? ? 1_555 F DG 1  N2 ? ? F DC  4    H DG 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?   ? E DT  1   N3  ? ? ? 1_555 F DA 11 N1 ? ? G DT  9    H DA 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?   ? E DT  1   O4  ? ? ? 1_555 F DA 11 N6 ? ? G DT  9    H DA 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?   ? E DG  2   N1  ? ? ? 1_555 F DC 10 N3 ? ? G DG  10   H DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?   ? E DG  2   N2  ? ? ? 1_555 F DC 10 O2 ? ? G DG  10   H DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?   ? E DG  2   O6  ? ? ? 1_555 F DC 10 N4 ? ? G DG  10   H DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?   ? E DT  3   N3  ? ? ? 1_555 F DA 9  N1 ? ? G DT  11   H DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?   ? E DT  3   O4  ? ? ? 1_555 F DA 9  N6 ? ? G DT  11   H DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?   ? E DG  4   N1  ? ? ? 1_555 F DC 8  N3 ? ? G DG  12   H DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?   ? E DG  4   N2  ? ? ? 1_555 F DC 8  O2 ? ? G DG  12   H DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?   ? E DG  4   O6  ? ? ? 1_555 F DC 8  N4 ? ? G DG  12   H DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?   ? E DG  5   N1  ? ? ? 1_555 F DC 7  N3 ? ? G DG  13   H DC 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?   ? E DG  5   N2  ? ? ? 1_555 F DC 7  O2 ? ? G DG  13   H DC 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?   ? E DG  5   O6  ? ? ? 1_555 F DC 7  N4 ? ? G DG  13   H DC 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?   ? E DA  6   N1  ? ? ? 1_555 F DT 6  N3 ? ? G DA  14   H DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?   ? E DA  6   N6  ? ? ? 1_555 F DT 6  O4 ? ? G DA  14   H DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?   ? E DT  7   N3  ? ? ? 1_555 F DA 5  N1 ? ? G DT  15   H DA 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?   ? E DT  7   O4  ? ? ? 1_555 F DA 5  N6 ? ? G DT  15   H DA 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 414 A . ? THR 1168 A GLY 415 A ? GLY 1169 A 1 -20.14 
2 SER 144 B . ? SER 546  B LYS 145 B ? LYS 547  B 1 -4.75  
3 LYS 171 B . ? LYS 573  B GLY 172 B ? GLY 574  B 1 0.48   
4 THR 414 B . ? THR 1168 B GLY 415 B ? GLY 1169 B 1 -13.62 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 6 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA8 3 4 ? parallel      
AA8 4 5 ? anti-parallel 
AA8 5 6 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? parallel      
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 48  ? LEU A 53  ? GLN A 450  LEU A 455  
AA1 2 GLU A 26  ? GLU A 31  ? GLU A 428  GLU A 433  
AA1 3 LYS A 98  ? MET A 102 ? LYS A 500  MET A 504  
AA1 4 VAL A 133 ? ALA A 136 ? VAL A 535  ALA A 538  
AA1 5 LEU A 201 ? THR A 205 ? LEU A 603  THR A 607  
AA1 6 ILE A 250 ? SER A 254 ? ILE A 1004 SER A 1008 
AA2 1 ARG A 306 ? LYS A 307 ? ARG A 1060 LYS A 1061 
AA2 2 GLU A 366 ? LEU A 369 ? GLU A 1120 LEU A 1123 
AA2 3 VAL A 345 ? HIS A 348 ? VAL A 1099 HIS A 1102 
AA3 1 PHE A 387 ? TRP A 389 ? PHE A 1141 TRP A 1143 
AA3 2 LYS A 396 ? PRO A 398 ? LYS A 1150 PRO A 1152 
AA4 1 SER A 413 ? ILE A 416 ? SER A 1167 ILE A 1170 
AA4 2 ALA A 421 ? ILE A 424 ? ALA A 1175 ILE A 1178 
AA5 1 GLN A 568 ? ASN A 574 ? GLN A 1322 ASN A 1328 
AA5 2 LYS A 479 ? ARG A 485 ? LYS A 1233 ARG A 1239 
AA5 3 ILE A 464 ? GLN A 466 ? ILE A 1218 GLN A 1220 
AA5 4 SER A 727 ? GLU A 729 ? SER A 1481 GLU A 1483 
AA6 1 ILE A 490 ? LEU A 493 ? ILE A 1244 LEU A 1247 
AA6 2 LYS A 497 ? ILE A 502 ? LYS A 1251 ILE A 1256 
AA6 3 ILE A 544 ? LEU A 548 ? ILE A 1298 LEU A 1302 
AA6 4 ILE A 530 ? ASP A 535 ? ILE A 1284 ASP A 1289 
AA7 1 VAL A 576 ? ASP A 579 ? VAL A 1330 ASP A 1333 
AA7 2 THR A 582 ? GLN A 585 ? THR A 1336 GLN A 1339 
AA8 1 GLN B 48  ? LEU B 53  ? GLN B 450  LEU B 455  
AA8 2 GLU B 26  ? GLU B 31  ? GLU B 428  GLU B 433  
AA8 3 LYS B 98  ? MET B 102 ? LYS B 500  MET B 504  
AA8 4 VAL B 133 ? ALA B 136 ? VAL B 535  ALA B 538  
AA8 5 LEU B 201 ? THR B 205 ? LEU B 603  THR B 607  
AA8 6 GLN B 251 ? SER B 254 ? GLN B 1005 SER B 1008 
AA9 1 ALA B 154 ? ALA B 156 ? ALA B 556  ALA B 558  
AA9 2 TYR B 141 ? MET B 143 ? TYR B 543  MET B 545  
AA9 3 LEU B 175 ? ARG B 177 ? LEU B 577  ARG B 579  
AB1 1 VAL B 345 ? HIS B 348 ? VAL B 1099 HIS B 1102 
AB1 2 GLU B 366 ? LEU B 369 ? GLU B 1120 LEU B 1123 
AB2 1 PHE B 387 ? TRP B 389 ? PHE B 1141 TRP B 1143 
AB2 2 LYS B 396 ? PRO B 398 ? LYS B 1150 PRO B 1152 
AB3 1 SER B 413 ? ILE B 416 ? SER B 1167 ILE B 1170 
AB3 2 ALA B 421 ? ILE B 424 ? ALA B 1175 ILE B 1178 
AB4 1 GLN B 568 ? ASN B 574 ? GLN B 1322 ASN B 1328 
AB4 2 LYS B 479 ? ARG B 485 ? LYS B 1233 ARG B 1239 
AB4 3 ILE B 464 ? GLN B 466 ? ILE B 1218 GLN B 1220 
AB4 4 SER B 727 ? GLU B 729 ? SER B 1481 GLU B 1483 
AB5 1 LYS B 487 ? LEU B 493 ? LYS B 1241 LEU B 1247 
AB5 2 LYS B 497 ? GLU B 504 ? LYS B 1251 GLU B 1258 
AB5 3 ILE B 544 ? LEU B 548 ? ILE B 1298 LEU B 1302 
AB5 4 ILE B 530 ? ASP B 535 ? ILE B 1284 ASP B 1289 
AB6 1 VAL B 576 ? ASP B 579 ? VAL B 1330 ASP B 1333 
AB6 2 THR B 582 ? GLN B 585 ? THR B 1336 GLN B 1339 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LEU A 53  ? O LEU A 455  N VAL A 30  ? N VAL A 432  
AA1 2 3 N LEU A 27  ? N LEU A 429  O ILE A 100 ? O ILE A 502  
AA1 3 4 N ILE A 99  ? N ILE A 501  O TYR A 134 ? O TYR A 536  
AA1 4 5 N VAL A 133 ? N VAL A 535  O VAL A 204 ? O VAL A 606  
AA1 5 6 N ARG A 203 ? N ARG A 605  O GLN A 251 ? O GLN A 1005 
AA2 1 2 N ARG A 306 ? N ARG A 1060 O ALA A 367 ? O ALA A 1121 
AA2 2 3 O ARG A 368 ? O ARG A 1122 N GLU A 346 ? N GLU A 1100 
AA3 1 2 N ALA A 388 ? N ALA A 1142 O GLU A 397 ? O GLU A 1151 
AA4 1 2 N SER A 413 ? N SER A 1167 O ILE A 424 ? O ILE A 1178 
AA5 1 2 O ILE A 569 ? O ILE A 1323 N VAL A 484 ? N VAL A 1238 
AA5 2 3 O ARG A 485 ? O ARG A 1239 N ILE A 464 ? N ILE A 1218 
AA5 3 4 N ILE A 465 ? N ILE A 1219 O SER A 727 ? O SER A 1481 
AA6 1 2 N LEU A 493 ? N LEU A 1247 O LYS A 497 ? O LYS A 1251 
AA6 2 3 N ILE A 500 ? N ILE A 1254 O ILE A 546 ? O ILE A 1300 
AA6 3 4 O GLU A 547 ? O GLU A 1301 N ALA A 531 ? N ALA A 1285 
AA7 1 2 N ALA A 577 ? N ALA A 1331 O ARG A 584 ? O ARG A 1338 
AA8 1 2 O LEU B 53  ? O LEU B 455  N VAL B 30  ? N VAL B 432  
AA8 2 3 N LEU B 27  ? N LEU B 429  O ILE B 100 ? O ILE B 502  
AA8 3 4 N ILE B 99  ? N ILE B 501  O TYR B 134 ? O TYR B 536  
AA8 4 5 N VAL B 133 ? N VAL B 535  O VAL B 204 ? O VAL B 606  
AA8 5 6 N ARG B 203 ? N ARG B 605  O GLN B 251 ? O GLN B 1005 
AA9 1 2 O ALA B 156 ? O ALA B 558  N TYR B 141 ? N TYR B 543  
AA9 2 3 N LYS B 142 ? N LYS B 544  O GLN B 176 ? O GLN B 578  
AB1 1 2 N GLU B 346 ? N GLU B 1100 O ARG B 368 ? O ARG B 1122 
AB2 1 2 N ALA B 388 ? N ALA B 1142 O GLU B 397 ? O GLU B 1151 
AB3 1 2 N SER B 413 ? N SER B 1167 O ILE B 424 ? O ILE B 1178 
AB4 1 2 O ILE B 569 ? O ILE B 1323 N VAL B 484 ? N VAL B 1238 
AB4 2 3 O VAL B 483 ? O VAL B 1237 N GLN B 466 ? N GLN B 1220 
AB4 3 4 N ILE B 465 ? N ILE B 1219 O SER B 727 ? O SER B 1481 
AB5 1 2 N GLU B 489 ? N GLU B 1243 O VAL B 501 ? O VAL B 1255 
AB5 2 3 N ILE B 500 ? N ILE B 1254 O ILE B 546 ? O ILE B 1300 
AB5 3 4 O GLU B 547 ? O GLU B 1301 N GLU B 532 ? N GLU B 1286 
AB6 1 2 N ASP B 579 ? N ASP B 1333 O THR B 582 ? O THR B 1336 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  1501 ? 4 'binding site for residue MG A 1501' 
AC2 Software A MG  1502 ? 2 'binding site for residue MG A 1502' 
AC3 Software B MG  1501 ? 3 'binding site for residue MG B 1501' 
AC4 Software B MG  1502 ? 2 'binding site for residue MG B 1502' 
AC5 Software F PDQ 101  ? 8 'binding site for residue PDQ F 101' 
AC6 Software H PDQ 101  ? 9 'binding site for residue PDQ H 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 PHE A 562 ? PHE A 1316 . ? 1_555 ? 
2  AC1 4 LYS A 563 ? LYS A 1317 . ? 1_555 ? 
3  AC1 4 THR A 565 ? THR A 1319 . ? 1_555 ? 
4  AC1 4 GLN A 568 ? GLN A 1322 . ? 1_555 ? 
5  AC2 2 ASP A 104 ? ASP A 506  . ? 1_555 ? 
6  AC2 2 ASP A 106 ? ASP A 508  . ? 1_555 ? 
7  AC3 3 PHE B 562 ? PHE B 1316 . ? 1_555 ? 
8  AC3 3 THR B 565 ? THR B 1319 . ? 1_555 ? 
9  AC3 3 GLN B 568 ? GLN B 1322 . ? 1_555 ? 
10 AC4 2 ASP B 104 ? ASP B 506  . ? 1_555 ? 
11 AC4 2 ASP B 106 ? ASP B 508  . ? 1_555 ? 
12 AC5 8 ARG A 54  ? ARG A 456  . ? 1_555 ? 
13 AC5 8 GLU A 73  ? GLU A 475  . ? 1_555 ? 
14 AC5 8 SER A 325 ? SER A 1079 . ? 1_555 ? 
15 AC5 8 ARG B 363 ? ARG B 1117 . ? 1_555 ? 
16 AC5 8 DC  C 7   ? DC  E 15   . ? 1_555 ? 
17 AC5 8 DC  D 4   ? DC  F 4    . ? 1_555 ? 
18 AC5 8 DG  D 5   ? DG  F 5    . ? 1_555 ? 
19 AC5 8 DG  F 1   ? DG  H 1    . ? 1_555 ? 
20 AC6 9 ARG A 363 ? ARG A 1117 . ? 1_555 ? 
21 AC6 9 ARG B 54  ? ARG B 456  . ? 1_555 ? 
22 AC6 9 GLY B 55  ? GLY B 457  . ? 1_555 ? 
23 AC6 9 GLU B 73  ? GLU B 475  . ? 1_555 ? 
24 AC6 9 SER B 325 ? SER B 1079 . ? 1_555 ? 
25 AC6 9 DA  D 1   ? DA  F 1    . ? 1_555 ? 
26 AC6 9 DT  E 7   ? DT  G 15   . ? 1_555 ? 
27 AC6 9 DT  F 4   ? DT  H 4    . ? 1_555 ? 
28 AC6 9 DA  F 5   ? DA  H 5    . ? 1_555 ? 
# 
_atom_sites.entry_id                    4Z4Q 
_atom_sites.fract_transf_matrix[1][1]   0.006328 
_atom_sites.fract_transf_matrix[1][2]   0.003654 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007307 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004734 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A 1 13  ? 11.918  123.106 14.145  1.00 92.52  ? 415  LYS A N     1 
ATOM   2     C  CA    . LYS A 1 13  ? 12.137  124.133 15.170  1.00 90.23  ? 415  LYS A CA    1 
ATOM   3     C  C     . LYS A 1 13  ? 13.583  124.630 15.137  1.00 102.01 ? 415  LYS A C     1 
ATOM   4     O  O     . LYS A 1 13  ? 13.864  125.777 15.463  1.00 106.94 ? 415  LYS A O     1 
ATOM   5     C  CB    . LYS A 1 13  ? 11.793  123.596 16.571  1.00 78.49  ? 415  LYS A CB    1 
ATOM   6     N  N     . LEU A 1 14  ? 14.498  123.760 14.718  1.00 106.03 ? 416  LEU A N     1 
ATOM   7     C  CA    . LEU A 1 14  ? 15.921  124.090 14.665  1.00 97.25  ? 416  LEU A CA    1 
ATOM   8     C  C     . LEU A 1 14  ? 16.411  124.488 13.267  1.00 96.26  ? 416  LEU A C     1 
ATOM   9     O  O     . LEU A 1 14  ? 15.995  123.912 12.261  1.00 93.29  ? 416  LEU A O     1 
ATOM   10    C  CB    . LEU A 1 14  ? 16.744  122.903 15.156  1.00 89.41  ? 416  LEU A CB    1 
ATOM   11    C  CG    . LEU A 1 14  ? 18.252  123.080 15.008  1.00 83.75  ? 416  LEU A CG    1 
ATOM   12    C  CD1   . LEU A 1 14  ? 18.740  124.127 15.976  1.00 86.79  ? 416  LEU A CD1   1 
ATOM   13    C  CD2   . LEU A 1 14  ? 18.962  121.781 15.232  1.00 85.38  ? 416  LEU A CD2   1 
ATOM   14    N  N     . THR A 1 15  ? 17.307  125.470 13.215  1.00 99.18  ? 417  THR A N     1 
ATOM   15    C  CA    . THR A 1 15  ? 18.004  125.825 11.978  1.00 101.30 ? 417  THR A CA    1 
ATOM   16    C  C     . THR A 1 15  ? 19.483  125.434 12.082  1.00 104.13 ? 417  THR A C     1 
ATOM   17    O  O     . THR A 1 15  ? 20.271  126.142 12.714  1.00 106.46 ? 417  THR A O     1 
ATOM   18    C  CB    . THR A 1 15  ? 17.927  127.338 11.700  1.00 102.53 ? 417  THR A CB    1 
ATOM   19    O  OG1   . THR A 1 15  ? 16.561  127.773 11.716  1.00 108.30 ? 417  THR A OG1   1 
ATOM   20    C  CG2   . THR A 1 15  ? 18.553  127.666 10.353  1.00 99.96  ? 417  THR A CG2   1 
ATOM   21    N  N     . PRO A 1 16  ? 19.868  124.310 11.452  1.00 100.62 ? 418  PRO A N     1 
ATOM   22    C  CA    . PRO A 1 16  ? 21.212  123.722 11.588  1.00 98.81  ? 418  PRO A CA    1 
ATOM   23    C  C     . PRO A 1 16  ? 22.265  124.314 10.653  1.00 95.08  ? 418  PRO A C     1 
ATOM   24    O  O     . PRO A 1 16  ? 21.934  124.763 9.558   1.00 96.42  ? 418  PRO A O     1 
ATOM   25    C  CB    . PRO A 1 16  ? 20.988  122.249 11.229  1.00 99.44  ? 418  PRO A CB    1 
ATOM   26    C  CG    . PRO A 1 16  ? 19.588  122.183 10.584  1.00 99.22  ? 418  PRO A CG    1 
ATOM   27    C  CD    . PRO A 1 16  ? 19.045  123.571 10.483  1.00 97.08  ? 418  PRO A CD    1 
ATOM   28    N  N     . ALA A 1 17  ? 23.524  124.303 11.075  1.00 91.52  ? 419  ALA A N     1 
ATOM   29    C  CA    . ALA A 1 17  ? 24.610  124.740 10.201  1.00 94.98  ? 419  ALA A CA    1 
ATOM   30    C  C     . ALA A 1 17  ? 24.694  123.887 8.923   1.00 97.03  ? 419  ALA A C     1 
ATOM   31    O  O     . ALA A 1 17  ? 24.131  122.795 8.846   1.00 97.02  ? 419  ALA A O     1 
ATOM   32    C  CB    . ALA A 1 17  ? 25.935  124.725 10.956  1.00 96.68  ? 419  ALA A CB    1 
ATOM   33    N  N     . GLN A 1 18  ? 25.396  124.391 7.914   1.00 98.65  ? 420  GLN A N     1 
ATOM   34    C  CA    . GLN A 1 18  ? 25.499  123.679 6.648   1.00 101.45 ? 420  GLN A CA    1 
ATOM   35    C  C     . GLN A 1 18  ? 26.408  122.438 6.758   1.00 103.94 ? 420  GLN A C     1 
ATOM   36    O  O     . GLN A 1 18  ? 25.995  121.324 6.431   1.00 101.40 ? 420  GLN A O     1 
ATOM   37    C  CB    . GLN A 1 18  ? 25.985  124.628 5.553   1.00 104.53 ? 420  GLN A CB    1 
ATOM   38    C  CG    . GLN A 1 18  ? 25.636  124.176 4.146   1.00 114.80 ? 420  GLN A CG    1 
ATOM   39    C  CD    . GLN A 1 18  ? 24.792  125.189 3.393   1.00 121.31 ? 420  GLN A CD    1 
ATOM   40    O  OE1   . GLN A 1 18  ? 25.040  126.397 3.456   1.00 120.89 ? 420  GLN A OE1   1 
ATOM   41    N  NE2   . GLN A 1 18  ? 23.785  124.699 2.674   1.00 124.26 ? 420  GLN A NE2   1 
ATOM   42    N  N     . SER A 1 19  ? 27.640  122.635 7.224   1.00 104.64 ? 421  SER A N     1 
ATOM   43    C  CA    . SER A 1 19  ? 28.585  121.537 7.401   1.00 102.93 ? 421  SER A CA    1 
ATOM   44    C  C     . SER A 1 19  ? 28.752  121.222 8.883   1.00 109.13 ? 421  SER A C     1 
ATOM   45    O  O     . SER A 1 19  ? 28.700  122.123 9.727   1.00 107.56 ? 421  SER A O     1 
ATOM   46    C  CB    . SER A 1 19  ? 29.938  121.886 6.777   1.00 95.36  ? 421  SER A CB    1 
ATOM   47    N  N     . LYS A 1 20  ? 28.944  119.940 9.194   1.00 111.24 ? 422  LYS A N     1 
ATOM   48    C  CA    . LYS A 1 20  ? 29.098  119.494 10.573  1.00 103.04 ? 422  LYS A CA    1 
ATOM   49    C  C     . LYS A 1 20  ? 30.553  119.660 11.001  1.00 103.93 ? 422  LYS A C     1 
ATOM   50    O  O     . LYS A 1 20  ? 31.440  119.058 10.413  1.00 97.91  ? 422  LYS A O     1 
ATOM   51    C  CB    . LYS A 1 20  ? 28.637  118.039 10.726  1.00 94.73  ? 422  LYS A CB    1 
ATOM   52    N  N     . ASN A 1 21  ? 30.796  120.499 12.008  1.00 104.41 ? 423  ASN A N     1 
ATOM   53    C  CA    . ASN A 1 21  ? 32.155  120.703 12.536  1.00 112.01 ? 423  ASN A CA    1 
ATOM   54    C  C     . ASN A 1 21  ? 32.202  121.106 14.022  1.00 116.15 ? 423  ASN A C     1 
ATOM   55    O  O     . ASN A 1 21  ? 32.074  122.286 14.356  1.00 112.32 ? 423  ASN A O     1 
ATOM   56    C  CB    . ASN A 1 21  ? 32.936  121.713 11.681  1.00 113.41 ? 423  ASN A CB    1 
ATOM   57    C  CG    . ASN A 1 21  ? 34.347  121.967 12.206  1.00 115.81 ? 423  ASN A CG    1 
ATOM   58    O  OD1   . ASN A 1 21  ? 34.829  121.256 13.086  1.00 124.46 ? 423  ASN A OD1   1 
ATOM   59    N  ND2   . ASN A 1 21  ? 35.016  122.977 11.657  1.00 109.39 ? 423  ASN A ND2   1 
ATOM   60    N  N     . PRO A 1 22  ? 32.405  120.117 14.915  1.00 121.38 ? 424  PRO A N     1 
ATOM   61    C  CA    . PRO A 1 22  ? 32.465  120.312 16.369  1.00 119.01 ? 424  PRO A CA    1 
ATOM   62    C  C     . PRO A 1 22  ? 33.686  121.115 16.832  1.00 119.84 ? 424  PRO A C     1 
ATOM   63    O  O     . PRO A 1 22  ? 33.892  121.299 18.039  1.00 120.47 ? 424  PRO A O     1 
ATOM   64    C  CB    . PRO A 1 22  ? 32.535  118.875 16.907  1.00 119.81 ? 424  PRO A CB    1 
ATOM   65    C  CG    . PRO A 1 22  ? 31.983  118.024 15.813  1.00 118.00 ? 424  PRO A CG    1 
ATOM   66    C  CD    . PRO A 1 22  ? 32.459  118.687 14.563  1.00 122.21 ? 424  PRO A CD    1 
ATOM   67    N  N     . ALA A 1 23  ? 34.488  121.586 15.883  1.00 116.75 ? 425  ALA A N     1 
ATOM   68    C  CA    . ALA A 1 23  ? 35.624  122.440 16.210  1.00 109.59 ? 425  ALA A CA    1 
ATOM   69    C  C     . ALA A 1 23  ? 35.252  123.923 16.105  1.00 111.44 ? 425  ALA A C     1 
ATOM   70    O  O     . ALA A 1 23  ? 35.697  124.748 16.911  1.00 109.35 ? 425  ALA A O     1 
ATOM   71    C  CB    . ALA A 1 23  ? 36.794  122.122 15.306  1.00 100.70 ? 425  ALA A CB    1 
ATOM   72    N  N     . LYS A 1 24  ? 34.435  124.254 15.108  1.00 108.99 ? 426  LYS A N     1 
ATOM   73    C  CA    . LYS A 1 24  ? 34.042  125.637 14.867  1.00 105.76 ? 426  LYS A CA    1 
ATOM   74    C  C     . LYS A 1 24  ? 32.569  125.861 15.223  1.00 107.55 ? 426  LYS A C     1 
ATOM   75    O  O     . LYS A 1 24  ? 32.236  126.773 15.983  1.00 107.18 ? 426  LYS A O     1 
ATOM   76    C  CB    . LYS A 1 24  ? 34.310  126.029 13.405  1.00 92.06  ? 426  LYS A CB    1 
ATOM   77    N  N     . ASN A 1 25  ? 31.699  125.017 14.670  1.00 106.91 ? 427  ASN A N     1 
ATOM   78    C  CA    . ASN A 1 25  ? 30.250  125.118 14.865  1.00 102.56 ? 427  ASN A CA    1 
ATOM   79    C  C     . ASN A 1 25  ? 29.760  125.742 16.198  1.00 104.03 ? 427  ASN A C     1 
ATOM   80    O  O     . ASN A 1 25  ? 30.195  125.377 17.294  1.00 103.85 ? 427  ASN A O     1 
ATOM   81    C  CB    . ASN A 1 25  ? 29.581  123.754 14.623  1.00 102.39 ? 427  ASN A CB    1 
ATOM   82    C  CG    . ASN A 1 25  ? 29.447  123.414 13.140  1.00 102.26 ? 427  ASN A CG    1 
ATOM   83    O  OD1   . ASN A 1 25  ? 30.219  123.888 12.303  1.00 103.05 ? 427  ASN A OD1   1 
ATOM   84    N  ND2   . ASN A 1 25  ? 28.456  122.585 12.814  1.00 101.40 ? 427  ASN A ND2   1 
ATOM   85    N  N     . GLU A 1 26  ? 28.833  126.685 16.074  1.00 99.86  ? 428  GLU A N     1 
ATOM   86    C  CA    . GLU A 1 26  ? 28.298  127.415 17.207  1.00 94.62  ? 428  GLU A CA    1 
ATOM   87    C  C     . GLU A 1 26  ? 26.779  127.245 17.291  1.00 97.73  ? 428  GLU A C     1 
ATOM   88    O  O     . GLU A 1 26  ? 26.092  127.237 16.267  1.00 98.35  ? 428  GLU A O     1 
ATOM   89    C  CB    . GLU A 1 26  ? 28.638  128.900 17.062  1.00 91.51  ? 428  GLU A CB    1 
ATOM   90    C  CG    . GLU A 1 26  ? 30.123  129.192 16.917  1.00 99.61  ? 428  GLU A CG    1 
ATOM   91    C  CD    . GLU A 1 26  ? 30.433  130.687 16.900  1.00 107.59 ? 428  GLU A CD    1 
ATOM   92    O  OE1   . GLU A 1 26  ? 29.503  131.492 16.661  1.00 106.23 ? 428  GLU A OE1   1 
ATOM   93    O  OE2   . GLU A 1 26  ? 31.608  131.054 17.134  1.00 115.10 ? 428  GLU A OE2   1 
ATOM   94    N  N     . LEU A 1 27  ? 26.257  127.118 18.512  1.00 99.36  ? 429  LEU A N     1 
ATOM   95    C  CA    . LEU A 1 27  ? 24.813  127.004 18.733  1.00 92.85  ? 429  LEU A CA    1 
ATOM   96    C  C     . LEU A 1 27  ? 24.290  128.268 19.386  1.00 84.35  ? 429  LEU A C     1 
ATOM   97    O  O     . LEU A 1 27  ? 24.683  128.612 20.494  1.00 87.80  ? 429  LEU A O     1 
ATOM   98    C  CB    . LEU A 1 27  ? 24.483  125.809 19.625  1.00 92.44  ? 429  LEU A CB    1 
ATOM   99    C  CG    . LEU A 1 27  ? 23.129  125.138 19.404  1.00 84.01  ? 429  LEU A CG    1 
ATOM   100   C  CD1   . LEU A 1 27  ? 22.661  124.495 20.690  1.00 79.28  ? 429  LEU A CD1   1 
ATOM   101   C  CD2   . LEU A 1 27  ? 22.117  126.119 18.870  1.00 71.22  ? 429  LEU A CD2   1 
ATOM   102   N  N     . TYR A 1 28  ? 23.403  128.961 18.689  1.00 79.92  ? 430  TYR A N     1 
ATOM   103   C  CA    . TYR A 1 28  ? 22.873  130.218 19.177  1.00 79.19  ? 430  TYR A CA    1 
ATOM   104   C  C     . TYR A 1 28  ? 21.491  130.010 19.758  1.00 78.36  ? 430  TYR A C     1 
ATOM   105   O  O     . TYR A 1 28  ? 20.570  129.586 19.049  1.00 72.99  ? 430  TYR A O     1 
ATOM   106   C  CB    . TYR A 1 28  ? 22.823  131.261 18.053  1.00 81.73  ? 430  TYR A CB    1 
ATOM   107   C  CG    . TYR A 1 28  ? 24.055  132.138 17.982  1.00 81.06  ? 430  TYR A CG    1 
ATOM   108   C  CD1   . TYR A 1 28  ? 25.222  131.670 17.406  1.00 90.18  ? 430  TYR A CD1   1 
ATOM   109   C  CD2   . TYR A 1 28  ? 24.047  133.428 18.493  1.00 75.56  ? 430  TYR A CD2   1 
ATOM   110   C  CE1   . TYR A 1 28  ? 26.349  132.455 17.341  1.00 94.98  ? 430  TYR A CE1   1 
ATOM   111   C  CE2   . TYR A 1 28  ? 25.167  134.223 18.432  1.00 83.57  ? 430  TYR A CE2   1 
ATOM   112   C  CZ    . TYR A 1 28  ? 26.320  133.728 17.854  1.00 95.67  ? 430  TYR A CZ    1 
ATOM   113   O  OH    . TYR A 1 28  ? 27.458  134.501 17.783  1.00 105.76 ? 430  TYR A OH    1 
ATOM   114   N  N     . LEU A 1 29  ? 21.362  130.305 21.055  1.00 77.32  ? 431  LEU A N     1 
ATOM   115   C  CA    . LEU A 1 29  ? 20.075  130.285 21.736  1.00 76.39  ? 431  LEU A CA    1 
ATOM   116   C  C     . LEU A 1 29  ? 19.495  131.696 21.786  1.00 82.35  ? 431  LEU A C     1 
ATOM   117   O  O     . LEU A 1 29  ? 19.919  132.535 22.588  1.00 83.74  ? 431  LEU A O     1 
ATOM   118   C  CB    . LEU A 1 29  ? 20.224  129.729 23.147  1.00 75.66  ? 431  LEU A CB    1 
ATOM   119   C  CG    . LEU A 1 29  ? 21.080  128.477 23.246  1.00 78.23  ? 431  LEU A CG    1 
ATOM   120   C  CD1   . LEU A 1 29  ? 21.206  128.109 24.702  1.00 83.74  ? 431  LEU A CD1   1 
ATOM   121   C  CD2   . LEU A 1 29  ? 20.454  127.349 22.440  1.00 78.15  ? 431  LEU A CD2   1 
ATOM   122   N  N     . VAL A 1 30  ? 18.514  131.937 20.922  1.00 80.38  ? 432  VAL A N     1 
ATOM   123   C  CA    . VAL A 1 30  ? 17.970  133.265 20.703  1.00 77.77  ? 432  VAL A CA    1 
ATOM   124   C  C     . VAL A 1 30  ? 16.617  133.426 21.404  1.00 78.98  ? 432  VAL A C     1 
ATOM   125   O  O     . VAL A 1 30  ? 15.705  132.621 21.191  1.00 81.26  ? 432  VAL A O     1 
ATOM   126   C  CB    . VAL A 1 30  ? 17.833  133.520 19.180  1.00 65.15  ? 432  VAL A CB    1 
ATOM   127   C  CG1   . VAL A 1 30  ? 17.060  134.814 18.888  1.00 65.92  ? 432  VAL A CG1   1 
ATOM   128   C  CG2   . VAL A 1 30  ? 19.203  133.543 18.540  1.00 62.55  ? 432  VAL A CG2   1 
ATOM   129   N  N     . GLU A 1 31  ? 16.491  134.454 22.242  1.00 77.22  ? 433  GLU A N     1 
ATOM   130   C  CA    . GLU A 1 31  ? 15.209  134.761 22.889  1.00 74.48  ? 433  GLU A CA    1 
ATOM   131   C  C     . GLU A 1 31  ? 14.200  135.281 21.871  1.00 77.53  ? 433  GLU A C     1 
ATOM   132   O  O     . GLU A 1 31  ? 14.369  136.383 21.341  1.00 88.14  ? 433  GLU A O     1 
ATOM   133   C  CB    . GLU A 1 31  ? 15.385  135.804 23.999  1.00 75.23  ? 433  GLU A CB    1 
ATOM   134   C  CG    . GLU A 1 31  ? 14.068  136.434 24.489  1.00 81.51  ? 433  GLU A CG    1 
ATOM   135   C  CD    . GLU A 1 31  ? 14.266  137.729 25.292  1.00 85.63  ? 433  GLU A CD    1 
ATOM   136   O  OE1   . GLU A 1 31  ? 13.271  138.261 25.836  1.00 81.39  ? 433  GLU A OE1   1 
ATOM   137   O  OE2   . GLU A 1 31  ? 15.416  138.216 25.383  1.00 89.04  ? 433  GLU A OE2   1 
ATOM   138   N  N     . GLY A 1 32  ? 13.155  134.493 21.608  1.00 71.76  ? 434  GLY A N     1 
ATOM   139   C  CA    . GLY A 1 32  ? 12.077  134.879 20.705  1.00 67.80  ? 434  GLY A CA    1 
ATOM   140   C  C     . GLY A 1 32  ? 12.121  134.244 19.323  1.00 72.97  ? 434  GLY A C     1 
ATOM   141   O  O     . GLY A 1 32  ? 13.185  134.167 18.695  1.00 72.99  ? 434  GLY A O     1 
ATOM   142   N  N     . ASP A 1 33  ? 10.969  133.784 18.836  1.00 77.13  ? 435  ASP A N     1 
ATOM   143   C  CA    . ASP A 1 33  ? 10.904  133.296 17.457  1.00 76.08  ? 435  ASP A CA    1 
ATOM   144   C  C     . ASP A 1 33  ? 11.261  134.442 16.523  1.00 68.74  ? 435  ASP A C     1 
ATOM   145   O  O     . ASP A 1 33  ? 11.980  134.255 15.534  1.00 69.35  ? 435  ASP A O     1 
ATOM   146   C  CB    . ASP A 1 33  ? 9.534   132.684 17.098  1.00 81.76  ? 435  ASP A CB    1 
ATOM   147   C  CG    . ASP A 1 33  ? 9.591   131.143 16.944  1.00 95.93  ? 435  ASP A CG    1 
ATOM   148   O  OD1   . ASP A 1 33  ? 10.663  130.606 16.578  1.00 100.18 ? 435  ASP A OD1   1 
ATOM   149   O  OD2   . ASP A 1 33  ? 8.566   130.459 17.183  1.00 102.02 ? 435  ASP A OD2   1 
ATOM   150   N  N     . SER A 1 34  ? 10.786  135.635 16.859  1.00 69.11  ? 436  SER A N     1 
ATOM   151   C  CA    . SER A 1 34  ? 11.047  136.819 16.035  1.00 77.28  ? 436  SER A CA    1 
ATOM   152   C  C     . SER A 1 34  ? 12.534  137.147 15.853  1.00 70.51  ? 436  SER A C     1 
ATOM   153   O  O     . SER A 1 34  ? 13.001  137.318 14.741  1.00 59.87  ? 436  SER A O     1 
ATOM   154   C  CB    . SER A 1 34  ? 10.278  138.031 16.573  1.00 88.38  ? 436  SER A CB    1 
ATOM   155   O  OG    . SER A 1 34  ? 8.878   137.836 16.404  1.00 97.76  ? 436  SER A OG    1 
ATOM   156   N  N     . ALA A 1 35  ? 13.280  137.246 16.944  1.00 74.99  ? 437  ALA A N     1 
ATOM   157   C  CA    . ALA A 1 35  ? 14.709  137.472 16.814  1.00 66.13  ? 437  ALA A CA    1 
ATOM   158   C  C     . ALA A 1 35  ? 15.372  136.226 16.230  1.00 64.67  ? 437  ALA A C     1 
ATOM   159   O  O     . ALA A 1 35  ? 16.351  136.308 15.491  1.00 64.52  ? 437  ALA A O     1 
ATOM   160   C  CB    . ALA A 1 35  ? 15.304  137.823 18.140  1.00 66.38  ? 437  ALA A CB    1 
ATOM   161   N  N     . GLY A 1 36  ? 14.837  135.064 16.568  1.00 65.80  ? 438  GLY A N     1 
ATOM   162   C  CA    . GLY A 1 36  ? 15.320  133.839 15.973  1.00 70.48  ? 438  GLY A CA    1 
ATOM   163   C  C     . GLY A 1 36  ? 15.308  133.981 14.470  1.00 65.97  ? 438  GLY A C     1 
ATOM   164   O  O     . GLY A 1 36  ? 16.216  133.489 13.790  1.00 71.10  ? 438  GLY A O     1 
ATOM   165   N  N     . GLY A 1 37  ? 14.271  134.651 13.963  1.00 59.36  ? 439  GLY A N     1 
ATOM   166   C  CA    . GLY A 1 37  ? 14.164  135.014 12.564  1.00 59.23  ? 439  GLY A CA    1 
ATOM   167   C  C     . GLY A 1 37  ? 15.317  135.881 12.090  1.00 66.54  ? 439  GLY A C     1 
ATOM   168   O  O     . GLY A 1 37  ? 16.051  135.493 11.179  1.00 61.46  ? 439  GLY A O     1 
ATOM   169   N  N     . SER A 1 38  ? 15.487  137.055 12.699  1.00 71.81  ? 440  SER A N     1 
ATOM   170   C  CA    . SER A 1 38  ? 16.601  137.941 12.357  1.00 66.89  ? 440  SER A CA    1 
ATOM   171   C  C     . SER A 1 38  ? 17.918  137.186 12.410  1.00 67.18  ? 440  SER A C     1 
ATOM   172   O  O     . SER A 1 38  ? 18.738  137.292 11.497  1.00 67.28  ? 440  SER A O     1 
ATOM   173   C  CB    . SER A 1 38  ? 16.648  139.157 13.276  1.00 65.48  ? 440  SER A CB    1 
ATOM   174   O  OG    . SER A 1 38  ? 15.556  140.017 13.006  1.00 71.18  ? 440  SER A OG    1 
ATOM   175   N  N     . ALA A 1 39  ? 18.100  136.413 13.480  1.00 69.37  ? 441  ALA A N     1 
ATOM   176   C  CA    . ALA A 1 39  ? 19.272  135.557 13.641  1.00 69.30  ? 441  ALA A CA    1 
ATOM   177   C  C     . ALA A 1 39  ? 19.489  134.645 12.441  1.00 66.73  ? 441  ALA A C     1 
ATOM   178   O  O     . ALA A 1 39  ? 20.544  134.685 11.824  1.00 69.64  ? 441  ALA A O     1 
ATOM   179   C  CB    . ALA A 1 39  ? 19.167  134.741 14.908  1.00 70.90  ? 441  ALA A CB    1 
ATOM   180   N  N     . LYS A 1 40  ? 18.501  133.816 12.117  1.00 71.01  ? 442  LYS A N     1 
ATOM   181   C  CA    . LYS A 1 40  ? 18.600  132.914 10.961  1.00 77.32  ? 442  LYS A CA    1 
ATOM   182   C  C     . LYS A 1 40  ? 19.051  133.672 9.694   1.00 80.77  ? 442  LYS A C     1 
ATOM   183   O  O     . LYS A 1 40  ? 19.929  133.217 8.950   1.00 77.95  ? 442  LYS A O     1 
ATOM   184   C  CB    . LYS A 1 40  ? 17.262  132.181 10.749  1.00 73.20  ? 442  LYS A CB    1 
ATOM   185   C  CG    . LYS A 1 40  ? 17.195  131.287 9.526   1.00 72.12  ? 442  LYS A CG    1 
ATOM   186   N  N     . GLN A 1 41  ? 18.470  134.851 9.492   1.00 81.89  ? 443  GLN A N     1 
ATOM   187   C  CA    . GLN A 1 41  ? 18.780  135.710 8.348   1.00 84.07  ? 443  GLN A CA    1 
ATOM   188   C  C     . GLN A 1 41  ? 20.173  136.354 8.387   1.00 89.84  ? 443  GLN A C     1 
ATOM   189   O  O     . GLN A 1 41  ? 20.804  136.545 7.345   1.00 96.65  ? 443  GLN A O     1 
ATOM   190   C  CB    . GLN A 1 41  ? 17.724  136.810 8.241   1.00 82.63  ? 443  GLN A CB    1 
ATOM   191   C  CG    . GLN A 1 41  ? 16.301  136.284 8.192   1.00 82.94  ? 443  GLN A CG    1 
ATOM   192   C  CD    . GLN A 1 41  ? 15.276  137.384 8.377   1.00 76.96  ? 443  GLN A CD    1 
ATOM   193   O  OE1   . GLN A 1 41  ? 15.599  138.570 8.255   1.00 73.70  ? 443  GLN A OE1   1 
ATOM   194   N  NE2   . GLN A 1 41  ? 14.032  136.999 8.683   1.00 72.99  ? 443  GLN A NE2   1 
ATOM   195   N  N     . GLY A 1 42  ? 20.644  136.694 9.585   1.00 85.92  ? 444  GLY A N     1 
ATOM   196   C  CA    . GLY A 1 42  ? 21.881  137.439 9.742   1.00 75.60  ? 444  GLY A CA    1 
ATOM   197   C  C     . GLY A 1 42  ? 23.152  136.621 9.899   1.00 80.23  ? 444  GLY A C     1 
ATOM   198   O  O     . GLY A 1 42  ? 24.245  137.176 9.817   1.00 88.88  ? 444  GLY A O     1 
ATOM   199   N  N     . ARG A 1 43  ? 23.022  135.310 10.093  1.00 80.14  ? 445  ARG A N     1 
ATOM   200   C  CA    . ARG A 1 43  ? 24.152  134.461 10.495  1.00 84.80  ? 445  ARG A CA    1 
ATOM   201   C  C     . ARG A 1 43  ? 25.127  134.147 9.354   1.00 94.28  ? 445  ARG A C     1 
ATOM   202   O  O     . ARG A 1 43  ? 25.033  134.700 8.258   1.00 96.68  ? 445  ARG A O     1 
ATOM   203   C  CB    . ARG A 1 43  ? 23.622  133.135 11.045  1.00 82.78  ? 445  ARG A CB    1 
ATOM   204   C  CG    . ARG A 1 43  ? 23.091  132.216 9.938   1.00 85.92  ? 445  ARG A CG    1 
ATOM   205   C  CD    . ARG A 1 43  ? 21.844  131.440 10.335  1.00 87.44  ? 445  ARG A CD    1 
ATOM   206   N  NE    . ARG A 1 43  ? 22.027  129.993 10.190  1.00 93.78  ? 445  ARG A NE    1 
ATOM   207   C  CZ    . ARG A 1 43  ? 21.548  129.257 9.188   1.00 95.15  ? 445  ARG A CZ    1 
ATOM   208   N  NH1   . ARG A 1 43  ? 20.837  129.808 8.201   1.00 90.28  ? 445  ARG A NH1   1 
ATOM   209   N  NH2   . ARG A 1 43  ? 21.782  127.952 9.178   1.00 97.51  ? 445  ARG A NH2   1 
ATOM   210   N  N     . ASP A 1 44  ? 26.065  133.250 9.645   1.00 100.90 ? 446  ASP A N     1 
ATOM   211   C  CA    . ASP A 1 44  ? 26.916  132.629 8.644   1.00 106.63 ? 446  ASP A CA    1 
ATOM   212   C  C     . ASP A 1 44  ? 26.535  131.151 8.615   1.00 105.05 ? 446  ASP A C     1 
ATOM   213   O  O     . ASP A 1 44  ? 27.036  130.355 9.413   1.00 109.82 ? 446  ASP A O     1 
ATOM   214   C  CB    . ASP A 1 44  ? 28.396  132.789 9.020   1.00 112.14 ? 446  ASP A CB    1 
ATOM   215   C  CG    . ASP A 1 44  ? 29.344  132.224 7.961   1.00 114.72 ? 446  ASP A CG    1 
ATOM   216   O  OD1   . ASP A 1 44  ? 28.883  131.487 7.061   1.00 117.11 ? 446  ASP A OD1   1 
ATOM   217   O  OD2   . ASP A 1 44  ? 30.557  132.518 8.032   1.00 111.33 ? 446  ASP A OD2   1 
ATOM   218   N  N     . ARG A 1 45  ? 25.651  130.786 7.694   1.00 97.62  ? 447  ARG A N     1 
ATOM   219   C  CA    . ARG A 1 45  ? 25.059  129.450 7.685   1.00 94.44  ? 447  ARG A CA    1 
ATOM   220   C  C     . ARG A 1 45  ? 26.043  128.269 7.586   1.00 101.24 ? 447  ARG A C     1 
ATOM   221   O  O     . ARG A 1 45  ? 25.651  127.119 7.790   1.00 105.87 ? 447  ARG A O     1 
ATOM   222   C  CB    . ARG A 1 45  ? 24.006  129.350 6.579   1.00 91.10  ? 447  ARG A CB    1 
ATOM   223   C  CG    . ARG A 1 45  ? 24.572  129.410 5.175   1.00 95.82  ? 447  ARG A CG    1 
ATOM   224   C  CD    . ARG A 1 45  ? 23.551  129.971 4.204   1.00 98.45  ? 447  ARG A CD    1 
ATOM   225   N  NE    . ARG A 1 45  ? 22.302  129.212 4.199   1.00 98.17  ? 447  ARG A NE    1 
ATOM   226   C  CZ    . ARG A 1 45  ? 21.169  129.658 3.662   1.00 96.52  ? 447  ARG A CZ    1 
ATOM   227   N  NH1   . ARG A 1 45  ? 21.131  130.859 3.101   1.00 100.41 ? 447  ARG A NH1   1 
ATOM   228   N  NH2   . ARG A 1 45  ? 20.070  128.914 3.687   1.00 90.96  ? 447  ARG A NH2   1 
ATOM   229   N  N     . LYS A 1 46  ? 27.310  128.529 7.278   1.00 99.63  ? 448  LYS A N     1 
ATOM   230   C  CA    . LYS A 1 46  ? 28.247  127.419 7.114   1.00 97.87  ? 448  LYS A CA    1 
ATOM   231   C  C     . LYS A 1 46  ? 28.599  126.769 8.463   1.00 103.43 ? 448  LYS A C     1 
ATOM   232   O  O     . LYS A 1 46  ? 28.980  125.596 8.512   1.00 111.58 ? 448  LYS A O     1 
ATOM   233   C  CB    . LYS A 1 46  ? 29.504  127.842 6.327   1.00 91.85  ? 448  LYS A CB    1 
ATOM   234   N  N     . PHE A 1 47  ? 28.450  127.513 9.560   1.00 98.35  ? 449  PHE A N     1 
ATOM   235   C  CA    . PHE A 1 47  ? 28.824  126.970 10.871  1.00 103.35 ? 449  PHE A CA    1 
ATOM   236   C  C     . PHE A 1 47  ? 28.044  127.498 12.084  1.00 100.07 ? 449  PHE A C     1 
ATOM   237   O  O     . PHE A 1 47  ? 28.415  127.217 13.220  1.00 98.08  ? 449  PHE A O     1 
ATOM   238   C  CB    . PHE A 1 47  ? 30.315  127.186 11.124  1.00 110.42 ? 449  PHE A CB    1 
ATOM   239   C  CG    . PHE A 1 47  ? 30.666  128.603 11.444  1.00 110.78 ? 449  PHE A CG    1 
ATOM   240   C  CD1   . PHE A 1 47  ? 30.870  129.522 10.424  1.00 113.01 ? 449  PHE A CD1   1 
ATOM   241   C  CD2   . PHE A 1 47  ? 30.773  129.025 12.766  1.00 107.89 ? 449  PHE A CD2   1 
ATOM   242   C  CE1   . PHE A 1 47  ? 31.185  130.837 10.712  1.00 114.42 ? 449  PHE A CE1   1 
ATOM   243   C  CE2   . PHE A 1 47  ? 31.087  130.341 13.070  1.00 107.46 ? 449  PHE A CE2   1 
ATOM   244   C  CZ    . PHE A 1 47  ? 31.298  131.249 12.040  1.00 112.62 ? 449  PHE A CZ    1 
ATOM   245   N  N     . GLN A 1 48  ? 26.986  128.269 11.853  1.00 97.83  ? 450  GLN A N     1 
ATOM   246   C  CA    . GLN A 1 48  ? 26.184  128.811 12.947  1.00 88.34  ? 450  GLN A CA    1 
ATOM   247   C  C     . GLN A 1 48  ? 24.751  128.313 12.849  1.00 88.92  ? 450  GLN A C     1 
ATOM   248   O  O     . GLN A 1 48  ? 24.058  128.565 11.850  1.00 91.10  ? 450  GLN A O     1 
ATOM   249   C  CB    . GLN A 1 48  ? 26.188  130.343 12.933  1.00 75.58  ? 450  GLN A CB    1 
ATOM   250   C  CG    . GLN A 1 48  ? 27.434  130.996 13.504  1.00 76.50  ? 450  GLN A CG    1 
ATOM   251   C  CD    . GLN A 1 48  ? 27.384  132.520 13.440  1.00 80.65  ? 450  GLN A CD    1 
ATOM   252   O  OE1   . GLN A 1 48  ? 26.500  133.098 12.808  1.00 79.58  ? 450  GLN A OE1   1 
ATOM   253   N  NE2   . GLN A 1 48  ? 28.343  133.175 14.091  1.00 82.21  ? 450  GLN A NE2   1 
ATOM   254   N  N     . ALA A 1 49  ? 24.308  127.611 13.890  1.00 82.07  ? 451  ALA A N     1 
ATOM   255   C  CA    . ALA A 1 49  ? 22.929  127.139 13.964  1.00 81.07  ? 451  ALA A CA    1 
ATOM   256   C  C     . ALA A 1 49  ? 22.072  128.031 14.867  1.00 78.73  ? 451  ALA A C     1 
ATOM   257   O  O     . ALA A 1 49  ? 22.590  128.771 15.700  1.00 78.71  ? 451  ALA A O     1 
ATOM   258   C  CB    . ALA A 1 49  ? 22.887  125.711 14.438  1.00 84.58  ? 451  ALA A CB    1 
ATOM   259   N  N     . ILE A 1 50  ? 20.757  127.958 14.692  1.00 73.65  ? 452  ILE A N     1 
ATOM   260   C  CA    . ILE A 1 50  ? 19.847  128.820 15.430  1.00 70.76  ? 452  ILE A CA    1 
ATOM   261   C  C     . ILE A 1 50  ? 18.737  128.001 16.079  1.00 73.93  ? 452  ILE A C     1 
ATOM   262   O  O     . ILE A 1 50  ? 18.059  127.223 15.404  1.00 76.29  ? 452  ILE A O     1 
ATOM   263   C  CB    . ILE A 1 50  ? 19.236  129.893 14.502  1.00 68.85  ? 452  ILE A CB    1 
ATOM   264   C  CG1   . ILE A 1 50  ? 20.350  130.644 13.767  1.00 67.52  ? 452  ILE A CG1   1 
ATOM   265   C  CG2   . ILE A 1 50  ? 18.321  130.858 15.278  1.00 64.40  ? 452  ILE A CG2   1 
ATOM   266   C  CD1   . ILE A 1 50  ? 21.097  131.643 14.626  1.00 68.55  ? 452  ILE A CD1   1 
ATOM   267   N  N     . LEU A 1 51  ? 18.580  128.161 17.393  1.00 69.53  ? 453  LEU A N     1 
ATOM   268   C  CA    . LEU A 1 51  ? 17.486  127.552 18.139  1.00 68.40  ? 453  LEU A CA    1 
ATOM   269   C  C     . LEU A 1 51  ? 16.726  128.677 18.813  1.00 67.36  ? 453  LEU A C     1 
ATOM   270   O  O     . LEU A 1 51  ? 17.227  129.316 19.736  1.00 68.48  ? 453  LEU A O     1 
ATOM   271   C  CB    . LEU A 1 51  ? 18.029  126.580 19.194  1.00 76.19  ? 453  LEU A CB    1 
ATOM   272   C  CG    . LEU A 1 51  ? 17.129  125.469 19.768  1.00 75.96  ? 453  LEU A CG    1 
ATOM   273   C  CD1   . LEU A 1 51  ? 17.913  124.577 20.699  1.00 71.45  ? 453  LEU A CD1   1 
ATOM   274   C  CD2   . LEU A 1 51  ? 15.890  125.998 20.485  1.00 71.13  ? 453  LEU A CD2   1 
ATOM   275   N  N     . PRO A 1 52  ? 15.525  128.972 18.326  1.00 70.31  ? 454  PRO A N     1 
ATOM   276   C  CA    . PRO A 1 52  ? 14.792  130.007 19.062  1.00 74.03  ? 454  PRO A CA    1 
ATOM   277   C  C     . PRO A 1 52  ? 14.144  129.417 20.317  1.00 80.99  ? 454  PRO A C     1 
ATOM   278   O  O     . PRO A 1 52  ? 13.501  128.365 20.258  1.00 89.74  ? 454  PRO A O     1 
ATOM   279   C  CB    . PRO A 1 52  ? 13.712  130.463 18.066  1.00 72.47  ? 454  PRO A CB    1 
ATOM   280   C  CG    . PRO A 1 52  ? 14.089  129.841 16.723  1.00 72.06  ? 454  PRO A CG    1 
ATOM   281   C  CD    . PRO A 1 52  ? 14.898  128.623 17.041  1.00 70.97  ? 454  PRO A CD    1 
ATOM   282   N  N     . LEU A 1 53  ? 14.335  130.081 21.448  1.00 72.03  ? 455  LEU A N     1 
ATOM   283   C  CA    . LEU A 1 53  ? 13.613  129.747 22.657  1.00 65.18  ? 455  LEU A CA    1 
ATOM   284   C  C     . LEU A 1 53  ? 12.341  130.574 22.648  1.00 68.81  ? 455  LEU A C     1 
ATOM   285   O  O     . LEU A 1 53  ? 12.386  131.807 22.708  1.00 67.89  ? 455  LEU A O     1 
ATOM   286   C  CB    . LEU A 1 53  ? 14.435  130.149 23.854  1.00 62.63  ? 455  LEU A CB    1 
ATOM   287   C  CG    . LEU A 1 53  ? 15.809  129.529 23.858  1.00 72.96  ? 455  LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1 53  ? 16.591  130.223 24.942  1.00 78.53  ? 455  LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1 53  ? 15.704  128.005 24.072  1.00 74.48  ? 455  LEU A CD2   1 
ATOM   290   N  N     . ARG A 1 54  ? 11.193  129.917 22.578  1.00 65.99  ? 456  ARG A N     1 
ATOM   291   C  CA    . ARG A 1 54  ? 9.984   130.668 22.330  1.00 66.22  ? 456  ARG A CA    1 
ATOM   292   C  C     . ARG A 1 54  ? 9.207   130.844 23.596  1.00 59.19  ? 456  ARG A C     1 
ATOM   293   O  O     . ARG A 1 54  ? 8.300   130.074 23.879  1.00 64.57  ? 456  ARG A O     1 
ATOM   294   C  CB    . ARG A 1 54  ? 9.140   130.021 21.222  1.00 75.07  ? 456  ARG A CB    1 
ATOM   295   C  CG    . ARG A 1 54  ? 9.478   128.575 20.962  1.00 82.06  ? 456  ARG A CG    1 
ATOM   296   C  CD    . ARG A 1 54  ? 8.783   128.069 19.721  1.00 91.31  ? 456  ARG A CD    1 
ATOM   297   N  NE    . ARG A 1 54  ? 7.460   127.495 19.965  1.00 89.88  ? 456  ARG A NE    1 
ATOM   298   C  CZ    . ARG A 1 54  ? 6.318   128.117 19.687  1.00 89.78  ? 456  ARG A CZ    1 
ATOM   299   N  NH1   . ARG A 1 54  ? 5.165   127.508 19.924  1.00 86.64  ? 456  ARG A NH1   1 
ATOM   300   N  NH2   . ARG A 1 54  ? 6.327   129.344 19.165  1.00 92.81  ? 456  ARG A NH2   1 
ATOM   301   N  N     . GLY A 1 55  ? 9.570   131.885 24.343  1.00 59.94  ? 457  GLY A N     1 
ATOM   302   C  CA    . GLY A 1 55  ? 8.961   132.187 25.630  1.00 61.41  ? 457  GLY A CA    1 
ATOM   303   C  C     . GLY A 1 55  ? 9.897   131.833 26.777  1.00 64.38  ? 457  GLY A C     1 
ATOM   304   O  O     . GLY A 1 55  ? 10.942  131.218 26.557  1.00 68.85  ? 457  GLY A O     1 
ATOM   305   N  N     . LYS A 1 56  ? 9.526   132.210 27.999  1.00 67.78  ? 458  LYS A N     1 
ATOM   306   C  CA    . LYS A 1 56  ? 10.389  131.983 29.163  1.00 72.13  ? 458  LYS A CA    1 
ATOM   307   C  C     . LYS A 1 56  ? 10.679  130.500 29.330  1.00 67.30  ? 458  LYS A C     1 
ATOM   308   O  O     . LYS A 1 56  ? 9.764   129.696 29.374  1.00 60.18  ? 458  LYS A O     1 
ATOM   309   C  CB    . LYS A 1 56  ? 9.780   132.578 30.445  1.00 69.29  ? 458  LYS A CB    1 
ATOM   310   C  CG    . LYS A 1 56  ? 10.091  134.068 30.672  1.00 73.51  ? 458  LYS A CG    1 
ATOM   311   C  CD    . LYS A 1 56  ? 9.522   134.550 32.017  1.00 82.86  ? 458  LYS A CD    1 
ATOM   312   C  CE    . LYS A 1 56  ? 9.538   136.090 32.203  1.00 80.93  ? 458  LYS A CE    1 
ATOM   313   N  NZ    . LYS A 1 56  ? 10.913  136.680 32.257  1.00 76.47  ? 458  LYS A NZ    1 
ATOM   314   N  N     . VAL A 1 57  ? 11.963  130.159 29.405  1.00 69.13  ? 459  VAL A N     1 
ATOM   315   C  CA    . VAL A 1 57  ? 12.428  128.775 29.535  1.00 71.05  ? 459  VAL A CA    1 
ATOM   316   C  C     . VAL A 1 57  ? 12.195  128.145 30.914  1.00 77.97  ? 459  VAL A C     1 
ATOM   317   O  O     . VAL A 1 57  ? 12.379  128.787 31.947  1.00 83.58  ? 459  VAL A O     1 
ATOM   318   C  CB    . VAL A 1 57  ? 13.923  128.686 29.244  1.00 70.42  ? 459  VAL A CB    1 
ATOM   319   C  CG1   . VAL A 1 57  ? 14.494  127.411 29.831  1.00 64.20  ? 459  VAL A CG1   1 
ATOM   320   C  CG2   . VAL A 1 57  ? 14.164  128.759 27.746  1.00 80.25  ? 459  VAL A CG2   1 
ATOM   321   N  N     . ILE A 1 58  ? 11.826  126.870 30.923  1.00 76.20  ? 460  ILE A N     1 
ATOM   322   C  CA    . ILE A 1 58  ? 11.506  126.169 32.162  1.00 73.37  ? 460  ILE A CA    1 
ATOM   323   C  C     . ILE A 1 58  ? 12.629  126.173 33.213  1.00 80.52  ? 460  ILE A C     1 
ATOM   324   O  O     . ILE A 1 58  ? 13.811  125.909 32.909  1.00 81.68  ? 460  ILE A O     1 
ATOM   325   C  CB    . ILE A 1 58  ? 11.093  124.707 31.884  1.00 68.90  ? 460  ILE A CB    1 
ATOM   326   C  CG1   . ILE A 1 58  ? 10.419  124.101 33.114  1.00 66.96  ? 460  ILE A CG1   1 
ATOM   327   C  CG2   . ILE A 1 58  ? 12.302  123.883 31.464  1.00 62.77  ? 460  ILE A CG2   1 
ATOM   328   C  CD1   . ILE A 1 58  ? 10.185  122.636 32.989  1.00 62.82  ? 460  ILE A CD1   1 
ATOM   329   N  N     . ASN A 1 59  ? 12.234  126.459 34.455  1.00 77.29  ? 461  ASN A N     1 
ATOM   330   C  CA    . ASN A 1 59  ? 13.126  126.328 35.603  1.00 82.97  ? 461  ASN A CA    1 
ATOM   331   C  C     . ASN A 1 59  ? 13.412  124.859 35.962  1.00 86.53  ? 461  ASN A C     1 
ATOM   332   O  O     . ASN A 1 59  ? 12.577  124.177 36.582  1.00 86.71  ? 461  ASN A O     1 
ATOM   333   C  CB    . ASN A 1 59  ? 12.558  127.058 36.822  1.00 82.09  ? 461  ASN A CB    1 
ATOM   334   C  CG    . ASN A 1 59  ? 13.579  127.205 37.939  1.00 78.80  ? 461  ASN A CG    1 
ATOM   335   O  OD1   . ASN A 1 59  ? 14.506  126.403 38.053  1.00 77.99  ? 461  ASN A OD1   1 
ATOM   336   N  ND2   . ASN A 1 59  ? 13.428  128.247 38.753  1.00 74.58  ? 461  ASN A ND2   1 
ATOM   337   N  N     . THR A 1 60  ? 14.594  124.387 35.569  1.00 80.63  ? 462  THR A N     1 
ATOM   338   C  CA    . THR A 1 60  ? 15.000  123.009 35.812  1.00 81.39  ? 462  THR A CA    1 
ATOM   339   C  C     . THR A 1 60  ? 15.518  122.734 37.234  1.00 86.89  ? 462  THR A C     1 
ATOM   340   O  O     . THR A 1 60  ? 16.169  121.719 37.478  1.00 92.36  ? 462  THR A O     1 
ATOM   341   C  CB    . THR A 1 60  ? 16.065  122.585 34.800  1.00 81.42  ? 462  THR A CB    1 
ATOM   342   O  OG1   . THR A 1 60  ? 17.136  123.542 34.808  1.00 76.18  ? 462  THR A OG1   1 
ATOM   343   C  CG2   . THR A 1 60  ? 15.457  122.527 33.417  1.00 82.54  ? 462  THR A CG2   1 
ATOM   344   N  N     . ALA A 1 61  ? 15.237  123.639 38.165  1.00 86.14  ? 463  ALA A N     1 
ATOM   345   C  CA    . ALA A 1 61  ? 15.575  123.425 39.572  1.00 84.12  ? 463  ALA A CA    1 
ATOM   346   C  C     . ALA A 1 61  ? 14.325  123.269 40.443  1.00 83.06  ? 463  ALA A C     1 
ATOM   347   O  O     . ALA A 1 61  ? 14.403  122.722 41.539  1.00 91.27  ? 463  ALA A O     1 
ATOM   348   C  CB    . ALA A 1 61  ? 16.451  124.555 40.098  1.00 77.88  ? 463  ALA A CB    1 
ATOM   349   N  N     . LYS A 1 62  ? 13.184  123.747 39.947  1.00 76.64  ? 464  LYS A N     1 
ATOM   350   C  CA    . LYS A 1 62  ? 11.910  123.635 40.651  1.00 83.84  ? 464  LYS A CA    1 
ATOM   351   C  C     . LYS A 1 62  ? 11.048  122.489 40.133  1.00 95.48  ? 464  LYS A C     1 
ATOM   352   O  O     . LYS A 1 62  ? 10.468  121.737 40.914  1.00 103.69 ? 464  LYS A O     1 
ATOM   353   C  CB    . LYS A 1 62  ? 11.101  124.933 40.538  1.00 78.84  ? 464  LYS A CB    1 
ATOM   354   C  CG    . LYS A 1 62  ? 11.801  126.159 41.041  1.00 71.42  ? 464  LYS A CG    1 
ATOM   355   C  CD    . LYS A 1 62  ? 10.857  127.333 41.149  1.00 64.24  ? 464  LYS A CD    1 
ATOM   356   C  CE    . LYS A 1 62  ? 11.637  128.566 41.581  1.00 61.46  ? 464  LYS A CE    1 
ATOM   357   N  NZ    . LYS A 1 62  ? 10.850  129.816 41.457  1.00 67.38  ? 464  LYS A NZ    1 
ATOM   358   N  N     . ALA A 1 63  ? 10.939  122.380 38.815  1.00 95.09  ? 465  ALA A N     1 
ATOM   359   C  CA    . ALA A 1 63  ? 10.020  121.422 38.213  1.00 96.68  ? 465  ALA A CA    1 
ATOM   360   C  C     . ALA A 1 63  ? 10.511  119.990 38.399  1.00 101.68 ? 465  ALA A C     1 
ATOM   361   O  O     . ALA A 1 63  ? 11.694  119.756 38.678  1.00 97.94  ? 465  ALA A O     1 
ATOM   362   C  CB    . ALA A 1 63  ? 9.811   121.739 36.737  1.00 93.66  ? 465  ALA A CB    1 
ATOM   363   N  N     . LYS A 1 64  ? 9.591   119.039 38.259  1.00 108.39 ? 466  LYS A N     1 
ATOM   364   C  CA    . LYS A 1 64  ? 9.923   117.619 38.360  1.00 116.84 ? 466  LYS A CA    1 
ATOM   365   C  C     . LYS A 1 64  ? 10.771  117.169 37.167  1.00 121.24 ? 466  LYS A C     1 
ATOM   366   O  O     . LYS A 1 64  ? 10.716  117.789 36.099  1.00 123.70 ? 466  LYS A O     1 
ATOM   367   C  CB    . LYS A 1 64  ? 8.643   116.781 38.440  1.00 117.28 ? 466  LYS A CB    1 
ATOM   368   N  N     . MET A 1 65  ? 11.556  116.103 37.336  1.00 121.45 ? 467  MET A N     1 
ATOM   369   C  CA    . MET A 1 65  ? 12.320  115.573 36.202  1.00 120.40 ? 467  MET A CA    1 
ATOM   370   C  C     . MET A 1 65  ? 11.353  114.954 35.187  1.00 130.50 ? 467  MET A C     1 
ATOM   371   O  O     . MET A 1 65  ? 11.732  114.651 34.052  1.00 128.61 ? 467  MET A O     1 
ATOM   372   C  CB    . MET A 1 65  ? 13.404  114.574 36.635  1.00 102.49 ? 467  MET A CB    1 
ATOM   373   C  CG    . MET A 1 65  ? 14.672  114.618 35.763  1.00 86.63  ? 467  MET A CG    1 
ATOM   374   N  N     . ALA A 1 66  ? 10.099  114.787 35.614  1.00 135.55 ? 468  ALA A N     1 
ATOM   375   C  CA    . ALA A 1 66  ? 9.009   114.347 34.742  1.00 130.60 ? 468  ALA A CA    1 
ATOM   376   C  C     . ALA A 1 66  ? 8.700   115.424 33.700  1.00 130.05 ? 468  ALA A C     1 
ATOM   377   O  O     . ALA A 1 66  ? 8.894   115.226 32.496  1.00 131.13 ? 468  ALA A O     1 
ATOM   378   C  CB    . ALA A 1 66  ? 7.756   114.022 35.573  1.00 120.77 ? 468  ALA A CB    1 
ATOM   379   N  N     . ASP A 1 67  ? 8.223   116.570 34.176  1.00 123.07 ? 469  ASP A N     1 
ATOM   380   C  CA    . ASP A 1 67  ? 7.930   117.701 33.303  1.00 108.18 ? 469  ASP A CA    1 
ATOM   381   C  C     . ASP A 1 67  ? 9.195   118.243 32.614  1.00 109.89 ? 469  ASP A C     1 
ATOM   382   O  O     . ASP A 1 67  ? 9.121   118.709 31.475  1.00 110.09 ? 469  ASP A O     1 
ATOM   383   C  CB    . ASP A 1 67  ? 7.218   118.808 34.088  1.00 91.94  ? 469  ASP A CB    1 
ATOM   384   C  CG    . ASP A 1 67  ? 5.977   118.311 34.815  1.00 84.46  ? 469  ASP A CG    1 
ATOM   385   N  N     . ILE A 1 68  ? 10.349  118.180 33.292  1.00 109.78 ? 470  ILE A N     1 
ATOM   386   C  CA    . ILE A 1 68  ? 11.611  118.636 32.686  1.00 106.09 ? 470  ILE A CA    1 
ATOM   387   C  C     . ILE A 1 68  ? 11.932  117.851 31.408  1.00 104.40 ? 470  ILE A C     1 
ATOM   388   O  O     . ILE A 1 68  ? 12.436  118.417 30.438  1.00 97.81  ? 470  ILE A O     1 
ATOM   389   C  CB    . ILE A 1 68  ? 12.821  118.621 33.673  1.00 69.60  ? 470  ILE A CB    1 
ATOM   390   N  N     . LEU A 1 69  ? 11.602  116.559 31.394  1.00 112.50 ? 471  LEU A N     1 
ATOM   391   C  CA    . LEU A 1 69  ? 11.856  115.706 30.221  1.00 115.42 ? 471  LEU A CA    1 
ATOM   392   C  C     . LEU A 1 69  ? 10.853  115.930 29.086  1.00 110.19 ? 471  LEU A C     1 
ATOM   393   O  O     . LEU A 1 69  ? 11.229  115.889 27.914  1.00 110.39 ? 471  LEU A O     1 
ATOM   394   C  CB    . LEU A 1 69  ? 11.912  114.216 30.602  1.00 116.21 ? 471  LEU A CB    1 
ATOM   395   N  N     . LYS A 1 70  ? 9.587   116.168 29.439  1.00 102.47 ? 472  LYS A N     1 
ATOM   396   C  CA    . LYS A 1 70  ? 8.528   116.399 28.454  1.00 89.15  ? 472  LYS A CA    1 
ATOM   397   C  C     . LYS A 1 70  ? 8.628   117.774 27.783  1.00 92.17  ? 472  LYS A C     1 
ATOM   398   O  O     . LYS A 1 70  ? 7.853   118.077 26.875  1.00 90.46  ? 472  LYS A O     1 
ATOM   399   C  CB    . LYS A 1 70  ? 7.140   116.232 29.094  1.00 75.56  ? 472  LYS A CB    1 
ATOM   400   N  N     . ASN A 1 71  ? 9.582   118.598 28.218  1.00 96.33  ? 473  ASN A N     1 
ATOM   401   C  CA    . ASN A 1 71  ? 9.652   119.994 27.767  1.00 94.72  ? 473  ASN A CA    1 
ATOM   402   C  C     . ASN A 1 71  ? 10.116  120.159 26.312  1.00 92.95  ? 473  ASN A C     1 
ATOM   403   O  O     . ASN A 1 71  ? 11.094  119.551 25.886  1.00 95.45  ? 473  ASN A O     1 
ATOM   404   C  CB    . ASN A 1 71  ? 10.513  120.840 28.720  1.00 94.51  ? 473  ASN A CB    1 
ATOM   405   C  CG    . ASN A 1 71  ? 10.358  122.341 28.479  1.00 97.64  ? 473  ASN A CG    1 
ATOM   406   O  OD1   . ASN A 1 71  ? 11.300  123.023 28.064  1.00 96.62  ? 473  ASN A OD1   1 
ATOM   407   N  ND2   . ASN A 1 71  ? 9.161   122.859 28.732  1.00 101.79 ? 473  ASN A ND2   1 
ATOM   408   N  N     . GLU A 1 72  ? 9.406   120.982 25.550  1.00 87.22  ? 474  GLU A N     1 
ATOM   409   C  CA    . GLU A 1 72  ? 9.719   121.147 24.141  1.00 81.25  ? 474  GLU A CA    1 
ATOM   410   C  C     . GLU A 1 72  ? 11.123  121.729 23.994  1.00 80.05  ? 474  GLU A C     1 
ATOM   411   O  O     . GLU A 1 72  ? 12.001  121.107 23.392  1.00 90.75  ? 474  GLU A O     1 
ATOM   412   C  CB    . GLU A 1 72  ? 8.667   122.028 23.453  1.00 90.10  ? 474  GLU A CB    1 
ATOM   413   C  CG    . GLU A 1 72  ? 8.640   121.939 21.911  1.00 105.11 ? 474  GLU A CG    1 
ATOM   414   C  CD    . GLU A 1 72  ? 7.581   122.848 21.260  1.00 115.45 ? 474  GLU A CD    1 
ATOM   415   O  OE1   . GLU A 1 72  ? 6.375   122.658 21.543  1.00 121.98 ? 474  GLU A OE1   1 
ATOM   416   O  OE2   . GLU A 1 72  ? 7.950   123.754 20.470  1.00 112.95 ? 474  GLU A OE2   1 
ATOM   417   N  N     . GLU A 1 73  ? 11.341  122.909 24.569  1.00 77.56  ? 475  GLU A N     1 
ATOM   418   C  CA    . GLU A 1 73  ? 12.622  123.612 24.435  1.00 82.45  ? 475  GLU A CA    1 
ATOM   419   C  C     . GLU A 1 73  ? 13.823  122.809 24.960  1.00 83.65  ? 475  GLU A C     1 
ATOM   420   O  O     . GLU A 1 73  ? 14.820  122.677 24.244  1.00 80.07  ? 475  GLU A O     1 
ATOM   421   C  CB    . GLU A 1 73  ? 12.564  124.991 25.096  1.00 87.73  ? 475  GLU A CB    1 
ATOM   422   C  CG    . GLU A 1 73  ? 11.146  125.503 25.344  1.00 97.14  ? 475  GLU A CG    1 
ATOM   423   C  CD    . GLU A 1 73  ? 10.644  126.469 24.272  1.00 104.94 ? 475  GLU A CD    1 
ATOM   424   O  OE1   . GLU A 1 73  ? 9.499   126.945 24.414  1.00 105.72 ? 475  GLU A OE1   1 
ATOM   425   O  OE2   . GLU A 1 73  ? 11.382  126.760 23.302  1.00 108.56 ? 475  GLU A OE2   1 
ATOM   426   N  N     . ILE A 1 74  ? 13.727  122.285 26.192  1.00 83.86  ? 476  ILE A N     1 
ATOM   427   C  CA    . ILE A 1 74  ? 14.763  121.398 26.771  1.00 85.50  ? 476  ILE A CA    1 
ATOM   428   C  C     . ILE A 1 74  ? 15.140  120.208 25.853  1.00 87.78  ? 476  ILE A C     1 
ATOM   429   O  O     . ILE A 1 74  ? 16.321  119.986 25.546  1.00 85.34  ? 476  ILE A O     1 
ATOM   430   C  CB    . ILE A 1 74  ? 14.366  120.852 28.202  1.00 72.40  ? 476  ILE A CB    1 
ATOM   431   C  CG1   . ILE A 1 74  ? 14.295  121.981 29.219  1.00 66.07  ? 476  ILE A CG1   1 
ATOM   432   C  CG2   . ILE A 1 74  ? 15.401  119.856 28.721  1.00 69.59  ? 476  ILE A CG2   1 
ATOM   433   C  CD1   . ILE A 1 74  ? 15.649  122.546 29.513  1.00 66.86  ? 476  ILE A CD1   1 
ATOM   434   N  N     . ASN A 1 75  ? 14.134  119.442 25.428  1.00 89.39  ? 477  ASN A N     1 
ATOM   435   C  CA    . ASN A 1 75  ? 14.357  118.266 24.590  1.00 93.32  ? 477  ASN A CA    1 
ATOM   436   C  C     . ASN A 1 75  ? 15.214  118.579 23.383  1.00 95.35  ? 477  ASN A C     1 
ATOM   437   O  O     . ASN A 1 75  ? 16.273  117.981 23.192  1.00 94.66  ? 477  ASN A O     1 
ATOM   438   C  CB    . ASN A 1 75  ? 13.028  117.664 24.132  1.00 97.68  ? 477  ASN A CB    1 
ATOM   439   C  CG    . ASN A 1 75  ? 12.726  116.355 24.821  1.00 110.65 ? 477  ASN A CG    1 
ATOM   440   O  OD1   . ASN A 1 75  ? 12.911  115.283 24.245  1.00 119.73 ? 477  ASN A OD1   1 
ATOM   441   N  ND2   . ASN A 1 75  ? 12.287  116.428 26.076  1.00 113.03 ? 477  ASN A ND2   1 
ATOM   442   N  N     . THR A 1 76  ? 14.757  119.535 22.582  1.00 95.43  ? 478  THR A N     1 
ATOM   443   C  CA    . THR A 1 76  ? 15.426  119.862 21.334  1.00 94.96  ? 478  THR A CA    1 
ATOM   444   C  C     . THR A 1 76  ? 16.864  120.394 21.535  1.00 92.33  ? 478  THR A C     1 
ATOM   445   O  O     . THR A 1 76  ? 17.701  120.253 20.641  1.00 96.45  ? 478  THR A O     1 
ATOM   446   C  CB    . THR A 1 76  ? 14.551  120.789 20.442  1.00 92.44  ? 478  THR A CB    1 
ATOM   447   O  OG1   . THR A 1 76  ? 14.738  122.153 20.827  1.00 103.43 ? 478  THR A OG1   1 
ATOM   448   C  CG2   . THR A 1 76  ? 13.054  120.410 20.553  1.00 78.17  ? 478  THR A CG2   1 
ATOM   449   N  N     . MET A 1 77  ? 17.161  120.971 22.704  1.00 88.28  ? 479  MET A N     1 
ATOM   450   C  CA    . MET A 1 77  ? 18.558  121.281 23.080  1.00 87.68  ? 479  MET A CA    1 
ATOM   451   C  C     . MET A 1 77  ? 19.367  120.010 23.390  1.00 94.52  ? 479  MET A C     1 
ATOM   452   O  O     . MET A 1 77  ? 20.535  119.896 22.989  1.00 87.48  ? 479  MET A O     1 
ATOM   453   C  CB    . MET A 1 77  ? 18.649  122.231 24.287  1.00 70.12  ? 479  MET A CB    1 
ATOM   454   C  CG    . MET A 1 77  ? 17.955  123.572 24.115  1.00 78.85  ? 479  MET A CG    1 
ATOM   455   S  SD    . MET A 1 77  ? 18.015  124.634 25.586  1.00 94.24  ? 479  MET A SD    1 
ATOM   456   C  CE    . MET A 1 77  ? 19.773  124.987 25.666  1.00 82.73  ? 479  MET A CE    1 
ATOM   457   N  N     . ILE A 1 78  ? 18.757  119.065 24.114  1.00 103.40 ? 480  ILE A N     1 
ATOM   458   C  CA    . ILE A 1 78  ? 19.449  117.824 24.477  1.00 106.34 ? 480  ILE A CA    1 
ATOM   459   C  C     . ILE A 1 78  ? 19.642  116.951 23.231  1.00 107.46 ? 480  ILE A C     1 
ATOM   460   O  O     . ILE A 1 78  ? 20.526  116.100 23.207  1.00 120.97 ? 480  ILE A O     1 
ATOM   461   C  CB    . ILE A 1 78  ? 18.764  117.051 25.663  1.00 76.86  ? 480  ILE A CB    1 
ATOM   462   N  N     . TYR A 1 79  ? 18.849  117.201 22.183  1.00 99.83  ? 481  TYR A N     1 
ATOM   463   C  CA    . TYR A 1 79  ? 18.928  116.437 20.929  1.00 94.69  ? 481  TYR A CA    1 
ATOM   464   C  C     . TYR A 1 79  ? 19.733  117.109 19.816  1.00 90.64  ? 481  TYR A C     1 
ATOM   465   O  O     . TYR A 1 79  ? 20.271  116.420 18.948  1.00 86.38  ? 481  TYR A O     1 
ATOM   466   C  CB    . TYR A 1 79  ? 17.534  116.100 20.391  1.00 91.99  ? 481  TYR A CB    1 
ATOM   467   N  N     . THR A 1 80  ? 19.790  118.441 19.813  1.00 93.58  ? 482  THR A N     1 
ATOM   468   C  CA    . THR A 1 80  ? 20.602  119.153 18.816  1.00 98.55  ? 482  THR A CA    1 
ATOM   469   C  C     . THR A 1 80  ? 22.067  119.141 19.225  1.00 97.34  ? 482  THR A C     1 
ATOM   470   O  O     . THR A 1 80  ? 22.957  119.113 18.382  1.00 100.07 ? 482  THR A O     1 
ATOM   471   C  CB    . THR A 1 80  ? 20.153  120.625 18.582  1.00 75.39  ? 482  THR A CB    1 
ATOM   472   N  N     . ILE A 1 81  ? 22.313  119.167 20.527  1.00 93.52  ? 483  ILE A N     1 
ATOM   473   C  CA    . ILE A 1 81  ? 23.674  119.179 21.028  1.00 90.37  ? 483  ILE A CA    1 
ATOM   474   C  C     . ILE A 1 81  ? 24.201  117.763 20.921  1.00 97.25  ? 483  ILE A C     1 
ATOM   475   O  O     . ILE A 1 81  ? 25.381  117.553 20.661  1.00 103.02 ? 483  ILE A O     1 
ATOM   476   C  CB    . ILE A 1 81  ? 23.758  119.720 22.489  1.00 88.00  ? 483  ILE A CB    1 
ATOM   477   C  CG1   . ILE A 1 81  ? 23.544  121.248 22.520  1.00 82.59  ? 483  ILE A CG1   1 
ATOM   478   C  CG2   . ILE A 1 81  ? 25.080  119.343 23.128  1.00 81.55  ? 483  ILE A CG2   1 
ATOM   479   C  CD1   . ILE A 1 81  ? 23.628  121.881 23.901  1.00 76.26  ? 483  ILE A CD1   1 
ATOM   480   N  N     . GLY A 1 82  ? 23.311  116.790 21.101  1.00 104.29 ? 484  GLY A N     1 
ATOM   481   C  CA    . GLY A 1 82  ? 23.653  115.386 20.915  1.00 114.95 ? 484  GLY A CA    1 
ATOM   482   C  C     . GLY A 1 82  ? 24.800  114.839 21.752  1.00 116.97 ? 484  GLY A C     1 
ATOM   483   O  O     . GLY A 1 82  ? 25.735  114.213 21.227  1.00 105.95 ? 484  GLY A O     1 
ATOM   484   N  N     . ALA A 1 83  ? 24.718  115.068 23.062  1.00 123.31 ? 485  ALA A N     1 
ATOM   485   C  CA    . ALA A 1 83  ? 25.704  114.542 23.993  1.00 122.70 ? 485  ALA A CA    1 
ATOM   486   C  C     . ALA A 1 83  ? 25.018  113.795 25.122  1.00 121.31 ? 485  ALA A C     1 
ATOM   487   O  O     . ALA A 1 83  ? 25.679  113.156 25.935  1.00 130.50 ? 485  ALA A O     1 
ATOM   488   C  CB    . ALA A 1 83  ? 26.572  115.659 24.546  1.00 118.97 ? 485  ALA A CB    1 
ATOM   489   N  N     . GLY A 1 84  ? 23.691  113.865 25.167  1.00 112.05 ? 486  GLY A N     1 
ATOM   490   C  CA    . GLY A 1 84  ? 22.950  113.217 26.235  1.00 114.55 ? 486  GLY A CA    1 
ATOM   491   C  C     . GLY A 1 84  ? 22.867  114.115 27.456  1.00 114.84 ? 486  GLY A C     1 
ATOM   492   O  O     . GLY A 1 84  ? 23.587  115.112 27.544  1.00 118.92 ? 486  GLY A O     1 
ATOM   493   N  N     . VAL A 1 85  ? 21.992  113.773 28.398  1.00 105.89 ? 487  VAL A N     1 
ATOM   494   C  CA    . VAL A 1 85  ? 21.718  114.662 29.523  1.00 100.11 ? 487  VAL A CA    1 
ATOM   495   C  C     . VAL A 1 85  ? 22.187  114.079 30.855  1.00 106.67 ? 487  VAL A C     1 
ATOM   496   O  O     . VAL A 1 85  ? 22.475  112.883 30.966  1.00 103.12 ? 487  VAL A O     1 
ATOM   497   C  CB    . VAL A 1 85  ? 20.222  115.022 29.611  1.00 81.13  ? 487  VAL A CB    1 
ATOM   498   N  N     . GLY A 1 86  ? 22.271  114.946 31.860  1.00 112.12 ? 488  GLY A N     1 
ATOM   499   C  CA    . GLY A 1 86  ? 22.599  114.540 33.215  1.00 115.81 ? 488  GLY A CA    1 
ATOM   500   C  C     . GLY A 1 86  ? 23.920  113.816 33.378  1.00 119.58 ? 488  GLY A C     1 
ATOM   501   O  O     . GLY A 1 86  ? 24.972  114.306 32.960  1.00 122.01 ? 488  GLY A O     1 
ATOM   502   N  N     . ALA A 1 87  ? 23.861  112.640 33.997  1.00 120.01 ? 489  ALA A N     1 
ATOM   503   C  CA    . ALA A 1 87  ? 25.067  111.895 34.333  1.00 117.77 ? 489  ALA A CA    1 
ATOM   504   C  C     . ALA A 1 87  ? 25.631  111.104 33.154  1.00 120.81 ? 489  ALA A C     1 
ATOM   505   O  O     . ALA A 1 87  ? 26.804  110.737 33.169  1.00 121.68 ? 489  ALA A O     1 
ATOM   506   C  CB    . ALA A 1 87  ? 24.812  110.986 35.515  1.00 114.78 ? 489  ALA A CB    1 
ATOM   507   N  N     . ASP A 1 88  ? 24.795  110.848 32.143  1.00 127.69 ? 490  ASP A N     1 
ATOM   508   C  CA    . ASP A 1 88  ? 25.219  110.157 30.910  1.00 131.65 ? 490  ASP A CA    1 
ATOM   509   C  C     . ASP A 1 88  ? 25.761  111.131 29.859  1.00 132.17 ? 490  ASP A C     1 
ATOM   510   O  O     . ASP A 1 88  ? 25.567  110.929 28.663  1.00 135.48 ? 490  ASP A O     1 
ATOM   511   C  CB    . ASP A 1 88  ? 24.058  109.361 30.293  1.00 125.30 ? 490  ASP A CB    1 
ATOM   512   C  CG    . ASP A 1 88  ? 23.600  108.214 31.167  1.00 121.06 ? 490  ASP A CG    1 
ATOM   513   N  N     . PHE A 1 89  ? 26.440  112.181 30.311  1.00 126.88 ? 491  PHE A N     1 
ATOM   514   C  CA    . PHE A 1 89  ? 26.873  113.256 29.424  1.00 118.69 ? 491  PHE A CA    1 
ATOM   515   C  C     . PHE A 1 89  ? 28.361  113.173 29.097  1.00 113.63 ? 491  PHE A C     1 
ATOM   516   O  O     . PHE A 1 89  ? 29.207  113.454 29.947  1.00 104.29 ? 491  PHE A O     1 
ATOM   517   C  CB    . PHE A 1 89  ? 26.538  114.620 30.042  1.00 116.40 ? 491  PHE A CB    1 
ATOM   518   C  CG    . PHE A 1 89  ? 26.863  115.794 29.155  1.00 120.50 ? 491  PHE A CG    1 
ATOM   519   C  CD1   . PHE A 1 89  ? 25.942  116.254 28.221  1.00 119.25 ? 491  PHE A CD1   1 
ATOM   520   C  CD2   . PHE A 1 89  ? 28.081  116.448 29.262  1.00 123.55 ? 491  PHE A CD2   1 
ATOM   521   C  CE1   . PHE A 1 89  ? 26.232  117.341 27.403  1.00 114.93 ? 491  PHE A CE1   1 
ATOM   522   C  CE2   . PHE A 1 89  ? 28.378  117.537 28.448  1.00 121.98 ? 491  PHE A CE2   1 
ATOM   523   C  CZ    . PHE A 1 89  ? 27.451  117.983 27.519  1.00 117.05 ? 491  PHE A CZ    1 
ATOM   524   N  N     . SER A 1 90  ? 28.665  112.781 27.860  1.00 118.79 ? 492  SER A N     1 
ATOM   525   C  CA    . SER A 1 90  ? 30.030  112.789 27.350  1.00 123.62 ? 492  SER A CA    1 
ATOM   526   C  C     . SER A 1 90  ? 30.273  114.004 26.439  1.00 125.96 ? 492  SER A C     1 
ATOM   527   O  O     . SER A 1 90  ? 29.874  113.999 25.273  1.00 129.84 ? 492  SER A O     1 
ATOM   528   C  CB    . SER A 1 90  ? 30.331  111.482 26.605  1.00 121.95 ? 492  SER A CB    1 
ATOM   529   N  N     . ILE A 1 91  ? 30.919  115.039 26.983  1.00 118.84 ? 493  ILE A N     1 
ATOM   530   C  CA    . ILE A 1 91  ? 31.312  116.225 26.213  1.00 109.99 ? 493  ILE A CA    1 
ATOM   531   C  C     . ILE A 1 91  ? 31.947  115.848 24.881  1.00 112.23 ? 493  ILE A C     1 
ATOM   532   O  O     . ILE A 1 91  ? 31.754  116.531 23.877  1.00 107.46 ? 493  ILE A O     1 
ATOM   533   C  CB    . ILE A 1 91  ? 32.328  117.100 26.983  1.00 94.65  ? 493  ILE A CB    1 
ATOM   534   N  N     . GLU A 1 92  ? 32.710  114.755 24.886  1.00 119.90 ? 494  GLU A N     1 
ATOM   535   C  CA    . GLU A 1 92  ? 33.470  114.317 23.717  1.00 118.54 ? 494  GLU A CA    1 
ATOM   536   C  C     . GLU A 1 92  ? 32.592  114.213 22.460  1.00 125.18 ? 494  GLU A C     1 
ATOM   537   O  O     . GLU A 1 92  ? 32.942  114.745 21.407  1.00 125.87 ? 494  GLU A O     1 
ATOM   538   C  CB    . GLU A 1 92  ? 34.195  112.994 24.015  1.00 107.59 ? 494  GLU A CB    1 
ATOM   539   N  N     . ASP A 1 93  ? 31.444  113.549 22.580  1.00 125.14 ? 495  ASP A N     1 
ATOM   540   C  CA    . ASP A 1 93  ? 30.549  113.340 21.442  1.00 116.41 ? 495  ASP A CA    1 
ATOM   541   C  C     . ASP A 1 93  ? 29.493  114.453 21.309  1.00 124.48 ? 495  ASP A C     1 
ATOM   542   O  O     . ASP A 1 93  ? 28.305  114.173 21.114  1.00 125.50 ? 495  ASP A O     1 
ATOM   543   C  CB    . ASP A 1 93  ? 29.884  111.958 21.526  1.00 101.89 ? 495  ASP A CB    1 
ATOM   544   N  N     . ALA A 1 94  ? 29.937  115.710 21.406  1.00 127.33 ? 496  ALA A N     1 
ATOM   545   C  CA    . ALA A 1 94  ? 29.056  116.882 21.269  1.00 117.59 ? 496  ALA A CA    1 
ATOM   546   C  C     . ALA A 1 94  ? 28.826  117.286 19.805  1.00 125.31 ? 496  ALA A C     1 
ATOM   547   O  O     . ALA A 1 94  ? 29.059  116.488 18.887  1.00 134.83 ? 496  ALA A O     1 
ATOM   548   C  CB    . ALA A 1 94  ? 29.609  118.069 22.064  1.00 99.10  ? 496  ALA A CB    1 
ATOM   549   N  N     . ASN A 1 95  ? 28.371  118.526 19.600  1.00 115.73 ? 497  ASN A N     1 
ATOM   550   C  CA    . ASN A 1 95  ? 28.114  119.064 18.257  1.00 107.20 ? 497  ASN A CA    1 
ATOM   551   C  C     . ASN A 1 95  ? 28.506  120.545 18.096  1.00 102.80 ? 497  ASN A C     1 
ATOM   552   O  O     . ASN A 1 95  ? 28.421  121.110 16.995  1.00 99.99  ? 497  ASN A O     1 
ATOM   553   C  CB    . ASN A 1 95  ? 26.642  118.884 17.857  1.00 101.93 ? 497  ASN A CB    1 
ATOM   554   C  CG    . ASN A 1 95  ? 26.297  117.455 17.449  1.00 99.69  ? 497  ASN A CG    1 
ATOM   555   O  OD1   . ASN A 1 95  ? 27.169  116.648 17.099  1.00 108.81 ? 497  ASN A OD1   1 
ATOM   556   N  ND2   . ASN A 1 95  ? 25.003  117.146 17.471  1.00 87.92  ? 497  ASN A ND2   1 
ATOM   557   N  N     . TYR A 1 96  ? 28.928  121.177 19.187  1.00 99.67  ? 498  TYR A N     1 
ATOM   558   C  CA    . TYR A 1 96  ? 29.377  122.562 19.112  1.00 102.23 ? 498  TYR A CA    1 
ATOM   559   C  C     . TYR A 1 96  ? 30.613  122.835 19.979  1.00 109.15 ? 498  TYR A C     1 
ATOM   560   O  O     . TYR A 1 96  ? 30.924  122.076 20.903  1.00 108.10 ? 498  TYR A O     1 
ATOM   561   C  CB    . TYR A 1 96  ? 28.216  123.514 19.444  1.00 102.57 ? 498  TYR A CB    1 
ATOM   562   C  CG    . TYR A 1 96  ? 26.972  123.205 18.630  1.00 102.79 ? 498  TYR A CG    1 
ATOM   563   C  CD1   . TYR A 1 96  ? 26.024  122.303 19.096  1.00 100.89 ? 498  TYR A CD1   1 
ATOM   564   C  CD2   . TYR A 1 96  ? 26.763  123.786 17.381  1.00 102.39 ? 498  TYR A CD2   1 
ATOM   565   C  CE1   . TYR A 1 96  ? 24.896  121.997 18.353  1.00 98.93  ? 498  TYR A CE1   1 
ATOM   566   C  CE2   . TYR A 1 96  ? 25.634  123.479 16.625  1.00 99.51  ? 498  TYR A CE2   1 
ATOM   567   C  CZ    . TYR A 1 96  ? 24.707  122.581 17.120  1.00 97.54  ? 498  TYR A CZ    1 
ATOM   568   O  OH    . TYR A 1 96  ? 23.583  122.258 16.395  1.00 91.59  ? 498  TYR A OH    1 
ATOM   569   N  N     . ASP A 1 97  ? 31.322  123.910 19.638  1.00 117.22 ? 499  ASP A N     1 
ATOM   570   C  CA    . ASP A 1 97  ? 32.497  124.386 20.377  1.00 124.84 ? 499  ASP A CA    1 
ATOM   571   C  C     . ASP A 1 97  ? 32.107  125.565 21.287  1.00 115.27 ? 499  ASP A C     1 
ATOM   572   O  O     . ASP A 1 97  ? 32.777  125.867 22.284  1.00 106.86 ? 499  ASP A O     1 
ATOM   573   C  CB    . ASP A 1 97  ? 33.602  124.792 19.378  1.00 133.87 ? 499  ASP A CB    1 
ATOM   574   C  CG    . ASP A 1 97  ? 34.538  125.876 19.919  1.00 139.50 ? 499  ASP A CG    1 
ATOM   575   O  OD1   . ASP A 1 97  ? 34.969  125.785 21.088  1.00 144.90 ? 499  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A 1 97  ? 34.848  126.824 19.164  1.00 137.81 ? 499  ASP A OD2   1 
ATOM   577   N  N     . LYS A 1 98  ? 31.005  126.213 20.930  1.00 108.13 ? 500  LYS A N     1 
ATOM   578   C  CA    . LYS A 1 98  ? 30.527  127.397 21.620  1.00 101.25 ? 500  LYS A CA    1 
ATOM   579   C  C     . LYS A 1 98  ? 29.013  127.352 21.634  1.00 100.05 ? 500  LYS A C     1 
ATOM   580   O  O     . LYS A 1 98  ? 28.387  127.224 20.589  1.00 107.49 ? 500  LYS A O     1 
ATOM   581   C  CB    . LYS A 1 98  ? 31.008  128.666 20.898  1.00 96.82  ? 500  LYS A CB    1 
ATOM   582   C  CG    . LYS A 1 98  ? 32.488  128.962 21.092  1.00 99.85  ? 500  LYS A CG    1 
ATOM   583   C  CD    . LYS A 1 98  ? 33.031  129.948 20.081  1.00 99.27  ? 500  LYS A CD    1 
ATOM   584   C  CE    . LYS A 1 98  ? 34.554  129.896 20.091  1.00 104.68 ? 500  LYS A CE    1 
ATOM   585   N  NZ    . LYS A 1 98  ? 35.166  130.516 18.885  1.00 105.35 ? 500  LYS A NZ    1 
ATOM   586   N  N     . ILE A 1 99  ? 28.419  127.433 22.815  1.00 90.95  ? 501  ILE A N     1 
ATOM   587   C  CA    . ILE A 1 99  ? 26.971  127.529 22.910  1.00 82.71  ? 501  ILE A CA    1 
ATOM   588   C  C     . ILE A 1 99  ? 26.726  128.956 23.351  1.00 81.76  ? 501  ILE A C     1 
ATOM   589   O  O     . ILE A 1 99  ? 27.241  129.380 24.379  1.00 89.07  ? 501  ILE A O     1 
ATOM   590   C  CB    . ILE A 1 99  ? 26.405  126.483 23.895  1.00 78.83  ? 501  ILE A CB    1 
ATOM   591   C  CG1   . ILE A 1 99  ? 27.039  125.113 23.603  1.00 82.96  ? 501  ILE A CG1   1 
ATOM   592   C  CG2   . ILE A 1 99  ? 24.900  126.397 23.809  1.00 73.01  ? 501  ILE A CG2   1 
ATOM   593   C  CD1   . ILE A 1 99  ? 26.036  123.988 23.368  1.00 83.01  ? 501  ILE A CD1   1 
ATOM   594   N  N     . ILE A 1 100 ? 25.992  129.718 22.548  1.00 76.91  ? 502  ILE A N     1 
ATOM   595   C  CA    . ILE A 1 100 ? 25.932  131.161 22.736  1.00 81.83  ? 502  ILE A CA    1 
ATOM   596   C  C     . ILE A 1 100 ? 24.514  131.618 22.976  1.00 85.69  ? 502  ILE A C     1 
ATOM   597   O  O     . ILE A 1 100 ? 23.682  131.574 22.064  1.00 84.34  ? 502  ILE A O     1 
ATOM   598   C  CB    . ILE A 1 100 ? 26.497  131.935 21.521  1.00 86.31  ? 502  ILE A CB    1 
ATOM   599   C  CG1   . ILE A 1 100 ? 27.820  131.312 21.045  1.00 96.29  ? 502  ILE A CG1   1 
ATOM   600   C  CG2   . ILE A 1 100 ? 26.696  133.397 21.873  1.00 82.14  ? 502  ILE A CG2   1 
ATOM   601   C  CD1   . ILE A 1 100 ? 28.546  132.075 19.924  1.00 96.22  ? 502  ILE A CD1   1 
ATOM   602   N  N     . ILE A 1 101 ? 24.251  132.065 24.205  1.00 84.29  ? 503  ILE A N     1 
ATOM   603   C  CA    . ILE A 1 101 ? 22.935  132.556 24.588  1.00 77.98  ? 503  ILE A CA    1 
ATOM   604   C  C     . ILE A 1 101 ? 22.777  134.044 24.295  1.00 77.59  ? 503  ILE A C     1 
ATOM   605   O  O     . ILE A 1 101 ? 23.557  134.869 24.783  1.00 75.46  ? 503  ILE A O     1 
ATOM   606   C  CB    . ILE A 1 101 ? 22.678  132.349 26.062  1.00 77.67  ? 503  ILE A CB    1 
ATOM   607   C  CG1   . ILE A 1 101 ? 22.828  130.872 26.426  1.00 73.81  ? 503  ILE A CG1   1 
ATOM   608   C  CG2   . ILE A 1 101 ? 21.299  132.887 26.419  1.00 76.17  ? 503  ILE A CG2   1 
ATOM   609   C  CD1   . ILE A 1 101 ? 22.998  130.649 27.902  1.00 70.95  ? 503  ILE A CD1   1 
ATOM   610   N  N     . MET A 1 102 ? 21.746  134.375 23.517  1.00 79.47  ? 504  MET A N     1 
ATOM   611   C  CA    . MET A 1 102 ? 21.584  135.716 22.963  1.00 82.46  ? 504  MET A CA    1 
ATOM   612   C  C     . MET A 1 102 ? 20.177  136.269 23.190  1.00 85.83  ? 504  MET A C     1 
ATOM   613   O  O     . MET A 1 102 ? 19.233  135.886 22.493  1.00 88.57  ? 504  MET A O     1 
ATOM   614   C  CB    . MET A 1 102 ? 21.897  135.695 21.459  1.00 84.89  ? 504  MET A CB    1 
ATOM   615   C  CG    . MET A 1 102 ? 21.945  137.080 20.829  1.00 90.21  ? 504  MET A CG    1 
ATOM   616   S  SD    . MET A 1 102 ? 22.349  137.123 19.071  1.00 94.75  ? 504  MET A SD    1 
ATOM   617   C  CE    . MET A 1 102 ? 20.852  136.471 18.332  1.00 77.98  ? 504  MET A CE    1 
ATOM   618   N  N     . THR A 1 103 ? 20.031  137.176 24.150  1.00 84.88  ? 505  THR A N     1 
ATOM   619   C  CA    . THR A 1 103 ? 18.706  137.707 24.478  1.00 79.65  ? 505  THR A CA    1 
ATOM   620   C  C     . THR A 1 103 ? 18.657  139.224 24.382  1.00 76.08  ? 505  THR A C     1 
ATOM   621   O  O     . THR A 1 103 ? 19.698  139.860 24.209  1.00 76.88  ? 505  THR A O     1 
ATOM   622   C  CB    . THR A 1 103 ? 18.265  137.311 25.911  1.00 70.60  ? 505  THR A CB    1 
ATOM   623   O  OG1   . THR A 1 103 ? 19.164  137.879 26.880  1.00 66.35  ? 505  THR A OG1   1 
ATOM   624   C  CG2   . THR A 1 103 ? 18.238  135.806 26.061  1.00 72.33  ? 505  THR A CG2   1 
ATOM   625   N  N     . ASP A 1 104 ? 17.448  139.787 24.502  1.00 77.28  ? 506  ASP A N     1 
ATOM   626   C  CA    . ASP A 1 104 ? 17.254  141.230 24.686  1.00 76.05  ? 506  ASP A CA    1 
ATOM   627   C  C     . ASP A 1 104 ? 18.197  141.688 25.806  1.00 72.95  ? 506  ASP A C     1 
ATOM   628   O  O     . ASP A 1 104 ? 18.426  140.956 26.779  1.00 64.97  ? 506  ASP A O     1 
ATOM   629   C  CB    . ASP A 1 104 ? 15.812  141.545 25.121  1.00 79.74  ? 506  ASP A CB    1 
ATOM   630   C  CG    . ASP A 1 104 ? 14.776  141.452 23.984  1.00 91.15  ? 506  ASP A CG    1 
ATOM   631   O  OD1   . ASP A 1 104 ? 15.114  140.972 22.868  1.00 87.24  ? 506  ASP A OD1   1 
ATOM   632   O  OD2   . ASP A 1 104 ? 13.600  141.862 24.241  1.00 103.54 ? 506  ASP A OD2   1 
ATOM   633   N  N     . ALA A 1 105 ? 18.760  142.883 25.689  1.00 73.85  ? 507  ALA A N     1 
ATOM   634   C  CA    . ALA A 1 105 ? 19.483  143.428 26.830  1.00 68.68  ? 507  ALA A CA    1 
ATOM   635   C  C     . ALA A 1 105 ? 18.451  144.105 27.740  1.00 71.00  ? 507  ALA A C     1 
ATOM   636   O  O     . ALA A 1 105 ? 18.551  145.290 28.047  1.00 73.10  ? 507  ALA A O     1 
ATOM   637   C  CB    . ALA A 1 105 ? 20.549  144.404 26.383  1.00 59.44  ? 507  ALA A CB    1 
ATOM   638   N  N     . ASP A 1 106 ? 17.416  143.360 28.117  1.00 69.75  ? 508  ASP A N     1 
ATOM   639   C  CA    . ASP A 1 106 ? 16.398  143.878 29.026  1.00 69.31  ? 508  ASP A CA    1 
ATOM   640   C  C     . ASP A 1 106 ? 16.330  142.970 30.263  1.00 71.61  ? 508  ASP A C     1 
ATOM   641   O  O     . ASP A 1 106 ? 17.144  142.042 30.393  1.00 67.71  ? 508  ASP A O     1 
ATOM   642   C  CB    . ASP A 1 106 ? 15.021  144.165 28.337  1.00 56.65  ? 508  ASP A CB    1 
ATOM   643   C  CG    . ASP A 1 106 ? 14.363  142.925 27.672  1.00 85.77  ? 508  ASP A CG    1 
ATOM   644   O  OD1   . ASP A 1 106 ? 14.642  141.767 28.085  1.00 75.29  ? 508  ASP A OD1   1 
ATOM   645   O  OD2   . ASP A 1 106 ? 13.526  143.129 26.736  1.00 96.51  ? 508  ASP A OD2   1 
ATOM   646   N  N     . THR A 1 107 ? 15.405  143.251 31.181  1.00 71.54  ? 509  THR A N     1 
ATOM   647   C  CA    . THR A 1 107 ? 15.351  142.490 32.418  1.00 70.08  ? 509  THR A CA    1 
ATOM   648   C  C     . THR A 1 107 ? 14.919  141.062 32.169  1.00 63.60  ? 509  THR A C     1 
ATOM   649   O  O     . THR A 1 107 ? 15.509  140.144 32.727  1.00 68.28  ? 509  THR A O     1 
ATOM   650   C  CB    . THR A 1 107 ? 14.436  143.128 33.469  1.00 79.66  ? 509  THR A CB    1 
ATOM   651   O  OG1   . THR A 1 107 ? 13.086  143.125 32.995  1.00 85.87  ? 509  THR A OG1   1 
ATOM   652   C  CG2   . THR A 1 107 ? 14.876  144.552 33.751  1.00 85.23  ? 509  THR A CG2   1 
ATOM   653   N  N     . ASP A 1 108 ? 13.904  140.869 31.331  1.00 54.61  ? 510  ASP A N     1 
ATOM   654   C  CA    . ASP A 1 108 ? 13.437  139.521 31.018  1.00 59.75  ? 510  ASP A CA    1 
ATOM   655   C  C     . ASP A 1 108 ? 14.462  138.687 30.272  1.00 67.05  ? 510  ASP A C     1 
ATOM   656   O  O     . ASP A 1 108 ? 14.460  137.458 30.380  1.00 69.07  ? 510  ASP A O     1 
ATOM   657   C  CB    . ASP A 1 108 ? 12.160  139.553 30.210  1.00 68.80  ? 510  ASP A CB    1 
ATOM   658   C  CG    . ASP A 1 108 ? 11.068  140.318 30.901  1.00 76.89  ? 510  ASP A CG    1 
ATOM   659   O  OD1   . ASP A 1 108 ? 10.334  139.686 31.708  1.00 70.41  ? 510  ASP A OD1   1 
ATOM   660   O  OD2   . ASP A 1 108 ? 10.952  141.547 30.629  1.00 84.43  ? 510  ASP A OD2   1 
ATOM   661   N  N     . GLY A 1 109 ? 15.323  139.338 29.496  1.00 66.96  ? 511  GLY A N     1 
ATOM   662   C  CA    . GLY A 1 109 ? 16.424  138.619 28.878  1.00 72.99  ? 511  GLY A CA    1 
ATOM   663   C  C     . GLY A 1 109 ? 17.327  138.096 29.986  1.00 75.47  ? 511  GLY A C     1 
ATOM   664   O  O     . GLY A 1 109 ? 17.781  136.937 29.980  1.00 70.92  ? 511  GLY A O     1 
ATOM   665   N  N     . ALA A 1 110 ? 17.581  138.976 30.950  1.00 68.18  ? 512  ALA A N     1 
ATOM   666   C  CA    . ALA A 1 110 ? 18.383  138.646 32.103  1.00 63.71  ? 512  ALA A CA    1 
ATOM   667   C  C     . ALA A 1 110 ? 17.811  137.391 32.741  1.00 67.68  ? 512  ALA A C     1 
ATOM   668   O  O     . ALA A 1 110 ? 18.522  136.420 32.993  1.00 63.97  ? 512  ALA A O     1 
ATOM   669   C  CB    . ALA A 1 110 ? 18.358  139.790 33.063  1.00 58.37  ? 512  ALA A CB    1 
ATOM   670   N  N     . HIS A 1 111 ? 16.507  137.404 32.981  1.00 66.89  ? 513  HIS A N     1 
ATOM   671   C  CA    . HIS A 1 111 ? 15.853  136.248 33.569  1.00 67.96  ? 513  HIS A CA    1 
ATOM   672   C  C     . HIS A 1 111 ? 16.140  134.993 32.730  1.00 69.21  ? 513  HIS A C     1 
ATOM   673   O  O     . HIS A 1 111 ? 16.638  133.989 33.262  1.00 65.97  ? 513  HIS A O     1 
ATOM   674   C  CB    . HIS A 1 111 ? 14.355  136.517 33.734  1.00 67.92  ? 513  HIS A CB    1 
ATOM   675   C  CG    . HIS A 1 111 ? 13.615  135.442 34.468  1.00 64.68  ? 513  HIS A CG    1 
ATOM   676   N  ND1   . HIS A 1 111 ? 12.278  135.181 34.253  1.00 62.44  ? 513  HIS A ND1   1 
ATOM   677   C  CD2   . HIS A 1 111 ? 14.021  134.564 35.408  1.00 62.23  ? 513  HIS A CD2   1 
ATOM   678   C  CE1   . HIS A 1 111 ? 11.896  134.177 35.021  1.00 61.39  ? 513  HIS A CE1   1 
ATOM   679   N  NE2   . HIS A 1 111 ? 12.934  133.790 35.736  1.00 66.23  ? 513  HIS A NE2   1 
ATOM   680   N  N     . ILE A 1 112 ? 15.862  135.079 31.422  1.00 66.14  ? 514  ILE A N     1 
ATOM   681   C  CA    . ILE A 1 112 ? 16.054  133.962 30.491  1.00 63.91  ? 514  ILE A CA    1 
ATOM   682   C  C     . ILE A 1 112 ? 17.459  133.350 30.544  1.00 68.37  ? 514  ILE A C     1 
ATOM   683   O  O     . ILE A 1 112 ? 17.597  132.121 30.580  1.00 75.53  ? 514  ILE A O     1 
ATOM   684   C  CB    . ILE A 1 112 ? 15.648  134.327 29.047  1.00 56.99  ? 514  ILE A CB    1 
ATOM   685   C  CG1   . ILE A 1 112 ? 14.160  134.085 28.859  1.00 62.57  ? 514  ILE A CG1   1 
ATOM   686   C  CG2   . ILE A 1 112 ? 16.361  133.462 28.039  1.00 58.00  ? 514  ILE A CG2   1 
ATOM   687   C  CD1   . ILE A 1 112 ? 13.507  135.030 27.830  1.00 65.34  ? 514  ILE A CD1   1 
ATOM   688   N  N     . GLN A 1 113 ? 18.498  134.183 30.556  1.00 65.15  ? 515  GLN A N     1 
ATOM   689   C  CA    . GLN A 1 113 ? 19.862  133.668 30.719  1.00 71.94  ? 515  GLN A CA    1 
ATOM   690   C  C     . GLN A 1 113 ? 19.971  132.860 32.004  1.00 82.96  ? 515  GLN A C     1 
ATOM   691   O  O     . GLN A 1 113 ? 20.501  131.749 32.022  1.00 88.72  ? 515  GLN A O     1 
ATOM   692   C  CB    . GLN A 1 113 ? 20.871  134.809 30.745  1.00 68.06  ? 515  GLN A CB    1 
ATOM   693   C  CG    . GLN A 1 113 ? 20.595  135.862 29.693  1.00 70.99  ? 515  GLN A CG    1 
ATOM   694   C  CD    . GLN A 1 113 ? 21.643  136.943 29.675  1.00 70.68  ? 515  GLN A CD    1 
ATOM   695   O  OE1   . GLN A 1 113 ? 22.630  136.878 30.400  1.00 68.23  ? 515  GLN A OE1   1 
ATOM   696   N  NE2   . GLN A 1 113 ? 21.435  137.947 28.844  1.00 71.08  ? 515  GLN A NE2   1 
ATOM   697   N  N     . THR A 1 114 ? 19.451  133.438 33.077  1.00 86.01  ? 516  THR A N     1 
ATOM   698   C  CA    . THR A 1 114 ? 19.421  132.807 34.386  1.00 84.92  ? 516  THR A CA    1 
ATOM   699   C  C     . THR A 1 114 ? 18.852  131.394 34.351  1.00 83.00  ? 516  THR A C     1 
ATOM   700   O  O     . THR A 1 114 ? 19.372  130.501 35.010  1.00 90.56  ? 516  THR A O     1 
ATOM   701   C  CB    . THR A 1 114 ? 18.585  133.654 35.365  1.00 81.01  ? 516  THR A CB    1 
ATOM   702   O  OG1   . THR A 1 114 ? 19.457  134.520 36.107  1.00 77.96  ? 516  THR A OG1   1 
ATOM   703   C  CG2   . THR A 1 114 ? 17.788  132.758 36.309  1.00 77.22  ? 516  THR A CG2   1 
ATOM   704   N  N     . LEU A 1 115 ? 17.776  131.202 33.595  1.00 77.06  ? 517  LEU A N     1 
ATOM   705   C  CA    . LEU A 1 115 ? 17.108  129.907 33.524  1.00 73.56  ? 517  LEU A CA    1 
ATOM   706   C  C     . LEU A 1 115 ? 17.908  128.915 32.691  1.00 80.82  ? 517  LEU A C     1 
ATOM   707   O  O     . LEU A 1 115 ? 17.876  127.701 32.939  1.00 91.34  ? 517  LEU A O     1 
ATOM   708   C  CB    . LEU A 1 115 ? 15.718  130.070 32.918  1.00 67.55  ? 517  LEU A CB    1 
ATOM   709   C  CG    . LEU A 1 115 ? 14.774  130.924 33.755  1.00 67.61  ? 517  LEU A CG    1 
ATOM   710   C  CD1   . LEU A 1 115 ? 13.816  131.714 32.874  1.00 57.51  ? 517  LEU A CD1   1 
ATOM   711   C  CD2   . LEU A 1 115 ? 14.028  130.009 34.746  1.00 70.93  ? 517  LEU A CD2   1 
ATOM   712   N  N     . LEU A 1 116 ? 18.611  129.433 31.692  1.00 76.09  ? 518  LEU A N     1 
ATOM   713   C  CA    . LEU A 1 116 ? 19.366  128.578 30.787  1.00 82.69  ? 518  LEU A CA    1 
ATOM   714   C  C     . LEU A 1 116 ? 20.584  128.106 31.515  1.00 89.30  ? 518  LEU A C     1 
ATOM   715   O  O     . LEU A 1 116 ? 20.901  126.915 31.504  1.00 92.61  ? 518  LEU A O     1 
ATOM   716   C  CB    . LEU A 1 116 ? 19.772  129.325 29.513  1.00 83.41  ? 518  LEU A CB    1 
ATOM   717   C  CG    . LEU A 1 116 ? 18.656  129.451 28.474  1.00 80.10  ? 518  LEU A CG    1 
ATOM   718   C  CD1   . LEU A 1 116 ? 19.005  130.507 27.451  1.00 76.98  ? 518  LEU A CD1   1 
ATOM   719   C  CD2   . LEU A 1 116 ? 18.414  128.095 27.830  1.00 78.03  ? 518  LEU A CD2   1 
ATOM   720   N  N     . LEU A 1 117 ? 21.258  129.055 32.159  1.00 88.17  ? 519  LEU A N     1 
ATOM   721   C  CA    . LEU A 1 117 ? 22.456  128.758 32.928  1.00 87.92  ? 519  LEU A CA    1 
ATOM   722   C  C     . LEU A 1 117 ? 22.199  127.669 33.983  1.00 85.89  ? 519  LEU A C     1 
ATOM   723   O  O     . LEU A 1 117 ? 23.014  126.753 34.141  1.00 81.14  ? 519  LEU A O     1 
ATOM   724   C  CB    . LEU A 1 117 ? 23.056  130.043 33.532  1.00 85.74  ? 519  LEU A CB    1 
ATOM   725   C  CG    . LEU A 1 117 ? 23.862  130.956 32.581  1.00 78.50  ? 519  LEU A CG    1 
ATOM   726   C  CD1   . LEU A 1 117 ? 24.516  132.132 33.307  1.00 72.27  ? 519  LEU A CD1   1 
ATOM   727   C  CD2   . LEU A 1 117 ? 24.930  130.163 31.828  1.00 74.36  ? 519  LEU A CD2   1 
ATOM   728   N  N     . THR A 1 118 ? 21.061  127.738 34.677  1.00 83.46  ? 520  THR A N     1 
ATOM   729   C  CA    . THR A 1 118 ? 20.765  126.728 35.693  1.00 86.32  ? 520  THR A CA    1 
ATOM   730   C  C     . THR A 1 118 ? 20.512  125.388 35.040  1.00 82.17  ? 520  THR A C     1 
ATOM   731   O  O     . THR A 1 118 ? 20.731  124.351 35.648  1.00 83.46  ? 520  THR A O     1 
ATOM   732   C  CB    . THR A 1 118 ? 19.565  127.070 36.601  1.00 88.77  ? 520  THR A CB    1 
ATOM   733   O  OG1   . THR A 1 118 ? 18.347  126.907 35.865  1.00 98.45  ? 520  THR A OG1   1 
ATOM   734   C  CG2   . THR A 1 118 ? 19.682  128.490 37.170  1.00 80.74  ? 520  THR A CG2   1 
ATOM   735   N  N     . PHE A 1 119 ? 20.054  125.398 33.799  1.00 85.10  ? 521  PHE A N     1 
ATOM   736   C  CA    . PHE A 1 119 ? 19.977  124.139 33.066  1.00 89.53  ? 521  PHE A CA    1 
ATOM   737   C  C     . PHE A 1 119 ? 21.352  123.565 32.705  1.00 86.79  ? 521  PHE A C     1 
ATOM   738   O  O     . PHE A 1 119 ? 21.545  122.350 32.753  1.00 78.17  ? 521  PHE A O     1 
ATOM   739   C  CB    . PHE A 1 119 ? 19.139  124.271 31.807  1.00 80.12  ? 521  PHE A CB    1 
ATOM   740   C  CG    . PHE A 1 119 ? 19.134  123.033 30.965  1.00 84.65  ? 521  PHE A CG    1 
ATOM   741   C  CD1   . PHE A 1 119 ? 18.352  121.943 31.316  1.00 83.90  ? 521  PHE A CD1   1 
ATOM   742   C  CD2   . PHE A 1 119 ? 19.913  122.955 29.811  1.00 88.28  ? 521  PHE A CD2   1 
ATOM   743   C  CE1   . PHE A 1 119 ? 18.338  120.802 30.525  1.00 81.99  ? 521  PHE A CE1   1 
ATOM   744   C  CE2   . PHE A 1 119 ? 19.910  121.818 29.023  1.00 80.26  ? 521  PHE A CE2   1 
ATOM   745   C  CZ    . PHE A 1 119 ? 19.119  120.742 29.382  1.00 79.85  ? 521  PHE A CZ    1 
ATOM   746   N  N     . PHE A 1 120 ? 22.294  124.437 32.344  1.00 91.22  ? 522  PHE A N     1 
ATOM   747   C  CA    . PHE A 1 120 ? 23.638  124.014 31.939  1.00 99.68  ? 522  PHE A CA    1 
ATOM   748   C  C     . PHE A 1 120 ? 24.568  123.769 33.122  1.00 110.49 ? 522  PHE A C     1 
ATOM   749   O  O     . PHE A 1 120 ? 25.653  123.191 32.967  1.00 114.96 ? 522  PHE A O     1 
ATOM   750   C  CB    . PHE A 1 120 ? 24.282  125.033 30.993  1.00 98.79  ? 522  PHE A CB    1 
ATOM   751   C  CG    . PHE A 1 120 ? 23.631  125.107 29.648  1.00 92.38  ? 522  PHE A CG    1 
ATOM   752   C  CD1   . PHE A 1 120 ? 23.355  123.953 28.930  1.00 92.51  ? 522  PHE A CD1   1 
ATOM   753   C  CD2   . PHE A 1 120 ? 23.281  126.330 29.106  1.00 90.68  ? 522  PHE A CD2   1 
ATOM   754   C  CE1   . PHE A 1 120 ? 22.742  124.018 27.689  1.00 96.12  ? 522  PHE A CE1   1 
ATOM   755   C  CE2   . PHE A 1 120 ? 22.669  126.402 27.868  1.00 93.67  ? 522  PHE A CE2   1 
ATOM   756   C  CZ    . PHE A 1 120 ? 22.399  125.243 27.156  1.00 96.00  ? 522  PHE A CZ    1 
ATOM   757   N  N     . TYR A 1 121 ? 24.155  124.224 34.300  1.00 111.72 ? 523  TYR A N     1 
ATOM   758   C  CA    . TYR A 1 121 ? 24.902  123.915 35.510  1.00 107.93 ? 523  TYR A CA    1 
ATOM   759   C  C     . TYR A 1 121 ? 24.396  122.616 36.134  1.00 103.71 ? 523  TYR A C     1 
ATOM   760   O  O     . TYR A 1 121 ? 25.139  121.944 36.835  1.00 110.77 ? 523  TYR A O     1 
ATOM   761   C  CB    . TYR A 1 121 ? 24.840  125.058 36.531  1.00 101.09 ? 523  TYR A CB    1 
ATOM   762   C  CG    . TYR A 1 121 ? 25.340  124.622 37.879  1.00 98.10  ? 523  TYR A CG    1 
ATOM   763   C  CD1   . TYR A 1 121 ? 26.696  124.455 38.106  1.00 103.34 ? 523  TYR A CD1   1 
ATOM   764   C  CD2   . TYR A 1 121 ? 24.455  124.333 38.916  1.00 96.61  ? 523  TYR A CD2   1 
ATOM   765   C  CE1   . TYR A 1 121 ? 27.171  124.028 39.333  1.00 110.74 ? 523  TYR A CE1   1 
ATOM   766   C  CE2   . TYR A 1 121 ? 24.918  123.903 40.154  1.00 102.79 ? 523  TYR A CE2   1 
ATOM   767   C  CZ    . TYR A 1 121 ? 26.281  123.753 40.356  1.00 109.38 ? 523  TYR A CZ    1 
ATOM   768   O  OH    . TYR A 1 121 ? 26.769  123.329 41.573  1.00 107.76 ? 523  TYR A OH    1 
ATOM   769   N  N     . ARG A 1 122 ? 23.137  122.267 35.868  1.00 91.79  ? 524  ARG A N     1 
ATOM   770   C  CA    . ARG A 1 122 ? 22.503  121.112 36.502  1.00 81.76  ? 524  ARG A CA    1 
ATOM   771   C  C     . ARG A 1 122 ? 22.590  119.852 35.664  1.00 84.87  ? 524  ARG A C     1 
ATOM   772   O  O     . ARG A 1 122 ? 22.712  118.757 36.199  1.00 89.50  ? 524  ARG A O     1 
ATOM   773   C  CB    . ARG A 1 122 ? 21.026  121.389 36.822  1.00 81.71  ? 524  ARG A CB    1 
ATOM   774   C  CG    . ARG A 1 122 ? 20.745  122.167 38.118  1.00 87.55  ? 524  ARG A CG    1 
ATOM   775   C  CD    . ARG A 1 122 ? 21.039  121.326 39.356  1.00 99.91  ? 524  ARG A CD    1 
ATOM   776   N  NE    . ARG A 1 122 ? 20.006  121.405 40.393  1.00 94.82  ? 524  ARG A NE    1 
ATOM   777   C  CZ    . ARG A 1 122 ? 18.715  121.159 40.192  1.00 91.34  ? 524  ARG A CZ    1 
ATOM   778   N  NH1   . ARG A 1 122 ? 18.262  120.843 38.979  1.00 82.11  ? 524  ARG A NH1   1 
ATOM   779   N  NH2   . ARG A 1 122 ? 17.870  121.249 41.210  1.00 99.29  ? 524  ARG A NH2   1 
ATOM   780   N  N     . TYR A 1 123 ? 22.509  119.989 34.348  1.00 88.43  ? 525  TYR A N     1 
ATOM   781   C  CA    . TYR A 1 123 ? 22.345  118.808 33.505  1.00 95.52  ? 525  TYR A CA    1 
ATOM   782   C  C     . TYR A 1 123 ? 23.386  118.688 32.401  1.00 93.95  ? 525  TYR A C     1 
ATOM   783   O  O     . TYR A 1 123 ? 23.292  117.800 31.561  1.00 90.56  ? 525  TYR A O     1 
ATOM   784   C  CB    . TYR A 1 123 ? 20.920  118.752 32.925  1.00 99.82  ? 525  TYR A CB    1 
ATOM   785   C  CG    . TYR A 1 123 ? 19.848  118.521 33.971  1.00 95.49  ? 525  TYR A CG    1 
ATOM   786   C  CD1   . TYR A 1 123 ? 19.312  119.582 34.682  1.00 93.20  ? 525  TYR A CD1   1 
ATOM   787   C  CD2   . TYR A 1 123 ? 19.387  117.236 34.255  1.00 97.21  ? 525  TYR A CD2   1 
ATOM   788   C  CE1   . TYR A 1 123 ? 18.347  119.377 35.652  1.00 101.07 ? 525  TYR A CE1   1 
ATOM   789   C  CE2   . TYR A 1 123 ? 18.413  117.015 35.214  1.00 102.07 ? 525  TYR A CE2   1 
ATOM   790   C  CZ    . TYR A 1 123 ? 17.897  118.091 35.918  1.00 107.98 ? 525  TYR A CZ    1 
ATOM   791   O  OH    . TYR A 1 123 ? 16.932  117.887 36.891  1.00 111.18 ? 525  TYR A OH    1 
ATOM   792   N  N     . MET A 1 124 ? 24.368  119.585 32.405  1.00 97.08  ? 526  MET A N     1 
ATOM   793   C  CA    . MET A 1 124 ? 25.486  119.529 31.464  1.00 100.83 ? 526  MET A CA    1 
ATOM   794   C  C     . MET A 1 124 ? 26.690  120.236 32.067  1.00 102.14 ? 526  MET A C     1 
ATOM   795   O  O     . MET A 1 124 ? 27.372  120.991 31.372  1.00 95.40  ? 526  MET A O     1 
ATOM   796   C  CB    . MET A 1 124 ? 25.123  120.192 30.126  1.00 102.98 ? 526  MET A CB    1 
ATOM   797   C  CG    . MET A 1 124 ? 23.948  119.538 29.385  1.00 110.15 ? 526  MET A CG    1 
ATOM   798   S  SD    . MET A 1 124 ? 23.421  120.305 27.823  1.00 85.84  ? 526  MET A SD    1 
ATOM   799   C  CE    . MET A 1 124 ? 24.962  120.315 26.905  1.00 154.44 ? 526  MET A CE    1 
ATOM   800   N  N     . ARG A 1 125 ? 26.948  119.989 33.356  1.00 105.04 ? 527  ARG A N     1 
ATOM   801   C  CA    . ARG A 1 125 ? 27.977  120.730 34.097  1.00 102.83 ? 527  ARG A CA    1 
ATOM   802   C  C     . ARG A 1 125 ? 29.330  120.763 33.377  1.00 105.67 ? 527  ARG A C     1 
ATOM   803   O  O     . ARG A 1 125 ? 30.017  121.787 33.393  1.00 99.81  ? 527  ARG A O     1 
ATOM   804   C  CB    . ARG A 1 125 ? 28.133  120.215 35.538  1.00 84.37  ? 527  ARG A CB    1 
ATOM   805   N  N     . PRO A 1 126 ? 29.713  119.646 32.733  1.00 110.28 ? 528  PRO A N     1 
ATOM   806   C  CA    . PRO A 1 126 ? 30.996  119.581 32.017  1.00 111.28 ? 528  PRO A CA    1 
ATOM   807   C  C     . PRO A 1 126 ? 31.119  120.671 30.946  1.00 109.73 ? 528  PRO A C     1 
ATOM   808   O  O     . PRO A 1 126 ? 32.198  121.245 30.770  1.00 108.24 ? 528  PRO A O     1 
ATOM   809   C  CB    . PRO A 1 126 ? 30.963  118.195 31.368  1.00 111.58 ? 528  PRO A CB    1 
ATOM   810   C  CG    . PRO A 1 126 ? 30.007  117.405 32.215  1.00 111.77 ? 528  PRO A CG    1 
ATOM   811   C  CD    . PRO A 1 126 ? 28.966  118.378 32.653  1.00 109.62 ? 528  PRO A CD    1 
ATOM   812   N  N     . LEU A 1 127 ? 30.016  120.949 30.252  1.00 103.50 ? 529  LEU A N     1 
ATOM   813   C  CA    . LEU A 1 127 ? 29.994  121.964 29.207  1.00 95.61  ? 529  LEU A CA    1 
ATOM   814   C  C     . LEU A 1 127 ? 30.333  123.353 29.745  1.00 96.89  ? 529  LEU A C     1 
ATOM   815   O  O     . LEU A 1 127 ? 31.065  124.104 29.101  1.00 94.83  ? 529  LEU A O     1 
ATOM   816   C  CB    . LEU A 1 127 ? 28.637  121.988 28.490  1.00 92.86  ? 529  LEU A CB    1 
ATOM   817   C  CG    . LEU A 1 127 ? 28.630  121.721 26.976  1.00 89.36  ? 529  LEU A CG    1 
ATOM   818   C  CD1   . LEU A 1 127 ? 27.514  122.496 26.291  1.00 80.31  ? 529  LEU A CD1   1 
ATOM   819   C  CD2   . LEU A 1 127 ? 29.987  122.028 26.335  1.00 88.87  ? 529  LEU A CD2   1 
ATOM   820   N  N     . VAL A 1 128 ? 29.799  123.699 30.917  1.00 105.03 ? 530  VAL A N     1 
ATOM   821   C  CA    . VAL A 1 128 ? 30.078  125.009 31.515  1.00 109.65 ? 530  VAL A CA    1 
ATOM   822   C  C     . VAL A 1 128 ? 31.485  125.056 32.137  1.00 109.62 ? 530  VAL A C     1 
ATOM   823   O  O     . VAL A 1 128 ? 32.119  126.112 32.169  1.00 108.68 ? 530  VAL A O     1 
ATOM   824   C  CB    . VAL A 1 128 ? 28.974  125.469 32.528  1.00 79.25  ? 530  VAL A CB    1 
ATOM   825   N  N     . GLU A 1 129 ? 31.985  123.912 32.600  1.00 110.91 ? 531  GLU A N     1 
ATOM   826   C  CA    . GLU A 1 129 ? 33.300  123.881 33.248  1.00 115.25 ? 531  GLU A CA    1 
ATOM   827   C  C     . GLU A 1 129 ? 34.423  123.971 32.220  1.00 116.58 ? 531  GLU A C     1 
ATOM   828   O  O     . GLU A 1 129 ? 35.525  124.421 32.532  1.00 118.98 ? 531  GLU A O     1 
ATOM   829   C  CB    . GLU A 1 129 ? 33.469  122.650 34.158  1.00 113.26 ? 531  GLU A CB    1 
ATOM   830   N  N     . ALA A 1 130 ? 34.135  123.546 30.993  1.00 113.59 ? 532  ALA A N     1 
ATOM   831   C  CA    . ALA A 1 130 ? 35.091  123.665 29.897  1.00 115.10 ? 532  ALA A CA    1 
ATOM   832   C  C     . ALA A 1 130 ? 34.867  124.954 29.080  1.00 122.91 ? 532  ALA A C     1 
ATOM   833   O  O     . ALA A 1 130 ? 35.372  125.099 27.963  1.00 122.64 ? 532  ALA A O     1 
ATOM   834   C  CB    . ALA A 1 130 ? 35.027  122.438 29.007  1.00 109.83 ? 532  ALA A CB    1 
ATOM   835   N  N     . GLY A 1 131 ? 34.098  125.881 29.647  1.00 127.31 ? 533  GLY A N     1 
ATOM   836   C  CA    . GLY A 1 131 ? 33.897  127.196 29.058  1.00 122.61 ? 533  GLY A CA    1 
ATOM   837   C  C     . GLY A 1 131 ? 33.363  127.225 27.637  1.00 111.92 ? 533  GLY A C     1 
ATOM   838   O  O     . GLY A 1 131 ? 33.817  128.017 26.809  1.00 106.13 ? 533  GLY A O     1 
ATOM   839   N  N     . HIS A 1 132 ? 32.386  126.373 27.357  1.00 108.30 ? 534  HIS A N     1 
ATOM   840   C  CA    . HIS A 1 132 ? 31.758  126.345 26.041  1.00 106.22 ? 534  HIS A CA    1 
ATOM   841   C  C     . HIS A 1 132 ? 30.449  127.155 25.988  1.00 96.35  ? 534  HIS A C     1 
ATOM   842   O  O     . HIS A 1 132 ? 29.826  127.308 24.932  1.00 87.66  ? 534  HIS A O     1 
ATOM   843   C  CB    . HIS A 1 132 ? 31.541  124.897 25.599  1.00 107.57 ? 534  HIS A CB    1 
ATOM   844   C  CG    . HIS A 1 132 ? 32.799  124.205 25.178  1.00 113.07 ? 534  HIS A CG    1 
ATOM   845   N  ND1   . HIS A 1 132 ? 34.040  124.802 25.263  1.00 116.50 ? 534  HIS A ND1   1 
ATOM   846   C  CD2   . HIS A 1 132 ? 33.008  122.974 24.654  1.00 115.25 ? 534  HIS A CD2   1 
ATOM   847   C  CE1   . HIS A 1 132 ? 34.960  123.965 24.818  1.00 118.64 ? 534  HIS A CE1   1 
ATOM   848   N  NE2   . HIS A 1 132 ? 34.359  122.849 24.442  1.00 119.62 ? 534  HIS A NE2   1 
ATOM   849   N  N     . VAL A 1 133 ? 30.040  127.682 27.135  1.00 91.01  ? 535  VAL A N     1 
ATOM   850   C  CA    . VAL A 1 133 ? 28.823  128.461 27.190  1.00 86.91  ? 535  VAL A CA    1 
ATOM   851   C  C     . VAL A 1 133 ? 29.176  129.949 27.268  1.00 92.45  ? 535  VAL A C     1 
ATOM   852   O  O     . VAL A 1 133 ? 29.955  130.365 28.123  1.00 97.73  ? 535  VAL A O     1 
ATOM   853   C  CB    . VAL A 1 133 ? 27.930  128.028 28.370  1.00 84.53  ? 535  VAL A CB    1 
ATOM   854   C  CG1   . VAL A 1 133 ? 26.648  128.788 28.335  1.00 85.31  ? 535  VAL A CG1   1 
ATOM   855   C  CG2   . VAL A 1 133 ? 27.630  126.545 28.308  1.00 76.09  ? 535  VAL A CG2   1 
ATOM   856   N  N     . TYR A 1 134 ? 28.622  130.741 26.354  1.00 93.66  ? 536  TYR A N     1 
ATOM   857   C  CA    . TYR A 1 134 ? 28.893  132.175 26.302  1.00 95.64  ? 536  TYR A CA    1 
ATOM   858   C  C     . TYR A 1 134 ? 27.608  132.984 26.384  1.00 101.14 ? 536  TYR A C     1 
ATOM   859   O  O     . TYR A 1 134 ? 26.503  132.440 26.415  1.00 102.03 ? 536  TYR A O     1 
ATOM   860   C  CB    . TYR A 1 134 ? 29.621  132.555 25.005  1.00 93.66  ? 536  TYR A CB    1 
ATOM   861   C  CG    . TYR A 1 134 ? 30.933  131.845 24.776  1.00 88.30  ? 536  TYR A CG    1 
ATOM   862   C  CD1   . TYR A 1 134 ? 30.959  130.509 24.400  1.00 88.04  ? 536  TYR A CD1   1 
ATOM   863   C  CD2   . TYR A 1 134 ? 32.143  132.510 24.918  1.00 85.77  ? 536  TYR A CD2   1 
ATOM   864   C  CE1   . TYR A 1 134 ? 32.148  129.847 24.184  1.00 93.37  ? 536  TYR A CE1   1 
ATOM   865   C  CE2   . TYR A 1 134 ? 33.350  131.853 24.701  1.00 94.12  ? 536  TYR A CE2   1 
ATOM   866   C  CZ    . TYR A 1 134 ? 33.345  130.514 24.332  1.00 96.74  ? 536  TYR A CZ    1 
ATOM   867   O  OH    . TYR A 1 134 ? 34.530  129.830 24.103  1.00 96.90  ? 536  TYR A OH    1 
ATOM   868   N  N     . ILE A 1 135 ? 27.766  134.300 26.390  1.00 106.37 ? 537  ILE A N     1 
ATOM   869   C  CA    . ILE A 1 135 ? 26.632  135.205 26.444  1.00 109.57 ? 537  ILE A CA    1 
ATOM   870   C  C     . ILE A 1 135 ? 26.865  136.415 25.540  1.00 114.96 ? 537  ILE A C     1 
ATOM   871   O  O     . ILE A 1 135 ? 27.698  137.287 25.824  1.00 122.18 ? 537  ILE A O     1 
ATOM   872   C  CB    . ILE A 1 135 ? 26.344  135.645 27.891  1.00 106.03 ? 537  ILE A CB    1 
ATOM   873   C  CG1   . ILE A 1 135 ? 25.748  134.478 28.677  1.00 99.58  ? 537  ILE A CG1   1 
ATOM   874   C  CG2   . ILE A 1 135 ? 25.409  136.847 27.919  1.00 104.96 ? 537  ILE A CG2   1 
ATOM   875   C  CD1   . ILE A 1 135 ? 25.455  134.815 30.114  1.00 96.62  ? 537  ILE A CD1   1 
ATOM   876   N  N     . ALA A 1 136 ? 26.123  136.448 24.440  1.00 104.53 ? 538  ALA A N     1 
ATOM   877   C  CA    . ALA A 1 136 ? 26.242  137.519 23.464  1.00 94.04  ? 538  ALA A CA    1 
ATOM   878   C  C     . ALA A 1 136 ? 25.659  138.794 24.016  1.00 96.28  ? 538  ALA A C     1 
ATOM   879   O  O     . ALA A 1 136 ? 24.464  138.872 24.284  1.00 103.67 ? 538  ALA A O     1 
ATOM   880   C  CB    . ALA A 1 136 ? 25.536  137.144 22.176  1.00 90.10  ? 538  ALA A CB    1 
ATOM   881   N  N     . LEU A 1 137 ? 26.511  139.791 24.193  1.00 74.54  ? 539  LEU A N     1 
ATOM   882   C  CA    . LEU A 1 137 ? 26.055  141.117 24.568  1.00 80.90  ? 539  LEU A CA    1 
ATOM   883   C  C     . LEU A 1 137 ? 25.717  141.920 23.307  1.00 93.77  ? 539  LEU A C     1 
ATOM   884   O  O     . LEU A 1 137 ? 26.600  142.211 22.495  1.00 99.57  ? 539  LEU A O     1 
ATOM   885   C  CB    . LEU A 1 137 ? 27.131  141.833 25.384  1.00 74.35  ? 539  LEU A CB    1 
ATOM   886   C  CG    . LEU A 1 137 ? 27.775  141.045 26.530  1.00 66.08  ? 539  LEU A CG    1 
ATOM   887   N  N     . PRO A 1 138 ? 24.429  142.247 23.119  1.00 95.79  ? 540  PRO A N     1 
ATOM   888   C  CA    . PRO A 1 138 ? 24.047  143.157 22.038  1.00 89.30  ? 540  PRO A CA    1 
ATOM   889   C  C     . PRO A 1 138 ? 24.149  144.596 22.527  1.00 83.37  ? 540  PRO A C     1 
ATOM   890   O  O     . PRO A 1 138 ? 24.072  144.837 23.734  1.00 80.89  ? 540  PRO A O     1 
ATOM   891   C  CB    . PRO A 1 138 ? 22.580  142.797 21.768  1.00 86.89  ? 540  PRO A CB    1 
ATOM   892   C  CG    . PRO A 1 138 ? 22.293  141.593 22.634  1.00 90.41  ? 540  PRO A CG    1 
ATOM   893   C  CD    . PRO A 1 138 ? 23.247  141.663 23.766  1.00 92.69  ? 540  PRO A CD    1 
ATOM   894   N  N     . PRO A 1 139 ? 24.296  145.544 21.595  1.00 79.00  ? 541  PRO A N     1 
ATOM   895   C  CA    . PRO A 1 139 ? 24.567  146.954 21.889  1.00 78.34  ? 541  PRO A CA    1 
ATOM   896   C  C     . PRO A 1 139 ? 23.372  147.620 22.539  1.00 81.19  ? 541  PRO A C     1 
ATOM   897   O  O     . PRO A 1 139 ? 22.241  147.215 22.278  1.00 87.23  ? 541  PRO A O     1 
ATOM   898   C  CB    . PRO A 1 139 ? 24.780  147.557 20.497  1.00 77.23  ? 541  PRO A CB    1 
ATOM   899   C  CG    . PRO A 1 139 ? 23.896  146.732 19.610  1.00 80.94  ? 541  PRO A CG    1 
ATOM   900   C  CD    . PRO A 1 139 ? 23.946  145.329 20.177  1.00 81.49  ? 541  PRO A CD    1 
ATOM   901   N  N     . LEU A 1 140 ? 23.622  148.638 23.356  1.00 78.02  ? 542  LEU A N     1 
ATOM   902   C  CA    . LEU A 1 140 ? 22.553  149.435 23.957  1.00 75.39  ? 542  LEU A CA    1 
ATOM   903   C  C     . LEU A 1 140 ? 22.185  150.693 23.121  1.00 87.62  ? 542  LEU A C     1 
ATOM   904   O  O     . LEU A 1 140 ? 21.020  151.107 23.099  1.00 90.43  ? 542  LEU A O     1 
ATOM   905   C  CB    . LEU A 1 140 ? 22.904  149.812 25.413  1.00 64.11  ? 542  LEU A CB    1 
ATOM   906   C  CG    . LEU A 1 140 ? 23.026  148.708 26.471  1.00 51.63  ? 542  LEU A CG    1 
ATOM   907   N  N     . TYR A 1 141 ? 23.156  151.281 22.419  1.00 83.42  ? 543  TYR A N     1 
ATOM   908   C  CA    . TYR A 1 141 ? 22.939  152.581 21.765  1.00 85.92  ? 543  TYR A CA    1 
ATOM   909   C  C     . TYR A 1 141 ? 23.378  152.703 20.269  1.00 85.10  ? 543  TYR A C     1 
ATOM   910   O  O     . TYR A 1 141 ? 24.314  152.020 19.838  1.00 77.57  ? 543  TYR A O     1 
ATOM   911   C  CB    . TYR A 1 141 ? 23.623  153.684 22.594  1.00 84.64  ? 543  TYR A CB    1 
ATOM   912   C  CG    . TYR A 1 141 ? 23.371  153.658 24.095  1.00 83.43  ? 543  TYR A CG    1 
ATOM   913   C  CD1   . TYR A 1 141 ? 22.260  154.285 24.656  1.00 83.49  ? 543  TYR A CD1   1 
ATOM   914   C  CD2   . TYR A 1 141 ? 24.273  153.044 24.959  1.00 88.74  ? 543  TYR A CD2   1 
ATOM   915   C  CE1   . TYR A 1 141 ? 22.043  154.281 26.041  1.00 87.55  ? 543  TYR A CE1   1 
ATOM   916   C  CE2   . TYR A 1 141 ? 24.072  153.035 26.344  1.00 92.50  ? 543  TYR A CE2   1 
ATOM   917   C  CZ    . TYR A 1 141 ? 22.958  153.653 26.882  1.00 93.73  ? 543  TYR A CZ    1 
ATOM   918   O  OH    . TYR A 1 141 ? 22.772  153.638 28.257  1.00 94.06  ? 543  TYR A OH    1 
ATOM   919   N  N     . LYS A 1 142 ? 22.710  153.594 19.508  1.00 90.04  ? 544  LYS A N     1 
ATOM   920   C  CA    . LYS A 1 142 ? 23.104  153.970 18.124  1.00 87.08  ? 544  LYS A CA    1 
ATOM   921   C  C     . LYS A 1 142 ? 23.199  155.498 17.883  1.00 84.89  ? 544  LYS A C     1 
ATOM   922   O  O     . LYS A 1 142 ? 24.127  156.009 17.209  1.00 84.37  ? 544  LYS A O     1 
ATOM   923   C  CB    . LYS A 1 142 ? 22.166  153.336 17.082  1.00 86.72  ? 544  LYS A CB    1 
ATOM   924   N  N     . ALA A 1 154 ? 26.861  154.323 14.115  1.00 83.94  ? 556  ALA A N     1 
ATOM   925   C  CA    . ALA A 1 154 ? 27.669  153.997 15.308  1.00 96.86  ? 556  ALA A CA    1 
ATOM   926   C  C     . ALA A 1 154 ? 26.904  153.317 16.471  1.00 99.75  ? 556  ALA A C     1 
ATOM   927   O  O     . ALA A 1 154 ? 25.727  153.622 16.703  1.00 101.28 ? 556  ALA A O     1 
ATOM   928   C  CB    . ALA A 1 154 ? 28.406  155.241 15.815  1.00 99.99  ? 556  ALA A CB    1 
ATOM   929   N  N     . TYR A 1 155 ? 27.597  152.423 17.198  1.00 91.30  ? 557  TYR A N     1 
ATOM   930   C  CA    . TYR A 1 155 ? 27.020  151.615 18.296  1.00 79.55  ? 557  TYR A CA    1 
ATOM   931   C  C     . TYR A 1 155 ? 27.800  151.712 19.607  1.00 84.67  ? 557  TYR A C     1 
ATOM   932   O  O     . TYR A 1 155 ? 29.031  151.681 19.596  1.00 86.37  ? 557  TYR A O     1 
ATOM   933   C  CB    . TYR A 1 155 ? 26.958  150.137 17.898  1.00 72.72  ? 557  TYR A CB    1 
ATOM   934   C  CG    . TYR A 1 155 ? 26.145  149.887 16.651  1.00 82.56  ? 557  TYR A CG    1 
ATOM   935   C  CD1   . TYR A 1 155 ? 24.776  149.634 16.729  1.00 85.38  ? 557  TYR A CD1   1 
ATOM   936   C  CD2   . TYR A 1 155 ? 26.738  149.922 15.390  1.00 83.59  ? 557  TYR A CD2   1 
ATOM   937   C  CE1   . TYR A 1 155 ? 24.023  149.410 15.590  1.00 89.69  ? 557  TYR A CE1   1 
ATOM   938   C  CE2   . TYR A 1 155 ? 25.992  149.709 14.236  1.00 85.44  ? 557  TYR A CE2   1 
ATOM   939   C  CZ    . TYR A 1 155 ? 24.634  149.450 14.342  1.00 91.46  ? 557  TYR A CZ    1 
ATOM   940   O  OH    . TYR A 1 155 ? 23.885  149.233 13.203  1.00 93.43  ? 557  TYR A OH    1 
ATOM   941   N  N     . ALA A 1 156 ? 27.083  151.801 20.734  1.00 90.69  ? 558  ALA A N     1 
ATOM   942   C  CA    . ALA A 1 156 ? 27.703  151.778 22.078  1.00 90.55  ? 558  ALA A CA    1 
ATOM   943   C  C     . ALA A 1 156 ? 27.135  150.679 22.995  1.00 90.91  ? 558  ALA A C     1 
ATOM   944   O  O     . ALA A 1 156 ? 25.962  150.315 22.872  1.00 91.69  ? 558  ALA A O     1 
ATOM   945   C  CB    . ALA A 1 156 ? 27.568  153.140 22.757  1.00 88.78  ? 558  ALA A CB    1 
ATOM   946   N  N     . TRP A 1 157 ? 27.967  150.164 23.910  1.00 90.10  ? 559  TRP A N     1 
ATOM   947   C  CA    . TRP A 1 157 ? 27.525  149.205 24.944  1.00 84.32  ? 559  TRP A CA    1 
ATOM   948   C  C     . TRP A 1 157 ? 27.439  149.821 26.347  1.00 88.14  ? 559  TRP A C     1 
ATOM   949   O  O     . TRP A 1 157 ? 26.503  149.545 27.098  1.00 86.13  ? 559  TRP A O     1 
ATOM   950   C  CB    . TRP A 1 157 ? 28.433  147.976 24.986  1.00 80.73  ? 559  TRP A CB    1 
ATOM   951   C  CG    . TRP A 1 157 ? 28.241  147.068 23.831  1.00 84.37  ? 559  TRP A CG    1 
ATOM   952   C  CD1   . TRP A 1 157 ? 27.705  145.809 23.851  1.00 86.83  ? 559  TRP A CD1   1 
ATOM   953   C  CD2   . TRP A 1 157 ? 28.572  147.344 22.467  1.00 91.26  ? 559  TRP A CD2   1 
ATOM   954   N  NE1   . TRP A 1 157 ? 27.685  145.281 22.580  1.00 92.57  ? 559  TRP A NE1   1 
ATOM   955   C  CE2   . TRP A 1 157 ? 28.208  146.202 21.709  1.00 95.84  ? 559  TRP A CE2   1 
ATOM   956   C  CE3   . TRP A 1 157 ? 29.137  148.446 21.809  1.00 89.90  ? 559  TRP A CE3   1 
ATOM   957   C  CZ2   . TRP A 1 157 ? 28.390  146.132 20.323  1.00 93.30  ? 559  TRP A CZ2   1 
ATOM   958   C  CZ3   . TRP A 1 157 ? 29.311  148.378 20.433  1.00 92.81  ? 559  TRP A CZ3   1 
ATOM   959   C  CH2   . TRP A 1 157 ? 28.939  147.227 19.705  1.00 94.01  ? 559  TRP A CH2   1 
ATOM   960   N  N     . THR A 1 158 ? 28.429  150.645 26.690  1.00 94.37  ? 560  THR A N     1 
ATOM   961   C  CA    . THR A 1 158 ? 28.502  151.327 27.988  1.00 98.97  ? 560  THR A CA    1 
ATOM   962   C  C     . THR A 1 158 ? 27.840  152.702 27.901  1.00 100.88 ? 560  THR A C     1 
ATOM   963   O  O     . THR A 1 158 ? 27.812  153.309 26.831  1.00 99.38  ? 560  THR A O     1 
ATOM   964   C  CB    . THR A 1 158 ? 29.982  151.528 28.416  1.00 53.97  ? 560  THR A CB    1 
ATOM   965   N  N     . ASP A 1 159 ? 27.306  153.208 29.008  1.00 105.33 ? 561  ASP A N     1 
ATOM   966   C  CA    . ASP A 1 159 ? 26.889  154.608 29.004  1.00 107.21 ? 561  ASP A CA    1 
ATOM   967   C  C     . ASP A 1 159 ? 28.160  155.466 28.964  1.00 110.34 ? 561  ASP A C     1 
ATOM   968   O  O     . ASP A 1 159 ? 28.101  156.686 28.810  1.00 114.80 ? 561  ASP A O     1 
ATOM   969   C  CB    . ASP A 1 159 ? 25.982  154.959 30.191  1.00 99.31  ? 561  ASP A CB    1 
ATOM   970   N  N     . GLY A 1 160 ? 29.311  154.804 29.067  1.00 107.69 ? 562  GLY A N     1 
ATOM   971   C  CA    . GLY A 1 160 ? 30.598  155.472 28.975  1.00 114.65 ? 562  GLY A CA    1 
ATOM   972   C  C     . GLY A 1 160 ? 31.094  155.640 27.548  1.00 116.43 ? 562  GLY A C     1 
ATOM   973   O  O     . GLY A 1 160 ? 31.640  156.691 27.198  1.00 111.94 ? 562  GLY A O     1 
ATOM   974   N  N     . GLU A 1 161 ? 30.910  154.597 26.733  1.00 120.69 ? 563  GLU A N     1 
ATOM   975   C  CA    . GLU A 1 161 ? 31.288  154.602 25.310  1.00 121.11 ? 563  GLU A CA    1 
ATOM   976   C  C     . GLU A 1 161 ? 30.455  155.610 24.529  1.00 111.78 ? 563  GLU A C     1 
ATOM   977   O  O     . GLU A 1 161 ? 30.902  156.172 23.527  1.00 109.34 ? 563  GLU A O     1 
ATOM   978   C  CB    . GLU A 1 161 ? 31.089  153.213 24.683  1.00 122.49 ? 563  GLU A CB    1 
ATOM   979   C  CG    . GLU A 1 161 ? 32.076  152.139 25.130  1.00 126.68 ? 563  GLU A CG    1 
ATOM   980   C  CD    . GLU A 1 161 ? 31.834  150.797 24.448  1.00 128.16 ? 563  GLU A CD    1 
ATOM   981   O  OE1   . GLU A 1 161 ? 30.819  150.666 23.733  1.00 126.74 ? 563  GLU A OE1   1 
ATOM   982   O  OE2   . GLU A 1 161 ? 32.655  149.870 24.628  1.00 130.62 ? 563  GLU A OE2   1 
ATOM   983   N  N     . LEU A 1 162 ? 29.233  155.816 25.005  1.00 103.48 ? 564  LEU A N     1 
ATOM   984   C  CA    . LEU A 1 162 ? 28.289  156.735 24.397  1.00 100.12 ? 564  LEU A CA    1 
ATOM   985   C  C     . LEU A 1 162 ? 28.760  158.185 24.517  1.00 107.67 ? 564  LEU A C     1 
ATOM   986   O  O     . LEU A 1 162 ? 28.374  159.040 23.717  1.00 107.81 ? 564  LEU A O     1 
ATOM   987   C  CB    . LEU A 1 162 ? 26.932  156.577 25.078  1.00 95.46  ? 564  LEU A CB    1 
ATOM   988   C  CG    . LEU A 1 162 ? 25.705  156.884 24.233  1.00 88.43  ? 564  LEU A CG    1 
ATOM   989   C  CD1   . LEU A 1 162 ? 24.503  157.235 25.103  1.00 80.83  ? 564  LEU A CD1   1 
ATOM   990   C  CD2   . LEU A 1 162 ? 26.039  157.999 23.271  1.00 92.89  ? 564  LEU A CD2   1 
ATOM   991   N  N     . GLU A 1 163 ? 29.580  158.463 25.527  1.00 115.62 ? 565  GLU A N     1 
ATOM   992   C  CA    . GLU A 1 163 ? 30.172  159.792 25.680  1.00 119.90 ? 565  GLU A CA    1 
ATOM   993   C  C     . GLU A 1 163 ? 31.248  160.041 24.611  1.00 119.95 ? 565  GLU A C     1 
ATOM   994   O  O     . GLU A 1 163 ? 31.323  161.134 24.043  1.00 117.89 ? 565  GLU A O     1 
ATOM   995   C  CB    . GLU A 1 163 ? 30.738  159.981 27.092  1.00 119.98 ? 565  GLU A CB    1 
ATOM   996   N  N     . GLU A 1 164 ? 32.067  159.023 24.334  1.00 118.78 ? 566  GLU A N     1 
ATOM   997   C  CA    . GLU A 1 164 ? 33.056  159.101 23.255  1.00 114.27 ? 566  GLU A CA    1 
ATOM   998   C  C     . GLU A 1 164 ? 32.395  159.109 21.862  1.00 110.55 ? 566  GLU A C     1 
ATOM   999   O  O     . GLU A 1 164 ? 32.769  159.922 21.014  1.00 111.28 ? 566  GLU A O     1 
ATOM   1000  C  CB    . GLU A 1 164 ? 34.114  157.990 23.367  1.00 102.51 ? 566  GLU A CB    1 
ATOM   1001  N  N     . LEU A 1 165 ? 31.414  158.228 21.626  1.00 104.28 ? 567  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1 165 ? 30.703  158.218 20.332  1.00 103.91 ? 567  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1 165 ? 29.978  159.545 20.079  1.00 107.12 ? 567  LEU A C     1 
ATOM   1004  O  O     . LEU A 1 165 ? 29.737  159.907 18.925  1.00 111.16 ? 567  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1 165 ? 29.748  157.008 20.154  1.00 60.45  ? 567  LEU A CB    1 
ATOM   1006  N  N     . ARG A 1 166 ? 29.662  160.278 21.150  1.00 106.65 ? 568  ARG A N     1 
ATOM   1007  C  CA    . ARG A 1 166 ? 28.974  161.573 21.029  1.00 107.32 ? 568  ARG A CA    1 
ATOM   1008  C  C     . ARG A 1 166 ? 29.918  162.759 20.750  1.00 116.26 ? 568  ARG A C     1 
ATOM   1009  O  O     . ARG A 1 166 ? 29.494  163.913 20.811  1.00 118.75 ? 568  ARG A O     1 
ATOM   1010  C  CB    . ARG A 1 166 ? 28.093  161.857 22.258  1.00 98.53  ? 568  ARG A CB    1 
ATOM   1011  N  N     . LYS A 1 167 ? 31.185  162.470 20.443  1.00 117.98 ? 569  LYS A N     1 
ATOM   1012  C  CA    . LYS A 1 167 ? 32.161  163.494 20.037  1.00 110.24 ? 569  LYS A CA    1 
ATOM   1013  C  C     . LYS A 1 167 ? 32.894  163.081 18.748  1.00 101.46 ? 569  LYS A C     1 
ATOM   1014  O  O     . LYS A 1 167 ? 32.446  162.184 18.013  1.00 88.63  ? 569  LYS A O     1 
ATOM   1015  C  CB    . LYS A 1 167 ? 33.164  163.787 21.166  1.00 102.48 ? 569  LYS A CB    1 
ATOM   1016  N  N     . LEU A 1 175 ? 20.777  159.337 18.700  1.00 75.80  ? 577  LEU A N     1 
ATOM   1017  C  CA    . LEU A 1 175 ? 20.806  158.072 19.466  1.00 90.13  ? 577  LEU A CA    1 
ATOM   1018  C  C     . LEU A 1 175 ? 19.470  157.310 19.461  1.00 97.46  ? 577  LEU A C     1 
ATOM   1019  O  O     . LEU A 1 175 ? 18.439  157.828 19.908  1.00 91.00  ? 577  LEU A O     1 
ATOM   1020  C  CB    . LEU A 1 175 ? 21.260  158.289 20.924  1.00 63.58  ? 577  LEU A CB    1 
ATOM   1021  N  N     . GLN A 1 176 ? 19.484  156.084 18.941  1.00 102.09 ? 578  GLN A N     1 
ATOM   1022  C  CA    . GLN A 1 176 ? 18.393  155.154 19.219  1.00 99.57  ? 578  GLN A CA    1 
ATOM   1023  C  C     . GLN A 1 176 ? 18.837  154.289 20.395  1.00 104.24 ? 578  GLN A C     1 
ATOM   1024  O  O     . GLN A 1 176 ? 19.860  153.604 20.317  1.00 107.80 ? 578  GLN A O     1 
ATOM   1025  C  CB    . GLN A 1 176 ? 18.032  154.286 18.001  1.00 87.11  ? 578  GLN A CB    1 
ATOM   1026  N  N     . ARG A 1 177 ? 18.097  154.363 21.500  1.00 101.08 ? 579  ARG A N     1 
ATOM   1027  C  CA    . ARG A 1 177 ? 18.310  153.465 22.632  1.00 86.28  ? 579  ARG A CA    1 
ATOM   1028  C  C     . ARG A 1 177 ? 17.532  152.154 22.374  1.00 85.63  ? 579  ARG A C     1 
ATOM   1029  O  O     . ARG A 1 177 ? 16.289  152.130 22.381  1.00 83.64  ? 579  ARG A O     1 
ATOM   1030  C  CB    . ARG A 1 177 ? 17.916  154.145 23.961  1.00 75.02  ? 579  ARG A CB    1 
ATOM   1031  N  N     . TYR A 1 178 ? 18.275  151.077 22.110  1.00 80.53  ? 580  TYR A N     1 
ATOM   1032  C  CA    . TYR A 1 178 ? 17.695  149.773 21.781  1.00 79.74  ? 580  TYR A CA    1 
ATOM   1033  C  C     . TYR A 1 178 ? 16.870  149.153 22.929  1.00 79.17  ? 580  TYR A C     1 
ATOM   1034  O  O     . TYR A 1 178 ? 17.369  149.007 24.055  1.00 77.64  ? 580  TYR A O     1 
ATOM   1035  C  CB    . TYR A 1 178 ? 18.814  148.815 21.377  1.00 78.25  ? 580  TYR A CB    1 
ATOM   1036  C  CG    . TYR A 1 178 ? 19.318  148.963 19.956  1.00 87.16  ? 580  TYR A CG    1 
ATOM   1037  C  CD1   . TYR A 1 178 ? 18.508  148.624 18.872  1.00 92.90  ? 580  TYR A CD1   1 
ATOM   1038  C  CD2   . TYR A 1 178 ? 20.619  149.393 19.694  1.00 88.69  ? 580  TYR A CD2   1 
ATOM   1039  C  CE1   . TYR A 1 178 ? 18.971  148.731 17.564  1.00 96.26  ? 580  TYR A CE1   1 
ATOM   1040  C  CE2   . TYR A 1 178 ? 21.096  149.507 18.383  1.00 90.07  ? 580  TYR A CE2   1 
ATOM   1041  C  CZ    . TYR A 1 178 ? 20.265  149.171 17.325  1.00 95.64  ? 580  TYR A CZ    1 
ATOM   1042  O  OH    . TYR A 1 178 ? 20.712  149.270 16.027  1.00 98.07  ? 580  TYR A OH    1 
ATOM   1043  N  N     . LYS A 1 179 ? 15.620  148.781 22.648  1.00 78.35  ? 581  LYS A N     1 
ATOM   1044  C  CA    . LYS A 1 179 ? 14.754  148.169 23.673  1.00 73.11  ? 581  LYS A CA    1 
ATOM   1045  C  C     . LYS A 1 179 ? 14.749  146.650 23.580  1.00 75.10  ? 581  LYS A C     1 
ATOM   1046  O  O     . LYS A 1 179 ? 14.158  145.973 24.421  1.00 80.75  ? 581  LYS A O     1 
ATOM   1047  C  CB    . LYS A 1 179 ? 13.312  148.693 23.601  1.00 68.53  ? 581  LYS A CB    1 
ATOM   1048  C  CG    . LYS A 1 179 ? 13.158  150.165 23.973  1.00 75.79  ? 581  LYS A CG    1 
ATOM   1049  C  CD    . LYS A 1 179 ? 11.930  150.803 23.323  1.00 75.86  ? 581  LYS A CD    1 
ATOM   1050  N  N     . GLY A 1 180 ? 15.400  146.114 22.554  1.00 75.44  ? 582  GLY A N     1 
ATOM   1051  C  CA    . GLY A 1 180 ? 15.471  144.673 22.384  1.00 73.94  ? 582  GLY A CA    1 
ATOM   1052  C  C     . GLY A 1 180 ? 16.028  144.295 21.030  1.00 69.58  ? 582  GLY A C     1 
ATOM   1053  O  O     . GLY A 1 180 ? 16.191  145.175 20.183  1.00 73.76  ? 582  GLY A O     1 
ATOM   1054  N  N     . LEU A 1 181 ? 16.326  143.006 20.833  1.00 67.92  ? 583  LEU A N     1 
ATOM   1055  C  CA    . LEU A 1 181 ? 16.844  142.495 19.552  1.00 72.51  ? 583  LEU A CA    1 
ATOM   1056  C  C     . LEU A 1 181 ? 15.876  142.754 18.400  1.00 76.04  ? 583  LEU A C     1 
ATOM   1057  O  O     . LEU A 1 181 ? 16.273  142.866 17.235  1.00 80.46  ? 583  LEU A O     1 
ATOM   1058  C  CB    . LEU A 1 181 ? 17.074  140.995 19.639  1.00 68.62  ? 583  LEU A CB    1 
ATOM   1059  C  CG    . LEU A 1 181 ? 17.999  140.498 20.737  1.00 70.27  ? 583  LEU A CG    1 
ATOM   1060  C  CD1   . LEU A 1 181 ? 17.930  138.996 20.771  1.00 73.66  ? 583  LEU A CD1   1 
ATOM   1061  C  CD2   . LEU A 1 181 ? 19.421  140.944 20.472  1.00 74.02  ? 583  LEU A CD2   1 
ATOM   1062  N  N     . GLY A 1 182 ? 14.599  142.843 18.745  1.00 70.19  ? 584  GLY A N     1 
ATOM   1063  C  CA    . GLY A 1 182 ? 13.550  143.021 17.770  1.00 79.87  ? 584  GLY A CA    1 
ATOM   1064  C  C     . GLY A 1 182 ? 13.623  144.269 16.916  1.00 86.76  ? 584  GLY A C     1 
ATOM   1065  O  O     . GLY A 1 182 ? 13.071  144.285 15.817  1.00 100.18 ? 584  GLY A O     1 
ATOM   1066  N  N     . GLU A 1 183 ? 14.277  145.316 17.406  1.00 81.07  ? 585  GLU A N     1 
ATOM   1067  C  CA    . GLU A 1 183 ? 14.362  146.567 16.645  1.00 87.27  ? 585  GLU A CA    1 
ATOM   1068  C  C     . GLU A 1 183 ? 15.639  146.627 15.804  1.00 88.71  ? 585  GLU A C     1 
ATOM   1069  O  O     . GLU A 1 183 ? 16.035  147.687 15.298  1.00 93.41  ? 585  GLU A O     1 
ATOM   1070  C  CB    . GLU A 1 183 ? 14.257  147.770 17.579  1.00 91.02  ? 585  GLU A CB    1 
ATOM   1071  C  CG    . GLU A 1 183 ? 12.885  147.895 18.201  1.00 100.07 ? 585  GLU A CG    1 
ATOM   1072  C  CD    . GLU A 1 183 ? 12.923  148.403 19.630  1.00 109.06 ? 585  GLU A CD    1 
ATOM   1073  O  OE1   . GLU A 1 183 ? 14.008  148.337 20.256  1.00 112.16 ? 585  GLU A OE1   1 
ATOM   1074  O  OE2   . GLU A 1 183 ? 11.862  148.868 20.118  1.00 109.34 ? 585  GLU A OE2   1 
ATOM   1075  N  N     . MET A 1 184 ? 16.264  145.467 15.641  1.00 80.98  ? 586  MET A N     1 
ATOM   1076  C  CA    . MET A 1 184 ? 17.535  145.380 14.960  1.00 75.52  ? 586  MET A CA    1 
ATOM   1077  C  C     . MET A 1 184 ? 17.431  144.645 13.598  1.00 95.82  ? 586  MET A C     1 
ATOM   1078  O  O     . MET A 1 184 ? 16.949  143.515 13.541  1.00 99.40  ? 586  MET A O     1 
ATOM   1079  C  CB    . MET A 1 184 ? 18.518  144.688 15.898  1.00 73.25  ? 586  MET A CB    1 
ATOM   1080  C  CG    . MET A 1 184 ? 19.905  145.308 15.923  1.00 78.55  ? 586  MET A CG    1 
ATOM   1081  S  SD    . MET A 1 184 ? 20.920  144.615 17.248  1.00 111.64 ? 586  MET A SD    1 
ATOM   1082  C  CE    . MET A 1 184 ? 19.885  145.014 18.660  1.00 90.91  ? 586  MET A CE    1 
ATOM   1083  N  N     . ASN A 1 185 ? 17.858  145.294 12.511  1.00 92.09  ? 587  ASN A N     1 
ATOM   1084  C  CA    . ASN A 1 185 ? 17.992  144.630 11.199  1.00 91.95  ? 587  ASN A CA    1 
ATOM   1085  C  C     . ASN A 1 185 ? 19.040  143.514 11.215  1.00 96.20  ? 587  ASN A C     1 
ATOM   1086  O  O     . ASN A 1 185 ? 20.050  143.608 11.923  1.00 94.52  ? 587  ASN A O     1 
ATOM   1087  C  CB    . ASN A 1 185 ? 18.400  145.625 10.110  1.00 90.36  ? 587  ASN A CB    1 
ATOM   1088  C  CG    . ASN A 1 185 ? 17.279  146.563 9.710   1.00 89.70  ? 587  ASN A CG    1 
ATOM   1089  O  OD1   . ASN A 1 185 ? 16.092  146.236 9.833   1.00 89.24  ? 587  ASN A OD1   1 
ATOM   1090  N  ND2   . ASN A 1 185 ? 17.654  147.736 9.200   1.00 89.23  ? 587  ASN A ND2   1 
ATOM   1091  N  N     . ALA A 1 186 ? 18.823  142.475 10.412  1.00 95.96  ? 588  ALA A N     1 
ATOM   1092  C  CA    . ALA A 1 186 ? 19.737  141.327 10.400  1.00 91.04  ? 588  ALA A CA    1 
ATOM   1093  C  C     . ALA A 1 186 ? 21.191  141.727 10.107  1.00 88.44  ? 588  ALA A C     1 
ATOM   1094  O  O     . ALA A 1 186 ? 22.126  141.157 10.664  1.00 85.56  ? 588  ALA A O     1 
ATOM   1095  C  CB    . ALA A 1 186 ? 19.251  140.254 9.426   1.00 85.45  ? 588  ALA A CB    1 
ATOM   1096  N  N     . ASP A 1 187 ? 21.372  142.717 9.240   1.00 89.94  ? 589  ASP A N     1 
ATOM   1097  C  CA    . ASP A 1 187 ? 22.694  143.272 8.964   1.00 84.37  ? 589  ASP A CA    1 
ATOM   1098  C  C     . ASP A 1 187 ? 23.361  143.755 10.264  1.00 82.17  ? 589  ASP A C     1 
ATOM   1099  O  O     . ASP A 1 187 ? 24.533  143.472 10.530  1.00 69.90  ? 589  ASP A O     1 
ATOM   1100  C  CB    . ASP A 1 187 ? 22.582  144.418 7.943   1.00 73.69  ? 589  ASP A CB    1 
ATOM   1101  N  N     . GLN A 1 188 ? 22.596  144.477 11.076  1.00 87.42  ? 590  GLN A N     1 
ATOM   1102  C  CA    . GLN A 1 188 ? 23.131  145.075 12.295  1.00 87.32  ? 590  GLN A CA    1 
ATOM   1103  C  C     . GLN A 1 188 ? 23.451  144.013 13.344  1.00 87.34  ? 590  GLN A C     1 
ATOM   1104  O  O     . GLN A 1 188 ? 24.470  144.085 14.032  1.00 86.60  ? 590  GLN A O     1 
ATOM   1105  C  CB    . GLN A 1 188 ? 22.155  146.122 12.840  1.00 87.11  ? 590  GLN A CB    1 
ATOM   1106  C  CG    . GLN A 1 188 ? 22.055  147.362 11.950  1.00 88.78  ? 590  GLN A CG    1 
ATOM   1107  C  CD    . GLN A 1 188 ? 20.755  148.120 12.115  1.00 90.85  ? 590  GLN A CD    1 
ATOM   1108  O  OE1   . GLN A 1 188 ? 19.757  147.584 12.604  1.00 92.00  ? 590  GLN A OE1   1 
ATOM   1109  N  NE2   . GLN A 1 188 ? 20.759  149.382 11.706  1.00 96.06  ? 590  GLN A NE2   1 
ATOM   1110  N  N     . LEU A 1 189 ? 22.577  143.018 13.450  1.00 87.07  ? 591  LEU A N     1 
ATOM   1111  C  CA    . LEU A 1 189 ? 22.809  141.892 14.342  1.00 81.96  ? 591  LEU A CA    1 
ATOM   1112  C  C     . LEU A 1 189 ? 24.170  141.271 14.069  1.00 81.53  ? 591  LEU A C     1 
ATOM   1113  O  O     . LEU A 1 189 ? 24.965  141.058 14.979  1.00 81.95  ? 591  LEU A O     1 
ATOM   1114  C  CB    . LEU A 1 189 ? 21.705  140.843 14.172  1.00 81.20  ? 591  LEU A CB    1 
ATOM   1115  C  CG    . LEU A 1 189 ? 21.017  140.430 15.478  1.00 81.09  ? 591  LEU A CG    1 
ATOM   1116  C  CD1   . LEU A 1 189 ? 19.930  139.400 15.250  1.00 80.35  ? 591  LEU A CD1   1 
ATOM   1117  C  CD2   . LEU A 1 189 ? 22.044  139.887 16.424  1.00 89.86  ? 591  LEU A CD2   1 
ATOM   1118  N  N     . TRP A 1 190 ? 24.432  140.981 12.801  1.00 84.60  ? 592  TRP A N     1 
ATOM   1119  C  CA    . TRP A 1 190 ? 25.671  140.325 12.416  1.00 84.35  ? 592  TRP A CA    1 
ATOM   1120  C  C     . TRP A 1 190 ? 26.861  141.188 12.799  1.00 84.86  ? 592  TRP A C     1 
ATOM   1121  O  O     . TRP A 1 190 ? 27.790  140.712 13.448  1.00 83.97  ? 592  TRP A O     1 
ATOM   1122  C  CB    . TRP A 1 190 ? 25.693  140.018 10.905  1.00 86.02  ? 592  TRP A CB    1 
ATOM   1123  C  CG    . TRP A 1 190 ? 27.048  139.613 10.431  1.00 86.07  ? 592  TRP A CG    1 
ATOM   1124  C  CD1   . TRP A 1 190 ? 27.947  140.396 9.789   1.00 82.97  ? 592  TRP A CD1   1 
ATOM   1125  C  CD2   . TRP A 1 190 ? 27.683  138.336 10.615  1.00 89.31  ? 592  TRP A CD2   1 
ATOM   1126  N  NE1   . TRP A 1 190 ? 29.103  139.692 9.547   1.00 85.57  ? 592  TRP A NE1   1 
ATOM   1127  C  CE2   . TRP A 1 190 ? 28.966  138.424 10.040  1.00 86.90  ? 592  TRP A CE2   1 
ATOM   1128  C  CE3   . TRP A 1 190 ? 27.290  137.130 11.212  1.00 94.87  ? 592  TRP A CE3   1 
ATOM   1129  C  CZ2   . TRP A 1 190 ? 29.865  137.356 10.040  1.00 91.29  ? 592  TRP A CZ2   1 
ATOM   1130  C  CZ3   . TRP A 1 190 ? 28.184  136.062 11.208  1.00 98.17  ? 592  TRP A CZ3   1 
ATOM   1131  C  CH2   . TRP A 1 190 ? 29.456  136.185 10.622  1.00 96.00  ? 592  TRP A CH2   1 
ATOM   1132  N  N     . GLU A 1 191 ? 26.819  142.458 12.399  1.00 87.90  ? 593  GLU A N     1 
ATOM   1133  C  CA    . GLU A 1 191 ? 27.944  143.373 12.585  1.00 88.31  ? 593  GLU A CA    1 
ATOM   1134  C  C     . GLU A 1 191 ? 28.308  143.541 14.072  1.00 94.24  ? 593  GLU A C     1 
ATOM   1135  O  O     . GLU A 1 191 ? 29.494  143.590 14.444  1.00 95.09  ? 593  GLU A O     1 
ATOM   1136  C  CB    . GLU A 1 191 ? 27.646  144.730 11.924  1.00 78.33  ? 593  GLU A CB    1 
ATOM   1137  N  N     . THR A 1 192 ? 27.281  143.593 14.917  1.00 92.50  ? 594  THR A N     1 
ATOM   1138  C  CA    . THR A 1 192 ? 27.465  143.902 16.330  1.00 86.93  ? 594  THR A CA    1 
ATOM   1139  C  C     . THR A 1 192 ? 27.594  142.691 17.236  1.00 76.74  ? 594  THR A C     1 
ATOM   1140  O  O     . THR A 1 192 ? 28.384  142.722 18.165  1.00 81.48  ? 594  THR A O     1 
ATOM   1141  C  CB    . THR A 1 192 ? 26.322  144.768 16.871  1.00 94.52  ? 594  THR A CB    1 
ATOM   1142  O  OG1   . THR A 1 192 ? 25.080  144.107 16.622  1.00 101.01 ? 594  THR A OG1   1 
ATOM   1143  C  CG2   . THR A 1 192 ? 26.301  146.144 16.191  1.00 98.58  ? 594  THR A CG2   1 
ATOM   1144  N  N     . THR A 1 193 ? 26.838  141.628 16.993  1.00 69.11  ? 595  THR A N     1 
ATOM   1145  C  CA    . THR A 1 193 ? 26.844  140.541 17.969  1.00 79.81  ? 595  THR A CA    1 
ATOM   1146  C  C     . THR A 1 193 ? 26.892  139.097 17.469  1.00 78.01  ? 595  THR A C     1 
ATOM   1147  O  O     . THR A 1 193 ? 26.892  138.171 18.291  1.00 76.13  ? 595  THR A O     1 
ATOM   1148  C  CB    . THR A 1 193 ? 25.694  140.684 19.013  1.00 73.72  ? 595  THR A CB    1 
ATOM   1149  O  OG1   . THR A 1 193 ? 24.815  139.557 18.936  1.00 70.01  ? 595  THR A OG1   1 
ATOM   1150  C  CG2   . THR A 1 193 ? 24.901  141.951 18.785  1.00 65.99  ? 595  THR A CG2   1 
ATOM   1151  N  N     . MET A 1 194 ? 26.945  138.884 16.157  1.00 72.16  ? 596  MET A N     1 
ATOM   1152  C  CA    . MET A 1 194 ? 27.077  137.509 15.654  1.00 72.91  ? 596  MET A CA    1 
ATOM   1153  C  C     . MET A 1 194 ? 28.437  137.201 14.999  1.00 81.90  ? 596  MET A C     1 
ATOM   1154  O  O     . MET A 1 194 ? 28.893  136.052 14.946  1.00 85.80  ? 596  MET A O     1 
ATOM   1155  C  CB    . MET A 1 194 ? 25.929  137.163 14.709  1.00 73.32  ? 596  MET A CB    1 
ATOM   1156  C  CG    . MET A 1 194 ? 24.567  137.279 15.354  1.00 77.22  ? 596  MET A CG    1 
ATOM   1157  S  SD    . MET A 1 194 ? 23.267  136.409 14.459  1.00 79.79  ? 596  MET A SD    1 
ATOM   1158  C  CE    . MET A 1 194 ? 23.858  134.725 14.553  1.00 68.63  ? 596  MET A CE    1 
ATOM   1159  N  N     . ASN A 1 195 ? 29.086  138.240 14.504  1.00 83.60  ? 597  ASN A N     1 
ATOM   1160  C  CA    . ASN A 1 195 ? 30.332  138.080 13.790  1.00 87.98  ? 597  ASN A CA    1 
ATOM   1161  C  C     . ASN A 1 195 ? 31.479  137.870 14.762  1.00 92.57  ? 597  ASN A C     1 
ATOM   1162  O  O     . ASN A 1 195 ? 31.772  138.749 15.571  1.00 98.41  ? 597  ASN A O     1 
ATOM   1163  C  CB    . ASN A 1 195 ? 30.566  139.327 12.949  1.00 96.41  ? 597  ASN A CB    1 
ATOM   1164  C  CG    . ASN A 1 195 ? 31.838  139.264 12.162  1.00 105.49 ? 597  ASN A CG    1 
ATOM   1165  O  OD1   . ASN A 1 195 ? 32.433  138.197 12.000  1.00 111.38 ? 597  ASN A OD1   1 
ATOM   1166  N  ND2   . ASN A 1 195 ? 32.269  140.411 11.659  1.00 106.43 ? 597  ASN A ND2   1 
ATOM   1167  N  N     . PRO A 1 196 ? 32.131  136.699 14.695  1.00 93.16  ? 598  PRO A N     1 
ATOM   1168  C  CA    . PRO A 1 196 ? 33.268  136.351 15.570  1.00 91.97  ? 598  PRO A CA    1 
ATOM   1169  C  C     . PRO A 1 196 ? 34.356  137.423 15.612  1.00 99.40  ? 598  PRO A C     1 
ATOM   1170  O  O     . PRO A 1 196 ? 35.113  137.476 16.580  1.00 101.99 ? 598  PRO A O     1 
ATOM   1171  C  CB    . PRO A 1 196 ? 33.819  135.071 14.940  1.00 85.92  ? 598  PRO A CB    1 
ATOM   1172  C  CG    . PRO A 1 196 ? 32.630  134.445 14.291  1.00 90.25  ? 598  PRO A CG    1 
ATOM   1173  C  CD    . PRO A 1 196 ? 31.737  135.581 13.821  1.00 91.42  ? 598  PRO A CD    1 
ATOM   1174  N  N     . GLU A 1 197 ? 34.417  138.260 14.577  1.00 101.44 ? 599  GLU A N     1 
ATOM   1175  C  CA    . GLU A 1 197 ? 35.411  139.329 14.471  1.00 95.85  ? 599  GLU A CA    1 
ATOM   1176  C  C     . GLU A 1 197 ? 34.985  140.646 15.142  1.00 98.37  ? 599  GLU A C     1 
ATOM   1177  O  O     . GLU A 1 197 ? 35.832  141.443 15.548  1.00 104.21 ? 599  GLU A O     1 
ATOM   1178  C  CB    . GLU A 1 197 ? 35.753  139.586 13.000  1.00 86.07  ? 599  GLU A CB    1 
ATOM   1179  N  N     . THR A 1 198 ? 33.683  140.873 15.267  1.00 92.66  ? 600  THR A N     1 
ATOM   1180  C  CA    . THR A 1 198 ? 33.192  142.157 15.742  1.00 91.08  ? 600  THR A CA    1 
ATOM   1181  C  C     . THR A 1 198 ? 32.382  142.023 17.034  1.00 97.35  ? 600  THR A C     1 
ATOM   1182  O  O     . THR A 1 198 ? 32.013  143.023 17.654  1.00 94.71  ? 600  THR A O     1 
ATOM   1183  C  CB    . THR A 1 198 ? 32.339  142.857 14.655  1.00 78.36  ? 600  THR A CB    1 
ATOM   1184  N  N     . ARG A 1 199 ? 32.116  140.788 17.450  1.00 101.42 ? 601  ARG A N     1 
ATOM   1185  C  CA    . ARG A 1 199 ? 31.195  140.558 18.569  1.00 94.34  ? 601  ARG A CA    1 
ATOM   1186  C  C     . ARG A 1 199 ? 31.912  140.578 19.916  1.00 91.63  ? 601  ARG A C     1 
ATOM   1187  O  O     . ARG A 1 199 ? 33.058  140.145 20.024  1.00 95.92  ? 601  ARG A O     1 
ATOM   1188  C  CB    . ARG A 1 199 ? 30.404  139.247 18.389  1.00 87.61  ? 601  ARG A CB    1 
ATOM   1189  C  CG    . ARG A 1 199 ? 31.150  138.016 18.863  1.00 83.80  ? 601  ARG A CG    1 
ATOM   1190  C  CD    . ARG A 1 199 ? 30.587  136.717 18.308  1.00 81.17  ? 601  ARG A CD    1 
ATOM   1191  N  NE    . ARG A 1 199 ? 31.600  135.667 18.431  1.00 93.81  ? 601  ARG A NE    1 
ATOM   1192  C  CZ    . ARG A 1 199 ? 31.453  134.411 18.015  1.00 96.87  ? 601  ARG A CZ    1 
ATOM   1193  N  NH1   . ARG A 1 199 ? 30.315  134.031 17.438  1.00 95.55  ? 601  ARG A NH1   1 
ATOM   1194  N  NH2   . ARG A 1 199 ? 32.449  133.537 18.178  1.00 93.90  ? 601  ARG A NH2   1 
ATOM   1195  N  N     . THR A 1 200 ? 31.219  141.096 20.928  1.00 92.32  ? 602  THR A N     1 
ATOM   1196  C  CA    . THR A 1 200 ? 31.718  141.165 22.294  1.00 96.04  ? 602  THR A CA    1 
ATOM   1197  C  C     . THR A 1 200 ? 31.039  140.086 23.155  1.00 96.53  ? 602  THR A C     1 
ATOM   1198  O  O     . THR A 1 200 ? 29.872  140.224 23.511  1.00 97.43  ? 602  THR A O     1 
ATOM   1199  C  CB    . THR A 1 200 ? 31.458  142.572 22.897  1.00 74.28  ? 602  THR A CB    1 
ATOM   1200  N  N     . LEU A 1 201 ? 31.763  139.016 23.488  1.00 97.35  ? 603  LEU A N     1 
ATOM   1201  C  CA    . LEU A 1 201 ? 31.190  137.902 24.265  1.00 100.61 ? 603  LEU A CA    1 
ATOM   1202  C  C     . LEU A 1 201 ? 31.582  137.858 25.751  1.00 105.82 ? 603  LEU A C     1 
ATOM   1203  O  O     . LEU A 1 201 ? 32.604  138.411 26.162  1.00 110.60 ? 603  LEU A O     1 
ATOM   1204  C  CB    . LEU A 1 201 ? 31.578  136.554 23.647  1.00 97.17  ? 603  LEU A CB    1 
ATOM   1205  C  CG    . LEU A 1 201 ? 31.054  136.145 22.271  1.00 88.69  ? 603  LEU A CG    1 
ATOM   1206  C  CD1   . LEU A 1 201 ? 31.394  134.678 22.029  1.00 85.13  ? 603  LEU A CD1   1 
ATOM   1207  C  CD2   . LEU A 1 201 ? 29.553  136.411 22.131  1.00 81.49  ? 603  LEU A CD2   1 
ATOM   1208  N  N     . ILE A 1 202 ? 30.765  137.170 26.546  1.00 99.92  ? 604  ILE A N     1 
ATOM   1209  C  CA    . ILE A 1 202 ? 31.130  136.799 27.915  1.00 93.43  ? 604  ILE A CA    1 
ATOM   1210  C  C     . ILE A 1 202 ? 31.244  135.277 28.049  1.00 88.03  ? 604  ILE A C     1 
ATOM   1211  O  O     . ILE A 1 202 ? 30.375  134.532 27.585  1.00 85.97  ? 604  ILE A O     1 
ATOM   1212  C  CB    . ILE A 1 202 ? 30.075  137.262 28.917  1.00 89.21  ? 604  ILE A CB    1 
ATOM   1213  C  CG1   . ILE A 1 202 ? 30.284  138.716 29.299  1.00 83.87  ? 604  ILE A CG1   1 
ATOM   1214  C  CG2   . ILE A 1 202 ? 30.128  136.416 30.170  1.00 91.35  ? 604  ILE A CG2   1 
ATOM   1215  C  CD1   . ILE A 1 202 ? 29.085  139.266 30.021  1.00 79.60  ? 604  ILE A CD1   1 
ATOM   1216  N  N     . ARG A 1 203 ? 32.304  134.814 28.696  1.00 86.91  ? 605  ARG A N     1 
ATOM   1217  C  CA    . ARG A 1 203 ? 32.507  133.381 28.856  1.00 89.62  ? 605  ARG A CA    1 
ATOM   1218  C  C     . ARG A 1 203 ? 32.169  132.907 30.268  1.00 95.06  ? 605  ARG A C     1 
ATOM   1219  O  O     . ARG A 1 203 ? 32.763  133.356 31.254  1.00 93.26  ? 605  ARG A O     1 
ATOM   1220  C  CB    . ARG A 1 203 ? 33.942  133.013 28.512  1.00 91.88  ? 605  ARG A CB    1 
ATOM   1221  C  CG    . ARG A 1 203 ? 34.074  131.654 27.885  1.00 97.68  ? 605  ARG A CG    1 
ATOM   1222  C  CD    . ARG A 1 203 ? 34.785  130.710 28.813  1.00 107.09 ? 605  ARG A CD    1 
ATOM   1223  N  NE    . ARG A 1 203 ? 35.707  129.817 28.109  1.00 109.34 ? 605  ARG A NE    1 
ATOM   1224  C  CZ    . ARG A 1 203 ? 36.593  130.210 27.201  1.00 97.54  ? 605  ARG A CZ    1 
ATOM   1225  N  NH1   . ARG A 1 203 ? 36.679  131.492 26.860  1.00 93.11  ? 605  ARG A NH1   1 
ATOM   1226  N  NH2   . ARG A 1 203 ? 37.392  129.316 26.637  1.00 91.77  ? 605  ARG A NH2   1 
ATOM   1227  N  N     . VAL A 1 204 ? 31.207  131.996 30.358  1.00 100.91 ? 606  VAL A N     1 
ATOM   1228  C  CA    . VAL A 1 204 ? 30.791  131.449 31.642  1.00 102.37 ? 606  VAL A CA    1 
ATOM   1229  C  C     . VAL A 1 204 ? 31.798  130.439 32.155  1.00 104.53 ? 606  VAL A C     1 
ATOM   1230  O  O     . VAL A 1 204 ? 32.136  129.481 31.454  1.00 97.87  ? 606  VAL A O     1 
ATOM   1231  C  CB    . VAL A 1 204 ? 29.427  130.752 31.542  1.00 102.05 ? 606  VAL A CB    1 
ATOM   1232  C  CG1   . VAL A 1 204 ? 29.155  129.946 32.811  1.00 101.76 ? 606  VAL A CG1   1 
ATOM   1233  C  CG2   . VAL A 1 204 ? 28.315  131.774 31.249  1.00 91.72  ? 606  VAL A CG2   1 
ATOM   1234  N  N     . THR A 1 205 ? 32.264  130.669 33.383  1.00 116.81 ? 607  THR A N     1 
ATOM   1235  C  CA    . THR A 1 205 ? 33.224  129.792 34.065  1.00 121.76 ? 607  THR A CA    1 
ATOM   1236  C  C     . THR A 1 205 ? 32.801  129.533 35.511  1.00 114.00 ? 607  THR A C     1 
ATOM   1237  O  O     . THR A 1 205 ? 32.270  130.424 36.178  1.00 115.27 ? 607  THR A O     1 
ATOM   1238  C  CB    . THR A 1 205 ? 34.645  130.409 34.103  1.00 122.98 ? 607  THR A CB    1 
ATOM   1239  O  OG1   . THR A 1 205 ? 34.614  131.658 34.815  1.00 117.10 ? 607  THR A OG1   1 
ATOM   1240  C  CG2   . THR A 1 205 ? 35.181  130.629 32.691  1.00 123.08 ? 607  THR A CG2   1 
ATOM   1241  N  N     . ILE A 1 206 ? 33.035  128.314 35.990  1.00 104.73 ? 608  ILE A N     1 
ATOM   1242  C  CA    . ILE A 1 206 ? 32.788  127.986 37.387  1.00 100.37 ? 608  ILE A CA    1 
ATOM   1243  C  C     . ILE A 1 206 ? 34.087  128.166 38.190  1.00 100.95 ? 608  ILE A C     1 
ATOM   1244  O  O     . ILE A 1 206 ? 34.996  127.344 38.088  1.00 96.85  ? 608  ILE A O     1 
ATOM   1245  C  CB    . ILE A 1 206 ? 32.238  126.546 37.538  1.00 84.34  ? 608  ILE A CB    1 
ATOM   1246  N  N     . GLU A 1 207 ? 34.180  129.249 38.969  1.00 105.01 ? 609  GLU A N     1 
ATOM   1247  C  CA    . GLU A 1 207 ? 35.393  129.549 39.754  1.00 106.56 ? 609  GLU A CA    1 
ATOM   1248  C  C     . GLU A 1 207 ? 35.474  128.804 41.110  1.00 109.85 ? 609  GLU A C     1 
ATOM   1249  O  O     . GLU A 1 207 ? 36.557  128.378 41.526  1.00 112.85 ? 609  GLU A O     1 
ATOM   1250  C  CB    . GLU A 1 207 ? 35.575  131.067 39.940  1.00 96.41  ? 609  GLU A CB    1 
ATOM   1251  N  N     . ASP A 1 208 ? 34.331  128.636 41.776  1.00 139.97 ? 610  ASP A N     1 
ATOM   1252  C  CA    . ASP A 1 208 ? 34.248  127.895 43.042  1.00 145.07 ? 610  ASP A CA    1 
ATOM   1253  C  C     . ASP A 1 208 ? 33.037  126.951 43.077  1.00 140.41 ? 610  ASP A C     1 
ATOM   1254  O  O     . ASP A 1 208 ? 31.941  127.357 43.475  1.00 138.21 ? 610  ASP A O     1 
ATOM   1255  C  CB    . ASP A 1 208 ? 34.179  128.865 44.229  1.00 150.50 ? 610  ASP A CB    1 
ATOM   1256  C  CG    . ASP A 1 208 ? 34.258  128.153 45.576  1.00 159.23 ? 610  ASP A CG    1 
ATOM   1257  O  OD1   . ASP A 1 208 ? 33.621  127.089 45.743  1.00 159.16 ? 610  ASP A OD1   1 
ATOM   1258  O  OD2   . ASP A 1 208 ? 34.968  128.658 46.472  1.00 166.12 ? 610  ASP A OD2   1 
ATOM   1259  N  N     . LEU A 1 209 ? 33.249  125.689 42.700  1.00 136.41 ? 611  LEU A N     1 
ATOM   1260  C  CA    . LEU A 1 209 ? 32.151  124.737 42.476  1.00 123.98 ? 611  LEU A CA    1 
ATOM   1261  C  C     . LEU A 1 209 ? 31.092  124.702 43.581  1.00 118.45 ? 611  LEU A C     1 
ATOM   1262  O  O     . LEU A 1 209 ? 29.930  124.375 43.326  1.00 115.99 ? 611  LEU A O     1 
ATOM   1263  C  CB    . LEU A 1 209 ? 32.692  123.327 42.201  1.00 121.10 ? 611  LEU A CB    1 
ATOM   1264  C  CG    . LEU A 1 209 ? 31.687  122.295 41.677  1.00 115.89 ? 611  LEU A CG    1 
ATOM   1265  C  CD1   . LEU A 1 209 ? 30.642  122.937 40.780  1.00 110.79 ? 611  LEU A CD1   1 
ATOM   1266  C  CD2   . LEU A 1 209 ? 32.409  121.195 40.922  1.00 120.57 ? 611  LEU A CD2   1 
ATOM   1267  N  N     . ALA A 1 210 ? 31.496  125.049 44.800  1.00 118.95 ? 612  ALA A N     1 
ATOM   1268  C  CA    . ALA A 1 210 ? 30.591  125.028 45.944  1.00 110.04 ? 612  ALA A CA    1 
ATOM   1269  C  C     . ALA A 1 210 ? 29.855  126.359 46.140  1.00 108.24 ? 612  ALA A C     1 
ATOM   1270  O  O     . ALA A 1 210 ? 28.630  126.373 46.281  1.00 102.02 ? 612  ALA A O     1 
ATOM   1271  C  CB    . ALA A 1 210 ? 31.341  124.637 47.197  1.00 114.66 ? 612  ALA A CB    1 
ATOM   1272  N  N     . ARG A 1 211 ? 30.595  127.470 46.148  1.00 108.80 ? 613  ARG A N     1 
ATOM   1273  C  CA    . ARG A 1 211 ? 29.983  128.789 46.277  1.00 103.41 ? 613  ARG A CA    1 
ATOM   1274  C  C     . ARG A 1 211 ? 29.010  128.985 45.102  1.00 111.65 ? 613  ARG A C     1 
ATOM   1275  O  O     . ARG A 1 211 ? 28.068  129.796 45.172  1.00 108.04 ? 613  ARG A O     1 
ATOM   1276  C  CB    . ARG A 1 211 ? 31.046  129.898 46.348  1.00 106.02 ? 613  ARG A CB    1 
ATOM   1277  N  N     . ALA A 1 212 ? 29.226  128.208 44.036  1.00 110.30 ? 614  ALA A N     1 
ATOM   1278  C  CA    . ALA A 1 212 ? 28.368  128.240 42.846  1.00 103.53 ? 614  ALA A CA    1 
ATOM   1279  C  C     . ALA A 1 212 ? 27.111  127.388 43.005  1.00 100.44 ? 614  ALA A C     1 
ATOM   1280  O  O     . ALA A 1 212 ? 26.044  127.787 42.549  1.00 89.85  ? 614  ALA A O     1 
ATOM   1281  C  CB    . ALA A 1 212 ? 29.146  127.828 41.580  1.00 102.60 ? 614  ALA A CB    1 
ATOM   1282  N  N     . GLU A 1 213 ? 27.226  126.223 43.644  1.00 103.16 ? 615  GLU A N     1 
ATOM   1283  C  CA    . GLU A 1 213 ? 26.038  125.406 43.905  1.00 103.46 ? 615  GLU A CA    1 
ATOM   1284  C  C     . GLU A 1 213 ? 25.036  126.153 44.795  1.00 104.75 ? 615  GLU A C     1 
ATOM   1285  O  O     . GLU A 1 213 ? 23.817  126.081 44.577  1.00 98.95  ? 615  GLU A O     1 
ATOM   1286  C  CB    . GLU A 1 213 ? 26.404  124.049 44.518  1.00 97.44  ? 615  GLU A CB    1 
ATOM   1287  C  CG    . GLU A 1 213 ? 25.217  123.265 45.146  1.00 121.55 ? 615  GLU A CG    1 
ATOM   1288  C  CD    . GLU A 1 213 ? 24.328  122.514 44.135  1.00 120.18 ? 615  GLU A CD    1 
ATOM   1289  O  OE1   . GLU A 1 213 ? 24.545  122.645 42.906  1.00 127.97 ? 615  GLU A OE1   1 
ATOM   1290  O  OE2   . GLU A 1 213 ? 23.409  121.780 44.574  1.00 109.64 ? 615  GLU A OE2   1 
ATOM   1291  N  N     . ARG A 1 214 ? 25.555  126.876 45.789  1.00 108.50 ? 616  ARG A N     1 
ATOM   1292  C  CA    . ARG A 1 214 ? 24.705  127.625 46.714  1.00 101.62 ? 616  ARG A CA    1 
ATOM   1293  C  C     . ARG A 1 214 ? 23.963  128.734 45.973  1.00 96.97  ? 616  ARG A C     1 
ATOM   1294  O  O     . ARG A 1 214 ? 22.738  128.851 46.080  1.00 93.01  ? 616  ARG A O     1 
ATOM   1295  C  CB    . ARG A 1 214 ? 25.513  128.192 47.895  1.00 93.86  ? 616  ARG A CB    1 
ATOM   1296  N  N     . ARG A 1 215 ? 24.703  129.536 45.212  1.00 96.61  ? 617  ARG A N     1 
ATOM   1297  C  CA    . ARG A 1 215 ? 24.091  130.638 44.477  1.00 93.95  ? 617  ARG A CA    1 
ATOM   1298  C  C     . ARG A 1 215 ? 22.941  130.182 43.584  1.00 90.02  ? 617  ARG A C     1 
ATOM   1299  O  O     . ARG A 1 215 ? 21.886  130.815 43.564  1.00 89.31  ? 617  ARG A O     1 
ATOM   1300  C  CB    . ARG A 1 215 ? 25.122  131.396 43.649  1.00 92.57  ? 617  ARG A CB    1 
ATOM   1301  C  CG    . ARG A 1 215 ? 24.509  132.508 42.858  1.00 81.74  ? 617  ARG A CG    1 
ATOM   1302  C  CD    . ARG A 1 215 ? 25.159  133.815 43.157  1.00 88.45  ? 617  ARG A CD    1 
ATOM   1303  N  NE    . ARG A 1 215 ? 25.139  134.085 44.582  1.00 92.34  ? 617  ARG A NE    1 
ATOM   1304  C  CZ    . ARG A 1 215 ? 25.600  135.201 45.126  1.00 99.50  ? 617  ARG A CZ    1 
ATOM   1305  N  NH1   . ARG A 1 215 ? 26.104  136.157 44.347  1.00 91.87  ? 617  ARG A NH1   1 
ATOM   1306  N  NH2   . ARG A 1 215 ? 25.553  135.356 46.447  1.00 109.44 ? 617  ARG A NH2   1 
ATOM   1307  N  N     . VAL A 1 216 ? 23.142  129.087 42.852  1.00 88.19  ? 618  VAL A N     1 
ATOM   1308  C  CA    . VAL A 1 216 ? 22.101  128.561 41.967  1.00 86.15  ? 618  VAL A CA    1 
ATOM   1309  C  C     . VAL A 1 216 ? 20.929  127.972 42.744  1.00 91.16  ? 618  VAL A C     1 
ATOM   1310  O  O     . VAL A 1 216 ? 19.778  128.343 42.479  1.00 91.79  ? 618  VAL A O     1 
ATOM   1311  C  CB    . VAL A 1 216 ? 22.642  127.530 40.949  1.00 85.48  ? 618  VAL A CB    1 
ATOM   1312  C  CG1   . VAL A 1 216 ? 21.501  126.873 40.195  1.00 80.77  ? 618  VAL A CG1   1 
ATOM   1313  C  CG2   . VAL A 1 216 ? 23.584  128.204 39.975  1.00 84.58  ? 618  VAL A CG2   1 
ATOM   1314  N  N     . ASN A 1 217 ? 21.213  127.068 43.694  1.00 92.23  ? 619  ASN A N     1 
ATOM   1315  C  CA    . ASN A 1 217 ? 20.171  126.519 44.576  1.00 89.78  ? 619  ASN A CA    1 
ATOM   1316  C  C     . ASN A 1 217 ? 19.333  127.626 45.251  1.00 91.68  ? 619  ASN A C     1 
ATOM   1317  O  O     . ASN A 1 217 ? 18.115  127.503 45.380  1.00 91.49  ? 619  ASN A O     1 
ATOM   1318  C  CB    . ASN A 1 217 ? 20.754  125.546 45.610  1.00 83.84  ? 619  ASN A CB    1 
ATOM   1319  N  N     . VAL A 1 218 ? 19.975  128.726 45.638  1.00 92.88  ? 620  VAL A N     1 
ATOM   1320  C  CA    . VAL A 1 218 ? 19.285  129.775 46.391  1.00 91.41  ? 620  VAL A CA    1 
ATOM   1321  C  C     . VAL A 1 218 ? 18.386  130.634 45.530  1.00 89.81  ? 620  VAL A C     1 
ATOM   1322  O  O     . VAL A 1 218 ? 17.244  130.918 45.898  1.00 95.94  ? 620  VAL A O     1 
ATOM   1323  C  CB    . VAL A 1 218 ? 20.266  130.697 47.141  1.00 93.20  ? 620  VAL A CB    1 
ATOM   1324  C  CG1   . VAL A 1 218 ? 19.514  131.892 47.733  1.00 81.86  ? 620  VAL A CG1   1 
ATOM   1325  C  CG2   . VAL A 1 218 ? 21.015  129.911 48.235  1.00 97.42  ? 620  VAL A CG2   1 
ATOM   1326  N  N     . LEU A 1 219 ? 18.906  131.054 44.385  1.00 89.49  ? 621  LEU A N     1 
ATOM   1327  C  CA    . LEU A 1 219 ? 18.152  131.912 43.473  1.00 80.42  ? 621  LEU A CA    1 
ATOM   1328  C  C     . LEU A 1 219 ? 17.068  131.194 42.672  1.00 76.36  ? 621  LEU A C     1 
ATOM   1329  O  O     . LEU A 1 219 ? 16.098  131.831 42.262  1.00 77.10  ? 621  LEU A O     1 
ATOM   1330  C  CB    . LEU A 1 219 ? 19.088  132.651 42.516  1.00 78.72  ? 621  LEU A CB    1 
ATOM   1331  C  CG    . LEU A 1 219 ? 20.046  133.646 43.169  1.00 83.04  ? 621  LEU A CG    1 
ATOM   1332  C  CD1   . LEU A 1 219 ? 20.886  134.350 42.117  1.00 89.46  ? 621  LEU A CD1   1 
ATOM   1333  C  CD2   . LEU A 1 219 ? 19.299  134.651 44.043  1.00 78.35  ? 621  LEU A CD2   1 
ATOM   1334  N  N     . MET A 1 220 ? 17.216  129.889 42.441  1.00 77.83  ? 622  MET A N     1 
ATOM   1335  C  CA    . MET A 1 220 ? 16.297  129.192 41.530  1.00 79.54  ? 622  MET A CA    1 
ATOM   1336  C  C     . MET A 1 220 ? 15.502  127.995 42.093  1.00 85.01  ? 622  MET A C     1 
ATOM   1337  O  O     . MET A 1 220 ? 14.692  127.403 41.368  1.00 84.91  ? 622  MET A O     1 
ATOM   1338  C  CB    . MET A 1 220 ? 17.031  128.764 40.255  1.00 74.91  ? 622  MET A CB    1 
ATOM   1339  C  CG    . MET A 1 220 ? 17.937  129.826 39.650  1.00 71.04  ? 622  MET A CG    1 
ATOM   1340  S  SD    . MET A 1 220 ? 17.074  131.237 38.918  1.00 88.34  ? 622  MET A SD    1 
ATOM   1341  C  CE    . MET A 1 220 ? 16.237  130.483 37.519  1.00 71.09  ? 622  MET A CE    1 
ATOM   1342  N  N     . GLY A 1 221 ? 15.708  127.651 43.366  1.00 81.78  ? 623  GLY A N     1 
ATOM   1343  C  CA    . GLY A 1 221 ? 15.089  126.469 43.939  1.00 74.43  ? 623  GLY A CA    1 
ATOM   1344  C  C     . GLY A 1 221 ? 13.695  126.667 44.499  1.00 86.96  ? 623  GLY A C     1 
ATOM   1345  O  O     . GLY A 1 221 ? 13.175  127.779 44.498  1.00 84.99  ? 623  GLY A O     1 
ATOM   1346  N  N     . ASP A 1 222 ? 13.103  125.579 44.988  1.00 92.75  ? 624  ASP A N     1 
ATOM   1347  C  CA    . ASP A 1 222 ? 11.751  125.573 45.563  1.00 96.60  ? 624  ASP A CA    1 
ATOM   1348  C  C     . ASP A 1 222 ? 11.509  126.540 46.729  1.00 94.29  ? 624  ASP A C     1 
ATOM   1349  O  O     . ASP A 1 222 ? 10.437  127.143 46.810  1.00 87.60  ? 624  ASP A O     1 
ATOM   1350  C  CB    . ASP A 1 222 ? 11.365  124.151 46.006  1.00 104.33 ? 624  ASP A CB    1 
ATOM   1351  C  CG    . ASP A 1 222 ? 10.843  123.305 44.857  1.00 107.96 ? 624  ASP A CG    1 
ATOM   1352  N  N     . LYS A 1 223 ? 12.476  126.674 47.640  1.00 95.83  ? 625  LYS A N     1 
ATOM   1353  C  CA    . LYS A 1 223 ? 12.251  127.477 48.850  1.00 93.09  ? 625  LYS A CA    1 
ATOM   1354  C  C     . LYS A 1 223 ? 12.316  128.993 48.616  1.00 91.15  ? 625  LYS A C     1 
ATOM   1355  O  O     . LYS A 1 223 ? 13.353  129.530 48.214  1.00 88.52  ? 625  LYS A O     1 
ATOM   1356  C  CB    . LYS A 1 223 ? 13.190  127.057 49.993  1.00 88.69  ? 625  LYS A CB    1 
ATOM   1357  N  N     . VAL A 1 224 ? 11.200  129.672 48.887  1.00 86.51  ? 626  VAL A N     1 
ATOM   1358  C  CA    . VAL A 1 224 ? 11.121  131.124 48.734  1.00 83.50  ? 626  VAL A CA    1 
ATOM   1359  C  C     . VAL A 1 224 ? 11.866  131.913 49.812  1.00 87.56  ? 626  VAL A C     1 
ATOM   1360  O  O     . VAL A 1 224 ? 12.556  132.874 49.499  1.00 89.23  ? 626  VAL A O     1 
ATOM   1361  C  CB    . VAL A 1 224 ? 9.663   131.626 48.710  1.00 85.39  ? 626  VAL A CB    1 
ATOM   1362  C  CG1   . VAL A 1 224 ? 9.610   133.107 48.291  1.00 72.56  ? 626  VAL A CG1   1 
ATOM   1363  C  CG2   . VAL A 1 224 ? 8.829   130.783 47.775  1.00 92.46  ? 626  VAL A CG2   1 
ATOM   1364  N  N     . GLU A 1 225 ? 11.733  131.514 51.077  1.00 88.25  ? 627  GLU A N     1 
ATOM   1365  C  CA    . GLU A 1 225 ? 12.291  132.315 52.173  1.00 88.33  ? 627  GLU A CA    1 
ATOM   1366  C  C     . GLU A 1 225 ? 13.792  132.647 51.993  1.00 86.34  ? 627  GLU A C     1 
ATOM   1367  O  O     . GLU A 1 225 ? 14.207  133.793 52.191  1.00 84.96  ? 627  GLU A O     1 
ATOM   1368  C  CB    . GLU A 1 225 ? 11.958  131.717 53.548  1.00 84.14  ? 627  GLU A CB    1 
ATOM   1369  N  N     . PRO A 1 226 ? 14.607  131.659 51.586  1.00 85.67  ? 628  PRO A N     1 
ATOM   1370  C  CA    . PRO A 1 226 ? 16.024  131.947 51.301  1.00 85.29  ? 628  PRO A CA    1 
ATOM   1371  C  C     . PRO A 1 226 ? 16.229  132.952 50.149  1.00 83.88  ? 628  PRO A C     1 
ATOM   1372  O  O     . PRO A 1 226 ? 17.219  133.684 50.121  1.00 81.50  ? 628  PRO A O     1 
ATOM   1373  C  CB    . PRO A 1 226 ? 16.584  130.577 50.910  1.00 82.10  ? 628  PRO A CB    1 
ATOM   1374  C  CG    . PRO A 1 226 ? 15.665  129.592 51.539  1.00 82.45  ? 628  PRO A CG    1 
ATOM   1375  C  CD    . PRO A 1 226 ? 14.306  130.218 51.513  1.00 81.06  ? 628  PRO A CD    1 
ATOM   1376  N  N     . ARG A 1 227 ? 15.294  132.977 49.203  1.00 83.04  ? 629  ARG A N     1 
ATOM   1377  C  CA    . ARG A 1 227 ? 15.342  133.915 48.090  1.00 72.44  ? 629  ARG A CA    1 
ATOM   1378  C  C     . ARG A 1 227 ? 14.998  135.328 48.536  1.00 77.43  ? 629  ARG A C     1 
ATOM   1379  O  O     . ARG A 1 227 ? 15.737  136.264 48.251  1.00 79.89  ? 629  ARG A O     1 
ATOM   1380  C  CB    . ARG A 1 227 ? 14.373  133.453 47.023  1.00 78.39  ? 629  ARG A CB    1 
ATOM   1381  C  CG    . ARG A 1 227 ? 14.352  134.256 45.733  1.00 77.51  ? 629  ARG A CG    1 
ATOM   1382  C  CD    . ARG A 1 227 ? 13.430  133.565 44.774  1.00 72.05  ? 629  ARG A CD    1 
ATOM   1383  N  NE    . ARG A 1 227 ? 13.857  132.181 44.634  1.00 81.75  ? 629  ARG A NE    1 
ATOM   1384  C  CZ    . ARG A 1 227 ? 13.051  131.135 44.728  1.00 78.48  ? 629  ARG A CZ    1 
ATOM   1385  N  NH1   . ARG A 1 227 ? 11.758  131.313 44.956  1.00 69.75  ? 629  ARG A NH1   1 
ATOM   1386  N  NH2   . ARG A 1 227 ? 13.546  129.915 44.585  1.00 70.12  ? 629  ARG A NH2   1 
ATOM   1387  N  N     . ARG A 1 228 ? 13.881  135.470 49.252  1.00 81.80  ? 630  ARG A N     1 
ATOM   1388  C  CA    . ARG A 1 228 ? 13.484  136.747 49.865  1.00 80.61  ? 630  ARG A CA    1 
ATOM   1389  C  C     . ARG A 1 228 ? 14.648  137.389 50.597  1.00 82.34  ? 630  ARG A C     1 
ATOM   1390  O  O     . ARG A 1 228 ? 14.976  138.555 50.341  1.00 79.57  ? 630  ARG A O     1 
ATOM   1391  C  CB    . ARG A 1 228 ? 12.310  136.576 50.848  1.00 75.51  ? 630  ARG A CB    1 
ATOM   1392  C  CG    . ARG A 1 228 ? 11.686  137.915 51.279  1.00 82.58  ? 630  ARG A CG    1 
ATOM   1393  C  CD    . ARG A 1 228 ? 10.572  137.786 52.329  1.00 98.81  ? 630  ARG A CD    1 
ATOM   1394  N  NE    . ARG A 1 228 ? 9.458   136.935 51.907  1.00 111.95 ? 630  ARG A NE    1 
ATOM   1395  C  CZ    . ARG A 1 228 ? 8.969   135.926 52.631  1.00 122.91 ? 630  ARG A CZ    1 
ATOM   1396  N  NH1   . ARG A 1 228 ? 9.493   135.637 53.822  1.00 128.17 ? 630  ARG A NH1   1 
ATOM   1397  N  NH2   . ARG A 1 228 ? 7.953   135.204 52.165  1.00 121.98 ? 630  ARG A NH2   1 
ATOM   1398  N  N     . LYS A 1 229 ? 15.251  136.612 51.509  1.00 85.18  ? 631  LYS A N     1 
ATOM   1399  C  CA    . LYS A 1 229 ? 16.396  137.033 52.322  1.00 88.61  ? 631  LYS A CA    1 
ATOM   1400  C  C     . LYS A 1 229 ? 17.561  137.446 51.431  1.00 92.37  ? 631  LYS A C     1 
ATOM   1401  O  O     . LYS A 1 229 ? 18.203  138.473 51.667  1.00 93.35  ? 631  LYS A O     1 
ATOM   1402  C  CB    . LYS A 1 229 ? 16.841  135.895 53.262  1.00 91.27  ? 631  LYS A CB    1 
ATOM   1403  C  CG    . LYS A 1 229 ? 17.339  136.317 54.652  1.00 92.54  ? 631  LYS A CG    1 
ATOM   1404  C  CD    . LYS A 1 229 ? 18.845  136.475 54.716  1.00 90.57  ? 631  LYS A CD    1 
ATOM   1405  N  N     . TRP A 1 230 ? 17.839  136.643 50.406  1.00 90.86  ? 632  TRP A N     1 
ATOM   1406  C  CA    . TRP A 1 230 ? 18.944  136.944 49.514  1.00 77.31  ? 632  TRP A CA    1 
ATOM   1407  C  C     . TRP A 1 230 ? 18.718  138.305 48.885  1.00 81.90  ? 632  TRP A C     1 
ATOM   1408  O  O     . TRP A 1 230 ? 19.646  139.110 48.808  1.00 82.40  ? 632  TRP A O     1 
ATOM   1409  C  CB    . TRP A 1 230 ? 19.074  135.889 48.428  1.00 75.90  ? 632  TRP A CB    1 
ATOM   1410  C  CG    . TRP A 1 230 ? 20.335  136.031 47.604  1.00 81.88  ? 632  TRP A CG    1 
ATOM   1411  C  CD1   . TRP A 1 230 ? 21.516  135.405 47.823  1.00 85.65  ? 632  TRP A CD1   1 
ATOM   1412  C  CD2   . TRP A 1 230 ? 20.528  136.837 46.426  1.00 78.55  ? 632  TRP A CD2   1 
ATOM   1413  N  NE1   . TRP A 1 230 ? 22.439  135.773 46.880  1.00 79.32  ? 632  TRP A NE1   1 
ATOM   1414  C  CE2   . TRP A 1 230 ? 21.857  136.647 46.004  1.00 77.89  ? 632  TRP A CE2   1 
ATOM   1415  C  CE3   . TRP A 1 230 ? 19.710  137.701 45.695  1.00 75.07  ? 632  TRP A CE3   1 
ATOM   1416  C  CZ2   . TRP A 1 230 ? 22.387  137.281 44.880  1.00 76.80  ? 632  TRP A CZ2   1 
ATOM   1417  C  CZ3   . TRP A 1 230 ? 20.242  138.335 44.590  1.00 72.64  ? 632  TRP A CZ3   1 
ATOM   1418  C  CH2   . TRP A 1 230 ? 21.566  138.120 44.193  1.00 74.60  ? 632  TRP A CH2   1 
ATOM   1419  N  N     . ILE A 1 231 ? 17.479  138.556 48.453  1.00 80.82  ? 633  ILE A N     1 
ATOM   1420  C  CA    . ILE A 1 231 ? 17.124  139.807 47.776  1.00 72.49  ? 633  ILE A CA    1 
ATOM   1421  C  C     . ILE A 1 231 ? 17.193  140.996 48.723  1.00 83.01  ? 633  ILE A C     1 
ATOM   1422  O  O     . ILE A 1 231 ? 17.643  142.073 48.339  1.00 77.17  ? 633  ILE A O     1 
ATOM   1423  C  CB    . ILE A 1 231 ? 15.706  139.775 47.132  1.00 70.70  ? 633  ILE A CB    1 
ATOM   1424  C  CG1   . ILE A 1 231 ? 15.637  138.816 45.950  1.00 68.63  ? 633  ILE A CG1   1 
ATOM   1425  C  CG2   . ILE A 1 231 ? 15.320  141.138 46.637  1.00 69.76  ? 633  ILE A CG2   1 
ATOM   1426  C  CD1   . ILE A 1 231 ? 14.228  138.423 45.610  1.00 67.34  ? 633  ILE A CD1   1 
ATOM   1427  N  N     . GLU A 1 232 ? 16.740  140.814 49.961  1.00 89.86  ? 634  GLU A N     1 
ATOM   1428  C  CA    . GLU A 1 232 ? 16.826  141.898 50.939  1.00 90.88  ? 634  GLU A CA    1 
ATOM   1429  C  C     . GLU A 1 232 ? 18.282  142.277 51.212  1.00 92.07  ? 634  GLU A C     1 
ATOM   1430  O  O     . GLU A 1 232 ? 18.610  143.451 51.314  1.00 95.75  ? 634  GLU A O     1 
ATOM   1431  C  CB    . GLU A 1 232 ? 16.136  141.528 52.246  1.00 94.87  ? 634  GLU A CB    1 
ATOM   1432  C  CG    . GLU A 1 232 ? 14.645  141.261 52.155  1.00 100.59 ? 634  GLU A CG    1 
ATOM   1433  C  CD    . GLU A 1 232 ? 14.095  140.738 53.478  1.00 115.38 ? 634  GLU A CD    1 
ATOM   1434  O  OE1   . GLU A 1 232 ? 14.743  140.976 54.521  1.00 119.91 ? 634  GLU A OE1   1 
ATOM   1435  O  OE2   . GLU A 1 232 ? 13.035  140.073 53.479  1.00 121.22 ? 634  GLU A OE2   1 
ATOM   1436  N  N     . ASP A 1 233 ? 19.159  141.283 51.304  1.00 84.96  ? 635  ASP A N     1 
ATOM   1437  C  CA    . ASP A 1 233 ? 20.555  141.535 51.657  1.00 98.21  ? 635  ASP A CA    1 
ATOM   1438  C  C     . ASP A 1 233 ? 21.445  142.028 50.500  1.00 92.56  ? 635  ASP A C     1 
ATOM   1439  O  O     . ASP A 1 233 ? 22.506  142.612 50.743  1.00 92.46  ? 635  ASP A O     1 
ATOM   1440  C  CB    . ASP A 1 233 ? 21.180  140.295 52.325  1.00 113.90 ? 635  ASP A CB    1 
ATOM   1441  C  CG    . ASP A 1 233 ? 20.610  140.016 53.723  1.00 123.43 ? 635  ASP A CG    1 
ATOM   1442  O  OD1   . ASP A 1 233 ? 19.972  140.920 54.321  1.00 128.45 ? 635  ASP A OD1   1 
ATOM   1443  O  OD2   . ASP A 1 233 ? 20.813  138.887 54.228  1.00 121.52 ? 635  ASP A OD2   1 
ATOM   1444  N  N     . ASN A 1 234 ? 21.019  141.803 49.256  1.00 90.12  ? 636  ASN A N     1 
ATOM   1445  C  CA    . ASN A 1 234 ? 21.832  142.168 48.087  1.00 87.51  ? 636  ASN A CA    1 
ATOM   1446  C  C     . ASN A 1 234 ? 21.213  143.198 47.149  1.00 84.24  ? 636  ASN A C     1 
ATOM   1447  O  O     . ASN A 1 234 ? 21.900  144.084 46.650  1.00 91.09  ? 636  ASN A O     1 
ATOM   1448  C  CB    . ASN A 1 234 ? 22.193  140.932 47.272  1.00 82.76  ? 636  ASN A CB    1 
ATOM   1449  C  CG    . ASN A 1 234 ? 22.933  139.916 48.079  1.00 83.58  ? 636  ASN A CG    1 
ATOM   1450  O  OD1   . ASN A 1 234 ? 23.880  140.248 48.786  1.00 84.41  ? 636  ASN A OD1   1 
ATOM   1451  N  ND2   . ASN A 1 234 ? 22.501  138.663 47.994  1.00 85.01  ? 636  ASN A ND2   1 
ATOM   1452  N  N     . VAL A 1 235 ? 19.925  143.070 46.880  1.00 75.31  ? 637  VAL A N     1 
ATOM   1453  C  CA    . VAL A 1 235 ? 19.276  144.003 45.974  1.00 79.04  ? 637  VAL A CA    1 
ATOM   1454  C  C     . VAL A 1 235 ? 19.170  145.399 46.603  1.00 88.88  ? 637  VAL A C     1 
ATOM   1455  O  O     . VAL A 1 235 ? 18.486  145.596 47.609  1.00 98.09  ? 637  VAL A O     1 
ATOM   1456  C  CB    . VAL A 1 235 ? 17.895  143.474 45.507  1.00 67.32  ? 637  VAL A CB    1 
ATOM   1457  C  CG1   . VAL A 1 235 ? 17.006  144.612 45.001  1.00 65.17  ? 637  VAL A CG1   1 
ATOM   1458  C  CG2   . VAL A 1 235 ? 18.081  142.382 44.450  1.00 63.47  ? 637  VAL A CG2   1 
ATOM   1459  N  N     . LYS A 1 236 ? 19.876  146.360 46.015  1.00 87.93  ? 638  LYS A N     1 
ATOM   1460  C  CA    . LYS A 1 236 ? 19.830  147.737 46.490  1.00 87.10  ? 638  LYS A CA    1 
ATOM   1461  C  C     . LYS A 1 236 ? 18.704  148.501 45.781  1.00 88.97  ? 638  LYS A C     1 
ATOM   1462  O  O     . LYS A 1 236 ? 18.897  149.064 44.703  1.00 90.52  ? 638  LYS A O     1 
ATOM   1463  C  CB    . LYS A 1 236 ? 21.198  148.416 46.299  1.00 79.22  ? 638  LYS A CB    1 
ATOM   1464  N  N     . PHE A 1 237 ? 17.518  148.505 46.383  1.00 86.35  ? 639  PHE A N     1 
ATOM   1465  C  CA    . PHE A 1 237 ? 16.380  149.219 45.805  1.00 84.17  ? 639  PHE A CA    1 
ATOM   1466  C  C     . PHE A 1 237 ? 16.625  150.734 45.741  1.00 89.27  ? 639  PHE A C     1 
ATOM   1467  O  O     . PHE A 1 237 ? 15.685  151.511 45.585  1.00 80.72  ? 639  PHE A O     1 
ATOM   1468  C  CB    . PHE A 1 237 ? 15.104  148.901 46.594  1.00 79.10  ? 639  PHE A CB    1 
ATOM   1469  C  CG    . PHE A 1 237 ? 14.697  147.453 46.527  1.00 80.78  ? 639  PHE A CG    1 
ATOM   1470  C  CD1   . PHE A 1 237 ? 14.035  146.952 45.420  1.00 89.85  ? 639  PHE A CD1   1 
ATOM   1471  C  CD2   . PHE A 1 237 ? 14.989  146.586 47.558  1.00 77.01  ? 639  PHE A CD2   1 
ATOM   1472  C  CE1   . PHE A 1 237 ? 13.670  145.604 45.348  1.00 85.83  ? 639  PHE A CE1   1 
ATOM   1473  C  CE2   . PHE A 1 237 ? 14.623  145.243 47.490  1.00 73.18  ? 639  PHE A CE2   1 
ATOM   1474  C  CZ    . PHE A 1 237 ? 13.967  144.756 46.393  1.00 75.84  ? 639  PHE A CZ    1 
ATOM   1475  N  N     . THR A 1 238 ? 17.902  151.120 45.835  1.00 101.70 ? 640  THR A N     1 
ATOM   1476  C  CA    . THR A 1 238 ? 18.372  152.513 46.006  1.00 94.97  ? 640  THR A CA    1 
ATOM   1477  C  C     . THR A 1 238 ? 17.303  153.500 46.497  1.00 81.55  ? 640  THR A C     1 
ATOM   1478  O  O     . THR A 1 238 ? 16.766  153.347 47.602  1.00 68.68  ? 640  THR A O     1 
ATOM   1479  C  CB    . THR A 1 238 ? 19.134  153.046 44.749  1.00 68.22  ? 640  THR A CB    1 
ATOM   1480  N  N     . ASN A 1 249 ? 37.120  142.193 23.794  1.00 103.98 ? 1003 ASN A N     1 
ATOM   1481  C  CA    . ASN A 1 249 ? 36.527  141.145 22.968  1.00 112.86 ? 1003 ASN A CA    1 
ATOM   1482  C  C     . ASN A 1 249 ? 35.814  140.054 23.787  1.00 115.61 ? 1003 ASN A C     1 
ATOM   1483  O  O     . ASN A 1 249 ? 34.582  139.954 23.747  1.00 114.02 ? 1003 ASN A O     1 
ATOM   1484  C  CB    . ASN A 1 249 ? 37.577  140.525 22.038  1.00 117.73 ? 1003 ASN A CB    1 
ATOM   1485  N  N     . ILE A 1 250 ? 36.581  139.237 24.513  1.00 114.75 ? 1004 ILE A N     1 
ATOM   1486  C  CA    . ILE A 1 250 ? 36.002  138.188 25.363  1.00 113.23 ? 1004 ILE A CA    1 
ATOM   1487  C  C     . ILE A 1 250 ? 36.471  138.306 26.813  1.00 117.81 ? 1004 ILE A C     1 
ATOM   1488  O  O     . ILE A 1 250 ? 37.663  138.166 27.089  1.00 123.11 ? 1004 ILE A O     1 
ATOM   1489  C  CB    . ILE A 1 250 ? 36.368  136.759 24.883  1.00 106.16 ? 1004 ILE A CB    1 
ATOM   1490  C  CG1   . ILE A 1 250 ? 36.078  136.570 23.393  1.00 113.75 ? 1004 ILE A CG1   1 
ATOM   1491  C  CG2   . ILE A 1 250 ? 35.614  135.711 25.697  1.00 96.28  ? 1004 ILE A CG2   1 
ATOM   1492  C  CD1   . ILE A 1 250 ? 36.414  135.172 22.893  1.00 114.15 ? 1004 ILE A CD1   1 
ATOM   1493  N  N     . GLN A 1 251 ? 35.534  138.549 27.730  1.00 117.54 ? 1005 GLN A N     1 
ATOM   1494  C  CA    . GLN A 1 251 ? 35.823  138.597 29.170  1.00 111.32 ? 1005 GLN A CA    1 
ATOM   1495  C  C     . GLN A 1 251 ? 35.197  137.402 29.889  1.00 110.96 ? 1005 GLN A C     1 
ATOM   1496  O  O     . GLN A 1 251 ? 34.078  136.996 29.577  1.00 110.02 ? 1005 GLN A O     1 
ATOM   1497  C  CB    . GLN A 1 251 ? 35.304  139.901 29.795  1.00 102.87 ? 1005 GLN A CB    1 
ATOM   1498  N  N     . ASN A 1 252 ? 35.916  136.841 30.854  1.00 110.80 ? 1006 ASN A N     1 
ATOM   1499  C  CA    . ASN A 1 252 ? 35.372  135.747 31.654  1.00 108.82 ? 1006 ASN A CA    1 
ATOM   1500  C  C     . ASN A 1 252 ? 34.618  136.226 32.904  1.00 104.97 ? 1006 ASN A C     1 
ATOM   1501  O  O     . ASN A 1 252 ? 35.116  137.074 33.651  1.00 104.33 ? 1006 ASN A O     1 
ATOM   1502  C  CB    . ASN A 1 252 ? 36.486  134.794 32.067  1.00 112.32 ? 1006 ASN A CB    1 
ATOM   1503  C  CG    . ASN A 1 252 ? 37.318  134.336 30.899  1.00 119.51 ? 1006 ASN A CG    1 
ATOM   1504  O  OD1   . ASN A 1 252 ? 37.105  133.252 30.358  1.00 124.62 ? 1006 ASN A OD1   1 
ATOM   1505  N  ND2   . ASN A 1 252 ? 38.278  135.159 30.500  1.00 122.36 ? 1006 ASN A ND2   1 
ATOM   1506  N  N     . MET A 1 253 ? 33.418  135.684 33.119  1.00 99.38  ? 1007 MET A N     1 
ATOM   1507  C  CA    . MET A 1 253 ? 32.648  135.938 34.340  1.00 96.36  ? 1007 MET A CA    1 
ATOM   1508  C  C     . MET A 1 253 ? 32.367  134.615 35.073  1.00 98.05  ? 1007 MET A C     1 
ATOM   1509  O  O     . MET A 1 253 ? 32.137  133.573 34.438  1.00 91.95  ? 1007 MET A O     1 
ATOM   1510  C  CB    . MET A 1 253 ? 31.337  136.698 34.037  1.00 90.29  ? 1007 MET A CB    1 
ATOM   1511  N  N     . SER A 1 254 ? 32.401  134.659 36.406  1.00 99.60  ? 1008 SER A N     1 
ATOM   1512  C  CA    . SER A 1 254 ? 32.040  133.500 37.220  1.00 102.23 ? 1008 SER A CA    1 
ATOM   1513  C  C     . SER A 1 254 ? 30.551  133.183 37.116  1.00 103.41 ? 1008 SER A C     1 
ATOM   1514  O  O     . SER A 1 254 ? 29.730  134.078 36.921  1.00 111.06 ? 1008 SER A O     1 
ATOM   1515  C  CB    . SER A 1 254 ? 32.401  133.731 38.685  1.00 107.04 ? 1008 SER A CB    1 
ATOM   1516  O  OG    . SER A 1 254 ? 32.058  132.592 39.463  1.00 111.41 ? 1008 SER A OG    1 
ATOM   1517  N  N     . LEU A 1 255 ? 30.204  131.906 37.241  1.00 95.79  ? 1009 LEU A N     1 
ATOM   1518  C  CA    . LEU A 1 255 ? 28.803  131.513 37.291  1.00 87.24  ? 1009 LEU A CA    1 
ATOM   1519  C  C     . LEU A 1 255 ? 28.130  132.148 38.521  1.00 92.94  ? 1009 LEU A C     1 
ATOM   1520  O  O     . LEU A 1 255 ? 26.984  132.597 38.432  1.00 92.76  ? 1009 LEU A O     1 
ATOM   1521  C  CB    . LEU A 1 255 ? 28.671  129.989 37.309  1.00 79.23  ? 1009 LEU A CB    1 
ATOM   1522  C  CG    . LEU A 1 255 ? 27.387  129.342 36.792  1.00 75.91  ? 1009 LEU A CG    1 
ATOM   1523  C  CD1   . LEU A 1 255 ? 27.051  128.073 37.564  1.00 70.25  ? 1009 LEU A CD1   1 
ATOM   1524  C  CD2   . LEU A 1 255 ? 26.241  130.304 36.868  1.00 79.99  ? 1009 LEU A CD2   1 
ATOM   1525  N  N     . GLU A 1 256 ? 28.834  132.211 39.660  1.00 95.69  ? 1010 GLU A N     1 
ATOM   1526  C  CA    . GLU A 1 256 ? 28.274  132.883 40.846  1.00 94.50  ? 1010 GLU A CA    1 
ATOM   1527  C  C     . GLU A 1 256 ? 27.970  134.357 40.549  1.00 100.61 ? 1010 GLU A C     1 
ATOM   1528  O  O     . GLU A 1 256 ? 26.938  134.880 40.959  1.00 100.83 ? 1010 GLU A O     1 
ATOM   1529  C  CB    . GLU A 1 256 ? 29.174  132.746 42.088  1.00 87.02  ? 1010 GLU A CB    1 
ATOM   1530  N  N     . ASP A 1 257 ? 28.869  135.013 39.822  1.00 104.40 ? 1011 ASP A N     1 
ATOM   1531  C  CA    . ASP A 1 257 ? 28.672  136.400 39.401  1.00 103.53 ? 1011 ASP A CA    1 
ATOM   1532  C  C     . ASP A 1 257 ? 27.546  136.591 38.369  1.00 94.97  ? 1011 ASP A C     1 
ATOM   1533  O  O     . ASP A 1 257 ? 26.615  137.350 38.627  1.00 90.24  ? 1011 ASP A O     1 
ATOM   1534  C  CB    . ASP A 1 257 ? 29.975  136.978 38.844  1.00 113.41 ? 1011 ASP A CB    1 
ATOM   1535  C  CG    . ASP A 1 257 ? 31.074  137.058 39.883  1.00 114.85 ? 1011 ASP A CG    1 
ATOM   1536  O  OD1   . ASP A 1 257 ? 30.782  137.514 41.009  1.00 112.66 ? 1011 ASP A OD1   1 
ATOM   1537  O  OD2   . ASP A 1 257 ? 32.226  136.670 39.571  1.00 117.08 ? 1011 ASP A OD2   1 
ATOM   1538  N  N     . ILE A 1 258 ? 27.643  135.937 37.202  1.00 96.67  ? 1012 ILE A N     1 
ATOM   1539  C  CA    . ILE A 1 258 ? 26.615  136.076 36.157  1.00 99.75  ? 1012 ILE A CA    1 
ATOM   1540  C  C     . ILE A 1 258 ? 25.207  135.915 36.748  1.00 97.09  ? 1012 ILE A C     1 
ATOM   1541  O  O     . ILE A 1 258 ? 24.333  136.740 36.492  1.00 100.13 ? 1012 ILE A O     1 
ATOM   1542  C  CB    . ILE A 1 258 ? 26.816  135.117 34.933  1.00 74.94  ? 1012 ILE A CB    1 
ATOM   1543  N  N     . MET A 1 259 ? 25.000  134.877 37.560  1.00 90.83  ? 1013 MET A N     1 
ATOM   1544  C  CA    . MET A 1 259 ? 23.692  134.616 38.175  1.00 78.90  ? 1013 MET A CA    1 
ATOM   1545  C  C     . MET A 1 259 ? 23.311  135.668 39.212  1.00 79.79  ? 1013 MET A C     1 
ATOM   1546  O  O     . MET A 1 259 ? 22.136  135.947 39.411  1.00 74.92  ? 1013 MET A O     1 
ATOM   1547  C  CB    . MET A 1 259 ? 23.656  133.220 38.791  1.00 69.96  ? 1013 MET A CB    1 
ATOM   1548  C  CG    . MET A 1 259 ? 23.729  132.125 37.752  1.00 67.09  ? 1013 MET A CG    1 
ATOM   1549  S  SD    . MET A 1 259 ? 22.101  131.487 37.373  1.00 109.24 ? 1013 MET A SD    1 
ATOM   1550  C  CE    . MET A 1 259 ? 21.549  131.021 39.009  1.00 111.55 ? 1013 MET A CE    1 
ATOM   1551  N  N     . GLY A 1 260 ? 24.316  136.251 39.862  1.00 87.85  ? 1014 GLY A N     1 
ATOM   1552  C  CA    . GLY A 1 260 ? 24.118  137.387 40.746  1.00 82.77  ? 1014 GLY A CA    1 
ATOM   1553  C  C     . GLY A 1 260 ? 23.579  138.630 40.043  1.00 80.20  ? 1014 GLY A C     1 
ATOM   1554  O  O     . GLY A 1 260 ? 22.481  139.085 40.376  1.00 77.69  ? 1014 GLY A O     1 
ATOM   1555  N  N     . GLU A 1 261 ? 24.339  139.181 39.087  1.00 77.01  ? 1015 GLU A N     1 
ATOM   1556  C  CA    . GLU A 1 261 ? 23.898  140.365 38.344  1.00 70.28  ? 1015 GLU A CA    1 
ATOM   1557  C  C     . GLU A 1 261 ? 22.578  140.095 37.625  1.00 78.07  ? 1015 GLU A C     1 
ATOM   1558  O  O     . GLU A 1 261 ? 21.650  140.880 37.708  1.00 78.19  ? 1015 GLU A O     1 
ATOM   1559  C  CB    . GLU A 1 261 ? 24.959  140.844 37.347  1.00 72.80  ? 1015 GLU A CB    1 
ATOM   1560  N  N     . ARG A 1 262 ? 22.487  138.965 36.938  1.00 74.11  ? 1016 ARG A N     1 
ATOM   1561  C  CA    . ARG A 1 262 ? 21.292  138.653 36.168  1.00 79.33  ? 1016 ARG A CA    1 
ATOM   1562  C  C     . ARG A 1 262 ? 20.015  138.568 36.993  1.00 80.70  ? 1016 ARG A C     1 
ATOM   1563  O  O     . ARG A 1 262 ? 19.004  139.174 36.626  1.00 77.97  ? 1016 ARG A O     1 
ATOM   1564  C  CB    . ARG A 1 262 ? 21.491  137.372 35.364  1.00 83.20  ? 1016 ARG A CB    1 
ATOM   1565  C  CG    . ARG A 1 262 ? 21.987  137.626 33.946  1.00 90.04  ? 1016 ARG A CG    1 
ATOM   1566  C  CD    . ARG A 1 262 ? 23.173  138.591 33.916  1.00 95.77  ? 1016 ARG A CD    1 
ATOM   1567  N  NE    . ARG A 1 262 ? 23.458  139.063 32.561  1.00 98.62  ? 1016 ARG A NE    1 
ATOM   1568  C  CZ    . ARG A 1 262 ? 24.580  139.680 32.198  1.00 97.25  ? 1016 ARG A CZ    1 
ATOM   1569  N  NH1   . ARG A 1 262 ? 25.543  139.899 33.087  1.00 93.50  ? 1016 ARG A NH1   1 
ATOM   1570  N  NH2   . ARG A 1 262 ? 24.743  140.068 30.940  1.00 97.28  ? 1016 ARG A NH2   1 
ATOM   1571  N  N     . PHE A 1 263 ? 20.047  137.825 38.099  1.00 81.33  ? 1017 PHE A N     1 
ATOM   1572  C  CA    . PHE A 1 263 ? 18.822  137.595 38.865  1.00 75.42  ? 1017 PHE A CA    1 
ATOM   1573  C  C     . PHE A 1 263 ? 18.433  138.801 39.709  1.00 73.88  ? 1017 PHE A C     1 
ATOM   1574  O  O     . PHE A 1 263 ? 17.240  139.055 39.935  1.00 70.35  ? 1017 PHE A O     1 
ATOM   1575  C  CB    . PHE A 1 263 ? 18.895  136.327 39.727  1.00 67.43  ? 1017 PHE A CB    1 
ATOM   1576  C  CG    . PHE A 1 263 ? 17.558  135.898 40.275  1.00 67.93  ? 1017 PHE A CG    1 
ATOM   1577  C  CD1   . PHE A 1 263 ? 17.104  136.383 41.505  1.00 66.17  ? 1017 PHE A CD1   1 
ATOM   1578  C  CD2   . PHE A 1 263 ? 16.741  135.027 39.550  1.00 62.71  ? 1017 PHE A CD2   1 
ATOM   1579  C  CE1   . PHE A 1 263 ? 15.857  136.001 42.003  1.00 62.55  ? 1017 PHE A CE1   1 
ATOM   1580  C  CE2   . PHE A 1 263 ? 15.492  134.636 40.032  1.00 58.33  ? 1017 PHE A CE2   1 
ATOM   1581  C  CZ    . PHE A 1 263 ? 15.052  135.119 41.264  1.00 65.52  ? 1017 PHE A CZ    1 
ATOM   1582  N  N     . GLY A 1 264 ? 19.440  139.536 40.172  1.00 67.98  ? 1018 GLY A N     1 
ATOM   1583  C  CA    . GLY A 1 264 ? 19.208  140.756 40.932  1.00 67.62  ? 1018 GLY A CA    1 
ATOM   1584  C  C     . GLY A 1 264 ? 18.553  141.817 40.064  1.00 70.88  ? 1018 GLY A C     1 
ATOM   1585  O  O     . GLY A 1 264 ? 17.664  142.535 40.512  1.00 75.67  ? 1018 GLY A O     1 
ATOM   1586  N  N     . ARG A 1 265 ? 18.991  141.887 38.807  1.00 77.06  ? 1019 ARG A N     1 
ATOM   1587  C  CA    . ARG A 1 265 ? 18.472  142.837 37.829  1.00 58.73  ? 1019 ARG A CA    1 
ATOM   1588  C  C     . ARG A 1 265 ? 16.987  142.566 37.651  1.00 65.51  ? 1019 ARG A C     1 
ATOM   1589  O  O     . ARG A 1 265 ? 16.162  143.464 37.885  1.00 70.45  ? 1019 ARG A O     1 
ATOM   1590  C  CB    . ARG A 1 265 ? 19.248  142.750 36.493  1.00 60.52  ? 1019 ARG A CB    1 
ATOM   1591  N  N     . TYR A 1 266 ? 16.655  141.324 37.272  1.00 61.93  ? 1020 TYR A N     1 
ATOM   1592  C  CA    . TYR A 1 266 ? 15.262  140.877 37.104  1.00 61.77  ? 1020 TYR A CA    1 
ATOM   1593  C  C     . TYR A 1 266 ? 14.449  140.988 38.397  1.00 64.13  ? 1020 TYR A C     1 
ATOM   1594  O  O     . TYR A 1 266 ? 13.333  141.509 38.377  1.00 66.86  ? 1020 TYR A O     1 
ATOM   1595  C  CB    . TYR A 1 266 ? 15.218  139.438 36.585  1.00 65.29  ? 1020 TYR A CB    1 
ATOM   1596  C  CG    . TYR A 1 266 ? 13.827  138.847 36.351  1.00 73.64  ? 1020 TYR A CG    1 
ATOM   1597  C  CD1   . TYR A 1 266 ? 13.073  139.206 35.238  1.00 83.77  ? 1020 TYR A CD1   1 
ATOM   1598  C  CD2   . TYR A 1 266 ? 13.297  137.893 37.213  1.00 76.71  ? 1020 TYR A CD2   1 
ATOM   1599  C  CE1   . TYR A 1 266 ? 11.811  138.650 35.001  1.00 90.65  ? 1020 TYR A CE1   1 
ATOM   1600  C  CE2   . TYR A 1 266 ? 12.036  137.332 36.991  1.00 86.24  ? 1020 TYR A CE2   1 
ATOM   1601  C  CZ    . TYR A 1 266 ? 11.287  137.710 35.876  1.00 88.76  ? 1020 TYR A CZ    1 
ATOM   1602  O  OH    . TYR A 1 266 ? 10.019  137.160 35.637  1.00 77.41  ? 1020 TYR A OH    1 
ATOM   1603  N  N     . SER A 1 267 ? 15.008  140.498 39.509  1.00 62.73  ? 1021 SER A N     1 
ATOM   1604  C  CA    . SER A 1 267 ? 14.349  140.590 40.815  1.00 58.87  ? 1021 SER A CA    1 
ATOM   1605  C  C     . SER A 1 267 ? 13.844  142.020 41.070  1.00 65.33  ? 1021 SER A C     1 
ATOM   1606  O  O     . SER A 1 267 ? 12.629  142.273 41.073  1.00 56.50  ? 1021 SER A O     1 
ATOM   1607  C  CB    . SER A 1 267 ? 15.283  140.125 41.935  1.00 55.17  ? 1021 SER A CB    1 
ATOM   1608  N  N     . LYS A 1 268 ? 14.784  142.947 41.260  1.00 67.47  ? 1022 LYS A N     1 
ATOM   1609  C  CA    . LYS A 1 268 ? 14.490  144.359 41.518  1.00 64.94  ? 1022 LYS A CA    1 
ATOM   1610  C  C     . LYS A 1 268 ? 13.381  144.943 40.627  1.00 66.02  ? 1022 LYS A C     1 
ATOM   1611  O  O     . LYS A 1 268 ? 12.448  145.613 41.127  1.00 56.00  ? 1022 LYS A O     1 
ATOM   1612  C  CB    . LYS A 1 268 ? 15.769  145.186 41.359  1.00 60.23  ? 1022 LYS A CB    1 
ATOM   1613  C  CG    . LYS A 1 268 ? 15.626  146.650 41.729  1.00 59.26  ? 1022 LYS A CG    1 
ATOM   1614  C  CD    . LYS A 1 268 ? 16.940  147.414 41.567  1.00 61.51  ? 1022 LYS A CD    1 
ATOM   1615  C  CE    . LYS A 1 268 ? 16.705  148.894 41.837  1.00 75.94  ? 1022 LYS A CE    1 
ATOM   1616  N  NZ    . LYS A 1 268 ? 17.894  149.607 42.383  1.00 85.19  ? 1022 LYS A NZ    1 
ATOM   1617  N  N     . TYR A 1 269 ? 13.490  144.697 39.315  1.00 69.20  ? 1023 TYR A N     1 
ATOM   1618  C  CA    . TYR A 1 269 ? 12.557  145.261 38.339  1.00 61.80  ? 1023 TYR A CA    1 
ATOM   1619  C  C     . TYR A 1 269 ? 11.178  144.660 38.524  1.00 68.08  ? 1023 TYR A C     1 
ATOM   1620  O  O     . TYR A 1 269 ? 10.168  145.367 38.551  1.00 75.76  ? 1023 TYR A O     1 
ATOM   1621  C  CB    . TYR A 1 269 ? 13.043  145.001 36.912  1.00 62.33  ? 1023 TYR A CB    1 
ATOM   1622  C  CG    . TYR A 1 269 ? 12.185  145.637 35.823  1.00 71.21  ? 1023 TYR A CG    1 
ATOM   1623  C  CD1   . TYR A 1 269 ? 12.356  146.962 35.456  1.00 75.52  ? 1023 TYR A CD1   1 
ATOM   1624  C  CD2   . TYR A 1 269 ? 11.216  144.910 35.168  1.00 73.95  ? 1023 TYR A CD2   1 
ATOM   1625  C  CE1   . TYR A 1 269 ? 11.579  147.547 34.466  1.00 80.36  ? 1023 TYR A CE1   1 
ATOM   1626  C  CE2   . TYR A 1 269 ? 10.437  145.483 34.183  1.00 87.90  ? 1023 TYR A CE2   1 
ATOM   1627  C  CZ    . TYR A 1 269 ? 10.613  146.805 33.827  1.00 93.42  ? 1023 TYR A CZ    1 
ATOM   1628  O  OH    . TYR A 1 269 ? 9.816   147.368 32.824  1.00 99.58  ? 1023 TYR A OH    1 
ATOM   1629  N  N     . ILE A 1 270 ? 11.146  143.341 38.646  1.00 71.53  ? 1024 ILE A N     1 
ATOM   1630  C  CA    . ILE A 1 270 ? 9.899   142.611 38.807  1.00 73.16  ? 1024 ILE A CA    1 
ATOM   1631  C  C     . ILE A 1 270 ? 9.189   143.024 40.088  1.00 70.03  ? 1024 ILE A C     1 
ATOM   1632  O  O     . ILE A 1 270 ? 7.954   143.044 40.132  1.00 61.13  ? 1024 ILE A O     1 
ATOM   1633  C  CB    . ILE A 1 270 ? 10.144  141.086 38.632  1.00 67.94  ? 1024 ILE A CB    1 
ATOM   1634  C  CG1   . ILE A 1 270 ? 10.011  140.823 37.158  1.00 79.71  ? 1024 ILE A CG1   1 
ATOM   1635  C  CG2   . ILE A 1 270 ? 9.136   140.220 39.324  1.00 60.53  ? 1024 ILE A CG2   1 
ATOM   1636  C  CD1   . ILE A 1 270 ? 9.136   141.884 36.538  1.00 83.20  ? 1024 ILE A CD1   1 
ATOM   1637  N  N     . ILE A 1 271 ? 9.969   143.413 41.101  1.00 54.75  ? 1025 ILE A N     1 
ATOM   1638  C  CA    . ILE A 1 271 ? 9.406   143.863 42.367  1.00 53.93  ? 1025 ILE A CA    1 
ATOM   1639  C  C     . ILE A 1 271 ? 8.993   145.327 42.317  1.00 61.81  ? 1025 ILE A C     1 
ATOM   1640  O  O     . ILE A 1 271 ? 7.872   145.664 42.684  1.00 67.70  ? 1025 ILE A O     1 
ATOM   1641  C  CB    . ILE A 1 271 ? 10.376  143.667 43.532  1.00 55.48  ? 1025 ILE A CB    1 
ATOM   1642  C  CG1   . ILE A 1 271 ? 10.648  142.187 43.762  1.00 52.79  ? 1025 ILE A CG1   1 
ATOM   1643  C  CG2   . ILE A 1 271 ? 9.798   144.268 44.797  1.00 57.74  ? 1025 ILE A CG2   1 
ATOM   1644  C  CD1   . ILE A 1 271 ? 11.938  141.922 44.468  1.00 53.05  ? 1025 ILE A CD1   1 
ATOM   1645  N  N     . GLN A 1 272 ? 9.884   146.206 41.867  1.00 61.09  ? 1026 GLN A N     1 
ATOM   1646  C  CA    . GLN A 1 272 ? 9.513   147.627 41.711  1.00 67.60  ? 1026 GLN A CA    1 
ATOM   1647  C  C     . GLN A 1 272 ? 8.524   147.960 40.568  1.00 71.09  ? 1026 GLN A C     1 
ATOM   1648  O  O     . GLN A 1 272 ? 7.522   148.630 40.791  1.00 64.68  ? 1026 GLN A O     1 
ATOM   1649  C  CB    . GLN A 1 272 ? 10.762  148.488 41.550  1.00 70.65  ? 1026 GLN A CB    1 
ATOM   1650  C  CG    . GLN A 1 272 ? 11.508  148.754 42.832  1.00 71.65  ? 1026 GLN A CG    1 
ATOM   1651  C  CD    . GLN A 1 272 ? 12.894  149.297 42.579  1.00 75.66  ? 1026 GLN A CD    1 
ATOM   1652  O  OE1   . GLN A 1 272 ? 13.471  149.082 41.503  1.00 73.64  ? 1026 GLN A OE1   1 
ATOM   1653  N  NE2   . GLN A 1 272 ? 13.444  150.007 43.568  1.00 74.66  ? 1026 GLN A NE2   1 
ATOM   1654  N  N     . ASP A 1 273 ? 8.815   147.476 39.357  1.00 71.41  ? 1027 ASP A N     1 
ATOM   1655  C  CA    . ASP A 1 273 ? 8.187   147.962 38.131  1.00 74.04  ? 1027 ASP A CA    1 
ATOM   1656  C  C     . ASP A 1 273 ? 7.362   146.923 37.378  1.00 77.94  ? 1027 ASP A C     1 
ATOM   1657  O  O     . ASP A 1 273 ? 7.441   146.874 36.145  1.00 83.94  ? 1027 ASP A O     1 
ATOM   1658  C  CB    . ASP A 1 273 ? 9.265   148.483 37.159  1.00 84.56  ? 1027 ASP A CB    1 
ATOM   1659  C  CG    . ASP A 1 273 ? 10.001  149.705 37.685  1.00 96.97  ? 1027 ASP A CG    1 
ATOM   1660  O  OD1   . ASP A 1 273 ? 9.326   150.697 38.038  1.00 108.16 ? 1027 ASP A OD1   1 
ATOM   1661  O  OD2   . ASP A 1 273 ? 11.254  149.675 37.749  1.00 94.42  ? 1027 ASP A OD2   1 
ATOM   1662  N  N     . ARG A 1 274 ? 6.590   146.092 38.086  1.00 75.28  ? 1028 ARG A N     1 
ATOM   1663  C  CA    . ARG A 1 274 ? 5.680   145.135 37.418  1.00 70.57  ? 1028 ARG A CA    1 
ATOM   1664  C  C     . ARG A 1 274 ? 4.544   144.659 38.312  1.00 62.01  ? 1028 ARG A C     1 
ATOM   1665  O  O     . ARG A 1 274 ? 3.400   145.077 38.155  1.00 63.69  ? 1028 ARG A O     1 
ATOM   1666  C  CB    . ARG A 1 274 ? 6.426   143.908 36.819  1.00 70.44  ? 1028 ARG A CB    1 
ATOM   1667  C  CG    . ARG A 1 274 ? 5.722   143.236 35.597  1.00 67.85  ? 1028 ARG A CG    1 
ATOM   1668  C  CD    . ARG A 1 274 ? 6.100   141.745 35.362  1.00 78.77  ? 1028 ARG A CD    1 
ATOM   1669  N  NE    . ARG A 1 274 ? 7.234   141.454 34.458  1.00 70.66  ? 1028 ARG A NE    1 
ATOM   1670  C  CZ    . ARG A 1 274 ? 7.813   142.329 33.633  1.00 79.92  ? 1028 ARG A CZ    1 
ATOM   1671  N  NH1   . ARG A 1 274 ? 7.368   143.586 33.565  1.00 87.75  ? 1028 ARG A NH1   1 
ATOM   1672  N  NH2   . ARG A 1 274 ? 8.837   141.952 32.870  1.00 67.84  ? 1028 ARG A NH2   1 
ATOM   1673  N  N     . ALA A 1 275 ? 4.867   143.793 39.261  1.00 66.04  ? 1029 ALA A N     1 
ATOM   1674  C  CA    . ALA A 1 275 ? 3.850   142.941 39.835  1.00 60.18  ? 1029 ALA A CA    1 
ATOM   1675  C  C     . ALA A 1 275 ? 3.150   143.525 41.041  1.00 59.41  ? 1029 ALA A C     1 
ATOM   1676  O  O     . ALA A 1 275 ? 2.024   143.128 41.343  1.00 63.09  ? 1029 ALA A O     1 
ATOM   1677  C  CB    . ALA A 1 275 ? 4.424   141.606 40.158  1.00 59.24  ? 1029 ALA A CB    1 
ATOM   1678  N  N     . LEU A 1 276 ? 3.798   144.466 41.727  1.00 58.52  ? 1030 LEU A N     1 
ATOM   1679  C  CA    . LEU A 1 276 ? 3.238   145.011 42.956  1.00 57.71  ? 1030 LEU A CA    1 
ATOM   1680  C  C     . LEU A 1 276 ? 2.810   146.460 42.825  1.00 61.49  ? 1030 LEU A C     1 
ATOM   1681  O  O     . LEU A 1 276 ? 3.449   147.231 42.141  1.00 67.92  ? 1030 LEU A O     1 
ATOM   1682  C  CB    . LEU A 1 276 ? 4.248   144.863 44.087  1.00 55.79  ? 1030 LEU A CB    1 
ATOM   1683  C  CG    . LEU A 1 276 ? 4.833   143.454 44.183  1.00 55.69  ? 1030 LEU A CG    1 
ATOM   1684  C  CD1   . LEU A 1 276 ? 6.046   143.426 45.098  1.00 53.95  ? 1030 LEU A CD1   1 
ATOM   1685  C  CD2   . LEU A 1 276 ? 3.756   142.498 44.646  1.00 58.16  ? 1030 LEU A CD2   1 
ATOM   1686  N  N     . PRO A 1 277 ? 1.722   146.832 43.512  1.00 41.75  ? 1031 PRO A N     1 
ATOM   1687  C  CA    . PRO A 1 277 ? 1.138   148.179 43.501  1.00 43.70  ? 1031 PRO A CA    1 
ATOM   1688  C  C     . PRO A 1 277 ? 1.896   149.210 44.346  1.00 48.99  ? 1031 PRO A C     1 
ATOM   1689  O  O     . PRO A 1 277 ? 2.465   148.867 45.393  1.00 48.88  ? 1031 PRO A O     1 
ATOM   1690  C  CB    . PRO A 1 277 ? -0.243  147.956 44.123  1.00 50.35  ? 1031 PRO A CB    1 
ATOM   1691  C  CG    . PRO A 1 277 ? -0.102  146.769 44.979  1.00 40.16  ? 1031 PRO A CG    1 
ATOM   1692  C  CD    . PRO A 1 277 ? 0.956   145.907 44.373  1.00 41.23  ? 1031 PRO A CD    1 
ATOM   1693  N  N     . ASP A 1 278 ? 1.892   150.467 43.909  1.00 44.77  ? 1032 ASP A N     1 
ATOM   1694  C  CA    . ASP A 1 278 ? 2.381   151.542 44.759  1.00 44.02  ? 1032 ASP A CA    1 
ATOM   1695  C  C     . ASP A 1 278 ? 1.378   151.684 45.914  1.00 49.47  ? 1032 ASP A C     1 
ATOM   1696  O  O     . ASP A 1 278 ? 0.157   151.743 45.701  1.00 50.24  ? 1032 ASP A O     1 
ATOM   1697  C  CB    . ASP A 1 278 ? 2.489   152.853 43.969  1.00 56.61  ? 1032 ASP A CB    1 
ATOM   1698  C  CG    . ASP A 1 278 ? 3.092   154.006 44.792  1.00 78.34  ? 1032 ASP A CG    1 
ATOM   1699  O  OD1   . ASP A 1 278 ? 2.357   154.657 45.570  1.00 86.39  ? 1032 ASP A OD1   1 
ATOM   1700  O  OD2   . ASP A 1 278 ? 4.299   154.282 44.640  1.00 83.78  ? 1032 ASP A OD2   1 
ATOM   1701  N  N     . ILE A 1 279 ? 1.885   151.738 47.135  1.00 48.66  ? 1033 ILE A N     1 
ATOM   1702  C  CA    . ILE A 1 279 ? 1.029   151.811 48.310  1.00 45.66  ? 1033 ILE A CA    1 
ATOM   1703  C  C     . ILE A 1 279 ? 0.129   153.055 48.309  1.00 49.97  ? 1033 ILE A C     1 
ATOM   1704  O  O     . ILE A 1 279 ? -0.907  153.076 48.975  1.00 55.25  ? 1033 ILE A O     1 
ATOM   1705  C  CB    . ILE A 1 279 ? 1.883   151.820 49.573  1.00 47.95  ? 1033 ILE A CB    1 
ATOM   1706  C  CG1   . ILE A 1 279 ? 1.081   151.288 50.752  1.00 48.95  ? 1033 ILE A CG1   1 
ATOM   1707  C  CG2   . ILE A 1 279 ? 2.399   153.214 49.820  1.00 48.90  ? 1033 ILE A CG2   1 
ATOM   1708  C  CD1   . ILE A 1 279 ? 1.669   151.627 52.086  1.00 46.48  ? 1033 ILE A CD1   1 
ATOM   1709  N  N     . ARG A 1 280 ? 0.510   154.075 47.543  1.00 47.29  ? 1034 ARG A N     1 
ATOM   1710  C  CA    . ARG A 1 280 ? -0.220  155.341 47.508  1.00 44.29  ? 1034 ARG A CA    1 
ATOM   1711  C  C     . ARG A 1 280 ? -1.438  155.368 46.605  1.00 51.32  ? 1034 ARG A C     1 
ATOM   1712  O  O     . ARG A 1 280 ? -2.531  155.667 47.071  1.00 61.17  ? 1034 ARG A O     1 
ATOM   1713  C  CB    . ARG A 1 280 ? 0.719   156.474 47.122  1.00 43.62  ? 1034 ARG A CB    1 
ATOM   1714  C  CG    . ARG A 1 280 ? 1.842   156.603 48.097  1.00 44.43  ? 1034 ARG A CG    1 
ATOM   1715  C  CD    . ARG A 1 280 ? 2.810   157.661 47.721  1.00 38.46  ? 1034 ARG A CD    1 
ATOM   1716  N  NE    . ARG A 1 280 ? 3.666   157.197 46.657  1.00 42.79  ? 1034 ARG A NE    1 
ATOM   1717  C  CZ    . ARG A 1 280 ? 4.574   157.961 46.074  1.00 47.80  ? 1034 ARG A CZ    1 
ATOM   1718  N  NH1   . ARG A 1 280 ? 4.734   159.207 46.531  1.00 53.12  ? 1034 ARG A NH1   1 
ATOM   1719  N  NH2   . ARG A 1 280 ? 5.293   157.490 45.046  1.00 42.49  ? 1034 ARG A NH2   1 
ATOM   1720  N  N     . ASP A 1 281 ? -1.263  155.067 45.321  1.00 43.47  ? 1035 ASP A N     1 
ATOM   1721  C  CA    . ASP A 1 281 ? -2.383  155.125 44.364  1.00 40.73  ? 1035 ASP A CA    1 
ATOM   1722  C  C     . ASP A 1 281 ? -2.934  153.748 43.949  1.00 45.12  ? 1035 ASP A C     1 
ATOM   1723  O  O     . ASP A 1 281 ? -3.843  153.660 43.097  1.00 46.46  ? 1035 ASP A O     1 
ATOM   1724  C  CB    . ASP A 1 281 ? -1.989  155.926 43.117  1.00 48.74  ? 1035 ASP A CB    1 
ATOM   1725  C  CG    . ASP A 1 281 ? -0.930  155.220 42.263  1.00 59.92  ? 1035 ASP A CG    1 
ATOM   1726  O  OD1   . ASP A 1 281 ? -0.744  153.992 42.457  1.00 59.95  ? 1035 ASP A OD1   1 
ATOM   1727  O  OD2   . ASP A 1 281 ? -0.285  155.902 41.413  1.00 59.57  ? 1035 ASP A OD2   1 
ATOM   1728  N  N     . GLY A 1 282 ? -2.369  152.687 44.542  1.00 40.80  ? 1036 GLY A N     1 
ATOM   1729  C  CA    . GLY A 1 282 ? -2.811  151.309 44.318  1.00 38.35  ? 1036 GLY A CA    1 
ATOM   1730  C  C     . GLY A 1 282 ? -2.616  150.727 42.919  1.00 50.95  ? 1036 GLY A C     1 
ATOM   1731  O  O     . GLY A 1 282 ? -3.105  149.636 42.603  1.00 65.34  ? 1036 GLY A O     1 
ATOM   1732  N  N     . LEU A 1 283 ? -1.887  151.447 42.076  1.00 49.06  ? 1037 LEU A N     1 
ATOM   1733  C  CA    . LEU A 1 283 ? -1.669  151.019 40.704  1.00 43.47  ? 1037 LEU A CA    1 
ATOM   1734  C  C     . LEU A 1 283 ? -0.334  150.307 40.508  1.00 49.38  ? 1037 LEU A C     1 
ATOM   1735  O  O     . LEU A 1 283 ? 0.661   150.632 41.152  1.00 52.14  ? 1037 LEU A O     1 
ATOM   1736  C  CB    . LEU A 1 283 ? -1.740  152.231 39.788  1.00 37.66  ? 1037 LEU A CB    1 
ATOM   1737  C  CG    . LEU A 1 283 ? -3.112  152.871 39.879  1.00 37.50  ? 1037 LEU A CG    1 
ATOM   1738  C  CD1   . LEU A 1 283 ? -3.252  154.054 38.946  1.00 40.85  ? 1037 LEU A CD1   1 
ATOM   1739  C  CD2   . LEU A 1 283 ? -4.116  151.806 39.534  1.00 34.59  ? 1037 LEU A CD2   1 
ATOM   1740  N  N     . LYS A 1 284 ? -0.327  149.311 39.630  1.00 49.32  ? 1038 LYS A N     1 
ATOM   1741  C  CA    . LYS A 1 284 ? 0.925   148.796 39.099  1.00 47.05  ? 1038 LYS A CA    1 
ATOM   1742  C  C     . LYS A 1 284 ? 1.239   149.639 37.862  1.00 53.53  ? 1038 LYS A C     1 
ATOM   1743  O  O     . LYS A 1 284 ? 0.327   150.192 37.236  1.00 65.47  ? 1038 LYS A O     1 
ATOM   1744  C  CB    . LYS A 1 284 ? 0.809   147.328 38.693  1.00 46.07  ? 1038 LYS A CB    1 
ATOM   1745  C  CG    . LYS A 1 284 ? -0.104  146.450 39.523  1.00 48.02  ? 1038 LYS A CG    1 
ATOM   1746  C  CD    . LYS A 1 284 ? 0.053   144.984 39.090  1.00 47.26  ? 1038 LYS A CD    1 
ATOM   1747  C  CE    . LYS A 1 284 ? -0.968  144.057 39.735  1.00 48.23  ? 1038 LYS A CE    1 
ATOM   1748  N  NZ    . LYS A 1 284 ? -0.892  142.672 39.195  1.00 46.39  ? 1038 LYS A NZ    1 
ATOM   1749  N  N     . PRO A 1 285 ? 2.522   149.720 37.478  1.00 49.49  ? 1039 PRO A N     1 
ATOM   1750  C  CA    . PRO A 1 285 ? 2.935   150.610 36.379  1.00 54.60  ? 1039 PRO A CA    1 
ATOM   1751  C  C     . PRO A 1 285 ? 2.104   150.471 35.071  1.00 58.00  ? 1039 PRO A C     1 
ATOM   1752  O  O     . PRO A 1 285 ? 1.741   151.482 34.454  1.00 58.22  ? 1039 PRO A O     1 
ATOM   1753  C  CB    . PRO A 1 285 ? 4.397   150.216 36.146  1.00 49.35  ? 1039 PRO A CB    1 
ATOM   1754  C  CG    . PRO A 1 285 ? 4.832   149.581 37.437  1.00 40.76  ? 1039 PRO A CG    1 
ATOM   1755  C  CD    . PRO A 1 285 ? 3.626   148.862 37.939  1.00 41.48  ? 1039 PRO A CD    1 
ATOM   1756  N  N     . VAL A 1 286 ? 1.800   149.248 34.650  1.00 53.81  ? 1040 VAL A N     1 
ATOM   1757  C  CA    . VAL A 1 286 ? 1.019   149.107 33.426  1.00 47.59  ? 1040 VAL A CA    1 
ATOM   1758  C  C     . VAL A 1 286 ? -0.311  149.811 33.573  1.00 45.19  ? 1040 VAL A C     1 
ATOM   1759  O  O     . VAL A 1 286 ? -0.773  150.486 32.640  1.00 33.60  ? 1040 VAL A O     1 
ATOM   1760  C  CB    . VAL A 1 286 ? 0.771   147.644 33.022  1.00 50.19  ? 1040 VAL A CB    1 
ATOM   1761  C  CG1   . VAL A 1 286 ? -0.079  146.896 34.066  1.00 52.64  ? 1040 VAL A CG1   1 
ATOM   1762  C  CG2   . VAL A 1 286 ? 0.093   147.637 31.704  1.00 39.43  ? 1040 VAL A CG2   1 
ATOM   1763  N  N     . GLN A 1 287 ? -0.931  149.663 34.747  1.00 44.49  ? 1041 GLN A N     1 
ATOM   1764  C  CA    . GLN A 1 287 ? -2.204  150.330 34.979  1.00 42.82  ? 1041 GLN A CA    1 
ATOM   1765  C  C     . GLN A 1 287 ? -2.076  151.847 34.961  1.00 46.21  ? 1041 GLN A C     1 
ATOM   1766  O  O     . GLN A 1 287 ? -2.848  152.532 34.271  1.00 48.07  ? 1041 GLN A O     1 
ATOM   1767  C  CB    . GLN A 1 287 ? -2.817  149.872 36.280  1.00 37.10  ? 1041 GLN A CB    1 
ATOM   1768  C  CG    . GLN A 1 287 ? -2.999  148.401 36.304  1.00 42.80  ? 1041 GLN A CG    1 
ATOM   1769  C  CD    . GLN A 1 287 ? -3.251  147.886 37.686  1.00 47.72  ? 1041 GLN A CD    1 
ATOM   1770  O  OE1   . GLN A 1 287 ? -2.556  148.247 38.643  1.00 62.70  ? 1041 GLN A OE1   1 
ATOM   1771  N  NE2   . GLN A 1 287 ? -4.245  147.037 37.810  1.00 46.23  ? 1041 GLN A NE2   1 
ATOM   1772  N  N     . ARG A 1 288 ? -1.106  152.372 35.713  1.00 45.47  ? 1042 ARG A N     1 
ATOM   1773  C  CA    . ARG A 1 288 ? -0.856  153.812 35.701  1.00 43.28  ? 1042 ARG A CA    1 
ATOM   1774  C  C     . ARG A 1 288 ? -0.587  154.331 34.284  1.00 45.46  ? 1042 ARG A C     1 
ATOM   1775  O  O     . ARG A 1 288 ? -1.071  155.390 33.917  1.00 45.04  ? 1042 ARG A O     1 
ATOM   1776  C  CB    . ARG A 1 288 ? 0.294   154.200 36.630  1.00 44.08  ? 1042 ARG A CB    1 
ATOM   1777  C  CG    . ARG A 1 288 ? 0.446   155.720 36.782  1.00 47.04  ? 1042 ARG A CG    1 
ATOM   1778  C  CD    . ARG A 1 288 ? 1.594   156.118 37.728  1.00 53.81  ? 1042 ARG A CD    1 
ATOM   1779  N  NE    . ARG A 1 288 ? 1.543   155.383 38.990  1.00 58.85  ? 1042 ARG A NE    1 
ATOM   1780  C  CZ    . ARG A 1 288 ? 2.154   154.222 39.182  1.00 56.12  ? 1042 ARG A CZ    1 
ATOM   1781  N  NH1   . ARG A 1 288 ? 2.862   153.679 38.194  1.00 68.31  ? 1042 ARG A NH1   1 
ATOM   1782  N  NH2   . ARG A 1 288 ? 2.053   153.605 40.340  1.00 40.70  ? 1042 ARG A NH2   1 
ATOM   1783  N  N     . ARG A 1 289 ? 0.178   153.595 33.480  1.00 48.69  ? 1043 ARG A N     1 
ATOM   1784  C  CA    . ARG A 1 289 ? 0.391   154.027 32.098  1.00 42.23  ? 1043 ARG A CA    1 
ATOM   1785  C  C     . ARG A 1 289 ? -0.878  153.952 31.260  1.00 42.43  ? 1043 ARG A C     1 
ATOM   1786  O  O     . ARG A 1 289 ? -1.174  154.873 30.513  1.00 42.42  ? 1043 ARG A O     1 
ATOM   1787  C  CB    . ARG A 1 289 ? 1.499   153.237 31.444  1.00 38.13  ? 1043 ARG A CB    1 
ATOM   1788  C  CG    . ARG A 1 289 ? 2.854   153.681 31.928  1.00 41.59  ? 1043 ARG A CG    1 
ATOM   1789  C  CD    . ARG A 1 289 ? 3.873   152.584 31.775  1.00 46.49  ? 1043 ARG A CD    1 
ATOM   1790  N  NE    . ARG A 1 289 ? 5.165   153.019 32.271  1.00 49.95  ? 1043 ARG A NE    1 
ATOM   1791  C  CZ    . ARG A 1 289 ? 6.216   152.221 32.366  1.00 60.71  ? 1043 ARG A CZ    1 
ATOM   1792  N  NH1   . ARG A 1 289 ? 6.120   150.942 31.986  1.00 54.74  ? 1043 ARG A NH1   1 
ATOM   1793  N  NH2   . ARG A 1 289 ? 7.357   152.702 32.839  1.00 70.79  ? 1043 ARG A NH2   1 
ATOM   1794  N  N     . ILE A 1 290 ? -1.642  152.872 31.393  1.00 36.89  ? 1044 ILE A N     1 
ATOM   1795  C  CA    . ILE A 1 290 ? -2.945  152.849 30.753  1.00 37.74  ? 1044 ILE A CA    1 
ATOM   1796  C  C     . ILE A 1 290 ? -3.776  154.108 31.079  1.00 38.68  ? 1044 ILE A C     1 
ATOM   1797  O  O     . ILE A 1 290 ? -4.353  154.712 30.172  1.00 36.24  ? 1044 ILE A O     1 
ATOM   1798  C  CB    . ILE A 1 290 ? -3.726  151.569 31.070  1.00 31.27  ? 1044 ILE A CB    1 
ATOM   1799  C  CG1   . ILE A 1 290 ? -3.025  150.385 30.435  1.00 35.01  ? 1044 ILE A CG1   1 
ATOM   1800  C  CG2   . ILE A 1 290 ? -5.148  151.651 30.533  1.00 31.21  ? 1044 ILE A CG2   1 
ATOM   1801  C  CD1   . ILE A 1 290 ? -3.500  149.048 30.969  1.00 32.15  ? 1044 ILE A CD1   1 
ATOM   1802  N  N     . LEU A 1 291 ? -3.838  154.519 32.346  1.00 38.83  ? 1045 LEU A N     1 
ATOM   1803  C  CA    . LEU A 1 291 ? -4.678  155.675 32.697  1.00 42.87  ? 1045 LEU A CA    1 
ATOM   1804  C  C     . LEU A 1 291 ? -4.069  156.995 32.249  1.00 44.75  ? 1045 LEU A C     1 
ATOM   1805  O  O     . LEU A 1 291 ? -4.761  157.834 31.662  1.00 50.18  ? 1045 LEU A O     1 
ATOM   1806  C  CB    . LEU A 1 291 ? -5.005  155.738 34.191  1.00 43.19  ? 1045 LEU A CB    1 
ATOM   1807  C  CG    . LEU A 1 291 ? -5.819  154.623 34.844  1.00 45.00  ? 1045 LEU A CG    1 
ATOM   1808  C  CD1   . LEU A 1 291 ? -6.057  154.979 36.302  1.00 48.50  ? 1045 LEU A CD1   1 
ATOM   1809  C  CD2   . LEU A 1 291 ? -7.129  154.433 34.165  1.00 48.54  ? 1045 LEU A CD2   1 
ATOM   1810  N  N     . TYR A 1 292 ? -2.781  157.187 32.517  1.00 37.46  ? 1046 TYR A N     1 
ATOM   1811  C  CA    . TYR A 1 292 ? -2.137  158.432 32.136  1.00 41.16  ? 1046 TYR A CA    1 
ATOM   1812  C  C     . TYR A 1 292 ? -2.235  158.688 30.625  1.00 44.69  ? 1046 TYR A C     1 
ATOM   1813  O  O     . TYR A 1 292 ? -2.541  159.796 30.175  1.00 41.74  ? 1046 TYR A O     1 
ATOM   1814  C  CB    . TYR A 1 292 ? -0.683  158.463 32.568  1.00 32.55  ? 1046 TYR A CB    1 
ATOM   1815  C  CG    . TYR A 1 292 ? -0.047  159.739 32.133  1.00 36.49  ? 1046 TYR A CG    1 
ATOM   1816  C  CD1   . TYR A 1 292 ? -0.323  160.937 32.779  1.00 42.90  ? 1046 TYR A CD1   1 
ATOM   1817  C  CD2   . TYR A 1 292 ? 0.785   159.769 31.042  1.00 39.40  ? 1046 TYR A CD2   1 
ATOM   1818  C  CE1   . TYR A 1 292 ? 0.244   162.131 32.351  1.00 47.00  ? 1046 TYR A CE1   1 
ATOM   1819  C  CE2   . TYR A 1 292 ? 1.346   160.946 30.604  1.00 50.86  ? 1046 TYR A CE2   1 
ATOM   1820  C  CZ    . TYR A 1 292 ? 1.086   162.129 31.257  1.00 49.86  ? 1046 TYR A CZ    1 
ATOM   1821  O  OH    . TYR A 1 292 ? 1.671   163.291 30.760  1.00 46.95  ? 1046 TYR A OH    1 
ATOM   1822  N  N     . SER A 1 293 ? -1.972  157.642 29.854  1.00 49.11  ? 1047 SER A N     1 
ATOM   1823  C  CA    . SER A 1 293 ? -1.987  157.723 28.404  1.00 48.17  ? 1047 SER A CA    1 
ATOM   1824  C  C     . SER A 1 293 ? -3.393  158.023 27.872  1.00 47.76  ? 1047 SER A C     1 
ATOM   1825  O  O     . SER A 1 293 ? -3.574  158.946 27.074  1.00 49.32  ? 1047 SER A O     1 
ATOM   1826  C  CB    . SER A 1 293 ? -1.403  156.444 27.770  1.00 46.95  ? 1047 SER A CB    1 
ATOM   1827  O  OG    . SER A 1 293 ? -1.460  156.497 26.348  1.00 56.63  ? 1047 SER A OG    1 
ATOM   1828  N  N     . MET A 1 294 ? -4.391  157.259 28.305  1.00 42.55  ? 1048 MET A N     1 
ATOM   1829  C  CA    . MET A 1 294 ? -5.745  157.545 27.846  1.00 44.41  ? 1048 MET A CA    1 
ATOM   1830  C  C     . MET A 1 294 ? -6.173  158.944 28.293  1.00 46.15  ? 1048 MET A C     1 
ATOM   1831  O  O     . MET A 1 294 ? -6.898  159.646 27.581  1.00 39.95  ? 1048 MET A O     1 
ATOM   1832  C  CB    . MET A 1 294 ? -6.733  156.492 28.336  1.00 38.67  ? 1048 MET A CB    1 
ATOM   1833  C  CG    . MET A 1 294 ? -6.425  155.116 27.825  1.00 47.49  ? 1048 MET A CG    1 
ATOM   1834  S  SD    . MET A 1 294 ? -7.539  153.830 28.407  1.00 53.84  ? 1048 MET A SD    1 
ATOM   1835  C  CE    . MET A 1 294 ? -9.118  154.542 27.894  1.00 57.60  ? 1048 MET A CE    1 
ATOM   1836  N  N     . ASN A 1 295 ? -5.717  159.362 29.470  1.00 46.06  ? 1049 ASN A N     1 
ATOM   1837  C  CA    . ASN A 1 295 ? -6.158  160.641 29.974  1.00 41.70  ? 1049 ASN A CA    1 
ATOM   1838  C  C     . ASN A 1 295 ? -5.552  161.754 29.135  1.00 46.02  ? 1049 ASN A C     1 
ATOM   1839  O  O     . ASN A 1 295 ? -6.239  162.707 28.776  1.00 42.58  ? 1049 ASN A O     1 
ATOM   1840  C  CB    . ASN A 1 295 ? -5.830  160.787 31.456  1.00 44.81  ? 1049 ASN A CB    1 
ATOM   1841  C  CG    . ASN A 1 295 ? -6.258  162.136 32.015  1.00 57.27  ? 1049 ASN A CG    1 
ATOM   1842  O  OD1   . ASN A 1 295 ? -5.421  163.020 32.191  1.00 71.94  ? 1049 ASN A OD1   1 
ATOM   1843  N  ND2   . ASN A 1 295 ? -7.563  162.306 32.289  1.00 42.22  ? 1049 ASN A ND2   1 
ATOM   1844  N  N     . LYS A 1 296 ? -4.272  161.604 28.801  1.00 51.12  ? 1050 LYS A N     1 
ATOM   1845  C  CA    . LYS A 1 296 ? -3.532  162.596 28.002  1.00 47.05  ? 1050 LYS A CA    1 
ATOM   1846  C  C     . LYS A 1 296 ? -4.207  162.791 26.666  1.00 56.76  ? 1050 LYS A C     1 
ATOM   1847  O  O     . LYS A 1 296 ? -4.131  163.865 26.076  1.00 62.48  ? 1050 LYS A O     1 
ATOM   1848  C  CB    . LYS A 1 296 ? -2.077  162.140 27.774  1.00 43.26  ? 1050 LYS A CB    1 
ATOM   1849  C  CG    . LYS A 1 296 ? -1.098  163.233 27.337  1.00 44.07  ? 1050 LYS A CG    1 
ATOM   1850  C  CD    . LYS A 1 296 ? 0.182   162.638 26.728  1.00 45.83  ? 1050 LYS A CD    1 
ATOM   1851  N  N     . ASP A 1 297 ? -4.876  161.734 26.206  1.00 62.04  ? 1051 ASP A N     1 
ATOM   1852  C  CA    . ASP A 1 297 ? -5.482  161.684 24.881  1.00 63.67  ? 1051 ASP A CA    1 
ATOM   1853  C  C     . ASP A 1 297 ? -6.966  162.055 24.905  1.00 61.45  ? 1051 ASP A C     1 
ATOM   1854  O  O     . ASP A 1 297 ? -7.682  161.841 23.933  1.00 61.88  ? 1051 ASP A O     1 
ATOM   1855  C  CB    . ASP A 1 297 ? -5.296  160.290 24.277  1.00 72.17  ? 1051 ASP A CB    1 
ATOM   1856  C  CG    . ASP A 1 297 ? -3.824  159.906 24.133  1.00 82.87  ? 1051 ASP A CG    1 
ATOM   1857  O  OD1   . ASP A 1 297 ? -2.978  160.828 24.269  1.00 85.76  ? 1051 ASP A OD1   1 
ATOM   1858  O  OD2   . ASP A 1 297 ? -3.521  158.703 23.880  1.00 80.27  ? 1051 ASP A OD2   1 
ATOM   1859  N  N     . SER A 1 298 ? -7.423  162.587 26.034  1.00 59.51  ? 1052 SER A N     1 
ATOM   1860  C  CA    . SER A 1 298 ? -8.785  163.096 26.158  1.00 53.28  ? 1052 SER A CA    1 
ATOM   1861  C  C     . SER A 1 298 ? -9.822  162.014 25.984  1.00 55.90  ? 1052 SER A C     1 
ATOM   1862  O  O     . SER A 1 298 ? -10.970 162.290 25.617  1.00 61.74  ? 1052 SER A O     1 
ATOM   1863  C  CB    . SER A 1 298 ? -9.021  164.184 25.137  1.00 49.96  ? 1052 SER A CB    1 
ATOM   1864  O  OG    . SER A 1 298 ? -8.123  165.248 25.359  1.00 61.10  ? 1052 SER A OG    1 
ATOM   1865  N  N     . ASN A 1 299 ? -9.404  160.783 26.260  1.00 45.83  ? 1053 ASN A N     1 
ATOM   1866  C  CA    . ASN A 1 299 ? -10.251 159.620 26.115  1.00 50.68  ? 1053 ASN A CA    1 
ATOM   1867  C  C     . ASN A 1 299 ? -11.014 159.380 27.431  1.00 59.64  ? 1053 ASN A C     1 
ATOM   1868  O  O     . ASN A 1 299 ? -10.768 158.396 28.162  1.00 55.70  ? 1053 ASN A O     1 
ATOM   1869  C  CB    . ASN A 1 299 ? -9.399  158.409 25.699  1.00 53.02  ? 1053 ASN A CB    1 
ATOM   1870  C  CG    . ASN A 1 299 ? -10.241 157.237 25.180  1.00 62.06  ? 1053 ASN A CG    1 
ATOM   1871  O  OD1   . ASN A 1 299 ? -11.488 157.322 25.124  1.00 64.32  ? 1053 ASN A OD1   1 
ATOM   1872  N  ND2   . ASN A 1 299 ? -9.563  156.133 24.791  1.00 57.76  ? 1053 ASN A ND2   1 
ATOM   1873  N  N     . THR A 1 300 ? -11.958 160.281 27.711  1.00 61.79  ? 1054 THR A N     1 
ATOM   1874  C  CA    . THR A 1 300 ? -12.569 160.351 29.035  1.00 61.00  ? 1054 THR A CA    1 
ATOM   1875  C  C     . THR A 1 300 ? -14.082 160.119 29.089  1.00 62.96  ? 1054 THR A C     1 
ATOM   1876  O  O     . THR A 1 300 ? -14.764 160.188 28.077  1.00 64.70  ? 1054 THR A O     1 
ATOM   1877  C  CB    . THR A 1 300 ? -12.180 161.656 29.756  1.00 56.31  ? 1054 THR A CB    1 
ATOM   1878  O  OG1   . THR A 1 300 ? -12.634 162.785 29.010  1.00 63.19  ? 1054 THR A OG1   1 
ATOM   1879  C  CG2   . THR A 1 300 ? -10.684 161.724 29.893  1.00 41.45  ? 1054 THR A CG2   1 
ATOM   1880  N  N     . PHE A 1 301 ? -14.576 159.830 30.291  1.00 63.93  ? 1055 PHE A N     1 
ATOM   1881  C  CA    . PHE A 1 301 ? -15.937 159.344 30.510  1.00 63.09  ? 1055 PHE A CA    1 
ATOM   1882  C  C     . PHE A 1 301 ? -16.986 160.167 29.803  1.00 57.90  ? 1055 PHE A C     1 
ATOM   1883  O  O     . PHE A 1 301 ? -18.060 159.668 29.501  1.00 65.85  ? 1055 PHE A O     1 
ATOM   1884  C  CB    . PHE A 1 301 ? -16.260 159.314 32.005  1.00 60.61  ? 1055 PHE A CB    1 
ATOM   1885  C  CG    . PHE A 1 301 ? -16.839 160.605 32.533  1.00 50.55  ? 1055 PHE A CG    1 
ATOM   1886  C  CD1   . PHE A 1 301 ? -16.026 161.690 32.805  1.00 43.19  ? 1055 PHE A CD1   1 
ATOM   1887  C  CD2   . PHE A 1 301 ? -18.195 160.719 32.777  1.00 46.38  ? 1055 PHE A CD2   1 
ATOM   1888  C  CE1   . PHE A 1 301 ? -16.565 162.865 33.274  1.00 41.12  ? 1055 PHE A CE1   1 
ATOM   1889  C  CE2   . PHE A 1 301 ? -18.726 161.878 33.261  1.00 42.97  ? 1055 PHE A CE2   1 
ATOM   1890  C  CZ    . PHE A 1 301 ? -17.912 162.960 33.494  1.00 43.95  ? 1055 PHE A CZ    1 
ATOM   1891  N  N     . ASP A 1 302 ? -16.663 161.430 29.556  1.00 47.14  ? 1056 ASP A N     1 
ATOM   1892  C  CA    . ASP A 1 302 ? -17.581 162.390 28.955  1.00 50.34  ? 1056 ASP A CA    1 
ATOM   1893  C  C     . ASP A 1 302 ? -17.429 162.525 27.406  1.00 51.52  ? 1056 ASP A C     1 
ATOM   1894  O  O     . ASP A 1 302 ? -18.037 163.390 26.760  1.00 48.99  ? 1056 ASP A O     1 
ATOM   1895  C  CB    . ASP A 1 302 ? -17.336 163.735 29.618  1.00 57.19  ? 1056 ASP A CB    1 
ATOM   1896  C  CG    . ASP A 1 302 ? -15.878 164.158 29.526  1.00 69.39  ? 1056 ASP A CG    1 
ATOM   1897  O  OD1   . ASP A 1 302 ? -14.990 163.288 29.742  1.00 67.25  ? 1056 ASP A OD1   1 
ATOM   1898  O  OD2   . ASP A 1 302 ? -15.627 165.350 29.220  1.00 76.63  ? 1056 ASP A OD2   1 
ATOM   1899  N  N     . LYS A 1 303 ? -16.619 161.658 26.822  1.00 49.55  ? 1057 LYS A N     1 
ATOM   1900  C  CA    . LYS A 1 303 ? -16.310 161.726 25.403  1.00 46.82  ? 1057 LYS A CA    1 
ATOM   1901  C  C     . LYS A 1 303 ? -16.470 160.353 24.708  1.00 53.59  ? 1057 LYS A C     1 
ATOM   1902  O  O     . LYS A 1 303 ? -16.417 159.311 25.357  1.00 67.34  ? 1057 LYS A O     1 
ATOM   1903  C  CB    . LYS A 1 303 ? -14.908 162.298 25.244  1.00 48.32  ? 1057 LYS A CB    1 
ATOM   1904  C  CG    . LYS A 1 303 ? -14.798 163.719 25.775  1.00 51.51  ? 1057 LYS A CG    1 
ATOM   1905  C  CD    . LYS A 1 303 ? -13.477 164.334 25.344  1.00 67.34  ? 1057 LYS A CD    1 
ATOM   1906  C  CE    . LYS A 1 303 ? -13.504 165.857 25.407  1.00 80.43  ? 1057 LYS A CE    1 
ATOM   1907  N  NZ    . LYS A 1 303 ? -12.730 166.374 26.576  1.00 85.16  ? 1057 LYS A NZ    1 
ATOM   1908  N  N     . SER A 1 304 ? -16.682 160.333 23.402  1.00 54.88  ? 1058 SER A N     1 
ATOM   1909  C  CA    . SER A 1 304 ? -17.030 159.067 22.745  1.00 60.55  ? 1058 SER A CA    1 
ATOM   1910  C  C     . SER A 1 304 ? -15.898 158.068 22.838  1.00 60.15  ? 1058 SER A C     1 
ATOM   1911  O  O     . SER A 1 304 ? -14.750 158.464 22.932  1.00 71.96  ? 1058 SER A O     1 
ATOM   1912  C  CB    . SER A 1 304 ? -17.399 159.304 21.293  1.00 64.21  ? 1058 SER A CB    1 
ATOM   1913  O  OG    . SER A 1 304 ? -16.696 160.443 20.840  1.00 71.64  ? 1058 SER A OG    1 
ATOM   1914  N  N     . TYR A 1 305 ? -16.224 156.779 22.802  1.00 56.24  ? 1059 TYR A N     1 
ATOM   1915  C  CA    . TYR A 1 305 ? -15.217 155.733 22.989  1.00 52.24  ? 1059 TYR A CA    1 
ATOM   1916  C  C     . TYR A 1 305 ? -14.226 155.687 21.831  1.00 51.46  ? 1059 TYR A C     1 
ATOM   1917  O  O     . TYR A 1 305 ? -14.614 155.865 20.668  1.00 63.79  ? 1059 TYR A O     1 
ATOM   1918  C  CB    . TYR A 1 305 ? -15.878 154.356 23.109  1.00 56.84  ? 1059 TYR A CB    1 
ATOM   1919  C  CG    . TYR A 1 305 ? -16.765 154.158 24.326  1.00 63.83  ? 1059 TYR A CG    1 
ATOM   1920  C  CD1   . TYR A 1 305 ? -18.044 154.708 24.370  1.00 60.85  ? 1059 TYR A CD1   1 
ATOM   1921  C  CD2   . TYR A 1 305 ? -16.341 153.378 25.415  1.00 58.33  ? 1059 TYR A CD2   1 
ATOM   1922  C  CE1   . TYR A 1 305 ? -18.871 154.520 25.458  1.00 59.12  ? 1059 TYR A CE1   1 
ATOM   1923  C  CE2   . TYR A 1 305 ? -17.163 153.176 26.521  1.00 56.73  ? 1059 TYR A CE2   1 
ATOM   1924  C  CZ    . TYR A 1 305 ? -18.434 153.753 26.538  1.00 65.66  ? 1059 TYR A CZ    1 
ATOM   1925  O  OH    . TYR A 1 305 ? -19.283 153.571 27.619  1.00 71.16  ? 1059 TYR A OH    1 
ATOM   1926  N  N     . ARG A 1 306 ? -12.957 155.438 22.153  1.00 50.14  ? 1060 ARG A N     1 
ATOM   1927  C  CA    . ARG A 1 306 ? -11.914 155.151 21.156  1.00 51.98  ? 1060 ARG A CA    1 
ATOM   1928  C  C     . ARG A 1 306 ? -11.650 153.641 20.972  1.00 50.82  ? 1060 ARG A C     1 
ATOM   1929  O  O     . ARG A 1 306 ? -11.836 152.847 21.890  1.00 58.11  ? 1060 ARG A O     1 
ATOM   1930  C  CB    . ARG A 1 306 ? -10.590 155.840 21.522  1.00 47.49  ? 1060 ARG A CB    1 
ATOM   1931  C  CG    . ARG A 1 306 ? -10.580 157.353 21.502  1.00 45.78  ? 1060 ARG A CG    1 
ATOM   1932  C  CD    . ARG A 1 306 ? -9.114  157.862 21.658  1.00 104.47 ? 1060 ARG A CD    1 
ATOM   1933  N  NE    . ARG A 1 306 ? -8.964  159.311 21.892  1.00 106.10 ? 1060 ARG A NE    1 
ATOM   1934  C  CZ    . ARG A 1 306 ? -9.959  160.203 21.986  1.00 105.78 ? 1060 ARG A CZ    1 
ATOM   1935  N  NH1   . ARG A 1 306 ? -11.233 159.836 21.864  1.00 105.36 ? 1060 ARG A NH1   1 
ATOM   1936  N  NH2   . ARG A 1 306 ? -9.677  161.484 22.200  1.00 104.01 ? 1060 ARG A NH2   1 
ATOM   1937  N  N     . LYS A 1 307 ? -11.194 153.259 19.784  1.00 46.09  ? 1061 LYS A N     1 
ATOM   1938  C  CA    . LYS A 1 307 ? -10.802 151.868 19.506  1.00 46.93  ? 1061 LYS A CA    1 
ATOM   1939  C  C     . LYS A 1 307 ? -9.718  151.385 20.463  1.00 45.87  ? 1061 LYS A C     1 
ATOM   1940  O  O     . LYS A 1 307 ? -8.663  152.025 20.634  1.00 44.70  ? 1061 LYS A O     1 
ATOM   1941  C  CB    . LYS A 1 307 ? -10.334 151.714 18.056  1.00 46.31  ? 1061 LYS A CB    1 
ATOM   1942  C  CG    . LYS A 1 307 ? -9.877  150.316 17.656  1.00 47.49  ? 1061 LYS A CG    1 
ATOM   1943  C  CD    . LYS A 1 307 ? -11.011 149.268 17.476  1.00 68.32  ? 1061 LYS A CD    1 
ATOM   1944  C  CE    . LYS A 1 307 ? -12.175 149.738 16.606  1.00 73.82  ? 1061 LYS A CE    1 
ATOM   1945  N  NZ    . LYS A 1 307 ? -13.249 148.680 16.437  1.00 75.99  ? 1061 LYS A NZ    1 
ATOM   1946  N  N     . SER A 1 308 ? -9.979  150.259 21.104  1.00 46.10  ? 1062 SER A N     1 
ATOM   1947  C  CA    . SER A 1 308 ? -9.004  149.730 22.038  1.00 50.95  ? 1062 SER A CA    1 
ATOM   1948  C  C     . SER A 1 308 ? -7.600  149.656 21.439  1.00 54.02  ? 1062 SER A C     1 
ATOM   1949  O  O     . SER A 1 308 ? -6.620  149.982 22.123  1.00 47.98  ? 1062 SER A O     1 
ATOM   1950  C  CB    . SER A 1 308 ? -9.448  148.377 22.585  1.00 50.40  ? 1062 SER A CB    1 
ATOM   1951  O  OG    . SER A 1 308 ? -10.608 148.546 23.388  1.00 54.52  ? 1062 SER A OG    1 
ATOM   1952  N  N     . ALA A 1 309 ? -7.493  149.264 20.168  1.00 46.20  ? 1063 ALA A N     1 
ATOM   1953  C  CA    . ALA A 1 309 ? -6.171  149.173 19.552  1.00 42.43  ? 1063 ALA A CA    1 
ATOM   1954  C  C     . ALA A 1 309 ? -5.432  150.520 19.500  1.00 47.07  ? 1063 ALA A C     1 
ATOM   1955  O  O     . ALA A 1 309 ? -4.214  150.568 19.649  1.00 56.13  ? 1063 ALA A O     1 
ATOM   1956  C  CB    . ALA A 1 309 ? -6.237  148.546 18.205  1.00 41.70  ? 1063 ALA A CB    1 
ATOM   1957  N  N     . LYS A 1 310 ? -6.158  151.615 19.315  1.00 48.27  ? 1064 LYS A N     1 
ATOM   1958  C  CA    . LYS A 1 310 ? -5.505  152.914 19.194  1.00 47.74  ? 1064 LYS A CA    1 
ATOM   1959  C  C     . LYS A 1 310 ? -4.892  153.309 20.523  1.00 46.35  ? 1064 LYS A C     1 
ATOM   1960  O  O     . LYS A 1 310 ? -3.786  153.831 20.564  1.00 49.43  ? 1064 LYS A O     1 
ATOM   1961  C  CB    . LYS A 1 310 ? -6.470  153.998 18.706  1.00 41.71  ? 1064 LYS A CB    1 
ATOM   1962  C  CG    . LYS A 1 310 ? -5.821  155.371 18.608  1.00 48.68  ? 1064 LYS A CG    1 
ATOM   1963  C  CD    . LYS A 1 310 ? -6.787  156.426 18.120  1.00 56.52  ? 1064 LYS A CD    1 
ATOM   1964  C  CE    . LYS A 1 310 ? -6.169  157.809 18.102  1.00 68.38  ? 1064 LYS A CE    1 
ATOM   1965  N  NZ    . LYS A 1 310 ? -7.202  158.820 17.674  1.00 79.04  ? 1064 LYS A NZ    1 
ATOM   1966  N  N     . SER A 1 311 ? -5.627  153.063 21.606  1.00 43.61  ? 1065 SER A N     1 
ATOM   1967  C  CA    . SER A 1 311 ? -5.156  153.368 22.945  1.00 43.20  ? 1065 SER A CA    1 
ATOM   1968  C  C     . SER A 1 311 ? -3.912  152.552 23.259  1.00 48.76  ? 1065 SER A C     1 
ATOM   1969  O  O     . SER A 1 311 ? -2.895  153.090 23.717  1.00 52.77  ? 1065 SER A O     1 
ATOM   1970  C  CB    . SER A 1 311 ? -6.232  153.017 23.963  1.00 48.79  ? 1065 SER A CB    1 
ATOM   1971  O  OG    . SER A 1 311 ? -7.495  153.559 23.607  1.00 61.86  ? 1065 SER A OG    1 
ATOM   1972  N  N     . VAL A 1 312 ? -4.015  151.243 23.019  1.00 43.33  ? 1066 VAL A N     1 
ATOM   1973  C  CA    . VAL A 1 312 ? -2.949  150.297 23.337  1.00 42.28  ? 1066 VAL A CA    1 
ATOM   1974  C  C     . VAL A 1 312 ? -1.630  150.617 22.630  1.00 48.30  ? 1066 VAL A C     1 
ATOM   1975  O  O     . VAL A 1 312 ? -0.563  150.522 23.219  1.00 62.07  ? 1066 VAL A O     1 
ATOM   1976  C  CB    . VAL A 1 312 ? -3.374  148.861 23.004  1.00 42.27  ? 1066 VAL A CB    1 
ATOM   1977  C  CG1   . VAL A 1 312 ? -2.173  147.964 22.925  1.00 38.93  ? 1066 VAL A CG1   1 
ATOM   1978  C  CG2   . VAL A 1 312 ? -4.346  148.342 24.029  1.00 46.38  ? 1066 VAL A CG2   1 
ATOM   1979  N  N     . GLY A 1 313 ? -1.699  150.992 21.364  1.00 46.08  ? 1067 GLY A N     1 
ATOM   1980  C  CA    . GLY A 1 313 ? -0.497  151.304 20.603  1.00 51.18  ? 1067 GLY A CA    1 
ATOM   1981  C  C     . GLY A 1 313 ? 0.126   152.597 21.087  1.00 53.73  ? 1067 GLY A C     1 
ATOM   1982  O  O     . GLY A 1 313 ? 1.343   152.778 21.071  1.00 53.52  ? 1067 GLY A O     1 
ATOM   1983  N  N     . ASN A 1 314 ? -0.723  153.506 21.540  1.00 48.10  ? 1068 ASN A N     1 
ATOM   1984  C  CA    . ASN A 1 314 ? -0.240  154.742 22.105  1.00 43.53  ? 1068 ASN A CA    1 
ATOM   1985  C  C     . ASN A 1 314 ? 0.527   154.488 23.396  1.00 46.58  ? 1068 ASN A C     1 
ATOM   1986  O  O     . ASN A 1 314 ? 1.543   155.135 23.649  1.00 46.10  ? 1068 ASN A O     1 
ATOM   1987  C  CB    . ASN A 1 314 ? -1.402  155.667 22.378  1.00 51.14  ? 1068 ASN A CB    1 
ATOM   1988  C  CG    . ASN A 1 314 ? -1.835  156.424 21.156  1.00 62.31  ? 1068 ASN A CG    1 
ATOM   1989  O  OD1   . ASN A 1 314 ? -1.123  156.482 20.143  1.00 63.35  ? 1068 ASN A OD1   1 
ATOM   1990  N  ND2   . ASN A 1 314 ? -3.009  157.033 21.245  1.00 73.08  ? 1068 ASN A ND2   1 
ATOM   1991  N  N     . ILE A 1 315 ? 0.039   153.545 24.206  1.00 49.68  ? 1069 ILE A N     1 
ATOM   1992  C  CA    . ILE A 1 315 ? 0.703   153.186 25.458  1.00 46.30  ? 1069 ILE A CA    1 
ATOM   1993  C  C     . ILE A 1 315 ? 2.040   152.514 25.174  1.00 55.03  ? 1069 ILE A C     1 
ATOM   1994  O  O     . ILE A 1 315 ? 3.061   152.850 25.779  1.00 49.78  ? 1069 ILE A O     1 
ATOM   1995  C  CB    . ILE A 1 315 ? -0.146  152.221 26.285  1.00 42.21  ? 1069 ILE A CB    1 
ATOM   1996  C  CG1   . ILE A 1 315 ? -1.342  152.945 26.889  1.00 48.17  ? 1069 ILE A CG1   1 
ATOM   1997  C  CG2   . ILE A 1 315 ? 0.698   151.558 27.360  1.00 41.79  ? 1069 ILE A CG2   1 
ATOM   1998  C  CD1   . ILE A 1 315 ? -2.538  152.053 27.046  1.00 43.30  ? 1069 ILE A CD1   1 
ATOM   1999  N  N     . MET A 1 316 ? 2.010   151.570 24.234  1.00 57.31  ? 1070 MET A N     1 
ATOM   2000  C  CA    . MET A 1 316 ? 3.183   150.814 23.815  1.00 48.23  ? 1070 MET A CA    1 
ATOM   2001  C  C     . MET A 1 316 ? 4.251   151.708 23.177  1.00 54.74  ? 1070 MET A C     1 
ATOM   2002  O  O     . MET A 1 316 ? 5.440   151.534 23.421  1.00 62.62  ? 1070 MET A O     1 
ATOM   2003  C  CB    . MET A 1 316 ? 2.761   149.704 22.847  1.00 46.35  ? 1070 MET A CB    1 
ATOM   2004  C  CG    . MET A 1 316 ? 3.860   148.699 22.528  1.00 47.51  ? 1070 MET A CG    1 
ATOM   2005  S  SD    . MET A 1 316 ? 3.287   147.344 21.495  1.00 75.69  ? 1070 MET A SD    1 
ATOM   2006  C  CE    . MET A 1 316 ? 1.650   147.043 22.173  1.00 59.19  ? 1070 MET A CE    1 
ATOM   2007  N  N     . GLY A 1 317 ? 3.830   152.669 22.362  1.00 55.62  ? 1071 GLY A N     1 
ATOM   2008  C  CA    . GLY A 1 317 ? 4.782   153.539 21.691  1.00 50.92  ? 1071 GLY A CA    1 
ATOM   2009  C  C     . GLY A 1 317 ? 5.312   154.637 22.593  1.00 59.70  ? 1071 GLY A C     1 
ATOM   2010  O  O     . GLY A 1 317 ? 6.394   155.168 22.374  1.00 69.28  ? 1071 GLY A O     1 
ATOM   2011  N  N     . ASN A 1 318 ? 4.558   154.982 23.626  1.00 60.56  ? 1072 ASN A N     1 
ATOM   2012  C  CA    . ASN A 1 318 ? 4.910   156.145 24.429  1.00 60.83  ? 1072 ASN A CA    1 
ATOM   2013  C  C     . ASN A 1 318 ? 5.484   155.832 25.797  1.00 51.84  ? 1072 ASN A C     1 
ATOM   2014  O  O     . ASN A 1 318 ? 6.392   156.522 26.244  1.00 49.25  ? 1072 ASN A O     1 
ATOM   2015  C  CB    . ASN A 1 318 ? 3.717   157.093 24.555  1.00 66.55  ? 1072 ASN A CB    1 
ATOM   2016  C  CG    . ASN A 1 318 ? 3.402   157.798 23.244  1.00 71.55  ? 1072 ASN A CG    1 
ATOM   2017  O  OD1   . ASN A 1 318 ? 4.216   157.790 22.325  1.00 64.71  ? 1072 ASN A OD1   1 
ATOM   2018  N  ND2   . ASN A 1 318 ? 2.224   158.411 23.156  1.00 79.04  ? 1072 ASN A ND2   1 
ATOM   2019  N  N     . PHE A 1 319 ? 4.983   154.788 26.451  1.00 47.86  ? 1073 PHE A N     1 
ATOM   2020  C  CA    . PHE A 1 319 ? 5.316   154.581 27.864  1.00 50.81  ? 1073 PHE A CA    1 
ATOM   2021  C  C     . PHE A 1 319 ? 5.810   153.195 28.287  1.00 56.92  ? 1073 PHE A C     1 
ATOM   2022  O  O     . PHE A 1 319 ? 6.833   153.083 28.945  1.00 66.11  ? 1073 PHE A O     1 
ATOM   2023  C  CB    . PHE A 1 319 ? 4.131   155.016 28.725  1.00 45.44  ? 1073 PHE A CB    1 
ATOM   2024  C  CG    . PHE A 1 319 ? 3.657   156.381 28.397  1.00 52.00  ? 1073 PHE A CG    1 
ATOM   2025  C  CD1   . PHE A 1 319 ? 4.393   157.488 28.794  1.00 55.44  ? 1073 PHE A CD1   1 
ATOM   2026  C  CD2   . PHE A 1 319 ? 2.506   156.565 27.639  1.00 52.54  ? 1073 PHE A CD2   1 
ATOM   2027  C  CE1   . PHE A 1 319 ? 3.971   158.774 28.465  1.00 60.50  ? 1073 PHE A CE1   1 
ATOM   2028  C  CE2   . PHE A 1 319 ? 2.077   157.839 27.299  1.00 52.97  ? 1073 PHE A CE2   1 
ATOM   2029  C  CZ    . PHE A 1 319 ? 2.808   158.953 27.709  1.00 54.67  ? 1073 PHE A CZ    1 
ATOM   2030  N  N     . HIS A 1 320 ? 5.072   152.165 27.893  1.00 57.25  ? 1074 HIS A N     1 
ATOM   2031  C  CA    . HIS A 1 320 ? 5.250   150.789 28.325  1.00 48.84  ? 1074 HIS A CA    1 
ATOM   2032  C  C     . HIS A 1 320 ? 5.876   149.925 27.231  1.00 57.98  ? 1074 HIS A C     1 
ATOM   2033  O  O     . HIS A 1 320 ? 5.200   149.516 26.292  1.00 59.27  ? 1074 HIS A O     1 
ATOM   2034  C  CB    . HIS A 1 320 ? 3.869   150.234 28.601  1.00 44.36  ? 1074 HIS A CB    1 
ATOM   2035  C  CG    . HIS A 1 320 ? 3.850   149.086 29.557  1.00 58.76  ? 1074 HIS A CG    1 
ATOM   2036  N  ND1   . HIS A 1 320 ? 4.252   149.202 30.872  1.00 53.52  ? 1074 HIS A ND1   1 
ATOM   2037  C  CD2   . HIS A 1 320 ? 3.431   147.809 29.401  1.00 63.73  ? 1074 HIS A CD2   1 
ATOM   2038  C  CE1   . HIS A 1 320 ? 4.090   148.040 31.478  1.00 53.74  ? 1074 HIS A CE1   1 
ATOM   2039  N  NE2   . HIS A 1 320 ? 3.593   147.178 30.611  1.00 53.37  ? 1074 HIS A NE2   1 
ATOM   2040  N  N     . PRO A 1 321 ? 7.166   149.607 27.361  1.00 60.29  ? 1075 PRO A N     1 
ATOM   2041  C  CA    . PRO A 1 321 ? 7.848   148.845 26.309  1.00 62.09  ? 1075 PRO A CA    1 
ATOM   2042  C  C     . PRO A 1 321 ? 7.629   147.352 26.441  1.00 59.33  ? 1075 PRO A C     1 
ATOM   2043  O  O     . PRO A 1 321 ? 8.625   146.615 26.480  1.00 63.54  ? 1075 PRO A O     1 
ATOM   2044  C  CB    . PRO A 1 321 ? 9.314   149.116 26.603  1.00 67.60  ? 1075 PRO A CB    1 
ATOM   2045  C  CG    . PRO A 1 321 ? 9.328   149.146 28.130  1.00 59.50  ? 1075 PRO A CG    1 
ATOM   2046  C  CD    . PRO A 1 321 ? 8.044   149.870 28.515  1.00 52.95  ? 1075 PRO A CD    1 
ATOM   2047  N  N     . HIS A 1 322 ? 6.377   146.906 26.504  1.00 50.88  ? 1076 HIS A N     1 
ATOM   2048  C  CA    . HIS A 1 322 ? 6.094   145.465 26.489  1.00 53.25  ? 1076 HIS A CA    1 
ATOM   2049  C  C     . HIS A 1 322 ? 4.972   145.088 25.518  1.00 59.62  ? 1076 HIS A C     1 
ATOM   2050  O  O     . HIS A 1 322 ? 4.423   145.936 24.800  1.00 63.77  ? 1076 HIS A O     1 
ATOM   2051  C  CB    . HIS A 1 322 ? 5.803   144.959 27.899  1.00 52.27  ? 1076 HIS A CB    1 
ATOM   2052  C  CG    . HIS A 1 322 ? 6.852   145.347 28.896  1.00 51.89  ? 1076 HIS A CG    1 
ATOM   2053  N  ND1   . HIS A 1 322 ? 7.967   144.576 29.144  1.00 57.83  ? 1076 HIS A ND1   1 
ATOM   2054  C  CD2   . HIS A 1 322 ? 6.982   146.453 29.665  1.00 48.87  ? 1076 HIS A CD2   1 
ATOM   2055  C  CE1   . HIS A 1 322 ? 8.728   145.174 30.046  1.00 57.83  ? 1076 HIS A CE1   1 
ATOM   2056  N  NE2   . HIS A 1 322 ? 8.153   146.316 30.377  1.00 58.94  ? 1076 HIS A NE2   1 
ATOM   2057  N  N     . GLY A 1 323 ? 4.639   143.806 25.478  1.00 59.07  ? 1077 GLY A N     1 
ATOM   2058  C  CA    . GLY A 1 323 ? 3.735   143.331 24.454  1.00 60.70  ? 1077 GLY A CA    1 
ATOM   2059  C  C     . GLY A 1 323 ? 2.326   143.836 24.653  1.00 61.43  ? 1077 GLY A C     1 
ATOM   2060  O  O     . GLY A 1 323 ? 1.874   143.994 25.790  1.00 63.18  ? 1077 GLY A O     1 
ATOM   2061  N  N     . ASP A 1 324 ? 1.624   144.067 23.547  1.00 66.46  ? 1078 ASP A N     1 
ATOM   2062  C  CA    . ASP A 1 324 ? 0.230   144.495 23.593  1.00 62.23  ? 1078 ASP A CA    1 
ATOM   2063  C  C     . ASP A 1 324 ? -0.669  143.540 24.394  1.00 50.58  ? 1078 ASP A C     1 
ATOM   2064  O  O     . ASP A 1 324 ? -1.521  143.995 25.145  1.00 56.31  ? 1078 ASP A O     1 
ATOM   2065  C  CB    . ASP A 1 324 ? -0.327  144.664 22.184  1.00 65.26  ? 1078 ASP A CB    1 
ATOM   2066  C  CG    . ASP A 1 324 ? -0.355  143.359 21.432  1.00 72.17  ? 1078 ASP A CG    1 
ATOM   2067  O  OD1   . ASP A 1 324 ? 0.733   142.950 20.995  1.00 71.45  ? 1078 ASP A OD1   1 
ATOM   2068  O  OD2   . ASP A 1 324 ? -1.435  142.726 21.328  1.00 76.09  ? 1078 ASP A OD2   1 
ATOM   2069  N  N     . SER A 1 325 ? -0.503  142.227 24.265  1.00 47.93  ? 1079 SER A N     1 
ATOM   2070  C  CA    . SER A 1 325 ? -1.392  141.355 25.049  1.00 52.36  ? 1079 SER A CA    1 
ATOM   2071  C  C     . SER A 1 325 ? -1.427  141.764 26.545  1.00 56.14  ? 1079 SER A C     1 
ATOM   2072  O  O     . SER A 1 325 ? -2.497  142.044 27.071  1.00 56.28  ? 1079 SER A O     1 
ATOM   2073  C  CB    . SER A 1 325 ? -1.121  139.863 24.840  1.00 52.38  ? 1079 SER A CB    1 
ATOM   2074  O  OG    . SER A 1 325 ? 0.167   139.501 25.298  1.00 69.92  ? 1079 SER A OG    1 
ATOM   2075  N  N     . SER A 1 326 ? -0.272  141.850 27.205  1.00 51.27  ? 1080 SER A N     1 
ATOM   2076  C  CA    . SER A 1 326 ? -0.223  142.389 28.565  1.00 56.57  ? 1080 SER A CA    1 
ATOM   2077  C  C     . SER A 1 326 ? -0.996  143.699 28.691  1.00 56.74  ? 1080 SER A C     1 
ATOM   2078  O  O     . SER A 1 326 ? -1.887  143.821 29.533  1.00 68.32  ? 1080 SER A O     1 
ATOM   2079  C  CB    . SER A 1 326 ? 1.218   142.586 29.049  1.00 63.17  ? 1080 SER A CB    1 
ATOM   2080  O  OG    . SER A 1 326 ? 1.991   141.434 28.767  1.00 73.47  ? 1080 SER A OG    1 
ATOM   2081  N  N     . ILE A 1 327 ? -0.673  144.682 27.860  1.00 49.67  ? 1081 ILE A N     1 
ATOM   2082  C  CA    . ILE A 1 327 ? -1.341  145.965 28.005  1.00 45.25  ? 1081 ILE A CA    1 
ATOM   2083  C  C     . ILE A 1 327 ? -2.844  145.841 27.832  1.00 43.28  ? 1081 ILE A C     1 
ATOM   2084  O  O     . ILE A 1 327 ? -3.608  146.331 28.628  1.00 48.43  ? 1081 ILE A O     1 
ATOM   2085  C  CB    . ILE A 1 327 ? -0.846  146.985 27.018  1.00 43.54  ? 1081 ILE A CB    1 
ATOM   2086  C  CG1   . ILE A 1 327 ? 0.643   147.251 27.223  1.00 43.03  ? 1081 ILE A CG1   1 
ATOM   2087  C  CG2   . ILE A 1 327 ? -1.619  148.266 27.211  1.00 44.79  ? 1081 ILE A CG2   1 
ATOM   2088  C  CD1   . ILE A 1 327 ? 1.241   148.102 26.112  1.00 48.47  ? 1081 ILE A CD1   1 
ATOM   2089  N  N     . TYR A 1 328 ? -3.285  145.166 26.795  1.00 48.19  ? 1082 TYR A N     1 
ATOM   2090  C  CA    . TYR A 1 328 ? -4.714  145.074 26.603  1.00 52.74  ? 1082 TYR A CA    1 
ATOM   2091  C  C     . TYR A 1 328 ? -5.398  144.279 27.731  1.00 51.48  ? 1082 TYR A C     1 
ATOM   2092  O  O     . TYR A 1 328 ? -6.424  144.705 28.253  1.00 41.27  ? 1082 TYR A O     1 
ATOM   2093  C  CB    . TYR A 1 328 ? -5.024  144.508 25.223  1.00 45.47  ? 1082 TYR A CB    1 
ATOM   2094  C  CG    . TYR A 1 328 ? -6.492  144.423 24.885  1.00 46.10  ? 1082 TYR A CG    1 
ATOM   2095  C  CD1   . TYR A 1 328 ? -7.291  145.562 24.791  1.00 41.29  ? 1082 TYR A CD1   1 
ATOM   2096  C  CD2   . TYR A 1 328 ? -7.090  143.192 24.678  1.00 48.55  ? 1082 TYR A CD2   1 
ATOM   2097  C  CE1   . TYR A 1 328 ? -8.667  145.447 24.465  1.00 37.62  ? 1082 TYR A CE1   1 
ATOM   2098  C  CE2   . TYR A 1 328 ? -8.433  143.073 24.354  1.00 43.13  ? 1082 TYR A CE2   1 
ATOM   2099  C  CZ    . TYR A 1 328 ? -9.214  144.189 24.243  1.00 39.42  ? 1082 TYR A CZ    1 
ATOM   2100  O  OH    . TYR A 1 328 ? -10.534 144.008 23.906  1.00 42.95  ? 1082 TYR A OH    1 
ATOM   2101  N  N     . ASP A 1 329 ? -4.834  143.138 28.117  1.00 51.62  ? 1083 ASP A N     1 
ATOM   2102  C  CA    . ASP A 1 329 ? -5.440  142.319 29.165  1.00 37.14  ? 1083 ASP A CA    1 
ATOM   2103  C  C     . ASP A 1 329 ? -5.637  143.123 30.432  1.00 46.94  ? 1083 ASP A C     1 
ATOM   2104  O  O     . ASP A 1 329 ? -6.664  142.998 31.110  1.00 48.01  ? 1083 ASP A O     1 
ATOM   2105  C  CB    . ASP A 1 329 ? -4.613  141.080 29.434  1.00 42.52  ? 1083 ASP A CB    1 
ATOM   2106  C  CG    . ASP A 1 329 ? -4.681  140.052 28.283  1.00 66.43  ? 1083 ASP A CG    1 
ATOM   2107  O  OD1   . ASP A 1 329 ? -5.512  140.213 27.339  1.00 70.42  ? 1083 ASP A OD1   1 
ATOM   2108  O  OD2   . ASP A 1 329 ? -3.897  139.072 28.338  1.00 70.65  ? 1083 ASP A OD2   1 
ATOM   2109  N  N     . ALA A 1 330 ? -4.666  143.973 30.736  1.00 38.73  ? 1084 ALA A N     1 
ATOM   2110  C  CA    . ALA A 1 330 ? -4.791  144.903 31.849  1.00 42.18  ? 1084 ALA A CA    1 
ATOM   2111  C  C     . ALA A 1 330 ? -5.923  145.926 31.708  1.00 48.62  ? 1084 ALA A C     1 
ATOM   2112  O  O     . ALA A 1 330 ? -6.683  146.197 32.655  1.00 53.51  ? 1084 ALA A O     1 
ATOM   2113  C  CB    . ALA A 1 330 ? -3.474  145.632 32.069  1.00 40.72  ? 1084 ALA A CB    1 
ATOM   2114  N  N     . MET A 1 331 ? -5.981  146.543 30.539  1.00 49.24  ? 1085 MET A N     1 
ATOM   2115  C  CA    . MET A 1 331 ? -7.039  147.470 30.208  1.00 45.53  ? 1085 MET A CA    1 
ATOM   2116  C  C     . MET A 1 331 ? -8.383  146.759 30.418  1.00 45.18  ? 1085 MET A C     1 
ATOM   2117  O  O     . MET A 1 331 ? -9.330  147.335 30.946  1.00 54.15  ? 1085 MET A O     1 
ATOM   2118  C  CB    . MET A 1 331 ? -6.845  147.937 28.758  1.00 53.11  ? 1085 MET A CB    1 
ATOM   2119  C  CG    . MET A 1 331 ? -7.779  149.021 28.287  1.00 64.41  ? 1085 MET A CG    1 
ATOM   2120  S  SD    . MET A 1 331 ? -7.264  149.777 26.732  1.00 57.96  ? 1085 MET A SD    1 
ATOM   2121  N  N     . VAL A 1 332 ? -8.447  145.491 30.034  1.00 38.73  ? 1086 VAL A N     1 
ATOM   2122  C  CA    . VAL A 1 332 ? -9.702  144.766 30.026  1.00 43.45  ? 1086 VAL A CA    1 
ATOM   2123  C  C     . VAL A 1 332 ? -10.117 144.485 31.472  1.00 47.62  ? 1086 VAL A C     1 
ATOM   2124  O  O     . VAL A 1 332 ? -11.277 144.689 31.853  1.00 48.17  ? 1086 VAL A O     1 
ATOM   2125  C  CB    . VAL A 1 332 ? -9.583  143.455 29.176  1.00 50.43  ? 1086 VAL A CB    1 
ATOM   2126  C  CG1   . VAL A 1 332 ? -10.709 142.449 29.486  1.00 49.46  ? 1086 VAL A CG1   1 
ATOM   2127  C  CG2   . VAL A 1 332 ? -9.537  143.780 27.680  1.00 47.43  ? 1086 VAL A CG2   1 
ATOM   2128  N  N     . ARG A 1 333 ? -9.163  144.040 32.288  1.00 43.86  ? 1087 ARG A N     1 
ATOM   2129  C  CA    . ARG A 1 333 ? -9.464  143.771 33.684  1.00 43.08  ? 1087 ARG A CA    1 
ATOM   2130  C  C     . ARG A 1 333 ? -10.030 145.024 34.373  1.00 46.53  ? 1087 ARG A C     1 
ATOM   2131  O  O     . ARG A 1 333 ? -11.037 144.959 35.080  1.00 48.91  ? 1087 ARG A O     1 
ATOM   2132  C  CB    . ARG A 1 333 ? -8.237  143.232 34.403  1.00 36.09  ? 1087 ARG A CB    1 
ATOM   2133  C  CG    . ARG A 1 333 ? -8.515  142.719 35.802  1.00 43.89  ? 1087 ARG A CG    1 
ATOM   2134  C  CD    . ARG A 1 333 ? -7.349  141.873 36.350  1.00 42.59  ? 1087 ARG A CD    1 
ATOM   2135  N  NE    . ARG A 1 333 ? -7.751  141.196 37.582  1.00 53.01  ? 1087 ARG A NE    1 
ATOM   2136  C  CZ    . ARG A 1 333 ? -7.885  141.780 38.774  1.00 51.30  ? 1087 ARG A CZ    1 
ATOM   2137  N  NH1   . ARG A 1 333 ? -7.639  143.065 38.917  1.00 39.98  ? 1087 ARG A NH1   1 
ATOM   2138  N  NH2   . ARG A 1 333 ? -8.265  141.070 39.830  1.00 64.34  ? 1087 ARG A NH2   1 
ATOM   2139  N  N     . MET A 1 334 ? -9.411  146.172 34.141  1.00 37.46  ? 1088 MET A N     1 
ATOM   2140  C  CA    . MET A 1 334 ? -9.878  147.390 34.787  1.00 41.05  ? 1088 MET A CA    1 
ATOM   2141  C  C     . MET A 1 334 ? -11.317 147.738 34.350  1.00 50.24  ? 1088 MET A C     1 
ATOM   2142  O  O     . MET A 1 334 ? -11.934 148.669 34.868  1.00 54.54  ? 1088 MET A O     1 
ATOM   2143  C  CB    . MET A 1 334 ? -8.934  148.576 34.488  1.00 38.11  ? 1088 MET A CB    1 
ATOM   2144  C  CG    . MET A 1 334 ? -7.485  148.453 34.993  1.00 35.69  ? 1088 MET A CG    1 
ATOM   2145  S  SD    . MET A 1 334 ? -6.509  149.930 34.616  1.00 63.39  ? 1088 MET A SD    1 
ATOM   2146  C  CE    . MET A 1 334 ? -5.514  149.257 33.291  1.00 63.42  ? 1088 MET A CE    1 
ATOM   2147  N  N     . SER A 1 335 ? -11.849 146.994 33.389  1.00 49.60  ? 1089 SER A N     1 
ATOM   2148  C  CA    . SER A 1 335 ? -13.168 147.298 32.862  1.00 49.34  ? 1089 SER A CA    1 
ATOM   2149  C  C     . SER A 1 335 ? -14.219 146.307 33.345  1.00 48.46  ? 1089 SER A C     1 
ATOM   2150  O  O     . SER A 1 335 ? -15.399 146.457 33.048  1.00 53.95  ? 1089 SER A O     1 
ATOM   2151  C  CB    . SER A 1 335 ? -13.122 147.296 31.334  1.00 55.45  ? 1089 SER A CB    1 
ATOM   2152  O  OG    . SER A 1 335 ? -13.331 145.999 30.803  1.00 49.04  ? 1089 SER A OG    1 
ATOM   2153  N  N     . GLN A 1 336 ? -13.793 145.282 34.077  1.00 47.64  ? 1090 GLN A N     1 
ATOM   2154  C  CA    . GLN A 1 336 ? -14.717 144.221 34.494  1.00 50.53  ? 1090 GLN A CA    1 
ATOM   2155  C  C     . GLN A 1 336 ? -15.212 144.418 35.935  1.00 53.28  ? 1090 GLN A C     1 
ATOM   2156  O  O     . GLN A 1 336 ? -14.428 144.399 36.875  1.00 61.67  ? 1090 GLN A O     1 
ATOM   2157  C  CB    . GLN A 1 336 ? -14.053 142.857 34.326  1.00 45.92  ? 1090 GLN A CB    1 
ATOM   2158  C  CG    . GLN A 1 336 ? -12.973 142.857 33.270  1.00 43.87  ? 1090 GLN A CG    1 
ATOM   2159  C  CD    . GLN A 1 336 ? -12.434 141.475 33.012  1.00 50.16  ? 1090 GLN A CD    1 
ATOM   2160  O  OE1   . GLN A 1 336 ? -11.414 141.055 33.592  1.00 53.85  ? 1090 GLN A OE1   1 
ATOM   2161  N  NE2   . GLN A 1 336 ? -13.120 140.740 32.146  1.00 48.25  ? 1090 GLN A NE2   1 
ATOM   2162  N  N     . ASN A 1 337 ? -16.510 144.603 36.113  1.00 50.58  ? 1091 ASN A N     1 
ATOM   2163  C  CA    . ASN A 1 337 ? -17.011 145.025 37.407  1.00 52.25  ? 1091 ASN A CA    1 
ATOM   2164  C  C     . ASN A 1 337 ? -17.191 143.860 38.353  1.00 55.93  ? 1091 ASN A C     1 
ATOM   2165  O  O     . ASN A 1 337 ? -17.613 144.056 39.498  1.00 60.27  ? 1091 ASN A O     1 
ATOM   2166  C  CB    . ASN A 1 337 ? -18.327 145.770 37.283  1.00 51.52  ? 1091 ASN A CB    1 
ATOM   2167  C  CG    . ASN A 1 337 ? -19.425 144.904 36.715  1.00 60.93  ? 1091 ASN A CG    1 
ATOM   2168  O  OD1   . ASN A 1 337 ? -19.174 143.852 36.105  1.00 62.76  ? 1091 ASN A OD1   1 
ATOM   2169  N  ND2   . ASN A 1 337 ? -20.654 145.333 36.912  1.00 66.64  ? 1091 ASN A ND2   1 
ATOM   2170  N  N     . TRP A 1 338 ? -16.888 142.651 37.888  1.00 47.19  ? 1092 TRP A N     1 
ATOM   2171  C  CA    . TRP A 1 338 ? -16.826 141.519 38.808  1.00 52.39  ? 1092 TRP A CA    1 
ATOM   2172  C  C     . TRP A 1 338 ? -15.385 141.272 39.301  1.00 53.10  ? 1092 TRP A C     1 
ATOM   2173  O  O     . TRP A 1 338 ? -15.153 140.310 40.031  1.00 45.77  ? 1092 TRP A O     1 
ATOM   2174  C  CB    . TRP A 1 338 ? -17.434 140.247 38.181  1.00 57.34  ? 1092 TRP A CB    1 
ATOM   2175  C  CG    . TRP A 1 338 ? -16.652 139.746 36.968  1.00 60.45  ? 1092 TRP A CG    1 
ATOM   2176  C  CD1   . TRP A 1 338 ? -15.687 138.795 36.961  1.00 62.86  ? 1092 TRP A CD1   1 
ATOM   2177  C  CD2   . TRP A 1 338 ? -16.766 140.207 35.611  1.00 57.82  ? 1092 TRP A CD2   1 
ATOM   2178  N  NE1   . TRP A 1 338 ? -15.194 138.624 35.692  1.00 63.13  ? 1092 TRP A NE1   1 
ATOM   2179  C  CE2   . TRP A 1 338 ? -15.843 139.473 34.844  1.00 57.90  ? 1092 TRP A CE2   1 
ATOM   2180  C  CE3   . TRP A 1 338 ? -17.562 141.165 34.975  1.00 44.90  ? 1092 TRP A CE3   1 
ATOM   2181  C  CZ2   . TRP A 1 338 ? -15.687 139.662 33.478  1.00 54.73  ? 1092 TRP A CZ2   1 
ATOM   2182  C  CZ3   . TRP A 1 338 ? -17.409 141.348 33.637  1.00 45.10  ? 1092 TRP A CZ3   1 
ATOM   2183  C  CH2   . TRP A 1 338 ? -16.467 140.610 32.894  1.00 49.77  ? 1092 TRP A CH2   1 
ATOM   2184  N  N     . LYS A 1 339 ? -14.429 142.113 38.895  1.00 42.05  ? 1093 LYS A N     1 
ATOM   2185  C  CA    . LYS A 1 339 ? -13.061 142.025 39.413  1.00 49.61  ? 1093 LYS A CA    1 
ATOM   2186  C  C     . LYS A 1 339 ? -12.661 143.333 40.105  1.00 51.19  ? 1093 LYS A C     1 
ATOM   2187  O  O     . LYS A 1 339 ? -12.086 143.317 41.207  1.00 56.56  ? 1093 LYS A O     1 
ATOM   2188  C  CB    . LYS A 1 339 ? -12.030 141.609 38.346  1.00 42.43  ? 1093 LYS A CB    1 
ATOM   2189  C  CG    . LYS A 1 339 ? -12.387 140.311 37.623  1.00 55.21  ? 1093 LYS A CG    1 
ATOM   2190  C  CD    . LYS A 1 339 ? -11.194 139.418 37.268  1.00 61.34  ? 1093 LYS A CD    1 
ATOM   2191  C  CE    . LYS A 1 339 ? -11.529 137.944 37.591  1.00 72.32  ? 1093 LYS A CE    1 
ATOM   2192  N  NZ    . LYS A 1 339 ? -10.419 136.969 37.362  1.00 80.92  ? 1093 LYS A NZ    1 
ATOM   2193  N  N     . ASN A 1 340 ? -12.990 144.468 39.495  1.00 41.95  ? 1094 ASN A N     1 
ATOM   2194  C  CA    . ASN A 1 340 ? -12.842 145.738 40.208  1.00 52.42  ? 1094 ASN A CA    1 
ATOM   2195  C  C     . ASN A 1 340 ? -14.100 146.195 40.944  1.00 53.84  ? 1094 ASN A C     1 
ATOM   2196  O  O     . ASN A 1 340 ? -15.206 146.075 40.411  1.00 49.54  ? 1094 ASN A O     1 
ATOM   2197  C  CB    . ASN A 1 340 ? -12.319 146.817 39.279  1.00 48.75  ? 1094 ASN A CB    1 
ATOM   2198  C  CG    . ASN A 1 340 ? -10.876 146.577 38.893  1.00 62.94  ? 1094 ASN A CG    1 
ATOM   2199  O  OD1   . ASN A 1 340 ? -10.586 145.818 37.971  1.00 74.36  ? 1094 ASN A OD1   1 
ATOM   2200  N  ND2   . ASN A 1 340 ? -9.958  147.206 39.615  1.00 65.24  ? 1094 ASN A ND2   1 
ATOM   2201  N  N     . ARG A 1 341 ? -13.930 146.684 42.180  1.00 50.97  ? 1095 ARG A N     1 
ATOM   2202  C  CA    . ARG A 1 341 ? -15.062 147.198 42.979  1.00 47.70  ? 1095 ARG A CA    1 
ATOM   2203  C  C     . ARG A 1 341 ? -15.533 148.530 42.424  1.00 47.24  ? 1095 ARG A C     1 
ATOM   2204  O  O     . ARG A 1 341 ? -16.653 148.966 42.653  1.00 51.46  ? 1095 ARG A O     1 
ATOM   2205  C  CB    . ARG A 1 341 ? -14.668 147.393 44.448  1.00 45.26  ? 1095 ARG A CB    1 
ATOM   2206  C  CG    . ARG A 1 341 ? -15.797 147.905 45.352  1.00 42.65  ? 1095 ARG A CG    1 
ATOM   2207  C  CD    . ARG A 1 341 ? -16.901 146.889 45.413  1.00 45.32  ? 1095 ARG A CD    1 
ATOM   2208  N  NE    . ARG A 1 341 ? -18.036 147.346 46.200  1.00 51.72  ? 1095 ARG A NE    1 
ATOM   2209  C  CZ    . ARG A 1 341 ? -18.850 148.323 45.832  1.00 52.45  ? 1095 ARG A CZ    1 
ATOM   2210  N  NH1   . ARG A 1 341 ? -18.639 148.947 44.697  1.00 60.16  ? 1095 ARG A NH1   1 
ATOM   2211  N  NH2   . ARG A 1 341 ? -19.872 148.673 46.600  1.00 50.80  ? 1095 ARG A NH2   1 
ATOM   2212  N  N     . GLU A 1 342 ? -14.654 149.165 41.671  1.00 46.49  ? 1096 GLU A N     1 
ATOM   2213  C  CA    . GLU A 1 342 ? -14.913 150.482 41.144  1.00 44.14  ? 1096 GLU A CA    1 
ATOM   2214  C  C     . GLU A 1 342 ? -14.137 150.571 39.814  1.00 48.63  ? 1096 GLU A C     1 
ATOM   2215  O  O     . GLU A 1 342 ? -12.964 150.976 39.801  1.00 45.18  ? 1096 GLU A O     1 
ATOM   2216  C  CB    . GLU A 1 342 ? -14.424 151.521 42.162  1.00 39.20  ? 1096 GLU A CB    1 
ATOM   2217  C  CG    . GLU A 1 342 ? -15.359 152.679 42.458  1.00 50.82  ? 1096 GLU A CG    1 
ATOM   2218  C  CD    . GLU A 1 342 ? -16.730 152.267 42.974  1.00 73.33  ? 1096 GLU A CD    1 
ATOM   2219  O  OE1   . GLU A 1 342 ? -16.948 152.265 44.220  1.00 74.43  ? 1096 GLU A OE1   1 
ATOM   2220  O  OE2   . GLU A 1 342 ? -17.606 151.989 42.122  1.00 83.09  ? 1096 GLU A OE2   1 
ATOM   2221  N  N     . ILE A 1 343 ? -14.780 150.190 38.702  1.00 44.66  ? 1097 ILE A N     1 
ATOM   2222  C  CA    . ILE A 1 343 ? -14.063 150.098 37.420  1.00 42.15  ? 1097 ILE A CA    1 
ATOM   2223  C  C     . ILE A 1 343 ? -13.512 151.416 36.922  1.00 36.57  ? 1097 ILE A C     1 
ATOM   2224  O  O     . ILE A 1 343 ? -14.212 152.421 36.913  1.00 40.23  ? 1097 ILE A O     1 
ATOM   2225  C  CB    . ILE A 1 343 ? -14.911 149.508 36.309  1.00 48.62  ? 1097 ILE A CB    1 
ATOM   2226  C  CG1   . ILE A 1 343 ? -16.100 150.402 36.023  1.00 52.66  ? 1097 ILE A CG1   1 
ATOM   2227  C  CG2   . ILE A 1 343 ? -15.418 148.132 36.687  1.00 56.34  ? 1097 ILE A CG2   1 
ATOM   2228  C  CD1   . ILE A 1 343 ? -16.731 150.050 34.702  1.00 44.03  ? 1097 ILE A CD1   1 
ATOM   2229  N  N     . LEU A 1 344 ? -12.248 151.382 36.515  1.00 41.99  ? 1098 LEU A N     1 
ATOM   2230  C  CA    . LEU A 1 344 ? -11.518 152.543 36.009  1.00 44.76  ? 1098 LEU A CA    1 
ATOM   2231  C  C     . LEU A 1 344 ? -11.641 152.701 34.473  1.00 45.36  ? 1098 LEU A C     1 
ATOM   2232  O  O     . LEU A 1 344 ? -11.379 153.765 33.921  1.00 48.05  ? 1098 LEU A O     1 
ATOM   2233  C  CB    . LEU A 1 344 ? -10.046 152.435 36.423  1.00 40.34  ? 1098 LEU A CB    1 
ATOM   2234  C  CG    . LEU A 1 344 ? -9.845  152.230 37.935  1.00 40.78  ? 1098 LEU A CG    1 
ATOM   2235  C  CD1   . LEU A 1 344 ? -8.398  151.965 38.291  1.00 34.88  ? 1098 LEU A CD1   1 
ATOM   2236  C  CD2   . LEU A 1 344 ? -10.354 153.440 38.710  1.00 40.68  ? 1098 LEU A CD2   1 
ATOM   2237  N  N     . VAL A 1 345 ? -12.047 151.646 33.782  1.00 49.21  ? 1099 VAL A N     1 
ATOM   2238  C  CA    . VAL A 1 345 ? -12.214 151.729 32.336  1.00 43.10  ? 1099 VAL A CA    1 
ATOM   2239  C  C     . VAL A 1 345 ? -13.584 151.230 31.874  1.00 48.07  ? 1099 VAL A C     1 
ATOM   2240  O  O     . VAL A 1 345 ? -14.024 150.146 32.244  1.00 60.56  ? 1099 VAL A O     1 
ATOM   2241  C  CB    . VAL A 1 345 ? -11.117 150.935 31.598  1.00 40.26  ? 1099 VAL A CB    1 
ATOM   2242  C  CG1   . VAL A 1 345 ? -11.401 150.912 30.146  1.00 35.94  ? 1099 VAL A CG1   1 
ATOM   2243  C  CG2   . VAL A 1 345 ? -9.757  151.566 31.855  1.00 40.96  ? 1099 VAL A CG2   1 
ATOM   2244  N  N     . GLU A 1 346 ? -14.263 152.034 31.077  1.00 47.51  ? 1100 GLU A N     1 
ATOM   2245  C  CA    . GLU A 1 346 ? -15.502 151.597 30.469  1.00 45.29  ? 1100 GLU A CA    1 
ATOM   2246  C  C     . GLU A 1 346 ? -15.193 151.086 29.057  1.00 46.50  ? 1100 GLU A C     1 
ATOM   2247  O  O     . GLU A 1 346 ? -14.599 151.797 28.236  1.00 51.46  ? 1100 GLU A O     1 
ATOM   2248  C  CB    . GLU A 1 346 ? -16.515 152.740 30.441  1.00 45.31  ? 1100 GLU A CB    1 
ATOM   2249  C  CG    . GLU A 1 346 ? -17.325 152.867 31.686  1.00 65.53  ? 1100 GLU A CG    1 
ATOM   2250  C  CD    . GLU A 1 346 ? -17.835 154.276 31.869  1.00 86.74  ? 1100 GLU A CD    1 
ATOM   2251  O  OE1   . GLU A 1 346 ? -18.021 154.688 33.046  1.00 88.94  ? 1100 GLU A OE1   1 
ATOM   2252  O  OE2   . GLU A 1 346 ? -18.037 154.964 30.832  1.00 88.64  ? 1100 GLU A OE2   1 
ATOM   2253  N  N     . MET A 1 347 ? -15.593 149.848 28.787  1.00 46.11  ? 1101 MET A N     1 
ATOM   2254  C  CA    . MET A 1 347 ? -15.299 149.186 27.522  1.00 44.74  ? 1101 MET A CA    1 
ATOM   2255  C  C     . MET A 1 347 ? -16.597 148.728 26.847  1.00 47.40  ? 1101 MET A C     1 
ATOM   2256  O  O     . MET A 1 347 ? -17.421 148.045 27.468  1.00 49.98  ? 1101 MET A O     1 
ATOM   2257  C  CB    . MET A 1 347 ? -14.340 148.014 27.760  1.00 36.52  ? 1101 MET A CB    1 
ATOM   2258  C  CG    . MET A 1 347 ? -14.042 147.176 26.555  1.00 47.42  ? 1101 MET A CG    1 
ATOM   2259  S  SD    . MET A 1 347 ? -12.458 146.291 26.635  1.00 66.24  ? 1101 MET A SD    1 
ATOM   2260  C  CE    . MET A 1 347 ? -11.322 147.530 27.270  1.00 47.34  ? 1101 MET A CE    1 
ATOM   2261  N  N     . HIS A 1 348 ? -16.787 149.141 25.584  1.00 53.78  ? 1102 HIS A N     1 
ATOM   2262  C  CA    . HIS A 1 348 ? -17.916 148.685 24.747  1.00 57.75  ? 1102 HIS A CA    1 
ATOM   2263  C  C     . HIS A 1 348 ? -17.588 147.355 24.083  1.00 57.73  ? 1102 HIS A C     1 
ATOM   2264  O  O     . HIS A 1 348 ? -16.526 147.198 23.471  1.00 54.57  ? 1102 HIS A O     1 
ATOM   2265  C  CB    . HIS A 1 348 ? -18.196 149.672 23.629  1.00 66.07  ? 1102 HIS A CB    1 
ATOM   2266  C  CG    . HIS A 1 348 ? -19.290 150.632 23.932  1.00 79.45  ? 1102 HIS A CG    1 
ATOM   2267  N  ND1   . HIS A 1 348 ? -20.132 150.482 25.012  1.00 91.55  ? 1102 HIS A ND1   1 
ATOM   2268  C  CD2   . HIS A 1 348 ? -19.678 151.767 23.296  1.00 82.63  ? 1102 HIS A CD2   1 
ATOM   2269  C  CE1   . HIS A 1 348 ? -20.996 151.483 25.030  1.00 99.58  ? 1102 HIS A CE1   1 
ATOM   2270  N  NE2   . HIS A 1 348 ? -20.739 152.276 24.000  1.00 94.74  ? 1102 HIS A NE2   1 
ATOM   2271  N  N     . GLY A 1 349 ? -18.508 146.404 24.187  1.00 56.44  ? 1103 GLY A N     1 
ATOM   2272  C  CA    . GLY A 1 349 ? -18.308 145.104 23.584  1.00 47.17  ? 1103 GLY A CA    1 
ATOM   2273  C  C     . GLY A 1 349 ? -17.932 144.020 24.563  1.00 48.20  ? 1103 GLY A C     1 
ATOM   2274  O  O     . GLY A 1 349 ? -18.034 144.175 25.780  1.00 71.46  ? 1103 GLY A O     1 
ATOM   2275  N  N     . ASN A 1 350 ? -17.482 142.919 23.989  1.00 44.20  ? 1104 ASN A N     1 
ATOM   2276  C  CA    . ASN A 1 350 ? -17.136 141.700 24.691  1.00 50.20  ? 1104 ASN A CA    1 
ATOM   2277  C  C     . ASN A 1 350 ? -15.873 141.850 25.513  1.00 45.32  ? 1104 ASN A C     1 
ATOM   2278  O  O     . ASN A 1 350 ? -14.781 141.674 25.005  1.00 48.33  ? 1104 ASN A O     1 
ATOM   2279  C  CB    . ASN A 1 350 ? -16.964 140.546 23.691  1.00 45.86  ? 1104 ASN A CB    1 
ATOM   2280  C  CG    . ASN A 1 350 ? -16.801 139.209 24.377  1.00 58.03  ? 1104 ASN A CG    1 
ATOM   2281  O  OD1   . ASN A 1 350 ? -16.392 139.151 25.541  1.00 64.01  ? 1104 ASN A OD1   1 
ATOM   2282  N  ND2   . ASN A 1 350 ? -17.124 138.119 23.666  1.00 63.67  ? 1104 ASN A ND2   1 
ATOM   2283  N  N     . ASN A 1 351 ? -16.029 142.151 26.797  1.00 52.18  ? 1105 ASN A N     1 
ATOM   2284  C  CA    . ASN A 1 351 ? -14.868 142.240 27.676  1.00 53.43  ? 1105 ASN A CA    1 
ATOM   2285  C  C     . ASN A 1 351 ? -14.827 141.084 28.639  1.00 53.80  ? 1105 ASN A C     1 
ATOM   2286  O  O     . ASN A 1 351 ? -14.274 141.208 29.716  1.00 59.60  ? 1105 ASN A O     1 
ATOM   2287  C  CB    . ASN A 1 351 ? -14.841 143.555 28.440  1.00 50.19  ? 1105 ASN A CB    1 
ATOM   2288  C  CG    . ASN A 1 351 ? -16.039 143.717 29.349  1.00 53.91  ? 1105 ASN A CG    1 
ATOM   2289  O  OD1   . ASN A 1 351 ? -17.131 143.193 29.074  1.00 65.03  ? 1105 ASN A OD1   1 
ATOM   2290  N  ND2   . ASN A 1 351 ? -15.842 144.437 30.449  1.00 46.10  ? 1105 ASN A ND2   1 
ATOM   2291  N  N     . GLY A 1 352 ? -15.414 139.964 28.232  1.00 55.11  ? 1106 GLY A N     1 
ATOM   2292  C  CA    . GLY A 1 352 ? -15.425 138.749 29.025  1.00 51.97  ? 1106 GLY A CA    1 
ATOM   2293  C  C     . GLY A 1 352 ? -16.676 138.647 29.868  1.00 55.03  ? 1106 GLY A C     1 
ATOM   2294  O  O     . GLY A 1 352 ? -17.595 139.461 29.744  1.00 60.63  ? 1106 GLY A O     1 
ATOM   2295  N  N     . SER A 1 353 ? -16.698 137.652 30.743  1.00 58.04  ? 1107 SER A N     1 
ATOM   2296  C  CA    . SER A 1 353 ? -17.846 137.391 31.602  1.00 63.63  ? 1107 SER A CA    1 
ATOM   2297  C  C     . SER A 1 353 ? -17.380 136.622 32.814  1.00 65.89  ? 1107 SER A C     1 
ATOM   2298  O  O     . SER A 1 353 ? -16.306 136.013 32.798  1.00 70.28  ? 1107 SER A O     1 
ATOM   2299  C  CB    . SER A 1 353 ? -18.844 136.507 30.876  1.00 61.44  ? 1107 SER A CB    1 
ATOM   2300  O  OG    . SER A 1 353 ? -18.248 135.241 30.605  1.00 59.10  ? 1107 SER A OG    1 
ATOM   2301  N  N     . MET A 1 354 ? -18.203 136.617 33.853  1.00 57.35  ? 1108 MET A N     1 
ATOM   2302  C  CA    . MET A 1 354 ? -17.935 135.762 35.000  1.00 58.77  ? 1108 MET A CA    1 
ATOM   2303  C  C     . MET A 1 354 ? -17.823 134.292 34.610  1.00 66.23  ? 1108 MET A C     1 
ATOM   2304  O  O     . MET A 1 354 ? -17.376 133.469 35.406  1.00 77.04  ? 1108 MET A O     1 
ATOM   2305  C  CB    . MET A 1 354 ? -19.024 135.910 36.051  1.00 59.03  ? 1108 MET A CB    1 
ATOM   2306  C  CG    . MET A 1 354 ? -18.900 137.133 36.939  1.00 52.83  ? 1108 MET A CG    1 
ATOM   2307  S  SD    . MET A 1 354 ? -20.092 136.965 38.286  1.00 70.58  ? 1108 MET A SD    1 
ATOM   2308  C  CE    . MET A 1 354 ? -19.207 135.813 39.349  1.00 125.66 ? 1108 MET A CE    1 
ATOM   2309  N  N     . ASP A 1 355 ? -18.253 133.944 33.407  1.00 63.46  ? 1109 ASP A N     1 
ATOM   2310  C  CA    . ASP A 1 355 ? -18.138 132.554 32.971  1.00 65.05  ? 1109 ASP A CA    1 
ATOM   2311  C  C     . ASP A 1 355 ? -16.726 132.286 32.454  1.00 64.04  ? 1109 ASP A C     1 
ATOM   2312  O  O     . ASP A 1 355 ? -16.389 131.167 32.072  1.00 61.75  ? 1109 ASP A O     1 
ATOM   2313  C  CB    . ASP A 1 355 ? -19.179 132.202 31.909  1.00 76.71  ? 1109 ASP A CB    1 
ATOM   2314  C  CG    . ASP A 1 355 ? -20.477 131.697 32.510  1.00 97.58  ? 1109 ASP A CG    1 
ATOM   2315  O  OD1   . ASP A 1 355 ? -20.537 131.577 33.757  1.00 100.32 ? 1109 ASP A OD1   1 
ATOM   2316  O  OD2   . ASP A 1 355 ? -21.427 131.401 31.737  1.00 109.34 ? 1109 ASP A OD2   1 
ATOM   2317  N  N     . GLY A 1 356 ? -15.899 133.325 32.437  1.00 60.59  ? 1110 GLY A N     1 
ATOM   2318  C  CA    . GLY A 1 356 ? -14.496 133.151 32.113  1.00 66.44  ? 1110 GLY A CA    1 
ATOM   2319  C  C     . GLY A 1 356 ? -14.155 133.066 30.639  1.00 76.09  ? 1110 GLY A C     1 
ATOM   2320  O  O     . GLY A 1 356 ? -12.998 132.825 30.286  1.00 77.79  ? 1110 GLY A O     1 
ATOM   2321  N  N     . ASP A 1 357 ? -15.143 133.272 29.774  1.00 82.26  ? 1111 ASP A N     1 
ATOM   2322  C  CA    . ASP A 1 357 ? -14.892 133.227 28.337  1.00 81.89  ? 1111 ASP A CA    1 
ATOM   2323  C  C     . ASP A 1 357 ? -14.090 134.444 27.831  1.00 74.12  ? 1111 ASP A C     1 
ATOM   2324  O  O     . ASP A 1 357 ? -14.195 135.543 28.381  1.00 77.29  ? 1111 ASP A O     1 
ATOM   2325  C  CB    . ASP A 1 357 ? -16.198 132.981 27.559  1.00 96.59  ? 1111 ASP A CB    1 
ATOM   2326  C  CG    . ASP A 1 357 ? -17.292 133.999 27.880  1.00 99.35  ? 1111 ASP A CG    1 
ATOM   2327  O  OD1   . ASP A 1 357 ? -17.000 135.214 27.827  1.00 105.05 ? 1111 ASP A OD1   1 
ATOM   2328  O  OD2   . ASP A 1 357 ? -18.446 133.582 28.154  1.00 91.40  ? 1111 ASP A OD2   1 
ATOM   2329  N  N     . PRO A 1 358 ? -13.267 134.243 26.787  1.00 66.51  ? 1112 PRO A N     1 
ATOM   2330  C  CA    . PRO A 1 358 ? -12.277 135.247 26.361  1.00 59.92  ? 1112 PRO A CA    1 
ATOM   2331  C  C     . PRO A 1 358 ? -12.961 136.504 25.917  1.00 60.45  ? 1112 PRO A C     1 
ATOM   2332  O  O     . PRO A 1 358 ? -13.932 136.405 25.161  1.00 69.86  ? 1112 PRO A O     1 
ATOM   2333  C  CB    . PRO A 1 358 ? -11.647 134.627 25.109  1.00 49.23  ? 1112 PRO A CB    1 
ATOM   2334  C  CG    . PRO A 1 358 ? -12.165 133.255 25.016  1.00 51.79  ? 1112 PRO A CG    1 
ATOM   2335  C  CD    . PRO A 1 358 ? -13.434 133.182 25.784  1.00 63.84  ? 1112 PRO A CD    1 
ATOM   2336  N  N     . PRO A 1 359 ? -12.461 137.662 26.363  1.00 52.66  ? 1113 PRO A N     1 
ATOM   2337  C  CA    . PRO A 1 359 ? -12.835 139.001 25.869  1.00 53.32  ? 1113 PRO A CA    1 
ATOM   2338  C  C     . PRO A 1 359 ? -12.475 139.135 24.386  1.00 58.96  ? 1113 PRO A C     1 
ATOM   2339  O  O     . PRO A 1 359 ? -11.427 138.609 23.990  1.00 62.11  ? 1113 PRO A O     1 
ATOM   2340  C  CB    . PRO A 1 359 ? -11.938 139.957 26.671  1.00 41.45  ? 1113 PRO A CB    1 
ATOM   2341  C  CG    . PRO A 1 359 ? -11.183 139.144 27.606  1.00 41.83  ? 1113 PRO A CG    1 
ATOM   2342  C  CD    . PRO A 1 359 ? -11.308 137.685 27.267  1.00 43.87  ? 1113 PRO A CD    1 
ATOM   2343  N  N     . ALA A 1 360 ? -13.310 139.814 23.592  1.00 58.78  ? 1114 ALA A N     1 
ATOM   2344  C  CA    . ALA A 1 360 ? -12.996 140.155 22.194  1.00 47.64  ? 1114 ALA A CA    1 
ATOM   2345  C  C     . ALA A 1 360 ? -11.618 140.797 22.100  1.00 49.30  ? 1114 ALA A C     1 
ATOM   2346  O  O     . ALA A 1 360 ? -11.142 141.437 23.057  1.00 48.61  ? 1114 ALA A O     1 
ATOM   2347  C  CB    . ALA A 1 360 ? -14.055 141.112 21.629  1.00 44.99  ? 1114 ALA A CB    1 
ATOM   2348  N  N     . ALA A 1 361 ? -10.966 140.648 20.955  1.00 48.23  ? 1115 ALA A N     1 
ATOM   2349  C  CA    . ALA A 1 361 ? -9.643  141.246 20.794  1.00 45.18  ? 1115 ALA A CA    1 
ATOM   2350  C  C     . ALA A 1 361 ? -9.666  142.767 20.611  1.00 55.56  ? 1115 ALA A C     1 
ATOM   2351  O  O     . ALA A 1 361 ? -10.689 143.374 20.266  1.00 53.90  ? 1115 ALA A O     1 
ATOM   2352  C  CB    . ALA A 1 361 ? -8.931  140.611 19.684  1.00 44.41  ? 1115 ALA A CB    1 
ATOM   2353  N  N     . MET A 1 362 ? -8.518  143.386 20.844  1.00 59.69  ? 1116 MET A N     1 
ATOM   2354  C  CA    . MET A 1 362 ? -8.466  144.835 20.854  1.00 55.81  ? 1116 MET A CA    1 
ATOM   2355  C  C     . MET A 1 362 ? -8.872  145.484 19.515  1.00 64.87  ? 1116 MET A C     1 
ATOM   2356  O  O     . MET A 1 362 ? -9.152  146.686 19.473  1.00 68.72  ? 1116 MET A O     1 
ATOM   2357  C  CB    . MET A 1 362 ? -7.096  145.315 21.322  1.00 47.02  ? 1116 MET A CB    1 
ATOM   2358  C  CG    . MET A 1 362 ? -6.068  145.377 20.240  1.00 55.66  ? 1116 MET A CG    1 
ATOM   2359  S  SD    . MET A 1 362 ? -4.392  145.686 20.824  1.00 55.08  ? 1116 MET A SD    1 
ATOM   2360  C  CE    . MET A 1 362 ? -3.496  145.262 19.296  1.00 61.94  ? 1116 MET A CE    1 
ATOM   2361  N  N     . ARG A 1 363 ? -8.915  144.703 18.434  1.00 59.41  ? 1117 ARG A N     1 
ATOM   2362  C  CA    . ARG A 1 363 ? -9.421  145.216 17.159  1.00 55.48  ? 1117 ARG A CA    1 
ATOM   2363  C  C     . ARG A 1 363 ? -10.953 145.374 17.164  1.00 60.31  ? 1117 ARG A C     1 
ATOM   2364  O  O     . ARG A 1 363 ? -11.490 146.177 16.405  1.00 59.38  ? 1117 ARG A O     1 
ATOM   2365  C  CB    . ARG A 1 363 ? -9.010  144.299 16.025  1.00 46.07  ? 1117 ARG A CB    1 
ATOM   2366  C  CG    . ARG A 1 363 ? -9.513  142.925 16.243  1.00 54.17  ? 1117 ARG A CG    1 
ATOM   2367  C  CD    . ARG A 1 363 ? -9.688  142.168 14.965  1.00 60.15  ? 1117 ARG A CD    1 
ATOM   2368  N  NE    . ARG A 1 363 ? -8.711  141.099 14.911  1.00 76.06  ? 1117 ARG A NE    1 
ATOM   2369  C  CZ    . ARG A 1 363 ? -8.940  139.906 14.387  1.00 101.00 ? 1117 ARG A CZ    1 
ATOM   2370  N  NH1   . ARG A 1 363 ? -10.124 139.623 13.859  1.00 101.87 ? 1117 ARG A NH1   1 
ATOM   2371  N  NH2   . ARG A 1 363 ? -7.977  138.999 14.388  1.00 118.55 ? 1117 ARG A NH2   1 
ATOM   2372  N  N     . TYR A 1 364 ? -11.651 144.617 18.025  1.00 64.13  ? 1118 TYR A N     1 
ATOM   2373  C  CA    . TYR A 1 364 ? -13.119 144.714 18.158  1.00 57.86  ? 1118 TYR A CA    1 
ATOM   2374  C  C     . TYR A 1 364 ? -13.619 145.786 19.141  1.00 56.51  ? 1118 TYR A C     1 
ATOM   2375  O  O     . TYR A 1 364 ? -14.613 146.449 18.873  1.00 67.70  ? 1118 TYR A O     1 
ATOM   2376  C  CB    . TYR A 1 364 ? -13.749 143.368 18.561  1.00 45.44  ? 1118 TYR A CB    1 
ATOM   2377  C  CG    . TYR A 1 364 ? -13.566 142.237 17.580  1.00 47.13  ? 1118 TYR A CG    1 
ATOM   2378  C  CD1   . TYR A 1 364 ? -14.399 142.091 16.476  1.00 52.23  ? 1118 TYR A CD1   1 
ATOM   2379  C  CD2   . TYR A 1 364 ? -12.557 141.316 17.746  1.00 47.03  ? 1118 TYR A CD2   1 
ATOM   2380  C  CE1   . TYR A 1 364 ? -14.228 141.057 15.577  1.00 50.83  ? 1118 TYR A CE1   1 
ATOM   2381  C  CE2   . TYR A 1 364 ? -12.385 140.290 16.836  1.00 48.82  ? 1118 TYR A CE2   1 
ATOM   2382  C  CZ    . TYR A 1 364 ? -13.226 140.163 15.761  1.00 50.67  ? 1118 TYR A CZ    1 
ATOM   2383  O  OH    . TYR A 1 364 ? -13.036 139.121 14.887  1.00 83.60  ? 1118 TYR A OH    1 
ATOM   2384  N  N     . THR A 1 365 ? -12.959 145.946 20.284  1.00 44.78  ? 1119 THR A N     1 
ATOM   2385  C  CA    . THR A 1 365 ? -13.542 146.741 21.369  1.00 40.89  ? 1119 THR A CA    1 
ATOM   2386  C  C     . THR A 1 365 ? -13.273 148.250 21.278  1.00 51.83  ? 1119 THR A C     1 
ATOM   2387  O  O     . THR A 1 365 ? -12.386 148.706 20.552  1.00 54.02  ? 1119 THR A O     1 
ATOM   2388  C  CB    . THR A 1 365 ? -13.044 146.233 22.734  1.00 42.73  ? 1119 THR A CB    1 
ATOM   2389  O  OG1   . THR A 1 365 ? -11.624 146.356 22.802  1.00 47.64  ? 1119 THR A OG1   1 
ATOM   2390  C  CG2   . THR A 1 365 ? -13.391 144.762 22.927  1.00 42.60  ? 1119 THR A CG2   1 
ATOM   2391  N  N     . GLU A 1 366 ? -14.053 149.033 22.010  1.00 51.64  ? 1120 GLU A N     1 
ATOM   2392  C  CA    . GLU A 1 366 ? -13.662 150.419 22.295  1.00 52.06  ? 1120 GLU A CA    1 
ATOM   2393  C  C     . GLU A 1 366 ? -13.757 150.752 23.801  1.00 50.45  ? 1120 GLU A C     1 
ATOM   2394  O  O     . GLU A 1 366 ? -14.382 150.019 24.572  1.00 51.93  ? 1120 GLU A O     1 
ATOM   2395  C  CB    . GLU A 1 366 ? -14.435 151.414 21.435  1.00 60.58  ? 1120 GLU A CB    1 
ATOM   2396  C  CG    . GLU A 1 366 ? -15.919 151.163 21.347  1.00 81.30  ? 1120 GLU A CG    1 
ATOM   2397  C  CD    . GLU A 1 366 ? -16.584 151.968 20.232  1.00 101.22 ? 1120 GLU A CD    1 
ATOM   2398  O  OE1   . GLU A 1 366 ? -17.836 152.056 20.243  1.00 112.61 ? 1120 GLU A OE1   1 
ATOM   2399  O  OE2   . GLU A 1 366 ? -15.861 152.499 19.343  1.00 100.65 ? 1120 GLU A OE2   1 
ATOM   2400  N  N     . ALA A 1 367 ? -13.125 151.842 24.220  1.00 40.80  ? 1121 ALA A N     1 
ATOM   2401  C  CA    . ALA A 1 367 ? -12.982 152.124 25.646  1.00 39.66  ? 1121 ALA A CA    1 
ATOM   2402  C  C     . ALA A 1 367 ? -12.810 153.597 25.953  1.00 43.87  ? 1121 ALA A C     1 
ATOM   2403  O  O     . ALA A 1 367 ? -12.566 154.408 25.070  1.00 39.91  ? 1121 ALA A O     1 
ATOM   2404  C  CB    . ALA A 1 367 ? -11.816 151.334 26.236  1.00 35.06  ? 1121 ALA A CB    1 
ATOM   2405  N  N     . ARG A 1 368 ? -12.962 153.929 27.230  1.00 44.77  ? 1122 ARG A N     1 
ATOM   2406  C  CA    . ARG A 1 368 ? -12.625 155.241 27.756  1.00 44.06  ? 1122 ARG A CA    1 
ATOM   2407  C  C     . ARG A 1 368 ? -12.452 155.073 29.240  1.00 53.30  ? 1122 ARG A C     1 
ATOM   2408  O  O     . ARG A 1 368 ? -12.872 154.062 29.818  1.00 57.46  ? 1122 ARG A O     1 
ATOM   2409  C  CB    . ARG A 1 368 ? -13.741 156.236 27.505  1.00 41.20  ? 1122 ARG A CB    1 
ATOM   2410  C  CG    . ARG A 1 368 ? -15.130 155.720 27.840  1.00 40.87  ? 1122 ARG A CG    1 
ATOM   2411  C  CD    . ARG A 1 368 ? -16.164 156.828 27.620  1.00 48.16  ? 1122 ARG A CD    1 
ATOM   2412  N  NE    . ARG A 1 368 ? -17.509 156.462 28.073  1.00 55.86  ? 1122 ARG A NE    1 
ATOM   2413  C  CZ    . ARG A 1 368 ? -18.625 156.999 27.589  1.00 58.71  ? 1122 ARG A CZ    1 
ATOM   2414  N  NH1   . ARG A 1 368 ? -18.549 157.916 26.629  1.00 57.91  ? 1122 ARG A NH1   1 
ATOM   2415  N  NH2   . ARG A 1 368 ? -19.815 156.609 28.043  1.00 63.41  ? 1122 ARG A NH2   1 
ATOM   2416  N  N     . LEU A 1 369 ? -11.818 156.062 29.856  1.00 48.42  ? 1123 LEU A N     1 
ATOM   2417  C  CA    . LEU A 1 369 ? -11.766 156.148 31.301  1.00 41.35  ? 1123 LEU A CA    1 
ATOM   2418  C  C     . LEU A 1 369 ? -13.164 156.313 31.897  1.00 44.00  ? 1123 LEU A C     1 
ATOM   2419  O  O     . LEU A 1 369 ? -14.053 156.959 31.319  1.00 40.86  ? 1123 LEU A O     1 
ATOM   2420  C  CB    . LEU A 1 369 ? -10.900 157.328 31.713  1.00 46.01  ? 1123 LEU A CB    1 
ATOM   2421  C  CG    . LEU A 1 369 ? -9.434  157.177 31.298  1.00 46.46  ? 1123 LEU A CG    1 
ATOM   2422  C  CD1   . LEU A 1 369 ? -8.577  158.244 31.930  1.00 49.99  ? 1123 LEU A CD1   1 
ATOM   2423  C  CD2   . LEU A 1 369 ? -8.865  155.800 31.603  1.00 35.19  ? 1123 LEU A CD2   1 
ATOM   2424  N  N     . SER A 1 370 ? -13.350 155.719 33.070  1.00 41.63  ? 1124 SER A N     1 
ATOM   2425  C  CA    . SER A 1 370 ? -14.582 155.900 33.820  1.00 41.93  ? 1124 SER A CA    1 
ATOM   2426  C  C     . SER A 1 370 ? -14.568 157.263 34.503  1.00 46.43  ? 1124 SER A C     1 
ATOM   2427  O  O     . SER A 1 370 ? -13.506 157.863 34.669  1.00 34.15  ? 1124 SER A O     1 
ATOM   2428  C  CB    . SER A 1 370 ? -14.702 154.810 34.862  1.00 41.96  ? 1124 SER A CB    1 
ATOM   2429  O  OG    . SER A 1 370 ? -13.688 154.975 35.831  1.00 50.98  ? 1124 SER A OG    1 
ATOM   2430  N  N     . GLU A 1 371 ? -15.736 157.756 34.911  1.00 45.36  ? 1125 GLU A N     1 
ATOM   2431  C  CA    . GLU A 1 371 ? -15.741 159.020 35.657  1.00 48.94  ? 1125 GLU A CA    1 
ATOM   2432  C  C     . GLU A 1 371 ? -14.846 158.960 36.905  1.00 50.76  ? 1125 GLU A C     1 
ATOM   2433  O  O     . GLU A 1 371 ? -14.065 159.880 37.148  1.00 42.27  ? 1125 GLU A O     1 
ATOM   2434  C  CB    . GLU A 1 371 ? -17.144 159.481 36.031  1.00 38.56  ? 1125 GLU A CB    1 
ATOM   2435  C  CG    . GLU A 1 371 ? -17.163 160.869 36.579  1.00 44.54  ? 1125 GLU A CG    1 
ATOM   2436  C  CD    . GLU A 1 371 ? -18.578 161.425 36.687  1.00 67.48  ? 1125 GLU A CD    1 
ATOM   2437  O  OE1   . GLU A 1 371 ? -19.543 160.631 36.533  1.00 68.79  ? 1125 GLU A OE1   1 
ATOM   2438  O  OE2   . GLU A 1 371 ? -18.721 162.654 36.910  1.00 76.38  ? 1125 GLU A OE2   1 
ATOM   2439  N  N     . ILE A 1 372 ? -14.934 157.877 37.680  1.00 47.30  ? 1126 ILE A N     1 
ATOM   2440  C  CA    . ILE A 1 372 ? -14.147 157.831 38.889  1.00 40.91  ? 1126 ILE A CA    1 
ATOM   2441  C  C     . ILE A 1 372 ? -12.652 157.856 38.588  1.00 46.85  ? 1126 ILE A C     1 
ATOM   2442  O  O     . ILE A 1 372 ? -11.883 158.505 39.313  1.00 50.73  ? 1126 ILE A O     1 
ATOM   2443  C  CB    . ILE A 1 372 ? -14.508 156.644 39.773  1.00 45.38  ? 1126 ILE A CB    1 
ATOM   2444  C  CG1   . ILE A 1 372 ? -14.418 157.057 41.250  1.00 48.79  ? 1126 ILE A CG1   1 
ATOM   2445  C  CG2   . ILE A 1 372 ? -13.628 155.465 39.448  1.00 46.33  ? 1126 ILE A CG2   1 
ATOM   2446  C  CD1   . ILE A 1 372 ? -14.703 155.958 42.227  1.00 47.09  ? 1126 ILE A CD1   1 
ATOM   2447  N  N     . ALA A 1 373 ? -12.240 157.164 37.522  1.00 45.91  ? 1127 ALA A N     1 
ATOM   2448  C  CA    . ALA A 1 373 ? -10.847 157.233 37.042  1.00 45.59  ? 1127 ALA A CA    1 
ATOM   2449  C  C     . ALA A 1 373 ? -10.381 158.682 36.923  1.00 47.35  ? 1127 ALA A C     1 
ATOM   2450  O  O     . ALA A 1 373 ? -9.215  158.998 37.141  1.00 52.64  ? 1127 ALA A O     1 
ATOM   2451  C  CB    . ALA A 1 373 ? -10.678 156.511 35.689  1.00 34.88  ? 1127 ALA A CB    1 
ATOM   2452  N  N     . GLY A 1 374 ? -11.299 159.568 36.572  1.00 35.59  ? 1128 GLY A N     1 
ATOM   2453  C  CA    . GLY A 1 374 ? -10.964 160.968 36.508  1.00 42.26  ? 1128 GLY A CA    1 
ATOM   2454  C  C     . GLY A 1 374 ? -10.376 161.456 37.812  1.00 47.93  ? 1128 GLY A C     1 
ATOM   2455  O  O     . GLY A 1 374 ? -9.477  162.293 37.843  1.00 50.44  ? 1128 GLY A O     1 
ATOM   2456  N  N     . TYR A 1 375 ? -10.883 160.921 38.909  1.00 46.52  ? 1129 TYR A N     1 
ATOM   2457  C  CA    . TYR A 1 375 ? -10.450 161.405 40.185  1.00 44.41  ? 1129 TYR A CA    1 
ATOM   2458  C  C     . TYR A 1 375 ? -9.022  160.948 40.527  1.00 53.08  ? 1129 TYR A C     1 
ATOM   2459  O  O     . TYR A 1 375 ? -8.260  161.719 41.097  1.00 60.62  ? 1129 TYR A O     1 
ATOM   2460  C  CB    . TYR A 1 375 ? -11.502 161.093 41.238  1.00 39.52  ? 1129 TYR A CB    1 
ATOM   2461  C  CG    . TYR A 1 375 ? -12.648 162.093 41.203  1.00 44.14  ? 1129 TYR A CG    1 
ATOM   2462  C  CD1   . TYR A 1 375 ? -13.638 162.015 40.245  1.00 44.39  ? 1129 TYR A CD1   1 
ATOM   2463  C  CD2   . TYR A 1 375 ? -12.722 163.128 42.118  1.00 42.90  ? 1129 TYR A CD2   1 
ATOM   2464  C  CE1   . TYR A 1 375 ? -14.686 162.922 40.216  1.00 38.48  ? 1129 TYR A CE1   1 
ATOM   2465  C  CE2   . TYR A 1 375 ? -13.755 164.045 42.084  1.00 38.96  ? 1129 TYR A CE2   1 
ATOM   2466  C  CZ    . TYR A 1 375 ? -14.739 163.943 41.132  1.00 45.97  ? 1129 TYR A CZ    1 
ATOM   2467  O  OH    . TYR A 1 375 ? -15.790 164.857 41.098  1.00 50.04  ? 1129 TYR A OH    1 
ATOM   2468  N  N     . LEU A 1 376 ? -8.627  159.738 40.128  1.00 46.19  ? 1130 LEU A N     1 
ATOM   2469  C  CA    . LEU A 1 376 ? -7.209  159.355 40.237  1.00 41.09  ? 1130 LEU A CA    1 
ATOM   2470  C  C     . LEU A 1 376 ? -6.257  160.335 39.534  1.00 46.26  ? 1130 LEU A C     1 
ATOM   2471  O  O     . LEU A 1 376 ? -5.101  160.474 39.944  1.00 55.80  ? 1130 LEU A O     1 
ATOM   2472  C  CB    . LEU A 1 376 ? -6.953  157.947 39.695  1.00 35.07  ? 1130 LEU A CB    1 
ATOM   2473  C  CG    . LEU A 1 376 ? -7.465  156.759 40.504  1.00 38.11  ? 1130 LEU A CG    1 
ATOM   2474  C  CD1   . LEU A 1 376 ? -7.105  155.456 39.837  1.00 36.40  ? 1130 LEU A CD1   1 
ATOM   2475  C  CD2   . LEU A 1 376 ? -6.872  156.786 41.881  1.00 55.13  ? 1130 LEU A CD2   1 
ATOM   2476  N  N     . LEU A 1 377 ? -6.730  161.003 38.482  1.00 36.10  ? 1131 LEU A N     1 
ATOM   2477  C  CA    . LEU A 1 377 ? -5.861  161.872 37.678  1.00 44.52  ? 1131 LEU A CA    1 
ATOM   2478  C  C     . LEU A 1 377 ? -6.027  163.338 38.019  1.00 50.92  ? 1131 LEU A C     1 
ATOM   2479  O  O     . LEU A 1 377 ? -5.365  164.214 37.458  1.00 51.13  ? 1131 LEU A O     1 
ATOM   2480  C  CB    . LEU A 1 377 ? -6.124  161.679 36.174  1.00 46.28  ? 1131 LEU A CB    1 
ATOM   2481  C  CG    . LEU A 1 377 ? -5.817  160.257 35.708  1.00 40.13  ? 1131 LEU A CG    1 
ATOM   2482  C  CD1   . LEU A 1 377 ? -6.650  159.871 34.527  1.00 35.56  ? 1131 LEU A CD1   1 
ATOM   2483  C  CD2   . LEU A 1 377 ? -4.348  160.156 35.402  1.00 38.55  ? 1131 LEU A CD2   1 
ATOM   2484  N  N     . GLN A 1 378 ? -6.924  163.618 38.940  1.00 53.42  ? 1132 GLN A N     1 
ATOM   2485  C  CA    . GLN A 1 378 ? -7.266  164.996 39.201  1.00 45.03  ? 1132 GLN A CA    1 
ATOM   2486  C  C     . GLN A 1 378 ? -6.016  165.822 39.554  1.00 50.13  ? 1132 GLN A C     1 
ATOM   2487  O  O     . GLN A 1 378 ? -5.248  165.470 40.456  1.00 63.39  ? 1132 GLN A O     1 
ATOM   2488  C  CB    . GLN A 1 378 ? -8.302  164.996 40.281  1.00 38.48  ? 1132 GLN A CB    1 
ATOM   2489  C  CG    . GLN A 1 378 ? -8.875  166.310 40.626  1.00 50.58  ? 1132 GLN A CG    1 
ATOM   2490  C  CD    . GLN A 1 378 ? -9.556  166.195 41.967  1.00 64.87  ? 1132 GLN A CD    1 
ATOM   2491  O  OE1   . GLN A 1 378 ? -8.918  165.803 42.965  1.00 77.22  ? 1132 GLN A OE1   1 
ATOM   2492  N  NE2   . GLN A 1 378 ? -10.860 166.477 42.002  1.00 54.70  ? 1132 GLN A NE2   1 
ATOM   2493  N  N     . ASP A 1 379 ? -5.781  166.881 38.790  1.00 47.86  ? 1133 ASP A N     1 
ATOM   2494  C  CA    . ASP A 1 379 ? -4.737  167.838 39.117  1.00 59.74  ? 1133 ASP A CA    1 
ATOM   2495  C  C     . ASP A 1 379 ? -3.346  167.463 38.591  1.00 62.03  ? 1133 ASP A C     1 
ATOM   2496  O  O     . ASP A 1 379 ? -2.372  168.205 38.784  1.00 64.42  ? 1133 ASP A O     1 
ATOM   2497  C  CB    . ASP A 1 379 ? -4.711  168.091 40.629  1.00 77.67  ? 1133 ASP A CB    1 
ATOM   2498  C  CG    . ASP A 1 379 ? -5.895  168.942 41.098  1.00 96.38  ? 1133 ASP A CG    1 
ATOM   2499  O  OD1   . ASP A 1 379 ? -6.379  169.788 40.299  1.00 104.51 ? 1133 ASP A OD1   1 
ATOM   2500  O  OD2   . ASP A 1 379 ? -6.335  168.772 42.263  1.00 96.37  ? 1133 ASP A OD2   1 
ATOM   2501  N  N     . ILE A 1 380 ? -3.255  166.326 37.914  1.00 55.93  ? 1134 ILE A N     1 
ATOM   2502  C  CA    . ILE A 1 380 ? -2.008  165.946 37.236  1.00 46.27  ? 1134 ILE A CA    1 
ATOM   2503  C  C     . ILE A 1 380 ? -1.390  167.091 36.401  1.00 45.50  ? 1134 ILE A C     1 
ATOM   2504  O  O     . ILE A 1 380 ? -0.172  167.161 36.233  1.00 49.24  ? 1134 ILE A O     1 
ATOM   2505  C  CB    . ILE A 1 380 ? -2.227  164.723 36.324  1.00 39.24  ? 1134 ILE A CB    1 
ATOM   2506  C  CG1   . ILE A 1 380 ? -0.898  164.098 35.939  1.00 40.98  ? 1134 ILE A CG1   1 
ATOM   2507  C  CG2   . ILE A 1 380 ? -3.000  165.123 35.114  1.00 41.08  ? 1134 ILE A CG2   1 
ATOM   2508  C  CD1   . ILE A 1 380 ? -0.827  162.628 36.271  1.00 37.64  ? 1134 ILE A CD1   1 
ATOM   2509  N  N     . GLU A 1 381 ? -2.224  167.998 35.895  1.00 48.39  ? 1135 GLU A N     1 
ATOM   2510  C  CA    . GLU A 1 381 ? -1.734  169.096 35.058  1.00 50.24  ? 1135 GLU A CA    1 
ATOM   2511  C  C     . GLU A 1 381 ? -1.070  170.183 35.861  1.00 54.34  ? 1135 GLU A C     1 
ATOM   2512  O  O     . GLU A 1 381 ? -0.693  171.223 35.311  1.00 65.13  ? 1135 GLU A O     1 
ATOM   2513  C  CB    . GLU A 1 381 ? -2.868  169.726 34.245  1.00 57.31  ? 1135 GLU A CB    1 
ATOM   2514  C  CG    . GLU A 1 381 ? -3.952  170.444 35.065  1.00 72.08  ? 1135 GLU A CG    1 
ATOM   2515  C  CD    . GLU A 1 381 ? -4.957  169.471 35.676  1.00 88.60  ? 1135 GLU A CD    1 
ATOM   2516  O  OE1   . GLU A 1 381 ? -4.805  168.242 35.465  1.00 93.88  ? 1135 GLU A OE1   1 
ATOM   2517  O  OE2   . GLU A 1 381 ? -5.898  169.934 36.367  1.00 95.69  ? 1135 GLU A OE2   1 
ATOM   2518  N  N     . LYS A 1 382 ? -0.956  169.958 37.161  1.00 51.73  ? 1136 LYS A N     1 
ATOM   2519  C  CA    . LYS A 1 382 ? -0.615  171.028 38.087  1.00 55.03  ? 1136 LYS A CA    1 
ATOM   2520  C  C     . LYS A 1 382 ? 0.663   170.756 38.857  1.00 60.49  ? 1136 LYS A C     1 
ATOM   2521  O  O     . LYS A 1 382 ? 0.896   171.363 39.896  1.00 63.21  ? 1136 LYS A O     1 
ATOM   2522  C  CB    . LYS A 1 382 ? -1.765  171.278 39.059  1.00 42.96  ? 1136 LYS A CB    1 
ATOM   2523  C  CG    . LYS A 1 382 ? -2.749  172.290 38.554  1.00 46.87  ? 1136 LYS A CG    1 
ATOM   2524  C  CD    . LYS A 1 382 ? -4.102  172.139 39.228  1.00 50.31  ? 1136 LYS A CD    1 
ATOM   2525  C  CE    . LYS A 1 382 ? -4.945  173.403 39.045  1.00 55.25  ? 1136 LYS A CE    1 
ATOM   2526  N  NZ    . LYS A 1 382 ? -6.128  173.360 39.931  1.00 54.84  ? 1136 LYS A NZ    1 
ATOM   2527  N  N     . LYS A 1 383 ? 1.485   169.855 38.327  1.00 60.99  ? 1137 LYS A N     1 
ATOM   2528  C  CA    . LYS A 1 383 ? 2.800   169.576 38.884  1.00 61.53  ? 1137 LYS A CA    1 
ATOM   2529  C  C     . LYS A 1 383 ? 2.637   169.108 40.317  1.00 53.92  ? 1137 LYS A C     1 
ATOM   2530  O  O     . LYS A 1 383 ? 3.386   169.544 41.211  1.00 60.64  ? 1137 LYS A O     1 
ATOM   2531  C  CB    . LYS A 1 383 ? 3.746   170.799 38.764  1.00 44.81  ? 1137 LYS A CB    1 
ATOM   2532  C  CG    . LYS A 1 383 ? 4.064   171.182 37.296  1.00 49.43  ? 1137 LYS A CG    1 
ATOM   2533  C  CD    . LYS A 1 383 ? 5.302   172.045 37.069  1.00 48.43  ? 1137 LYS A CD    1 
ATOM   2534  N  N     . THR A 1 384 ? 1.655   168.220 40.523  1.00 42.17  ? 1138 THR A N     1 
ATOM   2535  C  CA    . THR A 1 384 ? 1.345   167.700 41.859  1.00 50.03  ? 1138 THR A CA    1 
ATOM   2536  C  C     . THR A 1 384 ? 2.045   166.398 42.163  1.00 53.81  ? 1138 THR A C     1 
ATOM   2537  O  O     . THR A 1 384 ? 1.890   165.830 43.248  1.00 63.01  ? 1138 THR A O     1 
ATOM   2538  C  CB    . THR A 1 384 ? -0.157  167.406 42.062  1.00 49.38  ? 1138 THR A CB    1 
ATOM   2539  O  OG1   . THR A 1 384 ? -0.663  166.658 40.945  1.00 48.43  ? 1138 THR A OG1   1 
ATOM   2540  C  CG2   . THR A 1 384 ? -0.959  168.696 42.284  1.00 45.37  ? 1138 THR A CG2   1 
ATOM   2541  N  N     . VAL A 1 385 ? 2.822   165.912 41.215  1.00 57.05  ? 1139 VAL A N     1 
ATOM   2542  C  CA    . VAL A 1 385 ? 3.335   164.565 41.352  1.00 51.62  ? 1139 VAL A CA    1 
ATOM   2543  C  C     . VAL A 1 385 ? 4.598   164.431 40.513  1.00 54.31  ? 1139 VAL A C     1 
ATOM   2544  O  O     . VAL A 1 385 ? 4.730   165.097 39.488  1.00 60.81  ? 1139 VAL A O     1 
ATOM   2545  C  CB    . VAL A 1 385 ? 2.229   163.576 40.946  1.00 51.14  ? 1139 VAL A CB    1 
ATOM   2546  C  CG1   . VAL A 1 385 ? 2.513   163.002 39.605  1.00 52.61  ? 1139 VAL A CG1   1 
ATOM   2547  C  CG2   . VAL A 1 385 ? 2.050   162.507 41.989  1.00 56.90  ? 1139 VAL A CG2   1 
ATOM   2548  N  N     . PRO A 1 386 ? 5.548   163.607 40.970  1.00 56.04  ? 1140 PRO A N     1 
ATOM   2549  C  CA    . PRO A 1 386 ? 6.882   163.426 40.372  1.00 53.44  ? 1140 PRO A CA    1 
ATOM   2550  C  C     . PRO A 1 386 ? 6.811   162.792 38.992  1.00 54.45  ? 1140 PRO A C     1 
ATOM   2551  O  O     . PRO A 1 386 ? 6.173   161.750 38.817  1.00 52.44  ? 1140 PRO A O     1 
ATOM   2552  C  CB    . PRO A 1 386 ? 7.570   162.434 41.334  1.00 44.77  ? 1140 PRO A CB    1 
ATOM   2553  C  CG    . PRO A 1 386 ? 6.737   162.446 42.570  1.00 41.25  ? 1140 PRO A CG    1 
ATOM   2554  C  CD    . PRO A 1 386 ? 5.340   162.722 42.125  1.00 48.43  ? 1140 PRO A CD    1 
ATOM   2555  N  N     . PHE A 1 387 ? 7.473   163.395 38.017  1.00 63.33  ? 1141 PHE A N     1 
ATOM   2556  C  CA    . PHE A 1 387 ? 7.561   162.774 36.689  1.00 61.76  ? 1141 PHE A CA    1 
ATOM   2557  C  C     . PHE A 1 387 ? 8.968   162.282 36.393  1.00 69.18  ? 1141 PHE A C     1 
ATOM   2558  O  O     . PHE A 1 387 ? 9.951   162.810 36.915  1.00 78.70  ? 1141 PHE A O     1 
ATOM   2559  C  CB    . PHE A 1 387 ? 7.147   163.745 35.592  1.00 54.72  ? 1141 PHE A CB    1 
ATOM   2560  C  CG    . PHE A 1 387 ? 5.668   163.850 35.395  1.00 60.08  ? 1141 PHE A CG    1 
ATOM   2561  C  CD1   . PHE A 1 387 ? 4.859   164.350 36.392  1.00 54.99  ? 1141 PHE A CD1   1 
ATOM   2562  C  CD2   . PHE A 1 387 ? 5.089   163.480 34.185  1.00 66.54  ? 1141 PHE A CD2   1 
ATOM   2563  C  CE1   . PHE A 1 387 ? 3.503   164.457 36.203  1.00 58.48  ? 1141 PHE A CE1   1 
ATOM   2564  C  CE2   . PHE A 1 387 ? 3.737   163.588 33.993  1.00 62.14  ? 1141 PHE A CE2   1 
ATOM   2565  C  CZ    . PHE A 1 387 ? 2.939   164.075 35.004  1.00 61.38  ? 1141 PHE A CZ    1 
ATOM   2566  N  N     . ALA A 1 388 ? 9.057   161.267 35.548  1.00 67.13  ? 1142 ALA A N     1 
ATOM   2567  C  CA    . ALA A 1 388 ? 10.340  160.753 35.085  1.00 64.96  ? 1142 ALA A CA    1 
ATOM   2568  C  C     . ALA A 1 388 ? 10.270  160.612 33.575  1.00 66.56  ? 1142 ALA A C     1 
ATOM   2569  O  O     . ALA A 1 388 ? 9.172   160.568 33.007  1.00 69.44  ? 1142 ALA A O     1 
ATOM   2570  C  CB    . ALA A 1 388 ? 10.642  159.422 35.733  1.00 60.63  ? 1142 ALA A CB    1 
ATOM   2571  N  N     . TRP A 1 389 ? 11.427  160.565 32.919  1.00 66.03  ? 1143 TRP A N     1 
ATOM   2572  C  CA    . TRP A 1 389 ? 11.437  160.393 31.472  1.00 66.46  ? 1143 TRP A CA    1 
ATOM   2573  C  C     . TRP A 1 389 ? 10.962  159.006 31.127  1.00 65.29  ? 1143 TRP A C     1 
ATOM   2574  O  O     . TRP A 1 389 ? 11.052  158.092 31.955  1.00 66.13  ? 1143 TRP A O     1 
ATOM   2575  C  CB    . TRP A 1 389 ? 12.822  160.609 30.894  1.00 75.18  ? 1143 TRP A CB    1 
ATOM   2576  C  CG    . TRP A 1 389 ? 13.226  162.036 30.885  1.00 84.26  ? 1143 TRP A CG    1 
ATOM   2577  C  CD1   . TRP A 1 389 ? 14.124  162.638 31.715  1.00 87.86  ? 1143 TRP A CD1   1 
ATOM   2578  C  CD2   . TRP A 1 389 ? 12.740  163.056 30.011  1.00 79.68  ? 1143 TRP A CD2   1 
ATOM   2579  N  NE1   . TRP A 1 389 ? 14.233  163.965 31.404  1.00 87.16  ? 1143 TRP A NE1   1 
ATOM   2580  C  CE2   . TRP A 1 389 ? 13.394  164.249 30.362  1.00 81.96  ? 1143 TRP A CE2   1 
ATOM   2581  C  CE3   . TRP A 1 389 ? 11.814  163.076 28.970  1.00 71.96  ? 1143 TRP A CE3   1 
ATOM   2582  C  CZ2   . TRP A 1 389 ? 13.159  165.450 29.703  1.00 81.45  ? 1143 TRP A CZ2   1 
ATOM   2583  C  CZ3   . TRP A 1 389 ? 11.581  164.270 28.317  1.00 72.75  ? 1143 TRP A CZ3   1 
ATOM   2584  C  CH2   . TRP A 1 389 ? 12.250  165.441 28.685  1.00 76.47  ? 1143 TRP A CH2   1 
ATOM   2585  N  N     . ASN A 1 390 ? 10.422  158.863 29.919  1.00 68.29  ? 1144 ASN A N     1 
ATOM   2586  C  CA    . ASN A 1 390 ? 10.051  157.554 29.401  1.00 72.80  ? 1144 ASN A CA    1 
ATOM   2587  C  C     . ASN A 1 390 ? 11.293  156.940 28.787  1.00 80.74  ? 1144 ASN A C     1 
ATOM   2588  O  O     . ASN A 1 390 ? 12.344  157.570 28.760  1.00 92.73  ? 1144 ASN A O     1 
ATOM   2589  C  CB    . ASN A 1 390 ? 8.919   157.663 28.375  1.00 72.05  ? 1144 ASN A CB    1 
ATOM   2590  C  CG    . ASN A 1 390 ? 9.312   158.477 27.149  1.00 73.33  ? 1144 ASN A CG    1 
ATOM   2591  O  OD1   . ASN A 1 390 ? 10.313  159.180 27.171  1.00 82.18  ? 1144 ASN A OD1   1 
ATOM   2592  N  ND2   . ASN A 1 390 ? 8.515   158.393 26.080  1.00 64.86  ? 1144 ASN A ND2   1 
ATOM   2593  N  N     . PHE A 1 391 ? 11.192  155.711 28.308  1.00 76.00  ? 1145 PHE A N     1 
ATOM   2594  C  CA    . PHE A 1 391 ? 12.344  155.073 27.693  1.00 69.69  ? 1145 PHE A CA    1 
ATOM   2595  C  C     . PHE A 1 391 ? 12.839  155.904 26.493  1.00 78.46  ? 1145 PHE A C     1 
ATOM   2596  O  O     . PHE A 1 391 ? 14.024  156.190 26.364  1.00 77.14  ? 1145 PHE A O     1 
ATOM   2597  C  CB    . PHE A 1 391 ? 11.993  153.634 27.297  1.00 64.47  ? 1145 PHE A CB    1 
ATOM   2598  C  CG    . PHE A 1 391 ? 10.816  153.536 26.370  1.00 63.46  ? 1145 PHE A CG    1 
ATOM   2599  C  CD1   . PHE A 1 391 ? 10.985  153.674 24.996  1.00 70.82  ? 1145 PHE A CD1   1 
ATOM   2600  C  CD2   . PHE A 1 391 ? 9.549   153.336 26.860  1.00 62.23  ? 1145 PHE A CD2   1 
ATOM   2601  C  CE1   . PHE A 1 391 ? 9.912   153.604 24.138  1.00 62.85  ? 1145 PHE A CE1   1 
ATOM   2602  C  CE2   . PHE A 1 391 ? 8.466   153.269 25.995  1.00 64.43  ? 1145 PHE A CE2   1 
ATOM   2603  C  CZ    . PHE A 1 391 ? 8.653   153.405 24.633  1.00 58.36  ? 1145 PHE A CZ    1 
ATOM   2604  N  N     . ASP A 1 392 ? 11.910  156.312 25.635  1.00 96.14  ? 1146 ASP A N     1 
ATOM   2605  C  CA    . ASP A 1 392 ? 12.207  157.083 24.419  1.00 102.51 ? 1146 ASP A CA    1 
ATOM   2606  C  C     . ASP A 1 392 ? 12.908  158.415 24.677  1.00 98.19  ? 1146 ASP A C     1 
ATOM   2607  O  O     . ASP A 1 392 ? 13.404  159.048 23.744  1.00 92.88  ? 1146 ASP A O     1 
ATOM   2608  C  CB    . ASP A 1 392 ? 10.895  157.396 23.701  1.00 109.95 ? 1146 ASP A CB    1 
ATOM   2609  C  CG    . ASP A 1 392 ? 10.844  156.835 22.307  1.00 116.55 ? 1146 ASP A CG    1 
ATOM   2610  O  OD1   . ASP A 1 392 ? 11.793  156.121 21.920  1.00 120.86 ? 1146 ASP A OD1   1 
ATOM   2611  O  OD2   . ASP A 1 392 ? 9.841   157.100 21.607  1.00 117.65 ? 1146 ASP A OD2   1 
ATOM   2612  N  N     . ASP A 1 393 ? 12.916  158.843 25.939  1.00 97.82  ? 1147 ASP A N     1 
ATOM   2613  C  CA    . ASP A 1 393 ? 13.300  160.208 26.326  1.00 92.19  ? 1147 ASP A CA    1 
ATOM   2614  C  C     . ASP A 1 393 ? 12.602  161.334 25.544  1.00 86.74  ? 1147 ASP A C     1 
ATOM   2615  O  O     . ASP A 1 393 ? 13.136  162.439 25.399  1.00 85.57  ? 1147 ASP A O     1 
ATOM   2616  C  CB    . ASP A 1 393 ? 14.815  160.376 26.344  1.00 96.21  ? 1147 ASP A CB    1 
ATOM   2617  C  CG    . ASP A 1 393 ? 15.434  159.737 27.560  1.00 104.91 ? 1147 ASP A CG    1 
ATOM   2618  O  OD1   . ASP A 1 393 ? 15.795  158.541 27.488  1.00 108.45 ? 1147 ASP A OD1   1 
ATOM   2619  O  OD2   . ASP A 1 393 ? 15.522  160.421 28.603  1.00 108.25 ? 1147 ASP A OD2   1 
ATOM   2620  N  N     . THR A 1 394 ? 11.390  161.044 25.079  1.00 82.32  ? 1148 THR A N     1 
ATOM   2621  C  CA    . THR A 1 394 ? 10.581  162.015 24.359  1.00 80.21  ? 1148 THR A CA    1 
ATOM   2622  C  C     . THR A 1 394 ? 9.544   162.644 25.269  1.00 81.30  ? 1148 THR A C     1 
ATOM   2623  O  O     . THR A 1 394 ? 9.209   163.810 25.111  1.00 91.84  ? 1148 THR A O     1 
ATOM   2624  C  CB    . THR A 1 394 ? 9.844   161.368 23.163  1.00 77.66  ? 1148 THR A CB    1 
ATOM   2625  O  OG1   . THR A 1 394 ? 9.727   159.950 23.370  1.00 87.28  ? 1148 THR A OG1   1 
ATOM   2626  C  CG2   . THR A 1 394 ? 10.604  161.617 21.890  1.00 62.79  ? 1148 THR A CG2   1 
ATOM   2627  N  N     . GLU A 1 395 ? 9.030   161.865 26.217  1.00 77.32  ? 1149 GLU A N     1 
ATOM   2628  C  CA    . GLU A 1 395 ? 7.941   162.314 27.082  1.00 67.15  ? 1149 GLU A CA    1 
ATOM   2629  C  C     . GLU A 1 395 ? 8.265   162.024 28.524  1.00 66.10  ? 1149 GLU A C     1 
ATOM   2630  O  O     . GLU A 1 395 ? 8.968   161.061 28.850  1.00 68.69  ? 1149 GLU A O     1 
ATOM   2631  C  CB    . GLU A 1 395 ? 6.655   161.572 26.738  1.00 68.26  ? 1149 GLU A CB    1 
ATOM   2632  C  CG    . GLU A 1 395 ? 5.484   162.427 26.313  1.00 71.78  ? 1149 GLU A CG    1 
ATOM   2633  C  CD    . GLU A 1 395 ? 4.509   161.619 25.479  1.00 86.58  ? 1149 GLU A CD    1 
ATOM   2634  O  OE1   . GLU A 1 395 ? 4.990   160.872 24.599  1.00 89.84  ? 1149 GLU A OE1   1 
ATOM   2635  O  OE2   . GLU A 1 395 ? 3.276   161.701 25.704  1.00 97.66  ? 1149 GLU A OE2   1 
ATOM   2636  N  N     . LYS A 1 396 ? 7.743   162.868 29.397  1.00 61.94  ? 1150 LYS A N     1 
ATOM   2637  C  CA    . LYS A 1 396 ? 7.764   162.573 30.808  1.00 53.01  ? 1150 LYS A CA    1 
ATOM   2638  C  C     . LYS A 1 396 ? 6.483   161.785 31.138  1.00 55.92  ? 1150 LYS A C     1 
ATOM   2639  O  O     . LYS A 1 396 ? 5.455   161.954 30.477  1.00 57.25  ? 1150 LYS A O     1 
ATOM   2640  C  CB    . LYS A 1 396 ? 7.876   163.876 31.587  1.00 48.46  ? 1150 LYS A CB    1 
ATOM   2641  C  CG    . LYS A 1 396 ? 9.183   164.635 31.330  1.00 46.48  ? 1150 LYS A CG    1 
ATOM   2642  N  N     . GLU A 1 397 ? 6.567   160.871 32.103  1.00 54.87  ? 1151 GLU A N     1 
ATOM   2643  C  CA    . GLU A 1 397 ? 5.381   160.181 32.615  1.00 50.38  ? 1151 GLU A CA    1 
ATOM   2644  C  C     . GLU A 1 397 ? 5.355   160.303 34.133  1.00 56.62  ? 1151 GLU A C     1 
ATOM   2645  O  O     . GLU A 1 397 ? 6.391   160.538 34.751  1.00 60.61  ? 1151 GLU A O     1 
ATOM   2646  C  CB    . GLU A 1 397 ? 5.355   158.710 32.192  1.00 52.22  ? 1151 GLU A CB    1 
ATOM   2647  C  CG    . GLU A 1 397 ? 6.581   157.899 32.572  1.00 61.80  ? 1151 GLU A CG    1 
ATOM   2648  C  CD    . GLU A 1 397 ? 6.452   156.411 32.205  1.00 73.99  ? 1151 GLU A CD    1 
ATOM   2649  O  OE1   . GLU A 1 397 ? 7.465   155.787 31.805  1.00 83.75  ? 1151 GLU A OE1   1 
ATOM   2650  O  OE2   . GLU A 1 397 ? 5.336   155.860 32.323  1.00 67.27  ? 1151 GLU A OE2   1 
ATOM   2651  N  N     . PRO A 1 398 ? 4.167   160.167 34.746  1.00 59.57  ? 1152 PRO A N     1 
ATOM   2652  C  CA    . PRO A 1 398 ? 4.132   160.252 36.205  1.00 54.21  ? 1152 PRO A CA    1 
ATOM   2653  C  C     . PRO A 1 398 ? 4.494   158.896 36.828  1.00 55.58  ? 1152 PRO A C     1 
ATOM   2654  O  O     . PRO A 1 398 ? 4.232   157.860 36.223  1.00 64.67  ? 1152 PRO A O     1 
ATOM   2655  C  CB    . PRO A 1 398 ? 2.676   160.614 36.475  1.00 46.67  ? 1152 PRO A CB    1 
ATOM   2656  C  CG    . PRO A 1 398 ? 1.922   159.896 35.394  1.00 42.87  ? 1152 PRO A CG    1 
ATOM   2657  C  CD    . PRO A 1 398 ? 2.816   160.000 34.176  1.00 55.63  ? 1152 PRO A CD    1 
ATOM   2658  N  N     . THR A 1 399 ? 5.102   158.927 38.008  1.00 52.57  ? 1153 THR A N     1 
ATOM   2659  C  CA    . THR A 1 399 ? 5.505   157.736 38.750  1.00 50.03  ? 1153 THR A CA    1 
ATOM   2660  C  C     . THR A 1 399 ? 4.499   157.382 39.845  1.00 47.65  ? 1153 THR A C     1 
ATOM   2661  O  O     . THR A 1 399 ? 4.660   156.368 40.514  1.00 52.72  ? 1153 THR A O     1 
ATOM   2662  C  CB    . THR A 1 399 ? 6.838   157.981 39.476  1.00 51.55  ? 1153 THR A CB    1 
ATOM   2663  O  OG1   . THR A 1 399 ? 6.722   159.157 40.293  1.00 57.91  ? 1153 THR A OG1   1 
ATOM   2664  C  CG2   . THR A 1 399 ? 7.949   158.215 38.492  1.00 54.49  ? 1153 THR A CG2   1 
ATOM   2665  N  N     . VAL A 1 400 ? 3.497   158.237 40.061  1.00 44.38  ? 1154 VAL A N     1 
ATOM   2666  C  CA    . VAL A 1 400 ? 2.407   157.974 41.004  1.00 41.18  ? 1154 VAL A CA    1 
ATOM   2667  C  C     . VAL A 1 400 ? 1.281   158.940 40.623  1.00 42.72  ? 1154 VAL A C     1 
ATOM   2668  O  O     . VAL A 1 400 ? 1.554   160.083 40.281  1.00 43.05  ? 1154 VAL A O     1 
ATOM   2669  C  CB    . VAL A 1 400 ? 2.871   158.220 42.476  1.00 54.99  ? 1154 VAL A CB    1 
ATOM   2670  C  CG1   . VAL A 1 400 ? 3.666   159.510 42.574  1.00 55.21  ? 1154 VAL A CG1   1 
ATOM   2671  C  CG2   . VAL A 1 400 ? 1.699   158.261 43.446  1.00 47.90  ? 1154 VAL A CG2   1 
ATOM   2672  N  N     . LEU A 1 401 ? 0.021   158.526 40.644  1.00 35.66  ? 1155 LEU A N     1 
ATOM   2673  C  CA    . LEU A 1 401 ? -1.012  159.520 40.322  1.00 40.83  ? 1155 LEU A CA    1 
ATOM   2674  C  C     . LEU A 1 401 ? -1.538  160.233 41.569  1.00 47.25  ? 1155 LEU A C     1 
ATOM   2675  O  O     . LEU A 1 401 ? -1.422  159.728 42.673  1.00 52.65  ? 1155 LEU A O     1 
ATOM   2676  C  CB    . LEU A 1 401 ? -2.175  158.908 39.552  1.00 37.66  ? 1155 LEU A CB    1 
ATOM   2677  C  CG    . LEU A 1 401 ? -1.847  158.021 38.374  1.00 38.41  ? 1155 LEU A CG    1 
ATOM   2678  C  CD1   . LEU A 1 401 ? -3.146  157.426 37.847  1.00 47.59  ? 1155 LEU A CD1   1 
ATOM   2679  C  CD2   . LEU A 1 401 ? -1.128  158.807 37.279  1.00 40.00  ? 1155 LEU A CD2   1 
ATOM   2680  N  N     . PRO A 1 402 ? -2.135  161.413 41.383  1.00 53.49  ? 1156 PRO A N     1 
ATOM   2681  C  CA    . PRO A 1 402 ? -2.711  162.233 42.458  1.00 50.08  ? 1156 PRO A CA    1 
ATOM   2682  C  C     . PRO A 1 402 ? -3.631  161.482 43.423  1.00 43.75  ? 1156 PRO A C     1 
ATOM   2683  O  O     . PRO A 1 402 ? -3.588  161.778 44.596  1.00 52.52  ? 1156 PRO A O     1 
ATOM   2684  C  CB    . PRO A 1 402 ? -3.499  163.294 41.693  1.00 52.34  ? 1156 PRO A CB    1 
ATOM   2685  C  CG    . PRO A 1 402 ? -2.723  163.467 40.444  1.00 52.81  ? 1156 PRO A CG    1 
ATOM   2686  C  CD    . PRO A 1 402 ? -2.175  162.105 40.086  1.00 53.35  ? 1156 PRO A CD    1 
ATOM   2687  N  N     . ALA A 1 403 ? -4.474  160.573 42.943  1.00 40.85  ? 1157 ALA A N     1 
ATOM   2688  C  CA    . ALA A 1 403 ? -5.274  159.709 43.836  1.00 41.41  ? 1157 ALA A CA    1 
ATOM   2689  C  C     . ALA A 1 403 ? -6.267  160.401 44.803  1.00 44.96  ? 1157 ALA A C     1 
ATOM   2690  O  O     . ALA A 1 403 ? -6.159  160.272 46.009  1.00 54.31  ? 1157 ALA A O     1 
ATOM   2691  C  CB    . ALA A 1 403 ? -4.342  158.770 44.611  1.00 39.27  ? 1157 ALA A CB    1 
ATOM   2692  N  N     . ALA A 1 404 ? -7.257  161.092 44.270  1.00 41.24  ? 1158 ALA A N     1 
ATOM   2693  C  CA    . ALA A 1 404 ? -8.294  161.722 45.073  1.00 32.26  ? 1158 ALA A CA    1 
ATOM   2694  C  C     . ALA A 1 404 ? -9.188  160.749 45.817  1.00 45.60  ? 1158 ALA A C     1 
ATOM   2695  O  O     . ALA A 1 404 ? -9.983  161.168 46.637  1.00 59.24  ? 1158 ALA A O     1 
ATOM   2696  C  CB    . ALA A 1 404 ? -9.146  162.581 44.212  1.00 36.07  ? 1158 ALA A CB    1 
ATOM   2697  N  N     . PHE A 1 405 ? -9.115  159.465 45.514  1.00 52.52  ? 1159 PHE A N     1 
ATOM   2698  C  CA    . PHE A 1 405 ? -9.683  158.477 46.429  1.00 55.77  ? 1159 PHE A CA    1 
ATOM   2699  C  C     . PHE A 1 405 ? -8.638  157.379 46.685  1.00 60.58  ? 1159 PHE A C     1 
ATOM   2700  O  O     . PHE A 1 405 ? -7.746  157.185 45.860  1.00 66.75  ? 1159 PHE A O     1 
ATOM   2701  C  CB    . PHE A 1 405 ? -11.006 157.921 45.895  1.00 55.78  ? 1159 PHE A CB    1 
ATOM   2702  C  CG    . PHE A 1 405 ? -10.853 156.971 44.749  1.00 57.78  ? 1159 PHE A CG    1 
ATOM   2703  C  CD1   . PHE A 1 405 ? -10.761 155.600 44.972  1.00 62.17  ? 1159 PHE A CD1   1 
ATOM   2704  C  CD2   . PHE A 1 405 ? -10.816 157.437 43.449  1.00 54.18  ? 1159 PHE A CD2   1 
ATOM   2705  C  CE1   . PHE A 1 405 ? -10.613 154.694 43.906  1.00 60.82  ? 1159 PHE A CE1   1 
ATOM   2706  C  CE2   . PHE A 1 405 ? -10.687 156.542 42.370  1.00 59.29  ? 1159 PHE A CE2   1 
ATOM   2707  C  CZ    . PHE A 1 405 ? -10.581 155.161 42.610  1.00 61.80  ? 1159 PHE A CZ    1 
ATOM   2708  N  N     . PRO A 1 406 ? -8.724  156.676 47.831  1.00 55.86  ? 1160 PRO A N     1 
ATOM   2709  C  CA    . PRO A 1 406 ? -7.679  155.677 48.159  1.00 60.15  ? 1160 PRO A CA    1 
ATOM   2710  C  C     . PRO A 1 406 ? -7.855  154.322 47.433  1.00 57.35  ? 1160 PRO A C     1 
ATOM   2711  O  O     . PRO A 1 406 ? -8.376  153.334 47.978  1.00 48.14  ? 1160 PRO A O     1 
ATOM   2712  C  CB    . PRO A 1 406 ? -7.740  155.562 49.700  1.00 46.48  ? 1160 PRO A CB    1 
ATOM   2713  C  CG    . PRO A 1 406 ? -9.155  155.936 50.037  1.00 55.75  ? 1160 PRO A CG    1 
ATOM   2714  C  CD    . PRO A 1 406 ? -9.730  156.805 48.896  1.00 52.93  ? 1160 PRO A CD    1 
ATOM   2715  N  N     . ASN A 1 407 ? -7.393  154.309 46.181  1.00 58.78  ? 1161 ASN A N     1 
ATOM   2716  C  CA    . ASN A 1 407 ? -7.636  153.216 45.235  1.00 53.81  ? 1161 ASN A CA    1 
ATOM   2717  C  C     . ASN A 1 407 ? -7.151  151.844 45.730  1.00 52.22  ? 1161 ASN A C     1 
ATOM   2718  O  O     . ASN A 1 407 ? -7.856  150.848 45.563  1.00 55.49  ? 1161 ASN A O     1 
ATOM   2719  C  CB    . ASN A 1 407 ? -7.053  153.573 43.857  1.00 44.51  ? 1161 ASN A CB    1 
ATOM   2720  C  CG    . ASN A 1 407 ? -7.273  152.493 42.822  1.00 50.17  ? 1161 ASN A CG    1 
ATOM   2721  O  OD1   . ASN A 1 407 ? -8.396  152.255 42.386  1.00 48.58  ? 1161 ASN A OD1   1 
ATOM   2722  N  ND2   . ASN A 1 407 ? -6.194  151.841 42.410  1.00 64.57  ? 1161 ASN A ND2   1 
ATOM   2723  N  N     . LEU A 1 408 ? -5.985  151.809 46.380  1.00 49.15  ? 1162 LEU A N     1 
ATOM   2724  C  CA    . LEU A 1 408 ? -5.368  150.550 46.807  1.00 45.97  ? 1162 LEU A CA    1 
ATOM   2725  C  C     . LEU A 1 408 ? -6.331  149.656 47.568  1.00 45.67  ? 1162 LEU A C     1 
ATOM   2726  O  O     . LEU A 1 408 ? -6.415  148.460 47.305  1.00 39.95  ? 1162 LEU A O     1 
ATOM   2727  C  CB    . LEU A 1 408 ? -4.167  150.817 47.701  1.00 49.12  ? 1162 LEU A CB    1 
ATOM   2728  C  CG    . LEU A 1 408 ? -3.008  149.811 47.667  1.00 48.42  ? 1162 LEU A CG    1 
ATOM   2729  C  CD1   . LEU A 1 408 ? -2.724  149.220 49.028  1.00 38.50  ? 1162 LEU A CD1   1 
ATOM   2730  C  CD2   . LEU A 1 408 ? -3.218  148.722 46.614  1.00 54.65  ? 1162 LEU A CD2   1 
ATOM   2731  N  N     . LEU A 1 409 ? -7.052  150.233 48.526  1.00 43.67  ? 1163 LEU A N     1 
ATOM   2732  C  CA    . LEU A 1 409 ? -7.986  149.428 49.280  1.00 39.55  ? 1163 LEU A CA    1 
ATOM   2733  C  C     . LEU A 1 409 ? -9.287  149.234 48.536  1.00 45.28  ? 1163 LEU A C     1 
ATOM   2734  O  O     . LEU A 1 409 ? -9.810  148.130 48.497  1.00 58.05  ? 1163 LEU A O     1 
ATOM   2735  C  CB    . LEU A 1 409 ? -8.256  150.048 50.643  1.00 47.93  ? 1163 LEU A CB    1 
ATOM   2736  C  CG    . LEU A 1 409 ? -7.172  149.840 51.689  1.00 43.38  ? 1163 LEU A CG    1 
ATOM   2737  C  CD1   . LEU A 1 409 ? -7.593  150.589 52.897  1.00 44.03  ? 1163 LEU A CD1   1 
ATOM   2738  C  CD2   . LEU A 1 409 ? -7.036  148.362 51.986  1.00 34.14  ? 1163 LEU A CD2   1 
ATOM   2739  N  N     . VAL A 1 410 ? -9.834  150.308 47.967  1.00 46.87  ? 1164 VAL A N     1 
ATOM   2740  C  CA    . VAL A 1 410 ? -11.099 150.186 47.240  1.00 43.51  ? 1164 VAL A CA    1 
ATOM   2741  C  C     . VAL A 1 410 ? -11.045 149.072 46.176  1.00 48.14  ? 1164 VAL A C     1 
ATOM   2742  O  O     . VAL A 1 410 ? -11.910 148.188 46.153  1.00 46.76  ? 1164 VAL A O     1 
ATOM   2743  C  CB    . VAL A 1 410 ? -11.480 151.479 46.530  1.00 36.26  ? 1164 VAL A CB    1 
ATOM   2744  C  CG1   . VAL A 1 410 ? -12.678 151.219 45.616  1.00 41.73  ? 1164 VAL A CG1   1 
ATOM   2745  C  CG2   . VAL A 1 410 ? -11.800 152.557 47.523  1.00 39.30  ? 1164 VAL A CG2   1 
ATOM   2746  N  N     . ASN A 1 411 ? -10.037 149.105 45.299  1.00 41.13  ? 1165 ASN A N     1 
ATOM   2747  C  CA    . ASN A 1 411 ? -9.977  148.115 44.215  1.00 49.83  ? 1165 ASN A CA    1 
ATOM   2748  C  C     . ASN A 1 411 ? -9.146  146.883 44.502  1.00 57.14  ? 1165 ASN A C     1 
ATOM   2749  O  O     . ASN A 1 411 ? -9.403  145.797 43.952  1.00 57.41  ? 1165 ASN A O     1 
ATOM   2750  C  CB    . ASN A 1 411 ? -9.569  148.750 42.885  1.00 43.91  ? 1165 ASN A CB    1 
ATOM   2751  C  CG    . ASN A 1 411 ? -10.744 149.395 42.193  1.00 44.25  ? 1165 ASN A CG    1 
ATOM   2752  O  OD1   . ASN A 1 411 ? -11.865 148.871 42.252  1.00 45.90  ? 1165 ASN A OD1   1 
ATOM   2753  N  ND2   . ASN A 1 411 ? -10.515 150.550 41.571  1.00 39.16  ? 1165 ASN A ND2   1 
ATOM   2754  N  N     . GLY A 1 412 ? -8.163  147.051 45.378  1.00 50.47  ? 1166 GLY A N     1 
ATOM   2755  C  CA    . GLY A 1 412 ? -7.319  145.944 45.777  1.00 46.70  ? 1166 GLY A CA    1 
ATOM   2756  C  C     . GLY A 1 412 ? -6.235  145.649 44.768  1.00 45.68  ? 1166 GLY A C     1 
ATOM   2757  O  O     . GLY A 1 412 ? -5.950  146.470 43.897  1.00 56.04  ? 1166 GLY A O     1 
ATOM   2758  N  N     . SER A 1 413 ? -5.630  144.472 44.882  1.00 42.33  ? 1167 SER A N     1 
ATOM   2759  C  CA    . SER A 1 413 ? -4.534  144.110 44.007  1.00 45.59  ? 1167 SER A CA    1 
ATOM   2760  C  C     . SER A 1 413 ? -4.123  142.667 44.205  1.00 52.07  ? 1167 SER A C     1 
ATOM   2761  O  O     . SER A 1 413 ? -4.143  142.180 45.331  1.00 68.49  ? 1167 SER A O     1 
ATOM   2762  C  CB    . SER A 1 413 ? -3.342  145.022 44.297  1.00 53.50  ? 1167 SER A CB    1 
ATOM   2763  O  OG    . SER A 1 413 ? -2.520  145.149 43.152  1.00 65.91  ? 1167 SER A OG    1 
ATOM   2764  N  N     . THR A 1 414 ? -3.756  141.999 43.110  1.00 47.29  ? 1168 THR A N     1 
ATOM   2765  C  CA    . THR A 1 414 ? -3.030  140.710 43.111  1.00 42.91  ? 1168 THR A CA    1 
ATOM   2766  C  C     . THR A 1 414 ? -2.119  140.728 41.865  1.00 53.28  ? 1168 THR A C     1 
ATOM   2767  O  O     . THR A 1 414 ? -2.527  141.349 40.886  1.00 71.84  ? 1168 THR A O     1 
ATOM   2768  C  CB    . THR A 1 414 ? -4.029  139.534 42.999  1.00 49.17  ? 1168 THR A CB    1 
ATOM   2769  O  OG1   . THR A 1 414 ? -3.368  138.393 42.441  1.00 73.29  ? 1168 THR A OG1   1 
ATOM   2770  C  CG2   . THR A 1 414 ? -5.199  139.881 42.072  1.00 48.26  ? 1168 THR A CG2   1 
ATOM   2771  N  N     . GLY A 1 415 ? -0.892  140.185 41.846  1.00 39.03  ? 1169 GLY A N     1 
ATOM   2772  C  CA    . GLY A 1 415 ? -0.038  139.868 42.969  1.00 54.58  ? 1169 GLY A CA    1 
ATOM   2773  C  C     . GLY A 1 415 ? 0.938   138.685 42.882  1.00 63.29  ? 1169 GLY A C     1 
ATOM   2774  O  O     . GLY A 1 415 ? 0.837   137.816 43.746  1.00 79.60  ? 1169 GLY A O     1 
ATOM   2775  N  N     . ILE A 1 416 ? 1.866   138.614 41.909  1.00 49.65  ? 1170 ILE A N     1 
ATOM   2776  C  CA    . ILE A 1 416 ? 2.985   137.612 42.006  1.00 45.16  ? 1170 ILE A CA    1 
ATOM   2777  C  C     . ILE A 1 416 ? 4.368   138.018 41.478  1.00 58.88  ? 1170 ILE A C     1 
ATOM   2778  O  O     . ILE A 1 416 ? 4.654   137.877 40.294  1.00 66.01  ? 1170 ILE A O     1 
ATOM   2779  C  CB    . ILE A 1 416 ? 2.736   136.330 41.241  1.00 47.22  ? 1170 ILE A CB    1 
ATOM   2780  C  CG1   . ILE A 1 416 ? 1.494   135.608 41.703  1.00 46.95  ? 1170 ILE A CG1   1 
ATOM   2781  C  CG2   . ILE A 1 416 ? 3.944   135.423 41.347  1.00 49.67  ? 1170 ILE A CG2   1 
ATOM   2782  C  CD1   . ILE A 1 416 ? 1.046   134.620 40.634  1.00 48.84  ? 1170 ILE A CD1   1 
ATOM   2783  N  N     . SER A 1 417 ? 5.267   138.434 42.353  1.00 54.87  ? 1171 SER A N     1 
ATOM   2784  C  CA    . SER A 1 417 ? 6.582   138.876 41.902  1.00 53.49  ? 1171 SER A CA    1 
ATOM   2785  C  C     . SER A 1 417 ? 7.717   137.832 42.135  1.00 64.99  ? 1171 SER A C     1 
ATOM   2786  O  O     . SER A 1 417 ? 7.546   136.635 41.851  1.00 64.35  ? 1171 SER A O     1 
ATOM   2787  C  CB    . SER A 1 417 ? 6.871   140.229 42.535  1.00 53.16  ? 1171 SER A CB    1 
ATOM   2788  O  OG    . SER A 1 417 ? 8.246   140.395 42.718  1.00 65.39  ? 1171 SER A OG    1 
ATOM   2789  N  N     . ALA A 1 418 ? 8.882   138.270 42.602  1.00 67.51  ? 1172 ALA A N     1 
ATOM   2790  C  CA    . ALA A 1 418 ? 9.955   137.326 42.965  1.00 75.02  ? 1172 ALA A CA    1 
ATOM   2791  C  C     . ALA A 1 418 ? 10.305  137.521 44.432  1.00 77.73  ? 1172 ALA A C     1 
ATOM   2792  O  O     . ALA A 1 418 ? 10.588  138.642 44.853  1.00 74.82  ? 1172 ALA A O     1 
ATOM   2793  C  CB    . ALA A 1 418 ? 11.196  137.526 42.090  1.00 76.01  ? 1172 ALA A CB    1 
ATOM   2794  N  N     . GLY A 1 419 ? 10.278  136.442 45.210  1.00 77.83  ? 1173 GLY A N     1 
ATOM   2795  C  CA    . GLY A 1 419 ? 10.439  136.548 46.654  1.00 73.37  ? 1173 GLY A CA    1 
ATOM   2796  C  C     . GLY A 1 419 ? 9.237   137.188 47.343  1.00 70.24  ? 1173 GLY A C     1 
ATOM   2797  O  O     . GLY A 1 419 ? 9.115   137.139 48.561  1.00 71.42  ? 1173 GLY A O     1 
ATOM   2798  N  N     . TYR A 1 420 ? 8.348   137.789 46.556  1.00 66.72  ? 1174 TYR A N     1 
ATOM   2799  C  CA    . TYR A 1 420 ? 7.138   138.421 47.084  1.00 71.40  ? 1174 TYR A CA    1 
ATOM   2800  C  C     . TYR A 1 420 ? 5.907   138.203 46.182  1.00 67.71  ? 1174 TYR A C     1 
ATOM   2801  O  O     . TYR A 1 420 ? 6.036   137.944 44.983  1.00 69.80  ? 1174 TYR A O     1 
ATOM   2802  C  CB    . TYR A 1 420 ? 7.339   139.926 47.246  1.00 72.77  ? 1174 TYR A CB    1 
ATOM   2803  C  CG    . TYR A 1 420 ? 8.472   140.367 48.148  1.00 73.38  ? 1174 TYR A CG    1 
ATOM   2804  C  CD1   . TYR A 1 420 ? 9.766   140.487 47.666  1.00 77.43  ? 1174 TYR A CD1   1 
ATOM   2805  C  CD2   . TYR A 1 420 ? 8.234   140.733 49.459  1.00 72.29  ? 1174 TYR A CD2   1 
ATOM   2806  C  CE1   . TYR A 1 420 ? 10.797  140.926 48.471  1.00 77.78  ? 1174 TYR A CE1   1 
ATOM   2807  C  CE2   . TYR A 1 420 ? 9.262   141.174 50.276  1.00 76.24  ? 1174 TYR A CE2   1 
ATOM   2808  C  CZ    . TYR A 1 420 ? 10.541  141.268 49.775  1.00 80.69  ? 1174 TYR A CZ    1 
ATOM   2809  O  OH    . TYR A 1 420 ? 11.566  141.702 50.586  1.00 92.45  ? 1174 TYR A OH    1 
ATOM   2810  N  N     . ALA A 1 421 ? 4.718   138.320 46.771  1.00 59.69  ? 1175 ALA A N     1 
ATOM   2811  C  CA    . ALA A 1 421 ? 3.453   138.228 46.045  1.00 51.50  ? 1175 ALA A CA    1 
ATOM   2812  C  C     . ALA A 1 421 ? 2.473   139.094 46.824  1.00 54.57  ? 1175 ALA A C     1 
ATOM   2813  O  O     . ALA A 1 421 ? 2.810   139.597 47.893  1.00 62.60  ? 1175 ALA A O     1 
ATOM   2814  C  CB    . ALA A 1 421 ? 2.967   136.800 45.943  1.00 44.70  ? 1175 ALA A CB    1 
ATOM   2815  N  N     . THR A 1 422 ? 1.281   139.316 46.290  1.00 54.34  ? 1176 THR A N     1 
ATOM   2816  C  CA    . THR A 1 422 ? 0.340   140.182 46.982  1.00 58.24  ? 1176 THR A CA    1 
ATOM   2817  C  C     . THR A 1 422 ? -1.089  139.799 46.712  1.00 57.23  ? 1176 THR A C     1 
ATOM   2818  O  O     . THR A 1 422 ? -1.446  139.445 45.590  1.00 62.18  ? 1176 THR A O     1 
ATOM   2819  C  CB    . THR A 1 422 ? 0.488   141.668 46.601  1.00 59.53  ? 1176 THR A CB    1 
ATOM   2820  O  OG1   . THR A 1 422 ? -0.304  142.458 47.497  1.00 75.54  ? 1176 THR A OG1   1 
ATOM   2821  C  CG2   . THR A 1 422 ? -0.028  141.914 45.215  1.00 53.21  ? 1176 THR A CG2   1 
ATOM   2822  N  N     . ASP A 1 423 ? -1.889  139.854 47.767  1.00 47.17  ? 1177 ASP A N     1 
ATOM   2823  C  CA    . ASP A 1 423 ? -3.329  139.823 47.650  1.00 41.74  ? 1177 ASP A CA    1 
ATOM   2824  C  C     . ASP A 1 423 ? -3.899  140.830 48.585  1.00 49.07  ? 1177 ASP A C     1 
ATOM   2825  O  O     . ASP A 1 423 ? -3.604  140.801 49.774  1.00 60.71  ? 1177 ASP A O     1 
ATOM   2826  C  CB    . ASP A 1 423 ? -3.873  138.455 47.970  1.00 48.30  ? 1177 ASP A CB    1 
ATOM   2827  C  CG    . ASP A 1 423 ? -3.851  137.556 46.772  1.00 74.71  ? 1177 ASP A CG    1 
ATOM   2828  O  OD1   . ASP A 1 423 ? -4.578  137.870 45.787  1.00 82.90  ? 1177 ASP A OD1   1 
ATOM   2829  O  OD2   . ASP A 1 423 ? -3.105  136.554 46.807  1.00 83.15  ? 1177 ASP A OD2   1 
ATOM   2830  N  N     . ILE A 1 424 ? -4.679  141.750 48.037  1.00 48.50  ? 1178 ILE A N     1 
ATOM   2831  C  CA    . ILE A 1 424 ? -5.355  142.780 48.821  1.00 47.76  ? 1178 ILE A CA    1 
ATOM   2832  C  C     . ILE A 1 424 ? -6.733  142.880 48.229  1.00 51.42  ? 1178 ILE A C     1 
ATOM   2833  O  O     . ILE A 1 424 ? -6.879  143.197 47.050  1.00 48.35  ? 1178 ILE A O     1 
ATOM   2834  C  CB    . ILE A 1 424 ? -4.750  144.141 48.584  1.00 43.26  ? 1178 ILE A CB    1 
ATOM   2835  C  CG1   . ILE A 1 424 ? -3.374  144.259 49.206  1.00 47.38  ? 1178 ILE A CG1   1 
ATOM   2836  C  CG2   . ILE A 1 424 ? -5.642  145.188 49.133  1.00 43.84  ? 1178 ILE A CG2   1 
ATOM   2837  C  CD1   . ILE A 1 424 ? -2.684  145.531 48.771  1.00 48.95  ? 1178 ILE A CD1   1 
ATOM   2838  N  N     . PRO A 1 425 ? -7.753  142.597 49.034  1.00 50.47  ? 1179 PRO A N     1 
ATOM   2839  C  CA    . PRO A 1 425 ? -9.119  142.541 48.496  1.00 49.20  ? 1179 PRO A CA    1 
ATOM   2840  C  C     . PRO A 1 425 ? -9.715  143.943 48.407  1.00 39.72  ? 1179 PRO A C     1 
ATOM   2841  O  O     . PRO A 1 425 ? -9.223  144.848 49.050  1.00 41.04  ? 1179 PRO A O     1 
ATOM   2842  C  CB    . PRO A 1 425 ? -9.854  141.700 49.530  1.00 44.20  ? 1179 PRO A CB    1 
ATOM   2843  C  CG    . PRO A 1 425 ? -9.135  142.041 50.833  1.00 46.06  ? 1179 PRO A CG    1 
ATOM   2844  C  CD    . PRO A 1 425 ? -7.690  142.325 50.478  1.00 41.88  ? 1179 PRO A CD    1 
ATOM   2845  N  N     . PRO A 1 426 ? -10.759 144.112 47.607  1.00 36.92  ? 1180 PRO A N     1 
ATOM   2846  C  CA    . PRO A 1 426 ? -11.407 145.411 47.428  1.00 30.82  ? 1180 PRO A CA    1 
ATOM   2847  C  C     . PRO A 1 426 ? -12.189 145.795 48.669  1.00 49.25  ? 1180 PRO A C     1 
ATOM   2848  O  O     . PRO A 1 426 ? -12.693 144.948 49.414  1.00 42.28  ? 1180 PRO A O     1 
ATOM   2849  C  CB    . PRO A 1 426 ? -12.423 145.165 46.318  1.00 31.12  ? 1180 PRO A CB    1 
ATOM   2850  C  CG    . PRO A 1 426 ? -12.187 143.755 45.812  1.00 41.70  ? 1180 PRO A CG    1 
ATOM   2851  C  CD    . PRO A 1 426 ? -11.338 143.034 46.779  1.00 38.73  ? 1180 PRO A CD    1 
ATOM   2852  N  N     . HIS A 1 427 ? -12.345 147.092 48.862  1.00 47.18  ? 1181 HIS A N     1 
ATOM   2853  C  CA    . HIS A 1 427 ? -13.185 147.571 49.913  1.00 44.50  ? 1181 HIS A CA    1 
ATOM   2854  C  C     . HIS A 1 427 ? -14.204 148.551 49.391  1.00 50.09  ? 1181 HIS A C     1 
ATOM   2855  O  O     . HIS A 1 427 ? -14.032 149.128 48.315  1.00 56.37  ? 1181 HIS A O     1 
ATOM   2856  C  CB    . HIS A 1 427 ? -12.298 148.246 50.941  1.00 52.46  ? 1181 HIS A CB    1 
ATOM   2857  C  CG    . HIS A 1 427 ? -11.357 147.299 51.605  1.00 55.52  ? 1181 HIS A CG    1 
ATOM   2858  N  ND1   . HIS A 1 427 ? -10.307 146.709 50.937  1.00 53.83  ? 1181 HIS A ND1   1 
ATOM   2859  C  CD2   . HIS A 1 427 ? -11.342 146.793 52.863  1.00 52.94  ? 1181 HIS A CD2   1 
ATOM   2860  C  CE1   . HIS A 1 427 ? -9.667  145.901 51.764  1.00 55.65  ? 1181 HIS A CE1   1 
ATOM   2861  N  NE2   . HIS A 1 427 ? -10.272 145.940 52.940  1.00 55.02  ? 1181 HIS A NE2   1 
ATOM   2862  N  N     . ASN A 1 428 ? -15.242 148.763 50.189  1.00 49.39  ? 1182 ASN A N     1 
ATOM   2863  C  CA    . ASN A 1 428 ? -16.245 149.795 49.958  1.00 46.38  ? 1182 ASN A CA    1 
ATOM   2864  C  C     . ASN A 1 428 ? -15.721 151.260 50.084  1.00 56.38  ? 1182 ASN A C     1 
ATOM   2865  O  O     . ASN A 1 428 ? -15.165 151.634 51.118  1.00 50.94  ? 1182 ASN A O     1 
ATOM   2866  C  CB    . ASN A 1 428 ? -17.360 149.547 50.954  1.00 44.23  ? 1182 ASN A CB    1 
ATOM   2867  C  CG    . ASN A 1 428 ? -18.525 150.440 50.749  1.00 57.18  ? 1182 ASN A CG    1 
ATOM   2868  O  OD1   . ASN A 1 428 ? -18.576 151.551 51.288  1.00 63.42  ? 1182 ASN A OD1   1 
ATOM   2869  N  ND2   . ASN A 1 428 ? -19.492 149.969 49.969  1.00 58.74  ? 1182 ASN A ND2   1 
ATOM   2870  N  N     . LEU A 1 429 ? -15.909 152.085 49.043  1.00 55.35  ? 1183 LEU A N     1 
ATOM   2871  C  CA    . LEU A 1 429 ? -15.345 153.452 48.990  1.00 42.15  ? 1183 LEU A CA    1 
ATOM   2872  C  C     . LEU A 1 429 ? -15.825 154.342 50.148  1.00 50.58  ? 1183 LEU A C     1 
ATOM   2873  O  O     . LEU A 1 429 ? -15.013 155.026 50.792  1.00 51.81  ? 1183 LEU A O     1 
ATOM   2874  C  CB    . LEU A 1 429 ? -15.613 154.091 47.624  1.00 39.74  ? 1183 LEU A CB    1 
ATOM   2875  C  CG    . LEU A 1 429 ? -15.305 155.485 47.047  1.00 43.82  ? 1183 LEU A CG    1 
ATOM   2876  C  CD1   . LEU A 1 429 ? -15.874 156.584 47.866  1.00 57.70  ? 1183 LEU A CD1   1 
ATOM   2877  C  CD2   . LEU A 1 429 ? -13.827 155.755 46.762  1.00 48.21  ? 1183 LEU A CD2   1 
ATOM   2878  N  N     . ALA A 1 430 ? -17.120 154.334 50.450  1.00 51.76  ? 1184 ALA A N     1 
ATOM   2879  C  CA    . ALA A 1 430 ? -17.568 155.139 51.598  1.00 50.78  ? 1184 ALA A CA    1 
ATOM   2880  C  C     . ALA A 1 430 ? -16.825 154.729 52.864  1.00 52.63  ? 1184 ALA A C     1 
ATOM   2881  O  O     . ALA A 1 430 ? -16.418 155.579 53.651  1.00 54.31  ? 1184 ALA A O     1 
ATOM   2882  C  CB    . ALA A 1 430 ? -19.070 155.022 51.822  1.00 52.13  ? 1184 ALA A CB    1 
ATOM   2883  N  N     . GLU A 1 431 ? -16.654 153.421 53.058  1.00 50.20  ? 1185 GLU A N     1 
ATOM   2884  C  CA    . GLU A 1 431 ? -16.063 152.932 54.294  1.00 43.62  ? 1185 GLU A CA    1 
ATOM   2885  C  C     . GLU A 1 431 ? -14.609 153.313 54.388  1.00 50.57  ? 1185 GLU A C     1 
ATOM   2886  O  O     . GLU A 1 431 ? -14.176 153.784 55.439  1.00 59.01  ? 1185 GLU A O     1 
ATOM   2887  C  CB    . GLU A 1 431 ? -16.233 151.425 54.459  1.00 36.93  ? 1185 GLU A CB    1 
ATOM   2888  C  CG    . GLU A 1 431 ? -17.656 151.030 54.736  1.00 47.95  ? 1185 GLU A CG    1 
ATOM   2889  C  CD    . GLU A 1 431 ? -17.895 149.550 54.583  1.00 68.06  ? 1185 GLU A CD    1 
ATOM   2890  O  OE1   . GLU A 1 431 ? -16.945 148.834 54.164  1.00 80.38  ? 1185 GLU A OE1   1 
ATOM   2891  O  OE2   . GLU A 1 431 ? -19.042 149.112 54.861  1.00 69.72  ? 1185 GLU A OE2   1 
ATOM   2892  N  N     . VAL A 1 432 ? -13.860 153.132 53.300  1.00 47.20  ? 1186 VAL A N     1 
ATOM   2893  C  CA    . VAL A 1 432 ? -12.449 153.478 53.320  1.00 49.19  ? 1186 VAL A CA    1 
ATOM   2894  C  C     . VAL A 1 432 ? -12.304 154.958 53.650  1.00 52.89  ? 1186 VAL A C     1 
ATOM   2895  O  O     . VAL A 1 432 ? -11.546 155.335 54.553  1.00 52.86  ? 1186 VAL A O     1 
ATOM   2896  C  CB    . VAL A 1 432 ? -11.750 153.163 51.996  1.00 43.87  ? 1186 VAL A CB    1 
ATOM   2897  C  CG1   . VAL A 1 432 ? -10.326 153.751 51.980  1.00 40.22  ? 1186 VAL A CG1   1 
ATOM   2898  C  CG2   . VAL A 1 432 ? -11.712 151.661 51.767  1.00 45.84  ? 1186 VAL A CG2   1 
ATOM   2899  N  N     . ILE A 1 433 ? -13.052 155.799 52.941  1.00 51.98  ? 1187 ILE A N     1 
ATOM   2900  C  CA    . ILE A 1 433 ? -12.997 157.241 53.197  1.00 58.61  ? 1187 ILE A CA    1 
ATOM   2901  C  C     . ILE A 1 433 ? -13.346 157.616 54.660  1.00 47.30  ? 1187 ILE A C     1 
ATOM   2902  O  O     . ILE A 1 433 ? -12.658 158.436 55.291  1.00 42.26  ? 1187 ILE A O     1 
ATOM   2903  C  CB    . ILE A 1 433 ? -13.801 158.035 52.146  1.00 51.81  ? 1187 ILE A CB    1 
ATOM   2904  C  CG1   . ILE A 1 433 ? -13.079 157.949 50.809  1.00 44.33  ? 1187 ILE A CG1   1 
ATOM   2905  C  CG2   . ILE A 1 433 ? -13.937 159.500 52.514  1.00 37.19  ? 1187 ILE A CG2   1 
ATOM   2906  C  CD1   . ILE A 1 433 ? -13.739 158.794 49.730  1.00 51.28  ? 1187 ILE A CD1   1 
ATOM   2907  N  N     . ASP A 1 434 ? -14.374 156.988 55.216  1.00 53.03  ? 1188 ASP A N     1 
ATOM   2908  C  CA    . ASP A 1 434 ? -14.682 157.200 56.631  1.00 56.04  ? 1188 ASP A CA    1 
ATOM   2909  C  C     . ASP A 1 434 ? -13.473 156.899 57.522  1.00 47.37  ? 1188 ASP A C     1 
ATOM   2910  O  O     . ASP A 1 434 ? -13.107 157.716 58.362  1.00 50.87  ? 1188 ASP A O     1 
ATOM   2911  C  CB    . ASP A 1 434 ? -15.920 156.416 57.056  1.00 63.78  ? 1188 ASP A CB    1 
ATOM   2912  C  CG    . ASP A 1 434 ? -17.177 156.892 56.339  1.00 79.85  ? 1188 ASP A CG    1 
ATOM   2913  O  OD1   . ASP A 1 434 ? -17.138 158.014 55.780  1.00 85.33  ? 1188 ASP A OD1   1 
ATOM   2914  O  OD2   . ASP A 1 434 ? -18.193 156.154 56.327  1.00 85.38  ? 1188 ASP A OD2   1 
ATOM   2915  N  N     . ALA A 1 435 ? -12.818 155.768 57.293  1.00 39.11  ? 1189 ALA A N     1 
ATOM   2916  C  CA    . ALA A 1 435 ? -11.588 155.453 58.019  1.00 48.33  ? 1189 ALA A CA    1 
ATOM   2917  C  C     . ALA A 1 435 ? -10.538 156.538 57.866  1.00 53.34  ? 1189 ALA A C     1 
ATOM   2918  O  O     . ALA A 1 435 ? -9.995  157.008 58.867  1.00 64.78  ? 1189 ALA A O     1 
ATOM   2919  C  CB    . ALA A 1 435 ? -11.011 154.055 57.637  1.00 35.55  ? 1189 ALA A CB    1 
ATOM   2920  N  N     . ALA A 1 436 ? -10.270 156.951 56.626  1.00 47.93  ? 1190 ALA A N     1 
ATOM   2921  C  CA    . ALA A 1 436 ? -9.229  157.945 56.371  1.00 45.91  ? 1190 ALA A CA    1 
ATOM   2922  C  C     . ALA A 1 436 ? -9.538  159.278 57.055  1.00 52.01  ? 1190 ALA A C     1 
ATOM   2923  O  O     . ALA A 1 436 ? -8.653  159.960 57.613  1.00 53.58  ? 1190 ALA A O     1 
ATOM   2924  C  CB    . ALA A 1 436 ? -9.065  158.148 54.912  1.00 34.25  ? 1190 ALA A CB    1 
ATOM   2925  N  N     . VAL A 1 437 ? -10.800 159.663 57.014  1.00 49.38  ? 1191 VAL A N     1 
ATOM   2926  C  CA    . VAL A 1 437 ? -11.150 160.922 57.635  1.00 51.01  ? 1191 VAL A CA    1 
ATOM   2927  C  C     . VAL A 1 437 ? -10.929 160.851 59.164  1.00 55.41  ? 1191 VAL A C     1 
ATOM   2928  O  O     . VAL A 1 437 ? -10.413 161.800 59.768  1.00 56.16  ? 1191 VAL A O     1 
ATOM   2929  C  CB    . VAL A 1 437 ? -12.564 161.379 57.213  1.00 41.55  ? 1191 VAL A CB    1 
ATOM   2930  C  CG1   . VAL A 1 437 ? -12.983 162.582 57.968  1.00 41.92  ? 1191 VAL A CG1   1 
ATOM   2931  C  CG2   . VAL A 1 437 ? -12.539 161.718 55.749  1.00 38.54  ? 1191 VAL A CG2   1 
ATOM   2932  N  N     . TYR A 1 438 ? -11.275 159.722 59.785  1.00 52.80  ? 1192 TYR A N     1 
ATOM   2933  C  CA    . TYR A 1 438 ? -11.081 159.600 61.226  1.00 56.33  ? 1192 TYR A CA    1 
ATOM   2934  C  C     . TYR A 1 438 ? -9.603  159.703 61.527  1.00 63.40  ? 1192 TYR A C     1 
ATOM   2935  O  O     . TYR A 1 438 ? -9.192  160.415 62.444  1.00 66.68  ? 1192 TYR A O     1 
ATOM   2936  C  CB    . TYR A 1 438 ? -11.614 158.279 61.776  1.00 48.94  ? 1192 TYR A CB    1 
ATOM   2937  C  CG    . TYR A 1 438 ? -11.535 158.205 63.284  1.00 47.57  ? 1192 TYR A CG    1 
ATOM   2938  C  CD1   . TYR A 1 438 ? -12.478 158.849 64.078  1.00 53.03  ? 1192 TYR A CD1   1 
ATOM   2939  C  CD2   . TYR A 1 438 ? -10.525 157.483 63.918  1.00 53.16  ? 1192 TYR A CD2   1 
ATOM   2940  C  CE1   . TYR A 1 438 ? -12.421 158.793 65.457  1.00 59.60  ? 1192 TYR A CE1   1 
ATOM   2941  C  CE2   . TYR A 1 438 ? -10.471 157.387 65.298  1.00 60.79  ? 1192 TYR A CE2   1 
ATOM   2942  C  CZ    . TYR A 1 438 ? -11.420 158.057 66.066  1.00 68.02  ? 1192 TYR A CZ    1 
ATOM   2943  O  OH    . TYR A 1 438 ? -11.356 158.005 67.438  1.00 79.02  ? 1192 TYR A OH    1 
ATOM   2944  N  N     . MET A 1 439 ? -8.806  158.989 60.738  1.00 56.98  ? 1193 MET A N     1 
ATOM   2945  C  CA    . MET A 1 439 ? -7.356  158.993 60.898  1.00 49.70  ? 1193 MET A CA    1 
ATOM   2946  C  C     . MET A 1 439 ? -6.715  160.363 60.675  1.00 50.94  ? 1193 MET A C     1 
ATOM   2947  O  O     . MET A 1 439 ? -5.739  160.710 61.325  1.00 54.87  ? 1193 MET A O     1 
ATOM   2948  C  CB    . MET A 1 439 ? -6.738  157.973 59.950  1.00 46.74  ? 1193 MET A CB    1 
ATOM   2949  C  CG    . MET A 1 439 ? -5.247  157.748 60.127  1.00 49.01  ? 1193 MET A CG    1 
ATOM   2950  S  SD    . MET A 1 439 ? -4.833  156.007 59.922  1.00 77.56  ? 1193 MET A SD    1 
ATOM   2951  C  CE    . MET A 1 439 ? -3.099  156.219 59.500  1.00 77.48  ? 1193 MET A CE    1 
ATOM   2952  N  N     . ILE A 1 440 ? -7.231  161.138 59.735  1.00 47.58  ? 1194 ILE A N     1 
ATOM   2953  C  CA    . ILE A 1 440 ? -6.646  162.445 59.529  1.00 47.94  ? 1194 ILE A CA    1 
ATOM   2954  C  C     . ILE A 1 440 ? -6.726  163.204 60.840  1.00 48.89  ? 1194 ILE A C     1 
ATOM   2955  O  O     . ILE A 1 440 ? -5.764  163.864 61.233  1.00 54.83  ? 1194 ILE A O     1 
ATOM   2956  C  CB    . ILE A 1 440 ? -7.346  163.208 58.402  1.00 55.04  ? 1194 ILE A CB    1 
ATOM   2957  C  CG1   . ILE A 1 440 ? -6.842  162.687 57.052  1.00 44.69  ? 1194 ILE A CG1   1 
ATOM   2958  C  CG2   . ILE A 1 440 ? -7.142  164.726 58.535  1.00 43.75  ? 1194 ILE A CG2   1 
ATOM   2959  C  CD1   . ILE A 1 440 ? -7.868  162.813 55.947  1.00 50.88  ? 1194 ILE A CD1   1 
ATOM   2960  N  N     . ASP A 1 441 ? -7.868  163.069 61.516  1.00 50.65  ? 1195 ASP A N     1 
ATOM   2961  C  CA    . ASP A 1 441 ? -8.193  163.801 62.742  1.00 57.52  ? 1195 ASP A CA    1 
ATOM   2962  C  C     . ASP A 1 441 ? -7.649  163.109 64.001  1.00 55.99  ? 1195 ASP A C     1 
ATOM   2963  O  O     . ASP A 1 441 ? -7.669  163.668 65.087  1.00 64.58  ? 1195 ASP A O     1 
ATOM   2964  C  CB    . ASP A 1 441 ? -9.724  163.933 62.877  1.00 67.26  ? 1195 ASP A CB    1 
ATOM   2965  C  CG    . ASP A 1 441 ? -10.295 165.175 62.167  1.00 80.38  ? 1195 ASP A CG    1 
ATOM   2966  O  OD1   . ASP A 1 441 ? -9.589  166.206 62.069  1.00 88.01  ? 1195 ASP A OD1   1 
ATOM   2967  O  OD2   . ASP A 1 441 ? -11.470 165.126 61.728  1.00 82.42  ? 1195 ASP A OD2   1 
ATOM   2968  N  N     . HIS A 1 442 ? -7.181  161.880 63.854  1.00 57.17  ? 1196 HIS A N     1 
ATOM   2969  C  CA    . HIS A 1 442 ? -6.699  161.095 64.977  1.00 53.06  ? 1196 HIS A CA    1 
ATOM   2970  C  C     . HIS A 1 442 ? -5.589  160.188 64.508  1.00 53.68  ? 1196 HIS A C     1 
ATOM   2971  O  O     . HIS A 1 442 ? -5.798  158.977 64.400  1.00 47.94  ? 1196 HIS A O     1 
ATOM   2972  C  CB    . HIS A 1 442 ? -7.806  160.176 65.490  1.00 54.98  ? 1196 HIS A CB    1 
ATOM   2973  C  CG    . HIS A 1 442 ? -8.999  160.893 66.027  1.00 56.15  ? 1196 HIS A CG    1 
ATOM   2974  N  ND1   . HIS A 1 442 ? -10.098 161.191 65.252  1.00 64.62  ? 1196 HIS A ND1   1 
ATOM   2975  C  CD2   . HIS A 1 442 ? -9.271  161.363 67.264  1.00 61.85  ? 1196 HIS A CD2   1 
ATOM   2976  C  CE1   . HIS A 1 442 ? -11.002 161.811 65.989  1.00 69.66  ? 1196 HIS A CE1   1 
ATOM   2977  N  NE2   . HIS A 1 442 ? -10.518 161.937 67.211  1.00 72.42  ? 1196 HIS A NE2   1 
ATOM   2978  N  N     . PRO A 1 443 ? -4.412  160.759 64.218  1.00 56.57  ? 1197 PRO A N     1 
ATOM   2979  C  CA    . PRO A 1 443 ? -3.288  160.063 63.576  1.00 53.27  ? 1197 PRO A CA    1 
ATOM   2980  C  C     . PRO A 1 443 ? -2.897  158.749 64.258  1.00 61.01  ? 1197 PRO A C     1 
ATOM   2981  O  O     . PRO A 1 443 ? -2.510  157.807 63.575  1.00 72.81  ? 1197 PRO A O     1 
ATOM   2982  C  CB    . PRO A 1 443 ? -2.151  161.078 63.667  1.00 49.15  ? 1197 PRO A CB    1 
ATOM   2983  C  CG    . PRO A 1 443 ? -2.817  162.360 63.720  1.00 59.90  ? 1197 PRO A CG    1 
ATOM   2984  C  CD    . PRO A 1 443 ? -4.125  162.180 64.439  1.00 50.98  ? 1197 PRO A CD    1 
ATOM   2985  N  N     . THR A 1 444 ? -3.023  158.668 65.575  1.00 62.14  ? 1198 THR A N     1 
ATOM   2986  C  CA    . THR A 1 444 ? -2.566  157.481 66.289  1.00 61.68  ? 1198 THR A CA    1 
ATOM   2987  C  C     . THR A 1 444 ? -3.680  156.468 66.595  1.00 63.81  ? 1198 THR A C     1 
ATOM   2988  O  O     . THR A 1 444 ? -3.642  155.789 67.623  1.00 71.39  ? 1198 THR A O     1 
ATOM   2989  C  CB    . THR A 1 444 ? -1.958  157.879 67.627  1.00 56.72  ? 1198 THR A CB    1 
ATOM   2990  O  OG1   . THR A 1 444 ? -3.024  158.285 68.477  1.00 55.51  ? 1198 THR A OG1   1 
ATOM   2991  C  CG2   . THR A 1 444 ? -1.003  159.053 67.458  1.00 65.67  ? 1198 THR A CG2   1 
ATOM   2992  N  N     . ALA A 1 445 ? -4.655  156.354 65.704  1.00 60.37  ? 1199 ALA A N     1 
ATOM   2993  C  CA    . ALA A 1 445 ? -5.800  155.476 65.920  1.00 67.53  ? 1199 ALA A CA    1 
ATOM   2994  C  C     . ALA A 1 445 ? -5.471  153.975 65.873  1.00 77.19  ? 1199 ALA A C     1 
ATOM   2995  O  O     . ALA A 1 445 ? -4.625  153.528 65.093  1.00 75.00  ? 1199 ALA A O     1 
ATOM   2996  C  CB    . ALA A 1 445 ? -6.887  155.802 64.912  1.00 67.99  ? 1199 ALA A CB    1 
ATOM   2997  N  N     . LYS A 1 446 ? -6.167  153.202 66.705  1.00 83.74  ? 1200 LYS A N     1 
ATOM   2998  C  CA    . LYS A 1 446 ? -5.998  151.745 66.762  1.00 79.25  ? 1200 LYS A CA    1 
ATOM   2999  C  C     . LYS A 1 446 ? -6.898  150.985 65.757  1.00 65.97  ? 1200 LYS A C     1 
ATOM   3000  O  O     . LYS A 1 446 ? -8.012  151.424 65.455  1.00 56.56  ? 1200 LYS A O     1 
ATOM   3001  C  CB    . LYS A 1 446 ? -6.269  151.250 68.197  1.00 79.15  ? 1200 LYS A CB    1 
ATOM   3002  N  N     . ILE A 1 447 ? -6.435  149.835 65.265  1.00 59.62  ? 1201 ILE A N     1 
ATOM   3003  C  CA    . ILE A 1 447 ? -7.270  149.015 64.380  1.00 60.30  ? 1201 ILE A CA    1 
ATOM   3004  C  C     . ILE A 1 447 ? -8.724  148.880 64.856  1.00 63.24  ? 1201 ILE A C     1 
ATOM   3005  O  O     . ILE A 1 447 ? -9.663  148.925 64.055  1.00 61.77  ? 1201 ILE A O     1 
ATOM   3006  C  CB    . ILE A 1 447 ? -6.691  147.605 64.160  1.00 59.63  ? 1201 ILE A CB    1 
ATOM   3007  C  CG1   . ILE A 1 447 ? -5.523  147.667 63.186  1.00 69.95  ? 1201 ILE A CG1   1 
ATOM   3008  C  CG2   . ILE A 1 447 ? -7.736  146.688 63.589  1.00 55.41  ? 1201 ILE A CG2   1 
ATOM   3009  C  CD1   . ILE A 1 447 ? -4.298  148.334 63.786  1.00 81.87  ? 1201 ILE A CD1   1 
ATOM   3010  N  N     . ASP A 1 448 ? -8.912  148.722 66.158  1.00 64.30  ? 1202 ASP A N     1 
ATOM   3011  C  CA    . ASP A 1 448 ? -10.238 148.421 66.674  1.00 66.26  ? 1202 ASP A CA    1 
ATOM   3012  C  C     . ASP A 1 448 ? -11.224 149.526 66.369  1.00 63.37  ? 1202 ASP A C     1 
ATOM   3013  O  O     . ASP A 1 448 ? -12.341 149.261 65.916  1.00 72.33  ? 1202 ASP A O     1 
ATOM   3014  C  CB    . ASP A 1 448 ? -10.196 148.101 68.162  1.00 77.28  ? 1202 ASP A CB    1 
ATOM   3015  C  CG    . ASP A 1 448 ? -9.920  146.623 68.428  1.00 95.46  ? 1202 ASP A CG    1 
ATOM   3016  O  OD1   . ASP A 1 448 ? -10.157 145.800 67.503  1.00 101.70 ? 1202 ASP A OD1   1 
ATOM   3017  O  OD2   . ASP A 1 448 ? -9.480  146.283 69.556  1.00 101.71 ? 1202 ASP A OD2   1 
ATOM   3018  N  N     . LYS A 1 449 ? -10.797 150.763 66.594  1.00 54.02  ? 1203 LYS A N     1 
ATOM   3019  C  CA    . LYS A 1 449 ? -11.612 151.930 66.291  1.00 51.02  ? 1203 LYS A CA    1 
ATOM   3020  C  C     . LYS A 1 449 ? -11.778 152.042 64.756  1.00 58.42  ? 1203 LYS A C     1 
ATOM   3021  O  O     . LYS A 1 449 ? -12.898 152.200 64.249  1.00 64.61  ? 1203 LYS A O     1 
ATOM   3022  C  CB    . LYS A 1 449 ? -10.943 153.179 66.879  1.00 48.38  ? 1203 LYS A CB    1 
ATOM   3023  C  CG    . LYS A 1 449 ? -11.765 154.441 66.830  1.00 52.93  ? 1203 LYS A CG    1 
ATOM   3024  C  CD    . LYS A 1 449 ? -12.991 154.245 67.653  1.00 60.54  ? 1203 LYS A CD    1 
ATOM   3025  C  CE    . LYS A 1 449 ? -13.913 155.432 67.581  1.00 73.10  ? 1203 LYS A CE    1 
ATOM   3026  N  NZ    . LYS A 1 449 ? -14.975 155.265 68.627  1.00 85.93  ? 1203 LYS A NZ    1 
ATOM   3027  N  N     . LEU A 1 450 ? -10.669 151.943 64.019  1.00 53.39  ? 1204 LEU A N     1 
ATOM   3028  C  CA    . LEU A 1 450 ? -10.723 152.027 62.564  1.00 50.86  ? 1204 LEU A CA    1 
ATOM   3029  C  C     . LEU A 1 450 ? -11.728 151.024 61.994  1.00 56.14  ? 1204 LEU A C     1 
ATOM   3030  O  O     . LEU A 1 450 ? -12.437 151.336 61.048  1.00 63.34  ? 1204 LEU A O     1 
ATOM   3031  C  CB    . LEU A 1 450 ? -9.338  151.831 61.938  1.00 49.71  ? 1204 LEU A CB    1 
ATOM   3032  C  CG    . LEU A 1 450 ? -8.274  152.920 62.164  1.00 50.25  ? 1204 LEU A CG    1 
ATOM   3033  C  CD1   . LEU A 1 450 ? -6.925  152.419 61.713  1.00 52.08  ? 1204 LEU A CD1   1 
ATOM   3034  C  CD2   . LEU A 1 450 ? -8.580  154.219 61.439  1.00 48.75  ? 1204 LEU A CD2   1 
ATOM   3035  N  N     . MET A 1 451 ? -11.816 149.838 62.588  1.00 54.65  ? 1205 MET A N     1 
ATOM   3036  C  CA    . MET A 1 451 ? -12.798 148.853 62.127  1.00 55.94  ? 1205 MET A CA    1 
ATOM   3037  C  C     . MET A 1 451 ? -14.247 149.215 62.457  1.00 61.24  ? 1205 MET A C     1 
ATOM   3038  O  O     . MET A 1 451 ? -15.167 148.494 62.068  1.00 67.87  ? 1205 MET A O     1 
ATOM   3039  C  CB    . MET A 1 451 ? -12.453 147.425 62.594  1.00 48.30  ? 1205 MET A CB    1 
ATOM   3040  C  CG    . MET A 1 451 ? -11.152 146.949 61.996  1.00 43.61  ? 1205 MET A CG    1 
ATOM   3041  S  SD    . MET A 1 451 ? -10.615 145.304 62.422  1.00 66.39  ? 1205 MET A SD    1 
ATOM   3042  C  CE    . MET A 1 451 ? -12.149 144.423 62.200  1.00 46.60  ? 1205 MET A CE    1 
ATOM   3043  N  N     . GLU A 1 452 ? -14.469 150.324 63.155  1.00 57.61  ? 1206 GLU A N     1 
ATOM   3044  C  CA    . GLU A 1 452 ? -15.847 150.809 63.291  1.00 65.84  ? 1206 GLU A CA    1 
ATOM   3045  C  C     . GLU A 1 452 ? -16.303 151.460 61.974  1.00 64.54  ? 1206 GLU A C     1 
ATOM   3046  O  O     . GLU A 1 452 ? -17.493 151.529 61.684  1.00 67.35  ? 1206 GLU A O     1 
ATOM   3047  C  CB    . GLU A 1 452 ? -16.014 151.777 64.466  1.00 69.20  ? 1206 GLU A CB    1 
ATOM   3048  C  CG    . GLU A 1 452 ? -15.720 151.188 65.842  1.00 78.40  ? 1206 GLU A CG    1 
ATOM   3049  C  CD    . GLU A 1 452 ? -15.995 152.182 66.982  1.00 90.75  ? 1206 GLU A CD    1 
ATOM   3050  O  OE1   . GLU A 1 452 ? -16.384 153.339 66.664  1.00 93.77  ? 1206 GLU A OE1   1 
ATOM   3051  O  OE2   . GLU A 1 452 ? -15.837 151.801 68.183  1.00 93.25  ? 1206 GLU A OE2   1 
ATOM   3052  N  N     . PHE A 1 453 ? -15.346 151.909 61.170  1.00 60.72  ? 1207 PHE A N     1 
ATOM   3053  C  CA    . PHE A 1 453 ? -15.656 152.533 59.898  1.00 62.93  ? 1207 PHE A CA    1 
ATOM   3054  C  C     . PHE A 1 453 ? -15.383 151.608 58.719  1.00 64.74  ? 1207 PHE A C     1 
ATOM   3055  O  O     . PHE A 1 453 ? -16.061 151.693 57.693  1.00 69.30  ? 1207 PHE A O     1 
ATOM   3056  C  CB    . PHE A 1 453 ? -14.841 153.806 59.746  1.00 62.69  ? 1207 PHE A CB    1 
ATOM   3057  C  CG    . PHE A 1 453 ? -14.988 154.741 60.892  1.00 61.54  ? 1207 PHE A CG    1 
ATOM   3058  C  CD1   . PHE A 1 453 ? -16.110 155.533 61.006  1.00 53.88  ? 1207 PHE A CD1   1 
ATOM   3059  C  CD2   . PHE A 1 453 ? -14.007 154.827 61.862  1.00 65.10  ? 1207 PHE A CD2   1 
ATOM   3060  C  CE1   . PHE A 1 453 ? -16.238 156.389 62.052  1.00 57.73  ? 1207 PHE A CE1   1 
ATOM   3061  C  CE2   . PHE A 1 453 ? -14.135 155.690 62.926  1.00 57.88  ? 1207 PHE A CE2   1 
ATOM   3062  C  CZ    . PHE A 1 453 ? -15.241 156.467 63.029  1.00 57.15  ? 1207 PHE A CZ    1 
ATOM   3063  N  N     . LEU A 1 454 ? -14.389 150.735 58.888  1.00 59.11  ? 1208 LEU A N     1 
ATOM   3064  C  CA    . LEU A 1 454 ? -13.926 149.805 57.859  1.00 46.73  ? 1208 LEU A CA    1 
ATOM   3065  C  C     . LEU A 1 454 ? -13.978 148.397 58.425  1.00 57.22  ? 1208 LEU A C     1 
ATOM   3066  O  O     . LEU A 1 454 ? -12.979 147.874 58.896  1.00 61.52  ? 1208 LEU A O     1 
ATOM   3067  C  CB    . LEU A 1 454 ? -12.488 150.132 57.496  1.00 47.32  ? 1208 LEU A CB    1 
ATOM   3068  C  CG    . LEU A 1 454 ? -11.966 149.986 56.068  1.00 51.27  ? 1208 LEU A CG    1 
ATOM   3069  C  CD1   . LEU A 1 454 ? -10.505 149.530 56.081  1.00 44.18  ? 1208 LEU A CD1   1 
ATOM   3070  C  CD2   . LEU A 1 454 ? -12.824 149.056 55.274  1.00 60.67  ? 1208 LEU A CD2   1 
ATOM   3071  N  N     . PRO A 1 455 ? -15.160 147.777 58.389  1.00 61.35  ? 1209 PRO A N     1 
ATOM   3072  C  CA    . PRO A 1 455 ? -15.455 146.507 59.056  1.00 49.67  ? 1209 PRO A CA    1 
ATOM   3073  C  C     . PRO A 1 455 ? -14.820 145.305 58.338  1.00 62.94  ? 1209 PRO A C     1 
ATOM   3074  O  O     . PRO A 1 455 ? -14.650 144.236 58.937  1.00 72.62  ? 1209 PRO A O     1 
ATOM   3075  C  CB    . PRO A 1 455 ? -16.977 146.419 58.957  1.00 44.55  ? 1209 PRO A CB    1 
ATOM   3076  C  CG    . PRO A 1 455 ? -17.437 147.746 58.440  1.00 57.15  ? 1209 PRO A CG    1 
ATOM   3077  C  CD    . PRO A 1 455 ? -16.321 148.277 57.643  1.00 61.11  ? 1209 PRO A CD    1 
ATOM   3078  N  N     . GLY A 1 456 ? -14.480 145.479 57.067  1.00 55.68  ? 1210 GLY A N     1 
ATOM   3079  C  CA    . GLY A 1 456 ? -13.802 144.440 56.308  1.00 45.14  ? 1210 GLY A CA    1 
ATOM   3080  C  C     . GLY A 1 456 ? -14.049 144.640 54.820  1.00 50.92  ? 1210 GLY A C     1 
ATOM   3081  O  O     . GLY A 1 456 ? -14.788 145.550 54.411  1.00 56.35  ? 1210 GLY A O     1 
ATOM   3082  N  N     . PRO A 1 457 ? -13.462 143.772 53.995  1.00 47.00  ? 1211 PRO A N     1 
ATOM   3083  C  CA    . PRO A 1 457 ? -13.516 143.850 52.521  1.00 41.49  ? 1211 PRO A CA    1 
ATOM   3084  C  C     . PRO A 1 457 ? -14.956 143.890 51.991  1.00 43.69  ? 1211 PRO A C     1 
ATOM   3085  O  O     . PRO A 1 457 ? -15.871 143.377 52.629  1.00 46.61  ? 1211 PRO A O     1 
ATOM   3086  C  CB    . PRO A 1 457 ? -12.854 142.533 52.070  1.00 43.56  ? 1211 PRO A CB    1 
ATOM   3087  C  CG    . PRO A 1 457 ? -12.164 141.963 53.285  1.00 40.38  ? 1211 PRO A CG    1 
ATOM   3088  C  CD    . PRO A 1 457 ? -12.968 142.472 54.468  1.00 45.52  ? 1211 PRO A CD    1 
ATOM   3089  N  N     . ASP A 1 458 ? -15.149 144.492 50.829  1.00 44.68  ? 1212 ASP A N     1 
ATOM   3090  C  CA    . ASP A 1 458 ? -16.451 144.489 50.153  1.00 52.13  ? 1212 ASP A CA    1 
ATOM   3091  C  C     . ASP A 1 458 ? -16.283 143.982 48.687  1.00 50.99  ? 1212 ASP A C     1 
ATOM   3092  O  O     . ASP A 1 458 ? -16.006 144.751 47.765  1.00 54.55  ? 1212 ASP A O     1 
ATOM   3093  C  CB    . ASP A 1 458 ? -17.026 145.909 50.203  1.00 64.00  ? 1212 ASP A CB    1 
ATOM   3094  C  CG    . ASP A 1 458 ? -18.441 145.992 49.688  1.00 68.57  ? 1212 ASP A CG    1 
ATOM   3095  O  OD1   . ASP A 1 458 ? -19.205 145.013 49.903  1.00 71.00  ? 1212 ASP A OD1   1 
ATOM   3096  O  OD2   . ASP A 1 458 ? -18.770 147.047 49.081  1.00 62.96  ? 1212 ASP A OD2   1 
ATOM   3097  N  N     . PHE A 1 459 ? -16.415 142.681 48.478  1.00 44.91  ? 1213 PHE A N     1 
ATOM   3098  C  CA    . PHE A 1 459 ? -16.203 142.126 47.139  1.00 46.49  ? 1213 PHE A CA    1 
ATOM   3099  C  C     . PHE A 1 459 ? -17.276 142.574 46.125  1.00 49.64  ? 1213 PHE A C     1 
ATOM   3100  O  O     . PHE A 1 459 ? -18.473 142.558 46.420  1.00 46.61  ? 1213 PHE A O     1 
ATOM   3101  C  CB    . PHE A 1 459 ? -16.181 140.606 47.205  1.00 48.72  ? 1213 PHE A CB    1 
ATOM   3102  C  CG    . PHE A 1 459 ? -15.057 140.043 48.010  1.00 43.24  ? 1213 PHE A CG    1 
ATOM   3103  C  CD1   . PHE A 1 459 ? -13.745 140.270 47.649  1.00 41.84  ? 1213 PHE A CD1   1 
ATOM   3104  C  CD2   . PHE A 1 459 ? -15.311 139.233 49.097  1.00 49.90  ? 1213 PHE A CD2   1 
ATOM   3105  C  CE1   . PHE A 1 459 ? -12.697 139.726 48.399  1.00 44.26  ? 1213 PHE A CE1   1 
ATOM   3106  C  CE2   . PHE A 1 459 ? -14.270 138.667 49.835  1.00 50.34  ? 1213 PHE A CE2   1 
ATOM   3107  C  CZ    . PHE A 1 459 ? -12.961 138.916 49.487  1.00 46.21  ? 1213 PHE A CZ    1 
ATOM   3108  N  N     . PRO A 1 460 ? -16.852 142.974 44.919  1.00 55.57  ? 1214 PRO A N     1 
ATOM   3109  C  CA    . PRO A 1 460 ? -17.794 143.377 43.869  1.00 45.97  ? 1214 PRO A CA    1 
ATOM   3110  C  C     . PRO A 1 460 ? -18.790 142.254 43.551  1.00 45.09  ? 1214 PRO A C     1 
ATOM   3111  O  O     . PRO A 1 460 ? -19.894 142.532 43.101  1.00 46.85  ? 1214 PRO A O     1 
ATOM   3112  C  CB    . PRO A 1 460 ? -16.884 143.607 42.670  1.00 52.54  ? 1214 PRO A CB    1 
ATOM   3113  C  CG    . PRO A 1 460 ? -15.702 142.726 42.912  1.00 57.36  ? 1214 PRO A CG    1 
ATOM   3114  C  CD    . PRO A 1 460 ? -15.479 142.860 44.400  1.00 62.89  ? 1214 PRO A CD    1 
ATOM   3115  N  N     . THR A 1 461 ? -18.407 141.007 43.804  1.00 40.14  ? 1215 THR A N     1 
ATOM   3116  C  CA    . THR A 1 461 ? -19.291 139.874 43.588  1.00 48.10  ? 1215 THR A CA    1 
ATOM   3117  C  C     . THR A 1 461 ? -20.190 139.557 44.788  1.00 49.09  ? 1215 THR A C     1 
ATOM   3118  O  O     . THR A 1 461 ? -20.948 138.578 44.766  1.00 49.97  ? 1215 THR A O     1 
ATOM   3119  C  CB    . THR A 1 461 ? -18.483 138.602 43.254  1.00 54.79  ? 1215 THR A CB    1 
ATOM   3120  O  OG1   . THR A 1 461 ? -17.301 138.581 44.059  1.00 63.75  ? 1215 THR A OG1   1 
ATOM   3121  C  CG2   . THR A 1 461 ? -18.093 138.561 41.788  1.00 46.16  ? 1215 THR A CG2   1 
ATOM   3122  N  N     . GLY A 1 462 ? -20.078 140.367 45.837  1.00 43.57  ? 1216 GLY A N     1 
ATOM   3123  C  CA    . GLY A 1 462 ? -20.873 140.202 47.045  1.00 44.21  ? 1216 GLY A CA    1 
ATOM   3124  C  C     . GLY A 1 462 ? -20.523 139.000 47.909  1.00 49.08  ? 1216 GLY A C     1 
ATOM   3125  O  O     . GLY A 1 462 ? -19.360 138.778 48.261  1.00 47.05  ? 1216 GLY A O     1 
ATOM   3126  N  N     . ALA A 1 463 ? -21.546 138.230 48.265  1.00 51.91  ? 1217 ALA A N     1 
ATOM   3127  C  CA    . ALA A 1 463 ? -21.376 137.035 49.082  1.00 54.76  ? 1217 ALA A CA    1 
ATOM   3128  C  C     . ALA A 1 463 ? -21.176 137.320 50.568  1.00 65.64  ? 1217 ALA A C     1 
ATOM   3129  O  O     . ALA A 1 463 ? -21.324 138.446 51.044  1.00 74.50  ? 1217 ALA A O     1 
ATOM   3130  C  CB    . ALA A 1 463 ? -20.242 136.191 48.565  1.00 47.60  ? 1217 ALA A CB    1 
ATOM   3131  N  N     . ILE A 1 464 ? -20.824 136.266 51.287  1.00 59.25  ? 1218 ILE A N     1 
ATOM   3132  C  CA    . ILE A 1 464 ? -20.710 136.299 52.729  1.00 57.89  ? 1218 ILE A CA    1 
ATOM   3133  C  C     . ILE A 1 464 ? -19.262 136.126 53.188  1.00 56.64  ? 1218 ILE A C     1 
ATOM   3134  O  O     . ILE A 1 464 ? -18.614 135.129 52.872  1.00 56.33  ? 1218 ILE A O     1 
ATOM   3135  C  CB    . ILE A 1 464 ? -21.545 135.160 53.305  1.00 59.53  ? 1218 ILE A CB    1 
ATOM   3136  C  CG1   . ILE A 1 464 ? -22.999 135.314 52.868  1.00 52.62  ? 1218 ILE A CG1   1 
ATOM   3137  C  CG2   . ILE A 1 464 ? -21.430 135.108 54.789  1.00 44.88  ? 1218 ILE A CG2   1 
ATOM   3138  C  CD1   . ILE A 1 464 ? -23.829 134.175 53.319  1.00 54.24  ? 1218 ILE A CD1   1 
ATOM   3139  N  N     . ILE A 1 465 ? -18.760 137.096 53.939  1.00 52.15  ? 1219 ILE A N     1 
ATOM   3140  C  CA    . ILE A 1 465 ? -17.412 137.019 54.476  1.00 48.44  ? 1219 ILE A CA    1 
ATOM   3141  C  C     . ILE A 1 465 ? -17.446 136.664 55.952  1.00 56.69  ? 1219 ILE A C     1 
ATOM   3142  O  O     . ILE A 1 465 ? -17.974 137.418 56.757  1.00 73.78  ? 1219 ILE A O     1 
ATOM   3143  C  CB    . ILE A 1 465 ? -16.675 138.352 54.328  1.00 52.99  ? 1219 ILE A CB    1 
ATOM   3144  C  CG1   . ILE A 1 465 ? -16.752 138.854 52.881  1.00 51.29  ? 1219 ILE A CG1   1 
ATOM   3145  C  CG2   . ILE A 1 465 ? -15.236 138.191 54.760  1.00 55.69  ? 1219 ILE A CG2   1 
ATOM   3146  C  CD1   . ILE A 1 465 ? -15.852 140.055 52.601  1.00 45.88  ? 1219 ILE A CD1   1 
ATOM   3147  N  N     . GLN A 1 466 ? -16.876 135.516 56.295  1.00 55.81  ? 1220 GLN A N     1 
ATOM   3148  C  CA    . GLN A 1 466 ? -16.856 135.017 57.661  1.00 54.14  ? 1220 GLN A CA    1 
ATOM   3149  C  C     . GLN A 1 466 ? -15.443 135.091 58.292  1.00 62.30  ? 1220 GLN A C     1 
ATOM   3150  O  O     . GLN A 1 466 ? -14.492 134.487 57.766  1.00 63.71  ? 1220 GLN A O     1 
ATOM   3151  C  CB    . GLN A 1 466 ? -17.325 133.561 57.695  1.00 53.60  ? 1220 GLN A CB    1 
ATOM   3152  C  CG    . GLN A 1 466 ? -18.808 133.287 57.484  1.00 59.25  ? 1220 GLN A CG    1 
ATOM   3153  C  CD    . GLN A 1 466 ? -19.083 131.763 57.338  1.00 89.38  ? 1220 GLN A CD    1 
ATOM   3154  O  OE1   . GLN A 1 466 ? -18.256 130.930 57.734  1.00 88.76  ? 1220 GLN A OE1   1 
ATOM   3155  N  NE2   . GLN A 1 466 ? -20.234 131.406 56.756  1.00 85.69  ? 1220 GLN A NE2   1 
ATOM   3156  N  N     . GLY A 1 467 ? -15.317 135.824 59.413  1.00 61.57  ? 1221 GLY A N     1 
ATOM   3157  C  CA    . GLY A 1 467 ? -14.128 135.775 60.255  1.00 53.48  ? 1221 GLY A CA    1 
ATOM   3158  C  C     . GLY A 1 467 ? -13.561 137.080 60.792  1.00 59.33  ? 1221 GLY A C     1 
ATOM   3159  O  O     . GLY A 1 467 ? -12.473 137.480 60.381  1.00 61.30  ? 1221 GLY A O     1 
ATOM   3160  N  N     . ARG A 1 468 ? -14.251 137.725 61.737  1.00 65.14  ? 1222 ARG A N     1 
ATOM   3161  C  CA    . ARG A 1 468 ? -13.772 139.019 62.264  1.00 65.34  ? 1222 ARG A CA    1 
ATOM   3162  C  C     . ARG A 1 468 ? -12.360 138.975 62.861  1.00 60.00  ? 1222 ARG A C     1 
ATOM   3163  O  O     . ARG A 1 468 ? -11.604 139.932 62.716  1.00 61.86  ? 1222 ARG A O     1 
ATOM   3164  C  CB    . ARG A 1 468 ? -14.769 139.715 63.226  1.00 47.47  ? 1222 ARG A CB    1 
ATOM   3165  N  N     . ASP A 1 469 ? -11.969 137.883 63.499  1.00 57.33  ? 1223 ASP A N     1 
ATOM   3166  C  CA    . ASP A 1 469 ? -10.663 137.916 64.155  1.00 60.84  ? 1223 ASP A CA    1 
ATOM   3167  C  C     . ASP A 1 469 ? -9.556  137.828 63.106  1.00 62.16  ? 1223 ASP A C     1 
ATOM   3168  O  O     . ASP A 1 469 ? -8.527  138.504 63.208  1.00 62.95  ? 1223 ASP A O     1 
ATOM   3169  C  CB    . ASP A 1 469 ? -10.534 136.861 65.266  1.00 58.35  ? 1223 ASP A CB    1 
ATOM   3170  N  N     . GLU A 1 470 ? -9.779  137.031 62.070  1.00 61.49  ? 1224 GLU A N     1 
ATOM   3171  C  CA    . GLU A 1 470 ? -8.810  136.984 60.976  1.00 62.47  ? 1224 GLU A CA    1 
ATOM   3172  C  C     . GLU A 1 470 ? -8.777  138.304 60.176  1.00 58.68  ? 1224 GLU A C     1 
ATOM   3173  O  O     . GLU A 1 470 ? -7.723  138.721 59.673  1.00 51.70  ? 1224 GLU A O     1 
ATOM   3174  C  CB    . GLU A 1 470 ? -9.043  135.765 60.080  1.00 63.00  ? 1224 GLU A CB    1 
ATOM   3175  C  CG    . GLU A 1 470 ? -8.602  134.449 60.720  1.00 68.80  ? 1224 GLU A CG    1 
ATOM   3176  C  CD    . GLU A 1 470 ? -7.084  134.312 60.785  1.00 79.43  ? 1224 GLU A CD    1 
ATOM   3177  O  OE1   . GLU A 1 470 ? -6.436  134.468 59.720  1.00 83.43  ? 1224 GLU A OE1   1 
ATOM   3178  O  OE2   . GLU A 1 470 ? -6.540  134.059 61.896  1.00 83.20  ? 1224 GLU A OE2   1 
ATOM   3179  N  N     . ILE A 1 471 ? -9.920  138.978 60.083  1.00 51.91  ? 1225 ILE A N     1 
ATOM   3180  C  CA    . ILE A 1 471 ? -9.929  140.303 59.479  1.00 47.36  ? 1225 ILE A CA    1 
ATOM   3181  C  C     . ILE A 1 471 ? -9.066  141.260 60.311  1.00 61.25  ? 1225 ILE A C     1 
ATOM   3182  O  O     . ILE A 1 471 ? -8.189  141.936 59.759  1.00 57.64  ? 1225 ILE A O     1 
ATOM   3183  C  CB    . ILE A 1 471 ? -11.353 140.853 59.286  1.00 47.85  ? 1225 ILE A CB    1 
ATOM   3184  C  CG1   . ILE A 1 471 ? -12.117 139.976 58.285  1.00 49.48  ? 1225 ILE A CG1   1 
ATOM   3185  C  CG2   . ILE A 1 471 ? -11.288 142.305 58.785  1.00 37.78  ? 1225 ILE A CG2   1 
ATOM   3186  C  CD1   . ILE A 1 471 ? -13.568 140.404 58.011  1.00 47.50  ? 1225 ILE A CD1   1 
ATOM   3187  N  N     . LYS A 1 472 ? -9.308  141.305 61.631  1.00 63.38  ? 1226 LYS A N     1 
ATOM   3188  C  CA    . LYS A 1 472 ? -8.488  142.103 62.545  1.00 54.17  ? 1226 LYS A CA    1 
ATOM   3189  C  C     . LYS A 1 472 ? -7.023  141.720 62.302  1.00 54.81  ? 1226 LYS A C     1 
ATOM   3190  O  O     . LYS A 1 472 ? -6.175  142.595 62.066  1.00 56.25  ? 1226 LYS A O     1 
ATOM   3191  C  CB    . LYS A 1 472 ? -8.902  141.854 64.004  1.00 61.57  ? 1226 LYS A CB    1 
ATOM   3192  C  CG    . LYS A 1 472 ? -8.269  142.752 65.105  1.00 50.23  ? 1226 LYS A CG    1 
ATOM   3193  N  N     . LYS A 1 473 ? -6.734  140.415 62.306  1.00 47.91  ? 1227 LYS A N     1 
ATOM   3194  C  CA    . LYS A 1 473 ? -5.349  139.966 62.168  1.00 48.71  ? 1227 LYS A CA    1 
ATOM   3195  C  C     . LYS A 1 473 ? -4.720  140.565 60.906  1.00 48.14  ? 1227 LYS A C     1 
ATOM   3196  O  O     . LYS A 1 473 ? -3.640  141.169 60.961  1.00 50.41  ? 1227 LYS A O     1 
ATOM   3197  C  CB    . LYS A 1 473 ? -5.222  138.427 62.234  1.00 44.35  ? 1227 LYS A CB    1 
ATOM   3198  C  CG    . LYS A 1 473 ? -3.777  137.881 62.089  1.00 45.22  ? 1227 LYS A CG    1 
ATOM   3199  C  CD    . LYS A 1 473 ? -3.688  136.358 62.394  1.00 47.13  ? 1227 LYS A CD    1 
ATOM   3200  N  N     . ALA A 1 474 ? -5.419  140.432 59.782  1.00 52.87  ? 1228 ALA A N     1 
ATOM   3201  C  CA    . ALA A 1 474 ? -4.945  140.979 58.509  1.00 55.46  ? 1228 ALA A CA    1 
ATOM   3202  C  C     . ALA A 1 474 ? -4.750  142.499 58.550  1.00 55.32  ? 1228 ALA A C     1 
ATOM   3203  O  O     . ALA A 1 474 ? -3.737  143.019 58.097  1.00 56.69  ? 1228 ALA A O     1 
ATOM   3204  C  CB    . ALA A 1 474 ? -5.900  140.593 57.376  1.00 41.73  ? 1228 ALA A CB    1 
ATOM   3205  N  N     . TYR A 1 475 ? -5.720  143.213 59.097  1.00 49.18  ? 1229 TYR A N     1 
ATOM   3206  C  CA    . TYR A 1 475 ? -5.588  144.653 59.197  1.00 56.55  ? 1229 TYR A CA    1 
ATOM   3207  C  C     . TYR A 1 475 ? -4.388  145.068 60.065  1.00 61.75  ? 1229 TYR A C     1 
ATOM   3208  O  O     . TYR A 1 475 ? -3.890  146.197 59.969  1.00 57.59  ? 1229 TYR A O     1 
ATOM   3209  C  CB    . TYR A 1 475 ? -6.892  145.258 59.718  1.00 62.54  ? 1229 TYR A CB    1 
ATOM   3210  C  CG    . TYR A 1 475 ? -7.992  145.274 58.687  1.00 59.06  ? 1229 TYR A CG    1 
ATOM   3211  C  CD1   . TYR A 1 475 ? -7.709  144.992 57.360  1.00 62.02  ? 1229 TYR A CD1   1 
ATOM   3212  C  CD2   . TYR A 1 475 ? -9.307  145.592 59.033  1.00 56.98  ? 1229 TYR A CD2   1 
ATOM   3213  C  CE1   . TYR A 1 475 ? -8.702  145.011 56.395  1.00 59.56  ? 1229 TYR A CE1   1 
ATOM   3214  C  CE2   . TYR A 1 475 ? -10.316 145.615 58.075  1.00 60.77  ? 1229 TYR A CE2   1 
ATOM   3215  C  CZ    . TYR A 1 475 ? -10.002 145.320 56.749  1.00 60.10  ? 1229 TYR A CZ    1 
ATOM   3216  O  OH    . TYR A 1 475 ? -10.967 145.319 55.762  1.00 56.28  ? 1229 TYR A OH    1 
ATOM   3217  N  N     . GLU A 1 476 ? -3.924  144.151 60.909  1.00 61.28  ? 1230 GLU A N     1 
ATOM   3218  C  CA    . GLU A 1 476 ? -2.831  144.446 61.821  1.00 58.99  ? 1230 GLU A CA    1 
ATOM   3219  C  C     . GLU A 1 476 ? -1.473  144.103 61.229  1.00 58.81  ? 1230 GLU A C     1 
ATOM   3220  O  O     . GLU A 1 476 ? -0.500  144.813 61.453  1.00 64.94  ? 1230 GLU A O     1 
ATOM   3221  C  CB    . GLU A 1 476 ? -3.009  143.670 63.113  1.00 71.08  ? 1230 GLU A CB    1 
ATOM   3222  C  CG    . GLU A 1 476 ? -3.385  144.507 64.309  1.00 84.08  ? 1230 GLU A CG    1 
ATOM   3223  C  CD    . GLU A 1 476 ? -3.994  143.661 65.420  1.00 99.84  ? 1230 GLU A CD    1 
ATOM   3224  O  OE1   . GLU A 1 476 ? -4.074  142.417 65.252  1.00 102.21 ? 1230 GLU A OE1   1 
ATOM   3225  O  OE2   . GLU A 1 476 ? -4.396  144.238 66.458  1.00 107.13 ? 1230 GLU A OE2   1 
ATOM   3226  N  N     . THR A 1 477 ? -1.406  143.013 60.475  1.00 57.81  ? 1231 THR A N     1 
ATOM   3227  C  CA    . THR A 1 477 ? -0.128  142.467 60.034  1.00 58.13  ? 1231 THR A CA    1 
ATOM   3228  C  C     . THR A 1 477 ? -0.066  142.258 58.522  1.00 56.73  ? 1231 THR A C     1 
ATOM   3229  O  O     . THR A 1 477 ? 0.952   141.798 57.983  1.00 55.43  ? 1231 THR A O     1 
ATOM   3230  C  CB    . THR A 1 477 ? 0.110   141.099 60.702  1.00 61.29  ? 1231 THR A CB    1 
ATOM   3231  O  OG1   . THR A 1 477 ? -0.745  140.107 60.107  1.00 66.75  ? 1231 THR A OG1   1 
ATOM   3232  C  CG2   . THR A 1 477 ? -0.214  141.194 62.139  1.00 49.29  ? 1231 THR A CG2   1 
ATOM   3233  N  N     . GLY A 1 478 ? -1.175  142.557 57.854  1.00 55.84  ? 1232 GLY A N     1 
ATOM   3234  C  CA    . GLY A 1 478 ? -1.308  142.322 56.429  1.00 55.42  ? 1232 GLY A CA    1 
ATOM   3235  C  C     . GLY A 1 478 ? -1.442  140.863 55.999  1.00 60.27  ? 1232 GLY A C     1 
ATOM   3236  O  O     . GLY A 1 478 ? -1.594  140.583 54.805  1.00 62.55  ? 1232 GLY A O     1 
ATOM   3237  N  N     . LYS A 1 479 ? -1.338  139.921 56.934  1.00 55.95  ? 1233 LYS A N     1 
ATOM   3238  C  CA    . LYS A 1 479 ? -1.685  138.538 56.605  1.00 51.49  ? 1233 LYS A CA    1 
ATOM   3239  C  C     . LYS A 1 479 ? -2.868  138.118 57.440  1.00 59.72  ? 1233 LYS A C     1 
ATOM   3240  O  O     . LYS A 1 479 ? -3.038  138.563 58.578  1.00 79.17  ? 1233 LYS A O     1 
ATOM   3241  C  CB    . LYS A 1 479 ? -0.531  137.555 56.783  1.00 43.00  ? 1233 LYS A CB    1 
ATOM   3242  C  CG    . LYS A 1 479 ? 0.625   137.674 55.764  1.00 43.13  ? 1233 LYS A CG    1 
ATOM   3243  C  CD    . LYS A 1 479 ? 1.362   136.318 55.579  1.00 48.02  ? 1233 LYS A CD    1 
ATOM   3244  C  CE    . LYS A 1 479 ? 2.797   136.469 55.092  1.00 62.79  ? 1233 LYS A CE    1 
ATOM   3245  N  NZ    . LYS A 1 479 ? 3.033   135.993 53.671  1.00 76.61  ? 1233 LYS A NZ    1 
ATOM   3246  N  N     . GLY A 1 480 ? -3.701  137.277 56.851  1.00 54.37  ? 1234 GLY A N     1 
ATOM   3247  C  CA    . GLY A 1 480 ? -4.968  136.885 57.444  1.00 62.22  ? 1234 GLY A CA    1 
ATOM   3248  C  C     . GLY A 1 480 ? -5.737  135.929 56.542  1.00 64.98  ? 1234 GLY A C     1 
ATOM   3249  O  O     . GLY A 1 480 ? -5.623  135.985 55.313  1.00 60.29  ? 1234 GLY A O     1 
ATOM   3250  N  N     . ARG A 1 481 ? -6.500  135.020 57.134  1.00 61.98  ? 1235 ARG A N     1 
ATOM   3251  C  CA    . ARG A 1 481 ? -7.271  134.113 56.300  1.00 59.04  ? 1235 ARG A CA    1 
ATOM   3252  C  C     . ARG A 1 481 ? -8.731  134.090 56.674  1.00 58.18  ? 1235 ARG A C     1 
ATOM   3253  O  O     . ARG A 1 481 ? -9.098  133.629 57.744  1.00 57.65  ? 1235 ARG A O     1 
ATOM   3254  C  CB    . ARG A 1 481 ? -6.727  132.694 56.320  1.00 59.38  ? 1235 ARG A CB    1 
ATOM   3255  C  CG    . ARG A 1 481 ? -7.633  131.774 55.539  1.00 63.49  ? 1235 ARG A CG    1 
ATOM   3256  C  CD    . ARG A 1 481 ? -7.391  130.339 55.888  1.00 76.24  ? 1235 ARG A CD    1 
ATOM   3257  N  NE    . ARG A 1 481 ? -6.200  129.856 55.222  1.00 86.47  ? 1235 ARG A NE    1 
ATOM   3258  C  CZ    . ARG A 1 481 ? -5.660  128.676 55.469  1.00 102.72 ? 1235 ARG A CZ    1 
ATOM   3259  N  NH1   . ARG A 1 481 ? -6.213  127.874 56.379  1.00 95.24  ? 1235 ARG A NH1   1 
ATOM   3260  N  NH2   . ARG A 1 481 ? -4.568  128.305 54.812  1.00 117.23 ? 1235 ARG A NH2   1 
ATOM   3261  N  N     . VAL A 1 482 ? -9.565  134.561 55.763  1.00 56.49  ? 1236 VAL A N     1 
ATOM   3262  C  CA    . VAL A 1 482 ? -10.973 134.703 56.049  1.00 52.52  ? 1236 VAL A CA    1 
ATOM   3263  C  C     . VAL A 1 482 ? -11.734 133.658 55.210  1.00 57.14  ? 1236 VAL A C     1 
ATOM   3264  O  O     . VAL A 1 482 ? -11.128 132.980 54.378  1.00 62.36  ? 1236 VAL A O     1 
ATOM   3265  C  CB    . VAL A 1 482 ? -11.392 136.135 55.737  1.00 44.20  ? 1236 VAL A CB    1 
ATOM   3266  C  CG1   . VAL A 1 482 ? -12.073 136.209 54.383  1.00 43.11  ? 1236 VAL A CG1   1 
ATOM   3267  C  CG2   . VAL A 1 482 ? -12.268 136.684 56.841  1.00 48.36  ? 1236 VAL A CG2   1 
ATOM   3268  N  N     . VAL A 1 483 ? -13.031 133.481 55.448  1.00 49.27  ? 1237 VAL A N     1 
ATOM   3269  C  CA    . VAL A 1 483 ? -13.801 132.528 54.650  1.00 44.39  ? 1237 VAL A CA    1 
ATOM   3270  C  C     . VAL A 1 483 ? -14.829 133.253 53.790  1.00 58.62  ? 1237 VAL A C     1 
ATOM   3271  O  O     . VAL A 1 483 ? -15.505 134.147 54.268  1.00 62.41  ? 1237 VAL A O     1 
ATOM   3272  C  CB    . VAL A 1 483 ? -14.504 131.492 55.528  1.00 46.18  ? 1237 VAL A CB    1 
ATOM   3273  C  CG1   . VAL A 1 483 ? -15.721 130.941 54.815  1.00 47.01  ? 1237 VAL A CG1   1 
ATOM   3274  C  CG2   . VAL A 1 483 ? -13.560 130.368 55.847  1.00 47.66  ? 1237 VAL A CG2   1 
ATOM   3275  N  N     . VAL A 1 484 ? -14.933 132.911 52.512  1.00 55.69  ? 1238 VAL A N     1 
ATOM   3276  C  CA    . VAL A 1 484 ? -15.935 133.580 51.677  1.00 50.85  ? 1238 VAL A CA    1 
ATOM   3277  C  C     . VAL A 1 484 ? -16.926 132.595 51.125  1.00 56.42  ? 1238 VAL A C     1 
ATOM   3278  O  O     . VAL A 1 484 ? -16.541 131.620 50.484  1.00 60.56  ? 1238 VAL A O     1 
ATOM   3279  C  CB    . VAL A 1 484 ? -15.361 134.282 50.474  1.00 49.04  ? 1238 VAL A CB    1 
ATOM   3280  C  CG1   . VAL A 1 484 ? -16.508 134.984 49.734  1.00 41.39  ? 1238 VAL A CG1   1 
ATOM   3281  C  CG2   . VAL A 1 484 ? -14.262 135.246 50.882  1.00 41.37  ? 1238 VAL A CG2   1 
ATOM   3282  N  N     . ARG A 1 485 ? -18.206 132.864 51.344  1.00 50.72  ? 1239 ARG A N     1 
ATOM   3283  C  CA    . ARG A 1 485 ? -19.216 131.862 51.082  1.00 50.02  ? 1239 ARG A CA    1 
ATOM   3284  C  C     . ARG A 1 485 ? -20.418 132.413 50.349  1.00 54.32  ? 1239 ARG A C     1 
ATOM   3285  O  O     . ARG A 1 485 ? -20.799 133.572 50.526  1.00 59.95  ? 1239 ARG A O     1 
ATOM   3286  C  CB    . ARG A 1 485 ? -19.667 131.235 52.390  1.00 54.79  ? 1239 ARG A CB    1 
ATOM   3287  C  CG    . ARG A 1 485 ? -21.037 130.651 52.290  1.00 62.03  ? 1239 ARG A CG    1 
ATOM   3288  C  CD    . ARG A 1 485 ? -21.544 130.344 53.639  1.00 70.98  ? 1239 ARG A CD    1 
ATOM   3289  N  NE    . ARG A 1 485 ? -20.839 129.214 54.217  1.00 75.05  ? 1239 ARG A NE    1 
ATOM   3290  C  CZ    . ARG A 1 485 ? -21.324 128.535 55.241  1.00 81.65  ? 1239 ARG A CZ    1 
ATOM   3291  N  NH1   . ARG A 1 485 ? -22.489 128.906 55.752  1.00 82.73  ? 1239 ARG A NH1   1 
ATOM   3292  N  NH2   . ARG A 1 485 ? -20.663 127.504 55.747  1.00 85.36  ? 1239 ARG A NH2   1 
ATOM   3293  N  N     . SER A 1 486 ? -21.038 131.555 49.553  1.00 50.01  ? 1240 SER A N     1 
ATOM   3294  C  CA    . SER A 1 486 ? -22.075 131.978 48.631  1.00 49.21  ? 1240 SER A CA    1 
ATOM   3295  C  C     . SER A 1 486 ? -23.425 132.290 49.276  1.00 56.47  ? 1240 SER A C     1 
ATOM   3296  O  O     . SER A 1 486 ? -23.823 131.658 50.261  1.00 68.93  ? 1240 SER A O     1 
ATOM   3297  C  CB    . SER A 1 486 ? -22.222 130.940 47.519  1.00 53.87  ? 1240 SER A CB    1 
ATOM   3298  O  OG    . SER A 1 486 ? -21.103 131.001 46.659  1.00 55.83  ? 1240 SER A OG    1 
ATOM   3299  N  N     . LYS A 1 487 ? -24.113 133.279 48.703  1.00 53.17  ? 1241 LYS A N     1 
ATOM   3300  C  CA    . LYS A 1 487 ? -25.459 133.663 49.110  1.00 57.72  ? 1241 LYS A CA    1 
ATOM   3301  C  C     . LYS A 1 487 ? -26.439 132.610 48.635  1.00 68.50  ? 1241 LYS A C     1 
ATOM   3302  O  O     . LYS A 1 487 ? -26.698 132.487 47.438  1.00 73.90  ? 1241 LYS A O     1 
ATOM   3303  C  CB    . LYS A 1 487 ? -25.836 135.021 48.516  1.00 61.09  ? 1241 LYS A CB    1 
ATOM   3304  C  CG    . LYS A 1 487 ? -26.660 135.928 49.457  1.00 74.22  ? 1241 LYS A CG    1 
ATOM   3305  C  CD    . LYS A 1 487 ? -28.143 135.997 49.069  1.00 83.57  ? 1241 LYS A CD    1 
ATOM   3306  C  CE    . LYS A 1 487 ? -28.830 137.257 49.617  1.00 81.03  ? 1241 LYS A CE    1 
ATOM   3307  N  NZ    . LYS A 1 487 ? -28.250 138.526 49.068  1.00 75.49  ? 1241 LYS A NZ    1 
ATOM   3308  N  N     . THR A 1 488 ? -26.979 131.850 49.580  1.00 73.51  ? 1242 THR A N     1 
ATOM   3309  C  CA    . THR A 1 488 ? -27.880 130.751 49.262  1.00 73.41  ? 1242 THR A CA    1 
ATOM   3310  C  C     . THR A 1 488 ? -29.321 131.037 49.684  1.00 68.26  ? 1242 THR A C     1 
ATOM   3311  O  O     . THR A 1 488 ? -29.603 132.027 50.360  1.00 75.83  ? 1242 THR A O     1 
ATOM   3312  C  CB    . THR A 1 488 ? -27.399 129.421 49.896  1.00 79.84  ? 1242 THR A CB    1 
ATOM   3313  O  OG1   . THR A 1 488 ? -27.045 129.634 51.273  1.00 83.57  ? 1242 THR A OG1   1 
ATOM   3314  C  CG2   . THR A 1 488 ? -26.186 128.880 49.134  1.00 78.67  ? 1242 THR A CG2   1 
ATOM   3315  N  N     . GLU A 1 489 ? -30.233 130.175 49.249  1.00 61.21  ? 1243 GLU A N     1 
ATOM   3316  C  CA    . GLU A 1 489 ? -31.643 130.270 49.601  1.00 65.96  ? 1243 GLU A CA    1 
ATOM   3317  C  C     . GLU A 1 489 ? -32.295 128.962 49.186  1.00 74.63  ? 1243 GLU A C     1 
ATOM   3318  O  O     . GLU A 1 489 ? -31.835 128.298 48.258  1.00 77.55  ? 1243 GLU A O     1 
ATOM   3319  C  CB    . GLU A 1 489 ? -32.318 131.472 48.929  1.00 58.41  ? 1243 GLU A CB    1 
ATOM   3320  N  N     . ILE A 1 490 ? -33.353 128.578 49.888  1.00 73.21  ? 1244 ILE A N     1 
ATOM   3321  C  CA    . ILE A 1 490 ? -33.984 127.302 49.623  1.00 71.91  ? 1244 ILE A CA    1 
ATOM   3322  C  C     . ILE A 1 490 ? -35.409 127.470 49.124  1.00 76.12  ? 1244 ILE A C     1 
ATOM   3323  O  O     . ILE A 1 490 ? -36.287 127.839 49.890  1.00 85.44  ? 1244 ILE A O     1 
ATOM   3324  C  CB    . ILE A 1 490 ? -33.997 126.458 50.886  1.00 69.30  ? 1244 ILE A CB    1 
ATOM   3325  C  CG1   . ILE A 1 490 ? -32.576 126.345 51.441  1.00 64.77  ? 1244 ILE A CG1   1 
ATOM   3326  C  CG2   . ILE A 1 490 ? -34.575 125.087 50.597  1.00 70.07  ? 1244 ILE A CG2   1 
ATOM   3327  C  CD1   . ILE A 1 490 ? -31.959 124.977 51.271  1.00 63.23  ? 1244 ILE A CD1   1 
ATOM   3328  N  N     . GLU A 1 491 ? -35.635 127.203 47.841  1.00 77.53  ? 1245 GLU A N     1 
ATOM   3329  C  CA    . GLU A 1 491 ? -36.981 127.268 47.271  1.00 86.22  ? 1245 GLU A CA    1 
ATOM   3330  C  C     . GLU A 1 491 ? -37.654 125.911 47.379  1.00 86.27  ? 1245 GLU A C     1 
ATOM   3331  O  O     . GLU A 1 491 ? -37.063 124.898 47.016  1.00 90.22  ? 1245 GLU A O     1 
ATOM   3332  C  CB    . GLU A 1 491 ? -36.934 127.710 45.803  1.00 90.21  ? 1245 GLU A CB    1 
ATOM   3333  C  CG    . GLU A 1 491 ? -36.392 129.120 45.618  1.00 100.08 ? 1245 GLU A CG    1 
ATOM   3334  C  CD    . GLU A 1 491 ? -36.391 129.600 44.165  1.00 108.87 ? 1245 GLU A CD    1 
ATOM   3335  O  OE1   . GLU A 1 491 ? -36.599 128.773 43.240  1.00 112.56 ? 1245 GLU A OE1   1 
ATOM   3336  O  OE2   . GLU A 1 491 ? -36.173 130.820 43.958  1.00 106.39 ? 1245 GLU A OE2   1 
ATOM   3337  N  N     . LYS A 1 492 ? -38.881 125.874 47.886  1.00 85.44  ? 1246 LYS A N     1 
ATOM   3338  C  CA    . LYS A 1 492 ? -39.601 124.604 47.942  1.00 85.25  ? 1246 LYS A CA    1 
ATOM   3339  C  C     . LYS A 1 492 ? -40.262 124.407 46.578  1.00 96.01  ? 1246 LYS A C     1 
ATOM   3340  O  O     . LYS A 1 492 ? -40.703 125.372 45.953  1.00 100.53 ? 1246 LYS A O     1 
ATOM   3341  C  CB    . LYS A 1 492 ? -40.609 124.567 49.101  1.00 71.51  ? 1246 LYS A CB    1 
ATOM   3342  N  N     . LEU A 1 493 ? -40.277 123.171 46.093  1.00 96.39  ? 1247 LEU A N     1 
ATOM   3343  C  CA    . LEU A 1 493 ? -40.837 122.875 44.777  1.00 92.32  ? 1247 LEU A CA    1 
ATOM   3344  C  C     . LEU A 1 493 ? -41.956 121.838 44.889  1.00 107.16 ? 1247 LEU A C     1 
ATOM   3345  O  O     . LEU A 1 493 ? -42.130 121.196 45.936  1.00 107.67 ? 1247 LEU A O     1 
ATOM   3346  C  CB    . LEU A 1 493 ? -39.748 122.382 43.811  1.00 79.38  ? 1247 LEU A CB    1 
ATOM   3347  C  CG    . LEU A 1 493 ? -38.815 123.394 43.150  1.00 65.85  ? 1247 LEU A CG    1 
ATOM   3348  N  N     . LYS A 1 494 ? -42.708 121.673 43.803  1.00 116.51 ? 1248 LYS A N     1 
ATOM   3349  C  CA    . LYS A 1 494 ? -43.809 120.712 43.771  1.00 125.41 ? 1248 LYS A CA    1 
ATOM   3350  C  C     . LYS A 1 494 ? -43.321 119.268 43.938  1.00 127.72 ? 1248 LYS A C     1 
ATOM   3351  O  O     . LYS A 1 494 ? -42.397 118.827 43.247  1.00 130.34 ? 1248 LYS A O     1 
ATOM   3352  C  CB    . LYS A 1 494 ? -44.614 120.859 42.473  1.00 126.76 ? 1248 LYS A CB    1 
ATOM   3353  N  N     . GLY A 1 495 ? -43.937 118.539 44.863  1.00 124.31 ? 1249 GLY A N     1 
ATOM   3354  C  CA    . GLY A 1 495 ? -43.654 117.122 45.017  1.00 122.43 ? 1249 GLY A CA    1 
ATOM   3355  C  C     . GLY A 1 495 ? -42.765 116.792 46.200  1.00 120.62 ? 1249 GLY A C     1 
ATOM   3356  O  O     . GLY A 1 495 ? -42.150 115.719 46.248  1.00 115.34 ? 1249 GLY A O     1 
ATOM   3357  N  N     . GLY A 1 496 ? -42.698 117.717 47.157  1.00 123.37 ? 1250 GLY A N     1 
ATOM   3358  C  CA    . GLY A 1 496 ? -41.886 117.530 48.347  1.00 121.57 ? 1250 GLY A CA    1 
ATOM   3359  C  C     . GLY A 1 496 ? -40.395 117.568 48.063  1.00 114.59 ? 1250 GLY A C     1 
ATOM   3360  O  O     . GLY A 1 496 ? -39.604 116.913 48.743  1.00 115.18 ? 1250 GLY A O     1 
ATOM   3361  N  N     . LYS A 1 497 ? -40.016 118.334 47.045  1.00 105.23 ? 1251 LYS A N     1 
ATOM   3362  C  CA    . LYS A 1 497 ? -38.621 118.496 46.684  1.00 97.51  ? 1251 LYS A CA    1 
ATOM   3363  C  C     . LYS A 1 497 ? -38.200 119.914 47.042  1.00 96.34  ? 1251 LYS A C     1 
ATOM   3364  O  O     . LYS A 1 497 ? -38.998 120.851 46.974  1.00 97.38  ? 1251 LYS A O     1 
ATOM   3365  C  CB    . LYS A 1 497 ? -38.416 118.276 45.181  1.00 98.64  ? 1251 LYS A CB    1 
ATOM   3366  C  CG    . LYS A 1 497 ? -39.070 117.028 44.578  1.00 99.56  ? 1251 LYS A CG    1 
ATOM   3367  C  CD    . LYS A 1 497 ? -39.046 117.071 43.035  1.00 92.43  ? 1251 LYS A CD    1 
ATOM   3368  N  N     . GLU A 1 498 ? -36.944 120.076 47.426  1.00 93.09  ? 1252 GLU A N     1 
ATOM   3369  C  CA    . GLU A 1 498 ? -36.421 121.405 47.670  1.00 89.00  ? 1252 GLU A CA    1 
ATOM   3370  C  C     . GLU A 1 498 ? -35.387 121.773 46.602  1.00 82.89  ? 1252 GLU A C     1 
ATOM   3371  O  O     . GLU A 1 498 ? -34.882 120.920 45.882  1.00 79.59  ? 1252 GLU A O     1 
ATOM   3372  C  CB    . GLU A 1 498 ? -35.837 121.505 49.084  1.00 90.82  ? 1252 GLU A CB    1 
ATOM   3373  C  CG    . GLU A 1 498 ? -36.886 121.510 50.198  1.00 105.24 ? 1252 GLU A CG    1 
ATOM   3374  C  CD    . GLU A 1 498 ? -36.272 121.565 51.604  1.00 115.85 ? 1252 GLU A CD    1 
ATOM   3375  O  OE1   . GLU A 1 498 ? -35.067 121.883 51.710  1.00 118.36 ? 1252 GLU A OE1   1 
ATOM   3376  O  OE2   . GLU A 1 498 ? -36.986 121.285 52.601  1.00 116.89 ? 1252 GLU A OE2   1 
ATOM   3377  N  N     . GLN A 1 499 ? -35.078 123.057 46.509  1.00 76.28  ? 1253 GLN A N     1 
ATOM   3378  C  CA    . GLN A 1 499 ? -34.161 123.569 45.507  1.00 66.82  ? 1253 GLN A CA    1 
ATOM   3379  C  C     . GLN A 1 499 ? -33.234 124.586 46.177  1.00 73.93  ? 1253 GLN A C     1 
ATOM   3380  O  O     . GLN A 1 499 ? -33.704 125.516 46.841  1.00 76.29  ? 1253 GLN A O     1 
ATOM   3381  C  CB    . GLN A 1 499 ? -34.980 124.228 44.406  1.00 66.52  ? 1253 GLN A CB    1 
ATOM   3382  C  CG    . GLN A 1 499 ? -34.196 125.001 43.386  1.00 72.51  ? 1253 GLN A CG    1 
ATOM   3383  C  CD    . GLN A 1 499 ? -35.038 125.366 42.177  1.00 83.75  ? 1253 GLN A CD    1 
ATOM   3384  O  OE1   . GLN A 1 499 ? -35.299 124.523 41.313  1.00 89.60  ? 1253 GLN A OE1   1 
ATOM   3385  N  NE2   . GLN A 1 499 ? -35.467 126.628 42.107  1.00 84.94  ? 1253 GLN A NE2   1 
ATOM   3386  N  N     . ILE A 1 500 ? -31.922 124.390 46.034  1.00 70.20  ? 1254 ILE A N     1 
ATOM   3387  C  CA    . ILE A 1 500 ? -30.937 125.319 46.584  1.00 66.87  ? 1254 ILE A CA    1 
ATOM   3388  C  C     . ILE A 1 500 ? -30.564 126.323 45.513  1.00 72.40  ? 1254 ILE A C     1 
ATOM   3389  O  O     . ILE A 1 500 ? -30.111 125.919 44.449  1.00 81.37  ? 1254 ILE A O     1 
ATOM   3390  C  CB    . ILE A 1 500 ? -29.630 124.619 46.910  1.00 59.13  ? 1254 ILE A CB    1 
ATOM   3391  C  CG1   . ILE A 1 500 ? -29.836 123.492 47.901  1.00 72.02  ? 1254 ILE A CG1   1 
ATOM   3392  C  CG2   . ILE A 1 500 ? -28.610 125.616 47.447  1.00 47.69  ? 1254 ILE A CG2   1 
ATOM   3393  C  CD1   . ILE A 1 500 ? -28.534 122.809 48.246  1.00 78.82  ? 1254 ILE A CD1   1 
ATOM   3394  N  N     . VAL A 1 501 ? -30.708 127.618 45.795  1.00 61.99  ? 1255 VAL A N     1 
ATOM   3395  C  CA    . VAL A 1 501 ? -30.525 128.633 44.762  1.00 58.17  ? 1255 VAL A CA    1 
ATOM   3396  C  C     . VAL A 1 501 ? -29.484 129.678 45.072  1.00 59.21  ? 1255 VAL A C     1 
ATOM   3397  O  O     . VAL A 1 501 ? -29.664 130.497 45.960  1.00 64.86  ? 1255 VAL A O     1 
ATOM   3398  C  CB    . VAL A 1 501 ? -31.810 129.382 44.468  1.00 58.53  ? 1255 VAL A CB    1 
ATOM   3399  C  CG1   . VAL A 1 501 ? -31.553 130.431 43.395  1.00 53.10  ? 1255 VAL A CG1   1 
ATOM   3400  C  CG2   . VAL A 1 501 ? -32.871 128.413 44.018  1.00 65.47  ? 1255 VAL A CG2   1 
ATOM   3401  N  N     . ILE A 1 502 ? -28.429 129.683 44.271  1.00 60.11  ? 1256 ILE A N     1 
ATOM   3402  C  CA    . ILE A 1 502 ? -27.302 130.572 44.460  1.00 58.62  ? 1256 ILE A CA    1 
ATOM   3403  C  C     . ILE A 1 502 ? -27.488 131.917 43.763  1.00 65.72  ? 1256 ILE A C     1 
ATOM   3404  O  O     . ILE A 1 502 ? -27.973 131.983 42.641  1.00 74.41  ? 1256 ILE A O     1 
ATOM   3405  C  CB    . ILE A 1 502 ? -26.038 129.884 43.994  1.00 59.94  ? 1256 ILE A CB    1 
ATOM   3406  C  CG1   . ILE A 1 502 ? -25.885 128.583 44.797  1.00 67.13  ? 1256 ILE A CG1   1 
ATOM   3407  C  CG2   . ILE A 1 502 ? -24.836 130.820 44.173  1.00 60.13  ? 1256 ILE A CG2   1 
ATOM   3408  C  CD1   . ILE A 1 502 ? -24.781 127.670 44.335  1.00 71.25  ? 1256 ILE A CD1   1 
ATOM   3409  N  N     . THR A 1 503 ? -27.122 132.999 44.441  1.00 62.02  ? 1257 THR A N     1 
ATOM   3410  C  CA    . THR A 1 503 ? -27.360 134.323 43.887  1.00 57.44  ? 1257 THR A CA    1 
ATOM   3411  C  C     . THR A 1 503 ? -26.096 135.179 43.902  1.00 57.53  ? 1257 THR A C     1 
ATOM   3412  O  O     . THR A 1 503 ? -25.990 136.142 43.147  1.00 63.34  ? 1257 THR A O     1 
ATOM   3413  C  CB    . THR A 1 503 ? -28.554 135.036 44.572  1.00 63.98  ? 1257 THR A CB    1 
ATOM   3414  O  OG1   . THR A 1 503 ? -28.244 135.339 45.938  1.00 63.64  ? 1257 THR A OG1   1 
ATOM   3415  C  CG2   . THR A 1 503 ? -29.774 134.145 44.532  1.00 68.71  ? 1257 THR A CG2   1 
ATOM   3416  N  N     . GLU A 1 504 ? -25.133 134.820 44.748  1.00 49.44  ? 1258 GLU A N     1 
ATOM   3417  C  CA    . GLU A 1 504 ? -23.809 135.445 44.700  1.00 51.41  ? 1258 GLU A CA    1 
ATOM   3418  C  C     . GLU A 1 504 ? -22.743 134.376 44.962  1.00 55.87  ? 1258 GLU A C     1 
ATOM   3419  O  O     . GLU A 1 504 ? -22.958 133.442 45.743  1.00 50.99  ? 1258 GLU A O     1 
ATOM   3420  C  CB    . GLU A 1 504 ? -23.682 136.593 45.710  1.00 44.55  ? 1258 GLU A CB    1 
ATOM   3421  C  CG    . GLU A 1 504 ? -24.827 137.585 45.684  1.00 62.37  ? 1258 GLU A CG    1 
ATOM   3422  C  CD    . GLU A 1 504 ? -24.722 138.648 46.772  1.00 86.15  ? 1258 GLU A CD    1 
ATOM   3423  O  OE1   . GLU A 1 504 ? -23.793 138.574 47.609  1.00 96.46  ? 1258 GLU A OE1   1 
ATOM   3424  O  OE2   . GLU A 1 504 ? -25.573 139.564 46.796  1.00 93.00  ? 1258 GLU A OE2   1 
ATOM   3425  N  N     . ILE A 1 505 ? -21.602 134.495 44.286  1.00 57.33  ? 1259 ILE A N     1 
ATOM   3426  C  CA    . ILE A 1 505 ? -20.498 133.571 44.530  1.00 47.23  ? 1259 ILE A CA    1 
ATOM   3427  C  C     . ILE A 1 505 ? -19.200 134.286 44.913  1.00 48.25  ? 1259 ILE A C     1 
ATOM   3428  O  O     . ILE A 1 505 ? -19.087 135.511 44.841  1.00 67.05  ? 1259 ILE A O     1 
ATOM   3429  C  CB    . ILE A 1 505 ? -20.287 132.613 43.356  1.00 45.78  ? 1259 ILE A CB    1 
ATOM   3430  C  CG1   . ILE A 1 505 ? -19.893 133.372 42.091  1.00 52.75  ? 1259 ILE A CG1   1 
ATOM   3431  C  CG2   . ILE A 1 505 ? -21.553 131.851 43.089  1.00 40.35  ? 1259 ILE A CG2   1 
ATOM   3432  C  CD1   . ILE A 1 505 ? -19.499 132.451 40.955  1.00 47.96  ? 1259 ILE A CD1   1 
ATOM   3433  N  N     . PRO A 1 506 ? -18.226 133.522 45.380  1.00 40.07  ? 1260 PRO A N     1 
ATOM   3434  C  CA    . PRO A 1 506 ? -16.981 134.099 45.898  1.00 44.76  ? 1260 PRO A CA    1 
ATOM   3435  C  C     . PRO A 1 506 ? -16.132 134.826 44.849  1.00 48.28  ? 1260 PRO A C     1 
ATOM   3436  O  O     . PRO A 1 506 ? -16.002 134.370 43.711  1.00 53.09  ? 1260 PRO A O     1 
ATOM   3437  C  CB    . PRO A 1 506 ? -16.241 132.880 46.425  1.00 45.13  ? 1260 PRO A CB    1 
ATOM   3438  C  CG    . PRO A 1 506 ? -17.349 131.890 46.750  1.00 48.45  ? 1260 PRO A CG    1 
ATOM   3439  C  CD    . PRO A 1 506 ? -18.372 132.093 45.702  1.00 41.79  ? 1260 PRO A CD    1 
ATOM   3440  N  N     . TYR A 1 507 ? -15.565 135.956 45.250  1.00 40.43  ? 1261 TYR A N     1 
ATOM   3441  C  CA    . TYR A 1 507 ? -14.588 136.689 44.462  1.00 43.34  ? 1261 TYR A CA    1 
ATOM   3442  C  C     . TYR A 1 507 ? -13.570 135.779 43.821  1.00 50.01  ? 1261 TYR A C     1 
ATOM   3443  O  O     . TYR A 1 507 ? -13.068 134.845 44.459  1.00 48.86  ? 1261 TYR A O     1 
ATOM   3444  C  CB    . TYR A 1 507 ? -13.853 137.685 45.350  1.00 42.58  ? 1261 TYR A CB    1 
ATOM   3445  C  CG    . TYR A 1 507 ? -12.997 138.690 44.634  1.00 46.91  ? 1261 TYR A CG    1 
ATOM   3446  C  CD1   . TYR A 1 507 ? -13.543 139.536 43.653  1.00 49.78  ? 1261 TYR A CD1   1 
ATOM   3447  C  CD2   . TYR A 1 507 ? -11.645 138.841 44.960  1.00 45.73  ? 1261 TYR A CD2   1 
ATOM   3448  C  CE1   . TYR A 1 507 ? -12.757 140.490 42.992  1.00 46.75  ? 1261 TYR A CE1   1 
ATOM   3449  C  CE2   . TYR A 1 507 ? -10.855 139.793 44.313  1.00 47.04  ? 1261 TYR A CE2   1 
ATOM   3450  C  CZ    . TYR A 1 507 ? -11.414 140.614 43.324  1.00 50.60  ? 1261 TYR A CZ    1 
ATOM   3451  O  OH    . TYR A 1 507 ? -10.626 141.556 42.670  1.00 49.95  ? 1261 TYR A OH    1 
ATOM   3452  N  N     . GLU A 1 508 ? -13.272 136.078 42.557  1.00 51.37  ? 1262 GLU A N     1 
ATOM   3453  C  CA    . GLU A 1 508 ? -12.242 135.404 41.777  1.00 46.12  ? 1262 GLU A CA    1 
ATOM   3454  C  C     . GLU A 1 508 ? -12.603 133.975 41.381  1.00 51.51  ? 1262 GLU A C     1 
ATOM   3455  O  O     . GLU A 1 508 ? -11.743 133.201 40.942  1.00 62.73  ? 1262 GLU A O     1 
ATOM   3456  C  CB    . GLU A 1 508 ? -10.864 135.493 42.455  1.00 50.37  ? 1262 GLU A CB    1 
ATOM   3457  C  CG    . GLU A 1 508 ? -10.319 136.928 42.496  1.00 77.88  ? 1262 GLU A CG    1 
ATOM   3458  C  CD    . GLU A 1 508 ? -8.823  137.041 42.844  1.00 96.98  ? 1262 GLU A CD    1 
ATOM   3459  O  OE1   . GLU A 1 508 ? -8.093  137.716 42.066  1.00 101.86 ? 1262 GLU A OE1   1 
ATOM   3460  O  OE2   . GLU A 1 508 ? -8.391  136.489 43.895  1.00 97.93  ? 1262 GLU A OE2   1 
ATOM   3461  N  N     . ILE A 1 509 ? -13.877 133.628 41.503  1.00 46.20  ? 1263 ILE A N     1 
ATOM   3462  C  CA    . ILE A 1 509 ? -14.302 132.273 41.153  1.00 48.01  ? 1263 ILE A CA    1 
ATOM   3463  C  C     . ILE A 1 509 ? -15.023 132.270 39.818  1.00 54.34  ? 1263 ILE A C     1 
ATOM   3464  O  O     . ILE A 1 509 ? -15.911 133.105 39.593  1.00 59.58  ? 1263 ILE A O     1 
ATOM   3465  C  CB    . ILE A 1 509 ? -15.204 131.639 42.242  1.00 44.96  ? 1263 ILE A CB    1 
ATOM   3466  C  CG1   . ILE A 1 509 ? -14.442 130.556 42.993  1.00 40.20  ? 1263 ILE A CG1   1 
ATOM   3467  C  CG2   . ILE A 1 509 ? -16.391 130.947 41.606  1.00 49.64  ? 1263 ILE A CG2   1 
ATOM   3468  C  CD1   . ILE A 1 509 ? -13.034 130.936 43.385  1.00 42.03  ? 1263 ILE A CD1   1 
ATOM   3469  N  N     . ASN A 1 510 ? -14.654 131.333 38.943  1.00 55.60  ? 1264 ASN A N     1 
ATOM   3470  C  CA    . ASN A 1 510 ? -15.267 131.228 37.605  1.00 52.87  ? 1264 ASN A CA    1 
ATOM   3471  C  C     . ASN A 1 510 ? -16.650 130.535 37.642  1.00 51.30  ? 1264 ASN A C     1 
ATOM   3472  O  O     . ASN A 1 510 ? -16.758 129.360 38.017  1.00 50.72  ? 1264 ASN A O     1 
ATOM   3473  C  CB    . ASN A 1 510 ? -14.277 130.522 36.663  1.00 55.83  ? 1264 ASN A CB    1 
ATOM   3474  C  CG    . ASN A 1 510 ? -14.829 130.282 35.261  1.00 63.52  ? 1264 ASN A CG    1 
ATOM   3475  O  OD1   . ASN A 1 510 ? -15.906 129.696 35.074  1.00 63.43  ? 1264 ASN A OD1   1 
ATOM   3476  N  ND2   . ASN A 1 510 ? -14.062 130.703 34.259  1.00 73.71  ? 1264 ASN A ND2   1 
ATOM   3477  N  N     . LYS A 1 511 ? -17.709 131.254 37.271  1.00 47.43  ? 1265 LYS A N     1 
ATOM   3478  C  CA    . LYS A 1 511 ? -19.070 130.712 37.432  1.00 51.49  ? 1265 LYS A CA    1 
ATOM   3479  C  C     . LYS A 1 511 ? -19.192 129.385 36.719  1.00 57.16  ? 1265 LYS A C     1 
ATOM   3480  O  O     . LYS A 1 511 ? -19.601 128.400 37.310  1.00 65.18  ? 1265 LYS A O     1 
ATOM   3481  C  CB    . LYS A 1 511 ? -20.147 131.697 36.932  1.00 59.07  ? 1265 LYS A CB    1 
ATOM   3482  C  CG    . LYS A 1 511 ? -21.619 131.277 37.203  1.00 59.38  ? 1265 LYS A CG    1 
ATOM   3483  C  CD    . LYS A 1 511 ? -22.640 132.413 36.823  1.00 60.00  ? 1265 LYS A CD    1 
ATOM   3484  C  CE    . LYS A 1 511 ? -22.796 132.641 35.275  1.00 46.40  ? 1265 LYS A CE    1 
ATOM   3485  N  N     . ALA A 1 512 ? -18.802 129.362 35.445  1.00 56.94  ? 1266 ALA A N     1 
ATOM   3486  C  CA    . ALA A 1 512 ? -18.902 128.164 34.608  1.00 47.79  ? 1266 ALA A CA    1 
ATOM   3487  C  C     . ALA A 1 512 ? -18.186 126.910 35.153  1.00 57.25  ? 1266 ALA A C     1 
ATOM   3488  O  O     . ALA A 1 512 ? -18.781 125.828 35.168  1.00 67.28  ? 1266 ALA A O     1 
ATOM   3489  C  CB    . ALA A 1 512 ? -18.445 128.465 33.234  1.00 47.26  ? 1266 ALA A CB    1 
ATOM   3490  N  N     . ASN A 1 513 ? -16.928 127.032 35.588  1.00 52.06  ? 1267 ASN A N     1 
ATOM   3491  C  CA    . ASN A 1 513 ? -16.245 125.872 36.186  1.00 57.38  ? 1267 ASN A CA    1 
ATOM   3492  C  C     . ASN A 1 513 ? -16.940 125.410 37.465  1.00 62.98  ? 1267 ASN A C     1 
ATOM   3493  O  O     . ASN A 1 513 ? -17.019 124.213 37.744  1.00 65.79  ? 1267 ASN A O     1 
ATOM   3494  C  CB    . ASN A 1 513 ? -14.759 126.133 36.483  1.00 62.62  ? 1267 ASN A CB    1 
ATOM   3495  C  CG    . ASN A 1 513 ? -13.995 126.712 35.291  1.00 80.78  ? 1267 ASN A CG    1 
ATOM   3496  O  OD1   . ASN A 1 513 ? -14.362 126.527 34.114  1.00 83.66  ? 1267 ASN A OD1   1 
ATOM   3497  N  ND2   . ASN A 1 513 ? -12.908 127.422 35.600  1.00 85.44  ? 1267 ASN A ND2   1 
ATOM   3498  N  N     . LEU A 1 514 ? -17.432 126.369 38.248  1.00 58.19  ? 1268 LEU A N     1 
ATOM   3499  C  CA    . LEU A 1 514 ? -18.164 126.059 39.466  1.00 53.11  ? 1268 LEU A CA    1 
ATOM   3500  C  C     . LEU A 1 514 ? -19.352 125.183 39.113  1.00 62.06  ? 1268 LEU A C     1 
ATOM   3501  O  O     . LEU A 1 514 ? -19.517 124.087 39.682  1.00 65.44  ? 1268 LEU A O     1 
ATOM   3502  C  CB    . LEU A 1 514 ? -18.673 127.341 40.123  1.00 54.70  ? 1268 LEU A CB    1 
ATOM   3503  C  CG    . LEU A 1 514 ? -18.859 127.437 41.647  1.00 53.93  ? 1268 LEU A CG    1 
ATOM   3504  C  CD1   . LEU A 1 514 ? -20.080 128.249 41.950  1.00 52.30  ? 1268 LEU A CD1   1 
ATOM   3505  C  CD2   . LEU A 1 514 ? -18.979 126.090 42.299  1.00 62.32  ? 1268 LEU A CD2   1 
ATOM   3506  N  N     . VAL A 1 515 ? -20.179 125.676 38.180  1.00 62.47  ? 1269 VAL A N     1 
ATOM   3507  C  CA    . VAL A 1 515 ? -21.394 124.965 37.779  1.00 59.19  ? 1269 VAL A CA    1 
ATOM   3508  C  C     . VAL A 1 515 ? -21.076 123.560 37.282  1.00 58.70  ? 1269 VAL A C     1 
ATOM   3509  O  O     . VAL A 1 515 ? -21.799 122.620 37.599  1.00 57.26  ? 1269 VAL A O     1 
ATOM   3510  C  CB    . VAL A 1 515 ? -22.226 125.709 36.719  1.00 49.62  ? 1269 VAL A CB    1 
ATOM   3511  C  CG1   . VAL A 1 515 ? -23.374 124.832 36.283  1.00 45.69  ? 1269 VAL A CG1   1 
ATOM   3512  C  CG2   . VAL A 1 515 ? -22.766 127.000 37.278  1.00 45.70  ? 1269 VAL A CG2   1 
ATOM   3513  N  N     . LYS A 1 516 ? -19.988 123.430 36.519  1.00 53.75  ? 1270 LYS A N     1 
ATOM   3514  C  CA    . LYS A 1 516 ? -19.484 122.129 36.081  1.00 50.62  ? 1270 LYS A CA    1 
ATOM   3515  C  C     . LYS A 1 516 ? -19.048 121.276 37.283  1.00 55.58  ? 1270 LYS A C     1 
ATOM   3516  O  O     . LYS A 1 516 ? -19.478 120.137 37.420  1.00 55.93  ? 1270 LYS A O     1 
ATOM   3517  C  CB    . LYS A 1 516 ? -18.336 122.296 35.069  1.00 56.71  ? 1270 LYS A CB    1 
ATOM   3518  C  CG    . LYS A 1 516 ? -17.603 120.998 34.647  1.00 71.71  ? 1270 LYS A CG    1 
ATOM   3519  C  CD    . LYS A 1 516 ? -18.419 120.075 33.706  1.00 62.32  ? 1270 LYS A CD    1 
ATOM   3520  N  N     . LYS A 1 517 ? -18.222 121.829 38.167  1.00 55.30  ? 1271 LYS A N     1 
ATOM   3521  C  CA    . LYS A 1 517 ? -17.763 121.071 39.335  1.00 48.63  ? 1271 LYS A CA    1 
ATOM   3522  C  C     . LYS A 1 517 ? -18.906 120.568 40.254  1.00 69.28  ? 1271 LYS A C     1 
ATOM   3523  O  O     . LYS A 1 517 ? -18.821 119.457 40.819  1.00 61.44  ? 1271 LYS A O     1 
ATOM   3524  C  CB    . LYS A 1 517 ? -16.687 121.841 40.115  1.00 47.35  ? 1271 LYS A CB    1 
ATOM   3525  C  CG    . LYS A 1 517 ? -15.984 120.996 41.186  1.00 71.82  ? 1271 LYS A CG    1 
ATOM   3526  C  CD    . LYS A 1 517 ? -14.831 121.738 41.915  1.00 96.07  ? 1271 LYS A CD    1 
ATOM   3527  C  CE    . LYS A 1 517 ? -15.208 123.186 42.292  1.00 80.95  ? 1271 LYS A CE    1 
ATOM   3528  N  NZ    . LYS A 1 517 ? -14.130 123.867 43.034  1.00 61.34  ? 1271 LYS A NZ    1 
ATOM   3529  N  N     . ILE A 1 518 ? -19.973 121.363 40.391  1.00 67.17  ? 1272 ILE A N     1 
ATOM   3530  C  CA    . ILE A 1 518 ? -21.136 120.914 41.151  1.00 60.78  ? 1272 ILE A CA    1 
ATOM   3531  C  C     . ILE A 1 518 ? -21.788 119.743 40.452  1.00 66.35  ? 1272 ILE A C     1 
ATOM   3532  O  O     . ILE A 1 518 ? -22.107 118.741 41.083  1.00 67.11  ? 1272 ILE A O     1 
ATOM   3533  C  CB    . ILE A 1 518 ? -22.188 122.004 41.346  1.00 59.26  ? 1272 ILE A CB    1 
ATOM   3534  C  CG1   . ILE A 1 518 ? -21.651 123.084 42.288  1.00 62.20  ? 1272 ILE A CG1   1 
ATOM   3535  C  CG2   . ILE A 1 518 ? -23.476 121.392 41.922  1.00 48.53  ? 1272 ILE A CG2   1 
ATOM   3536  C  CD1   . ILE A 1 518 ? -22.483 124.363 42.341  1.00 54.10  ? 1272 ILE A CD1   1 
ATOM   3537  N  N     . ASP A 1 519 ? -21.971 119.865 39.139  1.00 71.64  ? 1273 ASP A N     1 
ATOM   3538  C  CA    . ASP A 1 519 ? -22.596 118.799 38.351  1.00 69.35  ? 1273 ASP A CA    1 
ATOM   3539  C  C     . ASP A 1 519 ? -21.806 117.486 38.456  1.00 74.91  ? 1273 ASP A C     1 
ATOM   3540  O  O     . ASP A 1 519 ? -22.409 116.405 38.518  1.00 74.18  ? 1273 ASP A O     1 
ATOM   3541  C  CB    . ASP A 1 519 ? -22.814 119.234 36.887  1.00 59.68  ? 1273 ASP A CB    1 
ATOM   3542  C  CG    . ASP A 1 519 ? -23.753 118.283 36.101  1.00 96.73  ? 1273 ASP A CG    1 
ATOM   3543  O  OD1   . ASP A 1 519 ? -24.984 118.235 36.377  1.00 90.03  ? 1273 ASP A OD1   1 
ATOM   3544  O  OD2   . ASP A 1 519 ? -23.253 117.599 35.176  1.00 100.40 ? 1273 ASP A OD2   1 
ATOM   3545  N  N     . ASP A 1 520 ? -20.474 117.574 38.500  1.00 78.19  ? 1274 ASP A N     1 
ATOM   3546  C  CA    . ASP A 1 520 ? -19.642 116.378 38.680  1.00 83.36  ? 1274 ASP A CA    1 
ATOM   3547  C  C     . ASP A 1 520 ? -20.080 115.652 39.943  1.00 75.44  ? 1274 ASP A C     1 
ATOM   3548  O  O     . ASP A 1 520 ? -20.239 114.420 39.953  1.00 76.86  ? 1274 ASP A O     1 
ATOM   3549  C  CB    . ASP A 1 520 ? -18.153 116.723 38.775  1.00 96.17  ? 1274 ASP A CB    1 
ATOM   3550  C  CG    . ASP A 1 520 ? -17.512 116.966 37.417  1.00 118.42 ? 1274 ASP A CG    1 
ATOM   3551  O  OD1   . ASP A 1 520 ? -18.242 117.252 36.435  1.00 130.92 ? 1274 ASP A OD1   1 
ATOM   3552  O  OD2   . ASP A 1 520 ? -16.266 116.880 37.338  1.00 123.71 ? 1274 ASP A OD2   1 
ATOM   3553  N  N     . VAL A 1 521 ? -20.283 116.428 41.006  1.00 61.51  ? 1275 VAL A N     1 
ATOM   3554  C  CA    . VAL A 1 521 ? -20.757 115.878 42.257  1.00 56.84  ? 1275 VAL A CA    1 
ATOM   3555  C  C     . VAL A 1 521 ? -22.003 115.034 42.007  1.00 61.23  ? 1275 VAL A C     1 
ATOM   3556  O  O     . VAL A 1 521 ? -22.085 113.882 42.443  1.00 64.20  ? 1275 VAL A O     1 
ATOM   3557  C  CB    . VAL A 1 521 ? -21.054 116.990 43.281  1.00 53.27  ? 1275 VAL A CB    1 
ATOM   3558  C  CG1   . VAL A 1 521 ? -21.738 116.422 44.492  1.00 53.81  ? 1275 VAL A CG1   1 
ATOM   3559  C  CG2   . VAL A 1 521 ? -19.779 117.664 43.678  1.00 45.05  ? 1275 VAL A CG2   1 
ATOM   3560  N  N     . ARG A 1 522 ? -22.958 115.615 41.292  1.00 60.95  ? 1276 ARG A N     1 
ATOM   3561  C  CA    . ARG A 1 522 ? -24.190 114.929 40.926  1.00 59.44  ? 1276 ARG A CA    1 
ATOM   3562  C  C     . ARG A 1 522 ? -23.926 113.667 40.110  1.00 66.16  ? 1276 ARG A C     1 
ATOM   3563  O  O     . ARG A 1 522 ? -24.470 112.598 40.405  1.00 74.41  ? 1276 ARG A O     1 
ATOM   3564  C  CB    . ARG A 1 522 ? -25.077 115.854 40.101  1.00 56.74  ? 1276 ARG A CB    1 
ATOM   3565  C  CG    . ARG A 1 522 ? -26.494 115.373 39.978  1.00 64.72  ? 1276 ARG A CG    1 
ATOM   3566  C  CD    . ARG A 1 522 ? -27.102 115.825 38.682  1.00 77.93  ? 1276 ARG A CD    1 
ATOM   3567  N  NE    . ARG A 1 522 ? -26.577 115.081 37.543  1.00 89.96  ? 1276 ARG A NE    1 
ATOM   3568  C  CZ    . ARG A 1 522 ? -26.923 115.330 36.286  1.00 99.60  ? 1276 ARG A CZ    1 
ATOM   3569  N  NH1   . ARG A 1 522 ? -27.783 116.306 36.025  1.00 104.20 ? 1276 ARG A NH1   1 
ATOM   3570  N  NH2   . ARG A 1 522 ? -26.417 114.608 35.295  1.00 102.06 ? 1276 ARG A NH2   1 
ATOM   3571  N  N     . VAL A 1 523 ? -23.097 113.811 39.081  1.00 65.54  ? 1277 VAL A N     1 
ATOM   3572  C  CA    . VAL A 1 523 ? -22.836 112.739 38.129  1.00 71.84  ? 1277 VAL A CA    1 
ATOM   3573  C  C     . VAL A 1 523 ? -22.064 111.585 38.750  1.00 71.60  ? 1277 VAL A C     1 
ATOM   3574  O  O     . VAL A 1 523 ? -22.240 110.437 38.352  1.00 70.12  ? 1277 VAL A O     1 
ATOM   3575  C  CB    . VAL A 1 523 ? -22.068 113.262 36.886  1.00 66.67  ? 1277 VAL A CB    1 
ATOM   3576  C  CG1   . VAL A 1 523 ? -21.534 112.113 36.070  1.00 59.21  ? 1277 VAL A CG1   1 
ATOM   3577  C  CG2   . VAL A 1 523 ? -22.963 114.159 36.038  1.00 58.97  ? 1277 VAL A CG2   1 
ATOM   3578  N  N     . ASN A 1 524 ? -21.209 111.889 39.722  1.00 74.26  ? 1278 ASN A N     1 
ATOM   3579  C  CA    . ASN A 1 524 ? -20.423 110.850 40.389  1.00 83.38  ? 1278 ASN A CA    1 
ATOM   3580  C  C     . ASN A 1 524 ? -21.036 110.365 41.689  1.00 85.94  ? 1278 ASN A C     1 
ATOM   3581  O  O     . ASN A 1 524 ? -20.452 109.519 42.373  1.00 89.44  ? 1278 ASN A O     1 
ATOM   3582  C  CB    . ASN A 1 524 ? -19.002 111.330 40.676  1.00 84.37  ? 1278 ASN A CB    1 
ATOM   3583  C  CG    . ASN A 1 524 ? -18.150 111.418 39.427  1.00 80.56  ? 1278 ASN A CG    1 
ATOM   3584  O  OD1   . ASN A 1 524 ? -18.076 110.468 38.637  1.00 82.50  ? 1278 ASN A OD1   1 
ATOM   3585  N  ND2   . ASN A 1 524 ? -17.497 112.561 39.242  1.00 67.78  ? 1278 ASN A ND2   1 
ATOM   3586  N  N     . ASN A 1 525 ? -22.201 110.907 42.032  1.00 79.79  ? 1279 ASN A N     1 
ATOM   3587  C  CA    . ASN A 1 525 ? -22.843 110.590 43.306  1.00 81.53  ? 1279 ASN A CA    1 
ATOM   3588  C  C     . ASN A 1 525 ? -21.878 110.499 44.512  1.00 74.79  ? 1279 ASN A C     1 
ATOM   3589  O  O     . ASN A 1 525 ? -21.831 109.484 45.199  1.00 78.73  ? 1279 ASN A O     1 
ATOM   3590  C  CB    . ASN A 1 525 ? -23.676 109.314 43.179  1.00 95.32  ? 1279 ASN A CB    1 
ATOM   3591  C  CG    . ASN A 1 525 ? -25.161 109.595 43.210  1.00 102.90 ? 1279 ASN A CG    1 
ATOM   3592  O  OD1   . ASN A 1 525 ? -25.696 110.226 42.293  1.00 110.71 ? 1279 ASN A OD1   1 
ATOM   3593  N  ND2   . ASN A 1 525 ? -25.841 109.138 44.270  1.00 96.08  ? 1279 ASN A ND2   1 
ATOM   3594  N  N     . LYS A 1 526 ? -21.123 111.571 44.750  1.00 66.72  ? 1280 LYS A N     1 
ATOM   3595  C  CA    . LYS A 1 526 ? -20.140 111.628 45.819  1.00 63.74  ? 1280 LYS A CA    1 
ATOM   3596  C  C     . LYS A 1 526 ? -20.874 111.800 47.119  1.00 71.32  ? 1280 LYS A C     1 
ATOM   3597  O  O     . LYS A 1 526 ? -20.557 111.173 48.135  1.00 82.36  ? 1280 LYS A O     1 
ATOM   3598  C  CB    . LYS A 1 526 ? -19.238 112.835 45.608  1.00 59.81  ? 1280 LYS A CB    1 
ATOM   3599  C  CG    . LYS A 1 526 ? -18.491 112.805 44.297  1.00 55.06  ? 1280 LYS A CG    1 
ATOM   3600  C  CD    . LYS A 1 526 ? -17.310 111.873 44.379  1.00 57.97  ? 1280 LYS A CD    1 
ATOM   3601  C  CE    . LYS A 1 526 ? -16.412 112.240 45.545  1.00 64.09  ? 1280 LYS A CE    1 
ATOM   3602  N  NZ    . LYS A 1 526 ? -15.510 111.110 45.914  1.00 77.40  ? 1280 LYS A NZ    1 
ATOM   3603  N  N     . VAL A 1 527 ? -21.859 112.681 47.072  1.00 67.17  ? 1281 VAL A N     1 
ATOM   3604  C  CA    . VAL A 1 527 ? -22.783 112.887 48.164  1.00 62.17  ? 1281 VAL A CA    1 
ATOM   3605  C  C     . VAL A 1 527 ? -24.113 112.623 47.477  1.00 65.04  ? 1281 VAL A C     1 
ATOM   3606  O  O     . VAL A 1 527 ? -24.161 112.635 46.257  1.00 62.20  ? 1281 VAL A O     1 
ATOM   3607  C  CB    . VAL A 1 527 ? -22.692 114.319 48.631  1.00 51.77  ? 1281 VAL A CB    1 
ATOM   3608  C  CG1   . VAL A 1 527 ? -23.633 115.154 47.822  1.00 51.34  ? 1281 VAL A CG1   1 
ATOM   3609  C  CG2   . VAL A 1 527 ? -23.009 114.414 50.092  1.00 61.36  ? 1281 VAL A CG2   1 
ATOM   3610  N  N     . ALA A 1 528 ? -25.186 112.347 48.214  1.00 73.09  ? 1282 ALA A N     1 
ATOM   3611  C  CA    . ALA A 1 528 ? -26.411 111.869 47.545  1.00 71.23  ? 1282 ALA A CA    1 
ATOM   3612  C  C     . ALA A 1 528 ? -27.612 112.823 47.594  1.00 76.96  ? 1282 ALA A C     1 
ATOM   3613  O  O     . ALA A 1 528 ? -27.792 113.563 48.553  1.00 82.86  ? 1282 ALA A O     1 
ATOM   3614  C  CB    . ALA A 1 528 ? -26.794 110.524 48.072  1.00 62.64  ? 1282 ALA A CB    1 
ATOM   3615  N  N     . GLY A 1 529 ? -28.438 112.801 46.554  1.00 75.46  ? 1283 GLY A N     1 
ATOM   3616  C  CA    . GLY A 1 529 ? -29.586 113.688 46.520  1.00 70.76  ? 1283 GLY A CA    1 
ATOM   3617  C  C     . GLY A 1 529 ? -29.674 114.775 45.454  1.00 74.17  ? 1283 GLY A C     1 
ATOM   3618  O  O     . GLY A 1 529 ? -30.677 115.492 45.407  1.00 81.07  ? 1283 GLY A O     1 
ATOM   3619  N  N     . ILE A 1 530 ? -28.663 114.927 44.597  1.00 66.25  ? 1284 ILE A N     1 
ATOM   3620  C  CA    . ILE A 1 530 ? -28.749 115.978 43.580  1.00 65.68  ? 1284 ILE A CA    1 
ATOM   3621  C  C     . ILE A 1 530 ? -29.525 115.531 42.325  1.00 71.24  ? 1284 ILE A C     1 
ATOM   3622  O  O     . ILE A 1 530 ? -29.203 114.526 41.685  1.00 69.42  ? 1284 ILE A O     1 
ATOM   3623  C  CB    . ILE A 1 530 ? -27.372 116.594 43.242  1.00 64.41  ? 1284 ILE A CB    1 
ATOM   3624  C  CG1   . ILE A 1 530 ? -26.710 117.141 44.506  1.00 64.12  ? 1284 ILE A CG1   1 
ATOM   3625  C  CG2   . ILE A 1 530 ? -27.524 117.734 42.277  1.00 53.73  ? 1284 ILE A CG2   1 
ATOM   3626  C  CD1   . ILE A 1 530 ? -25.287 117.554 44.287  1.00 61.11  ? 1284 ILE A CD1   1 
ATOM   3627  N  N     . ALA A 1 531 ? -30.575 116.281 42.009  1.00 78.39  ? 1285 ALA A N     1 
ATOM   3628  C  CA    . ALA A 1 531 ? -31.475 115.945 40.909  1.00 79.70  ? 1285 ALA A CA    1 
ATOM   3629  C  C     . ALA A 1 531 ? -30.981 116.539 39.604  1.00 76.70  ? 1285 ALA A C     1 
ATOM   3630  O  O     . ALA A 1 531 ? -30.795 115.821 38.637  1.00 81.12  ? 1285 ALA A O     1 
ATOM   3631  C  CB    . ALA A 1 531 ? -32.889 116.434 41.208  1.00 82.19  ? 1285 ALA A CB    1 
ATOM   3632  N  N     . GLU A 1 532 ? -30.786 117.854 39.580  1.00 73.56  ? 1286 GLU A N     1 
ATOM   3633  C  CA    . GLU A 1 532 ? -30.244 118.522 38.410  1.00 77.08  ? 1286 GLU A CA    1 
ATOM   3634  C  C     . GLU A 1 532 ? -29.489 119.798 38.814  1.00 78.93  ? 1286 GLU A C     1 
ATOM   3635  O  O     . GLU A 1 532 ? -29.773 120.381 39.851  1.00 82.53  ? 1286 GLU A O     1 
ATOM   3636  C  CB    . GLU A 1 532 ? -31.375 118.849 37.437  1.00 84.36  ? 1286 GLU A CB    1 
ATOM   3637  C  CG    . GLU A 1 532 ? -30.899 119.326 36.071  1.00 100.14 ? 1286 GLU A CG    1 
ATOM   3638  C  CD    . GLU A 1 532 ? -32.013 119.951 35.237  1.00 112.06 ? 1286 GLU A CD    1 
ATOM   3639  O  OE1   . GLU A 1 532 ? -32.930 120.569 35.829  1.00 116.23 ? 1286 GLU A OE1   1 
ATOM   3640  O  OE2   . GLU A 1 532 ? -31.970 119.820 33.991  1.00 111.64 ? 1286 GLU A OE2   1 
ATOM   3641  N  N     . VAL A 1 533 ? -28.517 120.215 38.008  1.00 76.64  ? 1287 VAL A N     1 
ATOM   3642  C  CA    . VAL A 1 533 ? -27.892 121.530 38.171  1.00 71.31  ? 1287 VAL A CA    1 
ATOM   3643  C  C     . VAL A 1 533 ? -28.119 122.416 36.933  1.00 80.40  ? 1287 VAL A C     1 
ATOM   3644  O  O     . VAL A 1 533 ? -27.874 121.991 35.809  1.00 87.86  ? 1287 VAL A O     1 
ATOM   3645  C  CB    . VAL A 1 533 ? -26.391 121.419 38.358  1.00 66.63  ? 1287 VAL A CB    1 
ATOM   3646  C  CG1   . VAL A 1 533 ? -25.798 122.802 38.488  1.00 70.80  ? 1287 VAL A CG1   1 
ATOM   3647  C  CG2   . VAL A 1 533 ? -26.074 120.590 39.566  1.00 63.82  ? 1287 VAL A CG2   1 
ATOM   3648  N  N     . ARG A 1 534 ? -28.566 123.651 37.146  1.00 78.28  ? 1288 ARG A N     1 
ATOM   3649  C  CA    . ARG A 1 534 ? -28.951 124.542 36.058  1.00 73.31  ? 1288 ARG A CA    1 
ATOM   3650  C  C     . ARG A 1 534 ? -28.359 125.914 36.281  1.00 74.48  ? 1288 ARG A C     1 
ATOM   3651  O  O     . ARG A 1 534 ? -28.673 126.568 37.272  1.00 69.07  ? 1288 ARG A O     1 
ATOM   3652  C  CB    . ARG A 1 534 ? -30.465 124.728 36.041  1.00 71.18  ? 1288 ARG A CB    1 
ATOM   3653  C  CG    . ARG A 1 534 ? -31.246 123.812 35.142  1.00 73.30  ? 1288 ARG A CG    1 
ATOM   3654  C  CD    . ARG A 1 534 ? -32.732 124.121 35.269  1.00 77.22  ? 1288 ARG A CD    1 
ATOM   3655  N  NE    . ARG A 1 534 ? -33.342 123.388 36.378  1.00 81.46  ? 1288 ARG A NE    1 
ATOM   3656  C  CZ    . ARG A 1 534 ? -33.940 123.952 37.428  1.00 86.57  ? 1288 ARG A CZ    1 
ATOM   3657  N  NH1   . ARG A 1 534 ? -34.011 125.275 37.522  1.00 91.20  ? 1288 ARG A NH1   1 
ATOM   3658  N  NH2   . ARG A 1 534 ? -34.472 123.194 38.389  1.00 83.27  ? 1288 ARG A NH2   1 
ATOM   3659  N  N     . ASP A 1 535 ? -27.518 126.378 35.366  1.00 79.29  ? 1289 ASP A N     1 
ATOM   3660  C  CA    . ASP A 1 535 ? -27.142 127.781 35.418  1.00 70.66  ? 1289 ASP A CA    1 
ATOM   3661  C  C     . ASP A 1 535 ? -28.267 128.581 34.745  1.00 72.81  ? 1289 ASP A C     1 
ATOM   3662  O  O     . ASP A 1 535 ? -28.539 128.416 33.560  1.00 77.05  ? 1289 ASP A O     1 
ATOM   3663  C  CB    . ASP A 1 535 ? -25.787 128.030 34.764  1.00 65.23  ? 1289 ASP A CB    1 
ATOM   3664  C  CG    . ASP A 1 535 ? -25.313 129.463 34.944  1.00 79.52  ? 1289 ASP A CG    1 
ATOM   3665  O  OD1   . ASP A 1 535 ? -26.118 130.307 35.401  1.00 81.08  ? 1289 ASP A OD1   1 
ATOM   3666  O  OD2   . ASP A 1 535 ? -24.142 129.760 34.616  1.00 88.88  ? 1289 ASP A OD2   1 
ATOM   3667  N  N     . GLU A 1 536 ? -28.948 129.415 35.518  1.00 70.14  ? 1290 GLU A N     1 
ATOM   3668  C  CA    . GLU A 1 536 ? -30.109 130.134 35.020  1.00 73.75  ? 1290 GLU A CA    1 
ATOM   3669  C  C     . GLU A 1 536 ? -29.817 131.621 34.994  1.00 75.25  ? 1290 GLU A C     1 
ATOM   3670  O  O     . GLU A 1 536 ? -30.726 132.452 34.945  1.00 79.23  ? 1290 GLU A O     1 
ATOM   3671  C  CB    . GLU A 1 536 ? -31.321 129.838 35.898  1.00 76.30  ? 1290 GLU A CB    1 
ATOM   3672  C  CG    . GLU A 1 536 ? -31.571 128.344 36.081  1.00 82.67  ? 1290 GLU A CG    1 
ATOM   3673  C  CD    . GLU A 1 536 ? -32.925 128.031 36.702  1.00 93.84  ? 1290 GLU A CD    1 
ATOM   3674  O  OE1   . GLU A 1 536 ? -33.452 128.866 37.477  1.00 95.66  ? 1290 GLU A OE1   1 
ATOM   3675  O  OE2   . GLU A 1 536 ? -33.460 126.938 36.404  1.00 99.32  ? 1290 GLU A OE2   1 
ATOM   3676  N  N     . SER A 1 537 ? -28.531 131.947 35.019  1.00 69.20  ? 1291 SER A N     1 
ATOM   3677  C  CA    . SER A 1 537 ? -28.093 133.325 34.964  1.00 68.06  ? 1291 SER A CA    1 
ATOM   3678  C  C     . SER A 1 537 ? -28.479 133.967 33.641  1.00 77.02  ? 1291 SER A C     1 
ATOM   3679  O  O     . SER A 1 537 ? -28.333 133.368 32.576  1.00 83.22  ? 1291 SER A O     1 
ATOM   3680  C  CB    . SER A 1 537 ? -26.585 133.384 35.141  1.00 66.63  ? 1291 SER A CB    1 
ATOM   3681  O  OG    . SER A 1 537 ? -26.208 132.766 36.352  1.00 63.28  ? 1291 SER A OG    1 
ATOM   3682  N  N     . ASP A 1 538 ? -28.978 135.191 33.708  1.00 79.10  ? 1292 ASP A N     1 
ATOM   3683  C  CA    . ASP A 1 538 ? -29.303 135.930 32.504  1.00 87.30  ? 1292 ASP A CA    1 
ATOM   3684  C  C     . ASP A 1 538 ? -28.530 137.236 32.521  1.00 85.97  ? 1292 ASP A C     1 
ATOM   3685  O  O     . ASP A 1 538 ? -27.773 137.488 33.463  1.00 67.70  ? 1292 ASP A O     1 
ATOM   3686  C  CB    . ASP A 1 538 ? -30.827 136.134 32.343  1.00 96.90  ? 1292 ASP A CB    1 
ATOM   3687  C  CG    . ASP A 1 538 ? -31.432 137.120 33.357  1.00 103.32 ? 1292 ASP A CG    1 
ATOM   3688  O  OD1   . ASP A 1 538 ? -30.759 137.529 34.334  1.00 103.96 ? 1292 ASP A OD1   1 
ATOM   3689  O  OD2   . ASP A 1 538 ? -32.617 137.478 33.165  1.00 106.14 ? 1292 ASP A OD2   1 
ATOM   3690  N  N     . ARG A 1 539 ? -28.716 138.048 31.479  1.00 93.93  ? 1293 ARG A N     1 
ATOM   3691  C  CA    . ARG A 1 539 ? -27.967 139.294 31.301  1.00 86.72  ? 1293 ARG A CA    1 
ATOM   3692  C  C     . ARG A 1 539 ? -28.070 140.272 32.477  1.00 88.59  ? 1293 ARG A C     1 
ATOM   3693  O  O     . ARG A 1 539 ? -27.310 141.240 32.541  1.00 90.84  ? 1293 ARG A O     1 
ATOM   3694  C  CB    . ARG A 1 539 ? -28.384 139.992 29.999  1.00 82.26  ? 1293 ARG A CB    1 
ATOM   3695  C  CG    . ARG A 1 539 ? -29.777 140.581 30.018  1.00 79.72  ? 1293 ARG A CG    1 
ATOM   3696  C  CD    . ARG A 1 539 ? -30.320 140.735 28.618  1.00 83.94  ? 1293 ARG A CD    1 
ATOM   3697  N  NE    . ARG A 1 539 ? -31.563 139.989 28.433  1.00 90.29  ? 1293 ARG A NE    1 
ATOM   3698  C  CZ    . ARG A 1 539 ? -31.633 138.663 28.362  1.00 97.74  ? 1293 ARG A CZ    1 
ATOM   3699  N  NH1   . ARG A 1 539 ? -30.523 137.946 28.481  1.00 106.17 ? 1293 ARG A NH1   1 
ATOM   3700  N  NH2   . ARG A 1 539 ? -32.806 138.051 28.185  1.00 94.59  ? 1293 ARG A NH2   1 
ATOM   3701  N  N     . ASP A 1 540 ? -29.001 140.027 33.400  1.00 87.57  ? 1294 ASP A N     1 
ATOM   3702  C  CA    . ASP A 1 540 ? -29.209 140.939 34.526  1.00 87.28  ? 1294 ASP A CA    1 
ATOM   3703  C  C     . ASP A 1 540 ? -29.450 140.216 35.844  1.00 84.92  ? 1294 ASP A C     1 
ATOM   3704  O  O     . ASP A 1 540 ? -30.230 140.664 36.681  1.00 86.65  ? 1294 ASP A O     1 
ATOM   3705  C  CB    . ASP A 1 540 ? -30.352 141.917 34.239  1.00 95.25  ? 1294 ASP A CB    1 
ATOM   3706  C  CG    . ASP A 1 540 ? -31.564 141.233 33.647  1.00 107.71 ? 1294 ASP A CG    1 
ATOM   3707  O  OD1   . ASP A 1 540 ? -31.767 140.035 33.947  1.00 114.75 ? 1294 ASP A OD1   1 
ATOM   3708  O  OD2   . ASP A 1 540 ? -32.307 141.886 32.880  1.00 110.56 ? 1294 ASP A OD2   1 
ATOM   3709  N  N     . GLY A 1 541 ? -28.767 139.100 36.038  1.00 81.70  ? 1295 GLY A N     1 
ATOM   3710  C  CA    . GLY A 1 541 ? -28.819 138.434 37.320  1.00 75.88  ? 1295 GLY A CA    1 
ATOM   3711  C  C     . GLY A 1 541 ? -28.029 137.151 37.323  1.00 73.18  ? 1295 GLY A C     1 
ATOM   3712  O  O     . GLY A 1 541 ? -27.910 136.483 36.297  1.00 81.67  ? 1295 GLY A O     1 
ATOM   3713  N  N     . LEU A 1 542 ? -27.484 136.806 38.483  1.00 64.93  ? 1296 LEU A N     1 
ATOM   3714  C  CA    . LEU A 1 542 ? -26.794 135.534 38.640  1.00 57.12  ? 1296 LEU A CA    1 
ATOM   3715  C  C     . LEU A 1 542 ? -27.709 134.568 39.400  1.00 58.97  ? 1296 LEU A C     1 
ATOM   3716  O  O     . LEU A 1 542 ? -28.288 134.920 40.423  1.00 63.04  ? 1296 LEU A O     1 
ATOM   3717  C  CB    . LEU A 1 542 ? -25.448 135.727 39.353  1.00 48.29  ? 1296 LEU A CB    1 
ATOM   3718  C  CG    . LEU A 1 542 ? -24.654 134.430 39.540  1.00 52.36  ? 1296 LEU A CG    1 
ATOM   3719  C  CD1   . LEU A 1 542 ? -23.268 134.706 40.078  1.00 55.39  ? 1296 LEU A CD1   1 
ATOM   3720  C  CD2   . LEU A 1 542 ? -25.399 133.430 40.453  1.00 51.06  ? 1296 LEU A CD2   1 
ATOM   3721  N  N     . ARG A 1 543 ? -27.870 133.360 38.880  1.00 58.49  ? 1297 ARG A N     1 
ATOM   3722  C  CA    . ARG A 1 543 ? -28.761 132.396 39.519  1.00 58.65  ? 1297 ARG A CA    1 
ATOM   3723  C  C     . ARG A 1 543 ? -28.440 130.970 39.102  1.00 63.19  ? 1297 ARG A C     1 
ATOM   3724  O  O     . ARG A 1 543 ? -28.526 130.625 37.924  1.00 72.82  ? 1297 ARG A O     1 
ATOM   3725  C  CB    . ARG A 1 543 ? -30.236 132.721 39.235  1.00 55.11  ? 1297 ARG A CB    1 
ATOM   3726  C  CG    . ARG A 1 543 ? -31.181 131.574 39.526  1.00 64.08  ? 1297 ARG A CG    1 
ATOM   3727  C  CD    . ARG A 1 543 ? -32.626 131.951 39.233  1.00 78.32  ? 1297 ARG A CD    1 
ATOM   3728  N  NE    . ARG A 1 543 ? -33.427 132.045 40.452  1.00 82.16  ? 1297 ARG A NE    1 
ATOM   3729  C  CZ    . ARG A 1 543 ? -34.387 131.189 40.777  1.00 83.74  ? 1297 ARG A CZ    1 
ATOM   3730  N  NH1   . ARG A 1 543 ? -34.681 130.173 39.973  1.00 83.81  ? 1297 ARG A NH1   1 
ATOM   3731  N  NH2   . ARG A 1 543 ? -35.055 131.355 41.906  1.00 87.74  ? 1297 ARG A NH2   1 
ATOM   3732  N  N     . ILE A 1 544 ? -28.066 130.158 40.087  1.00 59.58  ? 1298 ILE A N     1 
ATOM   3733  C  CA    . ILE A 1 544 ? -27.777 128.749 39.886  1.00 59.85  ? 1298 ILE A CA    1 
ATOM   3734  C  C     . ILE A 1 544 ? -28.763 127.925 40.713  1.00 64.44  ? 1298 ILE A C     1 
ATOM   3735  O  O     . ILE A 1 544 ? -28.870 128.124 41.905  1.00 57.66  ? 1298 ILE A O     1 
ATOM   3736  C  CB    . ILE A 1 544 ? -26.349 128.425 40.327  1.00 59.00  ? 1298 ILE A CB    1 
ATOM   3737  C  CG1   . ILE A 1 544 ? -25.357 129.353 39.625  1.00 61.01  ? 1298 ILE A CG1   1 
ATOM   3738  C  CG2   . ILE A 1 544 ? -26.009 126.980 40.044  1.00 57.65  ? 1298 ILE A CG2   1 
ATOM   3739  C  CD1   . ILE A 1 544 ? -23.916 129.116 40.049  1.00 62.43  ? 1298 ILE A CD1   1 
ATOM   3740  N  N     . ALA A 1 545 ? -29.503 127.029 40.062  1.00 71.64  ? 1299 ALA A N     1 
ATOM   3741  C  CA    . ALA A 1 545 ? -30.513 126.214 40.720  1.00 56.02  ? 1299 ALA A CA    1 
ATOM   3742  C  C     . ALA A 1 545 ? -29.938 124.824 40.870  1.00 66.14  ? 1299 ALA A C     1 
ATOM   3743  O  O     . ALA A 1 545 ? -29.536 124.203 39.887  1.00 69.88  ? 1299 ALA A O     1 
ATOM   3744  N  N     . ILE A 1 546 ? -29.866 124.345 42.107  1.00 71.39  ? 1300 ILE A N     1 
ATOM   3745  C  CA    . ILE A 1 546 ? -29.589 122.937 42.370  1.00 63.13  ? 1300 ILE A CA    1 
ATOM   3746  C  C     . ILE A 1 546 ? -30.866 122.248 42.839  1.00 71.11  ? 1300 ILE A C     1 
ATOM   3747  O  O     . ILE A 1 546 ? -31.259 122.361 44.000  1.00 78.55  ? 1300 ILE A O     1 
ATOM   3748  C  CB    . ILE A 1 546 ? -28.510 122.765 43.429  1.00 49.80  ? 1300 ILE A CB    1 
ATOM   3749  C  CG1   . ILE A 1 546 ? -27.283 123.588 43.072  1.00 46.43  ? 1300 ILE A CG1   1 
ATOM   3750  C  CG2   . ILE A 1 546 ? -28.105 121.314 43.556  1.00 47.37  ? 1300 ILE A CG2   1 
ATOM   3751  C  CD1   . ILE A 1 546 ? -26.209 123.475 44.143  1.00 49.92  ? 1300 ILE A CD1   1 
ATOM   3752  N  N     . GLU A 1 547 ? -31.533 121.557 41.922  1.00 76.97  ? 1301 GLU A N     1 
ATOM   3753  C  CA    . GLU A 1 547 ? -32.739 120.822 42.257  1.00 81.87  ? 1301 GLU A CA    1 
ATOM   3754  C  C     . GLU A 1 547 ? -32.305 119.556 42.974  1.00 81.88  ? 1301 GLU A C     1 
ATOM   3755  O  O     . GLU A 1 547 ? -31.406 118.856 42.504  1.00 84.26  ? 1301 GLU A O     1 
ATOM   3756  C  CB    . GLU A 1 547 ? -33.536 120.490 40.992  1.00 82.19  ? 1301 GLU A CB    1 
ATOM   3757  C  CG    . GLU A 1 547 ? -34.982 120.107 41.257  1.00 91.75  ? 1301 GLU A CG    1 
ATOM   3758  C  CD    . GLU A 1 547 ? -35.801 119.934 39.985  1.00 106.21 ? 1301 GLU A CD    1 
ATOM   3759  O  OE1   . GLU A 1 547 ? -36.478 118.884 39.862  1.00 114.74 ? 1301 GLU A OE1   1 
ATOM   3760  O  OE2   . GLU A 1 547 ? -35.784 120.847 39.122  1.00 105.06 ? 1301 GLU A OE2   1 
ATOM   3761  N  N     . LEU A 1 548 ? -32.918 119.291 44.128  1.00 78.21  ? 1302 LEU A N     1 
ATOM   3762  C  CA    . LEU A 1 548 ? -32.654 118.080 44.913  1.00 71.33  ? 1302 LEU A CA    1 
ATOM   3763  C  C     . LEU A 1 548 ? -33.748 117.025 44.723  1.00 82.09  ? 1302 LEU A C     1 
ATOM   3764  O  O     . LEU A 1 548 ? -34.809 117.310 44.160  1.00 88.63  ? 1302 LEU A O     1 
ATOM   3765  C  CB    . LEU A 1 548 ? -32.522 118.441 46.388  1.00 59.42  ? 1302 LEU A CB    1 
ATOM   3766  C  CG    . LEU A 1 548 ? -31.348 119.375 46.692  1.00 57.65  ? 1302 LEU A CG    1 
ATOM   3767  C  CD1   . LEU A 1 548 ? -31.369 119.871 48.124  1.00 54.49  ? 1302 LEU A CD1   1 
ATOM   3768  C  CD2   . LEU A 1 548 ? -30.031 118.673 46.421  1.00 63.38  ? 1302 LEU A CD2   1 
ATOM   3769  N  N     . LYS A 1 549 ? -33.492 115.806 45.186  1.00 87.58  ? 1303 LYS A N     1 
ATOM   3770  C  CA    . LYS A 1 549 ? -34.454 114.711 45.022  1.00 94.47  ? 1303 LYS A CA    1 
ATOM   3771  C  C     . LYS A 1 549 ? -35.455 114.679 46.182  1.00 100.91 ? 1303 LYS A C     1 
ATOM   3772  O  O     . LYS A 1 549 ? -35.224 115.316 47.216  1.00 97.61  ? 1303 LYS A O     1 
ATOM   3773  C  CB    . LYS A 1 549 ? -33.737 113.357 44.928  1.00 87.29  ? 1303 LYS A CB    1 
ATOM   3774  C  CG    . LYS A 1 549 ? -32.898 113.120 43.675  1.00 81.69  ? 1303 LYS A CG    1 
ATOM   3775  C  CD    . LYS A 1 549 ? -31.962 111.929 43.903  1.00 83.94  ? 1303 LYS A CD    1 
ATOM   3776  C  CE    . LYS A 1 549 ? -31.208 111.512 42.643  1.00 88.98  ? 1303 LYS A CE    1 
ATOM   3777  N  NZ    . LYS A 1 549 ? -30.397 110.277 42.879  1.00 90.92  ? 1303 LYS A NZ    1 
ATOM   3778  N  N     . LYS A 1 550 ? -36.558 113.941 46.008  1.00 103.08 ? 1304 LYS A N     1 
ATOM   3779  C  CA    . LYS A 1 550 ? -37.523 113.738 47.091  1.00 98.49  ? 1304 LYS A CA    1 
ATOM   3780  C  C     . LYS A 1 550 ? -36.791 113.223 48.334  1.00 105.10 ? 1304 LYS A C     1 
ATOM   3781  O  O     . LYS A 1 550 ? -36.084 112.212 48.274  1.00 109.68 ? 1304 LYS A O     1 
ATOM   3782  C  CB    . LYS A 1 550 ? -38.647 112.766 46.680  1.00 82.35  ? 1304 LYS A CB    1 
ATOM   3783  N  N     . ASP A 1 551 ? -36.942 113.932 49.451  1.00 103.00 ? 1305 ASP A N     1 
ATOM   3784  C  CA    . ASP A 1 551 ? -36.370 113.487 50.724  1.00 104.32 ? 1305 ASP A CA    1 
ATOM   3785  C  C     . ASP A 1 551 ? -34.844 113.278 50.634  1.00 100.49 ? 1305 ASP A C     1 
ATOM   3786  O  O     . ASP A 1 551 ? -34.345 112.152 50.612  1.00 100.23 ? 1305 ASP A O     1 
ATOM   3787  C  CB    . ASP A 1 551 ? -37.092 112.221 51.230  1.00 102.03 ? 1305 ASP A CB    1 
ATOM   3788  N  N     . ALA A 1 552 ? -34.116 114.385 50.569  1.00 95.44  ? 1306 ALA A N     1 
ATOM   3789  C  CA    . ALA A 1 552 ? -32.661 114.371 50.486  1.00 89.82  ? 1306 ALA A CA    1 
ATOM   3790  C  C     . ALA A 1 552 ? -32.195 115.400 51.468  1.00 86.15  ? 1306 ALA A C     1 
ATOM   3791  O  O     . ALA A 1 552 ? -32.678 116.535 51.441  1.00 83.55  ? 1306 ALA A O     1 
ATOM   3792  C  CB    . ALA A 1 552 ? -32.197 114.752 49.094  1.00 88.14  ? 1306 ALA A CB    1 
ATOM   3793  N  N     . ASN A 1 553 ? -31.265 115.012 52.335  1.00 88.19  ? 1307 ASN A N     1 
ATOM   3794  C  CA    . ASN A 1 553 ? -30.840 115.878 53.432  1.00 89.60  ? 1307 ASN A CA    1 
ATOM   3795  C  C     . ASN A 1 553 ? -30.201 117.177 52.925  1.00 83.84  ? 1307 ASN A C     1 
ATOM   3796  O  O     . ASN A 1 553 ? -28.987 117.250 52.700  1.00 81.84  ? 1307 ASN A O     1 
ATOM   3797  C  CB    . ASN A 1 553 ? -29.902 115.131 54.384  1.00 90.46  ? 1307 ASN A CB    1 
ATOM   3798  C  CG    . ASN A 1 553 ? -29.439 115.995 55.540  1.00 93.20  ? 1307 ASN A CG    1 
ATOM   3799  O  OD1   . ASN A 1 553 ? -29.517 117.230 55.483  1.00 98.80  ? 1307 ASN A OD1   1 
ATOM   3800  N  ND2   . ASN A 1 553 ? -28.950 115.353 56.597  1.00 90.66  ? 1307 ASN A ND2   1 
ATOM   3801  N  N     . THR A 1 554 ? -31.026 118.206 52.754  1.00 75.72  ? 1308 THR A N     1 
ATOM   3802  C  CA    . THR A 1 554 ? -30.582 119.373 52.015  1.00 64.16  ? 1308 THR A CA    1 
ATOM   3803  C  C     . THR A 1 554 ? -29.418 120.083 52.705  1.00 60.34  ? 1308 THR A C     1 
ATOM   3804  O  O     . THR A 1 554 ? -28.615 120.737 52.051  1.00 60.66  ? 1308 THR A O     1 
ATOM   3805  C  CB    . THR A 1 554 ? -31.760 120.314 51.587  1.00 68.81  ? 1308 THR A CB    1 
ATOM   3806  O  OG1   . THR A 1 554 ? -31.572 121.636 52.099  1.00 64.26  ? 1308 THR A OG1   1 
ATOM   3807  C  CG2   . THR A 1 554 ? -33.095 119.760 52.046  1.00 78.85  ? 1308 THR A CG2   1 
ATOM   3808  N  N     . GLU A 1 555 ? -29.287 119.912 54.014  1.00 65.23  ? 1309 GLU A N     1 
ATOM   3809  C  CA    . GLU A 1 555 ? -28.157 120.519 54.702  1.00 72.16  ? 1309 GLU A CA    1 
ATOM   3810  C  C     . GLU A 1 555 ? -26.904 119.708 54.382  1.00 75.50  ? 1309 GLU A C     1 
ATOM   3811  O  O     . GLU A 1 555 ? -25.827 120.265 54.146  1.00 72.04  ? 1309 GLU A O     1 
ATOM   3812  C  CB    . GLU A 1 555 ? -28.395 120.606 56.224  1.00 74.54  ? 1309 GLU A CB    1 
ATOM   3813  N  N     . LEU A 1 556 ? -27.055 118.387 54.376  1.00 76.40  ? 1310 LEU A N     1 
ATOM   3814  C  CA    . LEU A 1 556 ? -25.923 117.499 54.158  1.00 79.65  ? 1310 LEU A CA    1 
ATOM   3815  C  C     . LEU A 1 556 ? -25.272 117.909 52.855  1.00 73.53  ? 1310 LEU A C     1 
ATOM   3816  O  O     . LEU A 1 556 ? -24.075 118.180 52.810  1.00 76.86  ? 1310 LEU A O     1 
ATOM   3817  C  CB    . LEU A 1 556 ? -26.385 116.039 54.099  1.00 88.88  ? 1310 LEU A CB    1 
ATOM   3818  C  CG    . LEU A 1 556 ? -25.434 114.894 54.476  1.00 92.44  ? 1310 LEU A CG    1 
ATOM   3819  C  CD1   . LEU A 1 556 ? -24.669 114.347 53.269  1.00 82.38  ? 1310 LEU A CD1   1 
ATOM   3820  C  CD2   . LEU A 1 556 ? -24.476 115.348 55.579  1.00 103.54 ? 1310 LEU A CD2   1 
ATOM   3821  N  N     . VAL A 1 557 ? -26.083 117.973 51.804  1.00 60.89  ? 1311 VAL A N     1 
ATOM   3822  C  CA    . VAL A 1 557 ? -25.619 118.361 50.486  1.00 62.09  ? 1311 VAL A CA    1 
ATOM   3823  C  C     . VAL A 1 557 ? -24.947 119.738 50.487  1.00 65.73  ? 1311 VAL A C     1 
ATOM   3824  O  O     . VAL A 1 557 ? -23.848 119.915 49.949  1.00 73.90  ? 1311 VAL A O     1 
ATOM   3825  C  CB    . VAL A 1 557 ? -26.796 118.384 49.470  1.00 57.77  ? 1311 VAL A CB    1 
ATOM   3826  C  CG1   . VAL A 1 557 ? -26.419 119.166 48.205  1.00 52.05  ? 1311 VAL A CG1   1 
ATOM   3827  C  CG2   . VAL A 1 557 ? -27.244 116.978 49.130  1.00 52.68  ? 1311 VAL A CG2   1 
ATOM   3828  N  N     . LEU A 1 558 ? -25.613 120.722 51.077  1.00 57.35  ? 1312 LEU A N     1 
ATOM   3829  C  CA    . LEU A 1 558 ? -25.111 122.090 51.041  1.00 55.46  ? 1312 LEU A CA    1 
ATOM   3830  C  C     . LEU A 1 558 ? -23.777 122.212 51.774  1.00 63.57  ? 1312 LEU A C     1 
ATOM   3831  O  O     . LEU A 1 558 ? -22.895 122.978 51.367  1.00 64.21  ? 1312 LEU A O     1 
ATOM   3832  C  CB    . LEU A 1 558 ? -26.140 123.049 51.627  1.00 58.14  ? 1312 LEU A CB    1 
ATOM   3833  C  CG    . LEU A 1 558 ? -25.926 124.528 51.336  1.00 59.00  ? 1312 LEU A CG    1 
ATOM   3834  C  CD1   . LEU A 1 558 ? -25.743 124.741 49.840  1.00 59.06  ? 1312 LEU A CD1   1 
ATOM   3835  C  CD2   . LEU A 1 558 ? -27.115 125.308 51.842  1.00 63.01  ? 1312 LEU A CD2   1 
ATOM   3836  N  N     . ASN A 1 559 ? -23.624 121.450 52.851  1.00 65.36  ? 1313 ASN A N     1 
ATOM   3837  C  CA    . ASN A 1 559 ? -22.346 121.399 53.534  1.00 62.12  ? 1313 ASN A CA    1 
ATOM   3838  C  C     . ASN A 1 559 ? -21.309 120.742 52.651  1.00 60.58  ? 1313 ASN A C     1 
ATOM   3839  O  O     . ASN A 1 559 ? -20.211 121.271 52.469  1.00 59.19  ? 1313 ASN A O     1 
ATOM   3840  C  CB    . ASN A 1 559 ? -22.465 120.676 54.869  1.00 70.45  ? 1313 ASN A CB    1 
ATOM   3841  C  CG    . ASN A 1 559 ? -22.876 121.610 56.004  1.00 76.65  ? 1313 ASN A CG    1 
ATOM   3842  O  OD1   . ASN A 1 559 ? -23.189 122.791 55.783  1.00 63.50  ? 1313 ASN A OD1   1 
ATOM   3843  N  ND2   . ASN A 1 559 ? -22.881 121.081 57.229  1.00 88.21  ? 1313 ASN A ND2   1 
ATOM   3844  N  N     . TYR A 1 560 ? -21.665 119.604 52.067  1.00 66.88  ? 1314 TYR A N     1 
ATOM   3845  C  CA    . TYR A 1 560 ? -20.726 118.924 51.183  1.00 59.84  ? 1314 TYR A CA    1 
ATOM   3846  C  C     . TYR A 1 560 ? -20.207 119.828 50.075  1.00 55.26  ? 1314 TYR A C     1 
ATOM   3847  O  O     . TYR A 1 560 ? -19.003 119.829 49.804  1.00 52.87  ? 1314 TYR A O     1 
ATOM   3848  C  CB    . TYR A 1 560 ? -21.290 117.647 50.583  1.00 56.31  ? 1314 TYR A CB    1 
ATOM   3849  C  CG    . TYR A 1 560 ? -20.266 116.980 49.712  1.00 61.54  ? 1314 TYR A CG    1 
ATOM   3850  C  CD1   . TYR A 1 560 ? -19.311 116.122 50.258  1.00 63.86  ? 1314 TYR A CD1   1 
ATOM   3851  C  CD2   . TYR A 1 560 ? -20.222 117.241 48.336  1.00 59.38  ? 1314 TYR A CD2   1 
ATOM   3852  C  CE1   . TYR A 1 560 ? -18.348 115.510 49.449  1.00 70.44  ? 1314 TYR A CE1   1 
ATOM   3853  C  CE2   . TYR A 1 560 ? -19.266 116.652 47.525  1.00 61.01  ? 1314 TYR A CE2   1 
ATOM   3854  C  CZ    . TYR A 1 560 ? -18.333 115.786 48.079  1.00 71.42  ? 1314 TYR A CZ    1 
ATOM   3855  O  OH    . TYR A 1 560 ? -17.394 115.205 47.255  1.00 76.65  ? 1314 TYR A OH    1 
ATOM   3856  N  N     . LEU A 1 561 ? -21.101 120.589 49.442  1.00 51.01  ? 1315 LEU A N     1 
ATOM   3857  C  CA    . LEU A 1 561 ? -20.670 121.452 48.341  1.00 50.21  ? 1315 LEU A CA    1 
ATOM   3858  C  C     . LEU A 1 561 ? -19.776 122.586 48.825  1.00 54.16  ? 1315 LEU A C     1 
ATOM   3859  O  O     . LEU A 1 561 ? -18.903 123.029 48.081  1.00 57.32  ? 1315 LEU A O     1 
ATOM   3860  C  CB    . LEU A 1 561 ? -21.845 122.022 47.532  1.00 45.63  ? 1315 LEU A CB    1 
ATOM   3861  C  CG    . LEU A 1 561 ? -22.800 121.027 46.875  1.00 48.78  ? 1315 LEU A CG    1 
ATOM   3862  C  CD1   . LEU A 1 561 ? -23.990 121.770 46.311  1.00 60.41  ? 1315 LEU A CD1   1 
ATOM   3863  C  CD2   . LEU A 1 561 ? -22.104 120.254 45.786  1.00 48.03  ? 1315 LEU A CD2   1 
ATOM   3864  N  N     . PHE A 1 562 ? -19.988 123.059 50.056  1.00 53.93  ? 1316 PHE A N     1 
ATOM   3865  C  CA    . PHE A 1 562 ? -19.204 124.186 50.572  1.00 55.52  ? 1316 PHE A CA    1 
ATOM   3866  C  C     . PHE A 1 562 ? -17.756 123.765 50.727  1.00 54.09  ? 1316 PHE A C     1 
ATOM   3867  O  O     . PHE A 1 562 ? -16.813 124.514 50.377  1.00 55.91  ? 1316 PHE A O     1 
ATOM   3868  C  CB    . PHE A 1 562 ? -19.746 124.689 51.918  1.00 55.87  ? 1316 PHE A CB    1 
ATOM   3869  C  CG    . PHE A 1 562 ? -20.935 125.607 51.798  1.00 60.46  ? 1316 PHE A CG    1 
ATOM   3870  C  CD1   . PHE A 1 562 ? -21.130 126.375 50.657  1.00 60.92  ? 1316 PHE A CD1   1 
ATOM   3871  C  CD2   . PHE A 1 562 ? -21.858 125.707 52.832  1.00 60.05  ? 1316 PHE A CD2   1 
ATOM   3872  C  CE1   . PHE A 1 562 ? -22.219 127.230 50.552  1.00 58.86  ? 1316 PHE A CE1   1 
ATOM   3873  C  CE2   . PHE A 1 562 ? -22.961 126.549 52.732  1.00 54.21  ? 1316 PHE A CE2   1 
ATOM   3874  C  CZ    . PHE A 1 562 ? -23.137 127.315 51.593  1.00 59.43  ? 1316 PHE A CZ    1 
ATOM   3875  N  N     . LYS A 1 563 ? -17.601 122.543 51.230  1.00 47.55  ? 1317 LYS A N     1 
ATOM   3876  C  CA    . LYS A 1 563 ? -16.290 121.996 51.553  1.00 54.57  ? 1317 LYS A CA    1 
ATOM   3877  C  C     . LYS A 1 563 ? -15.538 121.523 50.303  1.00 55.84  ? 1317 LYS A C     1 
ATOM   3878  O  O     . LYS A 1 563 ? -14.333 121.707 50.192  1.00 58.11  ? 1317 LYS A O     1 
ATOM   3879  C  CB    . LYS A 1 563 ? -16.418 120.850 52.577  1.00 44.98  ? 1317 LYS A CB    1 
ATOM   3880  C  CG    . LYS A 1 563 ? -15.091 120.182 52.898  1.00 54.43  ? 1317 LYS A CG    1 
ATOM   3881  C  CD    . LYS A 1 563 ? -15.183 119.126 54.002  1.00 63.75  ? 1317 LYS A CD    1 
ATOM   3882  C  CE    . LYS A 1 563 ? -13.802 118.515 54.328  1.00 70.29  ? 1317 LYS A CE    1 
ATOM   3883  N  NZ    . LYS A 1 563 ? -13.881 117.390 55.317  1.00 73.97  ? 1317 LYS A NZ    1 
ATOM   3884  N  N     . TYR A 1 564 ? -16.255 120.930 49.358  1.00 49.46  ? 1318 TYR A N     1 
ATOM   3885  C  CA    . TYR A 1 564 ? -15.603 120.208 48.273  1.00 50.36  ? 1318 TYR A CA    1 
ATOM   3886  C  C     . TYR A 1 564 ? -15.689 120.874 46.891  1.00 56.53  ? 1318 TYR A C     1 
ATOM   3887  O  O     . TYR A 1 564 ? -15.171 120.342 45.907  1.00 65.46  ? 1318 TYR A O     1 
ATOM   3888  C  CB    . TYR A 1 564 ? -16.104 118.759 48.231  1.00 48.29  ? 1318 TYR A CB    1 
ATOM   3889  C  CG    . TYR A 1 564 ? -15.545 117.917 49.340  1.00 51.13  ? 1318 TYR A CG    1 
ATOM   3890  C  CD1   . TYR A 1 564 ? -14.311 117.301 49.212  1.00 46.96  ? 1318 TYR A CD1   1 
ATOM   3891  C  CD2   . TYR A 1 564 ? -16.250 117.737 50.517  1.00 57.30  ? 1318 TYR A CD2   1 
ATOM   3892  C  CE1   . TYR A 1 564 ? -13.788 116.540 50.219  1.00 60.54  ? 1318 TYR A CE1   1 
ATOM   3893  C  CE2   . TYR A 1 564 ? -15.734 116.969 51.546  1.00 61.49  ? 1318 TYR A CE2   1 
ATOM   3894  C  CZ    . TYR A 1 564 ? -14.501 116.380 51.398  1.00 63.68  ? 1318 TYR A CZ    1 
ATOM   3895  O  OH    . TYR A 1 564 ? -13.986 115.630 52.428  1.00 65.73  ? 1318 TYR A OH    1 
ATOM   3896  N  N     . THR A 1 565 ? -16.342 122.027 46.820  1.00 45.41  ? 1319 THR A N     1 
ATOM   3897  C  CA    . THR A 1 565 ? -16.267 122.863 45.638  1.00 46.13  ? 1319 THR A CA    1 
ATOM   3898  C  C     . THR A 1 565 ? -16.097 124.297 46.083  1.00 48.63  ? 1319 THR A C     1 
ATOM   3899  O  O     . THR A 1 565 ? -16.155 124.579 47.277  1.00 62.36  ? 1319 THR A O     1 
ATOM   3900  C  CB    . THR A 1 565 ? -17.518 122.765 44.760  1.00 52.73  ? 1319 THR A CB    1 
ATOM   3901  O  OG1   . THR A 1 565 ? -18.547 123.627 45.274  1.00 45.40  ? 1319 THR A OG1   1 
ATOM   3902  C  CG2   . THR A 1 565 ? -17.992 121.334 44.666  1.00 40.88  ? 1319 THR A CG2   1 
ATOM   3903  N  N     . ASP A 1 566 ? -15.868 125.199 45.127  1.00 47.87  ? 1320 ASP A N     1 
ATOM   3904  C  CA    . ASP A 1 566 ? -15.562 126.594 45.438  1.00 50.41  ? 1320 ASP A CA    1 
ATOM   3905  C  C     . ASP A 1 566 ? -16.845 127.364 45.706  1.00 63.55  ? 1320 ASP A C     1 
ATOM   3906  O  O     . ASP A 1 566 ? -16.841 128.592 45.718  1.00 70.86  ? 1320 ASP A O     1 
ATOM   3907  C  CB    . ASP A 1 566 ? -14.761 127.264 44.318  1.00 53.55  ? 1320 ASP A CB    1 
ATOM   3908  C  CG    . ASP A 1 566 ? -13.328 126.738 44.221  1.00 75.11  ? 1320 ASP A CG    1 
ATOM   3909  O  OD1   . ASP A 1 566 ? -12.896 126.037 45.163  1.00 79.86  ? 1320 ASP A OD1   1 
ATOM   3910  O  OD2   . ASP A 1 566 ? -12.623 127.028 43.216  1.00 81.39  ? 1320 ASP A OD2   1 
ATOM   3911  N  N     . LEU A 1 567 ? -17.946 126.640 45.914  1.00 58.74  ? 1321 LEU A N     1 
ATOM   3912  C  CA    . LEU A 1 567 ? -19.162 127.262 46.412  1.00 50.02  ? 1321 LEU A CA    1 
ATOM   3913  C  C     . LEU A 1 567 ? -18.808 128.059 47.677  1.00 55.90  ? 1321 LEU A C     1 
ATOM   3914  O  O     . LEU A 1 567 ? -19.470 129.042 48.019  1.00 65.90  ? 1321 LEU A O     1 
ATOM   3915  C  CB    . LEU A 1 567 ? -20.202 126.200 46.730  1.00 54.04  ? 1321 LEU A CB    1 
ATOM   3916  C  CG    . LEU A 1 567 ? -21.644 126.538 46.344  1.00 61.66  ? 1321 LEU A CG    1 
ATOM   3917  C  CD1   . LEU A 1 567 ? -22.593 126.248 47.492  1.00 60.01  ? 1321 LEU A CD1   1 
ATOM   3918  C  CD2   . LEU A 1 567 ? -21.745 127.989 45.901  1.00 65.26  ? 1321 LEU A CD2   1 
ATOM   3919  N  N     . GLN A 1 568 ? -17.751 127.617 48.358  1.00 50.65  ? 1322 GLN A N     1 
ATOM   3920  C  CA    . GLN A 1 568 ? -17.161 128.327 49.485  1.00 51.01  ? 1322 GLN A CA    1 
ATOM   3921  C  C     . GLN A 1 568 ? -15.658 128.103 49.492  1.00 55.65  ? 1322 GLN A C     1 
ATOM   3922  O  O     . GLN A 1 568 ? -15.207 126.938 49.383  1.00 62.32  ? 1322 GLN A O     1 
ATOM   3923  C  CB    . GLN A 1 568 ? -17.730 127.833 50.809  1.00 47.13  ? 1322 GLN A CB    1 
ATOM   3924  C  CG    . GLN A 1 568 ? -17.224 128.643 52.001  1.00 58.17  ? 1322 GLN A CG    1 
ATOM   3925  C  CD    . GLN A 1 568 ? -17.059 127.802 53.265  1.00 65.06  ? 1322 GLN A CD    1 
ATOM   3926  O  OE1   . GLN A 1 568 ? -18.044 127.423 53.902  1.00 60.27  ? 1322 GLN A OE1   1 
ATOM   3927  N  NE2   . GLN A 1 568 ? -15.805 127.507 53.626  1.00 66.00  ? 1322 GLN A NE2   1 
ATOM   3928  N  N     . ILE A 1 569 ? -14.913 129.209 49.645  1.00 49.12  ? 1323 ILE A N     1 
ATOM   3929  C  CA    . ILE A 1 569 ? -13.446 129.239 49.622  1.00 50.97  ? 1323 ILE A CA    1 
ATOM   3930  C  C     . ILE A 1 569 ? -12.790 130.018 50.764  1.00 54.53  ? 1323 ILE A C     1 
ATOM   3931  O  O     . ILE A 1 569 ? -13.437 130.799 51.478  1.00 54.39  ? 1323 ILE A O     1 
ATOM   3932  C  CB    . ILE A 1 569 ? -12.920 129.965 48.383  1.00 60.52  ? 1323 ILE A CB    1 
ATOM   3933  C  CG1   . ILE A 1 569 ? -13.103 131.483 48.547  1.00 45.40  ? 1323 ILE A CG1   1 
ATOM   3934  C  CG2   . ILE A 1 569 ? -13.528 129.398 47.103  1.00 49.21  ? 1323 ILE A CG2   1 
ATOM   3935  C  CD1   . ILE A 1 569 ? -12.873 132.202 47.290  1.00 47.42  ? 1323 ILE A CD1   1 
ATOM   3936  N  N     . ASN A 1 570 ? -11.480 129.834 50.913  1.00 56.01  ? 1324 ASN A N     1 
ATOM   3937  C  CA    . ASN A 1 570 ? -10.710 130.656 51.848  1.00 54.93  ? 1324 ASN A CA    1 
ATOM   3938  C  C     . ASN A 1 570 ? -9.967  131.726 51.085  1.00 58.66  ? 1324 ASN A C     1 
ATOM   3939  O  O     . ASN A 1 570 ? -9.118  131.413 50.271  1.00 75.33  ? 1324 ASN A O     1 
ATOM   3940  C  CB    . ASN A 1 570 ? -9.654  129.844 52.608  1.00 51.79  ? 1324 ASN A CB    1 
ATOM   3941  C  CG    . ASN A 1 570 ? -10.204 128.599 53.252  1.00 53.94  ? 1324 ASN A CG    1 
ATOM   3942  O  OD1   . ASN A 1 570 ? -11.336 128.573 53.730  1.00 65.22  ? 1324 ASN A OD1   1 
ATOM   3943  N  ND2   . ASN A 1 570 ? -9.388  127.545 53.275  1.00 52.54  ? 1324 ASN A ND2   1 
ATOM   3944  N  N     . TYR A 1 571 ? -10.267 132.987 51.344  1.00 53.71  ? 1325 TYR A N     1 
ATOM   3945  C  CA    . TYR A 1 571 ? -9.479  134.066 50.773  1.00 48.31  ? 1325 TYR A CA    1 
ATOM   3946  C  C     . TYR A 1 571 ? -8.363  134.433 51.746  1.00 51.70  ? 1325 TYR A C     1 
ATOM   3947  O  O     . TYR A 1 571 ? -8.590  134.554 52.958  1.00 50.74  ? 1325 TYR A O     1 
ATOM   3948  C  CB    . TYR A 1 571 ? -10.360 135.274 50.478  1.00 46.15  ? 1325 TYR A CB    1 
ATOM   3949  C  CG    . TYR A 1 571 ? -9.595  136.466 49.989  1.00 50.99  ? 1325 TYR A CG    1 
ATOM   3950  C  CD1   . TYR A 1 571 ? -8.940  137.309 50.884  1.00 60.74  ? 1325 TYR A CD1   1 
ATOM   3951  C  CD2   . TYR A 1 571 ? -9.523  136.761 48.623  1.00 54.39  ? 1325 TYR A CD2   1 
ATOM   3952  C  CE1   . TYR A 1 571 ? -8.227  138.424 50.426  1.00 68.09  ? 1325 TYR A CE1   1 
ATOM   3953  C  CE2   . TYR A 1 571 ? -8.822  137.871 48.149  1.00 51.93  ? 1325 TYR A CE2   1 
ATOM   3954  C  CZ    . TYR A 1 571 ? -8.174  138.691 49.050  1.00 62.87  ? 1325 TYR A CZ    1 
ATOM   3955  O  OH    . TYR A 1 571 ? -7.477  139.776 48.580  1.00 65.17  ? 1325 TYR A OH    1 
ATOM   3956  N  N     . ASN A 1 572 ? -7.160  134.600 51.209  1.00 55.82  ? 1326 ASN A N     1 
ATOM   3957  C  CA    . ASN A 1 572 ? -5.986  134.932 52.006  1.00 49.24  ? 1326 ASN A CA    1 
ATOM   3958  C  C     . ASN A 1 572 ? -5.449  136.322 51.757  1.00 54.33  ? 1326 ASN A C     1 
ATOM   3959  O  O     . ASN A 1 572 ? -4.979  136.624 50.657  1.00 62.13  ? 1326 ASN A O     1 
ATOM   3960  C  CB    . ASN A 1 572 ? -4.860  133.952 51.730  1.00 48.96  ? 1326 ASN A CB    1 
ATOM   3961  C  CG    . ASN A 1 572 ? -5.026  132.657 52.472  1.00 60.55  ? 1326 ASN A CG    1 
ATOM   3962  O  OD1   . ASN A 1 572 ? -4.745  132.567 53.673  1.00 81.04  ? 1326 ASN A OD1   1 
ATOM   3963  N  ND2   . ASN A 1 572 ? -5.466  131.638 51.764  1.00 57.25  ? 1326 ASN A ND2   1 
ATOM   3964  N  N     . PHE A 1 573 ? -5.507  137.161 52.787  1.00 58.26  ? 1327 PHE A N     1 
ATOM   3965  C  CA    . PHE A 1 573 ? -4.819  138.441 52.760  1.00 52.12  ? 1327 PHE A CA    1 
ATOM   3966  C  C     . PHE A 1 573 ? -3.321  138.157 52.737  1.00 55.63  ? 1327 PHE A C     1 
ATOM   3967  O  O     . PHE A 1 573 ? -2.827  137.302 53.474  1.00 67.92  ? 1327 PHE A O     1 
ATOM   3968  C  CB    . PHE A 1 573 ? -5.117  139.261 54.006  1.00 50.72  ? 1327 PHE A CB    1 
ATOM   3969  C  CG    . PHE A 1 573 ? -6.520  139.816 54.091  1.00 54.71  ? 1327 PHE A CG    1 
ATOM   3970  C  CD1   . PHE A 1 573 ? -7.581  139.013 54.484  1.00 53.82  ? 1327 PHE A CD1   1 
ATOM   3971  C  CD2   . PHE A 1 573 ? -6.755  141.172 53.899  1.00 54.02  ? 1327 PHE A CD2   1 
ATOM   3972  C  CE1   . PHE A 1 573 ? -8.869  139.539 54.619  1.00 47.95  ? 1327 PHE A CE1   1 
ATOM   3973  C  CE2   . PHE A 1 573 ? -8.033  141.701 54.038  1.00 49.97  ? 1327 PHE A CE2   1 
ATOM   3974  C  CZ    . PHE A 1 573 ? -9.095  140.875 54.390  1.00 44.87  ? 1327 PHE A CZ    1 
ATOM   3975  N  N     . ASN A 1 574 ? -2.611  138.862 51.864  1.00 48.57  ? 1328 ASN A N     1 
ATOM   3976  C  CA    . ASN A 1 574 ? -1.159  138.945 51.921  1.00 45.49  ? 1328 ASN A CA    1 
ATOM   3977  C  C     . ASN A 1 574 ? -0.784  140.323 51.366  1.00 50.22  ? 1328 ASN A C     1 
ATOM   3978  O  O     . ASN A 1 574 ? -0.195  140.441 50.297  1.00 51.63  ? 1328 ASN A O     1 
ATOM   3979  C  CB    . ASN A 1 574 ? -0.536  137.794 51.140  1.00 47.49  ? 1328 ASN A CB    1 
ATOM   3980  C  CG    . ASN A 1 574 ? 0.980   137.905 51.004  1.00 57.11  ? 1328 ASN A CG    1 
ATOM   3981  O  OD1   . ASN A 1 574 ? 1.676   138.374 51.917  1.00 58.29  ? 1328 ASN A OD1   1 
ATOM   3982  N  ND2   . ASN A 1 574 ? 1.503   137.449 49.852  1.00 58.44  ? 1328 ASN A ND2   1 
ATOM   3983  N  N     . MET A 1 575 ? -1.160  141.365 52.110  1.00 48.34  ? 1329 MET A N     1 
ATOM   3984  C  CA    . MET A 1 575 ? -1.072  142.742 51.629  1.00 49.66  ? 1329 MET A CA    1 
ATOM   3985  C  C     . MET A 1 575 ? 0.357   143.247 51.534  1.00 58.68  ? 1329 MET A C     1 
ATOM   3986  O  O     . MET A 1 575 ? 0.919   143.735 52.517  1.00 67.96  ? 1329 MET A O     1 
ATOM   3987  C  CB    . MET A 1 575 ? -1.904  143.685 52.514  1.00 46.19  ? 1329 MET A CB    1 
ATOM   3988  C  CG    . MET A 1 575 ? -3.303  143.148 52.820  1.00 53.97  ? 1329 MET A CG    1 
ATOM   3989  S  SD    . MET A 1 575 ? -4.607  144.358 53.175  1.00 69.07  ? 1329 MET A SD    1 
ATOM   3990  C  CE    . MET A 1 575 ? -4.130  144.876 54.854  1.00 42.31  ? 1329 MET A CE    1 
ATOM   3991  N  N     . VAL A 1 576 ? 0.936   143.135 50.342  1.00 54.27  ? 1330 VAL A N     1 
ATOM   3992  C  CA    . VAL A 1 576 ? 2.253   143.709 50.063  1.00 53.47  ? 1330 VAL A CA    1 
ATOM   3993  C  C     . VAL A 1 576 ? 2.158   144.837 49.045  1.00 48.45  ? 1330 VAL A C     1 
ATOM   3994  O  O     . VAL A 1 576 ? 1.546   144.667 48.014  1.00 57.74  ? 1330 VAL A O     1 
ATOM   3995  C  CB    . VAL A 1 576 ? 3.219   142.656 49.535  1.00 46.35  ? 1330 VAL A CB    1 
ATOM   3996  C  CG1   . VAL A 1 576 ? 4.567   143.276 49.248  1.00 48.70  ? 1330 VAL A CG1   1 
ATOM   3997  C  CG2   . VAL A 1 576 ? 3.376   141.594 50.547  1.00 40.98  ? 1330 VAL A CG2   1 
ATOM   3998  N  N     . ALA A 1 577 ? 2.749   145.987 49.347  1.00 39.12  ? 1331 ALA A N     1 
ATOM   3999  C  CA    . ALA A 1 577 ? 2.747   147.113 48.416  1.00 40.85  ? 1331 ALA A CA    1 
ATOM   4000  C  C     . ALA A 1 577 ? 4.160   147.685 48.311  1.00 48.75  ? 1331 ALA A C     1 
ATOM   4001  O  O     . ALA A 1 577 ? 5.082   147.222 49.024  1.00 45.09  ? 1331 ALA A O     1 
ATOM   4002  C  CB    . ALA A 1 577 ? 1.789   148.182 48.887  1.00 37.70  ? 1331 ALA A CB    1 
ATOM   4003  N  N     . ILE A 1 578 ? 4.338   148.682 47.435  1.00 47.01  ? 1332 ILE A N     1 
ATOM   4004  C  CA    . ILE A 1 578 ? 5.631   149.373 47.346  1.00 45.26  ? 1332 ILE A CA    1 
ATOM   4005  C  C     . ILE A 1 578 ? 5.615   150.715 48.071  1.00 50.27  ? 1332 ILE A C     1 
ATOM   4006  O  O     . ILE A 1 578 ? 4.853   151.614 47.726  1.00 52.77  ? 1332 ILE A O     1 
ATOM   4007  C  CB    . ILE A 1 578 ? 6.135   149.617 45.902  1.00 42.08  ? 1332 ILE A CB    1 
ATOM   4008  C  CG1   . ILE A 1 578 ? 6.288   148.312 45.120  1.00 41.20  ? 1332 ILE A CG1   1 
ATOM   4009  C  CG2   . ILE A 1 578 ? 7.486   150.302 45.978  1.00 47.02  ? 1332 ILE A CG2   1 
ATOM   4010  C  CD1   . ILE A 1 578 ? 7.407   147.411 45.637  1.00 44.61  ? 1332 ILE A CD1   1 
ATOM   4011  N  N     . ASP A 1 579 ? 6.473   150.836 49.075  1.00 58.86  ? 1333 ASP A N     1 
ATOM   4012  C  CA    . ASP A 1 579 ? 6.622   152.067 49.836  1.00 63.99  ? 1333 ASP A CA    1 
ATOM   4013  C  C     . ASP A 1 579 ? 8.100   152.435 49.742  1.00 64.84  ? 1333 ASP A C     1 
ATOM   4014  O  O     . ASP A 1 579 ? 8.975   151.594 49.994  1.00 65.64  ? 1333 ASP A O     1 
ATOM   4015  C  CB    . ASP A 1 579 ? 6.185   151.855 51.298  1.00 68.92  ? 1333 ASP A CB    1 
ATOM   4016  C  CG    . ASP A 1 579 ? 6.208   153.133 52.116  1.00 87.68  ? 1333 ASP A CG    1 
ATOM   4017  O  OD1   . ASP A 1 579 ? 6.747   154.143 51.620  1.00 104.47 ? 1333 ASP A OD1   1 
ATOM   4018  O  OD2   . ASP A 1 579 ? 5.691   153.133 53.256  1.00 85.87  ? 1333 ASP A OD2   1 
ATOM   4019  N  N     . ASN A 1 580 ? 8.384   153.673 49.347  1.00 58.36  ? 1334 ASN A N     1 
ATOM   4020  C  CA    . ASN A 1 580 ? 9.766   154.111 49.218  1.00 56.49  ? 1334 ASN A CA    1 
ATOM   4021  C  C     . ASN A 1 580 ? 10.640  153.172 48.341  1.00 59.00  ? 1334 ASN A C     1 
ATOM   4022  O  O     . ASN A 1 580 ? 11.771  152.835 48.688  1.00 65.61  ? 1334 ASN A O     1 
ATOM   4023  C  CB    . ASN A 1 580 ? 10.359  154.307 50.617  1.00 61.42  ? 1334 ASN A CB    1 
ATOM   4024  C  CG    . ASN A 1 580 ? 11.653  155.086 50.602  1.00 70.68  ? 1334 ASN A CG    1 
ATOM   4025  O  OD1   . ASN A 1 580 ? 11.786  156.084 49.892  1.00 72.76  ? 1334 ASN A OD1   1 
ATOM   4026  N  ND2   . ASN A 1 580 ? 12.625  154.624 51.383  1.00 73.07  ? 1334 ASN A ND2   1 
ATOM   4027  N  N     . PHE A 1 581 ? 10.099  152.747 47.204  1.00 61.93  ? 1335 PHE A N     1 
ATOM   4028  C  CA    . PHE A 1 581 ? 10.860  151.951 46.234  1.00 60.41  ? 1335 PHE A CA    1 
ATOM   4029  C  C     . PHE A 1 581 ? 11.071  150.501 46.622  1.00 55.08  ? 1335 PHE A C     1 
ATOM   4030  O  O     . PHE A 1 581 ? 11.685  149.739 45.881  1.00 58.45  ? 1335 PHE A O     1 
ATOM   4031  C  CB    . PHE A 1 581 ? 12.203  152.623 45.925  1.00 61.65  ? 1335 PHE A CB    1 
ATOM   4032  C  CG    . PHE A 1 581 ? 12.044  153.995 45.368  1.00 70.64  ? 1335 PHE A CG    1 
ATOM   4033  C  CD1   . PHE A 1 581 ? 11.596  154.173 44.062  1.00 70.70  ? 1335 PHE A CD1   1 
ATOM   4034  C  CD2   . PHE A 1 581 ? 12.275  155.110 46.163  1.00 70.62  ? 1335 PHE A CD2   1 
ATOM   4035  C  CE1   . PHE A 1 581 ? 11.409  155.438 43.549  1.00 74.53  ? 1335 PHE A CE1   1 
ATOM   4036  C  CE2   . PHE A 1 581 ? 12.097  156.377 45.662  1.00 72.36  ? 1335 PHE A CE2   1 
ATOM   4037  C  CZ    . PHE A 1 581 ? 11.661  156.546 44.353  1.00 77.47  ? 1335 PHE A CZ    1 
ATOM   4038  N  N     . THR A 1 582 ? 10.554  150.100 47.770  1.00 58.05  ? 1336 THR A N     1 
ATOM   4039  C  CA    . THR A 1 582 ? 10.815  148.748 48.235  1.00 66.06  ? 1336 THR A CA    1 
ATOM   4040  C  C     . THR A 1 582 ? 9.535   147.999 48.666  1.00 55.67  ? 1336 THR A C     1 
ATOM   4041  O  O     . THR A 1 582 ? 8.546   148.623 49.054  1.00 55.97  ? 1336 THR A O     1 
ATOM   4042  C  CB    . THR A 1 582 ? 11.894  148.778 49.359  1.00 66.57  ? 1336 THR A CB    1 
ATOM   4043  O  OG1   . THR A 1 582 ? 11.281  148.586 50.634  1.00 71.26  ? 1336 THR A OG1   1 
ATOM   4044  C  CG2   . THR A 1 582 ? 12.623  150.121 49.361  1.00 59.69  ? 1336 THR A CG2   1 
ATOM   4045  N  N     . PRO A 1 583 ? 9.555   146.656 48.606  1.00 43.97  ? 1337 PRO A N     1 
ATOM   4046  C  CA    . PRO A 1 583 ? 8.388   145.879 49.044  1.00 48.63  ? 1337 PRO A CA    1 
ATOM   4047  C  C     . PRO A 1 583 ? 8.174   145.907 50.587  1.00 65.92  ? 1337 PRO A C     1 
ATOM   4048  O  O     . PRO A 1 583 ? 9.141   145.797 51.350  1.00 62.32  ? 1337 PRO A O     1 
ATOM   4049  C  CB    . PRO A 1 583 ? 8.711   144.469 48.546  1.00 50.60  ? 1337 PRO A CB    1 
ATOM   4050  C  CG    . PRO A 1 583 ? 10.214  144.397 48.525  1.00 52.54  ? 1337 PRO A CG    1 
ATOM   4051  C  CD    . PRO A 1 583 ? 10.734  145.805 48.345  1.00 47.17  ? 1337 PRO A CD    1 
ATOM   4052  N  N     . ARG A 1 584 ? 6.924   146.076 51.028  1.00 59.94  ? 1338 ARG A N     1 
ATOM   4053  C  CA    . ARG A 1 584 ? 6.576   146.187 52.454  1.00 54.14  ? 1338 ARG A CA    1 
ATOM   4054  C  C     . ARG A 1 584 ? 5.294   145.409 52.743  1.00 57.11  ? 1338 ARG A C     1 
ATOM   4055  O  O     . ARG A 1 584 ? 4.244   145.663 52.141  1.00 53.94  ? 1338 ARG A O     1 
ATOM   4056  C  CB    . ARG A 1 584 ? 6.326   147.648 52.836  1.00 52.90  ? 1338 ARG A CB    1 
ATOM   4057  C  CG    . ARG A 1 584 ? 7.175   148.234 53.941  1.00 58.56  ? 1338 ARG A CG    1 
ATOM   4058  C  CD    . ARG A 1 584 ? 6.314   148.726 55.146  1.00 82.92  ? 1338 ARG A CD    1 
ATOM   4059  N  NE    . ARG A 1 584 ? 5.870   150.128 55.068  1.00 80.43  ? 1338 ARG A NE    1 
ATOM   4060  C  CZ    . ARG A 1 584 ? 5.459   150.858 56.118  1.00 83.53  ? 1338 ARG A CZ    1 
ATOM   4061  N  NH1   . ARG A 1 584 ? 5.431   150.348 57.355  1.00 63.90  ? 1338 ARG A NH1   1 
ATOM   4062  N  NH2   . ARG A 1 584 ? 5.074   152.117 55.937  1.00 93.09  ? 1338 ARG A NH2   1 
ATOM   4063  N  N     . GLN A 1 585 ? 5.359   144.456 53.660  1.00 60.46  ? 1339 GLN A N     1 
ATOM   4064  C  CA    . GLN A 1 585 ? 4.129   143.846 54.113  1.00 54.73  ? 1339 GLN A CA    1 
ATOM   4065  C  C     . GLN A 1 585 ? 3.515   144.850 55.056  1.00 51.69  ? 1339 GLN A C     1 
ATOM   4066  O  O     . GLN A 1 585 ? 4.213   145.383 55.906  1.00 63.28  ? 1339 GLN A O     1 
ATOM   4067  C  CB    . GLN A 1 585 ? 4.404   142.552 54.827  1.00 55.05  ? 1339 GLN A CB    1 
ATOM   4068  C  CG    . GLN A 1 585 ? 3.155   141.873 55.282  1.00 58.46  ? 1339 GLN A CG    1 
ATOM   4069  C  CD    . GLN A 1 585 ? 3.386   140.414 55.485  1.00 71.39  ? 1339 GLN A CD    1 
ATOM   4070  O  OE1   . GLN A 1 585 ? 3.951   139.737 54.611  1.00 81.62  ? 1339 GLN A OE1   1 
ATOM   4071  N  NE2   . GLN A 1 585 ? 2.964   139.906 56.641  1.00 65.68  ? 1339 GLN A NE2   1 
ATOM   4072  N  N     . VAL A 1 586 ? 2.229   145.139 54.873  1.00 45.86  ? 1340 VAL A N     1 
ATOM   4073  C  CA    . VAL A 1 586 ? 1.572   146.240 55.573  1.00 55.14  ? 1340 VAL A CA    1 
ATOM   4074  C  C     . VAL A 1 586 ? 0.104   145.960 55.811  1.00 57.48  ? 1340 VAL A C     1 
ATOM   4075  O  O     . VAL A 1 586 ? -0.565  145.304 54.999  1.00 65.84  ? 1340 VAL A O     1 
ATOM   4076  C  CB    . VAL A 1 586 ? 1.624   147.567 54.773  1.00 59.60  ? 1340 VAL A CB    1 
ATOM   4077  C  CG1   . VAL A 1 586 ? 3.063   148.065 54.610  1.00 52.40  ? 1340 VAL A CG1   1 
ATOM   4078  C  CG2   . VAL A 1 586 ? 0.891   147.413 53.412  1.00 35.26  ? 1340 VAL A CG2   1 
ATOM   4079  N  N     . GLY A 1 587 ? -0.396  146.500 56.918  1.00 51.46  ? 1341 GLY A N     1 
ATOM   4080  C  CA    . GLY A 1 587 ? -1.809  146.436 57.228  1.00 57.06  ? 1341 GLY A CA    1 
ATOM   4081  C  C     . GLY A 1 587 ? -2.525  147.763 57.059  1.00 62.14  ? 1341 GLY A C     1 
ATOM   4082  O  O     . GLY A 1 587 ? -1.976  148.721 56.526  1.00 63.04  ? 1341 GLY A O     1 
ATOM   4083  N  N     . ILE A 1 588 ? -3.759  147.814 57.541  1.00 65.23  ? 1342 ILE A N     1 
ATOM   4084  C  CA    . ILE A 1 588 ? -4.642  148.954 57.336  1.00 53.80  ? 1342 ILE A CA    1 
ATOM   4085  C  C     . ILE A 1 588 ? -4.004  150.294 57.723  1.00 56.42  ? 1342 ILE A C     1 
ATOM   4086  O  O     . ILE A 1 588 ? -4.306  151.307 57.112  1.00 62.71  ? 1342 ILE A O     1 
ATOM   4087  C  CB    . ILE A 1 588 ? -6.038  148.719 58.030  1.00 47.70  ? 1342 ILE A CB    1 
ATOM   4088  C  CG1   . ILE A 1 588 ? -7.138  148.804 56.999  1.00 57.13  ? 1342 ILE A CG1   1 
ATOM   4089  C  CG2   . ILE A 1 588 ? -6.327  149.719 59.104  1.00 51.15  ? 1342 ILE A CG2   1 
ATOM   4090  C  CD1   . ILE A 1 588 ? -6.651  148.366 55.668  1.00 63.77  ? 1342 ILE A CD1   1 
ATOM   4091  N  N     . VAL A 1 589 ? -3.102  150.306 58.705  1.00 64.06  ? 1343 VAL A N     1 
ATOM   4092  C  CA    . VAL A 1 589 ? -2.603  151.583 59.230  1.00 57.88  ? 1343 VAL A CA    1 
ATOM   4093  C  C     . VAL A 1 589 ? -1.518  152.274 58.397  1.00 51.83  ? 1343 VAL A C     1 
ATOM   4094  O  O     . VAL A 1 589 ? -1.685  153.438 58.049  1.00 51.67  ? 1343 VAL A O     1 
ATOM   4095  C  CB    . VAL A 1 589 ? -2.183  151.495 60.713  1.00 52.85  ? 1343 VAL A CB    1 
ATOM   4096  C  CG1   . VAL A 1 589 ? -1.116  152.530 61.020  1.00 46.48  ? 1343 VAL A CG1   1 
ATOM   4097  C  CG2   . VAL A 1 589 ? -3.395  151.687 61.604  1.00 39.73  ? 1343 VAL A CG2   1 
ATOM   4098  N  N     . PRO A 1 590 ? -0.396  151.582 58.100  1.00 48.72  ? 1344 PRO A N     1 
ATOM   4099  C  CA    . PRO A 1 590 ? 0.566   152.148 57.146  1.00 55.94  ? 1344 PRO A CA    1 
ATOM   4100  C  C     . PRO A 1 590 ? -0.026  152.464 55.775  1.00 60.16  ? 1344 PRO A C     1 
ATOM   4101  O  O     . PRO A 1 590 ? 0.442   153.404 55.154  1.00 63.92  ? 1344 PRO A O     1 
ATOM   4102  C  CB    . PRO A 1 590 ? 1.663   151.059 57.031  1.00 52.87  ? 1344 PRO A CB    1 
ATOM   4103  C  CG    . PRO A 1 590 ? 1.126   149.885 57.641  1.00 44.77  ? 1344 PRO A CG    1 
ATOM   4104  C  CD    . PRO A 1 590 ? 0.144   150.363 58.699  1.00 42.80  ? 1344 PRO A CD    1 
ATOM   4105  N  N     . ILE A 1 591 ? -1.012  151.696 55.315  1.00 61.38  ? 1345 ILE A N     1 
ATOM   4106  C  CA    . ILE A 1 591 ? -1.707  152.005 54.069  1.00 58.26  ? 1345 ILE A CA    1 
ATOM   4107  C  C     . ILE A 1 591 ? -2.429  153.363 54.150  1.00 56.54  ? 1345 ILE A C     1 
ATOM   4108  O  O     . ILE A 1 591 ? -2.155  154.274 53.373  1.00 60.11  ? 1345 ILE A O     1 
ATOM   4109  C  CB    . ILE A 1 591 ? -2.695  150.897 53.714  1.00 53.20  ? 1345 ILE A CB    1 
ATOM   4110  C  CG1   . ILE A 1 591 ? -1.949  149.696 53.130  1.00 58.95  ? 1345 ILE A CG1   1 
ATOM   4111  C  CG2   . ILE A 1 591 ? -3.724  151.395 52.728  1.00 50.64  ? 1345 ILE A CG2   1 
ATOM   4112  C  CD1   . ILE A 1 591 ? -2.805  148.442 52.967  1.00 48.84  ? 1345 ILE A CD1   1 
ATOM   4113  N  N     . LEU A 1 592 ? -3.339  153.503 55.102  1.00 49.52  ? 1346 LEU A N     1 
ATOM   4114  C  CA    . LEU A 1 592 ? -4.012  154.775 55.323  1.00 51.65  ? 1346 LEU A CA    1 
ATOM   4115  C  C     . LEU A 1 592 ? -3.055  155.918 55.642  1.00 57.27  ? 1346 LEU A C     1 
ATOM   4116  O  O     . LEU A 1 592 ? -3.274  157.059 55.250  1.00 61.03  ? 1346 LEU A O     1 
ATOM   4117  C  CB    . LEU A 1 592 ? -5.053  154.641 56.435  1.00 38.27  ? 1346 LEU A CB    1 
ATOM   4118  C  CG    . LEU A 1 592 ? -6.269  153.821 55.994  1.00 50.60  ? 1346 LEU A CG    1 
ATOM   4119  C  CD1   . LEU A 1 592 ? -7.276  153.767 57.091  1.00 50.14  ? 1346 LEU A CD1   1 
ATOM   4120  C  CD2   . LEU A 1 592 ? -6.907  154.366 54.699  1.00 39.94  ? 1346 LEU A CD2   1 
ATOM   4121  N  N     . SER A 1 593 ? -1.996  155.634 56.378  1.00 64.54  ? 1347 SER A N     1 
ATOM   4122  C  CA    . SER A 1 593 ? -1.081  156.706 56.726  1.00 59.67  ? 1347 SER A CA    1 
ATOM   4123  C  C     . SER A 1 593 ? -0.417  157.235 55.436  1.00 58.52  ? 1347 SER A C     1 
ATOM   4124  O  O     . SER A 1 593 ? -0.431  158.444 55.158  1.00 59.71  ? 1347 SER A O     1 
ATOM   4125  C  CB    . SER A 1 593 ? -0.065  156.238 57.769  1.00 49.52  ? 1347 SER A CB    1 
ATOM   4126  O  OG    . SER A 1 593 ? 0.927   155.418 57.184  1.00 72.84  ? 1347 SER A OG    1 
ATOM   4127  N  N     . SER A 1 594 ? 0.121   156.307 54.644  1.00 45.97  ? 1348 SER A N     1 
ATOM   4128  C  CA    . SER A 1 594 ? 0.795   156.608 53.388  1.00 48.22  ? 1348 SER A CA    1 
ATOM   4129  C  C     . SER A 1 594 ? -0.103  157.392 52.418  1.00 55.79  ? 1348 SER A C     1 
ATOM   4130  O  O     . SER A 1 594 ? 0.362   158.317 51.739  1.00 62.08  ? 1348 SER A O     1 
ATOM   4131  C  CB    . SER A 1 594 ? 1.280   155.312 52.740  1.00 50.77  ? 1348 SER A CB    1 
ATOM   4132  O  OG    . SER A 1 594 ? 2.317   154.703 53.509  1.00 65.81  ? 1348 SER A OG    1 
ATOM   4133  N  N     . TYR A 1 595 ? -1.385  157.028 52.369  1.00 48.85  ? 1349 TYR A N     1 
ATOM   4134  C  CA    . TYR A 1 595 ? -2.334  157.712 51.518  1.00 43.79  ? 1349 TYR A CA    1 
ATOM   4135  C  C     . TYR A 1 595 ? -2.506  159.135 52.006  1.00 47.37  ? 1349 TYR A C     1 
ATOM   4136  O  O     . TYR A 1 595 ? -2.389  160.088 51.228  1.00 53.18  ? 1349 TYR A O     1 
ATOM   4137  C  CB    . TYR A 1 595 ? -3.688  156.978 51.445  1.00 48.30  ? 1349 TYR A CB    1 
ATOM   4138  C  CG    . TYR A 1 595 ? -4.740  157.755 50.668  1.00 50.93  ? 1349 TYR A CG    1 
ATOM   4139  C  CD1   . TYR A 1 595 ? -4.715  157.792 49.287  1.00 45.88  ? 1349 TYR A CD1   1 
ATOM   4140  C  CD2   . TYR A 1 595 ? -5.735  158.480 51.324  1.00 51.90  ? 1349 TYR A CD2   1 
ATOM   4141  C  CE1   . TYR A 1 595 ? -5.651  158.524 48.567  1.00 53.89  ? 1349 TYR A CE1   1 
ATOM   4142  C  CE2   . TYR A 1 595 ? -6.685  159.196 50.616  1.00 52.17  ? 1349 TYR A CE2   1 
ATOM   4143  C  CZ    . TYR A 1 595 ? -6.628  159.222 49.231  1.00 55.73  ? 1349 TYR A CZ    1 
ATOM   4144  O  OH    . TYR A 1 595 ? -7.545  159.940 48.498  1.00 59.15  ? 1349 TYR A OH    1 
ATOM   4145  N  N     . ILE A 1 596 ? -2.788  159.285 53.290  1.00 48.18  ? 1350 ILE A N     1 
ATOM   4146  C  CA    . ILE A 1 596 ? -2.887  160.622 53.853  1.00 45.45  ? 1350 ILE A CA    1 
ATOM   4147  C  C     . ILE A 1 596 ? -1.618  161.454 53.597  1.00 45.25  ? 1350 ILE A C     1 
ATOM   4148  O  O     . ILE A 1 596 ? -1.719  162.615 53.206  1.00 41.42  ? 1350 ILE A O     1 
ATOM   4149  C  CB    . ILE A 1 596 ? -3.241  160.599 55.336  1.00 37.73  ? 1350 ILE A CB    1 
ATOM   4150  C  CG1   . ILE A 1 596 ? -4.717  160.208 55.476  1.00 36.62  ? 1350 ILE A CG1   1 
ATOM   4151  C  CG2   . ILE A 1 596 ? -2.978  161.975 55.952  1.00 34.92  ? 1350 ILE A CG2   1 
ATOM   4152  C  CD1   . ILE A 1 596 ? -5.169  159.730 56.873  1.00 42.44  ? 1350 ILE A CD1   1 
ATOM   4153  N  N     . ALA A 1 597 ? -0.439  160.853 53.775  1.00 48.91  ? 1351 ALA A N     1 
ATOM   4154  C  CA    . ALA A 1 597 ? 0.829   161.556 53.562  1.00 36.75  ? 1351 ALA A CA    1 
ATOM   4155  C  C     . ALA A 1 597 ? 0.911   162.084 52.138  1.00 45.04  ? 1351 ALA A C     1 
ATOM   4156  O  O     . ALA A 1 597 ? 1.209   163.267 51.916  1.00 49.15  ? 1351 ALA A O     1 
ATOM   4157  C  CB    . ALA A 1 597 ? 1.987   160.661 53.855  1.00 38.37  ? 1351 ALA A CB    1 
ATOM   4158  N  N     . HIS A 1 598 ? 0.666   161.173 51.191  1.00 41.50  ? 1352 HIS A N     1 
ATOM   4159  C  CA    . HIS A 1 598 ? 0.547   161.456 49.770  1.00 41.81  ? 1352 HIS A CA    1 
ATOM   4160  C  C     . HIS A 1 598 ? -0.430  162.588 49.458  1.00 48.14  ? 1352 HIS A C     1 
ATOM   4161  O  O     . HIS A 1 598 ? -0.087  163.523 48.715  1.00 53.96  ? 1352 HIS A O     1 
ATOM   4162  C  CB    . HIS A 1 598 ? 0.077   160.194 49.051  1.00 43.91  ? 1352 HIS A CB    1 
ATOM   4163  C  CG    . HIS A 1 598 ? 0.002   160.338 47.565  1.00 50.77  ? 1352 HIS A CG    1 
ATOM   4164  N  ND1   . HIS A 1 598 ? 1.105   160.632 46.788  1.00 54.53  ? 1352 HIS A ND1   1 
ATOM   4165  C  CD2   . HIS A 1 598 ? -1.048  160.235 46.711  1.00 53.44  ? 1352 HIS A CD2   1 
ATOM   4166  C  CE1   . HIS A 1 598 ? 0.732   160.706 45.520  1.00 59.39  ? 1352 HIS A CE1   1 
ATOM   4167  N  NE2   . HIS A 1 598 ? -0.570  160.475 45.448  1.00 55.65  ? 1352 HIS A NE2   1 
ATOM   4168  N  N     . ARG A 1 599 ? -1.646  162.510 50.005  1.00 43.51  ? 1353 ARG A N     1 
ATOM   4169  C  CA    . ARG A 1 599 ? -2.615  163.568 49.741  1.00 45.58  ? 1353 ARG A CA    1 
ATOM   4170  C  C     . ARG A 1 599 ? -2.079  164.896 50.194  1.00 53.17  ? 1353 ARG A C     1 
ATOM   4171  O  O     . ARG A 1 599 ? -2.280  165.903 49.510  1.00 62.64  ? 1353 ARG A O     1 
ATOM   4172  C  CB    . ARG A 1 599 ? -3.979  163.306 50.363  1.00 51.13  ? 1353 ARG A CB    1 
ATOM   4173  C  CG    . ARG A 1 599 ? -4.735  162.168 49.698  1.00 58.28  ? 1353 ARG A CG    1 
ATOM   4174  C  CD    . ARG A 1 599 ? -5.060  162.478 48.260  1.00 54.76  ? 1353 ARG A CD    1 
ATOM   4175  N  NE    . ARG A 1 599 ? -5.865  163.688 48.132  1.00 57.82  ? 1353 ARG A NE    1 
ATOM   4176  C  CZ    . ARG A 1 599 ? -6.085  164.303 46.969  1.00 63.13  ? 1353 ARG A CZ    1 
ATOM   4177  N  NH1   . ARG A 1 599 ? -5.547  163.819 45.850  1.00 57.29  ? 1353 ARG A NH1   1 
ATOM   4178  N  NH2   . ARG A 1 599 ? -6.827  165.405 46.920  1.00 67.19  ? 1353 ARG A NH2   1 
ATOM   4179  N  N     . ARG A 1 600 ? -1.396  164.894 51.336  1.00 57.45  ? 1354 ARG A N     1 
ATOM   4180  C  CA    . ARG A 1 600 ? -0.803  166.116 51.873  1.00 53.83  ? 1354 ARG A CA    1 
ATOM   4181  C  C     . ARG A 1 600 ? 0.156   166.656 50.838  1.00 45.83  ? 1354 ARG A C     1 
ATOM   4182  O  O     . ARG A 1 600 ? 0.130   167.840 50.523  1.00 49.00  ? 1354 ARG A O     1 
ATOM   4183  C  CB    . ARG A 1 600 ? -0.043  165.858 53.178  1.00 50.89  ? 1354 ARG A CB    1 
ATOM   4184  C  CG    . ARG A 1 600 ? 0.606   167.111 53.777  1.00 48.36  ? 1354 ARG A CG    1 
ATOM   4185  C  CD    . ARG A 1 600 ? 1.483   166.794 54.986  1.00 52.57  ? 1354 ARG A CD    1 
ATOM   4186  N  NE    . ARG A 1 600 ? 2.254   167.963 55.413  1.00 65.44  ? 1354 ARG A NE    1 
ATOM   4187  C  CZ    . ARG A 1 600 ? 3.483   168.269 54.987  1.00 77.95  ? 1354 ARG A CZ    1 
ATOM   4188  N  NH1   . ARG A 1 600 ? 4.122   167.481 54.123  1.00 83.90  ? 1354 ARG A NH1   1 
ATOM   4189  N  NH2   . ARG A 1 600 ? 4.076   169.373 55.427  1.00 77.19  ? 1354 ARG A NH2   1 
ATOM   4190  N  N     . GLU A 1 601 ? 0.985   165.772 50.295  1.00 42.62  ? 1355 GLU A N     1 
ATOM   4191  C  CA    . GLU A 1 601 ? 2.001   166.181 49.330  1.00 50.19  ? 1355 GLU A CA    1 
ATOM   4192  C  C     . GLU A 1 601 ? 1.370   166.809 48.109  1.00 53.85  ? 1355 GLU A C     1 
ATOM   4193  O  O     . GLU A 1 601 ? 1.756   167.904 47.695  1.00 57.56  ? 1355 GLU A O     1 
ATOM   4194  C  CB    . GLU A 1 601 ? 2.887   165.011 48.907  1.00 43.56  ? 1355 GLU A CB    1 
ATOM   4195  C  CG    . GLU A 1 601 ? 4.181   164.896 49.680  1.00 56.12  ? 1355 GLU A CG    1 
ATOM   4196  C  CD    . GLU A 1 601 ? 4.934   166.204 49.732  1.00 80.26  ? 1355 GLU A CD    1 
ATOM   4197  O  OE1   . GLU A 1 601 ? 5.744   166.377 50.674  1.00 81.96  ? 1355 GLU A OE1   1 
ATOM   4198  O  OE2   . GLU A 1 601 ? 4.706   167.057 48.832  1.00 93.02  ? 1355 GLU A OE2   1 
ATOM   4199  N  N     . VAL A 1 602 ? 0.389   166.110 47.556  1.00 42.19  ? 1356 VAL A N     1 
ATOM   4200  C  CA    . VAL A 1 602 ? -0.328  166.582 46.380  1.00 40.93  ? 1356 VAL A CA    1 
ATOM   4201  C  C     . VAL A 1 602 ? -1.019  167.915 46.602  1.00 43.98  ? 1356 VAL A C     1 
ATOM   4202  O  O     . VAL A 1 602 ? -0.925  168.814 45.780  1.00 51.19  ? 1356 VAL A O     1 
ATOM   4203  C  CB    . VAL A 1 602 ? -1.386  165.569 45.977  1.00 40.98  ? 1356 VAL A CB    1 
ATOM   4204  C  CG1   . VAL A 1 602 ? -2.243  166.094 44.846  1.00 34.23  ? 1356 VAL A CG1   1 
ATOM   4205  C  CG2   . VAL A 1 602 ? -0.716  164.283 45.612  1.00 39.85  ? 1356 VAL A CG2   1 
ATOM   4206  N  N     . ILE A 1 603 ? -1.739  168.038 47.705  1.00 48.92  ? 1357 ILE A N     1 
ATOM   4207  C  CA    . ILE A 1 603 ? -2.500  169.257 47.954  1.00 50.63  ? 1357 ILE A CA    1 
ATOM   4208  C  C     . ILE A 1 603 ? -1.574  170.470 48.082  1.00 56.82  ? 1357 ILE A C     1 
ATOM   4209  O  O     . ILE A 1 603 ? -1.841  171.556 47.538  1.00 58.83  ? 1357 ILE A O     1 
ATOM   4210  C  CB    . ILE A 1 603 ? -3.351  169.105 49.206  1.00 40.64  ? 1357 ILE A CB    1 
ATOM   4211  C  CG1   . ILE A 1 603 ? -4.643  168.352 48.880  1.00 41.25  ? 1357 ILE A CG1   1 
ATOM   4212  C  CG2   . ILE A 1 603 ? -3.657  170.440 49.811  1.00 37.22  ? 1357 ILE A CG2   1 
ATOM   4213  C  CD1   . ILE A 1 603 ? -5.388  167.902 50.141  1.00 50.18  ? 1357 ILE A CD1   1 
ATOM   4214  N  N     . LEU A 1 604 ? -0.478  170.277 48.804  1.00 50.23  ? 1358 LEU A N     1 
ATOM   4215  C  CA    . LEU A 1 604 ? 0.532   171.308 48.919  1.00 43.90  ? 1358 LEU A CA    1 
ATOM   4216  C  C     . LEU A 1 604 ? 1.101   171.697 47.541  1.00 50.43  ? 1358 LEU A C     1 
ATOM   4217  O  O     . LEU A 1 604 ? 1.154   172.874 47.188  1.00 45.92  ? 1358 LEU A O     1 
ATOM   4218  C  CB    . LEU A 1 604 ? 1.637   170.825 49.842  1.00 40.74  ? 1358 LEU A CB    1 
ATOM   4219  C  CG    . LEU A 1 604 ? 1.316   170.976 51.328  1.00 43.00  ? 1358 LEU A CG    1 
ATOM   4220  C  CD1   . LEU A 1 604 ? 2.386   170.294 52.171  1.00 42.45  ? 1358 LEU A CD1   1 
ATOM   4221  C  CD2   . LEU A 1 604 ? 1.170   172.439 51.723  1.00 48.65  ? 1358 LEU A CD2   1 
ATOM   4222  N  N     . ALA A 1 605 ? 1.522   170.700 46.765  1.00 51.59  ? 1359 ALA A N     1 
ATOM   4223  C  CA    . ALA A 1 605 ? 2.060   170.925 45.422  1.00 52.03  ? 1359 ALA A CA    1 
ATOM   4224  C  C     . ALA A 1 605 ? 1.063   171.694 44.554  1.00 49.83  ? 1359 ALA A C     1 
ATOM   4225  O  O     . ALA A 1 605 ? 1.384   172.727 43.949  1.00 49.46  ? 1359 ALA A O     1 
ATOM   4226  C  CB    . ALA A 1 605 ? 2.400   169.595 44.769  1.00 42.30  ? 1359 ALA A CB    1 
ATOM   4227  N  N     . ARG A 1 606 ? -0.150  171.158 44.497  1.00 41.83  ? 1360 ARG A N     1 
ATOM   4228  C  CA    . ARG A 1 606 ? -1.234  171.777 43.785  1.00 44.92  ? 1360 ARG A CA    1 
ATOM   4229  C  C     . ARG A 1 606 ? -1.348  173.241 44.193  1.00 46.52  ? 1360 ARG A C     1 
ATOM   4230  O  O     . ARG A 1 606 ? -1.401  174.144 43.336  1.00 41.66  ? 1360 ARG A O     1 
ATOM   4231  C  CB    . ARG A 1 606 ? -2.536  171.048 44.096  1.00 52.02  ? 1360 ARG A CB    1 
ATOM   4232  C  CG    . ARG A 1 606 ? -3.660  171.440 43.166  1.00 51.00  ? 1360 ARG A CG    1 
ATOM   4233  C  CD    . ARG A 1 606 ? -4.883  171.779 43.948  1.00 57.39  ? 1360 ARG A CD    1 
ATOM   4234  N  NE    . ARG A 1 606 ? -5.566  170.592 44.450  1.00 56.73  ? 1360 ARG A NE    1 
ATOM   4235  C  CZ    . ARG A 1 606 ? -6.254  170.589 45.588  1.00 52.62  ? 1360 ARG A CZ    1 
ATOM   4236  N  NH1   . ARG A 1 606 ? -6.305  171.694 46.313  1.00 50.05  ? 1360 ARG A NH1   1 
ATOM   4237  N  NH2   . ARG A 1 606 ? -6.879  169.499 46.010  1.00 59.87  ? 1360 ARG A NH2   1 
ATOM   4238  N  N     . SER A 1 607 ? -1.369  173.470 45.508  1.00 48.02  ? 1361 SER A N     1 
ATOM   4239  C  CA    . SER A 1 607 ? -1.599  174.802 46.037  1.00 44.63  ? 1361 SER A CA    1 
ATOM   4240  C  C     . SER A 1 607 ? -0.463  175.765 45.682  1.00 46.23  ? 1361 SER A C     1 
ATOM   4241  O  O     . SER A 1 607 ? -0.707  176.957 45.461  1.00 56.93  ? 1361 SER A O     1 
ATOM   4242  C  CB    . SER A 1 607 ? -1.885  174.746 47.542  1.00 46.87  ? 1361 SER A CB    1 
ATOM   4243  O  OG    . SER A 1 607 ? -3.183  174.218 47.799  1.00 44.52  ? 1361 SER A OG    1 
ATOM   4244  N  N     . ARG A 1 608 ? 0.765   175.249 45.600  1.00 44.40  ? 1362 ARG A N     1 
ATOM   4245  C  CA    . ARG A 1 608 ? 1.913   176.057 45.173  1.00 43.29  ? 1362 ARG A CA    1 
ATOM   4246  C  C     . ARG A 1 608 ? 1.770   176.476 43.719  1.00 54.28  ? 1362 ARG A C     1 
ATOM   4247  O  O     . ARG A 1 608 ? 1.946   177.638 43.353  1.00 61.67  ? 1362 ARG A O     1 
ATOM   4248  C  CB    . ARG A 1 608 ? 3.211   175.274 45.320  1.00 41.63  ? 1362 ARG A CB    1 
ATOM   4249  C  CG    . ARG A 1 608 ? 3.669   175.091 46.750  1.00 43.89  ? 1362 ARG A CG    1 
ATOM   4250  C  CD    . ARG A 1 608 ? 5.042   174.454 46.788  1.00 55.20  ? 1362 ARG A CD    1 
ATOM   4251  N  NE    . ARG A 1 608 ? 5.189   173.744 48.049  1.00 75.56  ? 1362 ARG A NE    1 
ATOM   4252  C  CZ    . ARG A 1 608 ? 5.085   172.425 48.187  1.00 84.97  ? 1362 ARG A CZ    1 
ATOM   4253  N  NH1   . ARG A 1 608 ? 4.863   171.647 47.120  1.00 78.68  ? 1362 ARG A NH1   1 
ATOM   4254  N  NH2   . ARG A 1 608 ? 5.215   171.887 49.401  1.00 90.93  ? 1362 ARG A NH2   1 
ATOM   4255  N  N     . PHE A 1 609 ? 1.442   175.501 42.890  1.00 58.14  ? 1363 PHE A N     1 
ATOM   4256  C  CA    . PHE A 1 609 ? 1.209   175.739 41.481  1.00 54.27  ? 1363 PHE A CA    1 
ATOM   4257  C  C     . PHE A 1 609 ? 0.152   176.838 41.214  1.00 54.75  ? 1363 PHE A C     1 
ATOM   4258  O  O     . PHE A 1 609 ? 0.397   177.765 40.446  1.00 60.74  ? 1363 PHE A O     1 
ATOM   4259  C  CB    . PHE A 1 609 ? 0.824   174.417 40.823  1.00 47.78  ? 1363 PHE A CB    1 
ATOM   4260  C  CG    . PHE A 1 609 ? 0.579   174.523 39.378  1.00 56.45  ? 1363 PHE A CG    1 
ATOM   4261  C  CD1   . PHE A 1 609 ? -0.605  175.078 38.908  1.00 59.26  ? 1363 PHE A CD1   1 
ATOM   4262  C  CD2   . PHE A 1 609 ? 1.513   174.063 38.472  1.00 53.27  ? 1363 PHE A CD2   1 
ATOM   4263  C  CE1   . PHE A 1 609 ? -0.849  175.182 37.556  1.00 48.95  ? 1363 PHE A CE1   1 
ATOM   4264  C  CE2   . PHE A 1 609 ? 1.267   174.154 37.122  1.00 49.14  ? 1363 PHE A CE2   1 
ATOM   4265  C  CZ    . PHE A 1 609 ? 0.087   174.722 36.665  1.00 42.72  ? 1363 PHE A CZ    1 
ATOM   4266  N  N     . ASP A 1 610 ? -1.018  176.749 41.838  1.00 44.98  ? 1364 ASP A N     1 
ATOM   4267  C  CA    . ASP A 1 610 ? -2.054  177.715 41.526  1.00 45.04  ? 1364 ASP A CA    1 
ATOM   4268  C  C     . ASP A 1 610 ? -1.632  179.087 42.014  1.00 43.93  ? 1364 ASP A C     1 
ATOM   4269  O  O     . ASP A 1 610 ? -1.906  180.110 41.376  1.00 44.77  ? 1364 ASP A O     1 
ATOM   4270  C  CB    . ASP A 1 610 ? -3.384  177.320 42.161  1.00 66.14  ? 1364 ASP A CB    1 
ATOM   4271  C  CG    . ASP A 1 610 ? -4.108  176.212 41.389  1.00 79.43  ? 1364 ASP A CG    1 
ATOM   4272  O  OD1   . ASP A 1 610 ? -3.877  176.066 40.161  1.00 84.95  ? 1364 ASP A OD1   1 
ATOM   4273  O  OD2   . ASP A 1 610 ? -4.925  175.501 42.023  1.00 78.74  ? 1364 ASP A OD2   1 
ATOM   4274  N  N     . LYS A 1 611 ? -0.958  179.099 43.154  1.00 47.97  ? 1365 LYS A N     1 
ATOM   4275  C  CA    . LYS A 1 611 ? -0.517  180.339 43.755  1.00 48.16  ? 1365 LYS A CA    1 
ATOM   4276  C  C     . LYS A 1 611 ? 0.526   180.997 42.879  1.00 47.16  ? 1365 LYS A C     1 
ATOM   4277  O  O     . LYS A 1 611 ? 0.541   182.217 42.718  1.00 46.88  ? 1365 LYS A O     1 
ATOM   4278  C  CB    . LYS A 1 611 ? 0.053   180.095 45.163  1.00 47.32  ? 1365 LYS A CB    1 
ATOM   4279  C  CG    . LYS A 1 611 ? 0.767   181.323 45.746  1.00 51.57  ? 1365 LYS A CG    1 
ATOM   4280  C  CD    . LYS A 1 611 ? 1.040   181.164 47.218  1.00 46.90  ? 1365 LYS A CD    1 
ATOM   4281  C  CE    . LYS A 1 611 ? 2.236   180.281 47.450  1.00 46.58  ? 1365 LYS A CE    1 
ATOM   4282  N  NZ    . LYS A 1 611 ? 3.451   181.124 47.656  1.00 58.95  ? 1365 LYS A NZ    1 
ATOM   4283  N  N     . GLU A 1 612 ? 1.419   180.200 42.311  1.00 41.78  ? 1366 GLU A N     1 
ATOM   4284  C  CA    . GLU A 1 612 ? 2.400   180.811 41.441  1.00 45.51  ? 1366 GLU A CA    1 
ATOM   4285  C  C     . GLU A 1 612 ? 1.724   181.403 40.193  1.00 49.67  ? 1366 GLU A C     1 
ATOM   4286  O  O     . GLU A 1 612 ? 2.124   182.478 39.745  1.00 49.16  ? 1366 GLU A O     1 
ATOM   4287  C  CB    . GLU A 1 612 ? 3.544   179.866 41.097  1.00 39.13  ? 1366 GLU A CB    1 
ATOM   4288  C  CG    . GLU A 1 612 ? 4.593   180.527 40.259  1.00 61.83  ? 1366 GLU A CG    1 
ATOM   4289  C  CD    . GLU A 1 612 ? 5.590   179.537 39.725  1.00 91.37  ? 1366 GLU A CD    1 
ATOM   4290  O  OE1   . GLU A 1 612 ? 6.201   179.828 38.673  1.00 107.61 ? 1366 GLU A OE1   1 
ATOM   4291  O  OE2   . GLU A 1 612 ? 5.757   178.465 40.354  1.00 95.57  ? 1366 GLU A OE2   1 
ATOM   4292  N  N     . LYS A 1 613 ? 0.693   180.733 39.655  1.00 42.38  ? 1367 LYS A N     1 
ATOM   4293  C  CA    . LYS A 1 613 ? -0.036  181.285 38.520  1.00 43.82  ? 1367 LYS A CA    1 
ATOM   4294  C  C     . LYS A 1 613 ? -0.693  182.573 38.962  1.00 45.32  ? 1367 LYS A C     1 
ATOM   4295  O  O     . LYS A 1 613 ? -0.619  183.603 38.267  1.00 43.12  ? 1367 LYS A O     1 
ATOM   4296  C  CB    . LYS A 1 613 ? -1.082  180.313 37.941  1.00 44.64  ? 1367 LYS A CB    1 
ATOM   4297  C  CG    . LYS A 1 613 ? -0.551  179.433 36.792  1.00 64.28  ? 1367 LYS A CG    1 
ATOM   4298  C  CD    . LYS A 1 613 ? -1.571  178.367 36.322  1.00 80.11  ? 1367 LYS A CD    1 
ATOM   4299  C  CE    . LYS A 1 613 ? -2.665  178.912 35.367  1.00 96.86  ? 1367 LYS A CE    1 
ATOM   4300  N  NZ    . LYS A 1 613 ? -3.717  179.750 36.033  1.00 89.48  ? 1367 LYS A NZ    1 
ATOM   4301  N  N     . ALA A 1 614 ? -1.321  182.537 40.132  1.00 44.07  ? 1368 ALA A N     1 
ATOM   4302  C  CA    . ALA A 1 614 ? -2.052  183.717 40.561  1.00 45.76  ? 1368 ALA A CA    1 
ATOM   4303  C  C     . ALA A 1 614 ? -1.082  184.881 40.749  1.00 53.97  ? 1368 ALA A C     1 
ATOM   4304  O  O     . ALA A 1 614 ? -1.391  186.021 40.389  1.00 50.58  ? 1368 ALA A O     1 
ATOM   4305  C  CB    . ALA A 1 614 ? -2.836  183.444 41.801  1.00 31.79  ? 1368 ALA A CB    1 
ATOM   4306  N  N     . GLU A 1 615 ? 0.111   184.588 41.264  1.00 49.39  ? 1369 GLU A N     1 
ATOM   4307  C  CA    . GLU A 1 615 ? 1.089   185.637 41.469  1.00 47.86  ? 1369 GLU A CA    1 
ATOM   4308  C  C     . GLU A 1 615 ? 1.711   186.178 40.164  1.00 56.20  ? 1369 GLU A C     1 
ATOM   4309  O  O     . GLU A 1 615 ? 1.876   187.406 40.037  1.00 50.70  ? 1369 GLU A O     1 
ATOM   4310  C  CB    . GLU A 1 615 ? 2.164   185.189 42.451  1.00 57.62  ? 1369 GLU A CB    1 
ATOM   4311  C  CG    . GLU A 1 615 ? 3.265   186.229 42.706  1.00 81.51  ? 1369 GLU A CG    1 
ATOM   4312  C  CD    . GLU A 1 615 ? 4.190   185.845 43.871  1.00 107.94 ? 1369 GLU A CD    1 
ATOM   4313  O  OE1   . GLU A 1 615 ? 3.795   184.969 44.688  1.00 115.29 ? 1369 GLU A OE1   1 
ATOM   4314  O  OE2   . GLU A 1 615 ? 5.305   186.424 43.966  1.00 117.30 ? 1369 GLU A OE2   1 
ATOM   4315  N  N     . LYS A 1 616 ? 2.042   185.282 39.211  1.00 54.96  ? 1370 LYS A N     1 
ATOM   4316  C  CA    . LYS A 1 616 ? 2.650   185.692 37.927  1.00 43.03  ? 1370 LYS A CA    1 
ATOM   4317  C  C     . LYS A 1 616 ? 1.746   186.702 37.257  1.00 39.83  ? 1370 LYS A C     1 
ATOM   4318  O  O     . LYS A 1 616 ? 2.221   187.704 36.697  1.00 45.18  ? 1370 LYS A O     1 
ATOM   4319  C  CB    . LYS A 1 616 ? 2.956   184.509 37.004  1.00 34.13  ? 1370 LYS A CB    1 
ATOM   4320  C  CG    . LYS A 1 616 ? 4.443   184.122 36.953  1.00 50.73  ? 1370 LYS A CG    1 
ATOM   4321  C  CD    . LYS A 1 616 ? 4.678   182.652 36.529  1.00 36.48  ? 1370 LYS A CD    1 
ATOM   4322  N  N     . ARG A 1 617 ? 0.444   186.459 37.410  1.00 36.80  ? 1371 ARG A N     1 
ATOM   4323  C  CA    . ARG A 1 617 ? -0.631  187.320 36.908  1.00 46.30  ? 1371 ARG A CA    1 
ATOM   4324  C  C     . ARG A 1 617 ? -0.838  188.635 37.672  1.00 54.87  ? 1371 ARG A C     1 
ATOM   4325  O  O     . ARG A 1 617 ? -1.124  189.677 37.071  1.00 50.14  ? 1371 ARG A O     1 
ATOM   4326  C  CB    . ARG A 1 617 ? -1.953  186.549 36.943  1.00 44.62  ? 1371 ARG A CB    1 
ATOM   4327  C  CG    . ARG A 1 617 ? -3.165  187.394 36.577  1.00 38.92  ? 1371 ARG A CG    1 
ATOM   4328  C  CD    . ARG A 1 617 ? -3.244  187.583 35.125  1.00 43.74  ? 1371 ARG A CD    1 
ATOM   4329  N  NE    . ARG A 1 617 ? -4.153  188.644 34.724  1.00 62.05  ? 1371 ARG A NE    1 
ATOM   4330  C  CZ    . ARG A 1 617 ? -4.016  189.309 33.582  1.00 59.40  ? 1371 ARG A CZ    1 
ATOM   4331  N  NH1   . ARG A 1 617 ? -3.012  189.003 32.772  1.00 55.56  ? 1371 ARG A NH1   1 
ATOM   4332  N  NH2   . ARG A 1 617 ? -4.853  190.276 33.251  1.00 51.38  ? 1371 ARG A NH2   1 
ATOM   4333  N  N     . LEU A 1 618 ? -0.751  188.562 38.999  1.00 54.23  ? 1372 LEU A N     1 
ATOM   4334  C  CA    . LEU A 1 618 ? -0.944  189.725 39.856  1.00 50.90  ? 1372 LEU A CA    1 
ATOM   4335  C  C     . LEU A 1 618 ? 0.126   190.734 39.496  1.00 53.40  ? 1372 LEU A C     1 
ATOM   4336  O  O     . LEU A 1 618 ? -0.125  191.932 39.399  1.00 57.89  ? 1372 LEU A O     1 
ATOM   4337  C  CB    . LEU A 1 618 ? -0.782  189.327 41.320  1.00 54.98  ? 1372 LEU A CB    1 
ATOM   4338  C  CG    . LEU A 1 618 ? -1.373  190.217 42.435  1.00 54.17  ? 1372 LEU A CG    1 
ATOM   4339  C  CD1   . LEU A 1 618 ? -0.358  190.477 43.457  1.00 42.00  ? 1372 LEU A CD1   1 
ATOM   4340  C  CD2   . LEU A 1 618 ? -1.947  191.531 41.967  1.00 49.52  ? 1372 LEU A CD2   1 
ATOM   4341  N  N     . HIS A 1 619 ? 1.325   190.214 39.278  1.00 54.25  ? 1373 HIS A N     1 
ATOM   4342  C  CA    . HIS A 1 619 ? 2.490   191.020 38.977  1.00 54.59  ? 1373 HIS A CA    1 
ATOM   4343  C  C     . HIS A 1 619 ? 2.295   191.760 37.656  1.00 53.91  ? 1373 HIS A C     1 
ATOM   4344  O  O     . HIS A 1 619 ? 2.559   192.971 37.563  1.00 45.26  ? 1373 HIS A O     1 
ATOM   4345  C  CB    . HIS A 1 619 ? 3.689   190.099 38.896  1.00 58.51  ? 1373 HIS A CB    1 
ATOM   4346  C  CG    . HIS A 1 619 ? 5.000   190.806 38.919  1.00 67.13  ? 1373 HIS A CG    1 
ATOM   4347  N  ND1   . HIS A 1 619 ? 5.426   191.539 40.003  1.00 77.80  ? 1373 HIS A ND1   1 
ATOM   4348  C  CD2   . HIS A 1 619 ? 5.990   190.874 37.997  1.00 69.32  ? 1373 HIS A CD2   1 
ATOM   4349  C  CE1   . HIS A 1 619 ? 6.618   192.045 39.738  1.00 82.77  ? 1373 HIS A CE1   1 
ATOM   4350  N  NE2   . HIS A 1 619 ? 6.984   191.654 38.529  1.00 75.67  ? 1373 HIS A NE2   1 
ATOM   4351  N  N     . ILE A 1 620 ? 1.820   191.033 36.641  1.00 49.40  ? 1374 ILE A N     1 
ATOM   4352  C  CA    . ILE A 1 620 ? 1.512   191.640 35.361  1.00 41.44  ? 1374 ILE A CA    1 
ATOM   4353  C  C     . ILE A 1 620 ? 0.456   192.739 35.466  1.00 55.46  ? 1374 ILE A C     1 
ATOM   4354  O  O     . ILE A 1 620 ? 0.634   193.836 34.907  1.00 65.53  ? 1374 ILE A O     1 
ATOM   4355  C  CB    . ILE A 1 620 ? 1.052   190.602 34.336  1.00 41.06  ? 1374 ILE A CB    1 
ATOM   4356  C  CG1   . ILE A 1 620 ? 2.268   189.983 33.659  1.00 33.66  ? 1374 ILE A CG1   1 
ATOM   4357  C  CG2   . ILE A 1 620 ? 0.162   191.260 33.269  1.00 31.91  ? 1374 ILE A CG2   1 
ATOM   4358  C  CD1   . ILE A 1 620 ? 2.059   188.565 33.298  1.00 39.85  ? 1374 ILE A CD1   1 
ATOM   4359  N  N     . VAL A 1 621 ? -0.637  192.446 36.178  1.00 51.66  ? 1375 VAL A N     1 
ATOM   4360  C  CA    . VAL A 1 621 ? -1.741  193.400 36.353  1.00 49.29  ? 1375 VAL A CA    1 
ATOM   4361  C  C     . VAL A 1 621 ? -1.316  194.687 37.086  1.00 57.45  ? 1375 VAL A C     1 
ATOM   4362  O  O     . VAL A 1 621 ? -1.714  195.806 36.729  1.00 48.97  ? 1375 VAL A O     1 
ATOM   4363  C  CB    . VAL A 1 621 ? -2.911  192.764 37.089  1.00 47.49  ? 1375 VAL A CB    1 
ATOM   4364  C  CG1   . VAL A 1 621 ? -3.864  193.839 37.559  1.00 51.74  ? 1375 VAL A CG1   1 
ATOM   4365  C  CG2   . VAL A 1 621 ? -3.618  191.727 36.202  1.00 32.75  ? 1375 VAL A CG2   1 
ATOM   4366  N  N     . GLU A 1 622 ? -0.485  194.545 38.104  1.00 59.93  ? 1376 GLU A N     1 
ATOM   4367  C  CA    . GLU A 1 622 ? 0.140   195.734 38.656  1.00 58.59  ? 1376 GLU A CA    1 
ATOM   4368  C  C     . GLU A 1 622 ? 0.868   196.551 37.581  1.00 58.84  ? 1376 GLU A C     1 
ATOM   4369  O  O     . GLU A 1 622 ? 0.678   197.764 37.490  1.00 62.20  ? 1376 GLU A O     1 
ATOM   4370  C  CB    . GLU A 1 622 ? 1.073   195.356 39.785  1.00 67.46  ? 1376 GLU A CB    1 
ATOM   4371  C  CG    . GLU A 1 622 ? 0.351   194.647 40.906  1.00 77.81  ? 1376 GLU A CG    1 
ATOM   4372  C  CD    . GLU A 1 622 ? 1.276   194.234 42.021  1.00 83.05  ? 1376 GLU A CD    1 
ATOM   4373  O  OE1   . GLU A 1 622 ? 2.388   193.724 41.716  1.00 73.23  ? 1376 GLU A OE1   1 
ATOM   4374  O  OE2   . GLU A 1 622 ? 0.876   194.433 43.195  1.00 96.97  ? 1376 GLU A OE2   1 
ATOM   4375  N  N     . GLY A 1 623 ? 1.684   195.883 36.767  1.00 55.66  ? 1377 GLY A N     1 
ATOM   4376  C  CA    . GLY A 1 623 ? 2.347   196.515 35.637  1.00 59.79  ? 1377 GLY A CA    1 
ATOM   4377  C  C     . GLY A 1 623 ? 1.433   197.287 34.685  1.00 60.47  ? 1377 GLY A C     1 
ATOM   4378  O  O     . GLY A 1 623 ? 1.725   198.461 34.333  1.00 55.41  ? 1377 GLY A O     1 
ATOM   4379  N  N     . LEU A 1 624 ? 0.340   196.641 34.254  1.00 46.93  ? 1378 LEU A N     1 
ATOM   4380  C  CA    . LEU A 1 624 ? -0.613  197.288 33.337  1.00 45.96  ? 1378 LEU A CA    1 
ATOM   4381  C  C     . LEU A 1 624 ? -1.261  198.499 33.996  1.00 60.88  ? 1378 LEU A C     1 
ATOM   4382  O  O     . LEU A 1 624 ? -1.336  199.576 33.387  1.00 68.24  ? 1378 LEU A O     1 
ATOM   4383  C  CB    . LEU A 1 624 ? -1.682  196.315 32.848  1.00 34.14  ? 1378 LEU A CB    1 
ATOM   4384  C  CG    . LEU A 1 624 ? -1.112  195.058 32.170  1.00 39.33  ? 1378 LEU A CG    1 
ATOM   4385  C  CD1   . LEU A 1 624 ? -2.187  194.298 31.518  1.00 32.73  ? 1378 LEU A CD1   1 
ATOM   4386  C  CD2   . LEU A 1 624 ? -0.075  195.396 31.116  1.00 42.70  ? 1378 LEU A CD2   1 
ATOM   4387  N  N     . ILE A 1 625 ? -1.704  198.333 35.246  1.00 60.93  ? 1379 ILE A N     1 
ATOM   4388  C  CA    . ILE A 1 625 ? -2.333  199.430 35.974  1.00 56.44  ? 1379 ILE A CA    1 
ATOM   4389  C  C     . ILE A 1 625 ? -1.423  200.649 35.987  1.00 60.45  ? 1379 ILE A C     1 
ATOM   4390  O  O     . ILE A 1 625 ? -1.874  201.773 35.789  1.00 69.68  ? 1379 ILE A O     1 
ATOM   4391  C  CB    . ILE A 1 625 ? -2.684  199.047 37.414  1.00 51.43  ? 1379 ILE A CB    1 
ATOM   4392  C  CG1   . ILE A 1 625 ? -3.790  198.008 37.412  1.00 51.86  ? 1379 ILE A CG1   1 
ATOM   4393  C  CG2   . ILE A 1 625 ? -3.167  200.266 38.196  1.00 47.24  ? 1379 ILE A CG2   1 
ATOM   4394  C  CD1   . ILE A 1 625 ? -4.284  197.639 38.794  1.00 62.09  ? 1379 ILE A CD1   1 
ATOM   4395  N  N     . ARG A 1 626 ? -0.140  200.420 36.221  1.00 49.82  ? 1380 ARG A N     1 
ATOM   4396  C  CA    . ARG A 1 626 ? 0.822   201.493 36.142  1.00 56.56  ? 1380 ARG A CA    1 
ATOM   4397  C  C     . ARG A 1 626 ? 0.870   202.074 34.735  1.00 67.70  ? 1380 ARG A C     1 
ATOM   4398  O  O     . ARG A 1 626 ? 0.771   203.289 34.547  1.00 70.53  ? 1380 ARG A O     1 
ATOM   4399  C  CB    . ARG A 1 626 ? 2.197   200.972 36.512  1.00 54.53  ? 1380 ARG A CB    1 
ATOM   4400  C  CG    . ARG A 1 626 ? 2.678   201.454 37.847  1.00 62.07  ? 1380 ARG A CG    1 
ATOM   4401  C  CD    . ARG A 1 626 ? 3.968   202.182 37.685  1.00 71.70  ? 1380 ARG A CD    1 
ATOM   4402  N  NE    . ARG A 1 626 ? 5.043   201.227 37.463  1.00 75.71  ? 1380 ARG A NE    1 
ATOM   4403  C  CZ    . ARG A 1 626 ? 6.288   201.583 37.175  1.00 81.65  ? 1380 ARG A CZ    1 
ATOM   4404  N  NH1   . ARG A 1 626 ? 6.599   202.888 37.065  1.00 70.65  ? 1380 ARG A NH1   1 
ATOM   4405  N  NH2   . ARG A 1 626 ? 7.213   200.636 36.996  1.00 86.00  ? 1380 ARG A NH2   1 
ATOM   4406  N  N     . VAL A 1 627 ? 1.038   201.196 33.752  1.00 63.37  ? 1381 VAL A N     1 
ATOM   4407  C  CA    . VAL A 1 627 ? 1.230   201.629 32.379  1.00 65.61  ? 1381 VAL A CA    1 
ATOM   4408  C  C     . VAL A 1 627 ? 0.165   202.646 31.958  1.00 67.09  ? 1381 VAL A C     1 
ATOM   4409  O  O     . VAL A 1 627 ? 0.467   203.628 31.263  1.00 64.60  ? 1381 VAL A O     1 
ATOM   4410  C  CB    . VAL A 1 627 ? 1.279   200.411 31.414  1.00 52.94  ? 1381 VAL A CB    1 
ATOM   4411  C  CG1   . VAL A 1 627 ? 0.799   200.772 30.048  1.00 45.02  ? 1381 VAL A CG1   1 
ATOM   4412  C  CG2   . VAL A 1 627 ? 2.675   199.882 31.329  1.00 61.20  ? 1381 VAL A CG2   1 
ATOM   4413  N  N     . ILE A 1 628 ? -1.074  202.425 32.397  1.00 65.11  ? 1382 ILE A N     1 
ATOM   4414  C  CA    . ILE A 1 628 ? -2.193  203.256 31.954  1.00 66.92  ? 1382 ILE A CA    1 
ATOM   4415  C  C     . ILE A 1 628 ? -2.066  204.685 32.434  1.00 72.60  ? 1382 ILE A C     1 
ATOM   4416  O  O     . ILE A 1 628 ? -2.540  205.621 31.779  1.00 65.11  ? 1382 ILE A O     1 
ATOM   4417  C  CB    . ILE A 1 628 ? -3.521  202.768 32.509  1.00 68.11  ? 1382 ILE A CB    1 
ATOM   4418  C  CG1   . ILE A 1 628 ? -3.777  201.324 32.115  1.00 63.39  ? 1382 ILE A CG1   1 
ATOM   4419  C  CG2   . ILE A 1 628 ? -4.642  203.658 32.007  1.00 74.14  ? 1382 ILE A CG2   1 
ATOM   4420  C  CD1   . ILE A 1 628 ? -5.084  200.827 32.646  1.00 68.82  ? 1382 ILE A CD1   1 
ATOM   4421  N  N     . SER A 1 629 ? -1.463  204.825 33.612  1.00 80.76  ? 1383 SER A N     1 
ATOM   4422  C  CA    . SER A 1 629 ? -1.263  206.110 34.267  1.00 77.36  ? 1383 SER A CA    1 
ATOM   4423  C  C     . SER A 1 629 ? -0.249  206.885 33.473  1.00 81.31  ? 1383 SER A C     1 
ATOM   4424  O  O     . SER A 1 629 ? -0.219  208.105 33.549  1.00 90.33  ? 1383 SER A O     1 
ATOM   4425  C  CB    . SER A 1 629 ? -0.728  205.914 35.695  1.00 65.41  ? 1383 SER A CB    1 
ATOM   4426  N  N     . ILE A 1 630 ? 0.588   206.162 32.726  1.00 72.72  ? 1384 ILE A N     1 
ATOM   4427  C  CA    . ILE A 1 630 ? 1.673   206.760 31.955  1.00 63.65  ? 1384 ILE A CA    1 
ATOM   4428  C  C     . ILE A 1 630 ? 1.749   206.212 30.552  1.00 63.99  ? 1384 ILE A C     1 
ATOM   4429  O  O     . ILE A 1 630 ? 2.841   206.087 29.975  1.00 65.09  ? 1384 ILE A O     1 
ATOM   4430  C  CB    . ILE A 1 630 ? 3.025   206.559 32.624  1.00 56.40  ? 1384 ILE A CB    1 
ATOM   4431  C  CG1   . ILE A 1 630 ? 3.364   205.070 32.712  1.00 55.58  ? 1384 ILE A CG1   1 
ATOM   4432  C  CG2   . ILE A 1 630 ? 2.997   207.186 34.004  1.00 57.67  ? 1384 ILE A CG2   1 
ATOM   4433  C  CD1   . ILE A 1 630 ? 4.875   204.797 32.893  1.00 56.87  ? 1384 ILE A CD1   1 
ATOM   4434  N  N     . LEU A 1 631 ? 0.576   205.900 30.013  1.00 64.00  ? 1385 LEU A N     1 
ATOM   4435  C  CA    . LEU A 1 631 ? 0.442   205.351 28.668  1.00 57.21  ? 1385 LEU A CA    1 
ATOM   4436  C  C     . LEU A 1 631 ? 1.260   206.111 27.641  1.00 59.26  ? 1385 LEU A C     1 
ATOM   4437  O  O     . LEU A 1 631 ? 2.060   205.516 26.922  1.00 60.71  ? 1385 LEU A O     1 
ATOM   4438  C  CB    . LEU A 1 631 ? -1.017  205.377 28.236  1.00 49.96  ? 1385 LEU A CB    1 
ATOM   4439  C  CG    . LEU A 1 631 ? -1.521  204.114 27.559  1.00 46.02  ? 1385 LEU A CG    1 
ATOM   4440  C  CD1   . LEU A 1 631 ? -2.347  204.552 26.384  1.00 53.45  ? 1385 LEU A CD1   1 
ATOM   4441  C  CD2   . LEU A 1 631 ? -0.373  203.212 27.134  1.00 41.95  ? 1385 LEU A CD2   1 
ATOM   4442  N  N     . ASP A 1 632 ? 1.051   207.426 27.578  1.00 63.71  ? 1386 ASP A N     1 
ATOM   4443  C  CA    . ASP A 1 632 ? 1.655   208.260 26.534  1.00 67.10  ? 1386 ASP A CA    1 
ATOM   4444  C  C     . ASP A 1 632 ? 3.193   208.150 26.425  1.00 72.02  ? 1386 ASP A C     1 
ATOM   4445  O  O     . ASP A 1 632 ? 3.733   207.923 25.331  1.00 66.46  ? 1386 ASP A O     1 
ATOM   4446  C  CB    . ASP A 1 632 ? 1.186   209.711 26.671  1.00 63.12  ? 1386 ASP A CB    1 
ATOM   4447  C  CG    . ASP A 1 632 ? -0.104  209.975 25.922  1.00 80.99  ? 1386 ASP A CG    1 
ATOM   4448  O  OD1   . ASP A 1 632 ? -0.490  209.133 25.062  1.00 86.20  ? 1386 ASP A OD1   1 
ATOM   4449  O  OD2   . ASP A 1 632 ? -0.726  211.034 26.176  1.00 91.65  ? 1386 ASP A OD2   1 
ATOM   4450  N  N     . GLU A 1 633 ? 3.884   208.288 27.555  1.00 74.11  ? 1387 GLU A N     1 
ATOM   4451  C  CA    . GLU A 1 633 ? 5.333   208.121 27.585  1.00 79.01  ? 1387 GLU A CA    1 
ATOM   4452  C  C     . GLU A 1 633 ? 5.826   206.697 27.309  1.00 73.50  ? 1387 GLU A C     1 
ATOM   4453  O  O     . GLU A 1 633 ? 6.947   206.532 26.832  1.00 80.11  ? 1387 GLU A O     1 
ATOM   4454  C  CB    . GLU A 1 633 ? 5.956   208.652 28.888  1.00 92.59  ? 1387 GLU A CB    1 
ATOM   4455  C  CG    . GLU A 1 633 ? 5.010   208.786 30.073  1.00 108.00 ? 1387 GLU A CG    1 
ATOM   4456  C  CD    . GLU A 1 633 ? 4.172   210.055 30.009  1.00 123.78 ? 1387 GLU A CD    1 
ATOM   4457  O  OE1   . GLU A 1 633 ? 4.429   210.994 30.803  1.00 127.63 ? 1387 GLU A OE1   1 
ATOM   4458  O  OE2   . GLU A 1 633 ? 3.254   210.109 29.162  1.00 129.32 ? 1387 GLU A OE2   1 
ATOM   4459  N  N     . VAL A 1 634 ? 5.025   205.672 27.607  1.00 63.34  ? 1388 VAL A N     1 
ATOM   4460  C  CA    . VAL A 1 634 ? 5.437   204.300 27.271  1.00 61.86  ? 1388 VAL A CA    1 
ATOM   4461  C  C     . VAL A 1 634 ? 5.403   204.032 25.758  1.00 64.70  ? 1388 VAL A C     1 
ATOM   4462  O  O     . VAL A 1 634 ? 6.306   203.417 25.192  1.00 67.45  ? 1388 VAL A O     1 
ATOM   4463  C  CB    . VAL A 1 634 ? 4.591   203.235 27.982  1.00 59.81  ? 1388 VAL A CB    1 
ATOM   4464  C  CG1   . VAL A 1 634 ? 4.898   201.859 27.417  1.00 50.69  ? 1388 VAL A CG1   1 
ATOM   4465  C  CG2   . VAL A 1 634 ? 4.848   203.261 29.475  1.00 65.80  ? 1388 VAL A CG2   1 
ATOM   4466  N  N     . ILE A 1 635 ? 4.355   204.498 25.098  1.00 63.59  ? 1389 ILE A N     1 
ATOM   4467  C  CA    . ILE A 1 635 ? 4.265   204.304 23.666  1.00 64.01  ? 1389 ILE A CA    1 
ATOM   4468  C  C     . ILE A 1 635 ? 5.425   205.030 23.019  1.00 70.70  ? 1389 ILE A C     1 
ATOM   4469  O  O     . ILE A 1 635 ? 6.032   204.551 22.057  1.00 71.33  ? 1389 ILE A O     1 
ATOM   4470  C  CB    . ILE A 1 635 ? 2.966   204.856 23.125  1.00 63.38  ? 1389 ILE A CB    1 
ATOM   4471  C  CG1   . ILE A 1 635 ? 1.786   204.176 23.823  1.00 73.45  ? 1389 ILE A CG1   1 
ATOM   4472  C  CG2   . ILE A 1 635 ? 2.910   204.616 21.653  1.00 50.92  ? 1389 ILE A CG2   1 
ATOM   4473  C  CD1   . ILE A 1 635 ? 0.531   204.997 23.812  1.00 84.86  ? 1389 ILE A CD1   1 
ATOM   4474  N  N     . ALA A 1 636 ? 5.729   206.194 23.580  1.00 68.23  ? 1390 ALA A N     1 
ATOM   4475  C  CA    . ALA A 1 636 ? 6.846   207.001 23.140  1.00 67.46  ? 1390 ALA A CA    1 
ATOM   4476  C  C     . ALA A 1 636 ? 8.154   206.215 23.252  1.00 76.60  ? 1390 ALA A C     1 
ATOM   4477  O  O     . ALA A 1 636 ? 8.916   206.117 22.278  1.00 90.64  ? 1390 ALA A O     1 
ATOM   4478  C  CB    . ALA A 1 636 ? 6.911   208.250 23.964  1.00 53.12  ? 1390 ALA A CB    1 
ATOM   4479  N  N     . LEU A 1 637 ? 8.403   205.652 24.439  1.00 63.41  ? 1391 LEU A N     1 
ATOM   4480  C  CA    . LEU A 1 637 ? 9.620   204.893 24.710  1.00 65.99  ? 1391 LEU A CA    1 
ATOM   4481  C  C     . LEU A 1 637 ? 9.772   203.668 23.793  1.00 67.23  ? 1391 LEU A C     1 
ATOM   4482  O  O     . LEU A 1 637 ? 10.871  203.358 23.295  1.00 67.91  ? 1391 LEU A O     1 
ATOM   4483  C  CB    . LEU A 1 637 ? 9.650   204.469 26.188  1.00 70.52  ? 1391 LEU A CB    1 
ATOM   4484  C  CG    . LEU A 1 637 ? 10.866  203.718 26.739  1.00 75.68  ? 1391 LEU A CG    1 
ATOM   4485  C  CD1   . LEU A 1 637 ? 11.166  204.165 28.154  1.00 79.14  ? 1391 LEU A CD1   1 
ATOM   4486  C  CD2   . LEU A 1 637 ? 10.603  202.222 26.713  1.00 77.75  ? 1391 LEU A CD2   1 
ATOM   4487  N  N     . ILE A 1 638 ? 8.671   202.957 23.578  1.00 71.85  ? 1392 ILE A N     1 
ATOM   4488  C  CA    . ILE A 1 638 ? 8.715   201.809 22.693  1.00 71.35  ? 1392 ILE A CA    1 
ATOM   4489  C  C     . ILE A 1 638 ? 9.023   202.286 21.289  1.00 77.03  ? 1392 ILE A C     1 
ATOM   4490  O  O     . ILE A 1 638 ? 9.802   201.663 20.560  1.00 79.89  ? 1392 ILE A O     1 
ATOM   4491  C  CB    . ILE A 1 638 ? 7.403   201.072 22.680  1.00 58.46  ? 1392 ILE A CB    1 
ATOM   4492  C  CG1   . ILE A 1 638 ? 7.308   200.192 23.921  1.00 46.60  ? 1392 ILE A CG1   1 
ATOM   4493  C  CG2   . ILE A 1 638 ? 7.328   200.223 21.435  1.00 65.21  ? 1392 ILE A CG2   1 
ATOM   4494  C  CD1   . ILE A 1 638 ? 5.995   199.501 24.039  1.00 48.77  ? 1392 ILE A CD1   1 
ATOM   4495  N  N     . ARG A 1 639 ? 8.395   203.404 20.940  1.00 70.91  ? 1393 ARG A N     1 
ATOM   4496  C  CA    . ARG A 1 639 ? 8.622   204.105 19.692  1.00 73.55  ? 1393 ARG A CA    1 
ATOM   4497  C  C     . ARG A 1 639 ? 10.106  204.422 19.480  1.00 82.97  ? 1393 ARG A C     1 
ATOM   4498  O  O     . ARG A 1 639 ? 10.645  204.257 18.375  1.00 83.63  ? 1393 ARG A O     1 
ATOM   4499  C  CB    . ARG A 1 639 ? 7.818   205.406 19.713  1.00 73.54  ? 1393 ARG A CB    1 
ATOM   4500  C  CG    . ARG A 1 639 ? 7.771   206.142 18.391  1.00 67.87  ? 1393 ARG A CG    1 
ATOM   4501  C  CD    . ARG A 1 639 ? 7.151   205.273 17.330  1.00 69.18  ? 1393 ARG A CD    1 
ATOM   4502  N  NE    . ARG A 1 639 ? 7.485   205.823 16.036  1.00 83.56  ? 1393 ARG A NE    1 
ATOM   4503  C  CZ    . ARG A 1 639 ? 6.834   206.834 15.490  1.00 86.91  ? 1393 ARG A CZ    1 
ATOM   4504  N  NH1   . ARG A 1 639 ? 5.803   207.364 16.141  1.00 89.21  ? 1393 ARG A NH1   1 
ATOM   4505  N  NH2   . ARG A 1 639 ? 7.215   207.300 14.305  1.00 81.06  ? 1393 ARG A NH2   1 
ATOM   4506  N  N     . ALA A 1 640 ? 10.758  204.883 20.543  1.00 83.71  ? 1394 ALA A N     1 
ATOM   4507  C  CA    . ALA A 1 640 ? 12.163  205.268 20.461  1.00 92.28  ? 1394 ALA A CA    1 
ATOM   4508  C  C     . ALA A 1 640 ? 13.078  204.056 20.373  1.00 90.10  ? 1394 ALA A C     1 
ATOM   4509  O  O     . ALA A 1 640 ? 14.152  204.124 19.762  1.00 88.39  ? 1394 ALA A O     1 
ATOM   4510  C  CB    . ALA A 1 640 ? 12.551  206.131 21.650  1.00 94.86  ? 1394 ALA A CB    1 
ATOM   4511  N  N     . SER A 1 641 ? 12.646  202.955 20.991  1.00 82.84  ? 1395 SER A N     1 
ATOM   4512  C  CA    . SER A 1 641 ? 13.427  201.721 21.016  1.00 72.67  ? 1395 SER A CA    1 
ATOM   4513  C  C     . SER A 1 641 ? 13.814  201.203 19.603  1.00 86.72  ? 1395 SER A C     1 
ATOM   4514  O  O     . SER A 1 641 ? 13.309  201.667 18.569  1.00 87.05  ? 1395 SER A O     1 
ATOM   4515  C  CB    . SER A 1 641 ? 12.738  200.653 21.880  1.00 54.84  ? 1395 SER A CB    1 
ATOM   4516  N  N     . GLU A 1 642 ? 14.739  200.252 19.581  1.00 80.48  ? 1396 GLU A N     1 
ATOM   4517  C  CA    . GLU A 1 642 ? 15.388  199.819 18.359  1.00 73.27  ? 1396 GLU A CA    1 
ATOM   4518  C  C     . GLU A 1 642 ? 15.072  198.352 18.088  1.00 72.39  ? 1396 GLU A C     1 
ATOM   4519  O  O     . GLU A 1 642 ? 15.823  197.671 17.404  1.00 83.98  ? 1396 GLU A O     1 
ATOM   4520  C  CB    . GLU A 1 642 ? 16.912  200.008 18.508  1.00 76.77  ? 1396 GLU A CB    1 
ATOM   4521  N  N     . ASN A 1 643 ? 13.971  197.865 18.641  1.00 70.34  ? 1397 ASN A N     1 
ATOM   4522  C  CA    . ASN A 1 643 ? 13.664  196.431 18.637  1.00 75.43  ? 1397 ASN A CA    1 
ATOM   4523  C  C     . ASN A 1 643 ? 13.134  195.924 19.990  1.00 75.81  ? 1397 ASN A C     1 
ATOM   4524  O  O     . ASN A 1 643 ? 13.264  196.587 21.023  1.00 69.99  ? 1397 ASN A O     1 
ATOM   4525  C  CB    . ASN A 1 643 ? 14.888  195.614 18.261  1.00 81.74  ? 1397 ASN A CB    1 
ATOM   4526  C  CG    . ASN A 1 643 ? 15.889  195.541 19.385  1.00 92.23  ? 1397 ASN A CG    1 
ATOM   4527  O  OD1   . ASN A 1 643 ? 15.764  194.710 20.289  1.00 98.10  ? 1397 ASN A OD1   1 
ATOM   4528  N  ND2   . ASN A 1 643 ? 16.885  196.420 19.350  1.00 94.10  ? 1397 ASN A ND2   1 
ATOM   4529  N  N     . LYS A 1 644 ? 12.544  194.734 19.975  1.00 77.12  ? 1398 LYS A N     1 
ATOM   4530  C  CA    . LYS A 1 644 ? 11.870  194.206 21.152  1.00 65.53  ? 1398 LYS A CA    1 
ATOM   4531  C  C     . LYS A 1 644 ? 12.846  194.179 22.334  1.00 65.73  ? 1398 LYS A C     1 
ATOM   4532  O  O     . LYS A 1 644 ? 12.589  194.766 23.389  1.00 63.43  ? 1398 LYS A O     1 
ATOM   4533  C  CB    . LYS A 1 644 ? 11.251  192.832 20.834  1.00 53.85  ? 1398 LYS A CB    1 
ATOM   4534  C  CG    . LYS A 1 644 ? 10.512  192.164 21.976  1.00 56.66  ? 1398 LYS A CG    1 
ATOM   4535  C  CD    . LYS A 1 644 ? 9.694   190.936 21.537  1.00 56.87  ? 1398 LYS A CD    1 
ATOM   4536  C  CE    . LYS A 1 644 ? 9.335   190.063 22.753  1.00 63.61  ? 1398 LYS A CE    1 
ATOM   4537  N  NZ    . LYS A 1 644 ? 8.555   188.829 22.431  1.00 66.33  ? 1398 LYS A NZ    1 
ATOM   4538  N  N     . ALA A 1 645 ? 13.988  193.538 22.138  1.00 70.05  ? 1399 ALA A N     1 
ATOM   4539  C  CA    . ALA A 1 645 ? 14.976  193.438 23.196  1.00 71.01  ? 1399 ALA A CA    1 
ATOM   4540  C  C     . ALA A 1 645 ? 15.266  194.796 23.868  1.00 73.58  ? 1399 ALA A C     1 
ATOM   4541  O  O     . ALA A 1 645 ? 15.274  194.897 25.100  1.00 74.73  ? 1399 ALA A O     1 
ATOM   4542  C  CB    . ALA A 1 645 ? 16.232  192.816 22.656  1.00 72.62  ? 1399 ALA A CB    1 
ATOM   4543  N  N     . ASP A 1 646 ? 15.484  195.833 23.061  1.00 75.17  ? 1400 ASP A N     1 
ATOM   4544  C  CA    . ASP A 1 646 ? 15.833  197.165 23.575  1.00 78.43  ? 1400 ASP A CA    1 
ATOM   4545  C  C     . ASP A 1 646 ? 14.655  197.846 24.264  1.00 78.43  ? 1400 ASP A C     1 
ATOM   4546  O  O     . ASP A 1 646 ? 14.831  198.660 25.175  1.00 77.52  ? 1400 ASP A O     1 
ATOM   4547  C  CB    . ASP A 1 646 ? 16.350  198.071 22.443  1.00 83.22  ? 1400 ASP A CB    1 
ATOM   4548  C  CG    . ASP A 1 646 ? 16.895  199.419 22.951  1.00 86.07  ? 1400 ASP A CG    1 
ATOM   4549  O  OD1   . ASP A 1 646 ? 17.518  199.452 24.040  1.00 82.25  ? 1400 ASP A OD1   1 
ATOM   4550  O  OD2   . ASP A 1 646 ? 16.711  200.445 22.247  1.00 87.16  ? 1400 ASP A OD2   1 
ATOM   4551  N  N     . ALA A 1 647 ? 13.453  197.523 23.804  1.00 75.78  ? 1401 ALA A N     1 
ATOM   4552  C  CA    . ALA A 1 647 ? 12.235  198.069 24.376  1.00 65.34  ? 1401 ALA A CA    1 
ATOM   4553  C  C     . ALA A 1 647 ? 12.059  197.578 25.823  1.00 69.35  ? 1401 ALA A C     1 
ATOM   4554  O  O     . ALA A 1 647 ? 11.871  198.367 26.761  1.00 64.23  ? 1401 ALA A O     1 
ATOM   4555  C  CB    . ALA A 1 647 ? 11.060  197.654 23.528  1.00 52.23  ? 1401 ALA A CB    1 
ATOM   4556  N  N     . LYS A 1 648 ? 12.123  196.264 25.999  1.00 70.03  ? 1402 LYS A N     1 
ATOM   4557  C  CA    . LYS A 1 648 ? 12.044  195.693 27.323  1.00 66.16  ? 1402 LYS A CA    1 
ATOM   4558  C  C     . LYS A 1 648 ? 13.124  196.332 28.208  1.00 76.98  ? 1402 LYS A C     1 
ATOM   4559  O  O     . LYS A 1 648 ? 12.858  196.758 29.340  1.00 77.03  ? 1402 LYS A O     1 
ATOM   4560  C  CB    . LYS A 1 648 ? 12.232  194.178 27.257  1.00 56.97  ? 1402 LYS A CB    1 
ATOM   4561  C  CG    . LYS A 1 648 ? 11.126  193.429 26.562  1.00 53.19  ? 1402 LYS A CG    1 
ATOM   4562  C  CD    . LYS A 1 648 ? 10.767  192.127 27.295  1.00 65.42  ? 1402 LYS A CD    1 
ATOM   4563  C  CE    . LYS A 1 648 ? 11.862  191.070 27.240  1.00 75.63  ? 1402 LYS A CE    1 
ATOM   4564  N  NZ    . LYS A 1 648 ? 12.293  190.812 25.845  1.00 86.40  ? 1402 LYS A NZ    1 
ATOM   4565  N  N     . GLU A 1 649 ? 14.347  196.411 27.697  1.00 80.06  ? 1403 GLU A N     1 
ATOM   4566  C  CA    . GLU A 1 649 ? 15.416  196.996 28.495  1.00 81.71  ? 1403 GLU A CA    1 
ATOM   4567  C  C     . GLU A 1 649 ? 15.137  198.463 28.839  1.00 76.68  ? 1403 GLU A C     1 
ATOM   4568  O  O     . GLU A 1 649 ? 15.435  198.913 29.941  1.00 79.37  ? 1403 GLU A O     1 
ATOM   4569  C  CB    . GLU A 1 649 ? 16.778  196.829 27.823  1.00 88.08  ? 1403 GLU A CB    1 
ATOM   4570  C  CG    . GLU A 1 649 ? 17.933  197.471 28.595  1.00 105.82 ? 1403 GLU A CG    1 
ATOM   4571  C  CD    . GLU A 1 649 ? 18.219  196.804 29.945  1.00 116.76 ? 1403 GLU A CD    1 
ATOM   4572  O  OE1   . GLU A 1 649 ? 19.030  197.368 30.724  1.00 118.13 ? 1403 GLU A OE1   1 
ATOM   4573  O  OE2   . GLU A 1 649 ? 17.644  195.721 30.221  1.00 119.86 ? 1403 GLU A OE2   1 
ATOM   4574  N  N     . ASN A 1 650 ? 14.553  199.206 27.908  1.00 70.79  ? 1404 ASN A N     1 
ATOM   4575  C  CA    . ASN A 1 650 ? 14.189  200.590 28.191  1.00 74.05  ? 1404 ASN A CA    1 
ATOM   4576  C  C     . ASN A 1 650 ? 13.086  200.730 29.240  1.00 76.65  ? 1404 ASN A C     1 
ATOM   4577  O  O     . ASN A 1 650 ? 13.099  201.643 30.070  1.00 77.79  ? 1404 ASN A O     1 
ATOM   4578  C  CB    . ASN A 1 650 ? 13.743  201.282 26.920  1.00 71.63  ? 1404 ASN A CB    1 
ATOM   4579  C  CG    . ASN A 1 650 ? 14.882  201.874 26.160  1.00 74.19  ? 1404 ASN A CG    1 
ATOM   4580  O  OD1   . ASN A 1 650 ? 15.854  202.341 26.745  1.00 68.11  ? 1404 ASN A OD1   1 
ATOM   4581  N  ND2   . ASN A 1 650 ? 14.772  201.866 24.841  1.00 85.13  ? 1404 ASN A ND2   1 
ATOM   4582  N  N     . LEU A 1 651 ? 12.110  199.838 29.181  1.00 74.06  ? 1405 LEU A N     1 
ATOM   4583  C  CA    . LEU A 1 651 ? 11.050  199.867 30.163  1.00 69.33  ? 1405 LEU A CA    1 
ATOM   4584  C  C     . LEU A 1 651 ? 11.640  199.626 31.552  1.00 75.70  ? 1405 LEU A C     1 
ATOM   4585  O  O     . LEU A 1 651 ? 11.294  200.320 32.506  1.00 79.85  ? 1405 LEU A O     1 
ATOM   4586  C  CB    . LEU A 1 651 ? 9.970   198.838 29.825  1.00 56.27  ? 1405 LEU A CB    1 
ATOM   4587  C  CG    . LEU A 1 651 ? 9.132   199.168 28.590  1.00 58.14  ? 1405 LEU A CG    1 
ATOM   4588  C  CD1   . LEU A 1 651 ? 8.344   197.947 28.121  1.00 57.35  ? 1405 LEU A CD1   1 
ATOM   4589  C  CD2   . LEU A 1 651 ? 8.190   200.334 28.879  1.00 55.30  ? 1405 LEU A CD2   1 
ATOM   4590  N  N     . LYS A 1 652 ? 12.545  198.657 31.662  1.00 73.92  ? 1406 LYS A N     1 
ATOM   4591  C  CA    . LYS A 1 652 ? 13.094  198.303 32.968  1.00 76.30  ? 1406 LYS A CA    1 
ATOM   4592  C  C     . LYS A 1 652 ? 13.854  199.483 33.558  1.00 88.29  ? 1406 LYS A C     1 
ATOM   4593  O  O     . LYS A 1 652 ? 13.727  199.811 34.741  1.00 87.54  ? 1406 LYS A O     1 
ATOM   4594  C  CB    . LYS A 1 652 ? 14.059  197.132 32.849  1.00 69.54  ? 1406 LYS A CB    1 
ATOM   4595  C  CG    . LYS A 1 652 ? 13.435  195.800 32.543  1.00 68.76  ? 1406 LYS A CG    1 
ATOM   4596  C  CD    . LYS A 1 652 ? 14.532  194.893 32.023  1.00 79.28  ? 1406 LYS A CD    1 
ATOM   4597  C  CE    . LYS A 1 652 ? 14.113  193.452 31.910  1.00 82.64  ? 1406 LYS A CE    1 
ATOM   4598  N  NZ    . LYS A 1 652 ? 15.307  192.657 31.494  1.00 88.14  ? 1406 LYS A NZ    1 
ATOM   4599  N  N     . VAL A 1 653 ? 14.659  200.108 32.712  1.00 91.57  ? 1407 VAL A N     1 
ATOM   4600  C  CA    . VAL A 1 653 ? 15.558  201.164 33.144  1.00 89.55  ? 1407 VAL A CA    1 
ATOM   4601  C  C     . VAL A 1 653 ? 14.797  202.457 33.473  1.00 80.10  ? 1407 VAL A C     1 
ATOM   4602  O  O     . VAL A 1 653 ? 14.937  203.001 34.564  1.00 84.61  ? 1407 VAL A O     1 
ATOM   4603  C  CB    . VAL A 1 653 ? 16.667  201.392 32.082  1.00 70.54  ? 1407 VAL A CB    1 
ATOM   4604  C  CG1   . VAL A 1 653 ? 17.106  202.830 32.057  1.00 75.92  ? 1407 VAL A CG1   1 
ATOM   4605  C  CG2   . VAL A 1 653 ? 17.831  200.446 32.307  1.00 73.57  ? 1407 VAL A CG2   1 
ATOM   4606  N  N     . SER A 1 654 ? 13.972  202.933 32.550  1.00 72.52  ? 1408 SER A N     1 
ATOM   4607  C  CA    . SER A 1 654 ? 13.292  204.206 32.755  1.00 75.63  ? 1408 SER A CA    1 
ATOM   4608  C  C     . SER A 1 654 ? 12.153  204.125 33.794  1.00 78.43  ? 1408 SER A C     1 
ATOM   4609  O  O     . SER A 1 654 ? 11.809  205.115 34.443  1.00 86.53  ? 1408 SER A O     1 
ATOM   4610  C  CB    . SER A 1 654 ? 12.778  204.777 31.414  1.00 67.42  ? 1408 SER A CB    1 
ATOM   4611  N  N     . TYR A 1 655 ? 11.565  202.950 33.968  1.00 72.22  ? 1409 TYR A N     1 
ATOM   4612  C  CA    . TYR A 1 655 ? 10.360  202.882 34.791  1.00 66.89  ? 1409 TYR A CA    1 
ATOM   4613  C  C     . TYR A 1 655 ? 10.302  201.711 35.784  1.00 66.71  ? 1409 TYR A C     1 
ATOM   4614  O  O     . TYR A 1 655 ? 9.230   201.366 36.281  1.00 66.60  ? 1409 TYR A O     1 
ATOM   4615  C  CB    . TYR A 1 655 ? 9.124   202.889 33.895  1.00 63.60  ? 1409 TYR A CB    1 
ATOM   4616  C  CG    . TYR A 1 655 ? 8.954   204.168 33.106  1.00 72.84  ? 1409 TYR A CG    1 
ATOM   4617  C  CD1   . TYR A 1 655 ? 8.470   205.314 33.718  1.00 81.68  ? 1409 TYR A CD1   1 
ATOM   4618  C  CD2   . TYR A 1 655 ? 9.259   204.228 31.743  1.00 71.11  ? 1409 TYR A CD2   1 
ATOM   4619  C  CE1   . TYR A 1 655 ? 8.295   206.491 33.004  1.00 83.34  ? 1409 TYR A CE1   1 
ATOM   4620  C  CE2   . TYR A 1 655 ? 9.091   205.401 31.022  1.00 70.11  ? 1409 TYR A CE2   1 
ATOM   4621  C  CZ    . TYR A 1 655 ? 8.602   206.536 31.659  1.00 76.88  ? 1409 TYR A CZ    1 
ATOM   4622  O  OH    . TYR A 1 655 ? 8.434   207.736 30.982  1.00 78.09  ? 1409 TYR A OH    1 
ATOM   4623  N  N     . ASP A 1 656 ? 11.448  201.106 36.070  1.00 64.22  ? 1410 ASP A N     1 
ATOM   4624  C  CA    . ASP A 1 656 ? 11.508  200.028 37.044  1.00 67.30  ? 1410 ASP A CA    1 
ATOM   4625  C  C     . ASP A 1 656 ? 10.471  198.944 36.804  1.00 70.84  ? 1410 ASP A C     1 
ATOM   4626  O  O     . ASP A 1 656 ? 9.912   198.419 37.763  1.00 73.34  ? 1410 ASP A O     1 
ATOM   4627  C  CB    . ASP A 1 656 ? 11.296  200.565 38.461  1.00 78.24  ? 1410 ASP A CB    1 
ATOM   4628  C  CG    . ASP A 1 656 ? 12.344  201.579 38.871  1.00 84.96  ? 1410 ASP A CG    1 
ATOM   4629  O  OD1   . ASP A 1 656 ? 13.509  201.174 39.114  1.00 87.01  ? 1410 ASP A OD1   1 
ATOM   4630  O  OD2   . ASP A 1 656 ? 11.988  202.779 38.967  1.00 85.94  ? 1410 ASP A OD2   1 
ATOM   4631  N  N     . PHE A 1 657 ? 10.192  198.607 35.547  1.00 70.34  ? 1411 PHE A N     1 
ATOM   4632  C  CA    . PHE A 1 657 ? 9.392   197.413 35.290  1.00 64.52  ? 1411 PHE A CA    1 
ATOM   4633  C  C     . PHE A 1 657 ? 10.286  196.183 35.409  1.00 66.42  ? 1411 PHE A C     1 
ATOM   4634  O  O     . PHE A 1 657 ? 11.483  196.242 35.116  1.00 68.63  ? 1411 PHE A O     1 
ATOM   4635  C  CB    . PHE A 1 657 ? 8.720   197.454 33.915  1.00 58.76  ? 1411 PHE A CB    1 
ATOM   4636  C  CG    . PHE A 1 657 ? 7.551   198.406 33.831  1.00 60.16  ? 1411 PHE A CG    1 
ATOM   4637  C  CD1   . PHE A 1 657 ? 6.336   198.089 34.413  1.00 58.82  ? 1411 PHE A CD1   1 
ATOM   4638  C  CD2   . PHE A 1 657 ? 7.659   199.607 33.148  1.00 57.56  ? 1411 PHE A CD2   1 
ATOM   4639  C  CE1   . PHE A 1 657 ? 5.252   198.968 34.329  1.00 55.40  ? 1411 PHE A CE1   1 
ATOM   4640  C  CE2   . PHE A 1 657 ? 6.582   200.484 33.072  1.00 50.56  ? 1411 PHE A CE2   1 
ATOM   4641  C  CZ    . PHE A 1 657 ? 5.384   200.166 33.666  1.00 47.27  ? 1411 PHE A CZ    1 
ATOM   4642  N  N     . THR A 1 658 ? 9.714   195.071 35.851  1.00 63.02  ? 1412 THR A N     1 
ATOM   4643  C  CA    . THR A 1 658 ? 10.427  193.805 35.755  1.00 64.81  ? 1412 THR A CA    1 
ATOM   4644  C  C     . THR A 1 658 ? 10.353  193.218 34.335  1.00 65.78  ? 1412 THR A C     1 
ATOM   4645  O  O     . THR A 1 658 ? 9.519   193.615 33.519  1.00 59.60  ? 1412 THR A O     1 
ATOM   4646  C  CB    . THR A 1 658 ? 9.893   192.777 36.751  1.00 60.93  ? 1412 THR A CB    1 
ATOM   4647  O  OG1   . THR A 1 658 ? 8.614   192.315 36.314  1.00 72.73  ? 1412 THR A OG1   1 
ATOM   4648  C  CG2   . THR A 1 658 ? 9.728   193.421 38.090  1.00 67.08  ? 1412 THR A CG2   1 
ATOM   4649  N  N     . GLU A 1 659 ? 11.248  192.280 34.059  1.00 61.86  ? 1413 GLU A N     1 
ATOM   4650  C  CA    . GLU A 1 659 ? 11.248  191.543 32.818  1.00 59.92  ? 1413 GLU A CA    1 
ATOM   4651  C  C     . GLU A 1 659 ? 9.841   191.046 32.481  1.00 62.90  ? 1413 GLU A C     1 
ATOM   4652  O  O     . GLU A 1 659 ? 9.289   191.350 31.414  1.00 61.90  ? 1413 GLU A O     1 
ATOM   4653  C  CB    . GLU A 1 659 ? 12.201  190.352 32.924  1.00 59.85  ? 1413 GLU A CB    1 
ATOM   4654  C  CG    . GLU A 1 659 ? 12.033  189.329 31.814  1.00 71.25  ? 1413 GLU A CG    1 
ATOM   4655  C  CD    . GLU A 1 659 ? 12.598  189.807 30.483  1.00 91.45  ? 1413 GLU A CD    1 
ATOM   4656  O  OE1   . GLU A 1 659 ? 12.108  189.360 29.421  1.00 101.30 ? 1413 GLU A OE1   1 
ATOM   4657  O  OE2   . GLU A 1 659 ? 13.543  190.622 30.502  1.00 94.71  ? 1413 GLU A OE2   1 
ATOM   4658  N  N     . GLU A 1 660 ? 9.262   190.274 33.386  1.00 55.37  ? 1414 GLU A N     1 
ATOM   4659  C  CA    . GLU A 1 660 ? 7.981   189.669 33.088  1.00 54.99  ? 1414 GLU A CA    1 
ATOM   4660  C  C     . GLU A 1 660 ? 6.960   190.750 32.763  1.00 57.28  ? 1414 GLU A C     1 
ATOM   4661  O  O     . GLU A 1 660 ? 6.100   190.565 31.905  1.00 59.83  ? 1414 GLU A O     1 
ATOM   4662  C  CB    . GLU A 1 660 ? 7.512   188.741 34.223  1.00 64.84  ? 1414 GLU A CB    1 
ATOM   4663  C  CG    . GLU A 1 660 ? 8.349   188.822 35.512  1.00 88.20  ? 1414 GLU A CG    1 
ATOM   4664  C  CD    . GLU A 1 660 ? 9.734   188.191 35.392  1.00 99.63  ? 1414 GLU A CD    1 
ATOM   4665  O  OE1   . GLU A 1 660 ? 10.597  188.491 36.253  1.00 101.08 ? 1414 GLU A OE1   1 
ATOM   4666  O  OE2   . GLU A 1 660 ? 9.957   187.394 34.448  1.00 104.17 ? 1414 GLU A OE2   1 
ATOM   4667  N  N     . GLN A 1 661 ? 7.053   191.888 33.440  1.00 58.74  ? 1415 GLN A N     1 
ATOM   4668  C  CA    . GLN A 1 661 ? 6.104   192.969 33.173  1.00 57.06  ? 1415 GLN A CA    1 
ATOM   4669  C  C     . GLN A 1 661 ? 6.410   193.550 31.820  1.00 53.97  ? 1415 GLN A C     1 
ATOM   4670  O  O     . GLN A 1 661 ? 5.512   193.786 31.034  1.00 47.79  ? 1415 GLN A O     1 
ATOM   4671  C  CB    . GLN A 1 661 ? 6.183   194.068 34.232  1.00 59.70  ? 1415 GLN A CB    1 
ATOM   4672  C  CG    . GLN A 1 661 ? 5.556   193.668 35.529  1.00 67.05  ? 1415 GLN A CG    1 
ATOM   4673  C  CD    . GLN A 1 661 ? 5.856   194.626 36.663  1.00 67.75  ? 1415 GLN A CD    1 
ATOM   4674  O  OE1   . GLN A 1 661 ? 6.987   195.106 36.834  1.00 67.17  ? 1415 GLN A OE1   1 
ATOM   4675  N  NE2   . GLN A 1 661 ? 4.835   194.906 37.454  1.00 69.44  ? 1415 GLN A NE2   1 
ATOM   4676  N  N     . ALA A 1 662 ? 7.694   193.796 31.571  1.00 60.72  ? 1416 ALA A N     1 
ATOM   4677  C  CA    . ALA A 1 662 ? 8.153   194.363 30.313  1.00 57.86  ? 1416 ALA A CA    1 
ATOM   4678  C  C     . ALA A 1 662 ? 7.675   193.499 29.158  1.00 59.87  ? 1416 ALA A C     1 
ATOM   4679  O  O     . ALA A 1 662 ? 7.046   194.003 28.221  1.00 64.31  ? 1416 ALA A O     1 
ATOM   4680  C  CB    . ALA A 1 662 ? 9.651   194.463 30.305  1.00 60.85  ? 1416 ALA A CB    1 
ATOM   4681  N  N     . GLU A 1 663 ? 7.958   192.199 29.235  1.00 51.18  ? 1417 GLU A N     1 
ATOM   4682  C  CA    . GLU A 1 663 ? 7.469   191.258 28.241  1.00 45.12  ? 1417 GLU A CA    1 
ATOM   4683  C  C     . GLU A 1 663 ? 6.002   191.467 27.974  1.00 48.85  ? 1417 GLU A C     1 
ATOM   4684  O  O     . GLU A 1 663 ? 5.608   191.800 26.847  1.00 55.53  ? 1417 GLU A O     1 
ATOM   4685  C  CB    . GLU A 1 663 ? 7.675   189.821 28.678  1.00 52.66  ? 1417 GLU A CB    1 
ATOM   4686  C  CG    . GLU A 1 663 ? 7.270   188.794 27.620  1.00 65.78  ? 1417 GLU A CG    1 
ATOM   4687  C  CD    . GLU A 1 663 ? 8.198   188.775 26.401  1.00 80.65  ? 1417 GLU A CD    1 
ATOM   4688  O  OE1   . GLU A 1 663 ? 9.391   189.176 26.523  1.00 78.56  ? 1417 GLU A OE1   1 
ATOM   4689  O  OE2   . GLU A 1 663 ? 7.716   188.367 25.316  1.00 87.47  ? 1417 GLU A OE2   1 
ATOM   4690  N  N     . ALA A 1 664 ? 5.186   191.284 29.004  1.00 47.74  ? 1418 ALA A N     1 
ATOM   4691  C  CA    . ALA A 1 664 ? 3.746   191.517 28.847  1.00 47.52  ? 1418 ALA A CA    1 
ATOM   4692  C  C     . ALA A 1 664 ? 3.424   192.836 28.158  1.00 50.31  ? 1418 ALA A C     1 
ATOM   4693  O  O     . ALA A 1 664 ? 2.659   192.862 27.195  1.00 57.63  ? 1418 ALA A O     1 
ATOM   4694  C  CB    . ALA A 1 664 ? 3.027   191.440 30.164  1.00 40.79  ? 1418 ALA A CB    1 
ATOM   4695  N  N     . ILE A 1 665 ? 3.994   193.928 28.657  1.00 48.66  ? 1419 ILE A N     1 
ATOM   4696  C  CA    . ILE A 1 665 ? 3.691   195.241 28.108  1.00 55.54  ? 1419 ILE A CA    1 
ATOM   4697  C  C     . ILE A 1 665 ? 3.932   195.262 26.614  1.00 62.33  ? 1419 ILE A C     1 
ATOM   4698  O  O     . ILE A 1 665 ? 3.117   195.761 25.834  1.00 62.41  ? 1419 ILE A O     1 
ATOM   4699  C  CB    . ILE A 1 665 ? 4.566   196.328 28.739  1.00 47.86  ? 1419 ILE A CB    1 
ATOM   4700  C  CG1   . ILE A 1 665 ? 4.126   196.576 30.165  1.00 41.65  ? 1419 ILE A CG1   1 
ATOM   4701  C  CG2   . ILE A 1 665 ? 4.448   197.638 27.958  1.00 36.05  ? 1419 ILE A CG2   1 
ATOM   4702  C  CD1   . ILE A 1 665 ? 5.028   197.535 30.855  1.00 53.03  ? 1419 ILE A CD1   1 
ATOM   4703  N  N     . VAL A 1 666 ? 5.064   194.697 26.230  1.00 61.76  ? 1420 VAL A N     1 
ATOM   4704  C  CA    . VAL A 1 666 ? 5.618   194.923 24.910  1.00 53.37  ? 1420 VAL A CA    1 
ATOM   4705  C  C     . VAL A 1 666 ? 5.014   193.996 23.869  1.00 51.94  ? 1420 VAL A C     1 
ATOM   4706  O  O     . VAL A 1 666 ? 5.195   194.199 22.682  1.00 53.06  ? 1420 VAL A O     1 
ATOM   4707  C  CB    . VAL A 1 666 ? 7.115   194.735 24.956  1.00 51.48  ? 1420 VAL A CB    1 
ATOM   4708  C  CG1   . VAL A 1 666 ? 7.536   193.529 24.120  1.00 47.86  ? 1420 VAL A CG1   1 
ATOM   4709  C  CG2   . VAL A 1 666 ? 7.775   195.992 24.527  1.00 53.06  ? 1420 VAL A CG2   1 
ATOM   4710  N  N     . THR A 1 667 ? 4.281   192.991 24.332  1.00 45.69  ? 1421 THR A N     1 
ATOM   4711  C  CA    . THR A 1 667 ? 3.576   192.066 23.455  1.00 40.78  ? 1421 THR A CA    1 
ATOM   4712  C  C     . THR A 1 667 ? 2.052   192.280 23.475  1.00 43.94  ? 1421 THR A C     1 
ATOM   4713  O  O     . THR A 1 667 ? 1.285   191.409 23.061  1.00 44.02  ? 1421 THR A O     1 
ATOM   4714  C  CB    . THR A 1 667 ? 3.876   190.635 23.857  1.00 42.16  ? 1421 THR A CB    1 
ATOM   4715  O  OG1   . THR A 1 667 ? 3.482   190.440 25.229  1.00 52.56  ? 1421 THR A OG1   1 
ATOM   4716  C  CG2   . THR A 1 667 ? 5.370   190.377 23.733  1.00 45.27  ? 1421 THR A CG2   1 
ATOM   4717  N  N     . LEU A 1 668 ? 1.616   193.429 23.981  1.00 44.44  ? 1422 LEU A N     1 
ATOM   4718  C  CA    . LEU A 1 668 ? 0.210   193.803 23.902  1.00 48.15  ? 1422 LEU A CA    1 
ATOM   4719  C  C     . LEU A 1 668 ? -0.125  194.120 22.445  1.00 52.36  ? 1422 LEU A C     1 
ATOM   4720  O  O     . LEU A 1 668 ? 0.709   194.662 21.707  1.00 56.16  ? 1422 LEU A O     1 
ATOM   4721  C  CB    . LEU A 1 668 ? -0.044  195.064 24.731  1.00 50.21  ? 1422 LEU A CB    1 
ATOM   4722  C  CG    . LEU A 1 668 ? -0.123  195.008 26.250  1.00 50.00  ? 1422 LEU A CG    1 
ATOM   4723  C  CD1   . LEU A 1 668 ? -0.101  196.422 26.756  1.00 46.69  ? 1422 LEU A CD1   1 
ATOM   4724  C  CD2   . LEU A 1 668 ? -1.396  194.327 26.666  1.00 48.74  ? 1422 LEU A CD2   1 
ATOM   4725  N  N     . GLN A 1 669 ? -1.346  193.815 22.034  1.00 43.26  ? 1423 GLN A N     1 
ATOM   4726  C  CA    . GLN A 1 669 ? -1.785  194.163 20.691  1.00 38.76  ? 1423 GLN A CA    1 
ATOM   4727  C  C     . GLN A 1 669 ? -2.222  195.633 20.692  1.00 41.83  ? 1423 GLN A C     1 
ATOM   4728  O  O     . GLN A 1 669 ? -2.635  196.138 21.725  1.00 45.01  ? 1423 GLN A O     1 
ATOM   4729  C  CB    . GLN A 1 669 ? -2.922  193.237 20.240  1.00 34.32  ? 1423 GLN A CB    1 
ATOM   4730  C  CG    . GLN A 1 669 ? -2.580  191.745 20.331  1.00 33.80  ? 1423 GLN A CG    1 
ATOM   4731  C  CD    . GLN A 1 669 ? -3.592  190.840 19.622  1.00 62.66  ? 1423 GLN A CD    1 
ATOM   4732  O  OE1   . GLN A 1 669 ? -4.663  191.274 19.206  1.00 73.02  ? 1423 GLN A OE1   1 
ATOM   4733  N  NE2   . GLN A 1 669 ? -3.238  189.571 19.476  1.00 76.74  ? 1423 GLN A NE2   1 
ATOM   4734  N  N     . LEU A 1 670 ? -2.115  196.327 19.555  1.00 39.35  ? 1424 LEU A N     1 
ATOM   4735  C  CA    . LEU A 1 670 ? -2.376  197.766 19.528  1.00 44.91  ? 1424 LEU A CA    1 
ATOM   4736  C  C     . LEU A 1 670 ? -3.745  198.163 20.096  1.00 51.51  ? 1424 LEU A C     1 
ATOM   4737  O  O     . LEU A 1 670 ? -3.914  199.264 20.646  1.00 49.23  ? 1424 LEU A O     1 
ATOM   4738  C  CB    . LEU A 1 670 ? -2.238  198.330 18.108  1.00 40.09  ? 1424 LEU A CB    1 
ATOM   4739  C  CG    . LEU A 1 670 ? -0.851  198.651 17.567  1.00 44.31  ? 1424 LEU A CG    1 
ATOM   4740  C  CD1   . LEU A 1 670 ? -0.989  199.356 16.257  1.00 47.66  ? 1424 LEU A CD1   1 
ATOM   4741  C  CD2   . LEU A 1 670 ? -0.157  199.551 18.525  1.00 52.72  ? 1424 LEU A CD2   1 
ATOM   4742  N  N     . TYR A 1 671 ? -4.743  197.300 19.942  1.00 51.86  ? 1425 TYR A N     1 
ATOM   4743  C  CA    . TYR A 1 671 ? -6.086  197.751 20.282  1.00 57.15  ? 1425 TYR A CA    1 
ATOM   4744  C  C     . TYR A 1 671 ? -6.250  197.909 21.803  1.00 55.61  ? 1425 TYR A C     1 
ATOM   4745  O  O     . TYR A 1 671 ? -7.090  198.684 22.293  1.00 50.81  ? 1425 TYR A O     1 
ATOM   4746  C  CB    . TYR A 1 671 ? -7.143  196.848 19.665  1.00 55.02  ? 1425 TYR A CB    1 
ATOM   4747  C  CG    . TYR A 1 671 ? -7.201  195.503 20.284  1.00 56.00  ? 1425 TYR A CG    1 
ATOM   4748  C  CD1   . TYR A 1 671 ? -7.890  195.311 21.459  1.00 50.78  ? 1425 TYR A CD1   1 
ATOM   4749  C  CD2   . TYR A 1 671 ? -6.571  194.420 19.700  1.00 63.05  ? 1425 TYR A CD2   1 
ATOM   4750  C  CE1   . TYR A 1 671 ? -7.962  194.077 22.041  1.00 55.26  ? 1425 TYR A CE1   1 
ATOM   4751  C  CE2   . TYR A 1 671 ? -6.632  193.169 20.286  1.00 66.82  ? 1425 TYR A CE2   1 
ATOM   4752  C  CZ    . TYR A 1 671 ? -7.332  193.012 21.462  1.00 63.34  ? 1425 TYR A CZ    1 
ATOM   4753  O  OH    . TYR A 1 671 ? -7.416  191.794 22.074  1.00 71.18  ? 1425 TYR A OH    1 
ATOM   4754  N  N     . ARG A 1 672 ? -5.412  197.196 22.543  1.00 51.93  ? 1426 ARG A N     1 
ATOM   4755  C  CA    . ARG A 1 672 ? -5.315  197.404 23.972  1.00 45.70  ? 1426 ARG A CA    1 
ATOM   4756  C  C     . ARG A 1 672 ? -5.207  198.880 24.316  1.00 48.53  ? 1426 ARG A C     1 
ATOM   4757  O  O     . ARG A 1 672 ? -5.868  199.325 25.234  1.00 66.54  ? 1426 ARG A O     1 
ATOM   4758  C  CB    . ARG A 1 672 ? -4.148  196.618 24.547  1.00 46.50  ? 1426 ARG A CB    1 
ATOM   4759  C  CG    . ARG A 1 672 ? -4.387  195.135 24.523  1.00 51.30  ? 1426 ARG A CG    1 
ATOM   4760  C  CD    . ARG A 1 672 ? -5.761  194.883 25.054  1.00 73.22  ? 1426 ARG A CD    1 
ATOM   4761  N  NE    . ARG A 1 672 ? -6.187  193.539 24.722  1.00 90.51  ? 1426 ARG A NE    1 
ATOM   4762  C  CZ    . ARG A 1 672 ? -5.717  192.465 25.333  1.00 98.69  ? 1426 ARG A CZ    1 
ATOM   4763  N  NH1   . ARG A 1 672 ? -4.816  192.624 26.306  1.00 98.69  ? 1426 ARG A NH1   1 
ATOM   4764  N  NH2   . ARG A 1 672 ? -6.143  191.253 24.975  1.00 96.80  ? 1426 ARG A NH2   1 
ATOM   4765  N  N     . LEU A 1 673 ? -4.403  199.647 23.586  1.00 45.20  ? 1427 LEU A N     1 
ATOM   4766  C  CA    . LEU A 1 673 ? -4.332  201.098 23.822  1.00 49.46  ? 1427 LEU A CA    1 
ATOM   4767  C  C     . LEU A 1 673 ? -5.672  201.836 23.823  1.00 49.90  ? 1427 LEU A C     1 
ATOM   4768  O  O     . LEU A 1 673 ? -5.724  203.033 24.132  1.00 60.42  ? 1427 LEU A O     1 
ATOM   4769  C  CB    . LEU A 1 673 ? -3.438  201.788 22.801  1.00 55.34  ? 1427 LEU A CB    1 
ATOM   4770  C  CG    . LEU A 1 673 ? -2.162  201.038 22.463  1.00 60.31  ? 1427 LEU A CG    1 
ATOM   4771  C  CD1   . LEU A 1 673 ? -1.497  201.817 21.339  1.00 58.68  ? 1427 LEU A CD1   1 
ATOM   4772  C  CD2   . LEU A 1 673 ? -1.240  200.814 23.709  1.00 44.51  ? 1427 LEU A CD2   1 
ATOM   4773  N  N     . THR A 1 674 ? -6.753  201.157 23.459  1.00 42.50  ? 1428 THR A N     1 
ATOM   4774  C  CA    . THR A 1 674 ? -8.048  201.833 23.464  1.00 54.58  ? 1428 THR A CA    1 
ATOM   4775  C  C     . THR A 1 674 ? -8.546  201.974 24.881  1.00 68.67  ? 1428 THR A C     1 
ATOM   4776  O  O     . THR A 1 674 ? -9.097  203.009 25.244  1.00 76.91  ? 1428 THR A O     1 
ATOM   4777  C  CB    . THR A 1 674 ? -9.105  201.065 22.694  1.00 55.28  ? 1428 THR A CB    1 
ATOM   4778  O  OG1   . THR A 1 674 ? -9.209  199.743 23.235  1.00 55.13  ? 1428 THR A OG1   1 
ATOM   4779  C  CG2   . THR A 1 674 ? -8.731  200.998 21.239  1.00 56.35  ? 1428 THR A CG2   1 
ATOM   4780  N  N     . ASN A 1 675 ? -8.338  200.928 25.678  1.00 72.44  ? 1429 ASN A N     1 
ATOM   4781  C  CA    . ASN A 1 675 ? -8.815  200.899 27.057  1.00 79.34  ? 1429 ASN A CA    1 
ATOM   4782  C  C     . ASN A 1 675 ? -8.067  201.758 28.081  1.00 79.18  ? 1429 ASN A C     1 
ATOM   4783  O  O     . ASN A 1 675 ? -6.844  201.870 28.064  1.00 79.30  ? 1429 ASN A O     1 
ATOM   4784  C  CB    . ASN A 1 675 ? -8.855  199.474 27.583  1.00 81.60  ? 1429 ASN A CB    1 
ATOM   4785  C  CG    . ASN A 1 675 ? -9.451  199.408 28.965  1.00 86.53  ? 1429 ASN A CG    1 
ATOM   4786  O  OD1   . ASN A 1 675 ? -10.671 199.526 29.117  1.00 93.43  ? 1429 ASN A OD1   1 
ATOM   4787  N  ND2   . ASN A 1 675 ? -8.602  199.251 29.987  1.00 82.32  ? 1429 ASN A ND2   1 
ATOM   4788  N  N     . THR A 1 676 ? -8.811  202.350 29.001  1.00 105.81 ? 1430 THR A N     1 
ATOM   4789  C  CA    . THR A 1 676 ? -8.163  203.067 30.091  1.00 107.96 ? 1430 THR A CA    1 
ATOM   4790  C  C     . THR A 1 676 ? -8.918  202.840 31.409  1.00 100.19 ? 1430 THR A C     1 
ATOM   4791  O  O     . THR A 1 676 ? -8.863  203.650 32.342  1.00 91.99  ? 1430 THR A O     1 
ATOM   4792  C  CB    . THR A 1 676 ? -7.956  204.569 29.755  1.00 106.66 ? 1430 THR A CB    1 
ATOM   4793  O  OG1   . THR A 1 676 ? -9.209  205.175 29.414  1.00 101.23 ? 1430 THR A OG1   1 
ATOM   4794  C  CG2   . THR A 1 676 ? -6.982  204.719 28.581  1.00 110.14 ? 1430 THR A CG2   1 
ATOM   4795  N  N     . ASP A 1 677 ? -9.612  201.708 31.464  1.00 94.62  ? 1431 ASP A N     1 
ATOM   4796  C  CA    . ASP A 1 677 ? -10.375 201.331 32.631  1.00 93.90  ? 1431 ASP A CA    1 
ATOM   4797  C  C     . ASP A 1 677 ? -9.414  200.699 33.609  1.00 91.45  ? 1431 ASP A C     1 
ATOM   4798  O  O     . ASP A 1 677 ? -8.964  199.567 33.422  1.00 100.14 ? 1431 ASP A O     1 
ATOM   4799  C  CB    . ASP A 1 677 ? -11.471 200.330 32.261  1.00 105.02 ? 1431 ASP A CB    1 
ATOM   4800  C  CG    . ASP A 1 677 ? -12.538 200.190 33.343  1.00 114.80 ? 1431 ASP A CG    1 
ATOM   4801  O  OD1   . ASP A 1 677 ? -12.314 200.646 34.491  1.00 117.61 ? 1431 ASP A OD1   1 
ATOM   4802  O  OD2   . ASP A 1 677 ? -13.607 199.616 33.034  1.00 116.82 ? 1431 ASP A OD2   1 
ATOM   4803  N  N     . VAL A 1 678 ? -9.091  201.431 34.658  1.00 76.37  ? 1432 VAL A N     1 
ATOM   4804  C  CA    . VAL A 1 678 ? -8.227  200.882 35.676  1.00 67.51  ? 1432 VAL A CA    1 
ATOM   4805  C  C     . VAL A 1 678 ? -9.038  200.122 36.733  1.00 75.14  ? 1432 VAL A C     1 
ATOM   4806  O  O     . VAL A 1 678 ? -8.503  199.371 37.543  1.00 77.35  ? 1432 VAL A O     1 
ATOM   4807  C  CB    . VAL A 1 678 ? -7.416  201.992 36.316  1.00 61.24  ? 1432 VAL A CB    1 
ATOM   4808  C  CG1   . VAL A 1 678 ? -7.763  202.108 37.788  1.00 66.86  ? 1432 VAL A CG1   1 
ATOM   4809  C  CG2   . VAL A 1 678 ? -5.943  201.724 36.105  1.00 68.53  ? 1432 VAL A CG2   1 
ATOM   4810  N  N     . VAL A 1 679 ? -10.345 200.307 36.699  1.00 75.33  ? 1433 VAL A N     1 
ATOM   4811  C  CA    . VAL A 1 679 ? -11.216 199.768 37.725  1.00 70.64  ? 1433 VAL A CA    1 
ATOM   4812  C  C     . VAL A 1 679 ? -11.465 198.269 37.563  1.00 74.12  ? 1433 VAL A C     1 
ATOM   4813  O  O     . VAL A 1 679 ? -11.446 197.508 38.544  1.00 71.06  ? 1433 VAL A O     1 
ATOM   4814  C  CB    . VAL A 1 679 ? -12.555 200.484 37.698  1.00 59.36  ? 1433 VAL A CB    1 
ATOM   4815  C  CG1   . VAL A 1 679 ? -13.612 199.654 38.406  1.00 53.40  ? 1433 VAL A CG1   1 
ATOM   4816  C  CG2   . VAL A 1 679 ? -12.407 201.884 38.285  1.00 58.01  ? 1433 VAL A CG2   1 
ATOM   4817  N  N     . VAL A 1 680 ? -11.711 197.839 36.331  1.00 70.40  ? 1434 VAL A N     1 
ATOM   4818  C  CA    . VAL A 1 680 ? -11.875 196.420 36.092  1.00 66.09  ? 1434 VAL A CA    1 
ATOM   4819  C  C     . VAL A 1 680 ? -10.594 195.682 36.487  1.00 67.95  ? 1434 VAL A C     1 
ATOM   4820  O  O     . VAL A 1 680 ? -10.649 194.606 37.087  1.00 70.56  ? 1434 VAL A O     1 
ATOM   4821  C  CB    . VAL A 1 680 ? -12.140 196.146 34.633  1.00 66.45  ? 1434 VAL A CB    1 
ATOM   4822  C  CG1   . VAL A 1 680 ? -10.871 196.434 33.819  1.00 79.51  ? 1434 VAL A CG1   1 
ATOM   4823  C  CG2   . VAL A 1 680 ? -12.601 194.709 34.449  1.00 54.44  ? 1434 VAL A CG2   1 
ATOM   4824  N  N     . LEU A 1 681 ? -9.440  196.255 36.141  1.00 65.18  ? 1435 LEU A N     1 
ATOM   4825  C  CA    . LEU A 1 681 ? -8.154  195.661 36.509  1.00 62.31  ? 1435 LEU A CA    1 
ATOM   4826  C  C     . LEU A 1 681 ? -8.010  195.583 38.032  1.00 61.93  ? 1435 LEU A C     1 
ATOM   4827  O  O     . LEU A 1 681 ? -7.631  194.555 38.593  1.00 63.70  ? 1435 LEU A O     1 
ATOM   4828  C  CB    . LEU A 1 681 ? -6.981  196.435 35.889  1.00 56.76  ? 1435 LEU A CB    1 
ATOM   4829  C  CG    . LEU A 1 681 ? -6.697  196.184 34.401  1.00 57.84  ? 1435 LEU A CG    1 
ATOM   4830  C  CD1   . LEU A 1 681 ? -5.518  197.010 33.917  1.00 52.99  ? 1435 LEU A CD1   1 
ATOM   4831  C  CD2   . LEU A 1 681 ? -6.448  194.717 34.191  1.00 56.60  ? 1435 LEU A CD2   1 
ATOM   4832  N  N     . GLN A 1 682 ? -8.330  196.675 38.702  1.00 55.13  ? 1436 GLN A N     1 
ATOM   4833  C  CA    . GLN A 1 682 ? -8.291  196.682 40.145  1.00 51.01  ? 1436 GLN A CA    1 
ATOM   4834  C  C     . GLN A 1 682 ? -9.227  195.645 40.773  1.00 48.92  ? 1436 GLN A C     1 
ATOM   4835  O  O     . GLN A 1 682 ? -8.907  195.085 41.815  1.00 53.49  ? 1436 GLN A O     1 
ATOM   4836  C  CB    . GLN A 1 682 ? -8.560  198.088 40.658  1.00 49.90  ? 1436 GLN A CB    1 
ATOM   4837  C  CG    . GLN A 1 682 ? -7.335  198.963 40.556  1.00 59.16  ? 1436 GLN A CG    1 
ATOM   4838  C  CD    . GLN A 1 682 ? -7.630  200.405 40.858  1.00 66.87  ? 1436 GLN A CD    1 
ATOM   4839  O  OE1   . GLN A 1 682 ? -8.773  200.852 40.743  1.00 70.21  ? 1436 GLN A OE1   1 
ATOM   4840  N  NE2   . GLN A 1 682 ? -6.599  201.151 41.252  1.00 70.49  ? 1436 GLN A NE2   1 
ATOM   4841  N  N     . GLU A 1 683 ? -10.370 195.367 40.151  1.00 52.07  ? 1437 GLU A N     1 
ATOM   4842  C  CA    . GLU A 1 683 ? -11.203 194.270 40.654  1.00 60.00  ? 1437 GLU A CA    1 
ATOM   4843  C  C     . GLU A 1 683 ? -10.436 192.953 40.546  1.00 67.16  ? 1437 GLU A C     1 
ATOM   4844  O  O     . GLU A 1 683 ? -10.438 192.160 41.483  1.00 72.69  ? 1437 GLU A O     1 
ATOM   4845  C  CB    . GLU A 1 683 ? -12.578 194.174 39.962  1.00 61.16  ? 1437 GLU A CB    1 
ATOM   4846  C  CG    . GLU A 1 683 ? -13.628 195.214 40.417  1.00 63.22  ? 1437 GLU A CG    1 
ATOM   4847  N  N     . GLU A 1 684 ? -9.758  192.724 39.423  1.00 64.18  ? 1438 GLU A N     1 
ATOM   4848  C  CA    . GLU A 1 684 ? -8.965  191.496 39.289  1.00 62.46  ? 1438 GLU A CA    1 
ATOM   4849  C  C     . GLU A 1 684 ? -7.807  191.390 40.312  1.00 66.83  ? 1438 GLU A C     1 
ATOM   4850  O  O     . GLU A 1 684 ? -7.511  190.312 40.812  1.00 66.08  ? 1438 GLU A O     1 
ATOM   4851  C  CB    . GLU A 1 684 ? -8.445  191.296 37.860  1.00 56.98  ? 1438 GLU A CB    1 
ATOM   4852  C  CG    . GLU A 1 684 ? -7.740  189.944 37.698  1.00 62.71  ? 1438 GLU A CG    1 
ATOM   4853  C  CD    . GLU A 1 684 ? -7.101  189.699 36.329  1.00 73.92  ? 1438 GLU A CD    1 
ATOM   4854  O  OE1   . GLU A 1 684 ? -6.704  188.529 36.079  1.00 68.86  ? 1438 GLU A OE1   1 
ATOM   4855  O  OE2   . GLU A 1 684 ? -6.992  190.659 35.519  1.00 75.98  ? 1438 GLU A OE2   1 
ATOM   4856  N  N     . GLU A 1 685 ? -7.159  192.512 40.601  1.00 63.41  ? 1439 GLU A N     1 
ATOM   4857  C  CA    . GLU A 1 685 ? -6.108  192.586 41.600  1.00 62.08  ? 1439 GLU A CA    1 
ATOM   4858  C  C     . GLU A 1 685 ? -6.639  192.074 42.948  1.00 60.81  ? 1439 GLU A C     1 
ATOM   4859  O  O     . GLU A 1 685 ? -6.009  191.250 43.631  1.00 63.77  ? 1439 GLU A O     1 
ATOM   4860  C  CB    . GLU A 1 685 ? -5.661  194.039 41.735  1.00 72.39  ? 1439 GLU A CB    1 
ATOM   4861  C  CG    . GLU A 1 685 ? -4.180  194.265 41.932  1.00 87.70  ? 1439 GLU A CG    1 
ATOM   4862  C  CD    . GLU A 1 685 ? -3.807  195.755 41.930  1.00 108.07 ? 1439 GLU A CD    1 
ATOM   4863  O  OE1   . GLU A 1 685 ? -2.769  196.116 41.322  1.00 116.20 ? 1439 GLU A OE1   1 
ATOM   4864  O  OE2   . GLU A 1 685 ? -4.549  196.567 42.538  1.00 113.77 ? 1439 GLU A OE2   1 
ATOM   4865  N  N     . ALA A 1 686 ? -7.811  192.564 43.324  1.00 51.32  ? 1440 ALA A N     1 
ATOM   4866  C  CA    . ALA A 1 686 ? -8.430  192.148 44.565  1.00 50.45  ? 1440 ALA A CA    1 
ATOM   4867  C  C     . ALA A 1 686 ? -8.716  190.649 44.550  1.00 59.17  ? 1440 ALA A C     1 
ATOM   4868  O  O     . ALA A 1 686 ? -8.359  189.948 45.494  1.00 68.94  ? 1440 ALA A O     1 
ATOM   4869  C  CB    . ALA A 1 686 ? -9.694  192.932 44.812  1.00 45.94  ? 1440 ALA A CB    1 
ATOM   4870  N  N     . GLU A 1 687 ? -9.342  190.145 43.485  1.00 56.68  ? 1441 GLU A N     1 
ATOM   4871  C  CA    . GLU A 1 687 ? -9.679  188.724 43.454  1.00 53.76  ? 1441 GLU A CA    1 
ATOM   4872  C  C     . GLU A 1 687 ? -8.412  187.847 43.557  1.00 57.16  ? 1441 GLU A C     1 
ATOM   4873  O  O     . GLU A 1 687 ? -8.407  186.843 44.279  1.00 60.08  ? 1441 GLU A O     1 
ATOM   4874  C  CB    . GLU A 1 687 ? -10.562 188.364 42.251  1.00 42.47  ? 1441 GLU A CB    1 
ATOM   4875  N  N     . LEU A 1 688 ? -7.334  188.245 42.880  1.00 55.02  ? 1442 LEU A N     1 
ATOM   4876  C  CA    . LEU A 1 688 ? -6.072  187.496 42.934  1.00 53.84  ? 1442 LEU A CA    1 
ATOM   4877  C  C     . LEU A 1 688 ? -5.485  187.460 44.334  1.00 63.17  ? 1442 LEU A C     1 
ATOM   4878  O  O     . LEU A 1 688 ? -5.053  186.411 44.823  1.00 70.56  ? 1442 LEU A O     1 
ATOM   4879  C  CB    . LEU A 1 688 ? -5.048  188.063 41.949  1.00 49.83  ? 1442 LEU A CB    1 
ATOM   4880  C  CG    . LEU A 1 688 ? -5.484  187.850 40.491  1.00 52.32  ? 1442 LEU A CG    1 
ATOM   4881  C  CD1   . LEU A 1 688 ? -4.665  188.657 39.532  1.00 52.49  ? 1442 LEU A CD1   1 
ATOM   4882  C  CD2   . LEU A 1 688 ? -5.390  186.400 40.121  1.00 41.31  ? 1442 LEU A CD2   1 
ATOM   4883  N  N     . ARG A 1 689 ? -5.477  188.612 44.984  1.00 58.48  ? 1443 ARG A N     1 
ATOM   4884  C  CA    . ARG A 1 689 ? -5.036  188.673 46.368  1.00 46.87  ? 1443 ARG A CA    1 
ATOM   4885  C  C     . ARG A 1 689 ? -5.854  187.769 47.307  1.00 51.69  ? 1443 ARG A C     1 
ATOM   4886  O  O     . ARG A 1 689 ? -5.265  187.064 48.124  1.00 61.52  ? 1443 ARG A O     1 
ATOM   4887  C  CB    . ARG A 1 689 ? -5.010  190.114 46.857  1.00 43.23  ? 1443 ARG A CB    1 
ATOM   4888  C  CG    . ARG A 1 689 ? -3.918  190.946 46.204  1.00 46.26  ? 1443 ARG A CG    1 
ATOM   4889  C  CD    . ARG A 1 689 ? -3.847  192.337 46.776  1.00 52.20  ? 1443 ARG A CD    1 
ATOM   4890  N  NE    . ARG A 1 689 ? -2.754  193.092 46.176  1.00 74.67  ? 1443 ARG A NE    1 
ATOM   4891  C  CZ    . ARG A 1 689 ? -2.926  194.238 45.525  1.00 80.36  ? 1443 ARG A CZ    1 
ATOM   4892  N  NH1   . ARG A 1 689 ? -4.152  194.746 45.429  1.00 80.91  ? 1443 ARG A NH1   1 
ATOM   4893  N  NH2   . ARG A 1 689 ? -1.887  194.877 44.979  1.00 72.76  ? 1443 ARG A NH2   1 
ATOM   4894  N  N     . GLU A 1 690 ? -7.187  187.759 47.207  1.00 45.77  ? 1444 GLU A N     1 
ATOM   4895  C  CA    . GLU A 1 690 ? -7.949  186.865 48.091  1.00 49.81  ? 1444 GLU A CA    1 
ATOM   4896  C  C     . GLU A 1 690 ? -7.491  185.457 47.813  1.00 51.17  ? 1444 GLU A C     1 
ATOM   4897  O  O     . GLU A 1 690 ? -7.255  184.691 48.737  1.00 58.56  ? 1444 GLU A O     1 
ATOM   4898  C  CB    . GLU A 1 690 ? -9.479  186.975 47.943  1.00 60.42  ? 1444 GLU A CB    1 
ATOM   4899  C  CG    . GLU A 1 690 ? -10.109 188.222 48.577  1.00 93.48  ? 1444 GLU A CG    1 
ATOM   4900  C  CD    . GLU A 1 690 ? -11.353 188.738 47.818  1.00 116.80 ? 1444 GLU A CD    1 
ATOM   4901  O  OE1   . GLU A 1 690 ? -11.995 187.942 47.085  1.00 122.24 ? 1444 GLU A OE1   1 
ATOM   4902  O  OE2   . GLU A 1 690 ? -11.680 189.948 47.949  1.00 120.78 ? 1444 GLU A OE2   1 
ATOM   4903  N  N     . LYS A 1 691 ? -7.345  185.129 46.529  1.00 53.16  ? 1445 LYS A N     1 
ATOM   4904  C  CA    . LYS A 1 691 ? -6.978  183.787 46.094  1.00 53.25  ? 1445 LYS A CA    1 
ATOM   4905  C  C     . LYS A 1 691 ? -5.615  183.390 46.686  1.00 53.78  ? 1445 LYS A C     1 
ATOM   4906  O  O     . LYS A 1 691 ? -5.420  182.280 47.205  1.00 49.69  ? 1445 LYS A O     1 
ATOM   4907  C  CB    . LYS A 1 691 ? -6.950  183.754 44.565  1.00 51.47  ? 1445 LYS A CB    1 
ATOM   4908  C  CG    . LYS A 1 691 ? -6.943  182.360 43.942  1.00 60.14  ? 1445 LYS A CG    1 
ATOM   4909  C  CD    . LYS A 1 691 ? -7.382  182.375 42.468  1.00 69.95  ? 1445 LYS A CD    1 
ATOM   4910  N  N     . ILE A 1 692 ? -4.671  184.315 46.634  1.00 47.26  ? 1446 ILE A N     1 
ATOM   4911  C  CA    . ILE A 1 692 ? -3.327  184.000 47.088  1.00 47.48  ? 1446 ILE A CA    1 
ATOM   4912  C  C     . ILE A 1 692 ? -3.281  183.750 48.590  1.00 46.19  ? 1446 ILE A C     1 
ATOM   4913  O  O     . ILE A 1 692 ? -2.582  182.864 49.071  1.00 43.44  ? 1446 ILE A O     1 
ATOM   4914  C  CB    . ILE A 1 692 ? -2.326  185.090 46.635  1.00 46.01  ? 1446 ILE A CB    1 
ATOM   4915  C  CG1   . ILE A 1 692 ? -2.238  185.043 45.092  1.00 42.89  ? 1446 ILE A CG1   1 
ATOM   4916  C  CG2   . ILE A 1 692 ? -0.974  184.932 47.361  1.00 40.00  ? 1446 ILE A CG2   1 
ATOM   4917  C  CD1   . ILE A 1 692 ? -1.269  186.031 44.432  1.00 47.63  ? 1446 ILE A CD1   1 
ATOM   4918  N  N     . ALA A 1 693 ? -4.045  184.544 49.324  1.00 52.81  ? 1447 ALA A N     1 
ATOM   4919  C  CA    . ALA A 1 693 ? -4.138  184.412 50.766  1.00 40.93  ? 1447 ALA A CA    1 
ATOM   4920  C  C     . ALA A 1 693 ? -4.623  183.015 51.068  1.00 51.28  ? 1447 ALA A C     1 
ATOM   4921  O  O     . ALA A 1 693 ? -4.000  182.315 51.856  1.00 57.02  ? 1447 ALA A O     1 
ATOM   4922  C  CB    . ALA A 1 693 ? -5.112  185.426 51.315  1.00 42.79  ? 1447 ALA A CB    1 
ATOM   4923  N  N     . MET A 1 694 ? -5.720  182.595 50.418  1.00 44.86  ? 1448 MET A N     1 
ATOM   4924  C  CA    . MET A 1 694 ? -6.318  181.306 50.751  1.00 47.63  ? 1448 MET A CA    1 
ATOM   4925  C  C     . MET A 1 694 ? -5.326  180.189 50.483  1.00 50.00  ? 1448 MET A C     1 
ATOM   4926  O  O     . MET A 1 694 ? -5.227  179.238 51.248  1.00 60.85  ? 1448 MET A O     1 
ATOM   4927  C  CB    . MET A 1 694 ? -7.689  181.080 50.078  1.00 42.64  ? 1448 MET A CB    1 
ATOM   4928  C  CG    . MET A 1 694 ? -8.912  181.328 51.032  1.00 43.07  ? 1448 MET A CG    1 
ATOM   4929  N  N     . LEU A 1 695 ? -4.555  180.332 49.420  1.00 48.31  ? 1449 LEU A N     1 
ATOM   4930  C  CA    . LEU A 1 695 ? -3.618  179.294 49.058  1.00 52.42  ? 1449 LEU A CA    1 
ATOM   4931  C  C     . LEU A 1 695 ? -2.405  179.280 50.016  1.00 50.54  ? 1449 LEU A C     1 
ATOM   4932  O  O     . LEU A 1 695 ? -1.955  178.226 50.466  1.00 59.87  ? 1449 LEU A O     1 
ATOM   4933  C  CB    . LEU A 1 695 ? -3.190  179.469 47.590  1.00 54.93  ? 1449 LEU A CB    1 
ATOM   4934  C  CG    . LEU A 1 695 ? -4.271  179.309 46.513  1.00 46.75  ? 1449 LEU A CG    1 
ATOM   4935  C  CD1   . LEU A 1 695 ? -3.710  179.616 45.143  1.00 55.61  ? 1449 LEU A CD1   1 
ATOM   4936  C  CD2   . LEU A 1 695 ? -4.783  177.912 46.514  1.00 40.50  ? 1449 LEU A CD2   1 
ATOM   4937  N  N     . ALA A 1 696 ? -1.865  180.452 50.313  1.00 47.10  ? 1450 ALA A N     1 
ATOM   4938  C  CA    . ALA A 1 696 ? -0.729  180.540 51.214  1.00 50.61  ? 1450 ALA A CA    1 
ATOM   4939  C  C     . ALA A 1 696 ? -1.034  179.792 52.524  1.00 58.82  ? 1450 ALA A C     1 
ATOM   4940  O  O     . ALA A 1 696 ? -0.312  178.884 52.931  1.00 60.16  ? 1450 ALA A O     1 
ATOM   4941  C  CB    . ALA A 1 696 ? -0.408  181.997 51.490  1.00 41.63  ? 1450 ALA A CB    1 
ATOM   4942  N  N     . ALA A 1 697 ? -2.132  180.178 53.159  1.00 56.74  ? 1451 ALA A N     1 
ATOM   4943  C  CA    . ALA A 1 697 ? -2.604  179.547 54.376  1.00 47.75  ? 1451 ALA A CA    1 
ATOM   4944  C  C     . ALA A 1 697 ? -2.610  178.024 54.331  1.00 51.78  ? 1451 ALA A C     1 
ATOM   4945  O  O     . ALA A 1 697 ? -2.267  177.383 55.310  1.00 63.30  ? 1451 ALA A O     1 
ATOM   4946  C  CB    . ALA A 1 697 ? -3.980  180.062 54.716  1.00 48.25  ? 1451 ALA A CB    1 
ATOM   4947  N  N     . ILE A 1 698 ? -3.020  177.438 53.217  1.00 46.65  ? 1452 ILE A N     1 
ATOM   4948  C  CA    . ILE A 1 698 ? -2.979  175.988 53.091  1.00 46.17  ? 1452 ILE A CA    1 
ATOM   4949  C  C     . ILE A 1 698 ? -1.542  175.497 53.193  1.00 48.72  ? 1452 ILE A C     1 
ATOM   4950  O  O     . ILE A 1 698 ? -1.253  174.506 53.840  1.00 63.32  ? 1452 ILE A O     1 
ATOM   4951  C  CB    . ILE A 1 698 ? -3.593  175.517 51.775  1.00 42.85  ? 1452 ILE A CB    1 
ATOM   4952  C  CG1   . ILE A 1 698 ? -5.098  175.782 51.783  1.00 42.03  ? 1452 ILE A CG1   1 
ATOM   4953  C  CG2   . ILE A 1 698 ? -3.332  174.043 51.558  1.00 38.85  ? 1452 ILE A CG2   1 
ATOM   4954  C  CD1   . ILE A 1 698 ? -5.677  175.968 50.392  1.00 39.55  ? 1452 ILE A CD1   1 
ATOM   4955  N  N     . ILE A 1 699 ? -0.636  176.205 52.557  1.00 43.54  ? 1453 ILE A N     1 
ATOM   4956  C  CA    . ILE A 1 699 ? 0.757   175.815 52.574  1.00 51.32  ? 1453 ILE A CA    1 
ATOM   4957  C  C     . ILE A 1 699 ? 1.330   176.033 53.989  1.00 55.85  ? 1453 ILE A C     1 
ATOM   4958  O  O     . ILE A 1 699 ? 2.058   175.185 54.518  1.00 60.87  ? 1453 ILE A O     1 
ATOM   4959  C  CB    . ILE A 1 699 ? 1.525   176.600 51.485  1.00 54.40  ? 1453 ILE A CB    1 
ATOM   4960  C  CG1   . ILE A 1 699 ? 1.032   176.148 50.102  1.00 57.69  ? 1453 ILE A CG1   1 
ATOM   4961  C  CG2   . ILE A 1 699 ? 3.030   176.446 51.621  1.00 42.41  ? 1453 ILE A CG2   1 
ATOM   4962  C  CD1   . ILE A 1 699 ? 1.287   177.146 48.972  1.00 64.40  ? 1453 ILE A CD1   1 
ATOM   4963  N  N     . GLY A 1 700 ? 0.954   177.146 54.613  1.00 57.87  ? 1454 GLY A N     1 
ATOM   4964  C  CA    . GLY A 1 700 ? 1.492   177.548 55.911  1.00 59.22  ? 1454 GLY A CA    1 
ATOM   4965  C  C     . GLY A 1 700 ? 0.901   176.945 57.182  1.00 56.95  ? 1454 GLY A C     1 
ATOM   4966  O  O     . GLY A 1 700 ? 1.546   176.984 58.226  1.00 66.86  ? 1454 GLY A O     1 
ATOM   4967  N  N     . ASP A 1 701 ? -0.296  176.368 57.095  1.00 47.15  ? 1455 ASP A N     1 
ATOM   4968  C  CA    . ASP A 1 701 ? -0.979  175.824 58.257  1.00 49.12  ? 1455 ASP A CA    1 
ATOM   4969  C  C     . ASP A 1 701 ? -1.540  174.413 58.071  1.00 49.01  ? 1455 ASP A C     1 
ATOM   4970  O  O     . ASP A 1 701 ? -2.577  174.215 57.408  1.00 43.40  ? 1455 ASP A O     1 
ATOM   4971  C  CB    . ASP A 1 701 ? -2.106  176.764 58.704  1.00 59.98  ? 1455 ASP A CB    1 
ATOM   4972  C  CG    . ASP A 1 701 ? -2.938  176.183 59.856  1.00 75.18  ? 1455 ASP A CG    1 
ATOM   4973  O  OD1   . ASP A 1 701 ? -2.365  175.762 60.904  1.00 85.01  ? 1455 ASP A OD1   1 
ATOM   4974  O  OD2   . ASP A 1 701 ? -4.177  176.134 59.696  1.00 72.93  ? 1455 ASP A OD2   1 
ATOM   4975  N  N     . GLU A 1 702 ? -0.895  173.457 58.745  1.00 54.74  ? 1456 GLU A N     1 
ATOM   4976  C  CA    . GLU A 1 702 ? -1.253  172.036 58.662  1.00 46.88  ? 1456 GLU A CA    1 
ATOM   4977  C  C     . GLU A 1 702 ? -2.747  171.780 58.886  1.00 43.81  ? 1456 GLU A C     1 
ATOM   4978  O  O     . GLU A 1 702 ? -3.367  170.994 58.184  1.00 42.66  ? 1456 GLU A O     1 
ATOM   4979  C  CB    . GLU A 1 702 ? -0.382  171.208 59.616  1.00 46.21  ? 1456 GLU A CB    1 
ATOM   4980  C  CG    . GLU A 1 702 ? 0.201   169.922 59.029  1.00 77.68  ? 1456 GLU A CG    1 
ATOM   4981  C  CD    . GLU A 1 702 ? 1.369   170.146 58.062  1.00 96.18  ? 1456 GLU A CD    1 
ATOM   4982  O  OE1   . GLU A 1 702 ? 1.721   169.207 57.311  1.00 101.54 ? 1456 GLU A OE1   1 
ATOM   4983  O  OE2   . GLU A 1 702 ? 1.949   171.247 58.056  1.00 102.45 ? 1456 GLU A OE2   1 
ATOM   4984  N  N     . ARG A 1 703 ? -3.338  172.447 59.862  1.00 54.60  ? 1457 ARG A N     1 
ATOM   4985  C  CA    . ARG A 1 703 ? -4.744  172.189 60.144  1.00 51.95  ? 1457 ARG A CA    1 
ATOM   4986  C  C     . ARG A 1 703 ? -5.623  172.616 58.962  1.00 46.64  ? 1457 ARG A C     1 
ATOM   4987  O  O     . ARG A 1 703 ? -6.534  171.895 58.564  1.00 43.91  ? 1457 ARG A O     1 
ATOM   4988  C  CB    . ARG A 1 703 ? -5.169  172.850 61.457  1.00 45.58  ? 1457 ARG A CB    1 
ATOM   4989  C  CG    . ARG A 1 703 ? -6.627  172.672 61.783  1.00 51.68  ? 1457 ARG A CG    1 
ATOM   4990  C  CD    . ARG A 1 703 ? -6.866  172.995 63.242  1.00 65.46  ? 1457 ARG A CD    1 
ATOM   4991  N  NE    . ARG A 1 703 ? -8.222  173.449 63.540  1.00 70.51  ? 1457 ARG A NE    1 
ATOM   4992  C  CZ    . ARG A 1 703 ? -8.563  174.045 64.676  1.00 77.15  ? 1457 ARG A CZ    1 
ATOM   4993  N  NH1   . ARG A 1 703 ? -7.649  174.257 65.621  1.00 90.13  ? 1457 ARG A NH1   1 
ATOM   4994  N  NH2   . ARG A 1 703 ? -9.811  174.432 64.874  1.00 70.70  ? 1457 ARG A NH2   1 
ATOM   4995  N  N     . THR A 1 704 ? -5.331  173.788 58.411  1.00 45.30  ? 1458 THR A N     1 
ATOM   4996  C  CA    . THR A 1 704 ? -6.023  174.291 57.241  1.00 52.58  ? 1458 THR A CA    1 
ATOM   4997  C  C     . THR A 1 704 ? -5.943  173.245 56.112  1.00 55.53  ? 1458 THR A C     1 
ATOM   4998  O  O     . THR A 1 704 ? -6.960  172.770 55.590  1.00 58.68  ? 1458 THR A O     1 
ATOM   4999  C  CB    . THR A 1 704 ? -5.390  175.615 56.783  1.00 53.26  ? 1458 THR A CB    1 
ATOM   5000  O  OG1   . THR A 1 704 ? -5.781  176.668 57.661  1.00 56.10  ? 1458 THR A OG1   1 
ATOM   5001  C  CG2   . THR A 1 704 ? -5.864  175.980 55.419  1.00 59.59  ? 1458 THR A CG2   1 
ATOM   5002  N  N     . MET A 1 705 ? -4.716  172.877 55.765  1.00 44.35  ? 1459 MET A N     1 
ATOM   5003  C  CA    . MET A 1 705 ? -4.462  171.832 54.789  1.00 43.22  ? 1459 MET A CA    1 
ATOM   5004  C  C     . MET A 1 705 ? -5.323  170.580 55.015  1.00 43.61  ? 1459 MET A C     1 
ATOM   5005  O  O     . MET A 1 705 ? -6.113  170.216 54.161  1.00 52.72  ? 1459 MET A O     1 
ATOM   5006  C  CB    . MET A 1 705 ? -2.961  171.521 54.752  1.00 42.10  ? 1459 MET A CB    1 
ATOM   5007  C  CG    . MET A 1 705 ? -2.557  170.662 53.604  1.00 40.92  ? 1459 MET A CG    1 
ATOM   5008  S  SD    . MET A 1 705 ? -2.883  168.967 54.076  1.00 62.94  ? 1459 MET A SD    1 
ATOM   5009  C  CE    . MET A 1 705 ? -1.784  168.826 55.476  1.00 44.92  ? 1459 MET A CE    1 
ATOM   5010  N  N     . TYR A 1 706 ? -5.185  169.938 56.170  1.00 51.52  ? 1460 TYR A N     1 
ATOM   5011  C  CA    . TYR A 1 706 ? -5.952  168.727 56.491  1.00 47.53  ? 1460 TYR A CA    1 
ATOM   5012  C  C     . TYR A 1 706 ? -7.480  168.935 56.456  1.00 54.68  ? 1460 TYR A C     1 
ATOM   5013  O  O     . TYR A 1 706 ? -8.237  168.017 56.149  1.00 55.61  ? 1460 TYR A O     1 
ATOM   5014  C  CB    . TYR A 1 706 ? -5.526  168.162 57.848  1.00 37.86  ? 1460 TYR A CB    1 
ATOM   5015  C  CG    . TYR A 1 706 ? -4.234  167.385 57.825  1.00 43.74  ? 1460 TYR A CG    1 
ATOM   5016  C  CD1   . TYR A 1 706 ? -4.092  166.263 57.027  1.00 51.37  ? 1460 TYR A CD1   1 
ATOM   5017  C  CD2   . TYR A 1 706 ? -3.152  167.763 58.608  1.00 41.98  ? 1460 TYR A CD2   1 
ATOM   5018  C  CE1   . TYR A 1 706 ? -2.897  165.545 57.006  1.00 48.43  ? 1460 TYR A CE1   1 
ATOM   5019  C  CE2   . TYR A 1 706 ? -1.960  167.040 58.595  1.00 41.73  ? 1460 TYR A CE2   1 
ATOM   5020  C  CZ    . TYR A 1 706 ? -1.845  165.944 57.787  1.00 46.79  ? 1460 TYR A CZ    1 
ATOM   5021  O  OH    . TYR A 1 706 ? -0.674  165.242 57.744  1.00 52.55  ? 1460 TYR A OH    1 
ATOM   5022  N  N     . ASN A 1 707 ? -7.958  170.130 56.772  1.00 46.25  ? 1461 ASN A N     1 
ATOM   5023  C  CA    . ASN A 1 707 ? -9.378  170.343 56.594  1.00 45.79  ? 1461 ASN A CA    1 
ATOM   5024  C  C     . ASN A 1 707 ? -9.779  170.220 55.141  1.00 56.89  ? 1461 ASN A C     1 
ATOM   5025  O  O     . ASN A 1 707 ? -10.789 169.604 54.847  1.00 64.75  ? 1461 ASN A O     1 
ATOM   5026  C  CB    . ASN A 1 707 ? -9.797  171.693 57.096  1.00 42.87  ? 1461 ASN A CB    1 
ATOM   5027  C  CG    . ASN A 1 707 ? -9.783  171.771 58.561  1.00 48.56  ? 1461 ASN A CG    1 
ATOM   5028  O  OD1   . ASN A 1 707 ? -9.956  170.766 59.246  1.00 53.94  ? 1461 ASN A OD1   1 
ATOM   5029  N  ND2   . ASN A 1 707 ? -9.566  172.970 59.078  1.00 59.83  ? 1461 ASN A ND2   1 
ATOM   5030  N  N     . LEU A 1 708 ? -8.992  170.828 54.248  1.00 56.31  ? 1462 LEU A N     1 
ATOM   5031  C  CA    . LEU A 1 708 ? -9.207  170.740 52.807  1.00 48.42  ? 1462 LEU A CA    1 
ATOM   5032  C  C     . LEU A 1 708 ? -9.278  169.301 52.369  1.00 47.95  ? 1462 LEU A C     1 
ATOM   5033  O  O     . LEU A 1 708 ? -10.207 168.890 51.651  1.00 41.81  ? 1462 LEU A O     1 
ATOM   5034  C  CB    . LEU A 1 708 ? -8.058  171.377 52.054  1.00 44.71  ? 1462 LEU A CB    1 
ATOM   5035  C  CG    . LEU A 1 708 ? -8.510  172.311 50.931  1.00 40.31  ? 1462 LEU A CG    1 
ATOM   5036  C  CD1   . LEU A 1 708 ? -7.427  172.411 49.917  1.00 62.98  ? 1462 LEU A CD1   1 
ATOM   5037  C  CD2   . LEU A 1 708 ? -9.774  171.803 50.334  1.00 39.82  ? 1462 LEU A CD2   1 
ATOM   5038  N  N     . MET A 1 709 ? -8.284  168.534 52.804  1.00 44.64  ? 1463 MET A N     1 
ATOM   5039  C  CA    . MET A 1 709 ? -8.234  167.130 52.478  1.00 37.57  ? 1463 MET A CA    1 
ATOM   5040  C  C     . MET A 1 709 ? -9.526  166.444 52.905  1.00 39.55  ? 1463 MET A C     1 
ATOM   5041  O  O     . MET A 1 709 ? -10.118 165.691 52.148  1.00 48.28  ? 1463 MET A O     1 
ATOM   5042  C  CB    . MET A 1 709 ? -6.987  166.502 53.076  1.00 31.39  ? 1463 MET A CB    1 
ATOM   5043  C  CG    . MET A 1 709 ? -6.897  164.985 53.085  1.00 31.73  ? 1463 MET A CG    1 
ATOM   5044  S  SD    . MET A 1 709 ? -5.154  164.716 53.495  1.00 50.91  ? 1463 MET A SD    1 
ATOM   5045  C  CE    . MET A 1 709 ? -5.129  162.983 53.867  1.00 45.25  ? 1463 MET A CE    1 
ATOM   5046  N  N     . LYS A 1 710 ? -9.996  166.732 54.106  1.00 41.78  ? 1464 LYS A N     1 
ATOM   5047  C  CA    . LYS A 1 710 ? -11.215 166.088 54.567  1.00 47.92  ? 1464 LYS A CA    1 
ATOM   5048  C  C     . LYS A 1 710 ? -12.417 166.514 53.710  1.00 49.95  ? 1464 LYS A C     1 
ATOM   5049  O  O     . LYS A 1 710 ? -13.243 165.674 53.323  1.00 55.22  ? 1464 LYS A O     1 
ATOM   5050  C  CB    . LYS A 1 710 ? -11.444 166.335 56.064  1.00 39.26  ? 1464 LYS A CB    1 
ATOM   5051  C  CG    . LYS A 1 710 ? -10.805 165.279 56.942  1.00 41.12  ? 1464 LYS A CG    1 
ATOM   5052  C  CD    . LYS A 1 710 ? -10.233 165.882 58.225  1.00 51.19  ? 1464 LYS A CD    1 
ATOM   5053  C  CE    . LYS A 1 710 ? -11.261 166.797 58.887  1.00 55.69  ? 1464 LYS A CE    1 
ATOM   5054  N  NZ    . LYS A 1 710 ? -10.588 167.944 59.524  1.00 53.34  ? 1464 LYS A NZ    1 
ATOM   5055  N  N     . LYS A 1 711 ? -12.486 167.808 53.394  1.00 39.29  ? 1465 LYS A N     1 
ATOM   5056  C  CA    . LYS A 1 711 ? -13.591 168.353 52.619  1.00 45.33  ? 1465 LYS A CA    1 
ATOM   5057  C  C     . LYS A 1 711 ? -13.667 167.606 51.293  1.00 57.06  ? 1465 LYS A C     1 
ATOM   5058  O  O     . LYS A 1 711 ? -14.750 167.174 50.877  1.00 66.98  ? 1465 LYS A O     1 
ATOM   5059  C  CB    . LYS A 1 711 ? -13.431 169.857 52.393  1.00 37.48  ? 1465 LYS A CB    1 
ATOM   5060  C  CG    . LYS A 1 711 ? -14.514 170.451 51.536  1.00 42.04  ? 1465 LYS A CG    1 
ATOM   5061  C  CD    . LYS A 1 711 ? -14.717 171.965 51.749  1.00 50.05  ? 1465 LYS A CD    1 
ATOM   5062  C  CE    . LYS A 1 711 ? -14.022 172.842 50.708  1.00 74.37  ? 1465 LYS A CE    1 
ATOM   5063  N  NZ    . LYS A 1 711 ? -14.422 172.538 49.286  1.00 88.67  ? 1465 LYS A NZ    1 
ATOM   5064  N  N     . GLU A 1 712 ? -12.511 167.425 50.651  1.00 55.71  ? 1466 GLU A N     1 
ATOM   5065  C  CA    . GLU A 1 712 ? -12.481 166.823 49.325  1.00 49.49  ? 1466 GLU A CA    1 
ATOM   5066  C  C     . GLU A 1 712 ? -12.805 165.329 49.392  1.00 49.48  ? 1466 GLU A C     1 
ATOM   5067  O  O     . GLU A 1 712 ? -13.567 164.812 48.568  1.00 60.27  ? 1466 GLU A O     1 
ATOM   5068  C  CB    . GLU A 1 712 ? -11.153 167.112 48.610  1.00 49.87  ? 1466 GLU A CB    1 
ATOM   5069  C  CG    . GLU A 1 712 ? -11.008 168.579 48.183  1.00 63.91  ? 1466 GLU A CG    1 
ATOM   5070  C  CD    . GLU A 1 712 ? -9.612  168.959 47.640  1.00 76.44  ? 1466 GLU A CD    1 
ATOM   5071  O  OE1   . GLU A 1 712 ? -8.714  168.081 47.605  1.00 78.67  ? 1466 GLU A OE1   1 
ATOM   5072  O  OE2   . GLU A 1 712 ? -9.423  170.147 47.243  1.00 77.13  ? 1466 GLU A OE2   1 
ATOM   5073  N  N     . LEU A 1 713 ? -12.260 164.646 50.393  1.00 45.98  ? 1467 LEU A N     1 
ATOM   5074  C  CA    . LEU A 1 713 ? -12.587 163.239 50.610  1.00 44.61  ? 1467 LEU A CA    1 
ATOM   5075  C  C     . LEU A 1 713 ? -14.095 163.033 50.763  1.00 51.55  ? 1467 LEU A C     1 
ATOM   5076  O  O     . LEU A 1 713 ? -14.665 162.098 50.191  1.00 53.44  ? 1467 LEU A O     1 
ATOM   5077  C  CB    . LEU A 1 713 ? -11.812 162.680 51.808  1.00 34.52  ? 1467 LEU A CB    1 
ATOM   5078  C  CG    . LEU A 1 713 ? -10.394 162.272 51.402  1.00 42.27  ? 1467 LEU A CG    1 
ATOM   5079  C  CD1   . LEU A 1 713 ? -9.440  161.976 52.556  1.00 42.09  ? 1467 LEU A CD1   1 
ATOM   5080  C  CD2   . LEU A 1 713 ? -10.502 161.075 50.497  1.00 39.74  ? 1467 LEU A CD2   1 
ATOM   5081  N  N     . ARG A 1 714 ? -14.752 163.923 51.502  1.00 43.36  ? 1468 ARG A N     1 
ATOM   5082  C  CA    . ARG A 1 714 ? -16.186 163.780 51.694  1.00 39.76  ? 1468 ARG A CA    1 
ATOM   5083  C  C     . ARG A 1 714 ? -16.958 164.025 50.393  1.00 52.68  ? 1468 ARG A C     1 
ATOM   5084  O  O     . ARG A 1 714 ? -17.921 163.308 50.117  1.00 58.11  ? 1468 ARG A O     1 
ATOM   5085  C  CB    . ARG A 1 714 ? -16.697 164.674 52.819  1.00 35.12  ? 1468 ARG A CB    1 
ATOM   5086  C  CG    . ARG A 1 714 ? -16.020 164.429 54.155  1.00 48.06  ? 1468 ARG A CG    1 
ATOM   5087  C  CD    . ARG A 1 714 ? -16.831 165.060 55.307  1.00 59.58  ? 1468 ARG A CD    1 
ATOM   5088  N  NE    . ARG A 1 714 ? -16.189 164.954 56.624  1.00 65.78  ? 1468 ARG A NE    1 
ATOM   5089  C  CZ    . ARG A 1 714 ? -15.436 165.917 57.146  1.00 70.58  ? 1468 ARG A CZ    1 
ATOM   5090  N  NH1   . ARG A 1 714 ? -15.229 167.047 56.453  1.00 64.53  ? 1468 ARG A NH1   1 
ATOM   5091  N  NH2   . ARG A 1 714 ? -14.889 165.754 58.350  1.00 71.41  ? 1468 ARG A NH2   1 
ATOM   5092  N  N     . GLU A 1 715 ? -16.546 165.016 49.590  1.00 45.60  ? 1469 GLU A N     1 
ATOM   5093  C  CA    . GLU A 1 715 ? -17.194 165.223 48.289  1.00 49.86  ? 1469 GLU A CA    1 
ATOM   5094  C  C     . GLU A 1 715 ? -17.125 163.932 47.451  1.00 54.09  ? 1469 GLU A C     1 
ATOM   5095  O  O     . GLU A 1 715 ? -18.138 163.479 46.912  1.00 47.49  ? 1469 GLU A O     1 
ATOM   5096  C  CB    . GLU A 1 715 ? -16.625 166.426 47.525  1.00 38.10  ? 1469 GLU A CB    1 
ATOM   5097  C  CG    . GLU A 1 715 ? -17.047 167.803 48.075  1.00 60.03  ? 1469 GLU A CG    1 
ATOM   5098  C  CD    . GLU A 1 715 ? -16.063 168.954 47.735  1.00 105.91 ? 1469 GLU A CD    1 
ATOM   5099  O  OE1   . GLU A 1 715 ? -15.264 168.811 46.782  1.00 106.05 ? 1469 GLU A OE1   1 
ATOM   5100  O  OE2   . GLU A 1 715 ? -16.086 170.005 48.424  1.00 101.54 ? 1469 GLU A OE2   1 
ATOM   5101  N  N     . VAL A 1 716 ? -15.946 163.318 47.382  1.00 47.63  ? 1470 VAL A N     1 
ATOM   5102  C  CA    . VAL A 1 716 ? -15.785 162.098 46.608  1.00 45.78  ? 1470 VAL A CA    1 
ATOM   5103  C  C     . VAL A 1 716 ? -16.715 161.006 47.110  1.00 48.94  ? 1470 VAL A C     1 
ATOM   5104  O  O     . VAL A 1 716 ? -17.370 160.313 46.322  1.00 49.14  ? 1470 VAL A O     1 
ATOM   5105  C  CB    . VAL A 1 716 ? -14.345 161.584 46.662  1.00 44.61  ? 1470 VAL A CB    1 
ATOM   5106  C  CG1   . VAL A 1 716 ? -14.284 160.137 46.195  1.00 40.89  ? 1470 VAL A CG1   1 
ATOM   5107  C  CG2   . VAL A 1 716 ? -13.467 162.441 45.804  1.00 46.83  ? 1470 VAL A CG2   1 
ATOM   5108  N  N     . LYS A 1 717 ? -16.762 160.850 48.430  1.00 47.79  ? 1471 LYS A N     1 
ATOM   5109  C  CA    . LYS A 1 717 ? -17.660 159.874 49.038  1.00 46.40  ? 1471 LYS A CA    1 
ATOM   5110  C  C     . LYS A 1 717 ? -19.097 160.191 48.678  1.00 47.00  ? 1471 LYS A C     1 
ATOM   5111  O  O     . LYS A 1 717 ? -19.819 159.313 48.218  1.00 51.42  ? 1471 LYS A O     1 
ATOM   5112  C  CB    . LYS A 1 717 ? -17.491 159.848 50.555  1.00 49.66  ? 1471 LYS A CB    1 
ATOM   5113  C  CG    . LYS A 1 717 ? -18.648 159.207 51.288  1.00 47.71  ? 1471 LYS A CG    1 
ATOM   5114  C  CD    . LYS A 1 717 ? -18.322 159.124 52.761  1.00 50.62  ? 1471 LYS A CD    1 
ATOM   5115  C  CE    . LYS A 1 717 ? -19.453 158.500 53.562  1.00 56.89  ? 1471 LYS A CE    1 
ATOM   5116  N  NZ    . LYS A 1 717 ? -19.659 159.185 54.875  1.00 51.97  ? 1471 LYS A NZ    1 
ATOM   5117  N  N     . LYS A 1 718 ? -19.497 161.455 48.844  1.00 41.29  ? 1472 LYS A N     1 
ATOM   5118  C  CA    . LYS A 1 718 ? -20.867 161.846 48.538  1.00 46.56  ? 1472 LYS A CA    1 
ATOM   5119  C  C     . LYS A 1 718 ? -21.225 161.489 47.100  1.00 56.27  ? 1472 LYS A C     1 
ATOM   5120  O  O     . LYS A 1 718 ? -22.365 161.131 46.801  1.00 65.13  ? 1472 LYS A O     1 
ATOM   5121  C  CB    . LYS A 1 718 ? -21.142 163.332 48.803  1.00 36.04  ? 1472 LYS A CB    1 
ATOM   5122  C  CG    . LYS A 1 718 ? -22.641 163.662 48.682  1.00 38.80  ? 1472 LYS A CG    1 
ATOM   5123  C  CD    . LYS A 1 718 ? -23.046 165.127 48.993  1.00 49.45  ? 1472 LYS A CD    1 
ATOM   5124  N  N     . LYS A 1 719 ? -20.237 161.562 46.218  1.00 55.64  ? 1473 LYS A N     1 
ATOM   5125  C  CA    . LYS A 1 719 ? -20.506 161.440 44.799  1.00 49.27  ? 1473 LYS A CA    1 
ATOM   5126  C  C     . LYS A 1 719 ? -20.514 160.004 44.330  1.00 53.34  ? 1473 LYS A C     1 
ATOM   5127  O  O     . LYS A 1 719 ? -21.320 159.637 43.472  1.00 56.83  ? 1473 LYS A O     1 
ATOM   5128  C  CB    . LYS A 1 719 ? -19.509 162.270 43.978  1.00 47.23  ? 1473 LYS A CB    1 
ATOM   5129  C  CG    . LYS A 1 719 ? -19.600 162.048 42.494  1.00 53.05  ? 1473 LYS A CG    1 
ATOM   5130  C  CD    . LYS A 1 719 ? -18.896 163.115 41.692  1.00 57.22  ? 1473 LYS A CD    1 
ATOM   5131  C  CE    . LYS A 1 719 ? -19.388 163.037 40.234  1.00 70.20  ? 1473 LYS A CE    1 
ATOM   5132  N  NZ    . LYS A 1 719 ? -18.746 164.059 39.374  1.00 80.65  ? 1473 LYS A NZ    1 
ATOM   5133  N  N     . PHE A 1 720 ? -19.627 159.192 44.897  1.00 51.10  ? 1474 PHE A N     1 
ATOM   5134  C  CA    . PHE A 1 720 ? -19.398 157.844 44.378  1.00 48.83  ? 1474 PHE A CA    1 
ATOM   5135  C  C     . PHE A 1 720 ? -19.821 156.711 45.328  1.00 58.64  ? 1474 PHE A C     1 
ATOM   5136  O  O     . PHE A 1 720 ? -19.615 155.534 45.019  1.00 69.39  ? 1474 PHE A O     1 
ATOM   5137  C  CB    . PHE A 1 720 ? -17.922 157.681 44.004  1.00 48.65  ? 1474 PHE A CB    1 
ATOM   5138  C  CG    . PHE A 1 720 ? -17.481 158.550 42.852  1.00 47.90  ? 1474 PHE A CG    1 
ATOM   5139  C  CD1   . PHE A 1 720 ? -17.843 158.237 41.548  1.00 47.31  ? 1474 PHE A CD1   1 
ATOM   5140  C  CD2   . PHE A 1 720 ? -16.697 159.670 43.072  1.00 49.94  ? 1474 PHE A CD2   1 
ATOM   5141  C  CE1   . PHE A 1 720 ? -17.440 159.028 40.492  1.00 52.12  ? 1474 PHE A CE1   1 
ATOM   5142  C  CE2   . PHE A 1 720 ? -16.294 160.475 42.022  1.00 51.63  ? 1474 PHE A CE2   1 
ATOM   5143  C  CZ    . PHE A 1 720 ? -16.663 160.151 40.725  1.00 55.69  ? 1474 PHE A CZ    1 
ATOM   5144  N  N     . ALA A 1 721 ? -20.408 157.053 46.476  1.00 54.19  ? 1475 ALA A N     1 
ATOM   5145  C  CA    . ALA A 1 721 ? -20.732 156.028 47.467  1.00 45.80  ? 1475 ALA A CA    1 
ATOM   5146  C  C     . ALA A 1 721 ? -21.799 155.097 46.965  1.00 52.50  ? 1475 ALA A C     1 
ATOM   5147  O  O     . ALA A 1 721 ? -22.788 155.533 46.384  1.00 56.98  ? 1475 ALA A O     1 
ATOM   5148  C  CB    . ALA A 1 721 ? -21.192 156.639 48.736  1.00 43.37  ? 1475 ALA A CB    1 
ATOM   5149  N  N     . THR A 1 722 ? -21.599 153.813 47.219  1.00 55.30  ? 1476 THR A N     1 
ATOM   5150  C  CA    . THR A 1 722 ? -22.608 152.809 46.926  1.00 58.72  ? 1476 THR A CA    1 
ATOM   5151  C  C     . THR A 1 722 ? -22.558 151.818 48.059  1.00 63.99  ? 1476 THR A C     1 
ATOM   5152  O  O     . THR A 1 722 ? -21.525 151.706 48.729  1.00 67.93  ? 1476 THR A O     1 
ATOM   5153  C  CB    . THR A 1 722 ? -22.347 152.102 45.580  1.00 55.83  ? 1476 THR A CB    1 
ATOM   5154  O  OG1   . THR A 1 722 ? -21.090 151.403 45.612  1.00 59.44  ? 1476 THR A OG1   1 
ATOM   5155  C  CG2   . THR A 1 722 ? -22.320 153.133 44.450  1.00 54.33  ? 1476 THR A CG2   1 
ATOM   5156  N  N     . PRO A 1 723 ? -23.667 151.098 48.283  1.00 61.90  ? 1477 PRO A N     1 
ATOM   5157  C  CA    . PRO A 1 723 ? -23.866 150.241 49.467  1.00 53.28  ? 1477 PRO A CA    1 
ATOM   5158  C  C     . PRO A 1 723 ? -22.991 148.976 49.464  1.00 55.12  ? 1477 PRO A C     1 
ATOM   5159  O  O     . PRO A 1 723 ? -22.446 148.629 48.405  1.00 65.64  ? 1477 PRO A O     1 
ATOM   5160  C  CB    . PRO A 1 723 ? -25.362 149.878 49.382  1.00 48.84  ? 1477 PRO A CB    1 
ATOM   5161  C  CG    . PRO A 1 723 ? -25.981 150.903 48.430  1.00 43.09  ? 1477 PRO A CG    1 
ATOM   5162  C  CD    . PRO A 1 723 ? -24.864 151.131 47.428  1.00 55.87  ? 1477 PRO A CD    1 
ATOM   5163  N  N     . ARG A 1 724 ? -22.847 148.318 50.620  1.00 57.40  ? 1478 ARG A N     1 
ATOM   5164  C  CA    . ARG A 1 724 ? -22.161 147.025 50.697  1.00 54.50  ? 1478 ARG A CA    1 
ATOM   5165  C  C     . ARG A 1 724 ? -22.843 145.972 49.836  1.00 59.59  ? 1478 ARG A C     1 
ATOM   5166  O  O     . ARG A 1 724 ? -24.058 146.003 49.634  1.00 61.94  ? 1478 ARG A O     1 
ATOM   5167  C  CB    . ARG A 1 724 ? -22.103 146.479 52.121  1.00 47.03  ? 1478 ARG A CB    1 
ATOM   5168  C  CG    . ARG A 1 724 ? -21.121 147.171 53.052  1.00 59.41  ? 1478 ARG A CG    1 
ATOM   5169  C  CD    . ARG A 1 724 ? -20.804 146.309 54.302  1.00 56.57  ? 1478 ARG A CD    1 
ATOM   5170  N  NE    . ARG A 1 724 ? -19.881 145.239 53.962  1.00 49.03  ? 1478 ARG A NE    1 
ATOM   5171  C  CZ    . ARG A 1 724 ? -18.564 145.366 54.028  1.00 50.57  ? 1478 ARG A CZ    1 
ATOM   5172  N  NH1   . ARG A 1 724 ? -18.042 146.503 54.442  1.00 49.41  ? 1478 ARG A NH1   1 
ATOM   5173  N  NH2   . ARG A 1 724 ? -17.772 144.364 53.691  1.00 55.23  ? 1478 ARG A NH2   1 
ATOM   5174  N  N     . LEU A 1 725 ? -22.048 145.028 49.351  1.00 56.85  ? 1479 LEU A N     1 
ATOM   5175  C  CA    . LEU A 1 725 ? -22.570 143.907 48.598  1.00 62.26  ? 1479 LEU A CA    1 
ATOM   5176  C  C     . LEU A 1 725 ? -22.380 142.615 49.381  1.00 63.89  ? 1479 LEU A C     1 
ATOM   5177  O  O     . LEU A 1 725 ? -23.264 141.737 49.379  1.00 64.72  ? 1479 LEU A O     1 
ATOM   5178  C  CB    . LEU A 1 725 ? -21.823 143.783 47.274  1.00 65.17  ? 1479 LEU A CB    1 
ATOM   5179  C  CG    . LEU A 1 725 ? -21.708 145.034 46.418  1.00 49.03  ? 1479 LEU A CG    1 
ATOM   5180  C  CD1   . LEU A 1 725 ? -20.944 144.645 45.190  1.00 48.29  ? 1479 LEU A CD1   1 
ATOM   5181  C  CD2   . LEU A 1 725 ? -23.090 145.528 46.078  1.00 33.88  ? 1479 LEU A CD2   1 
ATOM   5182  N  N     . SER A 1 726 ? -21.199 142.499 50.002  1.00 61.95  ? 1480 SER A N     1 
ATOM   5183  C  CA    . SER A 1 726 ? -20.822 141.353 50.834  1.00 57.17  ? 1480 SER A CA    1 
ATOM   5184  C  C     . SER A 1 726 ? -21.277 141.617 52.263  1.00 52.75  ? 1480 SER A C     1 
ATOM   5185  O  O     . SER A 1 726 ? -21.040 142.705 52.805  1.00 53.21  ? 1480 SER A O     1 
ATOM   5186  C  CB    . SER A 1 726 ? -19.295 141.150 50.850  1.00 54.22  ? 1480 SER A CB    1 
ATOM   5187  O  OG    . SER A 1 726 ? -18.713 141.006 49.556  1.00 55.48  ? 1480 SER A OG    1 
ATOM   5188  N  N     . SER A 1 727 ? -21.923 140.627 52.873  1.00 53.05  ? 1481 SER A N     1 
ATOM   5189  C  CA    . SER A 1 727 ? -22.318 140.728 54.270  1.00 58.97  ? 1481 SER A CA    1 
ATOM   5190  C  C     . SER A 1 727 ? -21.202 140.202 55.198  1.00 63.85  ? 1481 SER A C     1 
ATOM   5191  O  O     . SER A 1 727 ? -20.364 139.401 54.776  1.00 57.53  ? 1481 SER A O     1 
ATOM   5192  C  CB    . SER A 1 727 ? -23.660 140.015 54.502  1.00 57.29  ? 1481 SER A CB    1 
ATOM   5193  O  OG    . SER A 1 727 ? -23.583 138.631 54.225  1.00 63.01  ? 1481 SER A OG    1 
ATOM   5194  N  N     . LEU A 1 728 ? -21.177 140.664 56.452  1.00 66.79  ? 1482 LEU A N     1 
ATOM   5195  C  CA    . LEU A 1 728 ? -20.167 140.188 57.410  1.00 58.40  ? 1482 LEU A CA    1 
ATOM   5196  C  C     . LEU A 1 728 ? -20.710 139.360 58.585  1.00 67.05  ? 1482 LEU A C     1 
ATOM   5197  O  O     . LEU A 1 728 ? -21.845 139.567 59.036  1.00 72.08  ? 1482 LEU A O     1 
ATOM   5198  C  CB    . LEU A 1 728 ? -19.355 141.362 57.925  1.00 48.04  ? 1482 LEU A CB    1 
ATOM   5199  C  CG    . LEU A 1 728 ? -18.638 142.143 56.827  1.00 48.52  ? 1482 LEU A CG    1 
ATOM   5200  C  CD1   . LEU A 1 728 ? -18.106 143.459 57.352  1.00 38.57  ? 1482 LEU A CD1   1 
ATOM   5201  C  CD2   . LEU A 1 728 ? -17.500 141.317 56.247  1.00 52.19  ? 1482 LEU A CD2   1 
ATOM   5202  N  N     . GLU A 1 729 ? -19.881 138.429 59.072  1.00 73.06  ? 1483 GLU A N     1 
ATOM   5203  C  CA    . GLU A 1 729 ? -20.206 137.521 60.187  1.00 77.92  ? 1483 GLU A CA    1 
ATOM   5204  C  C     . GLU A 1 729 ? -18.919 137.049 60.881  1.00 79.82  ? 1483 GLU A C     1 
ATOM   5205  O  O     . GLU A 1 729 ? -17.835 137.254 60.346  1.00 82.78  ? 1483 GLU A O     1 
ATOM   5206  C  CB    . GLU A 1 729 ? -20.908 136.283 59.640  1.00 83.58  ? 1483 GLU A CB    1 
ATOM   5207  C  CG    . GLU A 1 729 ? -22.067 136.538 58.707  1.00 90.64  ? 1483 GLU A CG    1 
ATOM   5208  C  CD    . GLU A 1 729 ? -22.706 135.235 58.213  1.00 107.53 ? 1483 GLU A CD    1 
ATOM   5209  O  OE1   . GLU A 1 729 ? -22.162 134.136 58.510  1.00 106.02 ? 1483 GLU A OE1   1 
ATOM   5210  O  OE2   . GLU A 1 729 ? -23.754 135.314 57.524  1.00 116.34 ? 1483 GLU A OE2   1 
ATOM   5211  N  N     . ASP A 1 730 ? -19.012 136.403 62.047  1.00 81.05  ? 1484 ASP A N     1 
ATOM   5212  C  CA    . ASP A 1 730 ? -17.854 135.646 62.571  1.00 84.10  ? 1484 ASP A CA    1 
ATOM   5213  C  C     . ASP A 1 730 ? -18.236 134.315 63.237  1.00 96.65  ? 1484 ASP A C     1 
ATOM   5214  O  O     . ASP A 1 730 ? -17.886 133.232 62.748  1.00 100.47 ? 1484 ASP A O     1 
ATOM   5215  C  CB    . ASP A 1 730 ? -16.965 136.494 63.495  1.00 64.34  ? 1484 ASP A CB    1 
ATOM   5216  N  N     . LYS B 1 13  ? -17.960 123.671 20.118  1.00 86.85  ? 415  LYS B N     1 
ATOM   5217  C  CA    . LYS B 1 13  ? -18.205 124.682 19.080  1.00 90.01  ? 415  LYS B CA    1 
ATOM   5218  C  C     . LYS B 1 13  ? -19.596 125.293 19.201  1.00 91.50  ? 415  LYS B C     1 
ATOM   5219  O  O     . LYS B 1 13  ? -19.790 126.475 18.945  1.00 99.67  ? 415  LYS B O     1 
ATOM   5220  C  CB    . LYS B 1 13  ? -18.031 124.092 17.671  1.00 83.24  ? 415  LYS B CB    1 
ATOM   5221  N  N     . LEU B 1 14  ? -20.564 124.478 19.598  1.00 83.11  ? 416  LEU B N     1 
ATOM   5222  C  CA    . LEU B 1 14  ? -21.939 124.937 19.718  1.00 76.22  ? 416  LEU B CA    1 
ATOM   5223  C  C     . LEU B 1 14  ? -22.346 125.229 21.162  1.00 79.49  ? 416  LEU B C     1 
ATOM   5224  O  O     . LEU B 1 14  ? -22.028 124.468 22.069  1.00 79.14  ? 416  LEU B O     1 
ATOM   5225  C  CB    . LEU B 1 14  ? -22.882 123.873 19.164  1.00 72.42  ? 416  LEU B CB    1 
ATOM   5226  C  CG    . LEU B 1 14  ? -24.350 124.224 19.370  1.00 70.32  ? 416  LEU B CG    1 
ATOM   5227  C  CD1   . LEU B 1 14  ? -24.925 124.826 18.104  1.00 70.54  ? 416  LEU B CD1   1 
ATOM   5228  C  CD2   . LEU B 1 14  ? -25.144 123.016 19.830  1.00 67.61  ? 416  LEU B CD2   1 
ATOM   5229  N  N     . THR B 1 15  ? -23.073 126.319 21.377  1.00 85.93  ? 417  THR B N     1 
ATOM   5230  C  CA    . THR B 1 15  ? -23.683 126.566 22.686  1.00 88.97  ? 417  THR B CA    1 
ATOM   5231  C  C     . THR B 1 15  ? -25.162 126.196 22.630  1.00 87.20  ? 417  THR B C     1 
ATOM   5232  O  O     . THR B 1 15  ? -25.980 126.946 22.116  1.00 88.35  ? 417  THR B O     1 
ATOM   5233  C  CB    . THR B 1 15  ? -23.513 128.037 23.147  1.00 78.43  ? 417  THR B CB    1 
ATOM   5234  O  OG1   . THR B 1 15  ? -22.122 128.323 23.346  1.00 79.87  ? 417  THR B OG1   1 
ATOM   5235  C  CG2   . THR B 1 15  ? -24.258 128.282 24.443  1.00 75.28  ? 417  THR B CG2   1 
ATOM   5236  N  N     . PRO B 1 16  ? -25.508 125.024 23.158  1.00 88.03  ? 418  PRO B N     1 
ATOM   5237  C  CA    . PRO B 1 16  ? -26.855 124.462 23.001  1.00 92.70  ? 418  PRO B CA    1 
ATOM   5238  C  C     . PRO B 1 16  ? -27.861 125.163 23.889  1.00 85.95  ? 418  PRO B C     1 
ATOM   5239  O  O     . PRO B 1 16  ? -27.495 125.443 25.021  1.00 91.36  ? 418  PRO B O     1 
ATOM   5240  C  CB    . PRO B 1 16  ? -26.692 123.017 23.499  1.00 102.44 ? 418  PRO B CB    1 
ATOM   5241  C  CG    . PRO B 1 16  ? -25.201 122.812 23.745  1.00 100.00 ? 418  PRO B CG    1 
ATOM   5242  C  CD    . PRO B 1 16  ? -24.629 124.167 23.967  1.00 93.36  ? 418  PRO B CD    1 
ATOM   5243  N  N     . ALA B 1 17  ? -29.081 125.424 23.421  1.00 79.46  ? 419  ALA B N     1 
ATOM   5244  C  CA    . ALA B 1 17  ? -30.143 125.879 24.330  1.00 80.51  ? 419  ALA B CA    1 
ATOM   5245  C  C     . ALA B 1 17  ? -30.426 124.862 25.455  1.00 87.80  ? 419  ALA B C     1 
ATOM   5246  O  O     . ALA B 1 17  ? -30.117 123.669 25.338  1.00 84.52  ? 419  ALA B O     1 
ATOM   5247  C  CB    . ALA B 1 17  ? -31.432 126.221 23.572  1.00 72.20  ? 419  ALA B CB    1 
ATOM   5248  N  N     . GLN B 1 18  ? -31.026 125.347 26.537  1.00 95.16  ? 420  GLN B N     1 
ATOM   5249  C  CA    . GLN B 1 18  ? -31.231 124.552 27.742  1.00 107.52 ? 420  GLN B CA    1 
ATOM   5250  C  C     . GLN B 1 18  ? -32.260 123.415 27.588  1.00 115.87 ? 420  GLN B C     1 
ATOM   5251  O  O     . GLN B 1 18  ? -32.089 122.327 28.150  1.00 112.24 ? 420  GLN B O     1 
ATOM   5252  C  CB    . GLN B 1 18  ? -31.629 125.476 28.896  1.00 113.65 ? 420  GLN B CB    1 
ATOM   5253  C  CG    . GLN B 1 18  ? -31.403 124.890 30.274  1.00 124.86 ? 420  GLN B CG    1 
ATOM   5254  C  CD    . GLN B 1 18  ? -30.547 125.786 31.145  1.00 132.02 ? 420  GLN B CD    1 
ATOM   5255  O  OE1   . GLN B 1 18  ? -30.627 127.013 31.057  1.00 132.93 ? 420  GLN B OE1   1 
ATOM   5256  N  NE2   . GLN B 1 18  ? -29.710 125.175 31.987  1.00 134.97 ? 420  GLN B NE2   1 
ATOM   5257  N  N     . SER B 1 19  ? -33.328 123.667 26.836  1.00 121.94 ? 421  SER B N     1 
ATOM   5258  C  CA    . SER B 1 19  ? -34.408 122.690 26.708  1.00 119.25 ? 421  SER B CA    1 
ATOM   5259  C  C     . SER B 1 19  ? -34.796 122.472 25.249  1.00 116.37 ? 421  SER B C     1 
ATOM   5260  O  O     . SER B 1 19  ? -35.070 123.429 24.524  1.00 115.46 ? 421  SER B O     1 
ATOM   5261  C  CB    . SER B 1 19  ? -35.631 123.117 27.534  1.00 115.54 ? 421  SER B CB    1 
ATOM   5262  N  N     . LYS B 1 20  ? -34.818 121.206 24.832  1.00 114.80 ? 422  LYS B N     1 
ATOM   5263  C  CA    . LYS B 1 20  ? -35.181 120.840 23.466  1.00 105.77 ? 422  LYS B CA    1 
ATOM   5264  C  C     . LYS B 1 20  ? -36.643 121.173 23.199  1.00 107.96 ? 422  LYS B C     1 
ATOM   5265  O  O     . LYS B 1 20  ? -37.538 120.653 23.861  1.00 110.52 ? 422  LYS B O     1 
ATOM   5266  C  CB    . LYS B 1 20  ? -34.905 119.353 23.200  1.00 94.12  ? 422  LYS B CB    1 
ATOM   5267  N  N     . ASN B 1 21  ? -36.872 122.065 22.243  1.00 106.89 ? 423  ASN B N     1 
ATOM   5268  C  CA    . ASN B 1 21  ? -38.219 122.422 21.825  1.00 114.81 ? 423  ASN B CA    1 
ATOM   5269  C  C     . ASN B 1 21  ? -38.208 122.830 20.367  1.00 126.22 ? 423  ASN B C     1 
ATOM   5270  O  O     . ASN B 1 21  ? -38.018 124.006 20.045  1.00 124.74 ? 423  ASN B O     1 
ATOM   5271  C  CB    . ASN B 1 21  ? -38.790 123.558 22.675  1.00 113.25 ? 423  ASN B CB    1 
ATOM   5272  C  CG    . ASN B 1 21  ? -40.188 123.992 22.220  1.00 116.12 ? 423  ASN B CG    1 
ATOM   5273  O  OD1   . ASN B 1 21  ? -40.573 123.796 21.067  1.00 117.71 ? 423  ASN B OD1   1 
ATOM   5274  N  ND2   . ASN B 1 21  ? -40.946 124.590 23.130  1.00 116.59 ? 423  ASN B ND2   1 
ATOM   5275  N  N     . PRO B 1 22  ? -38.412 121.850 19.478  1.00 133.31 ? 424  PRO B N     1 
ATOM   5276  C  CA    . PRO B 1 22  ? -38.421 122.033 18.021  1.00 130.10 ? 424  PRO B CA    1 
ATOM   5277  C  C     . PRO B 1 22  ? -39.397 123.119 17.542  1.00 120.62 ? 424  PRO B C     1 
ATOM   5278  O  O     . PRO B 1 22  ? -39.318 123.547 16.387  1.00 120.93 ? 424  PRO B O     1 
ATOM   5279  C  CB    . PRO B 1 22  ? -38.846 120.654 17.508  1.00 136.88 ? 424  PRO B CB    1 
ATOM   5280  C  CG    . PRO B 1 22  ? -38.370 119.703 18.578  1.00 137.19 ? 424  PRO B CG    1 
ATOM   5281  C  CD    . PRO B 1 22  ? -38.590 120.437 19.866  1.00 135.67 ? 424  PRO B CD    1 
ATOM   5282  N  N     . ALA B 1 23  ? -40.292 123.566 18.419  1.00 110.98 ? 425  ALA B N     1 
ATOM   5283  C  CA    . ALA B 1 23  ? -41.304 124.556 18.048  1.00 105.33 ? 425  ALA B CA    1 
ATOM   5284  C  C     . ALA B 1 23  ? -40.921 126.015 18.356  1.00 113.50 ? 425  ALA B C     1 
ATOM   5285  O  O     . ALA B 1 23  ? -41.388 126.936 17.679  1.00 114.23 ? 425  ALA B O     1 
ATOM   5286  C  CB    . ALA B 1 23  ? -42.635 124.213 18.690  1.00 95.36  ? 425  ALA B CB    1 
ATOM   5287  N  N     . LYS B 1 24  ? -40.092 126.231 19.378  1.00 113.29 ? 426  LYS B N     1 
ATOM   5288  C  CA    . LYS B 1 24  ? -39.672 127.591 19.737  1.00 102.33 ? 426  LYS B CA    1 
ATOM   5289  C  C     . LYS B 1 24  ? -38.191 127.850 19.435  1.00 100.07 ? 426  LYS B C     1 
ATOM   5290  O  O     . LYS B 1 24  ? -37.852 128.820 18.750  1.00 94.90  ? 426  LYS B O     1 
ATOM   5291  C  CB    . LYS B 1 24  ? -39.982 127.905 21.208  1.00 90.39  ? 426  LYS B CB    1 
ATOM   5292  N  N     . ASN B 1 25  ? -37.321 126.978 19.942  1.00 97.86  ? 427  ASN B N     1 
ATOM   5293  C  CA    . ASN B 1 25  ? -35.872 127.153 19.820  1.00 95.44  ? 427  ASN B CA    1 
ATOM   5294  C  C     . ASN B 1 25  ? -35.359 127.847 18.545  1.00 100.90 ? 427  ASN B C     1 
ATOM   5295  O  O     . ASN B 1 25  ? -35.886 127.669 17.444  1.00 104.45 ? 427  ASN B O     1 
ATOM   5296  C  CB    . ASN B 1 25  ? -35.145 125.823 20.032  1.00 92.87  ? 427  ASN B CB    1 
ATOM   5297  C  CG    . ASN B 1 25  ? -35.247 125.327 21.462  1.00 95.30  ? 427  ASN B CG    1 
ATOM   5298  O  OD1   . ASN B 1 25  ? -36.097 125.789 22.231  1.00 98.96  ? 427  ASN B OD1   1 
ATOM   5299  N  ND2   . ASN B 1 25  ? -34.381 124.374 21.826  1.00 92.90  ? 427  ASN B ND2   1 
ATOM   5300  N  N     . GLU B 1 26  ? -34.307 128.638 18.717  1.00 100.12 ? 428  GLU B N     1 
ATOM   5301  C  CA    . GLU B 1 26  ? -33.732 129.404 17.629  1.00 95.97  ? 428  GLU B CA    1 
ATOM   5302  C  C     . GLU B 1 26  ? -32.238 129.113 17.491  1.00 92.11  ? 428  GLU B C     1 
ATOM   5303  O  O     . GLU B 1 26  ? -31.529 128.913 18.486  1.00 84.94  ? 428  GLU B O     1 
ATOM   5304  C  CB    . GLU B 1 26  ? -33.932 130.898 17.876  1.00 94.25  ? 428  GLU B CB    1 
ATOM   5305  C  CG    . GLU B 1 26  ? -35.370 131.336 18.036  1.00 101.36 ? 428  GLU B CG    1 
ATOM   5306  C  CD    . GLU B 1 26  ? -35.474 132.831 18.288  1.00 111.62 ? 428  GLU B CD    1 
ATOM   5307  O  OE1   . GLU B 1 26  ? -34.438 133.444 18.626  1.00 112.27 ? 428  GLU B OE1   1 
ATOM   5308  O  OE2   . GLU B 1 26  ? -36.583 133.395 18.143  1.00 118.15 ? 428  GLU B OE2   1 
ATOM   5309  N  N     . LEU B 1 27  ? -31.760 129.101 16.251  1.00 88.61  ? 429  LEU B N     1 
ATOM   5310  C  CA    . LEU B 1 27  ? -30.346 128.902 16.000  1.00 78.87  ? 429  LEU B CA    1 
ATOM   5311  C  C     . LEU B 1 27  ? -29.743 130.185 15.447  1.00 75.78  ? 429  LEU B C     1 
ATOM   5312  O  O     . LEU B 1 27  ? -30.156 130.677 14.401  1.00 78.79  ? 429  LEU B O     1 
ATOM   5313  C  CB    . LEU B 1 27  ? -30.137 127.751 15.023  1.00 80.16  ? 429  LEU B CB    1 
ATOM   5314  C  CG    . LEU B 1 27  ? -28.897 126.883 15.233  1.00 74.42  ? 429  LEU B CG    1 
ATOM   5315  C  CD1   . LEU B 1 27  ? -28.316 126.562 13.886  1.00 72.79  ? 429  LEU B CD1   1 
ATOM   5316  C  CD2   . LEU B 1 27  ? -27.870 127.545 16.144  1.00 64.15  ? 429  LEU B CD2   1 
ATOM   5317  N  N     . TYR B 1 28  ? -28.776 130.732 16.170  1.00 76.10  ? 430  TYR B N     1 
ATOM   5318  C  CA    . TYR B 1 28  ? -28.099 131.950 15.765  1.00 75.80  ? 430  TYR B CA    1 
ATOM   5319  C  C     . TYR B 1 28  ? -26.726 131.590 15.231  1.00 80.50  ? 430  TYR B C     1 
ATOM   5320  O  O     . TYR B 1 28  ? -25.863 131.100 15.973  1.00 84.80  ? 430  TYR B O     1 
ATOM   5321  C  CB    . TYR B 1 28  ? -27.949 132.912 16.946  1.00 77.41  ? 430  TYR B CB    1 
ATOM   5322  C  CG    . TYR B 1 28  ? -29.138 133.817 17.165  1.00 83.15  ? 430  TYR B CG    1 
ATOM   5323  C  CD1   . TYR B 1 28  ? -29.206 135.058 16.541  1.00 84.71  ? 430  TYR B CD1   1 
ATOM   5324  C  CD2   . TYR B 1 28  ? -30.189 133.438 18.001  1.00 82.79  ? 430  TYR B CD2   1 
ATOM   5325  C  CE1   . TYR B 1 28  ? -30.287 135.892 16.728  1.00 85.66  ? 430  TYR B CE1   1 
ATOM   5326  C  CE2   . TYR B 1 28  ? -31.276 134.267 18.197  1.00 81.41  ? 430  TYR B CE2   1 
ATOM   5327  C  CZ    . TYR B 1 28  ? -31.320 135.495 17.554  1.00 83.64  ? 430  TYR B CZ    1 
ATOM   5328  O  OH    . TYR B 1 28  ? -32.393 136.339 17.729  1.00 84.14  ? 430  TYR B OH    1 
ATOM   5329  N  N     . LEU B 1 29  ? -26.549 131.812 13.930  1.00 76.15  ? 431  LEU B N     1 
ATOM   5330  C  CA    . LEU B 1 29  ? -25.260 131.700 13.272  1.00 68.00  ? 431  LEU B CA    1 
ATOM   5331  C  C     . LEU B 1 29  ? -24.656 133.097 13.299  1.00 75.52  ? 431  LEU B C     1 
ATOM   5332  O  O     . LEU B 1 29  ? -25.122 133.996 12.608  1.00 88.19  ? 431  LEU B O     1 
ATOM   5333  C  CB    . LEU B 1 29  ? -25.448 131.196 11.832  1.00 62.89  ? 431  LEU B CB    1 
ATOM   5334  C  CG    . LEU B 1 29  ? -26.317 129.935 11.704  1.00 67.84  ? 431  LEU B CG    1 
ATOM   5335  C  CD1   . LEU B 1 29  ? -26.878 129.804 10.310  1.00 64.87  ? 431  LEU B CD1   1 
ATOM   5336  C  CD2   . LEU B 1 29  ? -25.606 128.625 12.141  1.00 60.99  ? 431  LEU B CD2   1 
ATOM   5337  N  N     . VAL B 1 30  ? -23.634 133.284 14.120  1.00 72.73  ? 432  VAL B N     1 
ATOM   5338  C  CA    . VAL B 1 30  ? -23.092 134.611 14.383  1.00 70.16  ? 432  VAL B CA    1 
ATOM   5339  C  C     . VAL B 1 30  ? -21.708 134.818 13.743  1.00 66.87  ? 432  VAL B C     1 
ATOM   5340  O  O     . VAL B 1 30  ? -20.846 133.932 13.761  1.00 65.12  ? 432  VAL B O     1 
ATOM   5341  C  CB    . VAL B 1 30  ? -23.042 134.873 15.915  1.00 65.50  ? 432  VAL B CB    1 
ATOM   5342  C  CG1   . VAL B 1 30  ? -22.317 136.177 16.245  1.00 63.04  ? 432  VAL B CG1   1 
ATOM   5343  C  CG2   . VAL B 1 30  ? -24.432 134.894 16.470  1.00 65.90  ? 432  VAL B CG2   1 
ATOM   5344  N  N     . GLU B 1 31  ? -21.497 135.995 13.173  1.00 64.82  ? 433  GLU B N     1 
ATOM   5345  C  CA    . GLU B 1 31  ? -20.229 136.292 12.524  1.00 68.05  ? 433  GLU B CA    1 
ATOM   5346  C  C     . GLU B 1 31  ? -19.132 136.493 13.563  1.00 64.48  ? 433  GLU B C     1 
ATOM   5347  O  O     . GLU B 1 31  ? -19.021 137.566 14.147  1.00 74.92  ? 433  GLU B O     1 
ATOM   5348  C  CB    . GLU B 1 31  ? -20.360 137.528 11.613  1.00 73.00  ? 433  GLU B CB    1 
ATOM   5349  C  CG    . GLU B 1 31  ? -19.027 138.097 11.106  1.00 80.78  ? 433  GLU B CG    1 
ATOM   5350  C  CD    . GLU B 1 31  ? -19.197 139.366 10.278  1.00 91.18  ? 433  GLU B CD    1 
ATOM   5351  O  OE1   . GLU B 1 31  ? -18.184 139.892 9.764   1.00 98.44  ? 433  GLU B OE1   1 
ATOM   5352  O  OE2   . GLU B 1 31  ? -20.344 139.840 10.132  1.00 91.70  ? 433  GLU B OE2   1 
ATOM   5353  N  N     . GLY B 1 32  ? -18.336 135.455 13.803  1.00 57.65  ? 434  GLY B N     1 
ATOM   5354  C  CA    . GLY B 1 32  ? -17.110 135.594 14.580  1.00 60.44  ? 434  GLY B CA    1 
ATOM   5355  C  C     . GLY B 1 32  ? -17.202 135.107 16.012  1.00 61.05  ? 434  GLY B C     1 
ATOM   5356  O  O     . GLY B 1 32  ? -18.270 135.166 16.634  1.00 58.95  ? 434  GLY B O     1 
ATOM   5357  N  N     . ASP B 1 33  ? -16.088 134.619 16.548  1.00 63.65  ? 435  ASP B N     1 
ATOM   5358  C  CA    . ASP B 1 33  ? -16.078 134.161 17.938  1.00 67.06  ? 435  ASP B CA    1 
ATOM   5359  C  C     . ASP B 1 33  ? -16.390 135.315 18.917  1.00 67.06  ? 435  ASP B C     1 
ATOM   5360  O  O     . ASP B 1 33  ? -17.144 135.149 19.872  1.00 55.22  ? 435  ASP B O     1 
ATOM   5361  C  CB    . ASP B 1 33  ? -14.746 133.487 18.282  1.00 72.71  ? 435  ASP B CB    1 
ATOM   5362  C  CG    . ASP B 1 33  ? -14.719 132.002 17.927  1.00 84.58  ? 435  ASP B CG    1 
ATOM   5363  O  OD1   . ASP B 1 33  ? -15.581 131.234 18.421  1.00 72.06  ? 435  ASP B OD1   1 
ATOM   5364  O  OD2   . ASP B 1 33  ? -13.816 131.605 17.152  1.00 100.68 ? 435  ASP B OD2   1 
ATOM   5365  N  N     . SER B 1 34  ? -15.837 136.495 18.654  1.00 73.52  ? 436  SER B N     1 
ATOM   5366  C  CA    . SER B 1 34  ? -16.060 137.636 19.534  1.00 76.57  ? 436  SER B CA    1 
ATOM   5367  C  C     . SER B 1 34  ? -17.543 138.024 19.681  1.00 73.10  ? 436  SER B C     1 
ATOM   5368  O  O     . SER B 1 34  ? -18.029 138.196 20.783  1.00 69.98  ? 436  SER B O     1 
ATOM   5369  C  CB    . SER B 1 34  ? -15.190 138.817 19.100  1.00 85.18  ? 436  SER B CB    1 
ATOM   5370  O  OG    . SER B 1 34  ? -13.810 138.527 19.326  1.00 90.15  ? 436  SER B OG    1 
ATOM   5371  N  N     . ALA B 1 35  ? -18.270 138.147 18.576  1.00 75.34  ? 437  ALA B N     1 
ATOM   5372  C  CA    . ALA B 1 35  ? -19.712 138.390 18.664  1.00 65.48  ? 437  ALA B CA    1 
ATOM   5373  C  C     . ALA B 1 35  ? -20.477 137.168 19.150  1.00 68.29  ? 437  ALA B C     1 
ATOM   5374  O  O     . ALA B 1 35  ? -21.544 137.297 19.749  1.00 72.01  ? 437  ALA B O     1 
ATOM   5375  C  CB    . ALA B 1 35  ? -20.263 138.850 17.341  1.00 54.89  ? 437  ALA B CB    1 
ATOM   5376  N  N     . GLY B 1 36  ? -19.956 135.981 18.862  1.00 70.00  ? 438  GLY B N     1 
ATOM   5377  C  CA    . GLY B 1 36  ? -20.533 134.769 19.411  1.00 69.57  ? 438  GLY B CA    1 
ATOM   5378  C  C     . GLY B 1 36  ? -20.533 134.874 20.924  1.00 64.57  ? 438  GLY B C     1 
ATOM   5379  O  O     . GLY B 1 36  ? -21.521 134.531 21.593  1.00 66.17  ? 438  GLY B O     1 
ATOM   5380  N  N     . GLY B 1 37  ? -19.416 135.366 21.458  1.00 61.76  ? 439  GLY B N     1 
ATOM   5381  C  CA    . GLY B 1 37  ? -19.254 135.606 22.889  1.00 58.61  ? 439  GLY B CA    1 
ATOM   5382  C  C     . GLY B 1 37  ? -20.365 136.481 23.439  1.00 57.59  ? 439  GLY B C     1 
ATOM   5383  O  O     . GLY B 1 37  ? -21.164 136.034 24.248  1.00 58.73  ? 439  GLY B O     1 
ATOM   5384  N  N     . SER B 1 38  ? -20.428 137.723 22.983  1.00 52.52  ? 440  SER B N     1 
ATOM   5385  C  CA    . SER B 1 38  ? -21.502 138.624 23.354  1.00 52.96  ? 440  SER B CA    1 
ATOM   5386  C  C     . SER B 1 38  ? -22.882 137.992 23.259  1.00 67.47  ? 440  SER B C     1 
ATOM   5387  O  O     . SER B 1 38  ? -23.730 138.228 24.112  1.00 79.50  ? 440  SER B O     1 
ATOM   5388  C  CB    . SER B 1 38  ? -21.470 139.857 22.468  1.00 69.33  ? 440  SER B CB    1 
ATOM   5389  O  OG    . SER B 1 38  ? -20.220 140.497 22.565  1.00 75.20  ? 440  SER B OG    1 
ATOM   5390  N  N     . ALA B 1 39  ? -23.130 137.212 22.216  1.00 64.03  ? 441  ALA B N     1 
ATOM   5391  C  CA    . ALA B 1 39  ? -24.446 136.613 22.046  1.00 65.19  ? 441  ALA B CA    1 
ATOM   5392  C  C     . ALA B 1 39  ? -24.676 135.469 23.033  1.00 68.68  ? 441  ALA B C     1 
ATOM   5393  O  O     . ALA B 1 39  ? -25.791 135.292 23.528  1.00 70.62  ? 441  ALA B O     1 
ATOM   5394  C  CB    . ALA B 1 39  ? -24.643 136.146 20.620  1.00 71.59  ? 441  ALA B CB    1 
ATOM   5395  N  N     . LYS B 1 40  ? -23.632 134.693 23.326  1.00 67.15  ? 442  LYS B N     1 
ATOM   5396  C  CA    . LYS B 1 40  ? -23.738 133.692 24.395  1.00 70.46  ? 442  LYS B CA    1 
ATOM   5397  C  C     . LYS B 1 40  ? -24.218 134.369 25.704  1.00 74.27  ? 442  LYS B C     1 
ATOM   5398  O  O     . LYS B 1 40  ? -25.043 133.824 26.441  1.00 76.78  ? 442  LYS B O     1 
ATOM   5399  C  CB    . LYS B 1 40  ? -22.408 132.931 24.581  1.00 62.94  ? 442  LYS B CB    1 
ATOM   5400  C  CG    . LYS B 1 40  ? -22.387 131.941 25.763  1.00 63.37  ? 442  LYS B CG    1 
ATOM   5401  N  N     . GLN B 1 41  ? -23.719 135.581 25.949  1.00 73.58  ? 443  GLN B N     1 
ATOM   5402  C  CA    . GLN B 1 41  ? -24.014 136.355 27.152  1.00 76.77  ? 443  GLN B CA    1 
ATOM   5403  C  C     . GLN B 1 41  ? -25.386 137.038 27.120  1.00 84.34  ? 443  GLN B C     1 
ATOM   5404  O  O     . GLN B 1 41  ? -26.070 137.134 28.151  1.00 95.74  ? 443  GLN B O     1 
ATOM   5405  C  CB    . GLN B 1 41  ? -22.925 137.413 27.370  1.00 79.58  ? 443  GLN B CB    1 
ATOM   5406  C  CG    . GLN B 1 41  ? -21.515 136.863 27.605  1.00 85.82  ? 443  GLN B CG    1 
ATOM   5407  C  CD    . GLN B 1 41  ? -20.435 137.881 27.236  1.00 88.21  ? 443  GLN B CD    1 
ATOM   5408  O  OE1   . GLN B 1 41  ? -20.686 139.089 27.245  1.00 89.23  ? 443  GLN B OE1   1 
ATOM   5409  N  NE2   . GLN B 1 41  ? -19.237 137.394 26.888  1.00 84.22  ? 443  GLN B NE2   1 
ATOM   5410  N  N     . GLY B 1 42  ? -25.785 137.518 25.945  1.00 80.37  ? 444  GLY B N     1 
ATOM   5411  C  CA    . GLY B 1 42  ? -27.037 138.242 25.799  1.00 79.75  ? 444  GLY B CA    1 
ATOM   5412  C  C     . GLY B 1 42  ? -28.287 137.409 25.527  1.00 82.58  ? 444  GLY B C     1 
ATOM   5413  O  O     . GLY B 1 42  ? -29.400 137.914 25.680  1.00 88.81  ? 444  GLY B O     1 
ATOM   5414  N  N     . ARG B 1 43  ? -28.110 136.146 25.130  1.00 78.09  ? 445  ARG B N     1 
ATOM   5415  C  CA    . ARG B 1 43  ? -29.217 135.264 24.713  1.00 77.86  ? 445  ARG B CA    1 
ATOM   5416  C  C     . ARG B 1 43  ? -30.252 135.046 25.820  1.00 84.84  ? 445  ARG B C     1 
ATOM   5417  O  O     . ARG B 1 43  ? -30.065 135.495 26.954  1.00 88.58  ? 445  ARG B O     1 
ATOM   5418  C  CB    . ARG B 1 43  ? -28.656 133.892 24.316  1.00 75.37  ? 445  ARG B CB    1 
ATOM   5419  C  CG    . ARG B 1 43  ? -28.034 133.146 25.517  1.00 74.35  ? 445  ARG B CG    1 
ATOM   5420  C  CD    . ARG B 1 43  ? -26.923 132.173 25.132  1.00 75.84  ? 445  ARG B CD    1 
ATOM   5421  N  NE    . ARG B 1 43  ? -27.465 130.857 24.832  1.00 84.42  ? 445  ARG B NE    1 
ATOM   5422  C  CZ    . ARG B 1 43  ? -27.284 129.761 25.567  1.00 86.63  ? 445  ARG B CZ    1 
ATOM   5423  N  NH1   . ARG B 1 43  ? -26.539 129.773 26.677  1.00 79.16  ? 445  ARG B NH1   1 
ATOM   5424  N  NH2   . ARG B 1 43  ? -27.854 128.633 25.170  1.00 91.10  ? 445  ARG B NH2   1 
ATOM   5425  N  N     . ASP B 1 44  ? -31.341 134.357 25.477  1.00 85.17  ? 446  ASP B N     1 
ATOM   5426  C  CA    . ASP B 1 44  ? -32.230 133.738 26.461  1.00 90.93  ? 446  ASP B CA    1 
ATOM   5427  C  C     . ASP B 1 44  ? -31.979 132.224 26.418  1.00 92.17  ? 446  ASP B C     1 
ATOM   5428  O  O     . ASP B 1 44  ? -32.493 131.527 25.546  1.00 95.29  ? 446  ASP B O     1 
ATOM   5429  C  CB    . ASP B 1 44  ? -33.703 134.062 26.149  1.00 94.25  ? 446  ASP B CB    1 
ATOM   5430  C  CG    . ASP B 1 44  ? -34.692 133.547 27.232  1.00 86.41  ? 446  ASP B CG    1 
ATOM   5431  O  OD1   . ASP B 1 44  ? -34.369 132.597 27.992  1.00 82.05  ? 446  ASP B OD1   1 
ATOM   5432  O  OD2   . ASP B 1 44  ? -35.817 134.097 27.296  1.00 83.54  ? 446  ASP B OD2   1 
ATOM   5433  N  N     . ARG B 1 45  ? -31.187 131.712 27.351  1.00 90.89  ? 447  ARG B N     1 
ATOM   5434  C  CA    . ARG B 1 45  ? -30.706 130.333 27.230  1.00 91.99  ? 447  ARG B CA    1 
ATOM   5435  C  C     . ARG B 1 45  ? -31.790 129.247 27.233  1.00 93.15  ? 447  ARG B C     1 
ATOM   5436  O  O     . ARG B 1 45  ? -31.494 128.071 27.016  1.00 94.63  ? 447  ARG B O     1 
ATOM   5437  C  CB    . ARG B 1 45  ? -29.618 130.020 28.273  1.00 90.84  ? 447  ARG B CB    1 
ATOM   5438  C  CG    . ARG B 1 45  ? -29.726 130.804 29.566  1.00 86.72  ? 447  ARG B CG    1 
ATOM   5439  C  CD    . ARG B 1 45  ? -29.408 129.924 30.747  1.00 87.50  ? 447  ARG B CD    1 
ATOM   5440  N  NE    . ARG B 1 45  ? -28.112 129.266 30.617  1.00 85.65  ? 447  ARG B NE    1 
ATOM   5441  C  CZ    . ARG B 1 45  ? -26.961 129.816 30.998  1.00 80.21  ? 447  ARG B CZ    1 
ATOM   5442  N  NH1   . ARG B 1 45  ? -26.950 131.039 31.516  1.00 70.65  ? 447  ARG B NH1   1 
ATOM   5443  N  NH2   . ARG B 1 45  ? -25.821 129.148 30.865  1.00 82.30  ? 447  ARG B NH2   1 
ATOM   5444  N  N     . LYS B 1 46  ? -33.041 129.620 27.469  1.00 93.66  ? 448  LYS B N     1 
ATOM   5445  C  CA    . LYS B 1 46  ? -34.081 128.598 27.509  1.00 95.73  ? 448  LYS B CA    1 
ATOM   5446  C  C     . LYS B 1 46  ? -34.353 128.069 26.090  1.00 102.41 ? 448  LYS B C     1 
ATOM   5447  O  O     . LYS B 1 46  ? -34.640 126.877 25.909  1.00 104.98 ? 448  LYS B O     1 
ATOM   5448  C  CB    . LYS B 1 46  ? -35.356 129.097 28.222  1.00 87.00  ? 448  LYS B CB    1 
ATOM   5449  N  N     . PHE B 1 47  ? -34.215 128.939 25.084  1.00 97.17  ? 449  PHE B N     1 
ATOM   5450  C  CA    . PHE B 1 47  ? -34.579 128.572 23.707  1.00 93.70  ? 449  PHE B CA    1 
ATOM   5451  C  C     . PHE B 1 47  ? -33.655 129.063 22.584  1.00 86.04  ? 449  PHE B C     1 
ATOM   5452  O  O     . PHE B 1 47  ? -33.931 128.823 21.413  1.00 80.63  ? 449  PHE B O     1 
ATOM   5453  C  CB    . PHE B 1 47  ? -36.016 129.017 23.397  1.00 96.31  ? 449  PHE B CB    1 
ATOM   5454  C  CG    . PHE B 1 47  ? -36.206 130.515 23.386  1.00 91.87  ? 449  PHE B CG    1 
ATOM   5455  C  CD1   . PHE B 1 47  ? -36.416 131.208 24.567  1.00 91.78  ? 449  PHE B CD1   1 
ATOM   5456  C  CD2   . PHE B 1 47  ? -36.184 131.226 22.192  1.00 87.03  ? 449  PHE B CD2   1 
ATOM   5457  C  CE1   . PHE B 1 47  ? -36.593 132.577 24.560  1.00 91.88  ? 449  PHE B CE1   1 
ATOM   5458  C  CE2   . PHE B 1 47  ? -36.357 132.601 22.178  1.00 85.60  ? 449  PHE B CE2   1 
ATOM   5459  C  CZ    . PHE B 1 47  ? -36.566 133.277 23.360  1.00 87.89  ? 449  PHE B CZ    1 
ATOM   5460  N  N     . GLN B 1 48  ? -32.575 129.756 22.920  1.00 83.98  ? 450  GLN B N     1 
ATOM   5461  C  CA    . GLN B 1 48  ? -31.685 130.290 21.891  1.00 75.78  ? 450  GLN B CA    1 
ATOM   5462  C  C     . GLN B 1 48  ? -30.296 129.683 21.973  1.00 79.64  ? 450  GLN B C     1 
ATOM   5463  O  O     . GLN B 1 48  ? -29.638 129.754 23.014  1.00 84.26  ? 450  GLN B O     1 
ATOM   5464  C  CB    . GLN B 1 48  ? -31.575 131.806 22.004  1.00 70.93  ? 450  GLN B CB    1 
ATOM   5465  C  CG    . GLN B 1 48  ? -32.867 132.551 21.750  1.00 73.91  ? 450  GLN B CG    1 
ATOM   5466  C  CD    . GLN B 1 48  ? -32.676 134.052 21.815  1.00 79.12  ? 450  GLN B CD    1 
ATOM   5467  O  OE1   . GLN B 1 48  ? -31.939 134.561 22.668  1.00 86.30  ? 450  GLN B OE1   1 
ATOM   5468  N  NE2   . GLN B 1 48  ? -33.323 134.771 20.903  1.00 75.74  ? 450  GLN B NE2   1 
ATOM   5469  N  N     . ALA B 1 49  ? -29.856 129.088 20.869  1.00 78.86  ? 451  ALA B N     1 
ATOM   5470  C  CA    . ALA B 1 49  ? -28.504 128.548 20.776  1.00 79.39  ? 451  ALA B CA    1 
ATOM   5471  C  C     . ALA B 1 49  ? -27.609 129.470 19.950  1.00 70.89  ? 451  ALA B C     1 
ATOM   5472  O  O     . ALA B 1 49  ? -28.086 130.292 19.173  1.00 71.47  ? 451  ALA B O     1 
ATOM   5473  C  CB    . ALA B 1 49  ? -28.522 127.131 20.190  1.00 84.61  ? 451  ALA B CB    1 
ATOM   5474  N  N     . ILE B 1 50  ? -26.309 129.352 20.135  1.00 62.14  ? 452  ILE B N     1 
ATOM   5475  C  CA    . ILE B 1 50  ? -25.397 130.179 19.383  1.00 68.24  ? 452  ILE B CA    1 
ATOM   5476  C  C     . ILE B 1 50  ? -24.429 129.237 18.686  1.00 79.45  ? 452  ILE B C     1 
ATOM   5477  O  O     . ILE B 1 50  ? -24.073 128.182 19.231  1.00 84.89  ? 452  ILE B O     1 
ATOM   5478  C  CB    . ILE B 1 50  ? -24.632 131.177 20.296  1.00 70.03  ? 452  ILE B CB    1 
ATOM   5479  C  CG1   . ILE B 1 50  ? -25.583 131.879 21.276  1.00 68.86  ? 452  ILE B CG1   1 
ATOM   5480  C  CG2   . ILE B 1 50  ? -23.858 132.209 19.471  1.00 65.67  ? 452  ILE B CG2   1 
ATOM   5481  C  CD1   . ILE B 1 50  ? -26.533 132.882 20.638  1.00 61.78  ? 452  ILE B CD1   1 
ATOM   5482  N  N     . LEU B 1 51  ? -24.026 129.601 17.470  1.00 77.11  ? 453  LEU B N     1 
ATOM   5483  C  CA    . LEU B 1 51  ? -23.095 128.786 16.706  1.00 79.22  ? 453  LEU B CA    1 
ATOM   5484  C  C     . LEU B 1 51  ? -22.238 129.709 15.879  1.00 78.58  ? 453  LEU B C     1 
ATOM   5485  O  O     . LEU B 1 51  ? -22.598 130.049 14.753  1.00 87.60  ? 453  LEU B O     1 
ATOM   5486  C  CB    . LEU B 1 51  ? -23.845 127.801 15.797  1.00 84.90  ? 453  LEU B CB    1 
ATOM   5487  C  CG    . LEU B 1 51  ? -23.000 126.682 15.181  1.00 85.20  ? 453  LEU B CG    1 
ATOM   5488  C  CD1   . LEU B 1 51  ? -22.738 126.954 13.746  1.00 71.66  ? 453  LEU B CD1   1 
ATOM   5489  C  CD2   . LEU B 1 51  ? -21.671 126.573 15.926  1.00 98.59  ? 453  LEU B CD2   1 
ATOM   5490  N  N     . PRO B 1 52  ? -21.098 130.135 16.436  1.00 70.72  ? 454  PRO B N     1 
ATOM   5491  C  CA    . PRO B 1 52  ? -20.268 131.120 15.734  1.00 67.63  ? 454  PRO B CA    1 
ATOM   5492  C  C     . PRO B 1 52  ? -19.643 130.572 14.444  1.00 66.47  ? 454  PRO B C     1 
ATOM   5493  O  O     . PRO B 1 52  ? -19.301 129.394 14.331  1.00 74.03  ? 454  PRO B O     1 
ATOM   5494  C  CB    . PRO B 1 52  ? -19.180 131.463 16.767  1.00 62.62  ? 454  PRO B CB    1 
ATOM   5495  C  CG    . PRO B 1 52  ? -19.747 131.050 18.064  1.00 60.91  ? 454  PRO B CG    1 
ATOM   5496  C  CD    . PRO B 1 52  ? -20.568 129.832 17.770  1.00 63.55  ? 454  PRO B CD    1 
ATOM   5497  N  N     . LEU B 1 53  ? -19.506 131.456 13.471  1.00 55.58  ? 455  LEU B N     1 
ATOM   5498  C  CA    . LEU B 1 53  ? -18.855 131.137 12.219  1.00 59.94  ? 455  LEU B CA    1 
ATOM   5499  C  C     . LEU B 1 53  ? -17.487 131.807 12.192  1.00 69.84  ? 455  LEU B C     1 
ATOM   5500  O  O     . LEU B 1 53  ? -17.378 133.019 11.969  1.00 76.71  ? 455  LEU B O     1 
ATOM   5501  C  CB    . LEU B 1 53  ? -19.700 131.662 11.072  1.00 65.66  ? 455  LEU B CB    1 
ATOM   5502  C  CG    . LEU B 1 53  ? -21.086 131.036 11.067  1.00 77.78  ? 455  LEU B CG    1 
ATOM   5503  C  CD1   . LEU B 1 53  ? -22.066 131.933 10.318  1.00 82.03  ? 455  LEU B CD1   1 
ATOM   5504  C  CD2   . LEU B 1 53  ? -21.029 129.610 10.479  1.00 77.98  ? 455  LEU B CD2   1 
ATOM   5505  N  N     . ARG B 1 54  ? -16.444 131.011 12.400  1.00 62.42  ? 456  ARG B N     1 
ATOM   5506  C  CA    . ARG B 1 54  ? -15.114 131.547 12.590  1.00 58.22  ? 456  ARG B CA    1 
ATOM   5507  C  C     . ARG B 1 54  ? -14.436 131.901 11.261  1.00 57.43  ? 456  ARG B C     1 
ATOM   5508  O  O     . ARG B 1 54  ? -13.619 131.138 10.760  1.00 67.63  ? 456  ARG B O     1 
ATOM   5509  C  CB    . ARG B 1 54  ? -14.272 130.537 13.375  1.00 67.47  ? 456  ARG B CB    1 
ATOM   5510  C  CG    . ARG B 1 54  ? -14.955 129.979 14.638  1.00 68.78  ? 456  ARG B CG    1 
ATOM   5511  C  CD    . ARG B 1 54  ? -14.220 128.755 15.168  1.00 77.13  ? 456  ARG B CD    1 
ATOM   5512  N  NE    . ARG B 1 54  ? -12.786 129.024 15.216  1.00 90.78  ? 456  ARG B NE    1 
ATOM   5513  C  CZ    . ARG B 1 54  ? -11.839 128.123 14.961  1.00 94.78  ? 456  ARG B CZ    1 
ATOM   5514  N  NH1   . ARG B 1 54  ? -12.177 126.870 14.640  1.00 94.72  ? 456  ARG B NH1   1 
ATOM   5515  N  NH2   . ARG B 1 54  ? -10.554 128.483 15.029  1.00 88.96  ? 456  ARG B NH2   1 
ATOM   5516  N  N     . GLY B 1 55  ? -14.761 133.062 10.698  1.00 61.17  ? 457  GLY B N     1 
ATOM   5517  C  CA    . GLY B 1 55  ? -14.160 133.497 9.448   1.00 68.21  ? 457  GLY B CA    1 
ATOM   5518  C  C     . GLY B 1 55  ? -15.142 133.369 8.304   1.00 72.36  ? 457  GLY B C     1 
ATOM   5519  O  O     . GLY B 1 55  ? -16.235 132.836 8.495   1.00 75.90  ? 457  GLY B O     1 
ATOM   5520  N  N     . LYS B 1 56  ? -14.767 133.859 7.125   1.00 71.59  ? 458  LYS B N     1 
ATOM   5521  C  CA    . LYS B 1 56  ? -15.614 133.713 5.926   1.00 67.66  ? 458  LYS B CA    1 
ATOM   5522  C  C     . LYS B 1 56  ? -15.984 132.241 5.696   1.00 70.68  ? 458  LYS B C     1 
ATOM   5523  O  O     . LYS B 1 56  ? -15.172 131.338 5.902   1.00 73.97  ? 458  LYS B O     1 
ATOM   5524  C  CB    . LYS B 1 56  ? -14.941 134.316 4.676   1.00 61.23  ? 458  LYS B CB    1 
ATOM   5525  C  CG    . LYS B 1 56  ? -15.024 135.854 4.569   1.00 56.73  ? 458  LYS B CG    1 
ATOM   5526  C  CD    . LYS B 1 56  ? -14.339 136.355 3.271   1.00 105.70 ? 458  LYS B CD    1 
ATOM   5527  C  CE    . LYS B 1 56  ? -14.312 137.898 3.109   1.00 81.41  ? 458  LYS B CE    1 
ATOM   5528  N  NZ    . LYS B 1 56  ? -15.674 138.547 3.154   1.00 81.72  ? 458  LYS B NZ    1 
ATOM   5529  N  N     . VAL B 1 57  ? -17.218 132.003 5.277   1.00 76.63  ? 459  VAL B N     1 
ATOM   5530  C  CA    . VAL B 1 57  ? -17.761 130.646 5.160   1.00 76.00  ? 459  VAL B CA    1 
ATOM   5531  C  C     . VAL B 1 57  ? -17.633 130.066 3.752   1.00 73.50  ? 459  VAL B C     1 
ATOM   5532  O  O     . VAL B 1 57  ? -17.845 130.773 2.777   1.00 67.93  ? 459  VAL B O     1 
ATOM   5533  C  CB    . VAL B 1 57  ? -19.246 130.657 5.536   1.00 70.04  ? 459  VAL B CB    1 
ATOM   5534  C  CG1   . VAL B 1 57  ? -19.918 129.370 5.118   1.00 58.16  ? 459  VAL B CG1   1 
ATOM   5535  C  CG2   . VAL B 1 57  ? -19.399 130.939 7.024   1.00 76.45  ? 459  VAL B CG2   1 
ATOM   5536  N  N     . ILE B 1 58  ? -17.327 128.772 3.665   1.00 75.40  ? 460  ILE B N     1 
ATOM   5537  C  CA    . ILE B 1 58  ? -17.061 128.081 2.388   1.00 76.21  ? 460  ILE B CA    1 
ATOM   5538  C  C     . ILE B 1 58  ? -18.161 128.192 1.329   1.00 78.22  ? 460  ILE B C     1 
ATOM   5539  O  O     . ILE B 1 58  ? -19.333 127.968 1.609   1.00 87.05  ? 460  ILE B O     1 
ATOM   5540  C  CB    . ILE B 1 58  ? -16.759 126.576 2.615   1.00 73.66  ? 460  ILE B CB    1 
ATOM   5541  C  CG1   . ILE B 1 58  ? -16.176 125.947 1.352   1.00 70.49  ? 460  ILE B CG1   1 
ATOM   5542  C  CG2   . ILE B 1 58  ? -18.003 125.820 3.121   1.00 60.38  ? 460  ILE B CG2   1 
ATOM   5543  C  CD1   . ILE B 1 58  ? -15.867 124.489 1.527   1.00 68.17  ? 460  ILE B CD1   1 
ATOM   5544  N  N     . ASN B 1 59  ? -17.775 128.517 0.100   1.00 73.59  ? 461  ASN B N     1 
ATOM   5545  C  CA    . ASN B 1 59  ? -18.741 128.649 -0.983  1.00 77.38  ? 461  ASN B CA    1 
ATOM   5546  C  C     . ASN B 1 59  ? -19.185 127.301 -1.550  1.00 82.87  ? 461  ASN B C     1 
ATOM   5547  O  O     . ASN B 1 59  ? -18.613 126.811 -2.528  1.00 83.81  ? 461  ASN B O     1 
ATOM   5548  C  CB    . ASN B 1 59  ? -18.154 129.485 -2.105  1.00 80.25  ? 461  ASN B CB    1 
ATOM   5549  C  CG    . ASN B 1 59  ? -19.182 129.859 -3.143  1.00 76.74  ? 461  ASN B CG    1 
ATOM   5550  O  OD1   . ASN B 1 59  ? -20.129 129.106 -3.406  1.00 80.85  ? 461  ASN B OD1   1 
ATOM   5551  N  ND2   . ASN B 1 59  ? -19.009 131.038 -3.738  1.00 71.08  ? 461  ASN B ND2   1 
ATOM   5552  N  N     . THR B 1 60  ? -20.212 126.715 -0.942  1.00 82.63  ? 462  THR B N     1 
ATOM   5553  C  CA    . THR B 1 60  ? -20.671 125.382 -1.316  1.00 88.40  ? 462  THR B CA    1 
ATOM   5554  C  C     . THR B 1 60  ? -21.230 125.283 -2.739  1.00 91.06  ? 462  THR B C     1 
ATOM   5555  O  O     . THR B 1 60  ? -21.862 124.287 -3.099  1.00 96.05  ? 462  THR B O     1 
ATOM   5556  C  CB    . THR B 1 60  ? -21.746 124.894 -0.352  1.00 88.82  ? 462  THR B CB    1 
ATOM   5557  O  OG1   . THR B 1 60  ? -22.686 125.952 -0.134  1.00 84.66  ? 462  THR B OG1   1 
ATOM   5558  C  CG2   . THR B 1 60  ? -21.118 124.486 0.970   1.00 92.80  ? 462  THR B CG2   1 
ATOM   5559  N  N     . ALA B 1 61  ? -21.008 126.316 -3.537  1.00 84.22  ? 463  ALA B N     1 
ATOM   5560  C  CA    . ALA B 1 61  ? -21.470 126.315 -4.915  1.00 81.56  ? 463  ALA B CA    1 
ATOM   5561  C  C     . ALA B 1 61  ? -20.291 126.590 -5.845  1.00 84.16  ? 463  ALA B C     1 
ATOM   5562  O  O     . ALA B 1 61  ? -20.451 127.220 -6.876  1.00 86.82  ? 463  ALA B O     1 
ATOM   5563  C  CB    . ALA B 1 61  ? -22.549 127.372 -5.099  1.00 75.18  ? 463  ALA B CB    1 
ATOM   5564  N  N     . LYS B 1 62  ? -19.109 126.109 -5.469  1.00 86.33  ? 464  LYS B N     1 
ATOM   5565  C  CA    . LYS B 1 62  ? -17.857 126.492 -6.117  1.00 81.78  ? 464  LYS B CA    1 
ATOM   5566  C  C     . LYS B 1 62  ? -16.812 125.433 -5.791  1.00 85.06  ? 464  LYS B C     1 
ATOM   5567  O  O     . LYS B 1 62  ? -15.902 125.175 -6.585  1.00 89.48  ? 464  LYS B O     1 
ATOM   5568  C  CB    . LYS B 1 62  ? -17.383 127.843 -5.571  1.00 76.46  ? 464  LYS B CB    1 
ATOM   5569  C  CG    . LYS B 1 62  ? -16.815 128.833 -6.583  1.00 75.60  ? 464  LYS B CG    1 
ATOM   5570  C  CD    . LYS B 1 62  ? -16.681 130.227 -5.954  1.00 77.76  ? 464  LYS B CD    1 
ATOM   5571  C  CE    . LYS B 1 62  ? -16.705 131.342 -6.997  1.00 76.27  ? 464  LYS B CE    1 
ATOM   5572  N  NZ    . LYS B 1 62  ? -16.888 132.718 -6.405  1.00 76.24  ? 464  LYS B NZ    1 
ATOM   5573  N  N     . ALA B 1 63  ? -16.959 124.817 -4.617  1.00 83.68  ? 465  ALA B N     1 
ATOM   5574  C  CA    . ALA B 1 63  ? -15.972 123.881 -4.101  1.00 86.06  ? 465  ALA B CA    1 
ATOM   5575  C  C     . ALA B 1 63  ? -16.419 122.439 -4.274  1.00 91.85  ? 465  ALA B C     1 
ATOM   5576  O  O     . ALA B 1 63  ? -17.612 122.175 -4.408  1.00 93.42  ? 465  ALA B O     1 
ATOM   5577  C  CB    . ALA B 1 63  ? -15.696 124.178 -2.642  1.00 85.81  ? 465  ALA B CB    1 
ATOM   5578  N  N     . LYS B 1 64  ? -15.456 121.515 -4.266  1.00 99.50  ? 466  LYS B N     1 
ATOM   5579  C  CA    . LYS B 1 64  ? -15.718 120.080 -4.436  1.00 108.23 ? 466  LYS B CA    1 
ATOM   5580  C  C     . LYS B 1 64  ? -16.498 119.513 -3.246  1.00 117.46 ? 466  LYS B C     1 
ATOM   5581  O  O     . LYS B 1 64  ? -16.215 119.884 -2.109  1.00 126.09 ? 466  LYS B O     1 
ATOM   5582  C  CB    . LYS B 1 64  ? -14.395 119.327 -4.591  1.00 103.52 ? 466  LYS B CB    1 
ATOM   5583  N  N     . MET B 1 65  ? -17.468 118.624 -3.489  1.00 114.61 ? 467  MET B N     1 
ATOM   5584  C  CA    . MET B 1 65  ? -18.292 118.103 -2.387  1.00 109.90 ? 467  MET B CA    1 
ATOM   5585  C  C     . MET B 1 65  ? -17.421 117.432 -1.312  1.00 114.75 ? 467  MET B C     1 
ATOM   5586  O  O     . MET B 1 65  ? -17.842 117.258 -0.156  1.00 107.15 ? 467  MET B O     1 
ATOM   5587  C  CB    . MET B 1 65  ? -19.397 117.155 -2.879  1.00 95.03  ? 467  MET B CB    1 
ATOM   5588  C  CG    . MET B 1 65  ? -20.544 116.972 -1.866  1.00 79.60  ? 467  MET B CG    1 
ATOM   5589  N  N     . ALA B 1 66  ? -16.200 117.073 -1.711  1.00 120.84 ? 468  ALA B N     1 
ATOM   5590  C  CA    . ALA B 1 66  ? -15.212 116.477 -0.814  1.00 119.21 ? 468  ALA B CA    1 
ATOM   5591  C  C     . ALA B 1 66  ? -14.817 117.477 0.264   1.00 126.49 ? 468  ALA B C     1 
ATOM   5592  O  O     . ALA B 1 66  ? -15.124 117.296 1.449   1.00 131.46 ? 468  ALA B O     1 
ATOM   5593  C  CB    . ALA B 1 66  ? -13.981 116.048 -1.605  1.00 110.20 ? 468  ALA B CB    1 
ATOM   5594  N  N     . ASP B 1 67  ? -14.128 118.531 -0.166  1.00 121.09 ? 469  ASP B N     1 
ATOM   5595  C  CA    . ASP B 1 67  ? -13.727 119.621 0.713   1.00 107.50 ? 469  ASP B CA    1 
ATOM   5596  C  C     . ASP B 1 67  ? -14.918 120.203 1.507   1.00 103.64 ? 469  ASP B C     1 
ATOM   5597  O  O     . ASP B 1 67  ? -14.732 120.740 2.610   1.00 104.67 ? 469  ASP B O     1 
ATOM   5598  C  CB    . ASP B 1 67  ? -13.014 120.711 -0.101  1.00 95.29  ? 469  ASP B CB    1 
ATOM   5599  C  CG    . ASP B 1 67  ? -11.778 120.194 -0.819  1.00 85.92  ? 469  ASP B CG    1 
ATOM   5600  N  N     . ILE B 1 68  ? -16.128 120.089 0.947   1.00 95.92  ? 470  ILE B N     1 
ATOM   5601  C  CA    . ILE B 1 68  ? -17.357 120.538 1.616   1.00 90.58  ? 470  ILE B CA    1 
ATOM   5602  C  C     . ILE B 1 68  ? -17.715 119.659 2.809   1.00 100.80 ? 470  ILE B C     1 
ATOM   5603  O  O     . ILE B 1 68  ? -18.220 120.161 3.817   1.00 101.17 ? 470  ILE B O     1 
ATOM   5604  C  CB    . ILE B 1 68  ? -18.589 120.558 0.680   1.00 84.82  ? 470  ILE B CB    1 
ATOM   5605  C  CG1   . ILE B 1 68  ? -18.425 121.594 -0.437  1.00 88.87  ? 470  ILE B CG1   1 
ATOM   5606  C  CG2   . ILE B 1 68  ? -19.850 120.860 1.477   1.00 73.13  ? 470  ILE B CG2   1 
ATOM   5607  C  CD1   . ILE B 1 68  ? -19.639 121.697 -1.369  1.00 91.50  ? 470  ILE B CD1   1 
ATOM   5608  N  N     . LEU B 1 69  ? -17.471 118.350 2.684   1.00 108.53 ? 471  LEU B N     1 
ATOM   5609  C  CA    . LEU B 1 69  ? -17.750 117.392 3.765   1.00 107.92 ? 471  LEU B CA    1 
ATOM   5610  C  C     . LEU B 1 69  ? -16.767 117.587 4.933   1.00 103.35 ? 471  LEU B C     1 
ATOM   5611  O  O     . LEU B 1 69  ? -17.153 117.517 6.110   1.00 91.85  ? 471  LEU B O     1 
ATOM   5612  C  CB    . LEU B 1 69  ? -17.722 115.941 3.239   1.00 103.50 ? 471  LEU B CB    1 
ATOM   5613  N  N     . LYS B 1 70  ? -15.508 117.865 4.576   1.00 103.80 ? 472  LYS B N     1 
ATOM   5614  C  CA    . LYS B 1 70  ? -14.408 118.032 5.522   1.00 96.90  ? 472  LYS B CA    1 
ATOM   5615  C  C     . LYS B 1 70  ? -14.460 119.371 6.263   1.00 109.19 ? 472  LYS B C     1 
ATOM   5616  O  O     . LYS B 1 70  ? -13.575 119.672 7.065   1.00 116.77 ? 472  LYS B O     1 
ATOM   5617  C  CB    . LYS B 1 70  ? -13.060 117.886 4.799   1.00 76.08  ? 472  LYS B CB    1 
ATOM   5618  N  N     . ASN B 1 71  ? -15.499 120.165 6.009   1.00 108.44 ? 473  ASN B N     1 
ATOM   5619  C  CA    . ASN B 1 71  ? -15.576 121.526 6.547   1.00 101.57 ? 473  ASN B CA    1 
ATOM   5620  C  C     . ASN B 1 71  ? -16.132 121.621 7.962   1.00 97.50  ? 473  ASN B C     1 
ATOM   5621  O  O     . ASN B 1 71  ? -17.275 121.247 8.209   1.00 94.82  ? 473  ASN B O     1 
ATOM   5622  C  CB    . ASN B 1 71  ? -16.408 122.416 5.630   1.00 99.35  ? 473  ASN B CB    1 
ATOM   5623  C  CG    . ASN B 1 71  ? -16.067 123.879 5.783   1.00 94.88  ? 473  ASN B CG    1 
ATOM   5624  O  OD1   . ASN B 1 71  ? -16.669 124.594 6.584   1.00 89.31  ? 473  ASN B OD1   1 
ATOM   5625  N  ND2   . ASN B 1 71  ? -15.083 124.332 5.016   1.00 95.92  ? 473  ASN B ND2   1 
ATOM   5626  N  N     . GLU B 1 72  ? -15.324 122.154 8.875   1.00 102.75 ? 474  GLU B N     1 
ATOM   5627  C  CA    . GLU B 1 72  ? -15.682 122.241 10.296  1.00 106.68 ? 474  GLU B CA    1 
ATOM   5628  C  C     . GLU B 1 72  ? -17.036 122.910 10.516  1.00 103.58 ? 474  GLU B C     1 
ATOM   5629  O  O     . GLU B 1 72  ? -17.860 122.399 11.268  1.00 102.87 ? 474  GLU B O     1 
ATOM   5630  C  CB    . GLU B 1 72  ? -14.582 122.960 11.095  1.00 112.56 ? 474  GLU B CB    1 
ATOM   5631  C  CG    . GLU B 1 72  ? -14.875 123.172 12.585  1.00 123.47 ? 474  GLU B CG    1 
ATOM   5632  C  CD    . GLU B 1 72  ? -13.739 123.900 13.316  1.00 132.09 ? 474  GLU B CD    1 
ATOM   5633  O  OE1   . GLU B 1 72  ? -12.595 123.391 13.290  1.00 137.43 ? 474  GLU B OE1   1 
ATOM   5634  O  OE2   . GLU B 1 72  ? -13.984 124.982 13.909  1.00 130.64 ? 474  GLU B OE2   1 
ATOM   5635  N  N     . GLU B 1 73  ? -17.269 124.040 9.849   1.00 102.69 ? 475  GLU B N     1 
ATOM   5636  C  CA    . GLU B 1 73  ? -18.526 124.782 9.998   1.00 98.71  ? 475  GLU B CA    1 
ATOM   5637  C  C     . GLU B 1 73  ? -19.736 124.013 9.439   1.00 98.06  ? 475  GLU B C     1 
ATOM   5638  O  O     . GLU B 1 73  ? -20.648 123.662 10.201  1.00 97.62  ? 475  GLU B O     1 
ATOM   5639  C  CB    . GLU B 1 73  ? -18.430 126.173 9.359   1.00 96.50  ? 475  GLU B CB    1 
ATOM   5640  C  CG    . GLU B 1 73  ? -17.009 126.704 9.198   1.00 101.24 ? 475  GLU B CG    1 
ATOM   5641  C  CD    . GLU B 1 73  ? -16.476 127.362 10.457  1.00 103.65 ? 475  GLU B CD    1 
ATOM   5642  O  OE1   . GLU B 1 73  ? -17.221 128.140 11.096  1.00 104.20 ? 475  GLU B OE1   1 
ATOM   5643  O  OE2   . GLU B 1 73  ? -15.308 127.101 10.808  1.00 103.15 ? 475  GLU B OE2   1 
ATOM   5644  N  N     . ILE B 1 74  ? -19.743 123.752 8.125   1.00 90.85  ? 476  ILE B N     1 
ATOM   5645  C  CA    . ILE B 1 74  ? -20.831 122.994 7.489   1.00 84.52  ? 476  ILE B CA    1 
ATOM   5646  C  C     . ILE B 1 74  ? -21.158 121.729 8.288   1.00 83.52  ? 476  ILE B C     1 
ATOM   5647  O  O     . ILE B 1 74  ? -22.298 121.538 8.700   1.00 82.97  ? 476  ILE B O     1 
ATOM   5648  C  CB    . ILE B 1 74  ? -20.526 122.628 6.006   1.00 76.69  ? 476  ILE B CB    1 
ATOM   5649  C  CG1   . ILE B 1 74  ? -20.269 123.883 5.180   1.00 77.49  ? 476  ILE B CG1   1 
ATOM   5650  C  CG2   . ILE B 1 74  ? -21.697 121.856 5.366   1.00 70.01  ? 476  ILE B CG2   1 
ATOM   5651  C  CD1   . ILE B 1 74  ? -21.504 124.712 4.973   1.00 74.03  ? 476  ILE B CD1   1 
ATOM   5652  N  N     . ASN B 1 75  ? -20.163 120.877 8.526   1.00 82.99  ? 477  ASN B N     1 
ATOM   5653  C  CA    . ASN B 1 75  ? -20.399 119.700 9.360   1.00 85.68  ? 477  ASN B CA    1 
ATOM   5654  C  C     . ASN B 1 75  ? -21.148 120.005 10.662  1.00 88.73  ? 477  ASN B C     1 
ATOM   5655  O  O     . ASN B 1 75  ? -22.124 119.327 10.959  1.00 94.83  ? 477  ASN B O     1 
ATOM   5656  C  CB    . ASN B 1 75  ? -19.123 118.869 9.609   1.00 82.91  ? 477  ASN B CB    1 
ATOM   5657  C  CG    . ASN B 1 75  ? -19.043 117.631 8.707   1.00 76.87  ? 477  ASN B CG    1 
ATOM   5658  N  N     . THR B 1 76  ? -20.738 121.015 11.430  1.00 88.26  ? 478  THR B N     1 
ATOM   5659  C  CA    . THR B 1 76  ? -21.428 121.245 12.717  1.00 92.90  ? 478  THR B CA    1 
ATOM   5660  C  C     . THR B 1 76  ? -22.829 121.878 12.590  1.00 90.69  ? 478  THR B C     1 
ATOM   5661  O  O     . THR B 1 76  ? -23.640 121.776 13.519  1.00 89.45  ? 478  THR B O     1 
ATOM   5662  C  CB    . THR B 1 76  ? -20.539 121.912 13.854  1.00 79.49  ? 478  THR B CB    1 
ATOM   5663  O  OG1   . THR B 1 76  ? -20.962 123.259 14.122  1.00 72.38  ? 478  THR B OG1   1 
ATOM   5664  C  CG2   . THR B 1 76  ? -19.047 121.868 13.518  1.00 81.08  ? 478  THR B CG2   1 
ATOM   5665  N  N     . MET B 1 77  ? -23.121 122.492 11.441  1.00 83.41  ? 479  MET B N     1 
ATOM   5666  C  CA    . MET B 1 77  ? -24.492 122.945 11.140  1.00 82.78  ? 479  MET B CA    1 
ATOM   5667  C  C     . MET B 1 77  ? -25.430 121.801 10.704  1.00 91.81  ? 479  MET B C     1 
ATOM   5668  O  O     . MET B 1 77  ? -26.607 121.788 11.082  1.00 91.51  ? 479  MET B O     1 
ATOM   5669  C  CB    . MET B 1 77  ? -24.501 124.056 10.088  1.00 76.98  ? 479  MET B CB    1 
ATOM   5670  C  CG    . MET B 1 77  ? -23.354 125.058 10.237  1.00 79.55  ? 479  MET B CG    1 
ATOM   5671  S  SD    . MET B 1 77  ? -23.238 126.267 8.888   1.00 126.26 ? 479  MET B SD    1 
ATOM   5672  C  CE    . MET B 1 77  ? -24.855 127.016 9.007   1.00 63.39  ? 479  MET B CE    1 
ATOM   5673  N  N     . ILE B 1 78  ? -24.916 120.854 9.910   1.00 95.52  ? 480  ILE B N     1 
ATOM   5674  C  CA    . ILE B 1 78  ? -25.708 119.697 9.491   1.00 93.34  ? 480  ILE B CA    1 
ATOM   5675  C  C     . ILE B 1 78  ? -26.079 118.899 10.729  1.00 91.65  ? 480  ILE B C     1 
ATOM   5676  O  O     . ILE B 1 78  ? -27.181 118.349 10.810  1.00 100.79 ? 480  ILE B O     1 
ATOM   5677  C  CB    . ILE B 1 78  ? -24.973 118.787 8.476   1.00 74.98  ? 480  ILE B CB    1 
ATOM   5678  N  N     . TYR B 1 79  ? -25.176 118.882 11.710  1.00 85.09  ? 481  TYR B N     1 
ATOM   5679  C  CA    . TYR B 1 79  ? -25.315 117.996 12.873  1.00 88.22  ? 481  TYR B CA    1 
ATOM   5680  C  C     . TYR B 1 79  ? -25.849 118.630 14.159  1.00 92.33  ? 481  TYR B C     1 
ATOM   5681  O  O     . TYR B 1 79  ? -25.902 117.961 15.186  1.00 92.94  ? 481  TYR B O     1 
ATOM   5682  C  CB    . TYR B 1 79  ? -24.003 117.250 13.169  1.00 82.67  ? 481  TYR B CB    1 
ATOM   5683  N  N     . THR B 1 80  ? -26.229 119.905 14.122  1.00 97.57  ? 482  THR B N     1 
ATOM   5684  C  CA    . THR B 1 80  ? -26.890 120.509 15.287  1.00 103.69 ? 482  THR B CA    1 
ATOM   5685  C  C     . THR B 1 80  ? -28.322 120.873 14.940  1.00 101.24 ? 482  THR B C     1 
ATOM   5686  O  O     . THR B 1 80  ? -29.148 121.139 15.821  1.00 103.90 ? 482  THR B O     1 
ATOM   5687  C  CB    . THR B 1 80  ? -26.163 121.769 15.859  1.00 110.32 ? 482  THR B CB    1 
ATOM   5688  O  OG1   . THR B 1 80  ? -26.473 122.924 15.070  1.00 99.36  ? 482  THR B OG1   1 
ATOM   5689  C  CG2   . THR B 1 80  ? -24.649 121.565 15.925  1.00 114.29 ? 482  THR B CG2   1 
ATOM   5690  N  N     . ILE B 1 81  ? -28.600 120.901 13.642  1.00 90.25  ? 483  ILE B N     1 
ATOM   5691  C  CA    . ILE B 1 81  ? -29.961 121.031 13.167  1.00 85.65  ? 483  ILE B CA    1 
ATOM   5692  C  C     . ILE B 1 81  ? -30.536 119.627 13.093  1.00 96.15  ? 483  ILE B C     1 
ATOM   5693  O  O     . ILE B 1 81  ? -31.751 119.425 13.221  1.00 92.70  ? 483  ILE B O     1 
ATOM   5694  C  CB    . ILE B 1 81  ? -29.994 121.708 11.816  1.00 80.05  ? 483  ILE B CB    1 
ATOM   5695  C  CG1   . ILE B 1 81  ? -29.478 123.140 11.960  1.00 72.27  ? 483  ILE B CG1   1 
ATOM   5696  C  CG2   . ILE B 1 81  ? -31.399 121.669 11.229  1.00 77.35  ? 483  ILE B CG2   1 
ATOM   5697  C  CD1   . ILE B 1 81  ? -29.389 123.886 10.654  1.00 75.15  ? 483  ILE B CD1   1 
ATOM   5698  N  N     . GLY B 1 82  ? -29.630 118.666 12.906  1.00 106.04 ? 484  GLY B N     1 
ATOM   5699  C  CA    . GLY B 1 82  ? -29.929 117.249 13.017  1.00 111.20 ? 484  GLY B CA    1 
ATOM   5700  C  C     . GLY B 1 82  ? -31.057 116.802 12.117  1.00 114.23 ? 484  GLY B C     1 
ATOM   5701  O  O     . GLY B 1 82  ? -31.990 116.128 12.559  1.00 113.78 ? 484  GLY B O     1 
ATOM   5702  N  N     . ALA B 1 83  ? -30.977 117.190 10.850  1.00 115.70 ? 485  ALA B N     1 
ATOM   5703  C  CA    . ALA B 1 83  ? -31.967 116.772 9.866   1.00 114.37 ? 485  ALA B CA    1 
ATOM   5704  C  C     . ALA B 1 83  ? -31.280 116.288 8.596   1.00 112.03 ? 485  ALA B C     1 
ATOM   5705  O  O     . ALA B 1 83  ? -31.926 116.116 7.571   1.00 116.32 ? 485  ALA B O     1 
ATOM   5706  C  CB    . ALA B 1 83  ? -32.951 117.904 9.557   1.00 106.49 ? 485  ALA B CB    1 
ATOM   5707  N  N     . GLY B 1 84  ? -29.970 116.057 8.678   1.00 106.09 ? 486  GLY B N     1 
ATOM   5708  C  CA    . GLY B 1 84  ? -29.200 115.603 7.534   1.00 102.13 ? 486  GLY B CA    1 
ATOM   5709  C  C     . GLY B 1 84  ? -29.078 116.691 6.484   1.00 105.01 ? 486  GLY B C     1 
ATOM   5710  O  O     . GLY B 1 84  ? -29.561 117.813 6.680   1.00 104.76 ? 486  GLY B O     1 
ATOM   5711  N  N     . VAL B 1 85  ? -28.425 116.365 5.370   1.00 107.14 ? 487  VAL B N     1 
ATOM   5712  C  CA    . VAL B 1 85  ? -28.279 117.299 4.255   1.00 103.03 ? 487  VAL B CA    1 
ATOM   5713  C  C     . VAL B 1 85  ? -28.664 116.651 2.930   1.00 106.05 ? 487  VAL B C     1 
ATOM   5714  O  O     . VAL B 1 85  ? -28.763 115.425 2.809   1.00 104.58 ? 487  VAL B O     1 
ATOM   5715  C  CB    . VAL B 1 85  ? -26.840 117.857 4.138   1.00 80.60  ? 487  VAL B CB    1 
ATOM   5716  N  N     . GLY B 1 86  ? -28.888 117.497 1.934   1.00 111.68 ? 488  GLY B N     1 
ATOM   5717  C  CA    . GLY B 1 86  ? -29.046 117.038 0.569   1.00 112.37 ? 488  GLY B CA    1 
ATOM   5718  C  C     . GLY B 1 86  ? -30.433 116.540 0.289   1.00 109.46 ? 488  GLY B C     1 
ATOM   5719  O  O     . GLY B 1 86  ? -31.416 117.065 0.800   1.00 109.14 ? 488  GLY B O     1 
ATOM   5720  N  N     . ALA B 1 87  ? -30.512 115.519 -0.543  1.00 114.22 ? 489  ALA B N     1 
ATOM   5721  C  CA    . ALA B 1 87  ? -31.798 114.948 -0.881  1.00 124.44 ? 489  ALA B CA    1 
ATOM   5722  C  C     . ALA B 1 87  ? -32.332 114.157 0.307   1.00 133.80 ? 489  ALA B C     1 
ATOM   5723  O  O     . ALA B 1 87  ? -33.537 113.916 0.405   1.00 137.66 ? 489  ALA B O     1 
ATOM   5724  C  CB    . ALA B 1 87  ? -31.682 114.067 -2.125  1.00 124.22 ? 489  ALA B CB    1 
ATOM   5725  N  N     . ASP B 1 88  ? -31.435 113.761 1.211   1.00 136.47 ? 490  ASP B N     1 
ATOM   5726  C  CA    . ASP B 1 88  ? -31.835 113.012 2.406   1.00 139.03 ? 490  ASP B CA    1 
ATOM   5727  C  C     . ASP B 1 88  ? -32.171 113.954 3.577   1.00 141.84 ? 490  ASP B C     1 
ATOM   5728  O  O     . ASP B 1 88  ? -31.871 113.654 4.738   1.00 142.53 ? 490  ASP B O     1 
ATOM   5729  C  CB    . ASP B 1 88  ? -30.768 111.979 2.799   1.00 131.46 ? 490  ASP B CB    1 
ATOM   5730  N  N     . PHE B 1 89  ? -32.818 115.078 3.248   1.00 137.91 ? 491  PHE B N     1 
ATOM   5731  C  CA    . PHE B 1 89  ? -33.203 116.113 4.218   1.00 124.65 ? 491  PHE B CA    1 
ATOM   5732  C  C     . PHE B 1 89  ? -34.686 116.108 4.638   1.00 124.47 ? 491  PHE B C     1 
ATOM   5733  O  O     . PHE B 1 89  ? -35.591 116.354 3.833   1.00 119.43 ? 491  PHE B O     1 
ATOM   5734  C  CB    . PHE B 1 89  ? -32.833 117.501 3.692   1.00 117.15 ? 491  PHE B CB    1 
ATOM   5735  C  CG    . PHE B 1 89  ? -33.150 118.613 4.652   1.00 116.23 ? 491  PHE B CG    1 
ATOM   5736  C  CD1   . PHE B 1 89  ? -32.232 118.987 5.628   1.00 113.45 ? 491  PHE B CD1   1 
ATOM   5737  C  CD2   . PHE B 1 89  ? -34.364 119.283 4.586   1.00 116.83 ? 491  PHE B CD2   1 
ATOM   5738  C  CE1   . PHE B 1 89  ? -32.517 120.010 6.521   1.00 108.85 ? 491  PHE B CE1   1 
ATOM   5739  C  CE2   . PHE B 1 89  ? -34.656 120.311 5.478   1.00 113.71 ? 491  PHE B CE2   1 
ATOM   5740  C  CZ    . PHE B 1 89  ? -33.729 120.675 6.446   1.00 108.52 ? 491  PHE B CZ    1 
ATOM   5741  N  N     . SER B 1 90  ? -34.906 115.869 5.927   1.00 128.88 ? 492  SER B N     1 
ATOM   5742  C  CA    . SER B 1 90  ? -36.239 115.752 6.504   1.00 132.83 ? 492  SER B CA    1 
ATOM   5743  C  C     . SER B 1 90  ? -36.579 116.939 7.426   1.00 129.69 ? 492  SER B C     1 
ATOM   5744  O  O     . SER B 1 90  ? -36.097 117.004 8.563   1.00 131.33 ? 492  SER B O     1 
ATOM   5745  C  CB    . SER B 1 90  ? -36.305 114.441 7.288   1.00 134.59 ? 492  SER B CB    1 
ATOM   5746  O  OG    . SER B 1 90  ? -35.132 113.671 7.061   1.00 130.01 ? 492  SER B OG    1 
ATOM   5747  N  N     . ILE B 1 91  ? -37.409 117.866 6.936   1.00 122.29 ? 493  ILE B N     1 
ATOM   5748  C  CA    . ILE B 1 91  ? -37.766 119.082 7.684   1.00 110.38 ? 493  ILE B CA    1 
ATOM   5749  C  C     . ILE B 1 91  ? -38.392 118.760 9.031   1.00 117.86 ? 493  ILE B C     1 
ATOM   5750  O  O     . ILE B 1 91  ? -38.297 119.555 9.973   1.00 111.39 ? 493  ILE B O     1 
ATOM   5751  C  CB    . ILE B 1 91  ? -38.772 119.959 6.915   1.00 99.38  ? 493  ILE B CB    1 
ATOM   5752  N  N     . GLU B 1 92  ? -39.037 117.593 9.098   1.00 124.69 ? 494  GLU B N     1 
ATOM   5753  C  CA    . GLU B 1 92  ? -39.809 117.163 10.264  1.00 122.25 ? 494  GLU B CA    1 
ATOM   5754  C  C     . GLU B 1 92  ? -38.908 116.849 11.461  1.00 121.42 ? 494  GLU B C     1 
ATOM   5755  O  O     . GLU B 1 92  ? -39.349 116.900 12.608  1.00 122.65 ? 494  GLU B O     1 
ATOM   5756  C  CB    . GLU B 1 92  ? -40.706 115.958 9.916   1.00 105.00 ? 494  GLU B CB    1 
ATOM   5757  N  N     . ASP B 1 93  ? -37.642 116.543 11.196  1.00 117.70 ? 495  ASP B N     1 
ATOM   5758  C  CA    . ASP B 1 93  ? -36.730 116.152 12.267  1.00 117.55 ? 495  ASP B CA    1 
ATOM   5759  C  C     . ASP B 1 93  ? -35.816 117.303 12.748  1.00 119.10 ? 495  ASP B C     1 
ATOM   5760  O  O     . ASP B 1 93  ? -34.949 117.099 13.603  1.00 117.10 ? 495  ASP B O     1 
ATOM   5761  C  CB    . ASP B 1 93  ? -35.924 114.906 11.858  1.00 109.92 ? 495  ASP B CB    1 
ATOM   5762  N  N     . ALA B 1 94  ? -36.029 118.507 12.213  1.00 118.57 ? 496  ALA B N     1 
ATOM   5763  C  CA    . ALA B 1 94  ? -35.244 119.689 12.598  1.00 112.96 ? 496  ALA B CA    1 
ATOM   5764  C  C     . ALA B 1 94  ? -35.361 119.989 14.096  1.00 122.81 ? 496  ALA B C     1 
ATOM   5765  O  O     . ALA B 1 94  ? -36.311 119.553 14.749  1.00 133.94 ? 496  ALA B O     1 
ATOM   5766  C  CB    . ALA B 1 94  ? -35.666 120.904 11.775  1.00 98.20  ? 496  ALA B CB    1 
ATOM   5767  N  N     . ASN B 1 95  ? -34.399 120.730 14.641  1.00 114.66 ? 497  ASN B N     1 
ATOM   5768  C  CA    . ASN B 1 95  ? -34.397 121.028 16.076  1.00 108.51 ? 497  ASN B CA    1 
ATOM   5769  C  C     . ASN B 1 95  ? -34.693 122.488 16.384  1.00 100.28 ? 497  ASN B C     1 
ATOM   5770  O  O     . ASN B 1 95  ? -34.718 122.891 17.546  1.00 99.38  ? 497  ASN B O     1 
ATOM   5771  C  CB    . ASN B 1 95  ? -33.054 120.660 16.702  1.00 109.39 ? 497  ASN B CB    1 
ATOM   5772  C  CG    . ASN B 1 95  ? -32.764 119.180 16.635  1.00 117.66 ? 497  ASN B CG    1 
ATOM   5773  O  OD1   . ASN B 1 95  ? -33.640 118.344 16.881  1.00 125.53 ? 497  ASN B OD1   1 
ATOM   5774  N  ND2   . ASN B 1 95  ? -31.522 118.843 16.303  1.00 115.56 ? 497  ASN B ND2   1 
ATOM   5775  N  N     . TYR B 1 96  ? -34.892 123.281 15.340  1.00 95.60  ? 498  TYR B N     1 
ATOM   5776  C  CA    . TYR B 1 96  ? -35.131 124.707 15.501  1.00 97.50  ? 498  TYR B CA    1 
ATOM   5777  C  C     . TYR B 1 96  ? -36.240 125.166 14.568  1.00 102.60 ? 498  TYR B C     1 
ATOM   5778  O  O     . TYR B 1 96  ? -36.343 124.719 13.423  1.00 103.20 ? 498  TYR B O     1 
ATOM   5779  C  CB    . TYR B 1 96  ? -33.859 125.528 15.220  1.00 96.69  ? 498  TYR B CB    1 
ATOM   5780  C  CG    . TYR B 1 96  ? -32.638 125.101 16.011  1.00 98.08  ? 498  TYR B CG    1 
ATOM   5781  C  CD1   . TYR B 1 96  ? -32.352 125.667 17.251  1.00 94.40  ? 498  TYR B CD1   1 
ATOM   5782  C  CD2   . TYR B 1 96  ? -31.770 124.128 15.517  1.00 98.75  ? 498  TYR B CD2   1 
ATOM   5783  C  CE1   . TYR B 1 96  ? -31.236 125.279 17.977  1.00 90.38  ? 498  TYR B CE1   1 
ATOM   5784  C  CE2   . TYR B 1 96  ? -30.654 123.730 16.239  1.00 96.22  ? 498  TYR B CE2   1 
ATOM   5785  C  CZ    . TYR B 1 96  ? -30.392 124.312 17.467  1.00 92.51  ? 498  TYR B CZ    1 
ATOM   5786  O  OH    . TYR B 1 96  ? -29.282 123.928 18.184  1.00 93.58  ? 498  TYR B OH    1 
ATOM   5787  N  N     . ASP B 1 97  ? -37.066 126.074 15.064  1.00 103.98 ? 499  ASP B N     1 
ATOM   5788  C  CA    . ASP B 1 97  ? -38.112 126.667 14.255  1.00 103.90 ? 499  ASP B CA    1 
ATOM   5789  C  C     . ASP B 1 97  ? -37.566 127.843 13.441  1.00 98.38  ? 499  ASP B C     1 
ATOM   5790  O  O     . ASP B 1 97  ? -38.090 128.168 12.374  1.00 97.77  ? 499  ASP B O     1 
ATOM   5791  C  CB    . ASP B 1 97  ? -39.250 127.126 15.161  1.00 111.39 ? 499  ASP B CB    1 
ATOM   5792  C  CG    . ASP B 1 97  ? -40.263 127.976 14.434  1.00 121.26 ? 499  ASP B CG    1 
ATOM   5793  O  OD1   . ASP B 1 97  ? -41.041 127.399 13.638  1.00 129.27 ? 499  ASP B OD1   1 
ATOM   5794  O  OD2   . ASP B 1 97  ? -40.285 129.212 14.665  1.00 118.80 ? 499  ASP B OD2   1 
ATOM   5795  N  N     . LYS B 1 98  ? -36.515 128.480 13.953  1.00 95.64  ? 500  LYS B N     1 
ATOM   5796  C  CA    . LYS B 1 98  ? -35.909 129.633 13.286  1.00 95.27  ? 500  LYS B CA    1 
ATOM   5797  C  C     . LYS B 1 98  ? -34.385 129.533 13.223  1.00 98.70  ? 500  LYS B C     1 
ATOM   5798  O  O     . LYS B 1 98  ? -33.721 129.328 14.243  1.00 104.59 ? 500  LYS B O     1 
ATOM   5799  C  CB    . LYS B 1 98  ? -36.304 130.949 13.978  1.00 88.31  ? 500  LYS B CB    1 
ATOM   5800  C  CG    . LYS B 1 98  ? -37.795 131.193 14.021  1.00 92.04  ? 500  LYS B CG    1 
ATOM   5801  C  CD    . LYS B 1 98  ? -38.170 132.594 14.462  1.00 93.16  ? 500  LYS B CD    1 
ATOM   5802  C  CE    . LYS B 1 98  ? -39.674 132.639 14.727  1.00 107.45 ? 500  LYS B CE    1 
ATOM   5803  N  NZ    . LYS B 1 98  ? -40.213 134.026 14.722  1.00 116.05 ? 500  LYS B NZ    1 
ATOM   5804  N  N     . ILE B 1 99  ? -33.835 129.674 12.021  1.00 89.32  ? 501  ILE B N     1 
ATOM   5805  C  CA    . ILE B 1 99  ? -32.399 129.876 11.873  1.00 78.69  ? 501  ILE B CA    1 
ATOM   5806  C  C     . ILE B 1 99  ? -32.185 131.366 11.620  1.00 77.37  ? 501  ILE B C     1 
ATOM   5807  O  O     . ILE B 1 99  ? -32.859 131.960 10.777  1.00 78.08  ? 501  ILE B O     1 
ATOM   5808  C  CB    . ILE B 1 99  ? -31.816 129.031 10.727  1.00 73.94  ? 501  ILE B CB    1 
ATOM   5809  C  CG1   . ILE B 1 99  ? -32.436 127.631 10.738  1.00 70.35  ? 501  ILE B CG1   1 
ATOM   5810  C  CG2   . ILE B 1 99  ? -30.299 128.961 10.835  1.00 72.39  ? 501  ILE B CG2   1 
ATOM   5811  C  CD1   . ILE B 1 99  ? -31.938 126.750 11.833  1.00 70.53  ? 501  ILE B CD1   1 
ATOM   5812  N  N     . ILE B 1 100 ? -31.281 131.982 12.375  1.00 79.32  ? 502  ILE B N     1 
ATOM   5813  C  CA    . ILE B 1 100 ? -31.093 133.435 12.293  1.00 80.59  ? 502  ILE B CA    1 
ATOM   5814  C  C     . ILE B 1 100 ? -29.653 133.832 11.973  1.00 85.16  ? 502  ILE B C     1 
ATOM   5815  O  O     . ILE B 1 100 ? -28.736 133.528 12.734  1.00 93.59  ? 502  ILE B O     1 
ATOM   5816  C  CB    . ILE B 1 100 ? -31.501 134.140 13.593  1.00 69.70  ? 502  ILE B CB    1 
ATOM   5817  C  CG1   . ILE B 1 100 ? -32.938 133.779 13.971  1.00 70.23  ? 502  ILE B CG1   1 
ATOM   5818  C  CG2   . ILE B 1 100 ? -31.354 135.637 13.428  1.00 64.96  ? 502  ILE B CG2   1 
ATOM   5819  C  CD1   . ILE B 1 100 ? -33.242 133.954 15.445  1.00 68.96  ? 502  ILE B CD1   1 
ATOM   5820  N  N     . ILE B 1 101 ? -29.454 134.514 10.849  1.00 71.26  ? 503  ILE B N     1 
ATOM   5821  C  CA    . ILE B 1 101 ? -28.114 134.895 10.454  1.00 65.25  ? 503  ILE B CA    1 
ATOM   5822  C  C     . ILE B 1 101 ? -27.838 136.302 10.961  1.00 72.55  ? 503  ILE B C     1 
ATOM   5823  O  O     . ILE B 1 101 ? -28.512 137.259 10.595  1.00 78.44  ? 503  ILE B O     1 
ATOM   5824  C  CB    . ILE B 1 101 ? -27.916 134.784 8.929   1.00 69.72  ? 503  ILE B CB    1 
ATOM   5825  C  CG1   . ILE B 1 101 ? -28.292 133.378 8.449   1.00 71.78  ? 503  ILE B CG1   1 
ATOM   5826  C  CG2   . ILE B 1 101 ? -26.473 135.115 8.543   1.00 62.37  ? 503  ILE B CG2   1 
ATOM   5827  C  CD1   . ILE B 1 101 ? -28.725 133.307 6.984   1.00 70.85  ? 503  ILE B CD1   1 
ATOM   5828  N  N     . MET B 1 102 ? -26.845 136.411 11.830  1.00 74.79  ? 504  MET B N     1 
ATOM   5829  C  CA    . MET B 1 102 ? -26.558 137.658 12.512  1.00 78.39  ? 504  MET B CA    1 
ATOM   5830  C  C     . MET B 1 102 ? -25.118 138.047 12.232  1.00 81.23  ? 504  MET B C     1 
ATOM   5831  O  O     . MET B 1 102 ? -24.193 137.532 12.860  1.00 86.86  ? 504  MET B O     1 
ATOM   5832  C  CB    . MET B 1 102 ? -26.784 137.491 14.026  1.00 81.27  ? 504  MET B CB    1 
ATOM   5833  C  CG    . MET B 1 102 ? -26.871 138.795 14.815  1.00 82.19  ? 504  MET B CG    1 
ATOM   5834  S  SD    . MET B 1 102 ? -27.057 138.563 16.603  1.00 80.83  ? 504  MET B SD    1 
ATOM   5835  C  CE    . MET B 1 102 ? -25.502 137.779 17.004  1.00 117.71 ? 504  MET B CE    1 
ATOM   5836  N  N     . THR B 1 103 ? -24.934 138.952 11.282  1.00 78.97  ? 505  THR B N     1 
ATOM   5837  C  CA    . THR B 1 103 ? -23.604 139.431 10.923  1.00 76.87  ? 505  THR B CA    1 
ATOM   5838  C  C     . THR B 1 103 ? -23.490 140.922 11.225  1.00 72.61  ? 505  THR B C     1 
ATOM   5839  O  O     . THR B 1 103 ? -24.497 141.574 11.480  1.00 70.25  ? 505  THR B O     1 
ATOM   5840  C  CB    . THR B 1 103 ? -23.392 139.286 9.418   1.00 76.38  ? 505  THR B CB    1 
ATOM   5841  O  OG1   . THR B 1 103 ? -24.261 140.213 8.749   1.00 80.52  ? 505  THR B OG1   1 
ATOM   5842  C  CG2   . THR B 1 103 ? -23.694 137.855 8.958   1.00 65.14  ? 505  THR B CG2   1 
ATOM   5843  N  N     . ASP B 1 104 ? -22.275 141.472 11.168  1.00 73.64  ? 506  ASP B N     1 
ATOM   5844  C  CA    . ASP B 1 104 ? -22.118 142.924 11.207  1.00 78.32  ? 506  ASP B CA    1 
ATOM   5845  C  C     . ASP B 1 104 ? -22.963 143.461 10.057  1.00 79.00  ? 506  ASP B C     1 
ATOM   5846  O  O     . ASP B 1 104 ? -23.156 142.779 9.033   1.00 73.85  ? 506  ASP B O     1 
ATOM   5847  C  CB    . ASP B 1 104 ? -20.672 143.377 10.942  1.00 91.26  ? 506  ASP B CB    1 
ATOM   5848  C  CG    . ASP B 1 104 ? -19.651 142.907 11.995  1.00 105.14 ? 506  ASP B CG    1 
ATOM   5849  O  OD1   . ASP B 1 104 ? -20.031 142.482 13.120  1.00 92.45  ? 506  ASP B OD1   1 
ATOM   5850  O  OD2   . ASP B 1 104 ? -18.432 143.007 11.663  1.00 127.57 ? 506  ASP B OD2   1 
ATOM   5851  N  N     . ALA B 1 105 ? -23.451 144.686 10.201  1.00 76.91  ? 507  ALA B N     1 
ATOM   5852  C  CA    . ALA B 1 105 ? -24.058 145.364 9.065   1.00 72.87  ? 507  ALA B CA    1 
ATOM   5853  C  C     . ALA B 1 105 ? -22.968 146.076 8.250   1.00 74.19  ? 507  ALA B C     1 
ATOM   5854  O  O     . ALA B 1 105 ? -23.029 147.287 8.029   1.00 70.54  ? 507  ALA B O     1 
ATOM   5855  C  CB    . ALA B 1 105 ? -25.095 146.343 9.540   1.00 69.65  ? 507  ALA B CB    1 
ATOM   5856  N  N     . ASP B 1 106 ? -21.947 145.322 7.850   1.00 74.57  ? 508  ASP B N     1 
ATOM   5857  C  CA    . ASP B 1 106 ? -20.872 145.843 7.002   1.00 71.68  ? 508  ASP B CA    1 
ATOM   5858  C  C     . ASP B 1 106 ? -20.829 145.011 5.698   1.00 64.29  ? 508  ASP B C     1 
ATOM   5859  O  O     . ASP B 1 106 ? -21.620 144.065 5.545   1.00 58.28  ? 508  ASP B O     1 
ATOM   5860  C  CB    . ASP B 1 106 ? -19.513 145.989 7.765   1.00 53.68  ? 508  ASP B CB    1 
ATOM   5861  C  CG    . ASP B 1 106 ? -18.984 144.672 8.399   1.00 86.25  ? 508  ASP B CG    1 
ATOM   5862  O  OD1   . ASP B 1 106 ? -19.299 143.593 7.850   1.00 83.40  ? 508  ASP B OD1   1 
ATOM   5863  O  OD2   . ASP B 1 106 ? -18.208 144.717 9.426   1.00 90.29  ? 508  ASP B OD2   1 
ATOM   5864  N  N     . THR B 1 107 ? -19.964 145.353 4.743   1.00 65.90  ? 509  THR B N     1 
ATOM   5865  C  CA    . THR B 1 107 ? -20.033 144.649 3.453   1.00 67.84  ? 509  THR B CA    1 
ATOM   5866  C  C     . THR B 1 107 ? -19.605 143.196 3.537   1.00 68.63  ? 509  THR B C     1 
ATOM   5867  O  O     . THR B 1 107 ? -20.166 142.347 2.835   1.00 74.76  ? 509  THR B O     1 
ATOM   5868  C  CB    . THR B 1 107 ? -19.211 145.301 2.348   1.00 67.80  ? 509  THR B CB    1 
ATOM   5869  O  OG1   . THR B 1 107 ? -17.891 145.559 2.831   1.00 74.75  ? 509  THR B OG1   1 
ATOM   5870  C  CG2   . THR B 1 107 ? -19.879 146.595 1.845   1.00 62.00  ? 509  THR B CG2   1 
ATOM   5871  N  N     . ASP B 1 108 ? -18.606 142.911 4.375   1.00 60.18  ? 510  ASP B N     1 
ATOM   5872  C  CA    . ASP B 1 108 ? -18.208 141.518 4.610   1.00 60.69  ? 510  ASP B CA    1 
ATOM   5873  C  C     . ASP B 1 108 ? -19.272 140.691 5.325   1.00 63.03  ? 510  ASP B C     1 
ATOM   5874  O  O     . ASP B 1 108 ? -19.226 139.461 5.306   1.00 65.16  ? 510  ASP B O     1 
ATOM   5875  C  CB    . ASP B 1 108 ? -16.908 141.438 5.390   1.00 66.47  ? 510  ASP B CB    1 
ATOM   5876  C  CG    . ASP B 1 108 ? -15.788 142.131 4.690   1.00 72.68  ? 510  ASP B CG    1 
ATOM   5877  O  OD1   . ASP B 1 108 ? -15.328 141.555 3.681   1.00 73.01  ? 510  ASP B OD1   1 
ATOM   5878  O  OD2   . ASP B 1 108 ? -15.378 143.237 5.144   1.00 75.00  ? 510  ASP B OD2   1 
ATOM   5879  N  N     . GLY B 1 109 ? -20.217 141.358 5.971   1.00 67.15  ? 511  GLY B N     1 
ATOM   5880  C  CA    . GLY B 1 109 ? -21.286 140.639 6.633   1.00 71.55  ? 511  GLY B CA    1 
ATOM   5881  C  C     . GLY B 1 109 ? -22.252 140.321 5.523   1.00 74.41  ? 511  GLY B C     1 
ATOM   5882  O  O     . GLY B 1 109 ? -22.799 139.218 5.412   1.00 72.06  ? 511  GLY B O     1 
ATOM   5883  N  N     . ALA B 1 110 ? -22.448 141.327 4.681   1.00 74.48  ? 512  ALA B N     1 
ATOM   5884  C  CA    . ALA B 1 110 ? -23.240 141.156 3.486   1.00 71.40  ? 512  ALA B CA    1 
ATOM   5885  C  C     . ALA B 1 110 ? -22.763 139.899 2.743   1.00 70.76  ? 512  ALA B C     1 
ATOM   5886  O  O     . ALA B 1 110 ? -23.570 139.039 2.382   1.00 66.47  ? 512  ALA B O     1 
ATOM   5887  C  CB    . ALA B 1 110 ? -23.112 142.372 2.628   1.00 65.81  ? 512  ALA B CB    1 
ATOM   5888  N  N     . HIS B 1 111 ? -21.447 139.780 2.563   1.00 64.83  ? 513  HIS B N     1 
ATOM   5889  C  CA    . HIS B 1 111 ? -20.865 138.621 1.892   1.00 68.68  ? 513  HIS B CA    1 
ATOM   5890  C  C     . HIS B 1 111 ? -21.192 137.293 2.603   1.00 69.96  ? 513  HIS B C     1 
ATOM   5891  O  O     . HIS B 1 111 ? -21.655 136.341 1.964   1.00 75.13  ? 513  HIS B O     1 
ATOM   5892  C  CB    . HIS B 1 111 ? -19.348 138.799 1.719   1.00 67.16  ? 513  HIS B CB    1 
ATOM   5893  C  CG    . HIS B 1 111 ? -18.713 137.766 0.836   1.00 66.69  ? 513  HIS B CG    1 
ATOM   5894  N  ND1   . HIS B 1 111 ? -17.421 137.318 1.020   1.00 64.52  ? 513  HIS B ND1   1 
ATOM   5895  C  CD2   . HIS B 1 111 ? -19.192 137.092 -0.235  1.00 63.00  ? 513  HIS B CD2   1 
ATOM   5896  C  CE1   . HIS B 1 111 ? -17.133 136.414 0.104   1.00 63.15  ? 513  HIS B CE1   1 
ATOM   5897  N  NE2   . HIS B 1 111 ? -18.188 136.266 -0.676  1.00 65.82  ? 513  HIS B NE2   1 
ATOM   5898  N  N     . ILE B 1 112 ? -20.954 137.231 3.913   1.00 65.46  ? 514  ILE B N     1 
ATOM   5899  C  CA    . ILE B 1 112 ? -21.284 136.027 4.692   1.00 65.71  ? 514  ILE B CA    1 
ATOM   5900  C  C     . ILE B 1 112 ? -22.747 135.590 4.559   1.00 66.56  ? 514  ILE B C     1 
ATOM   5901  O  O     . ILE B 1 112 ? -23.029 134.397 4.450   1.00 68.15  ? 514  ILE B O     1 
ATOM   5902  C  CB    . ILE B 1 112 ? -20.957 136.195 6.194   1.00 63.76  ? 514  ILE B CB    1 
ATOM   5903  C  CG1   . ILE B 1 112 ? -19.476 135.929 6.451   1.00 67.36  ? 514  ILE B CG1   1 
ATOM   5904  C  CG2   . ILE B 1 112 ? -21.778 135.240 7.022   1.00 57.17  ? 514  ILE B CG2   1 
ATOM   5905  C  CD1   . ILE B 1 112 ? -18.936 136.637 7.682   1.00 68.38  ? 514  ILE B CD1   1 
ATOM   5906  N  N     . GLN B 1 113 ? -23.673 136.550 4.578   1.00 67.42  ? 515  GLN B N     1 
ATOM   5907  C  CA    . GLN B 1 113 ? -25.096 136.238 4.449   1.00 69.03  ? 515  GLN B CA    1 
ATOM   5908  C  C     . GLN B 1 113 ? -25.325 135.521 3.135   1.00 78.22  ? 515  GLN B C     1 
ATOM   5909  O  O     . GLN B 1 113 ? -26.123 134.595 3.041   1.00 74.61  ? 515  GLN B O     1 
ATOM   5910  C  CB    . GLN B 1 113 ? -25.945 137.506 4.473   1.00 66.03  ? 515  GLN B CB    1 
ATOM   5911  C  CG    . GLN B 1 113 ? -25.739 138.388 5.686   1.00 70.16  ? 515  GLN B CG    1 
ATOM   5912  C  CD    . GLN B 1 113 ? -26.771 139.496 5.776   1.00 78.61  ? 515  GLN B CD    1 
ATOM   5913  O  OE1   . GLN B 1 113 ? -27.710 139.567 4.976   1.00 80.52  ? 515  GLN B OE1   1 
ATOM   5914  N  NE2   . GLN B 1 113 ? -26.601 140.370 6.752   1.00 84.80  ? 515  GLN B NE2   1 
ATOM   5915  N  N     . THR B 1 114 ? -24.615 135.987 2.116   1.00 85.91  ? 516  THR B N     1 
ATOM   5916  C  CA    . THR B 1 114 ? -24.638 135.401 0.786   1.00 80.89  ? 516  THR B CA    1 
ATOM   5917  C  C     . THR B 1 114 ? -24.199 133.943 0.816   1.00 79.85  ? 516  THR B C     1 
ATOM   5918  O  O     . THR B 1 114 ? -24.915 133.064 0.356   1.00 84.22  ? 516  THR B O     1 
ATOM   5919  C  CB    . THR B 1 114 ? -23.664 136.156 -0.125  1.00 81.91  ? 516  THR B CB    1 
ATOM   5920  O  OG1   . THR B 1 114 ? -24.348 137.238 -0.777  1.00 84.15  ? 516  THR B OG1   1 
ATOM   5921  C  CG2   . THR B 1 114 ? -23.058 135.212 -1.136  1.00 82.17  ? 516  THR B CG2   1 
ATOM   5922  N  N     . LEU B 1 115 ? -23.018 133.692 1.370   1.00 77.79  ? 517  LEU B N     1 
ATOM   5923  C  CA    . LEU B 1 115 ? -22.439 132.353 1.374   1.00 77.05  ? 517  LEU B CA    1 
ATOM   5924  C  C     . LEU B 1 115 ? -23.316 131.329 2.101   1.00 82.08  ? 517  LEU B C     1 
ATOM   5925  O  O     . LEU B 1 115 ? -23.555 130.216 1.588   1.00 79.03  ? 517  LEU B O     1 
ATOM   5926  C  CB    . LEU B 1 115 ? -21.030 132.393 1.972   1.00 75.10  ? 517  LEU B CB    1 
ATOM   5927  C  CG    . LEU B 1 115 ? -20.073 133.240 1.131   1.00 78.80  ? 517  LEU B CG    1 
ATOM   5928  C  CD1   . LEU B 1 115 ? -19.036 133.879 1.995   1.00 71.40  ? 517  LEU B CD1   1 
ATOM   5929  C  CD2   . LEU B 1 115 ? -19.415 132.404 0.045   1.00 82.43  ? 517  LEU B CD2   1 
ATOM   5930  N  N     . LEU B 1 116 ? -23.786 131.716 3.290   1.00 81.77  ? 518  LEU B N     1 
ATOM   5931  C  CA    . LEU B 1 116 ? -24.671 130.885 4.111   1.00 74.75  ? 518  LEU B CA    1 
ATOM   5932  C  C     . LEU B 1 116 ? -25.972 130.554 3.399   1.00 78.35  ? 518  LEU B C     1 
ATOM   5933  O  O     . LEU B 1 116 ? -26.391 129.402 3.401   1.00 82.31  ? 518  LEU B O     1 
ATOM   5934  C  CB    . LEU B 1 116 ? -24.970 131.570 5.449   1.00 69.42  ? 518  LEU B CB    1 
ATOM   5935  C  CG    . LEU B 1 116 ? -23.804 131.522 6.436   1.00 68.54  ? 518  LEU B CG    1 
ATOM   5936  C  CD1   . LEU B 1 116 ? -23.824 132.699 7.395   1.00 68.53  ? 518  LEU B CD1   1 
ATOM   5937  C  CD2   . LEU B 1 116 ? -23.872 130.216 7.182   1.00 66.61  ? 518  LEU B CD2   1 
ATOM   5938  N  N     . LEU B 1 117 ? -26.604 131.564 2.792   1.00 83.71  ? 519  LEU B N     1 
ATOM   5939  C  CA    . LEU B 1 117 ? -27.849 131.384 2.029   1.00 86.47  ? 519  LEU B CA    1 
ATOM   5940  C  C     . LEU B 1 117 ? -27.675 130.455 0.821   1.00 88.37  ? 519  LEU B C     1 
ATOM   5941  O  O     . LEU B 1 117 ? -28.560 129.637 0.518   1.00 88.27  ? 519  LEU B O     1 
ATOM   5942  C  CB    . LEU B 1 117 ? -28.449 132.737 1.599   1.00 79.95  ? 519  LEU B CB    1 
ATOM   5943  C  CG    . LEU B 1 117 ? -29.187 133.553 2.675   1.00 74.51  ? 519  LEU B CG    1 
ATOM   5944  C  CD1   . LEU B 1 117 ? -29.637 134.914 2.147   1.00 72.11  ? 519  LEU B CD1   1 
ATOM   5945  C  CD2   . LEU B 1 117 ? -30.377 132.783 3.231   1.00 69.67  ? 519  LEU B CD2   1 
ATOM   5946  N  N     . THR B 1 118 ? -26.537 130.556 0.137   1.00 80.64  ? 520  THR B N     1 
ATOM   5947  C  CA    . THR B 1 118 ? -26.318 129.646 -0.978  1.00 82.56  ? 520  THR B CA    1 
ATOM   5948  C  C     . THR B 1 118 ? -26.041 128.210 -0.513  1.00 86.27  ? 520  THR B C     1 
ATOM   5949  O  O     . THR B 1 118 ? -26.137 127.275 -1.298  1.00 97.26  ? 520  THR B O     1 
ATOM   5950  C  CB    . THR B 1 118 ? -25.265 130.146 -1.993  1.00 77.84  ? 520  THR B CB    1 
ATOM   5951  O  OG1   . THR B 1 118 ? -24.104 129.314 -1.941  1.00 77.18  ? 520  THR B OG1   1 
ATOM   5952  C  CG2   . THR B 1 118 ? -24.894 131.572 -1.722  1.00 77.92  ? 520  THR B CG2   1 
ATOM   5953  N  N     . PHE B 1 119 ? -25.725 128.033 0.763   1.00 85.72  ? 521  PHE B N     1 
ATOM   5954  C  CA    . PHE B 1 119 ? -25.651 126.686 1.335   1.00 87.73  ? 521  PHE B CA    1 
ATOM   5955  C  C     . PHE B 1 119 ? -27.043 126.133 1.678   1.00 90.90  ? 521  PHE B C     1 
ATOM   5956  O  O     . PHE B 1 119 ? -27.389 125.010 1.296   1.00 92.73  ? 521  PHE B O     1 
ATOM   5957  C  CB    . PHE B 1 119 ? -24.741 126.648 2.572   1.00 83.14  ? 521  PHE B CB    1 
ATOM   5958  C  CG    . PHE B 1 119 ? -24.791 125.342 3.312   1.00 90.49  ? 521  PHE B CG    1 
ATOM   5959  C  CD1   . PHE B 1 119 ? -24.040 124.256 2.883   1.00 95.80  ? 521  PHE B CD1   1 
ATOM   5960  C  CD2   . PHE B 1 119 ? -25.601 125.191 4.433   1.00 90.21  ? 521  PHE B CD2   1 
ATOM   5961  C  CE1   . PHE B 1 119 ? -24.092 123.038 3.561   1.00 92.86  ? 521  PHE B CE1   1 
ATOM   5962  C  CE2   . PHE B 1 119 ? -25.658 123.977 5.113   1.00 87.57  ? 521  PHE B CE2   1 
ATOM   5963  C  CZ    . PHE B 1 119 ? -24.901 122.899 4.671   1.00 88.26  ? 521  PHE B CZ    1 
ATOM   5964  N  N     . PHE B 1 120 ? -27.832 126.928 2.400   1.00 91.52  ? 522  PHE B N     1 
ATOM   5965  C  CA    . PHE B 1 120 ? -29.188 126.539 2.796   1.00 93.05  ? 522  PHE B CA    1 
ATOM   5966  C  C     . PHE B 1 120 ? -30.065 126.308 1.579   1.00 95.28  ? 522  PHE B C     1 
ATOM   5967  O  O     . PHE B 1 120 ? -31.044 125.558 1.625   1.00 89.21  ? 522  PHE B O     1 
ATOM   5968  C  CB    . PHE B 1 120 ? -29.809 127.600 3.711   1.00 88.33  ? 522  PHE B CB    1 
ATOM   5969  C  CG    . PHE B 1 120 ? -29.237 127.596 5.095   1.00 88.31  ? 522  PHE B CG    1 
ATOM   5970  C  CD1   . PHE B 1 120 ? -29.034 126.401 5.770   1.00 92.78  ? 522  PHE B CD1   1 
ATOM   5971  C  CD2   . PHE B 1 120 ? -28.871 128.772 5.711   1.00 84.11  ? 522  PHE B CD2   1 
ATOM   5972  C  CE1   . PHE B 1 120 ? -28.491 126.382 7.037   1.00 88.08  ? 522  PHE B CE1   1 
ATOM   5973  C  CE2   . PHE B 1 120 ? -28.326 128.756 6.977   1.00 85.87  ? 522  PHE B CE2   1 
ATOM   5974  C  CZ    . PHE B 1 120 ? -28.141 127.558 7.640   1.00 87.26  ? 522  PHE B CZ    1 
ATOM   5975  N  N     . TYR B 1 121 ? -29.702 126.965 0.486   1.00 99.29  ? 523  TYR B N     1 
ATOM   5976  C  CA    . TYR B 1 121 ? -30.402 126.770 -0.766  1.00 96.97  ? 523  TYR B CA    1 
ATOM   5977  C  C     . TYR B 1 121 ? -29.984 125.440 -1.385  1.00 90.34  ? 523  TYR B C     1 
ATOM   5978  O  O     . TYR B 1 121 ? -30.802 124.555 -1.564  1.00 91.43  ? 523  TYR B O     1 
ATOM   5979  C  CB    . TYR B 1 121 ? -30.127 127.934 -1.716  1.00 97.30  ? 523  TYR B CB    1 
ATOM   5980  C  CG    . TYR B 1 121 ? -30.850 127.810 -3.024  1.00 101.04 ? 523  TYR B CG    1 
ATOM   5981  C  CD1   . TYR B 1 121 ? -32.109 128.362 -3.195  1.00 103.04 ? 523  TYR B CD1   1 
ATOM   5982  C  CD2   . TYR B 1 121 ? -30.280 127.131 -4.088  1.00 107.20 ? 523  TYR B CD2   1 
ATOM   5983  C  CE1   . TYR B 1 121 ? -32.782 128.246 -4.398  1.00 111.81 ? 523  TYR B CE1   1 
ATOM   5984  C  CE2   . TYR B 1 121 ? -30.945 127.004 -5.296  1.00 114.40 ? 523  TYR B CE2   1 
ATOM   5985  C  CZ    . TYR B 1 121 ? -32.195 127.565 -5.447  1.00 118.90 ? 523  TYR B CZ    1 
ATOM   5986  O  OH    . TYR B 1 121 ? -32.857 127.445 -6.649  1.00 127.06 ? 523  TYR B OH    1 
ATOM   5987  N  N     . ARG B 1 122 ? -28.699 125.297 -1.687  1.00 89.29  ? 524  ARG B N     1 
ATOM   5988  C  CA    . ARG B 1 122 ? -28.203 124.093 -2.343  1.00 93.65  ? 524  ARG B CA    1 
ATOM   5989  C  C     . ARG B 1 122 ? -28.536 122.810 -1.574  1.00 97.91  ? 524  ARG B C     1 
ATOM   5990  O  O     . ARG B 1 122 ? -28.980 121.824 -2.182  1.00 93.06  ? 524  ARG B O     1 
ATOM   5991  C  CB    . ARG B 1 122 ? -26.687 124.187 -2.580  1.00 98.21  ? 524  ARG B CB    1 
ATOM   5992  C  CG    . ARG B 1 122 ? -26.222 125.396 -3.421  1.00 102.76 ? 524  ARG B CG    1 
ATOM   5993  C  CD    . ARG B 1 122 ? -26.496 125.229 -4.921  1.00 111.81 ? 524  ARG B CD    1 
ATOM   5994  N  NE    . ARG B 1 122 ? -25.406 124.618 -5.696  1.00 113.92 ? 524  ARG B NE    1 
ATOM   5995  C  CZ    . ARG B 1 122 ? -24.502 123.753 -5.230  1.00 117.56 ? 524  ARG B CZ    1 
ATOM   5996  N  NH1   . ARG B 1 122 ? -24.515 123.347 -3.964  1.00 119.98 ? 524  ARG B NH1   1 
ATOM   5997  N  NH2   . ARG B 1 122 ? -23.574 123.279 -6.048  1.00 117.23 ? 524  ARG B NH2   1 
ATOM   5998  N  N     . TYR B 1 123 ? -28.344 122.829 -0.248  1.00 102.19 ? 525  TYR B N     1 
ATOM   5999  C  CA    . TYR B 1 123 ? -28.339 121.592 0.551   1.00 101.83 ? 525  TYR B CA    1 
ATOM   6000  C  C     . TYR B 1 123 ? -29.418 121.453 1.643   1.00 104.35 ? 525  TYR B C     1 
ATOM   6001  O  O     . TYR B 1 123 ? -29.505 120.408 2.304   1.00 107.90 ? 525  TYR B O     1 
ATOM   6002  C  CB    . TYR B 1 123 ? -26.947 121.347 1.151   1.00 98.34  ? 525  TYR B CB    1 
ATOM   6003  C  CG    . TYR B 1 123 ? -25.887 120.960 0.138   1.00 102.90 ? 525  TYR B CG    1 
ATOM   6004  C  CD1   . TYR B 1 123 ? -25.024 121.911 -0.395  1.00 103.22 ? 525  TYR B CD1   1 
ATOM   6005  C  CD2   . TYR B 1 123 ? -25.748 119.638 -0.286  1.00 107.84 ? 525  TYR B CD2   1 
ATOM   6006  C  CE1   . TYR B 1 123 ? -24.054 121.560 -1.325  1.00 108.13 ? 525  TYR B CE1   1 
ATOM   6007  C  CE2   . TYR B 1 123 ? -24.777 119.277 -1.209  1.00 110.58 ? 525  TYR B CE2   1 
ATOM   6008  C  CZ    . TYR B 1 123 ? -23.937 120.242 -1.725  1.00 114.40 ? 525  TYR B CZ    1 
ATOM   6009  O  OH    . TYR B 1 123 ? -22.975 119.886 -2.641  1.00 122.23 ? 525  TYR B OH    1 
ATOM   6010  N  N     . MET B 1 124 ? -30.231 122.488 1.839   1.00 103.03 ? 526  MET B N     1 
ATOM   6011  C  CA    . MET B 1 124 ? -31.336 122.415 2.805   1.00 106.19 ? 526  MET B CA    1 
ATOM   6012  C  C     . MET B 1 124 ? -32.544 123.244 2.343   1.00 103.21 ? 526  MET B C     1 
ATOM   6013  O  O     . MET B 1 124 ? -33.146 123.991 3.126   1.00 97.29  ? 526  MET B O     1 
ATOM   6014  C  CB    . MET B 1 124 ? -30.872 122.827 4.213   1.00 103.65 ? 526  MET B CB    1 
ATOM   6015  C  CG    . MET B 1 124 ? -29.828 121.880 4.823   1.00 104.75 ? 526  MET B CG    1 
ATOM   6016  S  SD    . MET B 1 124 ? -29.142 122.360 6.433   1.00 90.38  ? 526  MET B SD    1 
ATOM   6017  C  CE    . MET B 1 124 ? -30.614 122.349 7.448   1.00 140.76 ? 526  MET B CE    1 
ATOM   6018  N  N     . ARG B 1 125 ? -32.903 123.079 1.069   1.00 101.01 ? 527  ARG B N     1 
ATOM   6019  C  CA    . ARG B 1 125 ? -33.911 123.919 0.429   1.00 97.59  ? 527  ARG B CA    1 
ATOM   6020  C  C     . ARG B 1 125 ? -35.223 123.999 1.221   1.00 98.55  ? 527  ARG B C     1 
ATOM   6021  O  O     . ARG B 1 125 ? -35.760 125.096 1.411   1.00 94.41  ? 527  ARG B O     1 
ATOM   6022  C  CB    . ARG B 1 125 ? -34.146 123.490 -1.034  1.00 84.57  ? 527  ARG B CB    1 
ATOM   6023  N  N     . PRO B 1 126 ? -35.732 122.846 1.703   1.00 98.51  ? 528  PRO B N     1 
ATOM   6024  C  CA    . PRO B 1 126 ? -37.028 122.827 2.407   1.00 104.13 ? 528  PRO B CA    1 
ATOM   6025  C  C     . PRO B 1 126 ? -37.121 123.842 3.563   1.00 110.96 ? 528  PRO B C     1 
ATOM   6026  O  O     . PRO B 1 126 ? -38.204 124.399 3.788   1.00 108.60 ? 528  PRO B O     1 
ATOM   6027  C  CB    . PRO B 1 126 ? -37.140 121.381 2.928   1.00 97.87  ? 528  PRO B CB    1 
ATOM   6028  C  CG    . PRO B 1 126 ? -36.256 120.581 2.035   1.00 91.10  ? 528  PRO B CG    1 
ATOM   6029  C  CD    . PRO B 1 126 ? -35.126 121.504 1.617   1.00 91.98  ? 528  PRO B CD    1 
ATOM   6030  N  N     . LEU B 1 127 ? -36.011 124.078 4.271   1.00 112.36 ? 529  LEU B N     1 
ATOM   6031  C  CA    . LEU B 1 127 ? -35.985 125.046 5.370   1.00 105.98 ? 529  LEU B CA    1 
ATOM   6032  C  C     . LEU B 1 127 ? -36.198 126.466 4.851   1.00 110.19 ? 529  LEU B C     1 
ATOM   6033  O  O     . LEU B 1 127 ? -36.919 127.249 5.471   1.00 111.12 ? 529  LEU B O     1 
ATOM   6034  C  CB    . LEU B 1 127 ? -34.686 124.951 6.186   1.00 94.72  ? 529  LEU B CB    1 
ATOM   6035  C  CG    . LEU B 1 127 ? -34.843 124.634 7.683   1.00 85.44  ? 529  LEU B CG    1 
ATOM   6036  N  N     . VAL B 1 128 ? -35.585 126.795 3.711   1.00 112.66 ? 530  VAL B N     1 
ATOM   6037  C  CA    . VAL B 1 128 ? -35.794 128.106 3.093   1.00 107.93 ? 530  VAL B CA    1 
ATOM   6038  C  C     . VAL B 1 128 ? -37.208 128.248 2.496   1.00 109.06 ? 530  VAL B C     1 
ATOM   6039  O  O     . VAL B 1 128 ? -37.825 129.307 2.618   1.00 111.41 ? 530  VAL B O     1 
ATOM   6040  C  CB    . VAL B 1 128 ? -34.707 128.456 2.049   1.00 76.41  ? 530  VAL B CB    1 
ATOM   6041  N  N     . GLU B 1 129 ? -37.735 127.189 1.877   1.00 105.80 ? 531  GLU B N     1 
ATOM   6042  C  CA    . GLU B 1 129 ? -39.090 127.253 1.306   1.00 103.57 ? 531  GLU B CA    1 
ATOM   6043  C  C     . GLU B 1 129 ? -40.171 127.393 2.392   1.00 104.32 ? 531  GLU B C     1 
ATOM   6044  O  O     . GLU B 1 129 ? -41.197 128.049 2.186   1.00 96.94  ? 531  GLU B O     1 
ATOM   6045  C  CB    . GLU B 1 129 ? -39.380 126.060 0.376   1.00 96.43  ? 531  GLU B CB    1 
ATOM   6046  N  N     . ALA B 1 130 ? -39.924 126.790 3.553   1.00 109.79 ? 532  ALA B N     1 
ATOM   6047  C  CA    . ALA B 1 130 ? -40.853 126.873 4.683   1.00 110.81 ? 532  ALA B CA    1 
ATOM   6048  C  C     . ALA B 1 130 ? -40.655 128.129 5.547   1.00 112.10 ? 532  ALA B C     1 
ATOM   6049  O  O     . ALA B 1 130 ? -41.171 128.202 6.665   1.00 112.60 ? 532  ALA B O     1 
ATOM   6050  C  CB    . ALA B 1 130 ? -40.756 125.618 5.541   1.00 104.65 ? 532  ALA B CB    1 
ATOM   6051  N  N     . GLY B 1 131 ? -39.907 129.105 5.029   1.00 112.04 ? 533  GLY B N     1 
ATOM   6052  C  CA    . GLY B 1 131 ? -39.656 130.358 5.731   1.00 113.29 ? 533  GLY B CA    1 
ATOM   6053  C  C     . GLY B 1 131 ? -39.165 130.220 7.166   1.00 106.92 ? 533  GLY B C     1 
ATOM   6054  O  O     . GLY B 1 131 ? -39.751 130.791 8.092   1.00 103.29 ? 533  GLY B O     1 
ATOM   6055  N  N     . HIS B 1 132 ? -38.086 129.459 7.340   1.00 99.67  ? 534  HIS B N     1 
ATOM   6056  C  CA    . HIS B 1 132 ? -37.519 129.198 8.656   1.00 99.09  ? 534  HIS B CA    1 
ATOM   6057  C  C     . HIS B 1 132 ? -36.128 129.827 8.779   1.00 96.05  ? 534  HIS B C     1 
ATOM   6058  O  O     . HIS B 1 132 ? -35.451 129.685 9.806   1.00 94.55  ? 534  HIS B O     1 
ATOM   6059  C  CB    . HIS B 1 132 ? -37.445 127.688 8.934   1.00 103.60 ? 534  HIS B CB    1 
ATOM   6060  C  CG    . HIS B 1 132 ? -38.748 127.077 9.356   1.00 110.84 ? 534  HIS B CG    1 
ATOM   6061  N  ND1   . HIS B 1 132 ? -39.947 127.758 9.308   1.00 117.61 ? 534  HIS B ND1   1 
ATOM   6062  C  CD2   . HIS B 1 132 ? -39.037 125.845 9.842   1.00 114.75 ? 534  HIS B CD2   1 
ATOM   6063  C  CE1   . HIS B 1 132 ? -40.918 126.970 9.735   1.00 123.33 ? 534  HIS B CE1   1 
ATOM   6064  N  NE2   . HIS B 1 132 ? -40.393 125.803 10.066  1.00 121.76 ? 534  HIS B NE2   1 
ATOM   6065  N  N     . VAL B 1 133 ? -35.710 130.531 7.732   1.00 90.17  ? 535  VAL B N     1 
ATOM   6066  C  CA    . VAL B 1 133 ? -34.396 131.160 7.729   1.00 80.65  ? 535  VAL B CA    1 
ATOM   6067  C  C     . VAL B 1 133 ? -34.489 132.688 7.668   1.00 82.61  ? 535  VAL B C     1 
ATOM   6068  O  O     . VAL B 1 133 ? -34.917 133.255 6.667   1.00 78.58  ? 535  VAL B O     1 
ATOM   6069  C  CB    . VAL B 1 133 ? -33.556 130.637 6.565   1.00 79.16  ? 535  VAL B CB    1 
ATOM   6070  C  CG1   . VAL B 1 133 ? -32.194 131.280 6.572   1.00 76.07  ? 535  VAL B CG1   1 
ATOM   6071  C  CG2   . VAL B 1 133 ? -33.431 129.136 6.654   1.00 80.91  ? 535  VAL B CG2   1 
ATOM   6072  N  N     . TYR B 1 134 ? -34.089 133.351 8.751   1.00 91.97  ? 536  TYR B N     1 
ATOM   6073  C  CA    . TYR B 1 134 ? -34.205 134.805 8.850   1.00 92.17  ? 536  TYR B CA    1 
ATOM   6074  C  C     . TYR B 1 134 ? -32.840 135.480 8.912   1.00 88.87  ? 536  TYR B C     1 
ATOM   6075  O  O     . TYR B 1 134 ? -31.815 134.831 9.139   1.00 90.83  ? 536  TYR B O     1 
ATOM   6076  C  CB    . TYR B 1 134 ? -35.016 135.214 10.089  1.00 90.02  ? 536  TYR B CB    1 
ATOM   6077  C  CG    . TYR B 1 134 ? -36.307 134.450 10.289  1.00 85.09  ? 536  TYR B CG    1 
ATOM   6078  C  CD1   . TYR B 1 134 ? -36.296 133.074 10.519  1.00 79.70  ? 536  TYR B CD1   1 
ATOM   6079  C  CD2   . TYR B 1 134 ? -37.535 135.106 10.280  1.00 84.06  ? 536  TYR B CD2   1 
ATOM   6080  C  CE1   . TYR B 1 134 ? -37.471 132.372 10.705  1.00 86.69  ? 536  TYR B CE1   1 
ATOM   6081  C  CE2   . TYR B 1 134 ? -38.729 134.406 10.469  1.00 85.58  ? 536  TYR B CE2   1 
ATOM   6082  C  CZ    . TYR B 1 134 ? -38.691 133.039 10.681  1.00 89.24  ? 536  TYR B CZ    1 
ATOM   6083  O  OH    . TYR B 1 134 ? -39.866 132.331 10.871  1.00 92.78  ? 536  TYR B OH    1 
ATOM   6084  N  N     . ILE B 1 135 ? -32.844 136.793 8.714   1.00 83.39  ? 537  ILE B N     1 
ATOM   6085  C  CA    . ILE B 1 135 ? -31.647 137.598 8.862   1.00 79.65  ? 537  ILE B CA    1 
ATOM   6086  C  C     . ILE B 1 135 ? -31.893 138.754 9.825   1.00 81.55  ? 537  ILE B C     1 
ATOM   6087  O  O     . ILE B 1 135 ? -32.744 139.616 9.587   1.00 88.90  ? 537  ILE B O     1 
ATOM   6088  C  CB    . ILE B 1 135 ? -31.191 138.175 7.521   1.00 76.52  ? 537  ILE B CB    1 
ATOM   6089  C  CG1   . ILE B 1 135 ? -30.943 137.048 6.515   1.00 75.35  ? 537  ILE B CG1   1 
ATOM   6090  C  CG2   . ILE B 1 135 ? -29.948 139.052 7.718   1.00 72.75  ? 537  ILE B CG2   1 
ATOM   6091  C  CD1   . ILE B 1 135 ? -30.583 137.552 5.106   1.00 76.59  ? 537  ILE B CD1   1 
ATOM   6092  N  N     . ALA B 1 136 ? -31.131 138.769 10.909  1.00 72.84  ? 538  ALA B N     1 
ATOM   6093  C  CA    . ALA B 1 136 ? -31.250 139.810 11.914  1.00 65.10  ? 538  ALA B CA    1 
ATOM   6094  C  C     . ALA B 1 136 ? -30.563 141.091 11.477  1.00 68.25  ? 538  ALA B C     1 
ATOM   6095  O  O     . ALA B 1 136 ? -29.420 141.077 11.025  1.00 76.89  ? 538  ALA B O     1 
ATOM   6096  C  CB    . ALA B 1 136 ? -30.673 139.332 13.224  1.00 61.88  ? 538  ALA B CB    1 
ATOM   6097  N  N     . LEU B 1 137 ? -31.261 142.204 11.633  1.00 67.59  ? 539  LEU B N     1 
ATOM   6098  C  CA    . LEU B 1 137 ? -30.692 143.501 11.321  1.00 76.49  ? 539  LEU B CA    1 
ATOM   6099  C  C     . LEU B 1 137 ? -30.270 144.240 12.596  1.00 75.29  ? 539  LEU B C     1 
ATOM   6100  O  O     . LEU B 1 137 ? -31.105 144.816 13.290  1.00 80.03  ? 539  LEU B O     1 
ATOM   6101  C  CB    . LEU B 1 137 ? -31.709 144.350 10.543  1.00 83.49  ? 539  LEU B CB    1 
ATOM   6102  C  CG    . LEU B 1 137 ? -32.361 143.789 9.273   1.00 78.54  ? 539  LEU B CG    1 
ATOM   6103  N  N     . PRO B 1 138 ? -28.966 144.248 12.895  1.00 69.38  ? 540  PRO B N     1 
ATOM   6104  C  CA    . PRO B 1 138 ? -28.425 145.090 13.968  1.00 68.01  ? 540  PRO B CA    1 
ATOM   6105  C  C     . PRO B 1 138 ? -28.660 146.544 13.608  1.00 75.67  ? 540  PRO B C     1 
ATOM   6106  O  O     . PRO B 1 138 ? -28.806 146.852 12.431  1.00 87.40  ? 540  PRO B O     1 
ATOM   6107  C  CB    . PRO B 1 138 ? -26.920 144.832 13.904  1.00 58.87  ? 540  PRO B CB    1 
ATOM   6108  C  CG    . PRO B 1 138 ? -26.753 143.658 13.043  1.00 67.17  ? 540  PRO B CG    1 
ATOM   6109  C  CD    . PRO B 1 138 ? -27.902 143.648 12.088  1.00 68.61  ? 540  PRO B CD    1 
ATOM   6110  N  N     . PRO B 1 139 ? -28.687 147.436 14.604  1.00 73.30  ? 541  PRO B N     1 
ATOM   6111  C  CA    . PRO B 1 139 ? -28.959 148.842 14.306  1.00 72.57  ? 541  PRO B CA    1 
ATOM   6112  C  C     . PRO B 1 139 ? -27.713 149.484 13.750  1.00 68.71  ? 541  PRO B C     1 
ATOM   6113  O  O     . PRO B 1 139 ? -26.615 148.977 14.010  1.00 65.33  ? 541  PRO B O     1 
ATOM   6114  C  CB    . PRO B 1 139 ? -29.279 149.432 15.680  1.00 70.89  ? 541  PRO B CB    1 
ATOM   6115  C  CG    . PRO B 1 139 ? -28.480 148.601 16.617  1.00 71.97  ? 541  PRO B CG    1 
ATOM   6116  C  CD    . PRO B 1 139 ? -28.451 147.207 16.039  1.00 73.54  ? 541  PRO B CD    1 
ATOM   6117  N  N     . LEU B 1 140 ? -27.887 150.580 13.012  1.00 66.95  ? 542  LEU B N     1 
ATOM   6118  C  CA    . LEU B 1 140 ? -26.766 151.284 12.402  1.00 70.93  ? 542  LEU B CA    1 
ATOM   6119  C  C     . LEU B 1 140 ? -26.252 152.410 13.315  1.00 70.31  ? 542  LEU B C     1 
ATOM   6120  O  O     . LEU B 1 140 ? -25.064 152.713 13.298  1.00 75.13  ? 542  LEU B O     1 
ATOM   6121  C  CB    . LEU B 1 140 ? -27.128 151.815 10.987  1.00 74.43  ? 542  LEU B CB    1 
ATOM   6122  C  CG    . LEU B 1 140 ? -27.332 150.857 9.798   1.00 46.73  ? 542  LEU B CG    1 
ATOM   6123  N  N     . TYR B 1 141 ? -27.132 153.011 14.120  1.00 71.03  ? 543  TYR B N     1 
ATOM   6124  C  CA    . TYR B 1 141 ? -26.771 154.213 14.896  1.00 74.71  ? 543  TYR B CA    1 
ATOM   6125  C  C     . TYR B 1 141 ? -27.220 154.124 16.355  1.00 74.31  ? 543  TYR B C     1 
ATOM   6126  O  O     . TYR B 1 141 ? -28.192 153.435 16.639  1.00 77.63  ? 543  TYR B O     1 
ATOM   6127  C  CB    . TYR B 1 141 ? -27.393 155.470 14.256  1.00 76.95  ? 543  TYR B CB    1 
ATOM   6128  C  CG    . TYR B 1 141 ? -27.193 155.552 12.756  1.00 86.24  ? 543  TYR B CG    1 
ATOM   6129  C  CD1   . TYR B 1 141 ? -26.099 156.222 12.211  1.00 88.07  ? 543  TYR B CD1   1 
ATOM   6130  C  CD2   . TYR B 1 141 ? -28.084 154.941 11.884  1.00 90.72  ? 543  TYR B CD2   1 
ATOM   6131  C  CE1   . TYR B 1 141 ? -25.903 156.288 10.835  1.00 91.52  ? 543  TYR B CE1   1 
ATOM   6132  C  CE2   . TYR B 1 141 ? -27.893 154.997 10.507  1.00 95.09  ? 543  TYR B CE2   1 
ATOM   6133  C  CZ    . TYR B 1 141 ? -26.804 155.671 9.984   1.00 94.68  ? 543  TYR B CZ    1 
ATOM   6134  O  OH    . TYR B 1 141 ? -26.619 155.723 8.609   1.00 92.78  ? 543  TYR B OH    1 
ATOM   6135  N  N     . LYS B 1 142 ? -26.512 154.806 17.268  1.00 71.22  ? 544  LYS B N     1 
ATOM   6136  C  CA    . LYS B 1 142 ? -27.041 155.112 18.617  1.00 74.44  ? 544  LYS B CA    1 
ATOM   6137  C  C     . LYS B 1 142 ? -26.841 156.590 18.950  1.00 79.15  ? 544  LYS B C     1 
ATOM   6138  O  O     . LYS B 1 142 ? -25.702 157.060 18.959  1.00 82.88  ? 544  LYS B O     1 
ATOM   6139  C  CB    . LYS B 1 142 ? -26.379 154.255 19.708  1.00 79.18  ? 544  LYS B CB    1 
ATOM   6140  N  N     . MET B 1 143 ? -27.927 157.326 19.220  1.00 84.63  ? 545  MET B N     1 
ATOM   6141  C  CA    . MET B 1 143 ? -27.816 158.752 19.600  1.00 93.53  ? 545  MET B CA    1 
ATOM   6142  C  C     . MET B 1 143 ? -27.592 158.909 21.132  1.00 102.96 ? 545  MET B C     1 
ATOM   6143  O  O     . MET B 1 143 ? -27.972 158.010 21.897  1.00 92.49  ? 545  MET B O     1 
ATOM   6144  C  CB    . MET B 1 143 ? -29.013 159.587 19.077  1.00 80.64  ? 545  MET B CB    1 
ATOM   6145  C  CG    . MET B 1 143 ? -28.647 160.725 18.100  1.00 66.23  ? 545  MET B CG    1 
ATOM   6146  N  N     . SER B 1 144 ? -26.954 160.025 21.543  1.00 110.36 ? 546  SER B N     1 
ATOM   6147  C  CA    . SER B 1 144 ? -26.574 160.364 22.945  1.00 108.67 ? 546  SER B CA    1 
ATOM   6148  C  C     . SER B 1 144 ? -27.677 160.044 23.957  1.00 130.38 ? 546  SER B C     1 
ATOM   6149  O  O     . SER B 1 144 ? -28.340 159.026 23.801  1.00 142.02 ? 546  SER B O     1 
ATOM   6150  C  CB    . SER B 1 144 ? -26.157 161.837 23.051  1.00 91.64  ? 546  SER B CB    1 
ATOM   6151  N  N     . LYS B 1 145 ? -27.904 160.857 24.997  1.00 133.35 ? 547  LYS B N     1 
ATOM   6152  C  CA    . LYS B 1 145 ? -27.148 162.045 25.394  1.00 127.06 ? 547  LYS B CA    1 
ATOM   6153  C  C     . LYS B 1 145 ? -27.011 162.013 26.923  1.00 130.24 ? 547  LYS B C     1 
ATOM   6154  O  O     . LYS B 1 145 ? -27.539 161.115 27.580  1.00 135.30 ? 547  LYS B O     1 
ATOM   6155  C  CB    . LYS B 1 145 ? -27.879 163.324 24.972  1.00 115.87 ? 547  LYS B CB    1 
ATOM   6156  N  N     . GLY B 1 146 ? -26.314 162.991 27.492  1.00 124.10 ? 548  GLY B N     1 
ATOM   6157  C  CA    . GLY B 1 146 ? -26.079 163.016 28.926  1.00 122.14 ? 548  GLY B CA    1 
ATOM   6158  C  C     . GLY B 1 146 ? -24.610 163.180 29.264  1.00 123.24 ? 548  GLY B C     1 
ATOM   6159  O  O     . GLY B 1 146 ? -23.899 163.935 28.616  1.00 132.23 ? 548  GLY B O     1 
ATOM   6160  N  N     . LYS B 1 147 ? -24.152 162.479 30.291  1.00 118.14 ? 549  LYS B N     1 
ATOM   6161  C  CA    . LYS B 1 147 ? -22.752 162.515 30.685  1.00 115.31 ? 549  LYS B CA    1 
ATOM   6162  C  C     . LYS B 1 147 ? -22.546 161.520 31.821  1.00 121.36 ? 549  LYS B C     1 
ATOM   6163  O  O     . LYS B 1 147 ? -22.969 161.761 32.950  1.00 119.23 ? 549  LYS B O     1 
ATOM   6164  C  CB    . LYS B 1 147 ? -22.332 163.927 31.106  1.00 101.21 ? 549  LYS B CB    1 
ATOM   6165  N  N     . GLY B 1 148 ? -21.929 160.383 31.508  1.00 124.87 ? 550  GLY B N     1 
ATOM   6166  C  CA    . GLY B 1 148 ? -21.612 159.381 32.514  1.00 126.87 ? 550  GLY B CA    1 
ATOM   6167  C  C     . GLY B 1 148 ? -22.815 158.780 33.217  1.00 121.63 ? 550  GLY B C     1 
ATOM   6168  O  O     . GLY B 1 148 ? -23.559 157.998 32.619  1.00 118.51 ? 550  GLY B O     1 
ATOM   6169  N  N     . LYS B 1 149 ? -22.992 159.138 34.491  1.00 118.13 ? 551  LYS B N     1 
ATOM   6170  C  CA    . LYS B 1 149 ? -24.113 158.649 35.298  1.00 116.43 ? 551  LYS B CA    1 
ATOM   6171  C  C     . LYS B 1 149 ? -25.478 158.967 34.660  1.00 110.96 ? 551  LYS B C     1 
ATOM   6172  O  O     . LYS B 1 149 ? -26.312 158.079 34.479  1.00 100.84 ? 551  LYS B O     1 
ATOM   6173  C  CB    . LYS B 1 149 ? -24.035 159.204 36.735  1.00 107.75 ? 551  LYS B CB    1 
ATOM   6174  N  N     . LYS B 1 150 ? -25.690 160.235 34.313  1.00 113.11 ? 552  LYS B N     1 
ATOM   6175  C  CA    . LYS B 1 150 ? -26.979 160.701 33.814  1.00 111.02 ? 552  LYS B CA    1 
ATOM   6176  C  C     . LYS B 1 150 ? -27.018 160.711 32.277  1.00 110.74 ? 552  LYS B C     1 
ATOM   6177  O  O     . LYS B 1 150 ? -27.260 161.747 31.659  1.00 117.60 ? 552  LYS B O     1 
ATOM   6178  C  CB    . LYS B 1 150 ? -27.305 162.092 34.394  1.00 108.35 ? 552  LYS B CB    1 
ATOM   6179  N  N     . GLU B 1 151 ? -26.796 159.549 31.668  1.00 106.05 ? 553  GLU B N     1 
ATOM   6180  C  CA    . GLU B 1 151 ? -26.659 159.450 30.213  1.00 110.14 ? 553  GLU B CA    1 
ATOM   6181  C  C     . GLU B 1 151 ? -27.740 158.539 29.595  1.00 116.34 ? 553  GLU B C     1 
ATOM   6182  O  O     . GLU B 1 151 ? -27.921 157.401 30.030  1.00 117.74 ? 553  GLU B O     1 
ATOM   6183  C  CB    . GLU B 1 151 ? -25.237 158.958 29.871  1.00 111.16 ? 553  GLU B CB    1 
ATOM   6184  C  CG    . GLU B 1 151 ? -24.885 158.810 28.368  1.00 122.21 ? 553  GLU B CG    1 
ATOM   6185  C  CD    . GLU B 1 151 ? -23.442 158.310 28.127  1.00 119.12 ? 553  GLU B CD    1 
ATOM   6186  O  OE1   . GLU B 1 151 ? -23.131 157.900 26.988  1.00 108.24 ? 553  GLU B OE1   1 
ATOM   6187  O  OE2   . GLU B 1 151 ? -22.617 158.331 29.073  1.00 126.16 ? 553  GLU B OE2   1 
ATOM   6188  N  N     . GLU B 1 152 ? -28.463 159.048 28.594  1.00 118.89 ? 554  GLU B N     1 
ATOM   6189  C  CA    . GLU B 1 152 ? -29.525 158.281 27.926  1.00 117.62 ? 554  GLU B CA    1 
ATOM   6190  C  C     . GLU B 1 152 ? -29.098 157.803 26.543  1.00 115.66 ? 554  GLU B C     1 
ATOM   6191  O  O     . GLU B 1 152 ? -28.076 158.247 26.023  1.00 116.68 ? 554  GLU B O     1 
ATOM   6192  C  CB    . GLU B 1 152 ? -30.809 159.105 27.805  1.00 120.80 ? 554  GLU B CB    1 
ATOM   6193  C  CG    . GLU B 1 152 ? -31.934 158.649 28.722  1.00 128.96 ? 554  GLU B CG    1 
ATOM   6194  C  CD    . GLU B 1 152 ? -31.869 159.300 30.090  1.00 144.33 ? 554  GLU B CD    1 
ATOM   6195  O  OE1   . GLU B 1 152 ? -31.535 158.602 31.073  1.00 149.59 ? 554  GLU B OE1   1 
ATOM   6196  O  OE2   . GLU B 1 152 ? -32.157 160.514 30.180  1.00 151.16 ? 554  GLU B OE2   1 
ATOM   6197  N  N     . VAL B 1 153 ? -29.890 156.909 25.946  1.00 114.52 ? 555  VAL B N     1 
ATOM   6198  C  CA    . VAL B 1 153 ? -29.536 156.276 24.667  1.00 108.61 ? 555  VAL B CA    1 
ATOM   6199  C  C     . VAL B 1 153 ? -30.762 155.728 23.915  1.00 101.75 ? 555  VAL B C     1 
ATOM   6200  O  O     . VAL B 1 153 ? -31.721 155.257 24.539  1.00 94.53  ? 555  VAL B O     1 
ATOM   6201  C  CB    . VAL B 1 153 ? -28.503 155.125 24.879  1.00 85.38  ? 555  VAL B CB    1 
ATOM   6202  C  CG1   . VAL B 1 153 ? -28.243 154.373 23.580  1.00 88.56  ? 555  VAL B CG1   1 
ATOM   6203  C  CG2   . VAL B 1 153 ? -27.196 155.660 25.472  1.00 76.91  ? 555  VAL B CG2   1 
ATOM   6204  N  N     . ALA B 1 154 ? -30.724 155.811 22.580  1.00 102.15 ? 556  ALA B N     1 
ATOM   6205  C  CA    . ALA B 1 154 ? -31.724 155.176 21.701  1.00 97.69  ? 556  ALA B CA    1 
ATOM   6206  C  C     . ALA B 1 154 ? -31.090 154.751 20.363  1.00 95.19  ? 556  ALA B C     1 
ATOM   6207  O  O     . ALA B 1 154 ? -30.018 155.245 20.001  1.00 95.33  ? 556  ALA B O     1 
ATOM   6208  C  CB    . ALA B 1 154 ? -32.929 156.092 21.483  1.00 90.14  ? 556  ALA B CB    1 
ATOM   6209  N  N     . TYR B 1 155 ? -31.740 153.834 19.641  1.00 91.67  ? 557  TYR B N     1 
ATOM   6210  C  CA    . TYR B 1 155 ? -31.157 153.260 18.410  1.00 85.94  ? 557  TYR B CA    1 
ATOM   6211  C  C     . TYR B 1 155 ? -31.943 153.576 17.130  1.00 84.75  ? 557  TYR B C     1 
ATOM   6212  O  O     . TYR B 1 155 ? -33.128 153.881 17.181  1.00 89.95  ? 557  TYR B O     1 
ATOM   6213  C  CB    . TYR B 1 155 ? -30.979 151.736 18.542  1.00 83.53  ? 557  TYR B CB    1 
ATOM   6214  C  CG    . TYR B 1 155 ? -30.244 151.315 19.799  1.00 87.54  ? 557  TYR B CG    1 
ATOM   6215  C  CD1   . TYR B 1 155 ? -30.945 151.001 20.969  1.00 88.65  ? 557  TYR B CD1   1 
ATOM   6216  C  CD2   . TYR B 1 155 ? -28.852 151.241 19.824  1.00 87.80  ? 557  TYR B CD2   1 
ATOM   6217  C  CE1   . TYR B 1 155 ? -30.283 150.621 22.123  1.00 89.34  ? 557  TYR B CE1   1 
ATOM   6218  C  CE2   . TYR B 1 155 ? -28.181 150.870 20.971  1.00 92.36  ? 557  TYR B CE2   1 
ATOM   6219  C  CZ    . TYR B 1 155 ? -28.898 150.559 22.121  1.00 92.81  ? 557  TYR B CZ    1 
ATOM   6220  O  OH    . TYR B 1 155 ? -28.223 150.189 23.267  1.00 91.92  ? 557  TYR B OH    1 
ATOM   6221  N  N     . ALA B 1 156 ? -31.274 153.481 15.984  1.00 83.97  ? 558  ALA B N     1 
ATOM   6222  C  CA    . ALA B 1 156 ? -31.899 153.742 14.685  1.00 80.70  ? 558  ALA B CA    1 
ATOM   6223  C  C     . ALA B 1 156 ? -31.270 152.923 13.524  1.00 85.70  ? 558  ALA B C     1 
ATOM   6224  O  O     . ALA B 1 156 ? -30.054 152.634 13.547  1.00 71.90  ? 558  ALA B O     1 
ATOM   6225  C  CB    . ALA B 1 156 ? -31.872 155.242 14.389  1.00 75.49  ? 558  ALA B CB    1 
ATOM   6226  N  N     . TRP B 1 157 ? -32.101 152.547 12.530  1.00 90.63  ? 559  TRP B N     1 
ATOM   6227  C  CA    . TRP B 1 157 ? -31.660 151.754 11.350  1.00 86.01  ? 559  TRP B CA    1 
ATOM   6228  C  C     . TRP B 1 157 ? -31.670 152.539 10.032  1.00 90.16  ? 559  TRP B C     1 
ATOM   6229  O  O     . TRP B 1 157 ? -30.822 152.329 9.161   1.00 86.82  ? 559  TRP B O     1 
ATOM   6230  C  CB    . TRP B 1 157 ? -32.513 150.492 11.139  1.00 72.74  ? 559  TRP B CB    1 
ATOM   6231  C  CG    . TRP B 1 157 ? -32.386 149.421 12.186  1.00 79.25  ? 559  TRP B CG    1 
ATOM   6232  C  CD1   . TRP B 1 157 ? -31.893 148.151 12.012  1.00 82.81  ? 559  TRP B CD1   1 
ATOM   6233  C  CD2   . TRP B 1 157 ? -32.774 149.513 13.566  1.00 79.80  ? 559  TRP B CD2   1 
ATOM   6234  N  NE1   . TRP B 1 157 ? -31.949 147.454 13.199  1.00 82.21  ? 559  TRP B NE1   1 
ATOM   6235  C  CE2   . TRP B 1 157 ? -32.482 148.269 14.167  1.00 81.67  ? 559  TRP B CE2   1 
ATOM   6236  C  CE3   . TRP B 1 157 ? -33.320 150.532 14.354  1.00 73.98  ? 559  TRP B CE3   1 
ATOM   6237  C  CZ2   . TRP B 1 157 ? -32.723 148.021 15.517  1.00 76.46  ? 559  TRP B CZ2   1 
ATOM   6238  C  CZ3   . TRP B 1 157 ? -33.563 150.279 15.693  1.00 70.38  ? 559  TRP B CZ3   1 
ATOM   6239  C  CH2   . TRP B 1 157 ? -33.266 149.036 16.258  1.00 72.64  ? 559  TRP B CH2   1 
ATOM   6240  N  N     . THR B 1 158 ? -32.653 153.413 9.870   1.00 94.27  ? 560  THR B N     1 
ATOM   6241  C  CA    . THR B 1 158 ? -32.776 154.182 8.644   1.00 89.80  ? 560  THR B CA    1 
ATOM   6242  C  C     . THR B 1 158 ? -32.182 155.558 8.904   1.00 97.66  ? 560  THR B C     1 
ATOM   6243  O  O     . THR B 1 158 ? -32.334 156.092 10.005  1.00 100.01 ? 560  THR B O     1 
ATOM   6244  C  CB    . THR B 1 158 ? -34.257 154.327 8.235   1.00 78.60  ? 560  THR B CB    1 
ATOM   6245  N  N     . ASP B 1 159 ? -31.496 156.136 7.920   1.00 99.88  ? 561  ASP B N     1 
ATOM   6246  C  CA    . ASP B 1 159 ? -31.083 157.535 8.048   1.00 101.81 ? 561  ASP B CA    1 
ATOM   6247  C  C     . ASP B 1 159 ? -32.328 158.381 8.404   1.00 100.10 ? 561  ASP B C     1 
ATOM   6248  O  O     . ASP B 1 159 ? -32.240 159.454 9.018   1.00 91.47  ? 561  ASP B O     1 
ATOM   6249  C  CB    . ASP B 1 159 ? -30.384 158.033 6.771   1.00 95.09  ? 561  ASP B CB    1 
ATOM   6250  N  N     . GLY B 1 160 ? -33.495 157.861 8.035   1.00 101.81 ? 562  GLY B N     1 
ATOM   6251  C  CA    . GLY B 1 160 ? -34.755 158.504 8.354   1.00 98.52  ? 562  GLY B CA    1 
ATOM   6252  C  C     . GLY B 1 160 ? -35.111 158.357 9.816   1.00 93.19  ? 562  GLY B C     1 
ATOM   6253  O  O     . GLY B 1 160 ? -35.468 159.346 10.472  1.00 92.64  ? 562  GLY B O     1 
ATOM   6254  N  N     . GLU B 1 161 ? -35.022 157.120 10.314  1.00 90.79  ? 563  GLU B N     1 
ATOM   6255  C  CA    . GLU B 1 161 ? -35.206 156.826 11.739  1.00 93.24  ? 563  GLU B CA    1 
ATOM   6256  C  C     . GLU B 1 161 ? -34.230 157.664 12.595  1.00 102.03 ? 563  GLU B C     1 
ATOM   6257  O  O     . GLU B 1 161 ? -34.553 158.096 13.712  1.00 101.10 ? 563  GLU B O     1 
ATOM   6258  C  CB    . GLU B 1 161 ? -35.053 155.313 12.013  1.00 80.46  ? 563  GLU B CB    1 
ATOM   6259  N  N     . LEU B 1 162 ? -33.043 157.907 12.044  1.00 102.13 ? 564  LEU B N     1 
ATOM   6260  C  CA    . LEU B 1 162 ? -32.025 158.717 12.704  1.00 98.33  ? 564  LEU B CA    1 
ATOM   6261  C  C     . LEU B 1 162 ? -32.435 160.197 12.743  1.00 108.04 ? 564  LEU B C     1 
ATOM   6262  O  O     . LEU B 1 162 ? -32.280 160.864 13.768  1.00 108.01 ? 564  LEU B O     1 
ATOM   6263  C  CB    . LEU B 1 162 ? -30.679 158.525 11.995  1.00 87.91  ? 564  LEU B CB    1 
ATOM   6264  C  CG    . LEU B 1 162 ? -29.413 159.137 12.597  1.00 83.33  ? 564  LEU B CG    1 
ATOM   6265  C  CD1   . LEU B 1 162 ? -29.292 160.618 12.256  1.00 85.24  ? 564  LEU B CD1   1 
ATOM   6266  C  CD2   . LEU B 1 162 ? -29.380 158.932 14.104  1.00 82.55  ? 564  LEU B CD2   1 
ATOM   6267  N  N     . GLU B 1 163 ? -32.972 160.701 11.632  1.00 112.46 ? 565  GLU B N     1 
ATOM   6268  C  CA    . GLU B 1 163 ? -33.467 162.080 11.569  1.00 108.86 ? 565  GLU B CA    1 
ATOM   6269  C  C     . GLU B 1 163 ? -34.549 162.355 12.625  1.00 104.56 ? 565  GLU B C     1 
ATOM   6270  O  O     . GLU B 1 163 ? -34.558 163.414 13.256  1.00 95.93  ? 565  GLU B O     1 
ATOM   6271  C  CB    . GLU B 1 163 ? -33.988 162.405 10.164  1.00 104.11 ? 565  GLU B CB    1 
ATOM   6272  N  N     . GLU B 1 164 ? -35.452 161.395 12.817  1.00 106.66 ? 566  GLU B N     1 
ATOM   6273  C  CA    . GLU B 1 164 ? -36.501 161.520 13.833  1.00 111.28 ? 566  GLU B CA    1 
ATOM   6274  C  C     . GLU B 1 164 ? -35.954 161.554 15.280  1.00 111.65 ? 566  GLU B C     1 
ATOM   6275  O  O     . GLU B 1 164 ? -36.487 162.266 16.138  1.00 109.45 ? 566  GLU B O     1 
ATOM   6276  C  CB    . GLU B 1 164 ? -37.549 160.410 13.663  1.00 109.14 ? 566  GLU B CB    1 
ATOM   6277  N  N     . LEU B 1 165 ? -34.896 160.786 15.550  1.00 109.14 ? 567  LEU B N     1 
ATOM   6278  C  CA    . LEU B 1 165 ? -34.249 160.817 16.862  1.00 103.24 ? 567  LEU B CA    1 
ATOM   6279  C  C     . LEU B 1 165 ? -33.648 162.194 17.159  1.00 104.16 ? 567  LEU B C     1 
ATOM   6280  O  O     . LEU B 1 165 ? -33.806 162.717 18.260  1.00 95.45  ? 567  LEU B O     1 
ATOM   6281  C  CB    . LEU B 1 165 ? -33.176 159.730 16.980  1.00 96.14  ? 567  LEU B CB    1 
ATOM   6282  C  CG    . LEU B 1 165 ? -33.618 158.330 17.416  1.00 91.40  ? 567  LEU B CG    1 
ATOM   6283  C  CD1   . LEU B 1 165 ? -32.433 157.365 17.532  1.00 84.18  ? 567  LEU B CD1   1 
ATOM   6284  C  CD2   . LEU B 1 165 ? -34.354 158.411 18.734  1.00 94.23  ? 567  LEU B CD2   1 
ATOM   6285  N  N     . ARG B 1 166 ? -32.965 162.776 16.174  1.00 113.58 ? 568  ARG B N     1 
ATOM   6286  C  CA    . ARG B 1 166 ? -32.406 164.126 16.314  1.00 117.44 ? 568  ARG B CA    1 
ATOM   6287  C  C     . ARG B 1 166 ? -33.475 165.167 16.698  1.00 129.04 ? 568  ARG B C     1 
ATOM   6288  O  O     . ARG B 1 166 ? -33.176 166.123 17.416  1.00 137.52 ? 568  ARG B O     1 
ATOM   6289  C  CB    . ARG B 1 166 ? -31.638 164.552 15.051  1.00 104.99 ? 568  ARG B CB    1 
ATOM   6290  N  N     . LYS B 1 167 ? -34.714 164.973 16.234  1.00 126.46 ? 569  LYS B N     1 
ATOM   6291  C  CA    . LYS B 1 167 ? -35.830 165.844 16.626  1.00 123.26 ? 569  LYS B CA    1 
ATOM   6292  C  C     . LYS B 1 167 ? -36.035 165.805 18.148  1.00 130.30 ? 569  LYS B C     1 
ATOM   6293  O  O     . LYS B 1 167 ? -35.974 166.847 18.809  1.00 132.07 ? 569  LYS B O     1 
ATOM   6294  C  CB    . LYS B 1 167 ? -37.122 165.492 15.874  1.00 110.95 ? 569  LYS B CB    1 
ATOM   6295  N  N     . GLN B 1 168 ? -36.267 164.611 18.704  1.00 130.92 ? 570  GLN B N     1 
ATOM   6296  C  CA    . GLN B 1 168 ? -36.227 164.429 20.159  1.00 131.94 ? 570  GLN B CA    1 
ATOM   6297  C  C     . GLN B 1 168 ? -34.780 164.690 20.598  1.00 140.53 ? 570  GLN B C     1 
ATOM   6298  O  O     . GLN B 1 168 ? -34.006 165.265 19.829  1.00 150.08 ? 570  GLN B O     1 
ATOM   6299  C  CB    . GLN B 1 168 ? -36.701 163.026 20.563  1.00 118.39 ? 570  GLN B CB    1 
ATOM   6300  N  N     . PHE B 1 169 ? -34.397 164.286 21.807  1.00 132.82 ? 571  PHE B N     1 
ATOM   6301  C  CA    . PHE B 1 169 ? -33.020 164.522 22.260  1.00 122.60 ? 571  PHE B CA    1 
ATOM   6302  C  C     . PHE B 1 169 ? -32.635 165.996 22.114  1.00 128.98 ? 571  PHE B C     1 
ATOM   6303  O  O     . PHE B 1 169 ? -32.596 166.748 23.095  1.00 132.18 ? 571  PHE B O     1 
ATOM   6304  C  CB    . PHE B 1 169 ? -32.025 163.682 21.449  1.00 110.42 ? 571  PHE B CB    1 
ATOM   6305  C  CG    . PHE B 1 169 ? -32.028 162.226 21.795  1.00 107.58 ? 571  PHE B CG    1 
ATOM   6306  C  CD1   . PHE B 1 169 ? -32.962 161.369 21.245  1.00 108.37 ? 571  PHE B CD1   1 
ATOM   6307  C  CD2   . PHE B 1 169 ? -31.081 161.706 22.659  1.00 107.12 ? 571  PHE B CD2   1 
ATOM   6308  C  CE1   . PHE B 1 169 ? -32.961 160.014 21.564  1.00 106.27 ? 571  PHE B CE1   1 
ATOM   6309  C  CE2   . PHE B 1 169 ? -31.073 160.355 22.980  1.00 100.72 ? 571  PHE B CE2   1 
ATOM   6310  C  CZ    . PHE B 1 169 ? -32.015 159.509 22.433  1.00 101.31 ? 571  PHE B CZ    1 
ATOM   6311  N  N     . GLY B 1 170 ? -32.328 166.389 20.876  1.00 130.05 ? 572  GLY B N     1 
ATOM   6312  C  CA    . GLY B 1 170 ? -32.045 167.774 20.540  1.00 132.20 ? 572  GLY B CA    1 
ATOM   6313  C  C     . GLY B 1 170 ? -30.573 168.132 20.588  1.00 126.52 ? 572  GLY B C     1 
ATOM   6314  O  O     . GLY B 1 170 ? -29.768 167.589 19.830  1.00 120.60 ? 572  GLY B O     1 
ATOM   6315  N  N     . LYS B 1 171 ? -30.236 169.065 21.475  1.00 126.62 ? 573  LYS B N     1 
ATOM   6316  C  CA    . LYS B 1 171 ? -28.851 169.449 21.731  1.00 125.27 ? 573  LYS B CA    1 
ATOM   6317  C  C     . LYS B 1 171 ? -28.522 169.178 23.203  1.00 133.05 ? 573  LYS B C     1 
ATOM   6318  O  O     . LYS B 1 171 ? -29.347 169.445 24.081  1.00 141.23 ? 573  LYS B O     1 
ATOM   6319  C  CB    . LYS B 1 171 ? -28.635 170.930 21.398  1.00 121.38 ? 573  LYS B CB    1 
ATOM   6320  N  N     . GLY B 1 172 ? -27.332 168.642 23.479  1.00 127.82 ? 574  GLY B N     1 
ATOM   6321  C  CA    . GLY B 1 172 ? -26.354 168.323 22.453  1.00 120.31 ? 574  GLY B CA    1 
ATOM   6322  C  C     . GLY B 1 172 ? -26.061 166.836 22.343  1.00 111.58 ? 574  GLY B C     1 
ATOM   6323  O  O     . GLY B 1 172 ? -25.105 166.323 22.931  1.00 108.87 ? 574  GLY B O     1 
ATOM   6324  N  N     . ALA B 1 173 ? -26.896 166.142 21.578  1.00 109.62 ? 575  ALA B N     1 
ATOM   6325  C  CA    . ALA B 1 173 ? -26.735 164.715 21.344  1.00 110.46 ? 575  ALA B CA    1 
ATOM   6326  C  C     . ALA B 1 173 ? -25.489 164.444 20.496  1.00 117.97 ? 575  ALA B C     1 
ATOM   6327  O  O     . ALA B 1 173 ? -24.963 165.351 19.848  1.00 121.78 ? 575  ALA B O     1 
ATOM   6328  C  CB    . ALA B 1 173 ? -27.986 164.151 20.661  1.00 107.23 ? 575  ALA B CB    1 
ATOM   6329  N  N     . THR B 1 174 ? -25.028 163.193 20.506  1.00 117.02 ? 576  THR B N     1 
ATOM   6330  C  CA    . THR B 1 174 ? -23.854 162.751 19.747  1.00 110.27 ? 576  THR B CA    1 
ATOM   6331  C  C     . THR B 1 174 ? -24.164 161.389 19.075  1.00 91.70  ? 576  THR B C     1 
ATOM   6332  O  O     . THR B 1 174 ? -24.658 160.484 19.750  1.00 90.51  ? 576  THR B O     1 
ATOM   6333  C  CB    . THR B 1 174 ? -22.601 162.639 20.688  1.00 104.48 ? 576  THR B CB    1 
ATOM   6334  O  OG1   . THR B 1 174 ? -22.926 161.876 21.859  1.00 109.54 ? 576  THR B OG1   1 
ATOM   6335  C  CG2   . THR B 1 174 ? -22.118 164.012 21.152  1.00 104.73 ? 576  THR B CG2   1 
ATOM   6336  N  N     . LEU B 1 175 ? -23.909 161.230 17.767  1.00 88.89  ? 577  LEU B N     1 
ATOM   6337  C  CA    . LEU B 1 175 ? -24.198 159.936 17.101  1.00 83.67  ? 577  LEU B CA    1 
ATOM   6338  C  C     . LEU B 1 175 ? -23.019 158.973 17.220  1.00 94.39  ? 577  LEU B C     1 
ATOM   6339  O  O     . LEU B 1 175 ? -21.868 159.371 17.050  1.00 99.10  ? 577  LEU B O     1 
ATOM   6340  C  CB    . LEU B 1 175 ? -24.633 160.085 15.621  1.00 64.82  ? 577  LEU B CB    1 
ATOM   6341  N  N     . GLN B 1 176 ? -23.309 157.719 17.561  1.00 96.20  ? 578  GLN B N     1 
ATOM   6342  C  CA    . GLN B 1 176 ? -22.341 156.635 17.397  1.00 87.34  ? 578  GLN B CA    1 
ATOM   6343  C  C     . GLN B 1 176 ? -22.783 155.816 16.196  1.00 80.58  ? 578  GLN B C     1 
ATOM   6344  O  O     . GLN B 1 176 ? -23.847 155.180 16.220  1.00 67.91  ? 578  GLN B O     1 
ATOM   6345  C  CB    . GLN B 1 176 ? -22.241 155.739 18.637  1.00 79.12  ? 578  GLN B CB    1 
ATOM   6346  N  N     . ARG B 1 177 ? -21.968 155.872 15.141  1.00 83.69  ? 579  ARG B N     1 
ATOM   6347  C  CA    . ARG B 1 177 ? -22.174 155.096 13.922  1.00 80.99  ? 579  ARG B CA    1 
ATOM   6348  C  C     . ARG B 1 177 ? -21.565 153.684 14.088  1.00 86.58  ? 579  ARG B C     1 
ATOM   6349  O  O     . ARG B 1 177 ? -20.353 153.488 13.933  1.00 96.82  ? 579  ARG B O     1 
ATOM   6350  C  CB    . ARG B 1 177 ? -21.600 155.849 12.703  1.00 66.20  ? 579  ARG B CB    1 
ATOM   6351  N  N     . TYR B 1 178 ? -22.407 152.711 14.434  1.00 75.51  ? 580  TYR B N     1 
ATOM   6352  C  CA    . TYR B 1 178 ? -21.971 151.322 14.603  1.00 71.38  ? 580  TYR B CA    1 
ATOM   6353  C  C     . TYR B 1 178 ? -21.209 150.726 13.401  1.00 71.90  ? 580  TYR B C     1 
ATOM   6354  O  O     . TYR B 1 178 ? -21.765 150.587 12.298  1.00 62.16  ? 580  TYR B O     1 
ATOM   6355  C  CB    . TYR B 1 178 ? -23.169 150.450 14.969  1.00 68.22  ? 580  TYR B CB    1 
ATOM   6356  C  CG    . TYR B 1 178 ? -23.514 150.513 16.432  1.00 85.68  ? 580  TYR B CG    1 
ATOM   6357  C  CD1   . TYR B 1 178 ? -22.516 150.506 17.391  1.00 90.23  ? 580  TYR B CD1   1 
ATOM   6358  C  CD2   . TYR B 1 178 ? -24.833 150.590 16.862  1.00 94.64  ? 580  TYR B CD2   1 
ATOM   6359  C  CE1   . TYR B 1 178 ? -22.814 150.559 18.737  1.00 92.75  ? 580  TYR B CE1   1 
ATOM   6360  C  CE2   . TYR B 1 178 ? -25.145 150.647 18.216  1.00 94.19  ? 580  TYR B CE2   1 
ATOM   6361  C  CZ    . TYR B 1 178 ? -24.126 150.627 19.145  1.00 97.19  ? 580  TYR B CZ    1 
ATOM   6362  O  OH    . TYR B 1 178 ? -24.404 150.683 20.490  1.00 106.91 ? 580  TYR B OH    1 
ATOM   6363  N  N     . LYS B 1 179 ? -19.942 150.366 13.623  1.00 70.58  ? 581  LYS B N     1 
ATOM   6364  C  CA    . LYS B 1 179 ? -19.115 149.758 12.572  1.00 67.40  ? 581  LYS B CA    1 
ATOM   6365  C  C     . LYS B 1 179 ? -19.197 148.198 12.546  1.00 79.25  ? 581  LYS B C     1 
ATOM   6366  O  O     . LYS B 1 179 ? -18.532 147.540 11.740  1.00 77.86  ? 581  LYS B O     1 
ATOM   6367  C  CB    . LYS B 1 179 ? -17.646 150.239 12.663  1.00 67.29  ? 581  LYS B CB    1 
ATOM   6368  C  CG    . LYS B 1 179 ? -17.438 151.744 12.902  1.00 71.72  ? 581  LYS B CG    1 
ATOM   6369  C  CD    . LYS B 1 179 ? -15.943 152.118 13.028  1.00 61.02  ? 581  LYS B CD    1 
ATOM   6370  N  N     . GLY B 1 180 ? -19.999 147.608 13.428  1.00 76.75  ? 582  GLY B N     1 
ATOM   6371  C  CA    . GLY B 1 180 ? -20.173 146.160 13.445  1.00 76.42  ? 582  GLY B CA    1 
ATOM   6372  C  C     . GLY B 1 180 ? -20.499 145.632 14.834  1.00 73.34  ? 582  GLY B C     1 
ATOM   6373  O  O     . GLY B 1 180 ? -20.330 146.364 15.813  1.00 84.04  ? 582  GLY B O     1 
ATOM   6374  N  N     . LEU B 1 181 ? -20.956 144.380 14.930  1.00 61.57  ? 583  LEU B N     1 
ATOM   6375  C  CA    . LEU B 1 181 ? -21.389 143.803 16.224  1.00 67.11  ? 583  LEU B CA    1 
ATOM   6376  C  C     . LEU B 1 181 ? -20.376 143.896 17.376  1.00 68.64  ? 583  LEU B C     1 
ATOM   6377  O  O     . LEU B 1 181 ? -20.746 143.757 18.538  1.00 66.30  ? 583  LEU B O     1 
ATOM   6378  C  CB    . LEU B 1 181 ? -21.786 142.335 16.064  1.00 64.90  ? 583  LEU B CB    1 
ATOM   6379  C  CG    . LEU B 1 181 ? -22.827 142.028 14.998  1.00 67.54  ? 583  LEU B CG    1 
ATOM   6380  C  CD1   . LEU B 1 181 ? -23.157 140.536 15.004  1.00 70.42  ? 583  LEU B CD1   1 
ATOM   6381  C  CD2   . LEU B 1 181 ? -24.069 142.869 15.234  1.00 65.95  ? 583  LEU B CD2   1 
ATOM   6382  N  N     . GLY B 1 182 ? -19.107 144.120 17.045  1.00 72.25  ? 584  GLY B N     1 
ATOM   6383  C  CA    . GLY B 1 182 ? -18.026 144.107 18.014  1.00 77.06  ? 584  GLY B CA    1 
ATOM   6384  C  C     . GLY B 1 182 ? -18.063 145.210 19.055  1.00 88.44  ? 584  GLY B C     1 
ATOM   6385  O  O     . GLY B 1 182 ? -17.467 145.072 20.140  1.00 97.55  ? 584  GLY B O     1 
ATOM   6386  N  N     . GLU B 1 183 ? -18.759 146.300 18.735  1.00 84.87  ? 585  GLU B N     1 
ATOM   6387  C  CA    . GLU B 1 183 ? -18.840 147.461 19.633  1.00 83.65  ? 585  GLU B CA    1 
ATOM   6388  C  C     . GLU B 1 183 ? -20.157 147.517 20.439  1.00 78.25  ? 585  GLU B C     1 
ATOM   6389  O  O     . GLU B 1 183 ? -20.501 148.556 21.031  1.00 80.56  ? 585  GLU B O     1 
ATOM   6390  C  CB    . GLU B 1 183 ? -18.570 148.765 18.861  1.00 84.61  ? 585  GLU B CB    1 
ATOM   6391  C  CG    . GLU B 1 183 ? -18.768 148.621 17.347  1.00 93.54  ? 585  GLU B CG    1 
ATOM   6392  C  CD    . GLU B 1 183 ? -17.984 149.638 16.524  1.00 100.05 ? 585  GLU B CD    1 
ATOM   6393  O  OE1   . GLU B 1 183 ? -18.584 150.648 16.095  1.00 100.00 ? 585  GLU B OE1   1 
ATOM   6394  O  OE2   . GLU B 1 183 ? -16.771 149.416 16.296  1.00 102.70 ? 585  GLU B OE2   1 
ATOM   6395  N  N     . MET B 1 184 ? -20.873 146.389 20.462  1.00 72.88  ? 586  MET B N     1 
ATOM   6396  C  CA    . MET B 1 184 ? -22.064 146.236 21.295  1.00 75.17  ? 586  MET B CA    1 
ATOM   6397  C  C     . MET B 1 184 ? -21.803 145.348 22.508  1.00 81.34  ? 586  MET B C     1 
ATOM   6398  O  O     . MET B 1 184 ? -21.120 144.321 22.403  1.00 84.30  ? 586  MET B O     1 
ATOM   6399  C  CB    . MET B 1 184 ? -23.240 145.662 20.501  1.00 74.96  ? 586  MET B CB    1 
ATOM   6400  C  CG    . MET B 1 184 ? -23.689 146.535 19.334  1.00 77.52  ? 586  MET B CG    1 
ATOM   6401  S  SD    . MET B 1 184 ? -25.241 145.983 18.588  1.00 93.15  ? 586  MET B SD    1 
ATOM   6402  C  CE    . MET B 1 184 ? -25.138 146.830 17.012  1.00 173.78 ? 586  MET B CE    1 
ATOM   6403  N  N     . ASN B 1 185 ? -22.348 145.771 23.650  1.00 81.92  ? 587  ASN B N     1 
ATOM   6404  C  CA    . ASN B 1 185 ? -22.409 144.956 24.858  1.00 83.66  ? 587  ASN B CA    1 
ATOM   6405  C  C     . ASN B 1 185 ? -23.563 143.962 24.726  1.00 81.53  ? 587  ASN B C     1 
ATOM   6406  O  O     . ASN B 1 185 ? -24.514 144.209 23.994  1.00 87.14  ? 587  ASN B O     1 
ATOM   6407  C  CB    . ASN B 1 185 ? -22.620 145.834 26.112  1.00 89.12  ? 587  ASN B CB    1 
ATOM   6408  C  CG    . ASN B 1 185 ? -21.403 146.718 26.453  1.00 86.97  ? 587  ASN B CG    1 
ATOM   6409  O  OD1   . ASN B 1 185 ? -20.278 146.227 26.634  1.00 91.32  ? 587  ASN B OD1   1 
ATOM   6410  N  ND2   . ASN B 1 185 ? -21.641 148.026 26.565  1.00 76.66  ? 587  ASN B ND2   1 
ATOM   6411  N  N     . ALA B 1 186 ? -23.472 142.838 25.428  1.00 79.98  ? 588  ALA B N     1 
ATOM   6412  C  CA    . ALA B 1 186 ? -24.551 141.852 25.465  1.00 78.35  ? 588  ALA B CA    1 
ATOM   6413  C  C     . ALA B 1 186 ? -25.935 142.439 25.793  1.00 85.57  ? 588  ALA B C     1 
ATOM   6414  O  O     . ALA B 1 186 ? -26.936 142.031 25.195  1.00 82.59  ? 588  ALA B O     1 
ATOM   6415  C  CB    . ALA B 1 186 ? -24.207 140.723 26.438  1.00 71.81  ? 588  ALA B CB    1 
ATOM   6416  N  N     . ASP B 1 187 ? -26.002 143.379 26.740  1.00 88.93  ? 589  ASP B N     1 
ATOM   6417  C  CA    . ASP B 1 187 ? -27.279 144.006 27.080  1.00 80.42  ? 589  ASP B CA    1 
ATOM   6418  C  C     . ASP B 1 187 ? -27.834 144.721 25.847  1.00 89.32  ? 589  ASP B C     1 
ATOM   6419  O  O     . ASP B 1 187 ? -29.024 144.609 25.538  1.00 90.71  ? 589  ASP B O     1 
ATOM   6420  C  CB    . ASP B 1 187 ? -27.136 144.973 28.259  1.00 60.40  ? 589  ASP B CB    1 
ATOM   6421  N  N     . GLN B 1 188 ? -26.966 145.440 25.129  1.00 89.86  ? 590  GLN B N     1 
ATOM   6422  C  CA    . GLN B 1 188 ? -27.380 146.181 23.929  1.00 80.27  ? 590  GLN B CA    1 
ATOM   6423  C  C     . GLN B 1 188 ? -27.823 145.231 22.816  1.00 81.06  ? 590  GLN B C     1 
ATOM   6424  O  O     . GLN B 1 188 ? -28.832 145.462 22.156  1.00 86.20  ? 590  GLN B O     1 
ATOM   6425  C  CB    . GLN B 1 188 ? -26.265 147.108 23.433  1.00 78.93  ? 590  GLN B CB    1 
ATOM   6426  C  CG    . GLN B 1 188 ? -25.827 148.185 24.430  1.00 88.23  ? 590  GLN B CG    1 
ATOM   6427  C  CD    . GLN B 1 188 ? -24.596 148.965 23.961  1.00 102.58 ? 590  GLN B CD    1 
ATOM   6428  O  OE1   . GLN B 1 188 ? -23.680 148.399 23.362  1.00 107.50 ? 590  GLN B OE1   1 
ATOM   6429  N  NE2   . GLN B 1 188 ? -24.575 150.270 24.229  1.00 106.71 ? 590  GLN B NE2   1 
ATOM   6430  N  N     . LEU B 1 189 ? -27.072 144.154 22.622  1.00 83.12  ? 591  LEU B N     1 
ATOM   6431  C  CA    . LEU B 1 189 ? -27.408 143.146 21.619  1.00 82.82  ? 591  LEU B CA    1 
ATOM   6432  C  C     . LEU B 1 189 ? -28.831 142.636 21.801  1.00 83.18  ? 591  LEU B C     1 
ATOM   6433  O  O     . LEU B 1 189 ? -29.673 142.739 20.903  1.00 84.98  ? 591  LEU B O     1 
ATOM   6434  C  CB    . LEU B 1 189 ? -26.445 141.960 21.722  1.00 81.36  ? 591  LEU B CB    1 
ATOM   6435  C  CG    . LEU B 1 189 ? -25.493 141.623 20.574  1.00 75.11  ? 591  LEU B CG    1 
ATOM   6436  C  CD1   . LEU B 1 189 ? -24.941 140.206 20.748  1.00 70.70  ? 591  LEU B CD1   1 
ATOM   6437  C  CD2   . LEU B 1 189 ? -26.162 141.786 19.215  1.00 75.38  ? 591  LEU B CD2   1 
ATOM   6438  N  N     . TRP B 1 190 ? -29.084 142.063 22.970  1.00 81.06  ? 592  TRP B N     1 
ATOM   6439  C  CA    . TRP B 1 190 ? -30.381 141.489 23.268  1.00 82.14  ? 592  TRP B CA    1 
ATOM   6440  C  C     . TRP B 1 190 ? -31.488 142.484 22.957  1.00 80.20  ? 592  TRP B C     1 
ATOM   6441  O  O     . TRP B 1 190 ? -32.430 142.172 22.215  1.00 78.51  ? 592  TRP B O     1 
ATOM   6442  C  CB    . TRP B 1 190 ? -30.440 141.090 24.739  1.00 86.29  ? 592  TRP B CB    1 
ATOM   6443  C  CG    . TRP B 1 190 ? -31.825 140.835 25.251  1.00 90.09  ? 592  TRP B CG    1 
ATOM   6444  C  CD1   . TRP B 1 190 ? -32.596 141.671 26.020  1.00 86.35  ? 592  TRP B CD1   1 
ATOM   6445  C  CD2   . TRP B 1 190 ? -32.605 139.657 25.035  1.00 94.52  ? 592  TRP B CD2   1 
ATOM   6446  N  NE1   . TRP B 1 190 ? -33.808 141.080 26.291  1.00 86.58  ? 592  TRP B NE1   1 
ATOM   6447  C  CE2   . TRP B 1 190 ? -33.836 139.842 25.702  1.00 90.45  ? 592  TRP B CE2   1 
ATOM   6448  C  CE3   . TRP B 1 190 ? -32.381 138.459 24.347  1.00 95.87  ? 592  TRP B CE3   1 
ATOM   6449  C  CZ2   . TRP B 1 190 ? -34.833 138.877 25.693  1.00 91.50  ? 592  TRP B CZ2   1 
ATOM   6450  C  CZ3   . TRP B 1 190 ? -33.372 137.503 24.346  1.00 94.86  ? 592  TRP B CZ3   1 
ATOM   6451  C  CH2   . TRP B 1 190 ? -34.582 137.717 25.011  1.00 94.05  ? 592  TRP B CH2   1 
ATOM   6452  N  N     . GLU B 1 191 ? -31.362 143.683 23.519  1.00 76.66  ? 593  GLU B N     1 
ATOM   6453  C  CA    . GLU B 1 191 ? -32.441 144.659 23.463  1.00 82.80  ? 593  GLU B CA    1 
ATOM   6454  C  C     . GLU B 1 191 ? -32.823 144.987 21.999  1.00 90.61  ? 593  GLU B C     1 
ATOM   6455  O  O     . GLU B 1 191 ? -34.004 145.212 21.676  1.00 93.56  ? 593  GLU B O     1 
ATOM   6456  C  CB    . GLU B 1 191 ? -32.082 145.914 24.283  1.00 75.24  ? 593  GLU B CB    1 
ATOM   6457  N  N     . THR B 1 192 ? -31.834 144.950 21.109  1.00 84.10  ? 594  THR B N     1 
ATOM   6458  C  CA    . THR B 1 192 ? -32.027 145.446 19.749  1.00 77.16  ? 594  THR B CA    1 
ATOM   6459  C  C     . THR B 1 192 ? -32.103 144.395 18.637  1.00 80.16  ? 594  THR B C     1 
ATOM   6460  O  O     . THR B 1 192 ? -32.674 144.668 17.585  1.00 90.17  ? 594  THR B O     1 
ATOM   6461  C  CB    . THR B 1 192 ? -30.913 146.422 19.372  1.00 74.75  ? 594  THR B CB    1 
ATOM   6462  O  OG1   . THR B 1 192 ? -29.678 145.702 19.276  1.00 76.10  ? 594  THR B OG1   1 
ATOM   6463  C  CG2   . THR B 1 192 ? -30.783 147.523 20.427  1.00 74.99  ? 594  THR B CG2   1 
ATOM   6464  N  N     . THR B 1 193 ? -31.523 143.214 18.840  1.00 75.64  ? 595  THR B N     1 
ATOM   6465  C  CA    . THR B 1 193 ? -31.512 142.218 17.766  1.00 75.38  ? 595  THR B CA    1 
ATOM   6466  C  C     . THR B 1 193 ? -31.834 140.764 18.166  1.00 74.45  ? 595  THR B C     1 
ATOM   6467  O  O     . THR B 1 193 ? -32.149 139.933 17.305  1.00 65.35  ? 595  THR B O     1 
ATOM   6468  C  CB    . THR B 1 193 ? -30.189 142.280 16.937  1.00 78.41  ? 595  THR B CB    1 
ATOM   6469  O  OG1   . THR B 1 193 ? -29.457 141.058 17.092  1.00 83.35  ? 595  THR B OG1   1 
ATOM   6470  C  CG2   . THR B 1 193 ? -29.323 143.476 17.350  1.00 63.55  ? 595  THR B CG2   1 
ATOM   6471  N  N     . MET B 1 194 ? -31.775 140.456 19.461  1.00 78.74  ? 596  MET B N     1 
ATOM   6472  C  CA    . MET B 1 194 ? -32.091 139.098 19.921  1.00 79.90  ? 596  MET B CA    1 
ATOM   6473  C  C     . MET B 1 194 ? -33.451 138.925 20.630  1.00 84.77  ? 596  MET B C     1 
ATOM   6474  O  O     . MET B 1 194 ? -34.043 137.840 20.587  1.00 82.17  ? 596  MET B O     1 
ATOM   6475  C  CB    . MET B 1 194 ? -30.969 138.552 20.796  1.00 72.96  ? 596  MET B CB    1 
ATOM   6476  C  CG    . MET B 1 194 ? -29.594 138.675 20.177  1.00 69.52  ? 596  MET B CG    1 
ATOM   6477  S  SD    . MET B 1 194 ? -28.385 137.622 21.002  1.00 78.33  ? 596  MET B SD    1 
ATOM   6478  C  CE    . MET B 1 194 ? -29.023 135.983 20.617  1.00 65.64  ? 596  MET B CE    1 
ATOM   6479  N  N     . ASN B 1 195 ? -33.945 139.977 21.284  1.00 84.05  ? 597  ASN B N     1 
ATOM   6480  C  CA    . ASN B 1 195 ? -35.245 139.897 21.950  1.00 85.58  ? 597  ASN B CA    1 
ATOM   6481  C  C     . ASN B 1 195 ? -36.370 139.754 20.930  1.00 82.67  ? 597  ASN B C     1 
ATOM   6482  O  O     . ASN B 1 195 ? -36.594 140.643 20.114  1.00 86.21  ? 597  ASN B O     1 
ATOM   6483  C  CB    . ASN B 1 195 ? -35.482 141.134 22.821  1.00 90.95  ? 597  ASN B CB    1 
ATOM   6484  C  CG    . ASN B 1 195 ? -36.623 140.943 23.814  1.00 93.65  ? 597  ASN B CG    1 
ATOM   6485  O  OD1   . ASN B 1 195 ? -37.541 140.154 23.589  1.00 85.11  ? 597  ASN B OD1   1 
ATOM   6486  N  ND2   . ASN B 1 195 ? -36.563 141.668 24.923  1.00 102.15 ? 597  ASN B ND2   1 
ATOM   6487  N  N     . PRO B 1 196 ? -37.086 138.629 20.963  1.00 77.07  ? 598  PRO B N     1 
ATOM   6488  C  CA    . PRO B 1 196 ? -38.132 138.416 19.951  1.00 78.92  ? 598  PRO B CA    1 
ATOM   6489  C  C     . PRO B 1 196 ? -39.129 139.561 19.947  1.00 91.36  ? 598  PRO B C     1 
ATOM   6490  O  O     . PRO B 1 196 ? -39.661 139.919 18.893  1.00 99.80  ? 598  PRO B O     1 
ATOM   6491  C  CB    . PRO B 1 196 ? -38.813 137.140 20.418  1.00 71.79  ? 598  PRO B CB    1 
ATOM   6492  C  CG    . PRO B 1 196 ? -37.757 136.423 21.203  1.00 75.29  ? 598  PRO B CG    1 
ATOM   6493  C  CD    . PRO B 1 196 ? -36.921 137.481 21.862  1.00 71.27  ? 598  PRO B CD    1 
ATOM   6494  N  N     . GLU B 1 197 ? -39.352 140.138 21.125  1.00 91.91  ? 599  GLU B N     1 
ATOM   6495  C  CA    . GLU B 1 197 ? -40.319 141.214 21.301  1.00 91.63  ? 599  GLU B CA    1 
ATOM   6496  C  C     . GLU B 1 197 ? -39.771 142.597 20.894  1.00 98.17  ? 599  GLU B C     1 
ATOM   6497  O  O     . GLU B 1 197 ? -40.505 143.581 20.869  1.00 101.93 ? 599  GLU B O     1 
ATOM   6498  C  CB    . GLU B 1 197 ? -40.835 141.223 22.750  1.00 82.87  ? 599  GLU B CB    1 
ATOM   6499  N  N     . THR B 1 198 ? -38.490 142.666 20.552  1.00 98.23  ? 600  THR B N     1 
ATOM   6500  C  CA    . THR B 1 198 ? -37.848 143.948 20.258  1.00 95.85  ? 600  THR B CA    1 
ATOM   6501  C  C     . THR B 1 198 ? -37.193 144.015 18.856  1.00 92.27  ? 600  THR B C     1 
ATOM   6502  O  O     . THR B 1 198 ? -36.993 145.094 18.297  1.00 85.70  ? 600  THR B O     1 
ATOM   6503  C  CB    . THR B 1 198 ? -36.801 144.302 21.362  1.00 66.20  ? 600  THR B CB    1 
ATOM   6504  N  N     . ARG B 1 199 ? -36.885 142.857 18.282  1.00 94.36  ? 601  ARG B N     1 
ATOM   6505  C  CA    . ARG B 1 199 ? -36.012 142.777 17.112  1.00 91.64  ? 601  ARG B CA    1 
ATOM   6506  C  C     . ARG B 1 199 ? -36.750 142.967 15.793  1.00 98.08  ? 601  ARG B C     1 
ATOM   6507  O  O     . ARG B 1 199 ? -37.918 142.603 15.673  1.00 104.85 ? 601  ARG B O     1 
ATOM   6508  C  CB    . ARG B 1 199 ? -35.288 141.420 17.095  1.00 87.78  ? 601  ARG B CB    1 
ATOM   6509  C  CG    . ARG B 1 199 ? -36.217 140.248 16.783  1.00 84.21  ? 601  ARG B CG    1 
ATOM   6510  C  CD    . ARG B 1 199 ? -35.665 138.886 17.199  1.00 78.53  ? 601  ARG B CD    1 
ATOM   6511  N  NE    . ARG B 1 199 ? -36.654 137.848 16.905  1.00 84.99  ? 601  ARG B NE    1 
ATOM   6512  C  CZ    . ARG B 1 199 ? -36.539 136.562 17.224  1.00 88.39  ? 601  ARG B CZ    1 
ATOM   6513  N  NH1   . ARG B 1 199 ? -35.466 136.115 17.861  1.00 80.36  ? 601  ARG B NH1   1 
ATOM   6514  N  NH2   . ARG B 1 199 ? -37.509 135.717 16.903  1.00 95.67  ? 601  ARG B NH2   1 
ATOM   6515  N  N     . THR B 1 200 ? -36.052 143.540 14.812  1.00 98.39  ? 602  THR B N     1 
ATOM   6516  C  CA    . THR B 1 200 ? -36.506 143.549 13.426  1.00 93.32  ? 602  THR B CA    1 
ATOM   6517  C  C     . THR B 1 200 ? -35.853 142.377 12.679  1.00 103.77 ? 602  THR B C     1 
ATOM   6518  O  O     . THR B 1 200 ? -34.637 142.200 12.728  1.00 108.95 ? 602  THR B O     1 
ATOM   6519  C  CB    . THR B 1 200 ? -36.154 144.880 12.716  1.00 73.49  ? 602  THR B CB    1 
ATOM   6520  N  N     . LEU B 1 201 ? -36.663 141.570 11.997  1.00 105.81 ? 603  LEU B N     1 
ATOM   6521  C  CA    . LEU B 1 201 ? -36.149 140.446 11.210  1.00 99.85  ? 603  LEU B CA    1 
ATOM   6522  C  C     . LEU B 1 201 ? -36.427 140.582 9.708   1.00 102.73 ? 603  LEU B C     1 
ATOM   6523  O  O     . LEU B 1 201 ? -37.234 141.411 9.278   1.00 100.25 ? 603  LEU B O     1 
ATOM   6524  C  CB    . LEU B 1 201 ? -36.747 139.124 11.706  1.00 91.68  ? 603  LEU B CB    1 
ATOM   6525  C  CG    . LEU B 1 201 ? -36.238 138.664 13.062  1.00 78.85  ? 603  LEU B CG    1 
ATOM   6526  C  CD1   . LEU B 1 201 ? -36.570 137.201 13.313  1.00 72.80  ? 603  LEU B CD1   1 
ATOM   6527  C  CD2   . LEU B 1 201 ? -34.750 138.927 13.117  1.00 70.24  ? 603  LEU B CD2   1 
ATOM   6528  N  N     . ILE B 1 202 ? -35.748 139.758 8.916   1.00 103.44 ? 604  ILE B N     1 
ATOM   6529  C  CA    . ILE B 1 202 ? -36.114 139.551 7.516   1.00 101.64 ? 604  ILE B CA    1 
ATOM   6530  C  C     . ILE B 1 202 ? -36.345 138.060 7.303   1.00 100.05 ? 604  ILE B C     1 
ATOM   6531  O  O     . ILE B 1 202 ? -35.510 137.246 7.699   1.00 102.31 ? 604  ILE B O     1 
ATOM   6532  C  CB    . ILE B 1 202 ? -35.005 140.006 6.547   1.00 92.27  ? 604  ILE B CB    1 
ATOM   6533  C  CG1   . ILE B 1 202 ? -34.824 141.515 6.595   1.00 83.69  ? 604  ILE B CG1   1 
ATOM   6534  C  CG2   . ILE B 1 202 ? -35.342 139.598 5.131   1.00 91.08  ? 604  ILE B CG2   1 
ATOM   6535  C  CD1   . ILE B 1 202 ? -33.759 141.997 5.665   1.00 81.90  ? 604  ILE B CD1   1 
ATOM   6536  N  N     . ARG B 1 203 ? -37.474 137.693 6.698   1.00 93.52  ? 605  ARG B N     1 
ATOM   6537  C  CA    . ARG B 1 203 ? -37.731 136.285 6.411   1.00 88.95  ? 605  ARG B CA    1 
ATOM   6538  C  C     . ARG B 1 203 ? -37.401 136.021 4.950   1.00 92.39  ? 605  ARG B C     1 
ATOM   6539  O  O     . ARG B 1 203 ? -38.059 136.562 4.063   1.00 103.12 ? 605  ARG B O     1 
ATOM   6540  C  CB    . ARG B 1 203 ? -39.186 135.882 6.733   1.00 83.29  ? 605  ARG B CB    1 
ATOM   6541  N  N     . VAL B 1 204 ? -36.364 135.219 4.702   1.00 85.52  ? 606  VAL B N     1 
ATOM   6542  C  CA    . VAL B 1 204 ? -36.069 134.757 3.348   1.00 82.10  ? 606  VAL B CA    1 
ATOM   6543  C  C     . VAL B 1 204 ? -37.163 133.785 2.929   1.00 86.07  ? 606  VAL B C     1 
ATOM   6544  O  O     . VAL B 1 204 ? -37.343 132.743 3.560   1.00 89.46  ? 606  VAL B O     1 
ATOM   6545  C  CB    . VAL B 1 204 ? -34.683 134.078 3.233   1.00 70.02  ? 606  VAL B CB    1 
ATOM   6546  N  N     . THR B 1 205 ? -37.911 134.175 1.892   1.00 88.72  ? 607  THR B N     1 
ATOM   6547  C  CA    . THR B 1 205 ? -38.939 133.358 1.231   1.00 90.26  ? 607  THR B CA    1 
ATOM   6548  C  C     . THR B 1 205 ? -38.584 133.250 -0.253  1.00 97.95  ? 607  THR B C     1 
ATOM   6549  O  O     . THR B 1 205 ? -38.067 134.199 -0.843  1.00 98.91  ? 607  THR B O     1 
ATOM   6550  C  CB    . THR B 1 205 ? -40.334 134.012 1.329   1.00 80.89  ? 607  THR B CB    1 
ATOM   6551  N  N     . ILE B 1 206 ? -38.841 132.098 -0.860  1.00 103.64 ? 608  ILE B N     1 
ATOM   6552  C  CA    . ILE B 1 206 ? -38.622 131.940 -2.301  1.00 102.29 ? 608  ILE B CA    1 
ATOM   6553  C  C     . ILE B 1 206 ? -39.910 132.259 -3.063  1.00 104.63 ? 608  ILE B C     1 
ATOM   6554  O  O     . ILE B 1 206 ? -40.936 131.621 -2.842  1.00 107.47 ? 608  ILE B O     1 
ATOM   6555  C  CB    . ILE B 1 206 ? -38.150 130.509 -2.651  1.00 96.72  ? 608  ILE B CB    1 
ATOM   6556  C  CG1   . ILE B 1 206 ? -36.785 130.228 -2.019  1.00 88.60  ? 608  ILE B CG1   1 
ATOM   6557  C  CG2   . ILE B 1 206 ? -38.078 130.314 -4.154  1.00 84.62  ? 608  ILE B CG2   1 
ATOM   6558  C  CD1   . ILE B 1 206 ? -36.325 128.802 -2.189  1.00 87.28  ? 608  ILE B CD1   1 
ATOM   6559  N  N     . GLU B 1 207 ? -39.867 133.254 -3.943  1.00 103.12 ? 609  GLU B N     1 
ATOM   6560  C  CA    . GLU B 1 207 ? -41.062 133.628 -4.704  1.00 99.51  ? 609  GLU B CA    1 
ATOM   6561  C  C     . GLU B 1 207 ? -41.146 132.917 -6.075  1.00 98.61  ? 609  GLU B C     1 
ATOM   6562  O  O     . GLU B 1 207 ? -42.229 132.501 -6.503  1.00 106.41 ? 609  GLU B O     1 
ATOM   6563  C  CB    . GLU B 1 207 ? -41.164 135.158 -4.835  1.00 90.26  ? 609  GLU B CB    1 
ATOM   6564  N  N     . ASP B 1 208 ? -40.000 132.772 -6.743  1.00 125.94 ? 610  ASP B N     1 
ATOM   6565  C  CA    . ASP B 1 208 ? -39.903 132.086 -8.038  1.00 123.59 ? 610  ASP B CA    1 
ATOM   6566  C  C     . ASP B 1 208 ? -38.667 131.171 -8.124  1.00 121.47 ? 610  ASP B C     1 
ATOM   6567  O  O     . ASP B 1 208 ? -37.555 131.639 -8.379  1.00 114.23 ? 610  ASP B O     1 
ATOM   6568  C  CB    . ASP B 1 208 ? -39.885 133.100 -9.194  1.00 118.06 ? 610  ASP B CB    1 
ATOM   6569  N  N     . LEU B 1 209 ? -38.871 129.870 -7.928  1.00 127.43 ? 611  LEU B N     1 
ATOM   6570  C  CA    . LEU B 1 209 ? -37.781 128.889 -7.967  1.00 127.94 ? 611  LEU B CA    1 
ATOM   6571  C  C     . LEU B 1 209 ? -36.830 129.044 -9.162  1.00 128.30 ? 611  LEU B C     1 
ATOM   6572  O  O     . LEU B 1 209 ? -35.618 128.858 -9.022  1.00 123.15 ? 611  LEU B O     1 
ATOM   6573  C  CB    . LEU B 1 209 ? -38.339 127.461 -7.931  1.00 132.27 ? 611  LEU B CB    1 
ATOM   6574  C  CG    . LEU B 1 209 ? -37.276 126.397 -7.652  1.00 131.52 ? 611  LEU B CG    1 
ATOM   6575  C  CD1   . LEU B 1 209 ? -36.361 126.211 -8.847  1.00 123.43 ? 611  LEU B CD1   1 
ATOM   6576  C  CD2   . LEU B 1 209 ? -36.462 126.795 -6.429  1.00 132.58 ? 611  LEU B CD2   1 
ATOM   6577  N  N     . ALA B 1 210 ? -37.389 129.366 -10.331 1.00 131.94 ? 612  ALA B N     1 
ATOM   6578  C  CA    . ALA B 1 210 ? -36.609 129.570 -11.555 1.00 120.47 ? 612  ALA B CA    1 
ATOM   6579  C  C     . ALA B 1 210 ? -35.680 130.765 -11.422 1.00 112.31 ? 612  ALA B C     1 
ATOM   6580  O  O     . ALA B 1 210 ? -34.459 130.619 -11.433 1.00 106.61 ? 612  ALA B O     1 
ATOM   6581  C  CB    . ALA B 1 210 ? -37.530 129.767 -12.739 1.00 116.77 ? 612  ALA B CB    1 
ATOM   6582  N  N     . ARG B 1 211 ? -36.275 131.949 -11.304 1.00 111.76 ? 613  ARG B N     1 
ATOM   6583  C  CA    . ARG B 1 211 ? -35.521 133.195 -11.189 1.00 114.35 ? 613  ARG B CA    1 
ATOM   6584  C  C     . ARG B 1 211 ? -34.464 133.154 -10.067 1.00 121.37 ? 613  ARG B C     1 
ATOM   6585  O  O     . ARG B 1 211 ? -33.482 133.911 -10.098 1.00 114.99 ? 613  ARG B O     1 
ATOM   6586  C  CB    . ARG B 1 211 ? -36.478 134.385 -10.991 1.00 112.99 ? 613  ARG B CB    1 
ATOM   6587  C  CG    . ARG B 1 211 ? -37.040 134.992 -12.274 1.00 108.45 ? 613  ARG B CG    1 
ATOM   6588  C  CD    . ARG B 1 211 ? -36.564 136.430 -12.482 1.00 102.21 ? 613  ARG B CD    1 
ATOM   6589  N  N     . ALA B 1 212 ? -34.670 132.270 -9.086  1.00 128.10 ? 614  ALA B N     1 
ATOM   6590  C  CA    . ALA B 1 212 ? -33.752 132.137 -7.946  1.00 121.68 ? 614  ALA B CA    1 
ATOM   6591  C  C     . ALA B 1 212 ? -32.558 131.203 -8.206  1.00 120.24 ? 614  ALA B C     1 
ATOM   6592  O  O     . ALA B 1 212 ? -31.497 131.368 -7.606  1.00 117.98 ? 614  ALA B O     1 
ATOM   6593  C  CB    . ALA B 1 212 ? -34.508 131.719 -6.675  1.00 118.19 ? 614  ALA B CB    1 
ATOM   6594  N  N     . GLU B 1 213 ? -32.720 130.229 -9.097  1.00 120.59 ? 615  GLU B N     1 
ATOM   6595  C  CA    . GLU B 1 213 ? -31.598 129.375 -9.482  1.00 111.14 ? 615  GLU B CA    1 
ATOM   6596  C  C     . GLU B 1 213 ? -30.529 130.150 -10.268 1.00 103.62 ? 615  GLU B C     1 
ATOM   6597  O  O     . GLU B 1 213 ? -29.355 130.120 -9.895  1.00 95.85  ? 615  GLU B O     1 
ATOM   6598  C  CB    . GLU B 1 213 ? -32.081 128.164 -10.274 1.00 116.21 ? 615  GLU B CB    1 
ATOM   6599  C  CG    . GLU B 1 213 ? -30.971 127.204 -10.692 1.00 119.44 ? 615  GLU B CG    1 
ATOM   6600  C  CD    . GLU B 1 213 ? -30.435 126.378 -9.539  1.00 122.03 ? 615  GLU B CD    1 
ATOM   6601  O  OE1   . GLU B 1 213 ? -30.835 126.654 -8.391  1.00 133.45 ? 615  GLU B OE1   1 
ATOM   6602  O  OE2   . GLU B 1 213 ? -29.620 125.455 -9.780  1.00 110.69 ? 615  GLU B OE2   1 
ATOM   6603  N  N     . ARG B 1 214 ? -30.931 130.845 -11.339 1.00 103.04 ? 616  ARG B N     1 
ATOM   6604  C  CA    . ARG B 1 214 ? -29.991 131.647 -12.136 1.00 101.29 ? 616  ARG B CA    1 
ATOM   6605  C  C     . ARG B 1 214 ? -29.290 132.701 -11.271 1.00 101.46 ? 616  ARG B C     1 
ATOM   6606  O  O     . ARG B 1 214 ? -28.086 132.941 -11.404 1.00 93.16  ? 616  ARG B O     1 
ATOM   6607  C  CB    . ARG B 1 214 ? -30.679 132.312 -13.339 1.00 94.92  ? 616  ARG B CB    1 
ATOM   6608  N  N     . ARG B 1 215 ? -30.044 133.328 -10.377 1.00 108.64 ? 617  ARG B N     1 
ATOM   6609  C  CA    . ARG B 1 215 ? -29.474 134.372 -9.534  1.00 107.35 ? 617  ARG B CA    1 
ATOM   6610  C  C     . ARG B 1 215 ? -28.309 133.820 -8.711  1.00 105.12 ? 617  ARG B C     1 
ATOM   6611  O  O     . ARG B 1 215 ? -27.209 134.379 -8.736  1.00 104.28 ? 617  ARG B O     1 
ATOM   6612  C  CB    . ARG B 1 215 ? -30.547 135.000 -8.638  1.00 109.02 ? 617  ARG B CB    1 
ATOM   6613  C  CG    . ARG B 1 215 ? -30.041 136.114 -7.735  1.00 104.85 ? 617  ARG B CG    1 
ATOM   6614  C  CD    . ARG B 1 215 ? -29.343 137.215 -8.518  1.00 102.21 ? 617  ARG B CD    1 
ATOM   6615  N  NE    . ARG B 1 215 ? -30.234 137.873 -9.466  1.00 101.15 ? 617  ARG B NE    1 
ATOM   6616  C  CZ    . ARG B 1 215 ? -30.940 138.965 -9.196  1.00 96.99  ? 617  ARG B CZ    1 
ATOM   6617  N  NH1   . ARG B 1 215 ? -30.864 139.530 -7.999  1.00 88.68  ? 617  ARG B NH1   1 
ATOM   6618  N  NH2   . ARG B 1 215 ? -31.724 139.495 -10.125 1.00 103.87 ? 617  ARG B NH2   1 
ATOM   6619  N  N     . VAL B 1 216 ? -28.541 132.710 -8.012  1.00 101.07 ? 618  VAL B N     1 
ATOM   6620  C  CA    . VAL B 1 216 ? -27.504 132.105 -7.178  1.00 97.84  ? 618  VAL B CA    1 
ATOM   6621  C  C     . VAL B 1 216 ? -26.300 131.601 -7.992  1.00 101.99 ? 618  VAL B C     1 
ATOM   6622  O  O     . VAL B 1 216 ? -25.155 131.771 -7.573  1.00 104.83 ? 618  VAL B O     1 
ATOM   6623  C  CB    . VAL B 1 216 ? -28.064 130.983 -6.256  1.00 100.48 ? 618  VAL B CB    1 
ATOM   6624  C  CG1   . VAL B 1 216 ? -26.942 130.247 -5.561  1.00 103.28 ? 618  VAL B CG1   1 
ATOM   6625  C  CG2   . VAL B 1 216 ? -29.010 131.558 -5.209  1.00 99.36  ? 618  VAL B CG2   1 
ATOM   6626  N  N     . ASN B 1 217 ? -26.545 131.005 -9.159  1.00 102.93 ? 619  ASN B N     1 
ATOM   6627  C  CA    . ASN B 1 217 ? -25.438 130.488 -9.977  1.00 87.81  ? 619  ASN B CA    1 
ATOM   6628  C  C     . ASN B 1 217 ? -24.581 131.553 -10.627 1.00 88.03  ? 619  ASN B C     1 
ATOM   6629  O  O     . ASN B 1 217 ? -23.366 131.411 -10.672 1.00 93.16  ? 619  ASN B O     1 
ATOM   6630  C  CB    . ASN B 1 217 ? -25.920 129.484 -11.009 1.00 90.63  ? 619  ASN B CB    1 
ATOM   6631  C  CG    . ASN B 1 217 ? -26.644 128.337 -10.375 1.00 105.93 ? 619  ASN B CG    1 
ATOM   6632  O  OD1   . ASN B 1 217 ? -26.463 128.068 -9.188  1.00 113.10 ? 619  ASN B OD1   1 
ATOM   6633  N  ND2   . ASN B 1 217 ? -27.482 127.659 -11.144 1.00 104.79 ? 619  ASN B ND2   1 
ATOM   6634  N  N     . VAL B 1 218 ? -25.197 132.619 -11.128 1.00 88.20  ? 620  VAL B N     1 
ATOM   6635  C  CA    . VAL B 1 218 ? -24.408 133.687 -11.714 1.00 88.34  ? 620  VAL B CA    1 
ATOM   6636  C  C     . VAL B 1 218 ? -23.432 134.169 -10.647 1.00 94.54  ? 620  VAL B C     1 
ATOM   6637  O  O     . VAL B 1 218 ? -22.225 134.124 -10.851 1.00 102.13 ? 620  VAL B O     1 
ATOM   6638  C  CB    . VAL B 1 218 ? -25.274 134.849 -12.225 1.00 81.31  ? 620  VAL B CB    1 
ATOM   6639  N  N     . LEU B 1 219 ? -23.952 134.577 -9.492  1.00 92.84  ? 621  LEU B N     1 
ATOM   6640  C  CA    . LEU B 1 219 ? -23.136 135.218 -8.453  1.00 92.20  ? 621  LEU B CA    1 
ATOM   6641  C  C     . LEU B 1 219 ? -22.136 134.314 -7.725  1.00 99.00  ? 621  LEU B C     1 
ATOM   6642  O  O     . LEU B 1 219 ? -21.056 134.768 -7.331  1.00 106.92 ? 621  LEU B O     1 
ATOM   6643  C  CB    . LEU B 1 219 ? -24.026 135.864 -7.393  1.00 84.14  ? 621  LEU B CB    1 
ATOM   6644  C  CG    . LEU B 1 219 ? -25.153 136.795 -7.813  1.00 84.41  ? 621  LEU B CG    1 
ATOM   6645  C  CD1   . LEU B 1 219 ? -26.047 137.033 -6.587  1.00 85.87  ? 621  LEU B CD1   1 
ATOM   6646  C  CD2   . LEU B 1 219 ? -24.623 138.098 -8.405  1.00 75.82  ? 621  LEU B CD2   1 
ATOM   6647  N  N     . MET B 1 220 ? -22.499 133.054 -7.514  1.00 94.06  ? 622  MET B N     1 
ATOM   6648  C  CA    . MET B 1 220 ? -21.737 132.213 -6.598  1.00 89.36  ? 622  MET B CA    1 
ATOM   6649  C  C     . MET B 1 220 ? -21.024 131.063 -7.292  1.00 88.49  ? 622  MET B C     1 
ATOM   6650  O  O     . MET B 1 220 ? -20.219 130.365 -6.663  1.00 83.86  ? 622  MET B O     1 
ATOM   6651  C  CB    . MET B 1 220 ? -22.642 131.668 -5.485  1.00 90.39  ? 622  MET B CB    1 
ATOM   6652  C  CG    . MET B 1 220 ? -23.485 132.732 -4.776  1.00 91.39  ? 622  MET B CG    1 
ATOM   6653  S  SD    . MET B 1 220 ? -22.529 134.064 -3.989  1.00 102.94 ? 622  MET B SD    1 
ATOM   6654  C  CE    . MET B 1 220 ? -21.808 133.188 -2.591  1.00 103.49 ? 622  MET B CE    1 
ATOM   6655  N  N     . GLY B 1 221 ? -21.318 130.877 -8.579  1.00 87.38  ? 623  GLY B N     1 
ATOM   6656  C  CA    . GLY B 1 221 ? -20.815 129.743 -9.338  1.00 82.63  ? 623  GLY B CA    1 
ATOM   6657  C  C     . GLY B 1 221 ? -19.337 129.792 -9.668  1.00 86.70  ? 623  GLY B C     1 
ATOM   6658  O  O     . GLY B 1 221 ? -18.675 130.786 -9.416  1.00 87.16  ? 623  GLY B O     1 
ATOM   6659  N  N     . ASP B 1 222 ? -18.819 128.712 -10.236 1.00 88.33  ? 624  ASP B N     1 
ATOM   6660  C  CA    . ASP B 1 222 ? -17.415 128.652 -10.623 1.00 85.49  ? 624  ASP B CA    1 
ATOM   6661  C  C     . ASP B 1 222 ? -17.072 129.551 -11.826 1.00 88.19  ? 624  ASP B C     1 
ATOM   6662  O  O     . ASP B 1 222 ? -15.954 130.044 -11.918 1.00 89.76  ? 624  ASP B O     1 
ATOM   6663  C  CB    . ASP B 1 222 ? -16.991 127.195 -10.889 1.00 89.22  ? 624  ASP B CB    1 
ATOM   6664  C  CG    . ASP B 1 222 ? -17.761 126.554 -12.043 1.00 89.56  ? 624  ASP B CG    1 
ATOM   6665  N  N     . LYS B 1 223 ? -18.013 129.772 -12.745 1.00 91.67  ? 625  LYS B N     1 
ATOM   6666  C  CA    . LYS B 1 223 ? -17.699 130.551 -13.953 1.00 95.06  ? 625  LYS B CA    1 
ATOM   6667  C  C     . LYS B 1 223 ? -17.645 132.070 -13.692 1.00 98.49  ? 625  LYS B C     1 
ATOM   6668  O  O     . LYS B 1 223 ? -18.601 132.666 -13.188 1.00 99.84  ? 625  LYS B O     1 
ATOM   6669  C  CB    . LYS B 1 223 ? -18.641 130.209 -15.117 1.00 82.90  ? 625  LYS B CB    1 
ATOM   6670  N  N     . VAL B 1 224 ? -16.516 132.681 -14.048 1.00 95.36  ? 626  VAL B N     1 
ATOM   6671  C  CA    . VAL B 1 224 ? -16.281 134.109 -13.824 1.00 89.28  ? 626  VAL B CA    1 
ATOM   6672  C  C     . VAL B 1 224 ? -16.971 135.060 -14.814 1.00 87.26  ? 626  VAL B C     1 
ATOM   6673  O  O     . VAL B 1 224 ? -17.481 136.100 -14.403 1.00 78.25  ? 626  VAL B O     1 
ATOM   6674  C  CB    . VAL B 1 224 ? -14.780 134.431 -13.880 1.00 90.51  ? 626  VAL B CB    1 
ATOM   6675  C  CG1   . VAL B 1 224 ? -14.477 135.710 -13.120 1.00 75.68  ? 626  VAL B CG1   1 
ATOM   6676  C  CG2   . VAL B 1 224 ? -13.975 133.276 -13.336 1.00 104.06 ? 626  VAL B CG2   1 
ATOM   6677  N  N     . GLU B 1 225 ? -16.964 134.733 -16.111 1.00 92.09  ? 627  GLU B N     1 
ATOM   6678  C  CA    . GLU B 1 225 ? -17.506 135.655 -17.124 1.00 92.27  ? 627  GLU B CA    1 
ATOM   6679  C  C     . GLU B 1 225 ? -18.927 136.145 -16.783 1.00 91.96  ? 627  GLU B C     1 
ATOM   6680  O  O     . GLU B 1 225 ? -19.155 137.350 -16.649 1.00 86.11  ? 627  GLU B O     1 
ATOM   6681  C  CB    . GLU B 1 225 ? -17.430 135.070 -18.545 1.00 80.88  ? 627  GLU B CB    1 
ATOM   6682  N  N     . PRO B 1 226 ? -19.885 135.215 -16.613 1.00 92.52  ? 628  PRO B N     1 
ATOM   6683  C  CA    . PRO B 1 226 ? -21.251 135.653 -16.299 1.00 89.16  ? 628  PRO B CA    1 
ATOM   6684  C  C     . PRO B 1 226 ? -21.265 136.702 -15.181 1.00 90.34  ? 628  PRO B C     1 
ATOM   6685  O  O     . PRO B 1 226 ? -21.747 137.808 -15.426 1.00 90.14  ? 628  PRO B O     1 
ATOM   6686  C  CB    . PRO B 1 226 ? -21.931 134.370 -15.834 1.00 84.65  ? 628  PRO B CB    1 
ATOM   6687  C  CG    . PRO B 1 226 ? -21.157 133.284 -16.458 1.00 83.93  ? 628  PRO B CG    1 
ATOM   6688  C  CD    . PRO B 1 226 ? -19.745 133.752 -16.553 1.00 88.36  ? 628  PRO B CD    1 
ATOM   6689  N  N     . ARG B 1 227 ? -20.728 136.357 -14.005 1.00 86.83  ? 629  ARG B N     1 
ATOM   6690  C  CA    . ARG B 1 227 ? -20.606 137.268 -12.847 1.00 76.44  ? 629  ARG B CA    1 
ATOM   6691  C  C     . ARG B 1 227 ? -20.050 138.660 -13.152 1.00 72.78  ? 629  ARG B C     1 
ATOM   6692  O  O     . ARG B 1 227 ? -20.597 139.659 -12.706 1.00 72.23  ? 629  ARG B O     1 
ATOM   6693  C  CB    . ARG B 1 227 ? -19.759 136.610 -11.759 1.00 73.74  ? 629  ARG B CB    1 
ATOM   6694  C  CG    . ARG B 1 227 ? -19.545 137.444 -10.486 1.00 76.29  ? 629  ARG B CG    1 
ATOM   6695  C  CD    . ARG B 1 227 ? -18.690 136.676 -9.502  1.00 70.98  ? 629  ARG B CD    1 
ATOM   6696  N  NE    . ARG B 1 227 ? -19.042 135.264 -9.552  1.00 77.45  ? 629  ARG B NE    1 
ATOM   6697  C  CZ    . ARG B 1 227 ? -18.169 134.275 -9.704  1.00 77.72  ? 629  ARG B CZ    1 
ATOM   6698  N  NH1   . ARG B 1 227 ? -16.874 134.532 -9.798  1.00 74.31  ? 629  ARG B NH1   1 
ATOM   6699  N  NH2   . ARG B 1 227 ? -18.592 133.021 -9.744  1.00 78.44  ? 629  ARG B NH2   1 
ATOM   6700  N  N     . ARG B 1 228 ? -18.951 138.718 -13.898 1.00 73.67  ? 630  ARG B N     1 
ATOM   6701  C  CA    . ARG B 1 228 ? -18.426 139.990 -14.375 1.00 72.44  ? 630  ARG B CA    1 
ATOM   6702  C  C     . ARG B 1 228 ? -19.532 140.764 -15.094 1.00 84.18  ? 630  ARG B C     1 
ATOM   6703  O  O     . ARG B 1 228 ? -19.758 141.931 -14.773 1.00 86.18  ? 630  ARG B O     1 
ATOM   6704  C  CB    . ARG B 1 228 ? -17.201 139.775 -15.281 1.00 76.87  ? 630  ARG B CB    1 
ATOM   6705  C  CG    . ARG B 1 228 ? -16.429 141.044 -15.673 1.00 76.32  ? 630  ARG B CG    1 
ATOM   6706  C  CD    . ARG B 1 228 ? -15.118 140.706 -16.380 1.00 74.26  ? 630  ARG B CD    1 
ATOM   6707  N  N     . LYS B 1 229 ? -20.235 140.111 -16.038 1.00 81.09  ? 631  LYS B N     1 
ATOM   6708  C  CA    . LYS B 1 229 ? -21.309 140.770 -16.804 1.00 85.10  ? 631  LYS B CA    1 
ATOM   6709  C  C     . LYS B 1 229 ? -22.496 141.171 -15.917 1.00 87.08  ? 631  LYS B C     1 
ATOM   6710  O  O     . LYS B 1 229 ? -23.056 142.258 -16.077 1.00 87.82  ? 631  LYS B O     1 
ATOM   6711  C  CB    . LYS B 1 229 ? -21.782 139.941 -18.012 1.00 79.28  ? 631  LYS B CB    1 
ATOM   6712  N  N     . TRP B 1 230 ? -22.870 140.309 -14.975 1.00 85.58  ? 632  TRP B N     1 
ATOM   6713  C  CA    . TRP B 1 230 ? -23.923 140.654 -14.019 1.00 75.94  ? 632  TRP B CA    1 
ATOM   6714  C  C     . TRP B 1 230 ? -23.560 141.925 -13.259 1.00 77.81  ? 632  TRP B C     1 
ATOM   6715  O  O     . TRP B 1 230 ? -24.425 142.763 -13.003 1.00 74.89  ? 632  TRP B O     1 
ATOM   6716  C  CB    . TRP B 1 230 ? -24.192 139.504 -13.053 1.00 76.04  ? 632  TRP B CB    1 
ATOM   6717  C  CG    . TRP B 1 230 ? -25.424 139.683 -12.227 1.00 76.89  ? 632  TRP B CG    1 
ATOM   6718  C  CD1   . TRP B 1 230 ? -26.657 139.163 -12.472 1.00 79.37  ? 632  TRP B CD1   1 
ATOM   6719  C  CD2   . TRP B 1 230 ? -25.536 140.409 -10.995 1.00 75.94  ? 632  TRP B CD2   1 
ATOM   6720  N  NE1   . TRP B 1 230 ? -27.541 139.534 -11.479 1.00 79.68  ? 632  TRP B NE1   1 
ATOM   6721  C  CE2   . TRP B 1 230 ? -26.871 140.297 -10.561 1.00 77.76  ? 632  TRP B CE2   1 
ATOM   6722  C  CE3   . TRP B 1 230 ? -24.632 141.133 -10.211 1.00 74.04  ? 632  TRP B CE3   1 
ATOM   6723  C  CZ2   . TRP B 1 230 ? -27.324 140.894 -9.394  1.00 82.99  ? 632  TRP B CZ2   1 
ATOM   6724  C  CZ3   . TRP B 1 230 ? -25.089 141.734 -9.060  1.00 73.98  ? 632  TRP B CZ3   1 
ATOM   6725  C  CH2   . TRP B 1 230 ? -26.418 141.607 -8.658  1.00 79.02  ? 632  TRP B CH2   1 
ATOM   6726  N  N     . ILE B 1 231 ? -22.276 142.076 -12.924 1.00 78.41  ? 633  ILE B N     1 
ATOM   6727  C  CA    . ILE B 1 231 ? -21.820 143.221 -12.132 1.00 77.98  ? 633  ILE B CA    1 
ATOM   6728  C  C     . ILE B 1 231 ? -21.773 144.479 -12.989 1.00 85.20  ? 633  ILE B C     1 
ATOM   6729  O  O     . ILE B 1 231 ? -22.149 145.565 -12.531 1.00 83.02  ? 633  ILE B O     1 
ATOM   6730  C  CB    . ILE B 1 231 ? -20.444 142.978 -11.442 1.00 70.04  ? 633  ILE B CB    1 
ATOM   6731  C  CG1   . ILE B 1 231 ? -20.525 141.801 -10.476 1.00 73.01  ? 633  ILE B CG1   1 
ATOM   6732  C  CG2   . ILE B 1 231 ? -20.009 144.211 -10.661 1.00 69.10  ? 633  ILE B CG2   1 
ATOM   6733  C  CD1   . ILE B 1 231 ? -19.176 141.190 -10.118 1.00 68.73  ? 633  ILE B CD1   1 
ATOM   6734  N  N     . GLU B 1 232 ? -21.321 144.326 -14.236 1.00 93.23  ? 634  GLU B N     1 
ATOM   6735  C  CA    . GLU B 1 232 ? -21.313 145.434 -15.191 1.00 92.85  ? 634  GLU B CA    1 
ATOM   6736  C  C     . GLU B 1 232 ? -22.734 145.965 -15.436 1.00 95.71  ? 634  GLU B C     1 
ATOM   6737  O  O     . GLU B 1 232 ? -22.931 147.172 -15.584 1.00 97.96  ? 634  GLU B O     1 
ATOM   6738  C  CB    . GLU B 1 232 ? -20.635 145.028 -16.503 1.00 93.96  ? 634  GLU B CB    1 
ATOM   6739  C  CG    . GLU B 1 232 ? -19.100 144.923 -16.440 1.00 100.32 ? 634  GLU B CG    1 
ATOM   6740  C  CD    . GLU B 1 232 ? -18.498 144.271 -17.700 1.00 112.32 ? 634  GLU B CD    1 
ATOM   6741  O  OE1   . GLU B 1 232 ? -19.179 144.261 -18.759 1.00 115.43 ? 634  GLU B OE1   1 
ATOM   6742  O  OE2   . GLU B 1 232 ? -17.350 143.760 -17.626 1.00 113.21 ? 634  GLU B OE2   1 
ATOM   6743  N  N     . ASP B 1 233 ? -23.721 145.066 -15.430 1.00 90.77  ? 635  ASP B N     1 
ATOM   6744  C  CA    . ASP B 1 233 ? -25.121 145.426 -15.693 1.00 94.62  ? 635  ASP B CA    1 
ATOM   6745  C  C     . ASP B 1 233 ? -25.912 145.944 -14.488 1.00 91.23  ? 635  ASP B C     1 
ATOM   6746  O  O     . ASP B 1 233 ? -26.873 146.693 -14.658 1.00 90.52  ? 635  ASP B O     1 
ATOM   6747  C  CB    . ASP B 1 233 ? -25.888 144.246 -16.304 1.00 101.70 ? 635  ASP B CB    1 
ATOM   6748  C  CG    . ASP B 1 233 ? -25.310 143.788 -17.632 1.00 109.83 ? 635  ASP B CG    1 
ATOM   6749  O  OD1   . ASP B 1 233 ? -24.691 144.613 -18.355 1.00 106.00 ? 635  ASP B OD1   1 
ATOM   6750  O  OD2   . ASP B 1 233 ? -25.479 142.588 -17.944 1.00 114.64 ? 635  ASP B OD2   1 
ATOM   6751  N  N     . ASN B 1 234 ? -25.538 145.541 -13.277 1.00 89.36  ? 636  ASN B N     1 
ATOM   6752  C  CA    . ASN B 1 234 ? -26.347 145.898 -12.107 1.00 80.72  ? 636  ASN B CA    1 
ATOM   6753  C  C     . ASN B 1 234 ? -25.718 146.887 -11.130 1.00 79.13  ? 636  ASN B C     1 
ATOM   6754  O  O     . ASN B 1 234 ? -26.387 147.811 -10.674 1.00 82.81  ? 636  ASN B O     1 
ATOM   6755  C  CB    . ASN B 1 234 ? -26.801 144.654 -11.353 1.00 73.26  ? 636  ASN B CB    1 
ATOM   6756  C  CG    . ASN B 1 234 ? -27.744 143.788 -12.162 1.00 75.67  ? 636  ASN B CG    1 
ATOM   6757  O  OD1   . ASN B 1 234 ? -28.687 144.279 -12.794 1.00 70.69  ? 636  ASN B OD1   1 
ATOM   6758  N  ND2   . ASN B 1 234 ? -27.492 142.482 -12.143 1.00 73.81  ? 636  ASN B ND2   1 
ATOM   6759  N  N     . VAL B 1 235 ? -24.445 146.692 -10.802 1.00 77.68  ? 637  VAL B N     1 
ATOM   6760  C  CA    . VAL B 1 235 ? -23.758 147.557 -9.841  1.00 72.73  ? 637  VAL B CA    1 
ATOM   6761  C  C     . VAL B 1 235 ? -23.572 148.983 -10.358 1.00 86.05  ? 637  VAL B C     1 
ATOM   6762  O  O     . VAL B 1 235 ? -22.933 149.198 -11.396 1.00 88.67  ? 637  VAL B O     1 
ATOM   6763  C  CB    . VAL B 1 235 ? -22.402 146.973 -9.490  1.00 67.36  ? 637  VAL B CB    1 
ATOM   6764  C  CG1   . VAL B 1 235 ? -21.649 147.889 -8.523  1.00 71.75  ? 637  VAL B CG1   1 
ATOM   6765  C  CG2   . VAL B 1 235 ? -22.591 145.585 -8.920  1.00 61.07  ? 637  VAL B CG2   1 
ATOM   6766  N  N     . LYS B 1 236 ? -24.139 149.957 -9.644  1.00 90.22  ? 638  LYS B N     1 
ATOM   6767  C  CA    . LYS B 1 236 ? -24.053 151.349 -10.085 1.00 90.98  ? 638  LYS B CA    1 
ATOM   6768  C  C     . LYS B 1 236 ? -22.905 152.073 -9.382  1.00 94.49  ? 638  LYS B C     1 
ATOM   6769  O  O     . LYS B 1 236 ? -23.083 152.644 -8.296  1.00 92.92  ? 638  LYS B O     1 
ATOM   6770  C  CB    . LYS B 1 236 ? -25.389 152.085 -9.909  1.00 79.60  ? 638  LYS B CB    1 
ATOM   6771  N  N     . PHE B 1 237 ? -21.727 152.030 -10.014 1.00 92.94  ? 639  PHE B N     1 
ATOM   6772  C  CA    . PHE B 1 237 ? -20.505 152.634 -9.477  1.00 87.39  ? 639  PHE B CA    1 
ATOM   6773  C  C     . PHE B 1 237 ? -20.630 154.163 -9.344  1.00 102.47 ? 639  PHE B C     1 
ATOM   6774  O  O     . PHE B 1 237 ? -19.644 154.859 -9.106  1.00 108.57 ? 639  PHE B O     1 
ATOM   6775  C  CB    . PHE B 1 237 ? -19.278 152.238 -10.329 1.00 68.98  ? 639  PHE B CB    1 
ATOM   6776  C  CG    . PHE B 1 237 ? -18.992 150.748 -10.346 1.00 66.44  ? 639  PHE B CG    1 
ATOM   6777  C  CD1   . PHE B 1 237 ? -18.289 150.146 -9.326  1.00 80.52  ? 639  PHE B CD1   1 
ATOM   6778  C  CD2   . PHE B 1 237 ? -19.432 149.952 -11.374 1.00 67.96  ? 639  PHE B CD2   1 
ATOM   6779  C  CE1   . PHE B 1 237 ? -18.040 148.773 -9.335  1.00 74.90  ? 639  PHE B CE1   1 
ATOM   6780  C  CE2   . PHE B 1 237 ? -19.175 148.584 -11.388 1.00 69.91  ? 639  PHE B CE2   1 
ATOM   6781  C  CZ    . PHE B 1 237 ? -18.486 148.001 -10.372 1.00 67.38  ? 639  PHE B CZ    1 
ATOM   6782  N  N     . THR B 1 238 ? -21.860 154.661 -9.465  1.00 105.09 ? 640  THR B N     1 
ATOM   6783  C  CA    . THR B 1 238 ? -22.159 156.096 -9.489  1.00 86.44  ? 640  THR B CA    1 
ATOM   6784  C  C     . THR B 1 238 ? -21.141 156.842 -10.342 1.00 75.92  ? 640  THR B C     1 
ATOM   6785  O  O     . THR B 1 238 ? -21.038 156.572 -11.545 1.00 68.76  ? 640  THR B O     1 
ATOM   6786  C  CB    . THR B 1 238 ? -22.297 156.704 -8.072  1.00 71.08  ? 640  THR B CB    1 
ATOM   6787  N  N     . ASN B 1 249 ? -41.472 145.980 12.187  1.00 102.02 ? 1003 ASN B N     1 
ATOM   6788  C  CA    . ASN B 1 249 ? -40.878 144.743 12.688  1.00 113.23 ? 1003 ASN B CA    1 
ATOM   6789  C  C     . ASN B 1 249 ? -40.401 143.841 11.547  1.00 127.20 ? 1003 ASN B C     1 
ATOM   6790  O  O     . ASN B 1 249 ? -39.567 144.256 10.742  1.00 132.52 ? 1003 ASN B O     1 
ATOM   6791  C  CB    . ASN B 1 249 ? -41.851 143.997 13.610  1.00 115.19 ? 1003 ASN B CB    1 
ATOM   6792  N  N     . ILE B 1 250 ? -40.942 142.624 11.473  1.00 129.62 ? 1004 ILE B N     1 
ATOM   6793  C  CA    . ILE B 1 250 ? -40.522 141.618 10.479  1.00 121.31 ? 1004 ILE B CA    1 
ATOM   6794  C  C     . ILE B 1 250 ? -41.036 141.839 9.030   1.00 110.46 ? 1004 ILE B C     1 
ATOM   6795  O  O     . ILE B 1 250 ? -42.219 142.105 8.807   1.00 104.90 ? 1004 ILE B O     1 
ATOM   6796  C  CB    . ILE B 1 250 ? -40.894 140.189 10.947  1.00 105.97 ? 1004 ILE B CB    1 
ATOM   6797  C  CG1   . ILE B 1 250 ? -40.383 139.149 9.951   1.00 100.13 ? 1004 ILE B CG1   1 
ATOM   6798  C  CG2   . ILE B 1 250 ? -42.395 140.063 11.133  1.00 101.08 ? 1004 ILE B CG2   1 
ATOM   6799  C  CD1   . ILE B 1 250 ? -40.709 137.743 10.347  1.00 102.68 ? 1004 ILE B CD1   1 
ATOM   6800  N  N     . GLN B 1 251 ? -40.127 141.720 8.058   1.00 108.95 ? 1005 GLN B N     1 
ATOM   6801  C  CA    . GLN B 1 251 ? -40.439 141.926 6.640   1.00 105.30 ? 1005 GLN B CA    1 
ATOM   6802  C  C     . GLN B 1 251 ? -39.939 140.765 5.806   1.00 103.54 ? 1005 GLN B C     1 
ATOM   6803  O  O     . GLN B 1 251 ? -39.038 140.041 6.212   1.00 100.48 ? 1005 GLN B O     1 
ATOM   6804  C  CB    . GLN B 1 251 ? -39.800 143.216 6.107   1.00 102.04 ? 1005 GLN B CB    1 
ATOM   6805  N  N     . ASN B 1 252 ? -40.517 140.602 4.624   1.00 110.36 ? 1006 ASN B N     1 
ATOM   6806  C  CA    . ASN B 1 252 ? -40.103 139.544 3.703   1.00 108.16 ? 1006 ASN B CA    1 
ATOM   6807  C  C     . ASN B 1 252 ? -39.250 140.056 2.543   1.00 95.19  ? 1006 ASN B C     1 
ATOM   6808  O  O     . ASN B 1 252 ? -39.444 141.159 2.046   1.00 96.85  ? 1006 ASN B O     1 
ATOM   6809  C  CB    . ASN B 1 252 ? -41.319 138.792 3.165   1.00 119.01 ? 1006 ASN B CB    1 
ATOM   6810  C  CG    . ASN B 1 252 ? -41.917 137.835 4.182   1.00 126.03 ? 1006 ASN B CG    1 
ATOM   6811  O  OD1   . ASN B 1 252 ? -41.902 136.624 3.986   1.00 131.09 ? 1006 ASN B OD1   1 
ATOM   6812  N  ND2   . ASN B 1 252 ? -42.444 138.375 5.274   1.00 125.78 ? 1006 ASN B ND2   1 
ATOM   6813  N  N     . MET B 1 253 ? -38.289 139.244 2.133   1.00 88.68  ? 1007 MET B N     1 
ATOM   6814  C  CA    . MET B 1 253 ? -37.427 139.549 1.005   1.00 87.98  ? 1007 MET B CA    1 
ATOM   6815  C  C     . MET B 1 253 ? -37.390 138.225 0.245   1.00 93.08  ? 1007 MET B C     1 
ATOM   6816  O  O     . MET B 1 253 ? -37.438 137.161 0.864   1.00 93.47  ? 1007 MET B O     1 
ATOM   6817  C  CB    . MET B 1 253 ? -36.003 139.937 1.486   1.00 120.02 ? 1007 MET B CB    1 
ATOM   6818  C  CG    . MET B 1 253 ? -35.575 141.443 1.457   1.00 64.66  ? 1007 MET B CG    1 
ATOM   6819  N  N     . SER B 1 254 ? -37.332 138.274 -1.083  1.00 93.70  ? 1008 SER B N     1 
ATOM   6820  C  CA    . SER B 1 254 ? -37.106 137.060 -1.874  1.00 89.70  ? 1008 SER B CA    1 
ATOM   6821  C  C     . SER B 1 254 ? -35.635 136.630 -1.803  1.00 78.73  ? 1008 SER B C     1 
ATOM   6822  O  O     . SER B 1 254 ? -34.754 137.466 -1.610  1.00 74.88  ? 1008 SER B O     1 
ATOM   6823  C  CB    . SER B 1 254 ? -37.503 137.294 -3.334  1.00 91.74  ? 1008 SER B CB    1 
ATOM   6824  O  OG    . SER B 1 254 ? -36.766 138.373 -3.891  1.00 91.36  ? 1008 SER B OG    1 
ATOM   6825  N  N     . LEU B 1 255 ? -35.361 135.336 -1.961  1.00 74.43  ? 1009 LEU B N     1 
ATOM   6826  C  CA    . LEU B 1 255 ? -33.972 134.889 -2.093  1.00 74.19  ? 1009 LEU B CA    1 
ATOM   6827  C  C     . LEU B 1 255 ? -33.249 135.581 -3.268  1.00 84.35  ? 1009 LEU B C     1 
ATOM   6828  O  O     . LEU B 1 255 ? -32.100 136.016 -3.118  1.00 79.53  ? 1009 LEU B O     1 
ATOM   6829  C  CB    . LEU B 1 255 ? -33.871 133.365 -2.223  1.00 62.56  ? 1009 LEU B CB    1 
ATOM   6830  C  CG    . LEU B 1 255 ? -32.429 132.866 -2.384  1.00 67.10  ? 1009 LEU B CG    1 
ATOM   6831  C  CD1   . LEU B 1 255 ? -31.706 132.943 -1.054  1.00 69.06  ? 1009 LEU B CD1   1 
ATOM   6832  C  CD2   . LEU B 1 255 ? -32.363 131.457 -2.914  1.00 68.68  ? 1009 LEU B CD2   1 
ATOM   6833  N  N     . GLU B 1 256 ? -33.915 135.681 -4.427  1.00 94.21  ? 1010 GLU B N     1 
ATOM   6834  C  CA    . GLU B 1 256 ? -33.334 136.364 -5.586  1.00 87.11  ? 1010 GLU B CA    1 
ATOM   6835  C  C     . GLU B 1 256 ? -32.998 137.801 -5.210  1.00 88.98  ? 1010 GLU B C     1 
ATOM   6836  O  O     . GLU B 1 256 ? -31.845 138.224 -5.316  1.00 90.31  ? 1010 GLU B O     1 
ATOM   6837  C  CB    . GLU B 1 256 ? -34.265 136.332 -6.804  1.00 81.84  ? 1010 GLU B CB    1 
ATOM   6838  N  N     . ASP B 1 257 ? -33.998 138.543 -4.744  1.00 85.56  ? 1011 ASP B N     1 
ATOM   6839  C  CA    . ASP B 1 257 ? -33.772 139.934 -4.364  1.00 78.74  ? 1011 ASP B CA    1 
ATOM   6840  C  C     . ASP B 1 257 ? -32.685 140.110 -3.270  1.00 83.32  ? 1011 ASP B C     1 
ATOM   6841  O  O     . ASP B 1 257 ? -31.793 140.949 -3.413  1.00 76.50  ? 1011 ASP B O     1 
ATOM   6842  C  CB    . ASP B 1 257 ? -35.095 140.632 -4.017  1.00 67.38  ? 1011 ASP B CB    1 
ATOM   6843  N  N     . ILE B 1 258 ? -32.720 139.318 -2.199  1.00 85.37  ? 1012 ILE B N     1 
ATOM   6844  C  CA    . ILE B 1 258 ? -31.694 139.474 -1.166  1.00 86.09  ? 1012 ILE B CA    1 
ATOM   6845  C  C     . ILE B 1 258 ? -30.307 139.228 -1.729  1.00 79.65  ? 1012 ILE B C     1 
ATOM   6846  O  O     . ILE B 1 258 ? -29.431 140.086 -1.625  1.00 80.34  ? 1012 ILE B O     1 
ATOM   6847  C  CB    . ILE B 1 258 ? -31.866 138.543 0.053   1.00 94.41  ? 1012 ILE B CB    1 
ATOM   6848  C  CG1   . ILE B 1 258 ? -33.244 138.691 0.671   1.00 108.18 ? 1012 ILE B CG1   1 
ATOM   6849  C  CG2   . ILE B 1 258 ? -30.806 138.854 1.126   1.00 87.41  ? 1012 ILE B CG2   1 
ATOM   6850  C  CD1   . ILE B 1 258 ? -33.433 137.771 1.858   1.00 117.64 ? 1012 ILE B CD1   1 
ATOM   6851  N  N     . MET B 1 259 ? -30.096 138.045 -2.298  1.00 75.92  ? 1013 MET B N     1 
ATOM   6852  C  CA    . MET B 1 259 ? -28.779 137.711 -2.836  1.00 76.04  ? 1013 MET B CA    1 
ATOM   6853  C  C     . MET B 1 259 ? -28.272 138.801 -3.779  1.00 81.42  ? 1013 MET B C     1 
ATOM   6854  O  O     . MET B 1 259 ? -27.106 139.198 -3.727  1.00 81.53  ? 1013 MET B O     1 
ATOM   6855  C  CB    . MET B 1 259 ? -28.813 136.365 -3.545  1.00 68.78  ? 1013 MET B CB    1 
ATOM   6856  C  CG    . MET B 1 259 ? -28.854 135.195 -2.597  1.00 60.60  ? 1013 MET B CG    1 
ATOM   6857  S  SD    . MET B 1 259 ? -27.211 134.695 -2.068  1.00 111.22 ? 1013 MET B SD    1 
ATOM   6858  C  CE    . MET B 1 259 ? -26.575 133.796 -3.499  1.00 63.20  ? 1013 MET B CE    1 
ATOM   6859  N  N     . GLY B 1 260 ? -29.161 139.286 -4.636  1.00 80.45  ? 1014 GLY B N     1 
ATOM   6860  C  CA    . GLY B 1 260 ? -28.839 140.410 -5.489  1.00 75.14  ? 1014 GLY B CA    1 
ATOM   6861  C  C     . GLY B 1 260 ? -28.279 141.577 -4.701  1.00 76.27  ? 1014 GLY B C     1 
ATOM   6862  O  O     . GLY B 1 260 ? -27.185 142.062 -5.005  1.00 79.48  ? 1014 GLY B O     1 
ATOM   6863  N  N     . GLU B 1 261 ? -29.023 142.014 -3.681  1.00 77.12  ? 1015 GLU B N     1 
ATOM   6864  C  CA    . GLU B 1 261 ? -28.659 143.197 -2.894  1.00 71.33  ? 1015 GLU B CA    1 
ATOM   6865  C  C     . GLU B 1 261 ? -27.420 143.010 -2.012  1.00 72.01  ? 1015 GLU B C     1 
ATOM   6866  O  O     . GLU B 1 261 ? -26.592 143.908 -1.926  1.00 72.97  ? 1015 GLU B O     1 
ATOM   6867  C  CB    . GLU B 1 261 ? -29.840 143.693 -2.059  1.00 70.40  ? 1015 GLU B CB    1 
ATOM   6868  C  CG    . GLU B 1 261 ? -29.806 145.195 -1.761  1.00 86.26  ? 1015 GLU B CG    1 
ATOM   6869  C  CD    . GLU B 1 261 ? -28.942 145.555 -0.561  1.00 102.47 ? 1015 GLU B CD    1 
ATOM   6870  O  OE1   . GLU B 1 261 ? -28.839 144.724 0.369   1.00 111.25 ? 1015 GLU B OE1   1 
ATOM   6871  O  OE2   . GLU B 1 261 ? -28.370 146.671 -0.542  1.00 103.67 ? 1015 GLU B OE2   1 
ATOM   6872  N  N     . ARG B 1 262 ? -27.282 141.856 -1.365  1.00 73.85  ? 1016 ARG B N     1 
ATOM   6873  C  CA    . ARG B 1 262 ? -26.119 141.628 -0.514  1.00 73.85  ? 1016 ARG B CA    1 
ATOM   6874  C  C     . ARG B 1 262 ? -24.841 141.465 -1.334  1.00 75.90  ? 1016 ARG B C     1 
ATOM   6875  O  O     . ARG B 1 262 ? -23.830 142.124 -1.066  1.00 76.58  ? 1016 ARG B O     1 
ATOM   6876  C  CB    . ARG B 1 262 ? -26.328 140.434 0.418   1.00 73.12  ? 1016 ARG B CB    1 
ATOM   6877  C  CG    . ARG B 1 262 ? -27.357 140.685 1.520   1.00 69.56  ? 1016 ARG B CG    1 
ATOM   6878  C  CD    . ARG B 1 262 ? -27.118 142.022 2.185   1.00 70.76  ? 1016 ARG B CD    1 
ATOM   6879  N  NE    . ARG B 1 262 ? -27.918 142.217 3.395   1.00 76.24  ? 1016 ARG B NE    1 
ATOM   6880  C  CZ    . ARG B 1 262 ? -29.218 142.497 3.407   1.00 84.09  ? 1016 ARG B CZ    1 
ATOM   6881  N  NH1   . ARG B 1 262 ? -29.900 142.595 2.268   1.00 85.78  ? 1016 ARG B NH1   1 
ATOM   6882  N  NH2   . ARG B 1 262 ? -29.845 142.660 4.563   1.00 82.42  ? 1016 ARG B NH2   1 
ATOM   6883  N  N     . PHE B 1 263 ? -24.874 140.607 -2.345  1.00 76.23  ? 1017 PHE B N     1 
ATOM   6884  C  CA    . PHE B 1 263 ? -23.678 140.431 -3.157  1.00 72.98  ? 1017 PHE B CA    1 
ATOM   6885  C  C     . PHE B 1 263 ? -23.298 141.704 -3.919  1.00 74.41  ? 1017 PHE B C     1 
ATOM   6886  O  O     . PHE B 1 263 ? -22.110 141.988 -4.119  1.00 77.04  ? 1017 PHE B O     1 
ATOM   6887  C  CB    . PHE B 1 263 ? -23.799 139.249 -4.115  1.00 65.12  ? 1017 PHE B CB    1 
ATOM   6888  C  CG    . PHE B 1 263 ? -22.497 138.871 -4.748  1.00 65.96  ? 1017 PHE B CG    1 
ATOM   6889  C  CD1   . PHE B 1 263 ? -21.643 137.967 -4.120  1.00 65.19  ? 1017 PHE B CD1   1 
ATOM   6890  C  CD2   . PHE B 1 263 ? -22.104 139.448 -5.952  1.00 67.84  ? 1017 PHE B CD2   1 
ATOM   6891  C  CE1   . PHE B 1 263 ? -20.426 137.628 -4.686  1.00 68.05  ? 1017 PHE B CE1   1 
ATOM   6892  C  CE2   . PHE B 1 263 ? -20.893 139.117 -6.531  1.00 71.24  ? 1017 PHE B CE2   1 
ATOM   6893  C  CZ    . PHE B 1 263 ? -20.051 138.205 -5.903  1.00 73.70  ? 1017 PHE B CZ    1 
ATOM   6894  N  N     . GLY B 1 264 ? -24.310 142.456 -4.348  1.00 82.45  ? 1018 GLY B N     1 
ATOM   6895  C  CA    . GLY B 1 264 ? -24.093 143.744 -4.985  1.00 73.05  ? 1018 GLY B CA    1 
ATOM   6896  C  C     . GLY B 1 264 ? -23.260 144.686 -4.127  1.00 79.21  ? 1018 GLY B C     1 
ATOM   6897  O  O     . GLY B 1 264 ? -22.364 145.366 -4.634  1.00 77.22  ? 1018 GLY B O     1 
ATOM   6898  N  N     . ARG B 1 265 ? -23.557 144.723 -2.824  1.00 82.32  ? 1019 ARG B N     1 
ATOM   6899  C  CA    . ARG B 1 265 ? -22.831 145.564 -1.875  1.00 72.45  ? 1019 ARG B CA    1 
ATOM   6900  C  C     . ARG B 1 265 ? -21.379 145.101 -1.786  1.00 72.69  ? 1019 ARG B C     1 
ATOM   6901  O  O     . ARG B 1 265 ? -20.455 145.897 -1.965  1.00 69.55  ? 1019 ARG B O     1 
ATOM   6902  C  CB    . ARG B 1 265 ? -23.484 145.530 -0.484  1.00 81.37  ? 1019 ARG B CB    1 
ATOM   6903  C  CG    . ARG B 1 265 ? -24.794 146.321 -0.326  1.00 79.15  ? 1019 ARG B CG    1 
ATOM   6904  N  N     . TYR B 1 266 ? -21.186 143.810 -1.514  1.00 74.61  ? 1020 TYR B N     1 
ATOM   6905  C  CA    . TYR B 1 266 ? -19.843 143.236 -1.396  1.00 72.76  ? 1020 TYR B CA    1 
ATOM   6906  C  C     . TYR B 1 266 ? -19.014 143.497 -2.650  1.00 69.75  ? 1020 TYR B C     1 
ATOM   6907  O  O     . TYR B 1 266 ? -17.915 144.047 -2.557  1.00 62.92  ? 1020 TYR B O     1 
ATOM   6908  C  CB    . TYR B 1 266 ? -19.929 141.734 -1.120  1.00 77.40  ? 1020 TYR B CB    1 
ATOM   6909  C  CG    . TYR B 1 266 ? -18.594 141.031 -0.943  1.00 85.24  ? 1020 TYR B CG    1 
ATOM   6910  C  CD1   . TYR B 1 266 ? -17.848 141.193 0.219   1.00 94.52  ? 1020 TYR B CD1   1 
ATOM   6911  C  CD2   . TYR B 1 266 ? -18.101 140.169 -1.921  1.00 87.95  ? 1020 TYR B CD2   1 
ATOM   6912  C  CE1   . TYR B 1 266 ? -16.630 140.534 0.394   1.00 100.88 ? 1020 TYR B CE1   1 
ATOM   6913  C  CE2   . TYR B 1 266 ? -16.887 139.509 -1.760  1.00 91.91  ? 1020 TYR B CE2   1 
ATOM   6914  C  CZ    . TYR B 1 266 ? -16.153 139.695 -0.597  1.00 97.49  ? 1020 TYR B CZ    1 
ATOM   6915  O  OH    . TYR B 1 266 ? -14.947 139.041 -0.425  1.00 94.40  ? 1020 TYR B OH    1 
ATOM   6916  N  N     . SER B 1 267 ? -19.553 143.088 -3.806  1.00 69.85  ? 1021 SER B N     1 
ATOM   6917  C  CA    . SER B 1 267 ? -18.926 143.289 -5.118  1.00 62.95  ? 1021 SER B CA    1 
ATOM   6918  C  C     . SER B 1 267 ? -18.421 144.734 -5.293  1.00 63.39  ? 1021 SER B C     1 
ATOM   6919  O  O     . SER B 1 267 ? -17.214 144.978 -5.416  1.00 56.39  ? 1021 SER B O     1 
ATOM   6920  C  CB    . SER B 1 267 ? -19.903 142.905 -6.253  1.00 51.59  ? 1021 SER B CB    1 
ATOM   6921  N  N     . LYS B 1 268 ? -19.349 145.686 -5.292  1.00 62.56  ? 1022 LYS B N     1 
ATOM   6922  C  CA    . LYS B 1 268 ? -18.996 147.090 -5.444  1.00 57.61  ? 1022 LYS B CA    1 
ATOM   6923  C  C     . LYS B 1 268 ? -17.852 147.475 -4.525  1.00 57.41  ? 1022 LYS B C     1 
ATOM   6924  O  O     . LYS B 1 268 ? -16.829 148.008 -4.971  1.00 62.53  ? 1022 LYS B O     1 
ATOM   6925  C  CB    . LYS B 1 268 ? -20.198 147.995 -5.171  1.00 57.13  ? 1022 LYS B CB    1 
ATOM   6926  C  CG    . LYS B 1 268 ? -19.886 149.474 -5.350  1.00 52.10  ? 1022 LYS B CG    1 
ATOM   6927  C  CD    . LYS B 1 268 ? -21.142 150.293 -5.292  1.00 58.02  ? 1022 LYS B CD    1 
ATOM   6928  C  CE    . LYS B 1 268 ? -20.832 151.733 -5.619  1.00 74.68  ? 1022 LYS B CE    1 
ATOM   6929  N  NZ    . LYS B 1 268 ? -22.055 152.583 -5.581  1.00 89.77  ? 1022 LYS B NZ    1 
ATOM   6930  N  N     . TYR B 1 269 ? -18.038 147.192 -3.243  1.00 63.24  ? 1023 TYR B N     1 
ATOM   6931  C  CA    . TYR B 1 269 ? -17.049 147.505 -2.209  1.00 59.59  ? 1023 TYR B CA    1 
ATOM   6932  C  C     . TYR B 1 269 ? -15.653 146.920 -2.440  1.00 60.01  ? 1023 TYR B C     1 
ATOM   6933  O  O     . TYR B 1 269 ? -14.673 147.675 -2.461  1.00 65.47  ? 1023 TYR B O     1 
ATOM   6934  C  CB    . TYR B 1 269 ? -17.560 147.108 -0.818  1.00 61.50  ? 1023 TYR B CB    1 
ATOM   6935  C  CG    . TYR B 1 269 ? -16.732 147.689 0.295   1.00 58.36  ? 1023 TYR B CG    1 
ATOM   6936  C  CD1   . TYR B 1 269 ? -15.608 147.029 0.760   1.00 61.30  ? 1023 TYR B CD1   1 
ATOM   6937  C  CD2   . TYR B 1 269 ? -17.062 148.904 0.870   1.00 61.66  ? 1023 TYR B CD2   1 
ATOM   6938  C  CE1   . TYR B 1 269 ? -14.836 147.552 1.774   1.00 76.42  ? 1023 TYR B CE1   1 
ATOM   6939  C  CE2   . TYR B 1 269 ? -16.280 149.454 1.889   1.00 69.16  ? 1023 TYR B CE2   1 
ATOM   6940  C  CZ    . TYR B 1 269 ? -15.169 148.767 2.338   1.00 81.06  ? 1023 TYR B CZ    1 
ATOM   6941  O  OH    . TYR B 1 269 ? -14.389 149.280 3.359   1.00 87.10  ? 1023 TYR B OH    1 
ATOM   6942  N  N     . ILE B 1 270 ? -15.525 145.601 -2.600  1.00 57.11  ? 1024 ILE B N     1 
ATOM   6943  C  CA    . ILE B 1 270 ? -14.164 145.086 -2.758  1.00 59.45  ? 1024 ILE B CA    1 
ATOM   6944  C  C     . ILE B 1 270 ? -13.556 145.457 -4.083  1.00 59.29  ? 1024 ILE B C     1 
ATOM   6945  O  O     . ILE B 1 270 ? -12.336 145.439 -4.225  1.00 68.94  ? 1024 ILE B O     1 
ATOM   6946  C  CB    . ILE B 1 270 ? -13.983 143.589 -2.495  1.00 58.26  ? 1024 ILE B CB    1 
ATOM   6947  C  CG1   . ILE B 1 270 ? -14.726 142.762 -3.542  1.00 63.76  ? 1024 ILE B CG1   1 
ATOM   6948  C  CG2   . ILE B 1 270 ? -14.364 143.272 -1.063  1.00 58.99  ? 1024 ILE B CG2   1 
ATOM   6949  C  CD1   . ILE B 1 270 ? -14.712 141.256 -3.269  1.00 69.43  ? 1024 ILE B CD1   1 
ATOM   6950  N  N     . ILE B 1 271 ? -14.391 145.815 -5.048  1.00 53.61  ? 1025 ILE B N     1 
ATOM   6951  C  CA    . ILE B 1 271 ? -13.856 146.364 -6.293  1.00 52.79  ? 1025 ILE B CA    1 
ATOM   6952  C  C     . ILE B 1 271 ? -13.290 147.766 -6.099  1.00 54.48  ? 1025 ILE B C     1 
ATOM   6953  O  O     . ILE B 1 271 ? -12.085 147.973 -6.259  1.00 62.97  ? 1025 ILE B O     1 
ATOM   6954  C  CB    . ILE B 1 271 ? -14.872 146.355 -7.434  1.00 50.32  ? 1025 ILE B CB    1 
ATOM   6955  C  CG1   . ILE B 1 271 ? -15.208 144.914 -7.819  1.00 47.71  ? 1025 ILE B CG1   1 
ATOM   6956  C  CG2   . ILE B 1 271 ? -14.318 147.114 -8.653  1.00 47.89  ? 1025 ILE B CG2   1 
ATOM   6957  C  CD1   . ILE B 1 271 ? -16.389 144.827 -8.743  1.00 50.08  ? 1025 ILE B CD1   1 
ATOM   6958  N  N     . GLN B 1 272 ? -14.125 148.732 -5.728  1.00 50.77  ? 1026 GLN B N     1 
ATOM   6959  C  CA    . GLN B 1 272 ? -13.596 150.100 -5.610  1.00 60.30  ? 1026 GLN B CA    1 
ATOM   6960  C  C     . GLN B 1 272 ? -12.806 150.455 -4.330  1.00 65.49  ? 1026 GLN B C     1 
ATOM   6961  O  O     . GLN B 1 272 ? -11.996 151.397 -4.356  1.00 64.52  ? 1026 GLN B O     1 
ATOM   6962  C  CB    . GLN B 1 272 ? -14.650 151.164 -5.952  1.00 60.56  ? 1026 GLN B CB    1 
ATOM   6963  C  CG    . GLN B 1 272 ? -15.900 151.091 -5.132  1.00 72.43  ? 1026 GLN B CG    1 
ATOM   6964  C  CD    . GLN B 1 272 ? -17.015 151.908 -5.736  1.00 72.62  ? 1026 GLN B CD    1 
ATOM   6965  O  OE1   . GLN B 1 272 ? -17.002 152.208 -6.935  1.00 65.66  ? 1026 GLN B OE1   1 
ATOM   6966  N  NE2   . GLN B 1 272 ? -17.985 152.287 -4.908  1.00 71.93  ? 1026 GLN B NE2   1 
ATOM   6967  N  N     . ASP B 1 273 ? -12.993 149.688 -3.249  1.00 67.58  ? 1027 ASP B N     1 
ATOM   6968  C  CA    . ASP B 1 273 ? -12.383 150.024 -1.949  1.00 63.88  ? 1027 ASP B CA    1 
ATOM   6969  C  C     . ASP B 1 273 ? -11.628 148.926 -1.196  1.00 61.45  ? 1027 ASP B C     1 
ATOM   6970  O  O     . ASP B 1 273 ? -11.635 148.923 0.045   1.00 68.34  ? 1027 ASP B O     1 
ATOM   6971  C  CB    . ASP B 1 273 ? -13.448 150.564 -1.003  1.00 76.81  ? 1027 ASP B CB    1 
ATOM   6972  C  CG    . ASP B 1 273 ? -13.828 151.977 -1.313  1.00 92.58  ? 1027 ASP B CG    1 
ATOM   6973  O  OD1   . ASP B 1 273 ? -12.905 152.823 -1.448  1.00 99.11  ? 1027 ASP B OD1   1 
ATOM   6974  O  OD2   . ASP B 1 273 ? -15.050 152.233 -1.432  1.00 99.06  ? 1027 ASP B OD2   1 
ATOM   6975  N  N     . ARG B 1 274 ? -10.988 147.998 -1.905  1.00 56.41  ? 1028 ARG B N     1 
ATOM   6976  C  CA    . ARG B 1 274 ? -10.168 146.983 -1.228  1.00 58.89  ? 1028 ARG B CA    1 
ATOM   6977  C  C     . ARG B 1 274 ? -9.061  146.485 -2.140  1.00 59.85  ? 1028 ARG B C     1 
ATOM   6978  O  O     . ARG B 1 274 ? -7.877  146.839 -1.974  1.00 52.52  ? 1028 ARG B O     1 
ATOM   6979  C  CB    . ARG B 1 274 ? -11.014 145.776 -0.757  1.00 59.19  ? 1028 ARG B CB    1 
ATOM   6980  C  CG    . ARG B 1 274 ? -10.444 144.963 0.445   1.00 53.33  ? 1028 ARG B CG    1 
ATOM   6981  C  CD    . ARG B 1 274 ? -10.915 143.491 0.417   1.00 65.91  ? 1028 ARG B CD    1 
ATOM   6982  N  NE    . ARG B 1 274 ? -12.053 143.088 1.275   1.00 69.20  ? 1028 ARG B NE    1 
ATOM   6983  C  CZ    . ARG B 1 274 ? -12.629 143.828 2.223   1.00 67.43  ? 1028 ARG B CZ    1 
ATOM   6984  N  NH1   . ARG B 1 274 ? -12.217 145.057 2.491   1.00 66.09  ? 1028 ARG B NH1   1 
ATOM   6985  N  NH2   . ARG B 1 274 ? -13.638 143.333 2.911   1.00 62.65  ? 1028 ARG B NH2   1 
ATOM   6986  N  N     . ALA B 1 275 ? -9.463  145.672 -3.116  1.00 60.51  ? 1029 ALA B N     1 
ATOM   6987  C  CA    . ALA B 1 275 ? -8.524  144.861 -3.881  1.00 55.93  ? 1029 ALA B CA    1 
ATOM   6988  C  C     . ALA B 1 275 ? -7.803  145.530 -5.061  1.00 54.17  ? 1029 ALA B C     1 
ATOM   6989  O  O     . ALA B 1 275 ? -6.688  145.132 -5.383  1.00 59.17  ? 1029 ALA B O     1 
ATOM   6990  C  CB    . ALA B 1 275 ? -9.199  143.600 -4.330  1.00 50.73  ? 1029 ALA B CB    1 
ATOM   6991  N  N     . LEU B 1 276 ? -8.421  146.522 -5.703  1.00 48.17  ? 1030 LEU B N     1 
ATOM   6992  C  CA    . LEU B 1 276 ? -7.795  147.183 -6.863  1.00 47.48  ? 1030 LEU B CA    1 
ATOM   6993  C  C     . LEU B 1 276 ? -7.306  148.618 -6.593  1.00 56.96  ? 1030 LEU B C     1 
ATOM   6994  O  O     . LEU B 1 276 ? -8.003  149.413 -5.954  1.00 70.12  ? 1030 LEU B O     1 
ATOM   6995  C  CB    . LEU B 1 276 ? -8.764  147.200 -8.043  1.00 44.25  ? 1030 LEU B CB    1 
ATOM   6996  C  CG    . LEU B 1 276 ? -9.495  145.880 -8.226  1.00 41.41  ? 1030 LEU B CG    1 
ATOM   6997  C  CD1   . LEU B 1 276 ? -10.640 146.053 -9.201  1.00 39.57  ? 1030 LEU B CD1   1 
ATOM   6998  C  CD2   . LEU B 1 276 ? -8.509  144.865 -8.714  1.00 45.84  ? 1030 LEU B CD2   1 
ATOM   6999  N  N     . PRO B 1 277 ? -6.120  148.961 -7.120  1.00 50.69  ? 1031 PRO B N     1 
ATOM   7000  C  CA    . PRO B 1 277 ? -5.467  150.264 -6.940  1.00 49.42  ? 1031 PRO B CA    1 
ATOM   7001  C  C     . PRO B 1 277 ? -6.150  151.376 -7.755  1.00 51.52  ? 1031 PRO B C     1 
ATOM   7002  O  O     . PRO B 1 277 ? -6.767  151.091 -8.779  1.00 51.31  ? 1031 PRO B O     1 
ATOM   7003  C  CB    . PRO B 1 277 ? -4.074  150.011 -7.506  1.00 45.63  ? 1031 PRO B CB    1 
ATOM   7004  C  CG    . PRO B 1 277 ? -4.333  149.054 -8.651  1.00 41.36  ? 1031 PRO B CG    1 
ATOM   7005  C  CD    . PRO B 1 277 ? -5.434  148.140 -8.137  1.00 45.73  ? 1031 PRO B CD    1 
ATOM   7006  N  N     . ASP B 1 278 ? -6.055  152.620 -7.297  1.00 50.29  ? 1032 ASP B N     1 
ATOM   7007  C  CA    . ASP B 1 278 ? -6.575  153.760 -8.040  1.00 54.79  ? 1032 ASP B CA    1 
ATOM   7008  C  C     . ASP B 1 278 ? -5.570  153.961 -9.151  1.00 60.93  ? 1032 ASP B C     1 
ATOM   7009  O  O     . ASP B 1 278 ? -4.371  153.778 -8.923  1.00 59.01  ? 1032 ASP B O     1 
ATOM   7010  C  CB    . ASP B 1 278 ? -6.651  155.023 -7.165  1.00 52.91  ? 1032 ASP B CB    1 
ATOM   7011  C  CG    . ASP B 1 278 ? -7.105  156.270 -7.944  1.00 67.57  ? 1032 ASP B CG    1 
ATOM   7012  O  OD1   . ASP B 1 278 ? -6.262  156.929 -8.592  1.00 70.38  ? 1032 ASP B OD1   1 
ATOM   7013  O  OD2   . ASP B 1 278 ? -8.304  156.607 -7.904  1.00 74.30  ? 1032 ASP B OD2   1 
ATOM   7014  N  N     . ILE B 1 279 ? -6.046  154.343 -10.341 1.00 60.62  ? 1033 ILE B N     1 
ATOM   7015  C  CA    . ILE B 1 279 ? -5.184  154.404 -11.502 1.00 54.67  ? 1033 ILE B CA    1 
ATOM   7016  C  C     . ILE B 1 279 ? -4.260  155.612 -11.460 1.00 58.37  ? 1033 ILE B C     1 
ATOM   7017  O  O     . ILE B 1 279 ? -3.336  155.718 -12.263 1.00 68.90  ? 1033 ILE B O     1 
ATOM   7018  C  CB    . ILE B 1 279 ? -5.975  154.435 -12.796 1.00 56.91  ? 1033 ILE B CB    1 
ATOM   7019  C  CG1   . ILE B 1 279 ? -5.035  154.161 -13.976 1.00 59.93  ? 1033 ILE B CG1   1 
ATOM   7020  C  CG2   . ILE B 1 279 ? -6.637  155.784 -12.967 1.00 59.95  ? 1033 ILE B CG2   1 
ATOM   7021  C  CD1   . ILE B 1 279 ? -5.695  154.258 -15.338 1.00 57.50  ? 1033 ILE B CD1   1 
ATOM   7022  N  N     . ARG B 1 280 ? -4.482  156.515 -10.516 1.00 51.43  ? 1034 ARG B N     1 
ATOM   7023  C  CA    . ARG B 1 280 ? -3.631  157.698 -10.428 1.00 48.34  ? 1034 ARG B CA    1 
ATOM   7024  C  C     . ARG B 1 280 ? -2.428  157.610 -9.494  1.00 45.70  ? 1034 ARG B C     1 
ATOM   7025  O  O     . ARG B 1 280 ? -1.345  158.057 -9.844  1.00 57.16  ? 1034 ARG B O     1 
ATOM   7026  C  CB    . ARG B 1 280 ? -4.467  158.914 -10.085 1.00 46.52  ? 1034 ARG B CB    1 
ATOM   7027  C  CG    . ARG B 1 280 ? -5.544  159.143 -11.091 1.00 40.62  ? 1034 ARG B CG    1 
ATOM   7028  C  CD    . ARG B 1 280 ? -6.556  160.104 -10.551 1.00 41.02  ? 1034 ARG B CD    1 
ATOM   7029  N  NE    . ARG B 1 280 ? -7.332  159.494 -9.482  1.00 53.33  ? 1034 ARG B NE    1 
ATOM   7030  C  CZ    . ARG B 1 280 ? -8.339  160.115 -8.885  1.00 51.06  ? 1034 ARG B CZ    1 
ATOM   7031  N  NH1   . ARG B 1 280 ? -8.670  161.334 -9.302  1.00 53.49  ? 1034 ARG B NH1   1 
ATOM   7032  N  NH2   . ARG B 1 280 ? -9.008  159.533 -7.901  1.00 43.06  ? 1034 ARG B NH2   1 
ATOM   7033  N  N     . ASP B 1 281 ? -2.597  157.044 -8.310  1.00 41.87  ? 1035 ASP B N     1 
ATOM   7034  C  CA    . ASP B 1 281 ? -1.484  156.982 -7.360  1.00 44.05  ? 1035 ASP B CA    1 
ATOM   7035  C  C     . ASP B 1 281 ? -1.045  155.536 -7.155  1.00 51.45  ? 1035 ASP B C     1 
ATOM   7036  O  O     . ASP B 1 281 ? -0.023  155.255 -6.508  1.00 54.14  ? 1035 ASP B O     1 
ATOM   7037  C  CB    . ASP B 1 281 ? -1.839  157.668 -6.033  1.00 42.80  ? 1035 ASP B CB    1 
ATOM   7038  C  CG    . ASP B 1 281 ? -3.038  157.024 -5.326  1.00 56.71  ? 1035 ASP B CG    1 
ATOM   7039  O  OD1   . ASP B 1 281 ? -3.200  155.795 -5.457  1.00 59.09  ? 1035 ASP B OD1   1 
ATOM   7040  O  OD2   . ASP B 1 281 ? -3.814  157.746 -4.639  1.00 56.26  ? 1035 ASP B OD2   1 
ATOM   7041  N  N     . GLY B 1 282 ? -1.808  154.617 -7.737  1.00 47.26  ? 1036 GLY B N     1 
ATOM   7042  C  CA    . GLY B 1 282 ? -1.426  153.221 -7.731  1.00 48.69  ? 1036 GLY B CA    1 
ATOM   7043  C  C     . GLY B 1 282 ? -1.581  152.551 -6.385  1.00 52.71  ? 1036 GLY B C     1 
ATOM   7044  O  O     . GLY B 1 282 ? -1.053  151.465 -6.163  1.00 64.18  ? 1036 GLY B O     1 
ATOM   7045  N  N     . LEU B 1 283 ? -2.321  153.190 -5.488  1.00 48.89  ? 1037 LEU B N     1 
ATOM   7046  C  CA    . LEU B 1 283 ? -2.526  152.663 -4.137  1.00 42.13  ? 1037 LEU B CA    1 
ATOM   7047  C  C     . LEU B 1 283 ? -3.903  152.036 -3.963  1.00 42.88  ? 1037 LEU B C     1 
ATOM   7048  O  O     . LEU B 1 283 ? -4.877  152.489 -4.563  1.00 46.57  ? 1037 LEU B O     1 
ATOM   7049  C  CB    . LEU B 1 283 ? -2.315  153.773 -3.108  1.00 37.78  ? 1037 LEU B CB    1 
ATOM   7050  C  CG    . LEU B 1 283 ? -0.886  154.281 -3.224  1.00 42.49  ? 1037 LEU B CG    1 
ATOM   7051  C  CD1   . LEU B 1 283 ? -0.617  155.498 -2.383  1.00 40.80  ? 1037 LEU B CD1   1 
ATOM   7052  C  CD2   . LEU B 1 283 ? 0.039   153.150 -2.842  1.00 44.32  ? 1037 LEU B CD2   1 
ATOM   7053  N  N     . LYS B 1 284 ? -3.961  150.970 -3.168  1.00 39.84  ? 1038 LYS B N     1 
ATOM   7054  C  CA    . LYS B 1 284 ? -5.219  150.457 -2.640  1.00 37.69  ? 1038 LYS B CA    1 
ATOM   7055  C  C     . LYS B 1 284 ? -5.564  151.309 -1.421  1.00 47.31  ? 1038 LYS B C     1 
ATOM   7056  O  O     . LYS B 1 284 ? -4.678  151.917 -0.826  1.00 53.31  ? 1038 LYS B O     1 
ATOM   7057  C  CB    . LYS B 1 284 ? -5.045  149.002 -2.235  1.00 42.20  ? 1038 LYS B CB    1 
ATOM   7058  C  CG    . LYS B 1 284 ? -4.832  148.038 -3.407  1.00 47.21  ? 1038 LYS B CG    1 
ATOM   7059  C  CD    . LYS B 1 284 ? -4.025  146.821 -2.982  1.00 47.65  ? 1038 LYS B CD    1 
ATOM   7060  C  CE    . LYS B 1 284 ? -4.227  145.656 -3.946  1.00 49.88  ? 1038 LYS B CE    1 
ATOM   7061  N  NZ    . LYS B 1 284 ? -3.220  144.555 -3.738  1.00 49.88  ? 1038 LYS B NZ    1 
ATOM   7062  N  N     . PRO B 1 285 ? -6.848  151.375 -1.044  1.00 48.55  ? 1039 PRO B N     1 
ATOM   7063  C  CA    . PRO B 1 285 ? -7.210  152.295 0.049   1.00 52.23  ? 1039 PRO B CA    1 
ATOM   7064  C  C     . PRO B 1 285 ? -6.429  152.048 1.350   1.00 55.10  ? 1039 PRO B C     1 
ATOM   7065  O  O     . PRO B 1 285 ? -6.032  153.000 2.033   1.00 59.38  ? 1039 PRO B O     1 
ATOM   7066  C  CB    . PRO B 1 285 ? -8.705  152.035 0.255   1.00 46.86  ? 1039 PRO B CB    1 
ATOM   7067  C  CG    . PRO B 1 285 ? -9.180  151.460 -1.069  1.00 43.46  ? 1039 PRO B CG    1 
ATOM   7068  C  CD    . PRO B 1 285 ? -8.009  150.635 -1.560  1.00 46.87  ? 1039 PRO B CD    1 
ATOM   7069  N  N     . VAL B 1 286 ? -6.183  150.793 1.693   1.00 48.84  ? 1040 VAL B N     1 
ATOM   7070  C  CA    . VAL B 1 286 ? -5.379  150.557 2.891   1.00 47.65  ? 1040 VAL B CA    1 
ATOM   7071  C  C     . VAL B 1 286 ? -3.968  151.134 2.786   1.00 47.74  ? 1040 VAL B C     1 
ATOM   7072  O  O     . VAL B 1 286 ? -3.408  151.584 3.783   1.00 47.21  ? 1040 VAL B O     1 
ATOM   7073  C  CB    . VAL B 1 286 ? -5.209  149.104 3.197   1.00 46.13  ? 1040 VAL B CB    1 
ATOM   7074  C  CG1   . VAL B 1 286 ? -4.162  148.505 2.252   1.00 42.99  ? 1040 VAL B CG1   1 
ATOM   7075  C  CG2   . VAL B 1 286 ? -4.756  148.993 4.605   1.00 34.54  ? 1040 VAL B CG2   1 
ATOM   7076  N  N     . GLN B 1 287 ? -3.369  151.094 1.593   1.00 43.75  ? 1041 GLN B N     1 
ATOM   7077  C  CA    . GLN B 1 287 ? -2.050  151.698 1.452   1.00 44.87  ? 1041 GLN B CA    1 
ATOM   7078  C  C     . GLN B 1 287 ? -2.107  153.231 1.603   1.00 46.05  ? 1041 GLN B C     1 
ATOM   7079  O  O     . GLN B 1 287 ? -1.261  153.836 2.268   1.00 45.91  ? 1041 GLN B O     1 
ATOM   7080  C  CB    . GLN B 1 287 ? -1.409  151.302 0.130   1.00 47.07  ? 1041 GLN B CB    1 
ATOM   7081  C  CG    . GLN B 1 287 ? -1.129  149.826 0.001   1.00 52.45  ? 1041 GLN B CG    1 
ATOM   7082  C  CD    . GLN B 1 287 ? -1.016  149.373 -1.452  1.00 58.71  ? 1041 GLN B CD    1 
ATOM   7083  O  OE1   . GLN B 1 287 ? -1.465  150.054 -2.371  1.00 72.50  ? 1041 GLN B OE1   1 
ATOM   7084  N  NE2   . GLN B 1 287 ? -0.426  148.218 -1.656  1.00 55.13  ? 1041 GLN B NE2   1 
ATOM   7085  N  N     . ARG B 1 288 ? -3.107  153.848 0.987   1.00 46.22  ? 1042 ARG B N     1 
ATOM   7086  C  CA    . ARG B 1 288 ? -3.252  155.297 1.027   1.00 43.39  ? 1042 ARG B CA    1 
ATOM   7087  C  C     . ARG B 1 288 ? -3.387  155.714 2.475   1.00 50.80  ? 1042 ARG B C     1 
ATOM   7088  O  O     . ARG B 1 288 ? -2.780  156.693 2.897   1.00 50.54  ? 1042 ARG B O     1 
ATOM   7089  C  CB    . ARG B 1 288 ? -4.482  155.765 0.226   1.00 37.62  ? 1042 ARG B CB    1 
ATOM   7090  C  CG    . ARG B 1 288 ? -4.463  157.239 -0.159  1.00 32.94  ? 1042 ARG B CG    1 
ATOM   7091  C  CD    . ARG B 1 288 ? -5.536  157.573 -1.240  1.00 67.10  ? 1042 ARG B CD    1 
ATOM   7092  N  NE    . ARG B 1 288 ? -5.396  156.762 -2.455  1.00 63.13  ? 1042 ARG B NE    1 
ATOM   7093  C  CZ    . ARG B 1 288 ? -6.200  155.745 -2.780  1.00 60.68  ? 1042 ARG B CZ    1 
ATOM   7094  N  NH1   . ARG B 1 288 ? -7.211  155.410 -1.989  1.00 64.11  ? 1042 ARG B NH1   1 
ATOM   7095  N  NH2   . ARG B 1 288 ? -5.990  155.044 -3.889  1.00 55.65  ? 1042 ARG B NH2   1 
ATOM   7096  N  N     . ARG B 1 289 ? -4.168  154.965 3.253   1.00 47.79  ? 1043 ARG B N     1 
ATOM   7097  C  CA    . ARG B 1 289 ? -4.335  155.320 4.667   1.00 47.02  ? 1043 ARG B CA    1 
ATOM   7098  C  C     . ARG B 1 289 ? -3.061  155.141 5.505   1.00 48.99  ? 1043 ARG B C     1 
ATOM   7099  O  O     . ARG B 1 289 ? -2.707  156.012 6.298   1.00 51.63  ? 1043 ARG B O     1 
ATOM   7100  C  CB    . ARG B 1 289 ? -5.497  154.562 5.268   1.00 45.98  ? 1043 ARG B CB    1 
ATOM   7101  C  CG    . ARG B 1 289 ? -6.791  154.957 4.628   1.00 47.95  ? 1043 ARG B CG    1 
ATOM   7102  C  CD    . ARG B 1 289 ? -7.885  153.982 4.927   1.00 46.90  ? 1043 ARG B CD    1 
ATOM   7103  N  NE    . ARG B 1 289 ? -9.171  154.592 4.645   1.00 45.07  ? 1043 ARG B NE    1 
ATOM   7104  C  CZ    . ARG B 1 289 ? -10.247 153.897 4.321   1.00 51.14  ? 1043 ARG B CZ    1 
ATOM   7105  N  NH1   . ARG B 1 289 ? -10.155 152.576 4.232   1.00 48.55  ? 1043 ARG B NH1   1 
ATOM   7106  N  NH2   . ARG B 1 289 ? -11.400 154.521 4.089   1.00 51.96  ? 1043 ARG B NH2   1 
ATOM   7107  N  N     . ILE B 1 290 ? -2.362  154.026 5.304   1.00 46.64  ? 1044 ILE B N     1 
ATOM   7108  C  CA    . ILE B 1 290 ? -1.074  153.841 5.941   1.00 41.83  ? 1044 ILE B CA    1 
ATOM   7109  C  C     . ILE B 1 290 ? -0.180  155.049 5.680   1.00 49.60  ? 1044 ILE B C     1 
ATOM   7110  O  O     . ILE B 1 290 ? 0.453   155.578 6.604   1.00 47.33  ? 1044 ILE B O     1 
ATOM   7111  C  CB    . ILE B 1 290 ? -0.386  152.561 5.482   1.00 34.65  ? 1044 ILE B CB    1 
ATOM   7112  C  CG1   . ILE B 1 290 ? -1.147  151.350 6.028   1.00 35.41  ? 1044 ILE B CG1   1 
ATOM   7113  C  CG2   . ILE B 1 290 ? 1.045   152.545 5.980   1.00 31.42  ? 1044 ILE B CG2   1 
ATOM   7114  C  CD1   . ILE B 1 290 ? -0.840  150.018 5.337   1.00 34.05  ? 1044 ILE B CD1   1 
ATOM   7115  N  N     . LEU B 1 291 ? -0.140  155.500 4.429   1.00 49.09  ? 1045 LEU B N     1 
ATOM   7116  C  CA    . LEU B 1 291 ? 0.721   156.622 4.094   1.00 46.00  ? 1045 LEU B CA    1 
ATOM   7117  C  C     . LEU B 1 291 ? 0.213   157.902 4.727   1.00 47.97  ? 1045 LEU B C     1 
ATOM   7118  O  O     . LEU B 1 291 ? 0.970   158.643 5.361   1.00 54.57  ? 1045 LEU B O     1 
ATOM   7119  C  CB    . LEU B 1 291 ? 0.867   156.785 2.590   1.00 39.41  ? 1045 LEU B CB    1 
ATOM   7120  C  CG    . LEU B 1 291 ? 1.575   155.615 1.911   1.00 43.96  ? 1045 LEU B CG    1 
ATOM   7121  C  CD1   . LEU B 1 291 ? 1.856   155.935 0.453   1.00 51.16  ? 1045 LEU B CD1   1 
ATOM   7122  C  CD2   . LEU B 1 291 ? 2.854   155.305 2.614   1.00 39.60  ? 1045 LEU B CD2   1 
ATOM   7123  N  N     . TYR B 1 292 ? -1.076  158.154 4.568   1.00 42.23  ? 1046 TYR B N     1 
ATOM   7124  C  CA    . TYR B 1 292 ? -1.607  159.424 4.980   1.00 43.58  ? 1046 TYR B CA    1 
ATOM   7125  C  C     . TYR B 1 292 ? -1.456  159.542 6.497   1.00 49.59  ? 1046 TYR B C     1 
ATOM   7126  O  O     . TYR B 1 292 ? -1.009  160.576 7.019   1.00 45.86  ? 1046 TYR B O     1 
ATOM   7127  C  CB    . TYR B 1 292 ? -3.046  159.561 4.557   1.00 29.99  ? 1046 TYR B CB    1 
ATOM   7128  C  CG    . TYR B 1 292 ? -3.616  160.831 5.052   1.00 38.68  ? 1046 TYR B CG    1 
ATOM   7129  C  CD1   . TYR B 1 292 ? -3.214  162.056 4.530   1.00 38.78  ? 1046 TYR B CD1   1 
ATOM   7130  C  CD2   . TYR B 1 292 ? -4.531  160.835 6.083   1.00 46.44  ? 1046 TYR B CD2   1 
ATOM   7131  C  CE1   . TYR B 1 292 ? -3.735  163.253 5.025   1.00 38.37  ? 1046 TYR B CE1   1 
ATOM   7132  C  CE2   . TYR B 1 292 ? -5.055  162.019 6.587   1.00 55.42  ? 1046 TYR B CE2   1 
ATOM   7133  C  CZ    . TYR B 1 292 ? -4.665  163.216 6.055   1.00 49.18  ? 1046 TYR B CZ    1 
ATOM   7134  O  OH    . TYR B 1 292 ? -5.225  164.354 6.577   1.00 53.07  ? 1046 TYR B OH    1 
ATOM   7135  N  N     . SER B 1 293 ? -1.779  158.462 7.207   1.00 51.63  ? 1047 SER B N     1 
ATOM   7136  C  CA    . SER B 1 293 ? -1.699  158.489 8.654   1.00 50.17  ? 1047 SER B CA    1 
ATOM   7137  C  C     . SER B 1 293 ? -0.266  158.744 9.094   1.00 42.92  ? 1047 SER B C     1 
ATOM   7138  O  O     . SER B 1 293 ? 0.013   159.684 9.844   1.00 37.83  ? 1047 SER B O     1 
ATOM   7139  C  CB    . SER B 1 293 ? -2.222  157.193 9.269   1.00 56.98  ? 1047 SER B CB    1 
ATOM   7140  O  OG    . SER B 1 293 ? -2.266  157.309 10.682  1.00 73.21  ? 1047 SER B OG    1 
ATOM   7141  N  N     . MET B 1 294 ? 0.656   157.916 8.624   1.00 40.37  ? 1048 MET B N     1 
ATOM   7142  C  CA    . MET B 1 294 ? 2.024   158.052 9.099   1.00 44.36  ? 1048 MET B CA    1 
ATOM   7143  C  C     . MET B 1 294 ? 2.532   159.460 8.842   1.00 51.70  ? 1048 MET B C     1 
ATOM   7144  O  O     . MET B 1 294 ? 3.343   160.003 9.605   1.00 53.08  ? 1048 MET B O     1 
ATOM   7145  C  CB    . MET B 1 294 ? 2.941   156.989 8.482   1.00 38.41  ? 1048 MET B CB    1 
ATOM   7146  C  CG    . MET B 1 294 ? 2.611   155.578 9.002   1.00 37.34  ? 1048 MET B CG    1 
ATOM   7147  S  SD    . MET B 1 294 ? 3.605   154.242 8.339   1.00 60.00  ? 1048 MET B SD    1 
ATOM   7148  C  CE    . MET B 1 294 ? 5.244   154.811 8.851   1.00 46.83  ? 1048 MET B CE    1 
ATOM   7149  N  N     . ASN B 1 295 ? 2.043   160.072 7.771   1.00 48.30  ? 1049 ASN B N     1 
ATOM   7150  C  CA    . ASN B 1 295 ? 2.585   161.356 7.409   1.00 42.86  ? 1049 ASN B CA    1 
ATOM   7151  C  C     . ASN B 1 295 ? 1.994   162.459 8.302   1.00 44.36  ? 1049 ASN B C     1 
ATOM   7152  O  O     . ASN B 1 295 ? 2.705   163.386 8.709   1.00 44.75  ? 1049 ASN B O     1 
ATOM   7153  C  CB    . ASN B 1 295 ? 2.449   161.582 5.899   1.00 41.44  ? 1049 ASN B CB    1 
ATOM   7154  C  CG    . ASN B 1 295 ? 2.947   162.942 5.458   1.00 45.25  ? 1049 ASN B CG    1 
ATOM   7155  O  OD1   . ASN B 1 295 ? 2.148   163.849 5.214   1.00 46.07  ? 1049 ASN B OD1   1 
ATOM   7156  N  ND2   . ASN B 1 295 ? 4.263   163.093 5.344   1.00 47.65  ? 1049 ASN B ND2   1 
ATOM   7157  N  N     . LYS B 1 296 ? 0.716   162.315 8.652   1.00 44.54  ? 1050 LYS B N     1 
ATOM   7158  C  CA    . LYS B 1 296 ? 0.029   163.240 9.572   1.00 46.46  ? 1050 LYS B CA    1 
ATOM   7159  C  C     . LYS B 1 296 ? 0.790   163.302 10.889  1.00 53.74  ? 1050 LYS B C     1 
ATOM   7160  O  O     . LYS B 1 296 ? 0.932   164.356 11.506  1.00 60.26  ? 1050 LYS B O     1 
ATOM   7161  C  CB    . LYS B 1 296 ? -1.407  162.748 9.850   1.00 47.71  ? 1050 LYS B CB    1 
ATOM   7162  C  CG    . LYS B 1 296 ? -2.494  163.827 9.990   1.00 51.32  ? 1050 LYS B CG    1 
ATOM   7163  C  CD    . LYS B 1 296 ? -3.683  163.302 10.797  1.00 54.73  ? 1050 LYS B CD    1 
ATOM   7164  N  N     . ASP B 1 297 ? 1.273   162.141 11.305  1.00 53.17  ? 1051 ASP B N     1 
ATOM   7165  C  CA    . ASP B 1 297 ? 1.959   161.977 12.561  1.00 54.04  ? 1051 ASP B CA    1 
ATOM   7166  C  C     . ASP B 1 297 ? 3.464   162.257 12.443  1.00 61.16  ? 1051 ASP B C     1 
ATOM   7167  O  O     . ASP B 1 297 ? 4.252   161.944 13.338  1.00 68.89  ? 1051 ASP B O     1 
ATOM   7168  C  CB    . ASP B 1 297 ? 1.656   160.581 13.093  1.00 60.96  ? 1051 ASP B CB    1 
ATOM   7169  C  CG    . ASP B 1 297 ? 0.152   160.342 13.228  1.00 83.00  ? 1051 ASP B CG    1 
ATOM   7170  O  OD1   . ASP B 1 297 ? -0.596  161.314 12.953  1.00 92.83  ? 1051 ASP B OD1   1 
ATOM   7171  O  OD2   . ASP B 1 297 ? -0.284  159.222 13.610  1.00 85.67  ? 1051 ASP B OD2   1 
ATOM   7172  N  N     . SER B 1 298 ? 3.862   162.853 11.329  1.00 61.28  ? 1052 SER B N     1 
ATOM   7173  C  CA    . SER B 1 298 ? 5.251   163.253 11.164  1.00 64.91  ? 1052 SER B CA    1 
ATOM   7174  C  C     . SER B 1 298 ? 6.239   162.090 11.278  1.00 58.83  ? 1052 SER B C     1 
ATOM   7175  O  O     . SER B 1 298 ? 7.412   162.297 11.583  1.00 60.14  ? 1052 SER B O     1 
ATOM   7176  C  CB    . SER B 1 298 ? 5.567   164.315 12.196  1.00 70.80  ? 1052 SER B CB    1 
ATOM   7177  O  OG    . SER B 1 298 ? 4.446   165.169 12.325  1.00 73.11  ? 1052 SER B OG    1 
ATOM   7178  N  N     . ASN B 1 299 ? 5.747   160.883 10.998  1.00 47.80  ? 1053 ASN B N     1 
ATOM   7179  C  CA    . ASN B 1 299 ? 6.530   159.658 11.003  1.00 42.93  ? 1053 ASN B CA    1 
ATOM   7180  C  C     . ASN B 1 299 ? 7.262   159.498 9.654   1.00 54.00  ? 1053 ASN B C     1 
ATOM   7181  O  O     . ASN B 1 299 ? 6.993   158.582 8.851   1.00 50.91  ? 1053 ASN B O     1 
ATOM   7182  C  CB    . ASN B 1 299 ? 5.591   158.474 11.283  1.00 42.16  ? 1053 ASN B CB    1 
ATOM   7183  C  CG    . ASN B 1 299 ? 6.329   157.213 11.698  1.00 54.81  ? 1053 ASN B CG    1 
ATOM   7184  O  OD1   . ASN B 1 299 ? 7.572   157.207 11.824  1.00 66.43  ? 1053 ASN B OD1   1 
ATOM   7185  N  ND2   . ASN B 1 299 ? 5.570   156.131 11.929  1.00 48.47  ? 1053 ASN B ND2   1 
ATOM   7186  N  N     . THR B 1 300 ? 8.210   160.395 9.421   1.00 57.83  ? 1054 THR B N     1 
ATOM   7187  C  CA    . THR B 1 300 ? 8.783   160.569 8.102   1.00 56.22  ? 1054 THR B CA    1 
ATOM   7188  C  C     . THR B 1 300 ? 10.244  160.163 8.074   1.00 69.60  ? 1054 THR B C     1 
ATOM   7189  O  O     . THR B 1 300 ? 10.821  159.859 9.116   1.00 81.81  ? 1054 THR B O     1 
ATOM   7190  C  CB    . THR B 1 300 ? 8.587   162.009 7.618   1.00 53.69  ? 1054 THR B CB    1 
ATOM   7191  O  OG1   . THR B 1 300 ? 9.059   162.937 8.608   1.00 56.76  ? 1054 THR B OG1   1 
ATOM   7192  C  CG2   . THR B 1 300 ? 7.107   162.258 7.380   1.00 45.90  ? 1054 THR B CG2   1 
ATOM   7193  N  N     . PHE B 1 301 ? 10.831  160.145 6.881   1.00 70.43  ? 1055 PHE B N     1 
ATOM   7194  C  CA    . PHE B 1 301 ? 12.148  159.532 6.679   1.00 68.78  ? 1055 PHE B CA    1 
ATOM   7195  C  C     . PHE B 1 301 ? 13.259  160.240 7.458   1.00 64.68  ? 1055 PHE B C     1 
ATOM   7196  O  O     . PHE B 1 301 ? 14.268  159.635 7.818   1.00 66.87  ? 1055 PHE B O     1 
ATOM   7197  C  CB    . PHE B 1 301 ? 12.501  159.528 5.189   1.00 65.21  ? 1055 PHE B CB    1 
ATOM   7198  C  CG    . PHE B 1 301 ? 13.102  160.814 4.721   1.00 53.53  ? 1055 PHE B CG    1 
ATOM   7199  C  CD1   . PHE B 1 301 ? 12.325  161.949 4.597   1.00 54.29  ? 1055 PHE B CD1   1 
ATOM   7200  C  CD2   . PHE B 1 301 ? 14.446  160.896 4.426   1.00 49.87  ? 1055 PHE B CD2   1 
ATOM   7201  C  CE1   . PHE B 1 301 ? 12.880  163.145 4.181   1.00 57.79  ? 1055 PHE B CE1   1 
ATOM   7202  C  CE2   . PHE B 1 301 ? 15.008  162.086 4.004   1.00 49.98  ? 1055 PHE B CE2   1 
ATOM   7203  C  CZ    . PHE B 1 301 ? 14.222  163.213 3.892   1.00 54.93  ? 1055 PHE B CZ    1 
ATOM   7204  N  N     . ASP B 1 302 ? 13.055  161.527 7.698   1.00 60.84  ? 1056 ASP B N     1 
ATOM   7205  C  CA    . ASP B 1 302 ? 14.030  162.387 8.349   1.00 62.31  ? 1056 ASP B CA    1 
ATOM   7206  C  C     . ASP B 1 302 ? 13.945  162.369 9.886   1.00 61.28  ? 1056 ASP B C     1 
ATOM   7207  O  O     . ASP B 1 302 ? 14.729  163.053 10.557  1.00 59.32  ? 1056 ASP B O     1 
ATOM   7208  C  CB    . ASP B 1 302 ? 13.787  163.815 7.883   1.00 69.01  ? 1056 ASP B CB    1 
ATOM   7209  C  CG    . ASP B 1 302 ? 12.359  164.269 8.154   1.00 80.20  ? 1056 ASP B CG    1 
ATOM   7210  O  OD1   . ASP B 1 302 ? 11.424  163.451 7.997   1.00 75.79  ? 1056 ASP B OD1   1 
ATOM   7211  O  OD2   . ASP B 1 302 ? 12.168  165.439 8.539   1.00 94.91  ? 1056 ASP B OD2   1 
ATOM   7212  N  N     . LYS B 1 303 ? 12.992  161.607 10.433  1.00 56.24  ? 1057 LYS B N     1 
ATOM   7213  C  CA    . LYS B 1 303 ? 12.726  161.588 11.880  1.00 56.00  ? 1057 LYS B CA    1 
ATOM   7214  C  C     . LYS B 1 303 ? 12.803  160.173 12.490  1.00 63.39  ? 1057 LYS B C     1 
ATOM   7215  O  O     . LYS B 1 303 ? 12.850  159.178 11.767  1.00 66.81  ? 1057 LYS B O     1 
ATOM   7216  C  CB    . LYS B 1 303 ? 11.378  162.254 12.195  1.00 53.07  ? 1057 LYS B CB    1 
ATOM   7217  C  CG    . LYS B 1 303 ? 11.321  163.754 11.849  1.00 55.44  ? 1057 LYS B CG    1 
ATOM   7218  C  CD    . LYS B 1 303 ? 10.049  164.409 12.376  1.00 66.78  ? 1057 LYS B CD    1 
ATOM   7219  C  CE    . LYS B 1 303 ? 9.703   165.712 11.660  1.00 81.90  ? 1057 LYS B CE    1 
ATOM   7220  N  NZ    . LYS B 1 303 ? 8.970   165.460 10.363  1.00 90.17  ? 1057 LYS B NZ    1 
ATOM   7221  N  N     . SER B 1 304 ? 12.823  160.074 13.816  1.00 62.92  ? 1058 SER B N     1 
ATOM   7222  C  CA    . SER B 1 304 ? 13.059  158.776 14.454  1.00 62.08  ? 1058 SER B CA    1 
ATOM   7223  C  C     . SER B 1 304 ? 12.031  157.720 14.071  1.00 66.24  ? 1058 SER B C     1 
ATOM   7224  O  O     . SER B 1 304 ? 10.878  158.044 13.816  1.00 72.13  ? 1058 SER B O     1 
ATOM   7225  C  CB    . SER B 1 304 ? 13.104  158.942 15.956  1.00 69.97  ? 1058 SER B CB    1 
ATOM   7226  O  OG    . SER B 1 304 ? 13.700  160.193 16.259  1.00 94.07  ? 1058 SER B OG    1 
ATOM   7227  N  N     . TYR B 1 305 ? 12.446  156.457 14.008  1.00 68.28  ? 1059 TYR B N     1 
ATOM   7228  C  CA    . TYR B 1 305 ? 11.482  155.400 13.730  1.00 65.68  ? 1059 TYR B CA    1 
ATOM   7229  C  C     . TYR B 1 305 ? 10.423  155.443 14.815  1.00 68.89  ? 1059 TYR B C     1 
ATOM   7230  O  O     . TYR B 1 305 ? 10.437  156.330 15.659  1.00 79.05  ? 1059 TYR B O     1 
ATOM   7231  C  CB    . TYR B 1 305 ? 12.139  154.024 13.672  1.00 65.99  ? 1059 TYR B CB    1 
ATOM   7232  C  CG    . TYR B 1 305 ? 12.950  153.786 12.427  1.00 70.63  ? 1059 TYR B CG    1 
ATOM   7233  C  CD1   . TYR B 1 305 ? 14.210  154.360 12.284  1.00 76.77  ? 1059 TYR B CD1   1 
ATOM   7234  C  CD2   . TYR B 1 305 ? 12.471  152.977 11.396  1.00 67.51  ? 1059 TYR B CD2   1 
ATOM   7235  C  CE1   . TYR B 1 305 ? 14.972  154.152 11.148  1.00 77.76  ? 1059 TYR B CE1   1 
ATOM   7236  C  CE2   . TYR B 1 305 ? 13.234  152.763 10.247  1.00 74.44  ? 1059 TYR B CE2   1 
ATOM   7237  C  CZ    . TYR B 1 305 ? 14.485  153.361 10.129  1.00 77.38  ? 1059 TYR B CZ    1 
ATOM   7238  O  OH    . TYR B 1 305 ? 15.269  153.173 9.008   1.00 72.60  ? 1059 TYR B OH    1 
ATOM   7239  N  N     . ARG B 1 306 ? 9.512   154.484 14.809  1.00 59.82  ? 1060 ARG B N     1 
ATOM   7240  C  CA    . ARG B 1 306 ? 8.333   154.587 15.651  1.00 53.23  ? 1060 ARG B CA    1 
ATOM   7241  C  C     . ARG B 1 306 ? 7.615   153.225 15.690  1.00 54.89  ? 1060 ARG B C     1 
ATOM   7242  O  O     . ARG B 1 306 ? 7.426   152.571 14.642  1.00 58.35  ? 1060 ARG B O     1 
ATOM   7243  C  CB    . ARG B 1 306 ? 7.452   155.761 15.156  1.00 47.56  ? 1060 ARG B CB    1 
ATOM   7244  C  CG    . ARG B 1 306 ? 6.136   155.981 15.901  1.00 70.24  ? 1060 ARG B CG    1 
ATOM   7245  C  CD    . ARG B 1 306 ? 5.069   156.600 14.968  1.00 92.13  ? 1060 ARG B CD    1 
ATOM   7246  N  NE    . ARG B 1 306 ? 4.402   157.789 15.504  1.00 105.04 ? 1060 ARG B NE    1 
ATOM   7247  C  CZ    . ARG B 1 306 ? 4.971   158.990 15.591  1.00 111.52 ? 1060 ARG B CZ    1 
ATOM   7248  N  NH1   . ARG B 1 306 ? 6.231   159.164 15.197  1.00 108.18 ? 1060 ARG B NH1   1 
ATOM   7249  N  NH2   . ARG B 1 306 ? 4.288   160.015 16.089  1.00 116.21 ? 1060 ARG B NH2   1 
ATOM   7250  N  N     . LYS B 1 307 ? 7.277   152.779 16.901  1.00 40.38  ? 1061 LYS B N     1 
ATOM   7251  C  CA    . LYS B 1 307 ? 6.706   151.446 17.106  1.00 43.00  ? 1061 LYS B CA    1 
ATOM   7252  C  C     . LYS B 1 307 ? 5.583   151.155 16.122  1.00 47.46  ? 1061 LYS B C     1 
ATOM   7253  O  O     . LYS B 1 307 ? 4.627   151.927 16.026  1.00 53.47  ? 1061 LYS B O     1 
ATOM   7254  C  CB    . LYS B 1 307 ? 6.184   151.319 18.533  1.00 56.87  ? 1061 LYS B CB    1 
ATOM   7255  C  CG    . LYS B 1 307 ? 5.507   149.999 18.864  1.00 69.11  ? 1061 LYS B CG    1 
ATOM   7256  C  CD    . LYS B 1 307 ? 6.450   148.801 18.719  1.00 79.26  ? 1061 LYS B CD    1 
ATOM   7257  C  CE    . LYS B 1 307 ? 7.733   148.953 19.522  1.00 83.42  ? 1061 LYS B CE    1 
ATOM   7258  N  NZ    . LYS B 1 307 ? 8.861   148.202 18.877  1.00 79.97  ? 1061 LYS B NZ    1 
ATOM   7259  N  N     . SER B 1 308 ? 5.695   150.048 15.388  1.00 48.44  ? 1062 SER B N     1 
ATOM   7260  C  CA    . SER B 1 308 ? 4.699   149.713 14.362  1.00 52.00  ? 1062 SER B CA    1 
ATOM   7261  C  C     . SER B 1 308 ? 3.281   149.690 14.921  1.00 52.02  ? 1062 SER B C     1 
ATOM   7262  O  O     . SER B 1 308 ? 2.356   150.270 14.326  1.00 44.01  ? 1062 SER B O     1 
ATOM   7263  C  CB    . SER B 1 308 ? 5.001   148.370 13.704  1.00 55.23  ? 1062 SER B CB    1 
ATOM   7264  O  OG    . SER B 1 308 ? 6.190   148.418 12.939  1.00 60.36  ? 1062 SER B OG    1 
ATOM   7265  N  N     . ALA B 1 309 ? 3.112   149.023 16.060  1.00 50.94  ? 1063 ALA B N     1 
ATOM   7266  C  CA    . ALA B 1 309 ? 1.813   149.004 16.731  1.00 46.57  ? 1063 ALA B CA    1 
ATOM   7267  C  C     . ALA B 1 309 ? 1.200   150.406 16.913  1.00 48.10  ? 1063 ALA B C     1 
ATOM   7268  O  O     . ALA B 1 309 ? -0.002  150.585 16.753  1.00 50.71  ? 1063 ALA B O     1 
ATOM   7269  C  CB    . ALA B 1 309 ? 1.906   148.279 18.069  1.00 45.27  ? 1063 ALA B CB    1 
ATOM   7270  N  N     . LYS B 1 310 ? 2.017   151.400 17.243  1.00 46.19  ? 1064 LYS B N     1 
ATOM   7271  C  CA    . LYS B 1 310 ? 1.499   152.754 17.392  1.00 47.48  ? 1064 LYS B CA    1 
ATOM   7272  C  C     . LYS B 1 310 ? 0.952   153.286 16.058  1.00 49.01  ? 1064 LYS B C     1 
ATOM   7273  O  O     . LYS B 1 310 ? -0.077  153.970 16.044  1.00 55.46  ? 1064 LYS B O     1 
ATOM   7274  C  CB    . LYS B 1 310 ? 2.544   153.730 17.959  1.00 46.49  ? 1064 LYS B CB    1 
ATOM   7275  C  CG    . LYS B 1 310 ? 1.913   155.059 18.343  1.00 46.68  ? 1064 LYS B CG    1 
ATOM   7276  C  CD    . LYS B 1 310 ? 2.897   156.157 18.612  1.00 55.50  ? 1064 LYS B CD    1 
ATOM   7277  C  CE    . LYS B 1 310 ? 2.153   157.483 18.797  1.00 69.82  ? 1064 LYS B CE    1 
ATOM   7278  N  NZ    . LYS B 1 310 ? 2.852   158.510 19.651  1.00 76.35  ? 1064 LYS B NZ    1 
ATOM   7279  N  N     . SER B 1 311 ? 1.641   152.988 14.950  1.00 45.19  ? 1065 SER B N     1 
ATOM   7280  C  CA    . SER B 1 311 ? 1.197   153.412 13.635  1.00 43.61  ? 1065 SER B CA    1 
ATOM   7281  C  C     . SER B 1 311 ? -0.101  152.702 13.274  1.00 51.63  ? 1065 SER B C     1 
ATOM   7282  O  O     . SER B 1 311 ? -1.091  153.346 12.872  1.00 52.98  ? 1065 SER B O     1 
ATOM   7283  C  CB    . SER B 1 311 ? 2.269   153.121 12.596  1.00 53.14  ? 1065 SER B CB    1 
ATOM   7284  O  OG    . SER B 1 311 ? 3.473   153.836 12.845  1.00 64.07  ? 1065 SER B OG    1 
ATOM   7285  N  N     . VAL B 1 312 ? -0.093  151.377 13.447  1.00 48.86  ? 1066 VAL B N     1 
ATOM   7286  C  CA    . VAL B 1 312 ? -1.234  150.522 13.099  1.00 46.29  ? 1066 VAL B CA    1 
ATOM   7287  C  C     . VAL B 1 312 ? -2.514  150.910 13.821  1.00 49.87  ? 1066 VAL B C     1 
ATOM   7288  O  O     . VAL B 1 312 ? -3.588  150.965 13.223  1.00 58.79  ? 1066 VAL B O     1 
ATOM   7289  C  CB    . VAL B 1 312 ? -0.962  149.045 13.413  1.00 43.65  ? 1066 VAL B CB    1 
ATOM   7290  C  CG1   . VAL B 1 312 ? -2.250  148.245 13.370  1.00 37.05  ? 1066 VAL B CG1   1 
ATOM   7291  C  CG2   . VAL B 1 312 ? 0.031   148.464 12.448  1.00 49.77  ? 1066 VAL B CG2   1 
ATOM   7292  N  N     . GLY B 1 313 ? -2.405  151.166 15.113  1.00 39.79  ? 1067 GLY B N     1 
ATOM   7293  C  CA    . GLY B 1 313 ? -3.564  151.546 15.896  1.00 42.08  ? 1067 GLY B CA    1 
ATOM   7294  C  C     . GLY B 1 313 ? -4.113  152.901 15.508  1.00 44.76  ? 1067 GLY B C     1 
ATOM   7295  O  O     . GLY B 1 313 ? -5.324  153.111 15.494  1.00 47.56  ? 1067 GLY B O     1 
ATOM   7296  N  N     . ASN B 1 314 ? -3.234  153.841 15.191  1.00 46.22  ? 1068 ASN B N     1 
ATOM   7297  C  CA    . ASN B 1 314 ? -3.724  155.133 14.766  1.00 45.05  ? 1068 ASN B CA    1 
ATOM   7298  C  C     . ASN B 1 314 ? -4.488  154.970 13.465  1.00 45.84  ? 1068 ASN B C     1 
ATOM   7299  O  O     . ASN B 1 314 ? -5.580  155.522 13.314  1.00 45.09  ? 1068 ASN B O     1 
ATOM   7300  C  CB    . ASN B 1 314 ? -2.600  156.129 14.617  1.00 44.99  ? 1068 ASN B CB    1 
ATOM   7301  C  CG    . ASN B 1 314 ? -2.117  156.632 15.920  1.00 57.05  ? 1068 ASN B CG    1 
ATOM   7302  O  OD1   . ASN B 1 314 ? -2.848  156.644 16.911  1.00 58.48  ? 1068 ASN B OD1   1 
ATOM   7303  N  ND2   . ASN B 1 314 ? -0.870  157.065 15.947  1.00 77.38  ? 1068 ASN B ND2   1 
ATOM   7304  N  N     . ILE B 1 315 ? -3.930  154.187 12.540  1.00 46.99  ? 1069 ILE B N     1 
ATOM   7305  C  CA    . ILE B 1 315 ? -4.634  153.882 11.293  1.00 46.49  ? 1069 ILE B CA    1 
ATOM   7306  C  C     . ILE B 1 315 ? -6.010  153.263 11.558  1.00 46.85  ? 1069 ILE B C     1 
ATOM   7307  O  O     . ILE B 1 315 ? -7.033  153.750 11.064  1.00 47.10  ? 1069 ILE B O     1 
ATOM   7308  C  CB    . ILE B 1 315 ? -3.814  152.944 10.400  1.00 43.19  ? 1069 ILE B CB    1 
ATOM   7309  C  CG1   . ILE B 1 315 ? -2.665  153.716 9.753   1.00 42.51  ? 1069 ILE B CG1   1 
ATOM   7310  C  CG2   . ILE B 1 315 ? -4.702  152.306 9.322   1.00 38.25  ? 1069 ILE B CG2   1 
ATOM   7311  C  CD1   . ILE B 1 315 ? -1.466  152.842 9.519   1.00 32.26  ? 1069 ILE B CD1   1 
ATOM   7312  N  N     . MET B 1 316 ? -6.028  152.202 12.361  1.00 46.60  ? 1070 MET B N     1 
ATOM   7313  C  CA    . MET B 1 316 ? -7.256  151.481 12.649  1.00 43.13  ? 1070 MET B CA    1 
ATOM   7314  C  C     . MET B 1 316 ? -8.288  152.362 13.374  1.00 48.97  ? 1070 MET B C     1 
ATOM   7315  O  O     . MET B 1 316 ? -9.499  152.134 13.278  1.00 59.77  ? 1070 MET B O     1 
ATOM   7316  C  CB    . MET B 1 316 ? -6.941  150.227 13.452  1.00 39.37  ? 1070 MET B CB    1 
ATOM   7317  C  CG    . MET B 1 316 ? -8.156  149.396 13.731  1.00 52.85  ? 1070 MET B CG    1 
ATOM   7318  S  SD    . MET B 1 316 ? -7.761  147.902 14.659  1.00 73.01  ? 1070 MET B SD    1 
ATOM   7319  C  CE    . MET B 1 316 ? -6.066  147.646 14.154  1.00 40.35  ? 1070 MET B CE    1 
ATOM   7320  N  N     . GLY B 1 317 ? -7.819  153.386 14.080  1.00 51.18  ? 1071 GLY B N     1 
ATOM   7321  C  CA    . GLY B 1 317 ? -8.712  154.210 14.882  1.00 49.78  ? 1071 GLY B CA    1 
ATOM   7322  C  C     . GLY B 1 317 ? -9.232  155.403 14.120  1.00 47.65  ? 1071 GLY B C     1 
ATOM   7323  O  O     . GLY B 1 317 ? -10.357 155.856 14.324  1.00 50.17  ? 1071 GLY B O     1 
ATOM   7324  N  N     . ASN B 1 318 ? -8.412  155.916 13.218  1.00 49.26  ? 1072 ASN B N     1 
ATOM   7325  C  CA    . ASN B 1 318 ? -8.776  157.130 12.505  1.00 56.70  ? 1072 ASN B CA    1 
ATOM   7326  C  C     . ASN B 1 318 ? -9.343  156.928 11.099  1.00 50.86  ? 1072 ASN B C     1 
ATOM   7327  O  O     . ASN B 1 318 ? -10.141 157.748 10.652  1.00 49.11  ? 1072 ASN B O     1 
ATOM   7328  C  CB    . ASN B 1 318 ? -7.595  158.097 12.458  1.00 63.03  ? 1072 ASN B CB    1 
ATOM   7329  C  CG    . ASN B 1 318 ? -7.106  158.486 13.842  1.00 65.03  ? 1072 ASN B CG    1 
ATOM   7330  O  OD1   . ASN B 1 318 ? -7.896  158.629 14.780  1.00 62.89  ? 1072 ASN B OD1   1 
ATOM   7331  N  ND2   . ASN B 1 318 ? -5.794  158.656 13.974  1.00 71.09  ? 1072 ASN B ND2   1 
ATOM   7332  N  N     . PHE B 1 319 ? -8.958  155.846 10.416  1.00 48.63  ? 1073 PHE B N     1 
ATOM   7333  C  CA    . PHE B 1 319 ? -9.246  155.724 8.980   1.00 51.65  ? 1073 PHE B CA    1 
ATOM   7334  C  C     . PHE B 1 319 ? -9.769  154.374 8.472   1.00 54.32  ? 1073 PHE B C     1 
ATOM   7335  O  O     . PHE B 1 319 ? -10.706 154.337 7.684   1.00 51.77  ? 1073 PHE B O     1 
ATOM   7336  C  CB    . PHE B 1 319 ? -8.017  156.144 8.163   1.00 44.43  ? 1073 PHE B CB    1 
ATOM   7337  C  CG    . PHE B 1 319 ? -7.479  157.487 8.555   1.00 49.41  ? 1073 PHE B CG    1 
ATOM   7338  C  CD1   . PHE B 1 319 ? -8.195  158.644 8.270   1.00 49.82  ? 1073 PHE B CD1   1 
ATOM   7339  C  CD2   . PHE B 1 319 ? -6.274  157.595 9.244   1.00 45.81  ? 1073 PHE B CD2   1 
ATOM   7340  C  CE1   . PHE B 1 319 ? -7.705  159.895 8.655   1.00 51.26  ? 1073 PHE B CE1   1 
ATOM   7341  C  CE2   . PHE B 1 319 ? -5.768  158.837 9.621   1.00 42.55  ? 1073 PHE B CE2   1 
ATOM   7342  C  CZ    . PHE B 1 319 ? -6.482  159.987 9.330   1.00 43.96  ? 1073 PHE B CZ    1 
ATOM   7343  N  N     . HIS B 1 320 ? -9.175  153.280 8.931   1.00 59.47  ? 1074 HIS B N     1 
ATOM   7344  C  CA    . HIS B 1 320 ? -9.393  151.963 8.339   1.00 52.84  ? 1074 HIS B CA    1 
ATOM   7345  C  C     . HIS B 1 320 ? -10.043 150.990 9.302   1.00 51.98  ? 1074 HIS B C     1 
ATOM   7346  O  O     . HIS B 1 320 ? -9.363  150.434 10.161  1.00 62.49  ? 1074 HIS B O     1 
ATOM   7347  C  CB    . HIS B 1 320 ? -8.045  151.380 7.938   1.00 50.37  ? 1074 HIS B CB    1 
ATOM   7348  C  CG    . HIS B 1 320 ? -8.131  150.335 6.877   1.00 57.16  ? 1074 HIS B CG    1 
ATOM   7349  N  ND1   . HIS B 1 320 ? -8.564  150.610 5.594   1.00 48.63  ? 1074 HIS B ND1   1 
ATOM   7350  C  CD2   . HIS B 1 320 ? -7.819  149.018 6.898   1.00 58.96  ? 1074 HIS B CD2   1 
ATOM   7351  C  CE1   . HIS B 1 320 ? -8.537  149.499 4.882   1.00 50.24  ? 1074 HIS B CE1   1 
ATOM   7352  N  NE2   . HIS B 1 320 ? -8.077  148.522 5.643   1.00 55.82  ? 1074 HIS B NE2   1 
ATOM   7353  N  N     . PRO B 1 321 ? -11.354 150.746 9.152   1.00 52.68  ? 1075 PRO B N     1 
ATOM   7354  C  CA    . PRO B 1 321 ? -12.060 149.914 10.137  1.00 54.40  ? 1075 PRO B CA    1 
ATOM   7355  C  C     . PRO B 1 321 ? -11.938 148.430 9.854   1.00 54.04  ? 1075 PRO B C     1 
ATOM   7356  O  O     . PRO B 1 321 ? -12.973 147.804 9.656   1.00 53.39  ? 1075 PRO B O     1 
ATOM   7357  C  CB    . PRO B 1 321 ? -13.512 150.320 9.934   1.00 47.91  ? 1075 PRO B CB    1 
ATOM   7358  C  CG    . PRO B 1 321 ? -13.568 150.531 8.464   1.00 50.07  ? 1075 PRO B CG    1 
ATOM   7359  C  CD    . PRO B 1 321 ? -12.268 151.215 8.098   1.00 51.90  ? 1075 PRO B CD    1 
ATOM   7360  N  N     . HIS B 1 322 ? -10.727 147.879 9.852   1.00 47.08  ? 1076 HIS B N     1 
ATOM   7361  C  CA    . HIS B 1 322 ? -10.550 146.452 9.629   1.00 49.22  ? 1076 HIS B CA    1 
ATOM   7362  C  C     . HIS B 1 322 ? -9.476  145.913 10.544  1.00 51.96  ? 1076 HIS B C     1 
ATOM   7363  O  O     . HIS B 1 322 ? -8.896  146.667 11.313  1.00 55.62  ? 1076 HIS B O     1 
ATOM   7364  C  CB    . HIS B 1 322 ? -10.246 146.177 8.154   1.00 57.19  ? 1076 HIS B CB    1 
ATOM   7365  C  CG    . HIS B 1 322 ? -11.254 146.787 7.224   1.00 61.46  ? 1076 HIS B CG    1 
ATOM   7366  N  ND1   . HIS B 1 322 ? -12.458 146.181 6.930   1.00 58.28  ? 1076 HIS B ND1   1 
ATOM   7367  C  CD2   . HIS B 1 322 ? -11.258 147.975 6.569   1.00 59.01  ? 1076 HIS B CD2   1 
ATOM   7368  C  CE1   . HIS B 1 322 ? -13.153 146.963 6.120   1.00 63.22  ? 1076 HIS B CE1   1 
ATOM   7369  N  NE2   . HIS B 1 322 ? -12.448 148.057 5.887   1.00 60.67  ? 1076 HIS B NE2   1 
ATOM   7370  N  N     . GLY B 1 323 ? -9.235  144.605 10.486  1.00 56.15  ? 1077 GLY B N     1 
ATOM   7371  C  CA    . GLY B 1 323 ? -8.299  143.963 11.388  1.00 57.20  ? 1077 GLY B CA    1 
ATOM   7372  C  C     . GLY B 1 323 ? -6.912  144.578 11.310  1.00 65.41  ? 1077 GLY B C     1 
ATOM   7373  O  O     . GLY B 1 323 ? -6.464  145.049 10.250  1.00 56.86  ? 1077 GLY B O     1 
ATOM   7374  N  N     . ASP B 1 324 ? -6.226  144.584 12.449  1.00 74.60  ? 1078 ASP B N     1 
ATOM   7375  C  CA    . ASP B 1 324 ? -4.851  145.070 12.504  1.00 72.14  ? 1078 ASP B CA    1 
ATOM   7376  C  C     . ASP B 1 324 ? -3.926  144.249 11.598  1.00 60.02  ? 1078 ASP B C     1 
ATOM   7377  O  O     . ASP B 1 324 ? -3.003  144.795 10.993  1.00 66.30  ? 1078 ASP B O     1 
ATOM   7378  C  CB    . ASP B 1 324 ? -4.320  145.120 13.954  1.00 76.75  ? 1078 ASP B CB    1 
ATOM   7379  C  CG    . ASP B 1 324 ? -4.600  143.829 14.743  1.00 79.09  ? 1078 ASP B CG    1 
ATOM   7380  O  OD1   . ASP B 1 324 ? -5.708  143.710 15.307  1.00 90.49  ? 1078 ASP B OD1   1 
ATOM   7381  O  OD2   . ASP B 1 324 ? -3.714  142.942 14.811  1.00 69.78  ? 1078 ASP B OD2   1 
ATOM   7382  N  N     . SER B 1 325 ? -4.163  142.949 11.487  1.00 48.48  ? 1079 SER B N     1 
ATOM   7383  C  CA    . SER B 1 325 ? -3.260  142.140 10.678  1.00 54.63  ? 1079 SER B CA    1 
ATOM   7384  C  C     . SER B 1 325 ? -3.321  142.553 9.202   1.00 53.79  ? 1079 SER B C     1 
ATOM   7385  O  O     . SER B 1 325 ? -2.285  142.697 8.568   1.00 53.87  ? 1079 SER B O     1 
ATOM   7386  C  CB    . SER B 1 325 ? -3.466  140.639 10.874  1.00 52.06  ? 1079 SER B CB    1 
ATOM   7387  O  OG    . SER B 1 325 ? -4.834  140.336 10.805  1.00 63.04  ? 1079 SER B OG    1 
ATOM   7388  N  N     . SER B 1 326 ? -4.508  142.805 8.660   1.00 48.26  ? 1080 SER B N     1 
ATOM   7389  C  CA    . SER B 1 326 ? -4.531  143.401 7.331   1.00 50.34  ? 1080 SER B CA    1 
ATOM   7390  C  C     . SER B 1 326 ? -3.691  144.673 7.284   1.00 47.75  ? 1080 SER B C     1 
ATOM   7391  O  O     . SER B 1 326 ? -2.774  144.786 6.467   1.00 50.50  ? 1080 SER B O     1 
ATOM   7392  C  CB    . SER B 1 326 ? -5.947  143.636 6.821   1.00 55.48  ? 1080 SER B CB    1 
ATOM   7393  O  OG    . SER B 1 326 ? -6.608  142.394 6.698   1.00 71.60  ? 1080 SER B OG    1 
ATOM   7394  N  N     . ILE B 1 327 ? -3.975  145.632 8.154   1.00 46.76  ? 1081 ILE B N     1 
ATOM   7395  C  CA    . ILE B 1 327 ? -3.150  146.834 8.143   1.00 47.22  ? 1081 ILE B CA    1 
ATOM   7396  C  C     . ILE B 1 327 ? -1.652  146.519 8.302   1.00 47.92  ? 1081 ILE B C     1 
ATOM   7397  O  O     . ILE B 1 327 ? -0.845  146.907 7.480   1.00 48.50  ? 1081 ILE B O     1 
ATOM   7398  C  CB    . ILE B 1 327 ? -3.568  147.821 9.218   1.00 41.55  ? 1081 ILE B CB    1 
ATOM   7399  C  CG1   . ILE B 1 327 ? -5.057  148.149 9.067   1.00 42.03  ? 1081 ILE B CG1   1 
ATOM   7400  C  CG2   . ILE B 1 327 ? -2.693  149.059 9.140   1.00 33.51  ? 1081 ILE B CG2   1 
ATOM   7401  C  CD1   . ILE B 1 327 ? -5.660  148.912 10.231  1.00 50.09  ? 1081 ILE B CD1   1 
ATOM   7402  N  N     . TYR B 1 328 ? -1.267  145.803 9.347   1.00 46.19  ? 1082 TYR B N     1 
ATOM   7403  C  CA    . TYR B 1 328 ? 0.156   145.581 9.530   1.00 49.64  ? 1082 TYR B CA    1 
ATOM   7404  C  C     . TYR B 1 328 ? 0.846   144.922 8.332   1.00 50.46  ? 1082 TYR B C     1 
ATOM   7405  O  O     . TYR B 1 328 ? 1.947   145.317 7.922   1.00 40.05  ? 1082 TYR B O     1 
ATOM   7406  C  CB    . TYR B 1 328 ? 0.411   144.753 10.761  1.00 42.73  ? 1082 TYR B CB    1 
ATOM   7407  C  CG    . TYR B 1 328 ? 1.870   144.613 11.082  1.00 42.04  ? 1082 TYR B CG    1 
ATOM   7408  C  CD1   . TYR B 1 328 ? 2.684   145.730 11.325  1.00 39.09  ? 1082 TYR B CD1   1 
ATOM   7409  C  CD2   . TYR B 1 328 ? 2.437   143.368 11.153  1.00 39.98  ? 1082 TYR B CD2   1 
ATOM   7410  C  CE1   . TYR B 1 328 ? 4.045   145.574 11.646  1.00 37.52  ? 1082 TYR B CE1   1 
ATOM   7411  C  CE2   . TYR B 1 328 ? 3.768   143.196 11.473  1.00 42.69  ? 1082 TYR B CE2   1 
ATOM   7412  C  CZ    . TYR B 1 328 ? 4.569   144.278 11.719  1.00 42.67  ? 1082 TYR B CZ    1 
ATOM   7413  O  OH    . TYR B 1 328 ? 5.877   143.995 12.027  1.00 42.50  ? 1082 TYR B OH    1 
ATOM   7414  N  N     . ASP B 1 329 ? 0.198   143.899 7.796   1.00 51.79  ? 1083 ASP B N     1 
ATOM   7415  C  CA    . ASP B 1 329 ? 0.777   143.091 6.735   1.00 45.05  ? 1083 ASP B CA    1 
ATOM   7416  C  C     . ASP B 1 329 ? 1.014   143.932 5.481   1.00 52.88  ? 1083 ASP B C     1 
ATOM   7417  O  O     . ASP B 1 329 ? 2.041   143.796 4.808   1.00 57.47  ? 1083 ASP B O     1 
ATOM   7418  C  CB    . ASP B 1 329 ? -0.149  141.927 6.428   1.00 46.43  ? 1083 ASP B CB    1 
ATOM   7419  C  CG    . ASP B 1 329 ? -0.086  140.833 7.485   1.00 58.29  ? 1083 ASP B CG    1 
ATOM   7420  O  OD1   . ASP B 1 329 ? 0.936   140.758 8.218   1.00 58.96  ? 1083 ASP B OD1   1 
ATOM   7421  O  OD2   . ASP B 1 329 ? -1.056  140.040 7.567   1.00 63.93  ? 1083 ASP B OD2   1 
ATOM   7422  N  N     . ALA B 1 330 ? 0.057   144.802 5.184   1.00 45.29  ? 1084 ALA B N     1 
ATOM   7423  C  CA    . ALA B 1 330 ? 0.191   145.758 4.108   1.00 45.02  ? 1084 ALA B CA    1 
ATOM   7424  C  C     . ALA B 1 330 ? 1.378   146.675 4.321   1.00 54.70  ? 1084 ALA B C     1 
ATOM   7425  O  O     . ALA B 1 330 ? 2.169   146.890 3.389   1.00 65.65  ? 1084 ALA B O     1 
ATOM   7426  C  CB    . ALA B 1 330 ? -1.078  146.575 3.962   1.00 35.19  ? 1084 ALA B CB    1 
ATOM   7427  N  N     . MET B 1 331 ? 1.481   147.233 5.533   1.00 49.82  ? 1085 MET B N     1 
ATOM   7428  C  CA    . MET B 1 331 ? 2.576   148.138 5.908   1.00 41.50  ? 1085 MET B CA    1 
ATOM   7429  C  C     . MET B 1 331 ? 3.901   147.433 5.690   1.00 45.22  ? 1085 MET B C     1 
ATOM   7430  O  O     . MET B 1 331 ? 4.852   148.023 5.178   1.00 53.48  ? 1085 MET B O     1 
ATOM   7431  C  CB    . MET B 1 331 ? 2.437   148.566 7.359   1.00 45.08  ? 1085 MET B CB    1 
ATOM   7432  C  CG    . MET B 1 331 ? 3.486   149.553 7.866   1.00 53.61  ? 1085 MET B CG    1 
ATOM   7433  S  SD    . MET B 1 331 ? 3.192   149.981 9.617   1.00 53.16  ? 1085 MET B SD    1 
ATOM   7434  N  N     . VAL B 1 332 ? 3.926   146.150 6.037   1.00 37.97  ? 1086 VAL B N     1 
ATOM   7435  C  CA    . VAL B 1 332 ? 5.122   145.326 5.932   1.00 40.98  ? 1086 VAL B CA    1 
ATOM   7436  C  C     . VAL B 1 332 ? 5.576   145.180 4.500   1.00 45.10  ? 1086 VAL B C     1 
ATOM   7437  O  O     . VAL B 1 332 ? 6.710   145.520 4.176   1.00 48.09  ? 1086 VAL B O     1 
ATOM   7438  C  CB    . VAL B 1 332 ? 4.898   143.927 6.537   1.00 46.30  ? 1086 VAL B CB    1 
ATOM   7439  C  CG1   . VAL B 1 332 ? 6.071   142.989 6.204   1.00 40.31  ? 1086 VAL B CG1   1 
ATOM   7440  C  CG2   . VAL B 1 332 ? 4.681   144.035 8.053   1.00 46.54  ? 1086 VAL B CG2   1 
ATOM   7441  N  N     . ARG B 1 333 ? 4.685   144.669 3.653   1.00 48.08  ? 1087 ARG B N     1 
ATOM   7442  C  CA    . ARG B 1 333 ? 4.933   144.556 2.211   1.00 40.42  ? 1087 ARG B CA    1 
ATOM   7443  C  C     . ARG B 1 333 ? 5.476   145.845 1.591   1.00 41.83  ? 1087 ARG B C     1 
ATOM   7444  O  O     . ARG B 1 333 ? 6.405   145.783 0.804   1.00 52.76  ? 1087 ARG B O     1 
ATOM   7445  C  CB    . ARG B 1 333 ? 3.662   144.138 1.475   1.00 39.24  ? 1087 ARG B CB    1 
ATOM   7446  C  CG    . ARG B 1 333 ? 3.882   143.649 0.061   1.00 38.48  ? 1087 ARG B CG    1 
ATOM   7447  C  CD    . ARG B 1 333 ? 2.604   143.003 -0.547  1.00 49.29  ? 1087 ARG B CD    1 
ATOM   7448  N  NE    . ARG B 1 333 ? 2.900   142.369 -1.830  1.00 60.82  ? 1087 ARG B NE    1 
ATOM   7449  C  CZ    . ARG B 1 333 ? 3.230   143.023 -2.947  1.00 55.24  ? 1087 ARG B CZ    1 
ATOM   7450  N  NH1   . ARG B 1 333 ? 3.300   144.342 -2.950  1.00 37.30  ? 1087 ARG B NH1   1 
ATOM   7451  N  NH2   . ARG B 1 333 ? 3.498   142.344 -4.061  1.00 63.24  ? 1087 ARG B NH2   1 
ATOM   7452  N  N     . MET B 1 334 ? 4.934   147.015 1.942   1.00 39.52  ? 1088 MET B N     1 
ATOM   7453  C  CA    . MET B 1 334 ? 5.454   148.245 1.331   1.00 41.29  ? 1088 MET B CA    1 
ATOM   7454  C  C     . MET B 1 334 ? 6.896   148.512 1.784   1.00 46.04  ? 1088 MET B C     1 
ATOM   7455  O  O     . MET B 1 334 ? 7.522   149.498 1.375   1.00 51.16  ? 1088 MET B O     1 
ATOM   7456  C  CB    . MET B 1 334 ? 4.566   149.477 1.604   1.00 42.43  ? 1088 MET B CB    1 
ATOM   7457  C  CG    . MET B 1 334 ? 3.049   149.234 1.658   1.00 43.79  ? 1088 MET B CG    1 
ATOM   7458  S  SD    . MET B 1 334 ? 2.090   150.784 1.805   1.00 55.01  ? 1088 MET B SD    1 
ATOM   7459  C  CE    . MET B 1 334 ? 2.560   151.307 3.447   1.00 159.96 ? 1088 MET B CE    1 
ATOM   7460  N  N     . SER B 1 335 ? 7.419   147.630 2.627   1.00 45.51  ? 1089 SER B N     1 
ATOM   7461  C  CA    . SER B 1 335 ? 8.723   147.850 3.231   1.00 49.95  ? 1089 SER B CA    1 
ATOM   7462  C  C     . SER B 1 335 ? 9.757   146.864 2.729   1.00 43.33  ? 1089 SER B C     1 
ATOM   7463  O  O     . SER B 1 335 ? 10.954  147.035 2.975   1.00 48.59  ? 1089 SER B O     1 
ATOM   7464  C  CB    . SER B 1 335 ? 8.632   147.771 4.769   1.00 58.87  ? 1089 SER B CB    1 
ATOM   7465  O  OG    . SER B 1 335 ? 8.938   146.479 5.299   1.00 51.87  ? 1089 SER B OG    1 
ATOM   7466  N  N     . GLN B 1 336 ? 9.293   145.820 2.047   1.00 43.84  ? 1090 GLN B N     1 
ATOM   7467  C  CA    . GLN B 1 336 ? 10.202  144.765 1.580   1.00 57.46  ? 1090 GLN B CA    1 
ATOM   7468  C  C     . GLN B 1 336 ? 10.699  145.072 0.173   1.00 57.95  ? 1090 GLN B C     1 
ATOM   7469  O  O     . GLN B 1 336 ? 9.921   145.159 -0.788  1.00 54.64  ? 1090 GLN B O     1 
ATOM   7470  C  CB    . GLN B 1 336 ? 9.546   143.381 1.657   1.00 54.37  ? 1090 GLN B CB    1 
ATOM   7471  C  CG    . GLN B 1 336 ? 8.149   143.418 2.258   1.00 54.20  ? 1090 GLN B CG    1 
ATOM   7472  C  CD    . GLN B 1 336 ? 7.618   142.040 2.583   1.00 52.88  ? 1090 GLN B CD    1 
ATOM   7473  O  OE1   . GLN B 1 336 ? 6.540   141.624 2.108   1.00 52.12  ? 1090 GLN B OE1   1 
ATOM   7474  N  NE2   . GLN B 1 336 ? 8.360   141.323 3.419   1.00 52.90  ? 1090 GLN B NE2   1 
ATOM   7475  N  N     . ASN B 1 337 ? 12.005  145.262 0.065   1.00 54.19  ? 1091 ASN B N     1 
ATOM   7476  C  CA    . ASN B 1 337 ? 12.571  145.722 -1.183  1.00 48.28  ? 1091 ASN B CA    1 
ATOM   7477  C  C     . ASN B 1 337 ? 12.687  144.635 -2.228  1.00 54.59  ? 1091 ASN B C     1 
ATOM   7478  O  O     . ASN B 1 337 ? 13.260  144.877 -3.279  1.00 69.58  ? 1091 ASN B O     1 
ATOM   7479  C  CB    . ASN B 1 337 ? 13.945  146.321 -0.957  1.00 53.36  ? 1091 ASN B CB    1 
ATOM   7480  C  CG    . ASN B 1 337 ? 14.951  145.291 -0.582  1.00 62.38  ? 1091 ASN B CG    1 
ATOM   7481  O  OD1   . ASN B 1 337 ? 14.605  144.143 -0.292  1.00 74.55  ? 1091 ASN B OD1   1 
ATOM   7482  N  ND2   . ASN B 1 337 ? 16.208  145.682 -0.564  1.00 66.10  ? 1091 ASN B ND2   1 
ATOM   7483  N  N     . TRP B 1 338 ? 12.172  143.442 -1.948  1.00 51.18  ? 1092 TRP B N     1 
ATOM   7484  C  CA    . TRP B 1 338 ? 12.125  142.391 -2.966  1.00 48.60  ? 1092 TRP B CA    1 
ATOM   7485  C  C     . TRP B 1 338 ? 10.704  142.170 -3.489  1.00 48.37  ? 1092 TRP B C     1 
ATOM   7486  O  O     . TRP B 1 338 ? 10.463  141.232 -4.255  1.00 50.67  ? 1092 TRP B O     1 
ATOM   7487  C  CB    . TRP B 1 338 ? 12.691  141.088 -2.425  1.00 50.10  ? 1092 TRP B CB    1 
ATOM   7488  C  CG    . TRP B 1 338 ? 11.828  140.492 -1.394  1.00 60.72  ? 1092 TRP B CG    1 
ATOM   7489  C  CD1   . TRP B 1 338 ? 10.809  139.619 -1.592  1.00 67.15  ? 1092 TRP B CD1   1 
ATOM   7490  C  CD2   . TRP B 1 338 ? 11.888  140.728 0.012   1.00 64.61  ? 1092 TRP B CD2   1 
ATOM   7491  N  NE1   . TRP B 1 338 ? 10.223  139.284 -0.395  1.00 69.28  ? 1092 TRP B NE1   1 
ATOM   7492  C  CE2   . TRP B 1 338 ? 10.871  139.946 0.610   1.00 68.18  ? 1092 TRP B CE2   1 
ATOM   7493  C  CE3   . TRP B 1 338 ? 12.706  141.515 0.827   1.00 48.32  ? 1092 TRP B CE3   1 
ATOM   7494  C  CZ2   . TRP B 1 338 ? 10.654  139.923 1.979   1.00 62.36  ? 1092 TRP B CZ2   1 
ATOM   7495  C  CZ3   . TRP B 1 338 ? 12.482  141.504 2.172   1.00 50.78  ? 1092 TRP B CZ3   1 
ATOM   7496  C  CH2   . TRP B 1 338 ? 11.460  140.712 2.744   1.00 62.15  ? 1092 TRP B CH2   1 
ATOM   7497  N  N     . LYS B 1 339 ? 9.778   143.031 -3.062  1.00 46.01  ? 1093 LYS B N     1 
ATOM   7498  C  CA    . LYS B 1 339 ? 8.413   143.052 -3.572  1.00 55.20  ? 1093 LYS B CA    1 
ATOM   7499  C  C     . LYS B 1 339 ? 8.136   144.424 -4.173  1.00 65.32  ? 1093 LYS B C     1 
ATOM   7500  O  O     . LYS B 1 339 ? 7.487   144.536 -5.212  1.00 77.44  ? 1093 LYS B O     1 
ATOM   7501  C  CB    . LYS B 1 339 ? 7.371   142.765 -2.481  1.00 55.18  ? 1093 LYS B CB    1 
ATOM   7502  C  CG    . LYS B 1 339 ? 7.662   141.560 -1.600  1.00 65.42  ? 1093 LYS B CG    1 
ATOM   7503  C  CD    . LYS B 1 339 ? 6.437   140.676 -1.372  1.00 69.92  ? 1093 LYS B CD    1 
ATOM   7504  C  CE    . LYS B 1 339 ? 6.278   139.686 -2.522  1.00 82.90  ? 1093 LYS B CE    1 
ATOM   7505  N  NZ    . LYS B 1 339 ? 5.339   138.578 -2.214  1.00 89.42  ? 1093 LYS B NZ    1 
ATOM   7506  N  N     . ASN B 1 340 ? 8.612   145.479 -3.527  1.00 58.62  ? 1094 ASN B N     1 
ATOM   7507  C  CA    . ASN B 1 340 ? 8.455   146.806 -4.124  1.00 61.43  ? 1094 ASN B CA    1 
ATOM   7508  C  C     . ASN B 1 340 ? 9.724   147.288 -4.803  1.00 58.06  ? 1094 ASN B C     1 
ATOM   7509  O  O     . ASN B 1 340 ? 10.828  147.043 -4.312  1.00 56.67  ? 1094 ASN B O     1 
ATOM   7510  C  CB    . ASN B 1 340 ? 7.933   147.827 -3.112  1.00 58.12  ? 1094 ASN B CB    1 
ATOM   7511  C  CG    . ASN B 1 340 ? 6.431   147.710 -2.896  1.00 63.05  ? 1094 ASN B CG    1 
ATOM   7512  O  OD1   . ASN B 1 340 ? 5.632   148.119 -3.744  1.00 64.51  ? 1094 ASN B OD1   1 
ATOM   7513  N  ND2   . ASN B 1 340 ? 6.040   147.146 -1.766  1.00 69.52  ? 1094 ASN B ND2   1 
ATOM   7514  N  N     . ARG B 1 341 ? 9.569   147.933 -5.955  1.00 56.28  ? 1095 ARG B N     1 
ATOM   7515  C  CA    . ARG B 1 341 ? 10.732  148.383 -6.724  1.00 57.56  ? 1095 ARG B CA    1 
ATOM   7516  C  C     . ARG B 1 341 ? 11.296  149.597 -6.017  1.00 57.03  ? 1095 ARG B C     1 
ATOM   7517  O  O     . ARG B 1 341 ? 12.499  149.845 -6.024  1.00 62.01  ? 1095 ARG B O     1 
ATOM   7518  C  CB    . ARG B 1 341 ? 10.353  148.757 -8.163  1.00 54.66  ? 1095 ARG B CB    1 
ATOM   7519  C  CG    . ARG B 1 341 ? 11.500  149.346 -8.980  1.00 41.81  ? 1095 ARG B CG    1 
ATOM   7520  C  CD    . ARG B 1 341 ? 12.484  148.258 -9.258  1.00 51.87  ? 1095 ARG B CD    1 
ATOM   7521  N  NE    . ARG B 1 341 ? 13.662  148.690 -9.995  1.00 54.53  ? 1095 ARG B NE    1 
ATOM   7522  C  CZ    . ARG B 1 341 ? 14.616  149.449 -9.475  1.00 60.14  ? 1095 ARG B CZ    1 
ATOM   7523  N  NH1   . ARG B 1 341 ? 14.484  149.871 -8.226  1.00 62.75  ? 1095 ARG B NH1   1 
ATOM   7524  N  NH2   . ARG B 1 341 ? 15.684  149.795 -10.199 1.00 61.47  ? 1095 ARG B NH2   1 
ATOM   7525  N  N     . GLU B 1 342 ? 10.406  150.340 -5.379  1.00 53.87  ? 1096 GLU B N     1 
ATOM   7526  C  CA    . GLU B 1 342 ? 10.779  151.578 -4.732  1.00 56.24  ? 1096 GLU B CA    1 
ATOM   7527  C  C     . GLU B 1 342 ? 10.023  151.647 -3.380  1.00 49.58  ? 1096 GLU B C     1 
ATOM   7528  O  O     . GLU B 1 342 ? 8.922   152.217 -3.318  1.00 45.81  ? 1096 GLU B O     1 
ATOM   7529  C  CB    . GLU B 1 342 ? 10.428  152.731 -5.683  1.00 54.47  ? 1096 GLU B CB    1 
ATOM   7530  C  CG    . GLU B 1 342 ? 11.408  153.892 -5.727  1.00 68.09  ? 1096 GLU B CG    1 
ATOM   7531  C  CD    . GLU B 1 342 ? 12.828  153.488 -6.107  1.00 86.35  ? 1096 GLU B CD    1 
ATOM   7532  O  OE1   . GLU B 1 342 ? 13.016  152.325 -6.515  1.00 97.10  ? 1096 GLU B OE1   1 
ATOM   7533  O  OE2   . GLU B 1 342 ? 13.757  154.333 -5.991  1.00 87.57  ? 1096 GLU B OE2   1 
ATOM   7534  N  N     . ILE B 1 343 ? 10.597  151.061 -2.312  1.00 41.89  ? 1097 ILE B N     1 
ATOM   7535  C  CA    . ILE B 1 343 ? 9.843   150.893 -1.050  1.00 42.70  ? 1097 ILE B CA    1 
ATOM   7536  C  C     . ILE B 1 343 ? 9.326   152.194 -0.417  1.00 46.32  ? 1097 ILE B C     1 
ATOM   7537  O  O     . ILE B 1 343 ? 10.041  153.201 -0.350  1.00 45.00  ? 1097 ILE B O     1 
ATOM   7538  C  CB    . ILE B 1 343 ? 10.609  150.138 0.061   1.00 44.74  ? 1097 ILE B CB    1 
ATOM   7539  C  CG1   . ILE B 1 343 ? 11.776  150.977 0.572   1.00 45.25  ? 1097 ILE B CG1   1 
ATOM   7540  C  CG2   . ILE B 1 343 ? 11.044  148.744 -0.391  1.00 45.61  ? 1097 ILE B CG2   1 
ATOM   7541  C  CD1   . ILE B 1 343 ? 12.447  150.339 1.729   1.00 38.48  ? 1097 ILE B CD1   1 
ATOM   7542  N  N     . LEU B 1 344 ? 8.092   152.137 0.075   1.00 49.70  ? 1098 LEU B N     1 
ATOM   7543  C  CA    . LEU B 1 344 ? 7.382   153.312 0.559   1.00 52.14  ? 1098 LEU B CA    1 
ATOM   7544  C  C     . LEU B 1 344 ? 7.461   153.405 2.071   1.00 53.43  ? 1098 LEU B C     1 
ATOM   7545  O  O     . LEU B 1 344 ? 7.238   154.472 2.640   1.00 64.06  ? 1098 LEU B O     1 
ATOM   7546  C  CB    . LEU B 1 344 ? 5.919   153.278 0.105   1.00 53.42  ? 1098 LEU B CB    1 
ATOM   7547  C  CG    . LEU B 1 344 ? 5.714   153.232 -1.425  1.00 47.00  ? 1098 LEU B CG    1 
ATOM   7548  C  CD1   . LEU B 1 344 ? 4.253   153.187 -1.762  1.00 53.08  ? 1098 LEU B CD1   1 
ATOM   7549  C  CD2   . LEU B 1 344 ? 6.339   154.407 -2.152  1.00 38.40  ? 1098 LEU B CD2   1 
ATOM   7550  N  N     . VAL B 1 345 ? 7.798   152.291 2.716   1.00 48.84  ? 1099 VAL B N     1 
ATOM   7551  C  CA    . VAL B 1 345 ? 7.979   152.268 4.162   1.00 48.71  ? 1099 VAL B CA    1 
ATOM   7552  C  C     . VAL B 1 345 ? 9.303   151.626 4.549   1.00 52.25  ? 1099 VAL B C     1 
ATOM   7553  O  O     . VAL B 1 345 ? 9.656   150.560 4.044   1.00 67.62  ? 1099 VAL B O     1 
ATOM   7554  C  CB    . VAL B 1 345 ? 6.842   151.492 4.838   1.00 46.73  ? 1099 VAL B CB    1 
ATOM   7555  C  CG1   . VAL B 1 345 ? 7.088   151.355 6.343   1.00 38.70  ? 1099 VAL B CG1   1 
ATOM   7556  C  CG2   . VAL B 1 345 ? 5.511   152.174 4.559   1.00 49.14  ? 1099 VAL B CG2   1 
ATOM   7557  N  N     . GLU B 1 346 ? 10.041  152.279 5.439   1.00 45.12  ? 1100 GLU B N     1 
ATOM   7558  C  CA    . GLU B 1 346 ? 11.258  151.684 5.990   1.00 48.10  ? 1100 GLU B CA    1 
ATOM   7559  C  C     . GLU B 1 346 ? 10.973  151.111 7.392   1.00 50.66  ? 1100 GLU B C     1 
ATOM   7560  O  O     . GLU B 1 346 ? 10.323  151.745 8.230   1.00 55.00  ? 1100 GLU B O     1 
ATOM   7561  C  CB    . GLU B 1 346 ? 12.398  152.703 6.071   1.00 52.49  ? 1100 GLU B CB    1 
ATOM   7562  C  CG    . GLU B 1 346 ? 12.708  153.469 4.806   1.00 64.41  ? 1100 GLU B CG    1 
ATOM   7563  C  CD    . GLU B 1 346 ? 13.796  154.512 5.036   1.00 81.28  ? 1100 GLU B CD    1 
ATOM   7564  O  OE1   . GLU B 1 346 ? 14.232  155.168 4.058   1.00 88.69  ? 1100 GLU B OE1   1 
ATOM   7565  O  OE2   . GLU B 1 346 ? 14.210  154.678 6.207   1.00 81.59  ? 1100 GLU B OE2   1 
ATOM   7566  N  N     . MET B 1 347 ? 11.486  149.920 7.654   1.00 48.95  ? 1101 MET B N     1 
ATOM   7567  C  CA    . MET B 1 347 ? 11.134  149.213 8.863   1.00 42.73  ? 1101 MET B CA    1 
ATOM   7568  C  C     . MET B 1 347 ? 12.342  148.585 9.569   1.00 48.06  ? 1101 MET B C     1 
ATOM   7569  O  O     . MET B 1 347 ? 13.146  147.908 8.966   1.00 58.25  ? 1101 MET B O     1 
ATOM   7570  C  CB    . MET B 1 347 ? 10.057  148.180 8.542   1.00 36.45  ? 1101 MET B CB    1 
ATOM   7571  C  CG    . MET B 1 347 ? 9.729   147.238 9.671   1.00 44.88  ? 1101 MET B CG    1 
ATOM   7572  S  SD    . MET B 1 347 ? 8.134   146.422 9.421   1.00 70.18  ? 1101 MET B SD    1 
ATOM   7573  C  CE    . MET B 1 347 ? 7.192   147.730 8.640   1.00 44.02  ? 1101 MET B CE    1 
ATOM   7574  N  N     . HIS B 1 348 ? 12.475  148.853 10.859  1.00 53.80  ? 1102 HIS B N     1 
ATOM   7575  C  CA    . HIS B 1 348 ? 13.581  148.315 11.638  1.00 58.00  ? 1102 HIS B CA    1 
ATOM   7576  C  C     . HIS B 1 348 ? 13.199  146.952 12.181  1.00 56.84  ? 1102 HIS B C     1 
ATOM   7577  O  O     . HIS B 1 348 ? 12.110  146.772 12.733  1.00 54.28  ? 1102 HIS B O     1 
ATOM   7578  C  CB    . HIS B 1 348 ? 13.927  149.255 12.792  1.00 72.33  ? 1102 HIS B CB    1 
ATOM   7579  C  CG    . HIS B 1 348 ? 15.126  150.106 12.535  1.00 80.50  ? 1102 HIS B CG    1 
ATOM   7580  N  ND1   . HIS B 1 348 ? 16.029  149.833 11.528  1.00 87.37  ? 1102 HIS B ND1   1 
ATOM   7581  C  CD2   . HIS B 1 348 ? 15.575  151.223 13.153  1.00 84.35  ? 1102 HIS B CD2   1 
ATOM   7582  C  CE1   . HIS B 1 348 ? 16.985  150.744 11.539  1.00 88.74  ? 1102 HIS B CE1   1 
ATOM   7583  N  NE2   . HIS B 1 348 ? 16.732  151.599 12.514  1.00 90.54  ? 1102 HIS B NE2   1 
ATOM   7584  N  N     . GLY B 1 349 ? 14.092  145.988 12.024  1.00 54.98  ? 1103 GLY B N     1 
ATOM   7585  C  CA    . GLY B 1 349 ? 13.816  144.644 12.477  1.00 46.70  ? 1103 GLY B CA    1 
ATOM   7586  C  C     . GLY B 1 349 ? 13.416  143.645 11.410  1.00 51.85  ? 1103 GLY B C     1 
ATOM   7587  O  O     . GLY B 1 349 ? 13.614  143.854 10.203  1.00 74.49  ? 1103 GLY B O     1 
ATOM   7588  N  N     . ASN B 1 350 ? 12.856  142.541 11.880  1.00 47.92  ? 1104 ASN B N     1 
ATOM   7589  C  CA    . ASN B 1 350 ? 12.542  141.391 11.056  1.00 50.98  ? 1104 ASN B CA    1 
ATOM   7590  C  C     . ASN B 1 350 ? 11.240  141.634 10.295  1.00 55.09  ? 1104 ASN B C     1 
ATOM   7591  O  O     . ASN B 1 350 ? 10.136  141.370 10.795  1.00 51.51  ? 1104 ASN B O     1 
ATOM   7592  C  CB    . ASN B 1 350 ? 12.478  140.116 11.909  1.00 48.18  ? 1104 ASN B CB    1 
ATOM   7593  C  CG    . ASN B 1 350 ? 11.994  138.912 11.131  1.00 68.45  ? 1104 ASN B CG    1 
ATOM   7594  O  OD1   . ASN B 1 350 ? 11.592  139.026 9.970   1.00 71.65  ? 1104 ASN B OD1   1 
ATOM   7595  N  ND2   . ASN B 1 350 ? 12.026  137.741 11.763  1.00 69.59  ? 1104 ASN B ND2   1 
ATOM   7596  N  N     . ASN B 1 351 ? 11.385  142.143 9.075   1.00 62.38  ? 1105 ASN B N     1 
ATOM   7597  C  CA    . ASN B 1 351 ? 10.252  142.380 8.190   1.00 57.25  ? 1105 ASN B CA    1 
ATOM   7598  C  C     . ASN B 1 351 ? 10.136  141.287 7.121   1.00 62.25  ? 1105 ASN B C     1 
ATOM   7599  O  O     . ASN B 1 351 ? 9.564   141.497 6.063   1.00 65.30  ? 1105 ASN B O     1 
ATOM   7600  C  CB    . ASN B 1 351 ? 10.379  143.755 7.544   1.00 50.49  ? 1105 ASN B CB    1 
ATOM   7601  C  CG    . ASN B 1 351 ? 11.456  143.800 6.458   1.00 53.68  ? 1105 ASN B CG    1 
ATOM   7602  O  OD1   . ASN B 1 351 ? 12.421  143.029 6.462   1.00 63.99  ? 1105 ASN B OD1   1 
ATOM   7603  N  ND2   . ASN B 1 351 ? 11.283  144.708 5.520   1.00 51.31  ? 1105 ASN B ND2   1 
ATOM   7604  N  N     . GLY B 1 352 ? 10.688  140.117 7.412   1.00 67.80  ? 1106 GLY B N     1 
ATOM   7605  C  CA    . GLY B 1 352 ? 10.592  138.988 6.513   1.00 68.53  ? 1106 GLY B CA    1 
ATOM   7606  C  C     . GLY B 1 352 ? 11.843  138.791 5.681   1.00 75.01  ? 1106 GLY B C     1 
ATOM   7607  O  O     . GLY B 1 352 ? 12.903  139.349 5.965   1.00 79.10  ? 1106 GLY B O     1 
ATOM   7608  N  N     . SER B 1 353 ? 11.712  137.983 4.639   1.00 74.04  ? 1107 SER B N     1 
ATOM   7609  C  CA    . SER B 1 353 ? 12.830  137.671 3.771   1.00 72.64  ? 1107 SER B CA    1 
ATOM   7610  C  C     . SER B 1 353 ? 12.293  137.079 2.488   1.00 69.34  ? 1107 SER B C     1 
ATOM   7611  O  O     . SER B 1 353 ? 11.089  136.835 2.366   1.00 70.39  ? 1107 SER B O     1 
ATOM   7612  C  CB    . SER B 1 353 ? 13.771  136.673 4.447   1.00 73.31  ? 1107 SER B CB    1 
ATOM   7613  O  OG    . SER B 1 353 ? 13.172  135.388 4.563   1.00 71.90  ? 1107 SER B OG    1 
ATOM   7614  N  N     . MET B 1 354 ? 13.191  136.851 1.538   1.00 61.83  ? 1108 MET B N     1 
ATOM   7615  C  CA    . MET B 1 354 ? 12.834  136.178 0.304   1.00 61.95  ? 1108 MET B CA    1 
ATOM   7616  C  C     . MET B 1 354 ? 12.529  134.701 0.535   1.00 69.04  ? 1108 MET B C     1 
ATOM   7617  O  O     . MET B 1 354 ? 12.001  134.031 -0.349  1.00 79.57  ? 1108 MET B O     1 
ATOM   7618  C  CB    . MET B 1 354 ? 13.953  136.334 -0.724  1.00 69.43  ? 1108 MET B CB    1 
ATOM   7619  C  CG    . MET B 1 354 ? 13.972  137.695 -1.395  1.00 72.40  ? 1108 MET B CG    1 
ATOM   7620  S  SD    . MET B 1 354 ? 15.248  137.849 -2.669  1.00 74.96  ? 1108 MET B SD    1 
ATOM   7621  C  CE    . MET B 1 354 ? 14.631  136.740 -3.945  1.00 84.70  ? 1108 MET B CE    1 
ATOM   7622  N  N     . ASP B 1 355 ? 12.878  134.181 1.708   1.00 72.21  ? 1109 ASP B N     1 
ATOM   7623  C  CA    . ASP B 1 355 ? 12.576  132.782 2.030   1.00 71.12  ? 1109 ASP B CA    1 
ATOM   7624  C  C     . ASP B 1 355 ? 11.151  132.658 2.550   1.00 65.05  ? 1109 ASP B C     1 
ATOM   7625  O  O     . ASP B 1 355 ? 10.688  131.578 2.900   1.00 62.15  ? 1109 ASP B O     1 
ATOM   7626  C  CB    . ASP B 1 355 ? 13.563  132.216 3.049   1.00 72.24  ? 1109 ASP B CB    1 
ATOM   7627  C  CG    . ASP B 1 355 ? 14.909  131.903 2.440   1.00 88.15  ? 1109 ASP B CG    1 
ATOM   7628  O  OD1   . ASP B 1 355 ? 15.041  132.044 1.206   1.00 96.14  ? 1109 ASP B OD1   1 
ATOM   7629  O  OD2   . ASP B 1 355 ? 15.833  131.506 3.184   1.00 95.86  ? 1109 ASP B OD2   1 
ATOM   7630  N  N     . GLY B 1 356 ? 10.459  133.784 2.602   1.00 56.75  ? 1110 GLY B N     1 
ATOM   7631  C  CA    . GLY B 1 356 ? 9.074   133.786 2.996   1.00 60.94  ? 1110 GLY B CA    1 
ATOM   7632  C  C     . GLY B 1 356 ? 8.838   133.446 4.451   1.00 74.44  ? 1110 GLY B C     1 
ATOM   7633  O  O     . GLY B 1 356 ? 7.721   133.103 4.821   1.00 81.33  ? 1110 GLY B O     1 
ATOM   7634  N  N     . ASP B 1 357 ? 9.861   133.531 5.296   1.00 81.01  ? 1111 ASP B N     1 
ATOM   7635  C  CA    . ASP B 1 357 ? 9.584   133.385 6.724   1.00 78.59  ? 1111 ASP B CA    1 
ATOM   7636  C  C     . ASP B 1 357 ? 8.824   134.610 7.261   1.00 71.58  ? 1111 ASP B C     1 
ATOM   7637  O  O     . ASP B 1 357 ? 8.852   135.698 6.664   1.00 72.05  ? 1111 ASP B O     1 
ATOM   7638  C  CB    . ASP B 1 357 ? 10.835  133.027 7.541   1.00 85.34  ? 1111 ASP B CB    1 
ATOM   7639  C  CG    . ASP B 1 357 ? 11.971  134.008 7.345   1.00 94.33  ? 1111 ASP B CG    1 
ATOM   7640  O  OD1   . ASP B 1 357 ? 11.700  135.225 7.361   1.00 100.10 ? 1111 ASP B OD1   1 
ATOM   7641  O  OD2   . ASP B 1 357 ? 13.136  133.566 7.194   1.00 97.80  ? 1111 ASP B OD2   1 
ATOM   7642  N  N     . PRO B 1 358 ? 8.114   134.428 8.374   1.00 57.34  ? 1112 PRO B N     1 
ATOM   7643  C  CA    . PRO B 1 358 ? 7.204   135.424 8.929   1.00 56.17  ? 1112 PRO B CA    1 
ATOM   7644  C  C     . PRO B 1 358 ? 7.953   136.575 9.563   1.00 61.42  ? 1112 PRO B C     1 
ATOM   7645  O  O     . PRO B 1 358 ? 8.930   136.344 10.297  1.00 71.36  ? 1112 PRO B O     1 
ATOM   7646  C  CB    . PRO B 1 358 ? 6.490   134.653 10.041  1.00 55.64  ? 1112 PRO B CB    1 
ATOM   7647  C  CG    . PRO B 1 358 ? 6.901   133.252 9.904   1.00 58.24  ? 1112 PRO B CG    1 
ATOM   7648  C  CD    . PRO B 1 358 ? 8.238   133.279 9.266   1.00 58.80  ? 1112 PRO B CD    1 
ATOM   7649  N  N     . PRO B 1 359 ? 7.497   137.802 9.282   1.00 48.10  ? 1113 PRO B N     1 
ATOM   7650  C  CA    . PRO B 1 359 ? 7.955   139.074 9.854   1.00 48.81  ? 1113 PRO B CA    1 
ATOM   7651  C  C     . PRO B 1 359 ? 7.610   139.093 11.314  1.00 57.80  ? 1113 PRO B C     1 
ATOM   7652  O  O     . PRO B 1 359 ? 6.629   138.460 11.692  1.00 62.37  ? 1113 PRO B O     1 
ATOM   7653  C  CB    . PRO B 1 359 ? 7.094   140.119 9.146   1.00 41.15  ? 1113 PRO B CB    1 
ATOM   7654  C  CG    . PRO B 1 359 ? 6.639   139.468 7.917   1.00 53.34  ? 1113 PRO B CG    1 
ATOM   7655  C  CD    . PRO B 1 359 ? 6.504   138.001 8.222   1.00 49.07  ? 1113 PRO B CD    1 
ATOM   7656  N  N     . ALA B 1 360 ? 8.393   139.807 12.115  1.00 58.75  ? 1114 ALA B N     1 
ATOM   7657  C  CA    . ALA B 1 360 ? 8.083   139.988 13.524  1.00 52.41  ? 1114 ALA B CA    1 
ATOM   7658  C  C     . ALA B 1 360 ? 6.715   140.637 13.661  1.00 58.35  ? 1114 ALA B C     1 
ATOM   7659  O  O     . ALA B 1 360 ? 6.266   141.355 12.754  1.00 59.17  ? 1114 ALA B O     1 
ATOM   7660  C  CB    . ALA B 1 360 ? 9.127   140.855 14.156  1.00 47.51  ? 1114 ALA B CB    1 
ATOM   7661  N  N     . ALA B 1 361 ? 6.052   140.396 14.790  1.00 60.14  ? 1115 ALA B N     1 
ATOM   7662  C  CA    . ALA B 1 361 ? 4.747   141.030 15.059  1.00 55.97  ? 1115 ALA B CA    1 
ATOM   7663  C  C     . ALA B 1 361 ? 4.836   142.553 15.268  1.00 52.09  ? 1115 ALA B C     1 
ATOM   7664  O  O     . ALA B 1 361 ? 5.870   143.086 15.667  1.00 53.87  ? 1115 ALA B O     1 
ATOM   7665  C  CB    . ALA B 1 361 ? 4.073   140.359 16.233  1.00 63.00  ? 1115 ALA B CB    1 
ATOM   7666  N  N     . MET B 1 362 ? 3.765   143.271 14.974  1.00 49.34  ? 1116 MET B N     1 
ATOM   7667  C  CA    . MET B 1 362 ? 3.846   144.722 15.094  1.00 50.50  ? 1116 MET B CA    1 
ATOM   7668  C  C     . MET B 1 362 ? 4.271   145.235 16.496  1.00 50.98  ? 1116 MET B C     1 
ATOM   7669  O  O     . MET B 1 362 ? 4.477   146.443 16.688  1.00 51.56  ? 1116 MET B O     1 
ATOM   7670  C  CB    . MET B 1 362 ? 2.522   145.360 14.688  1.00 45.33  ? 1116 MET B CB    1 
ATOM   7671  C  CG    . MET B 1 362 ? 1.450   145.169 15.694  1.00 47.21  ? 1116 MET B CG    1 
ATOM   7672  S  SD    . MET B 1 362 ? -0.092  145.889 15.168  1.00 56.09  ? 1116 MET B SD    1 
ATOM   7673  C  CE    . MET B 1 362 ? -1.118  145.399 16.571  1.00 46.21  ? 1116 MET B CE    1 
ATOM   7674  N  N     . ARG B 1 363 ? 4.392   144.342 17.475  1.00 49.92  ? 1117 ARG B N     1 
ATOM   7675  C  CA    . ARG B 1 363 ? 4.852   144.769 18.776  1.00 44.38  ? 1117 ARG B CA    1 
ATOM   7676  C  C     . ARG B 1 363 ? 6.373   144.867 18.824  1.00 60.16  ? 1117 ARG B C     1 
ATOM   7677  O  O     . ARG B 1 363 ? 6.912   145.560 19.673  1.00 64.46  ? 1117 ARG B O     1 
ATOM   7678  C  CB    . ARG B 1 363 ? 4.338   143.838 19.863  1.00 46.88  ? 1117 ARG B CB    1 
ATOM   7679  C  CG    . ARG B 1 363 ? 5.016   142.501 19.910  1.00 49.57  ? 1117 ARG B CG    1 
ATOM   7680  C  CD    . ARG B 1 363 ? 5.113   142.025 21.335  1.00 67.28  ? 1117 ARG B CD    1 
ATOM   7681  N  NE    . ARG B 1 363 ? 5.191   140.573 21.439  1.00 85.93  ? 1117 ARG B NE    1 
ATOM   7682  C  CZ    . ARG B 1 363 ? 4.186   139.753 21.148  1.00 95.47  ? 1117 ARG B CZ    1 
ATOM   7683  N  NH1   . ARG B 1 363 ? 3.026   140.239 20.723  1.00 99.24  ? 1117 ARG B NH1   1 
ATOM   7684  N  NH2   . ARG B 1 363 ? 4.350   138.446 21.280  1.00 97.70  ? 1117 ARG B NH2   1 
ATOM   7685  N  N     . TYR B 1 364 ? 7.065   144.196 17.902  1.00 61.92  ? 1118 TYR B N     1 
ATOM   7686  C  CA    . TYR B 1 364 ? 8.539   144.228 17.852  1.00 56.13  ? 1118 TYR B CA    1 
ATOM   7687  C  C     . TYR B 1 364 ? 9.191   145.301 16.979  1.00 58.65  ? 1118 TYR B C     1 
ATOM   7688  O  O     . TYR B 1 364 ? 10.320  145.692 17.243  1.00 66.38  ? 1118 TYR B O     1 
ATOM   7689  C  CB    . TYR B 1 364 ? 9.093   142.913 17.343  1.00 46.56  ? 1118 TYR B CB    1 
ATOM   7690  C  CG    . TYR B 1 364 ? 8.755   141.707 18.160  1.00 48.86  ? 1118 TYR B CG    1 
ATOM   7691  C  CD1   . TYR B 1 364 ? 9.505   141.359 19.278  1.00 51.64  ? 1118 TYR B CD1   1 
ATOM   7692  C  CD2   . TYR B 1 364 ? 7.719   140.880 17.787  1.00 56.54  ? 1118 TYR B CD2   1 
ATOM   7693  C  CE1   . TYR B 1 364 ? 9.208   140.231 20.014  1.00 56.77  ? 1118 TYR B CE1   1 
ATOM   7694  C  CE2   . TYR B 1 364 ? 7.413   139.745 18.514  1.00 59.42  ? 1118 TYR B CE2   1 
ATOM   7695  C  CZ    . TYR B 1 364 ? 8.168   139.418 19.622  1.00 63.18  ? 1118 TYR B CZ    1 
ATOM   7696  O  OH    . TYR B 1 364 ? 7.818   138.296 20.339  1.00 72.71  ? 1118 TYR B OH    1 
ATOM   7697  N  N     . THR B 1 365 ? 8.518   145.738 15.916  1.00 54.37  ? 1119 THR B N     1 
ATOM   7698  C  CA    . THR B 1 365 ? 9.198   146.472 14.845  1.00 47.56  ? 1119 THR B CA    1 
ATOM   7699  C  C     . THR B 1 365 ? 8.940   147.971 14.909  1.00 55.05  ? 1119 THR B C     1 
ATOM   7700  O  O     . THR B 1 365 ? 7.942   148.409 15.476  1.00 62.85  ? 1119 THR B O     1 
ATOM   7701  C  CB    . THR B 1 365 ? 8.779   145.938 13.474  1.00 43.74  ? 1119 THR B CB    1 
ATOM   7702  O  OG1   . THR B 1 365 ? 7.385   146.178 13.271  1.00 42.58  ? 1119 THR B OG1   1 
ATOM   7703  C  CG2   . THR B 1 365 ? 9.006   144.445 13.395  1.00 42.74  ? 1119 THR B CG2   1 
ATOM   7704  N  N     . GLU B 1 366 ? 9.851   148.768 14.359  1.00 58.85  ? 1120 GLU B N     1 
ATOM   7705  C  CA    . GLU B 1 366 ? 9.613   150.209 14.254  1.00 55.47  ? 1120 GLU B CA    1 
ATOM   7706  C  C     . GLU B 1 366 ? 9.597   150.555 12.783  1.00 53.41  ? 1120 GLU B C     1 
ATOM   7707  O  O     . GLU B 1 366 ? 10.159  149.814 11.987  1.00 53.53  ? 1120 GLU B O     1 
ATOM   7708  C  CB    . GLU B 1 366 ? 10.733  151.004 14.894  1.00 56.88  ? 1120 GLU B CB    1 
ATOM   7709  C  CG    . GLU B 1 366 ? 11.365  150.388 16.073  1.00 73.14  ? 1120 GLU B CG    1 
ATOM   7710  C  CD    . GLU B 1 366 ? 12.510  151.231 16.557  1.00 87.35  ? 1120 GLU B CD    1 
ATOM   7711  O  OE1   . GLU B 1 366 ? 13.485  151.394 15.765  1.00 82.82  ? 1120 GLU B OE1   1 
ATOM   7712  O  OE2   . GLU B 1 366 ? 12.411  151.741 17.706  1.00 92.53  ? 1120 GLU B OE2   1 
ATOM   7713  N  N     . ALA B 1 367 ? 9.004   151.686 12.422  1.00 47.89  ? 1121 ALA B N     1 
ATOM   7714  C  CA    . ALA B 1 367 ? 8.878   152.031 11.006  1.00 46.18  ? 1121 ALA B CA    1 
ATOM   7715  C  C     . ALA B 1 367 ? 8.784   153.521 10.780  1.00 54.81  ? 1121 ALA B C     1 
ATOM   7716  O  O     . ALA B 1 367 ? 8.535   154.287 11.728  1.00 56.46  ? 1121 ALA B O     1 
ATOM   7717  C  CB    . ALA B 1 367 ? 7.653   151.348 10.397  1.00 38.33  ? 1121 ALA B CB    1 
ATOM   7718  N  N     . ARG B 1 368 ? 8.973   153.918 9.518   1.00 50.40  ? 1122 ARG B N     1 
ATOM   7719  C  CA    . ARG B 1 368 ? 8.686   155.279 9.043   1.00 48.54  ? 1122 ARG B CA    1 
ATOM   7720  C  C     . ARG B 1 368 ? 8.514   155.276 7.545   1.00 54.51  ? 1122 ARG B C     1 
ATOM   7721  O  O     . ARG B 1 368 ? 8.886   154.298 6.861   1.00 49.51  ? 1122 ARG B O     1 
ATOM   7722  C  CB    . ARG B 1 368 ? 9.823   156.237 9.378   1.00 41.33  ? 1122 ARG B CB    1 
ATOM   7723  C  CG    . ARG B 1 368 ? 11.178  155.688 9.044   1.00 36.75  ? 1122 ARG B CG    1 
ATOM   7724  C  CD    . ARG B 1 368 ? 12.245  156.652 9.431   1.00 50.03  ? 1122 ARG B CD    1 
ATOM   7725  N  NE    . ARG B 1 368 ? 13.462  156.434 8.661   1.00 67.27  ? 1122 ARG B NE    1 
ATOM   7726  C  CZ    . ARG B 1 368 ? 14.654  156.877 9.028   1.00 63.55  ? 1122 ARG B CZ    1 
ATOM   7727  N  NH1   . ARG B 1 368 ? 14.772  157.538 10.164  1.00 52.73  ? 1122 ARG B NH1   1 
ATOM   7728  N  NH2   . ARG B 1 368 ? 15.714  156.653 8.271   1.00 69.56  ? 1122 ARG B NH2   1 
ATOM   7729  N  N     . LEU B 1 369 ? 7.968   156.380 7.034   1.00 54.28  ? 1123 LEU B N     1 
ATOM   7730  C  CA    . LEU B 1 369 ? 7.884   156.590 5.588   1.00 45.90  ? 1123 LEU B CA    1 
ATOM   7731  C  C     . LEU B 1 369 ? 9.287   156.627 4.983   1.00 55.38  ? 1123 LEU B C     1 
ATOM   7732  O  O     . LEU B 1 369 ? 10.224  157.159 5.591   1.00 52.52  ? 1123 LEU B O     1 
ATOM   7733  C  CB    . LEU B 1 369 ? 7.156   157.898 5.274   1.00 44.18  ? 1123 LEU B CB    1 
ATOM   7734  C  CG    . LEU B 1 369 ? 5.684   157.905 5.697   1.00 45.90  ? 1123 LEU B CG    1 
ATOM   7735  C  CD1   . LEU B 1 369 ? 4.845   159.039 5.047   1.00 36.28  ? 1123 LEU B CD1   1 
ATOM   7736  C  CD2   . LEU B 1 369 ? 5.098   156.549 5.414   1.00 37.10  ? 1123 LEU B CD2   1 
ATOM   7737  N  N     . SER B 1 370 ? 9.444   156.056 3.791   1.00 54.20  ? 1124 SER B N     1 
ATOM   7738  C  CA    . SER B 1 370 ? 10.688  156.245 3.047   1.00 42.82  ? 1124 SER B CA    1 
ATOM   7739  C  C     . SER B 1 370 ? 10.721  157.674 2.514   1.00 50.49  ? 1124 SER B C     1 
ATOM   7740  O  O     . SER B 1 370 ? 9.679   158.339 2.433   1.00 51.92  ? 1124 SER B O     1 
ATOM   7741  C  CB    . SER B 1 370 ? 10.726  155.290 1.890   1.00 49.04  ? 1124 SER B CB    1 
ATOM   7742  O  OG    . SER B 1 370 ? 9.849   155.729 0.878   1.00 61.49  ? 1124 SER B OG    1 
ATOM   7743  N  N     . GLU B 1 371 ? 11.895  158.173 2.156   1.00 54.46  ? 1125 GLU B N     1 
ATOM   7744  C  CA    . GLU B 1 371 ? 11.937  159.520 1.556   1.00 52.76  ? 1125 GLU B CA    1 
ATOM   7745  C  C     . GLU B 1 371 ? 11.086  159.644 0.270   1.00 55.09  ? 1125 GLU B C     1 
ATOM   7746  O  O     . GLU B 1 371 ? 10.414  160.658 0.059   1.00 56.25  ? 1125 GLU B O     1 
ATOM   7747  C  CB    . GLU B 1 371 ? 13.375  159.975 1.312   1.00 47.29  ? 1125 GLU B CB    1 
ATOM   7748  C  CG    . GLU B 1 371 ? 13.513  161.286 0.595   1.00 47.22  ? 1125 GLU B CG    1 
ATOM   7749  C  CD    . GLU B 1 371 ? 14.951  161.791 0.586   1.00 66.19  ? 1125 GLU B CD    1 
ATOM   7750  O  OE1   . GLU B 1 371 ? 15.895  160.958 0.610   1.00 68.08  ? 1125 GLU B OE1   1 
ATOM   7751  O  OE2   . GLU B 1 371 ? 15.133  163.029 0.564   1.00 77.40  ? 1125 GLU B OE2   1 
ATOM   7752  N  N     . ILE B 1 372 ? 11.088  158.617 -0.579  1.00 53.17  ? 1126 ILE B N     1 
ATOM   7753  C  CA    . ILE B 1 372 ? 10.317  158.724 -1.810  1.00 47.36  ? 1126 ILE B CA    1 
ATOM   7754  C  C     . ILE B 1 372 ? 8.828   158.815 -1.548  1.00 45.12  ? 1126 ILE B C     1 
ATOM   7755  O  O     . ILE B 1 372 ? 8.098   159.442 -2.322  1.00 42.57  ? 1126 ILE B O     1 
ATOM   7756  C  CB    . ILE B 1 372 ? 10.610  157.597 -2.814  1.00 45.56  ? 1126 ILE B CB    1 
ATOM   7757  C  CG1   . ILE B 1 372 ? 10.496  158.141 -4.232  1.00 42.80  ? 1126 ILE B CG1   1 
ATOM   7758  C  CG2   . ILE B 1 372 ? 9.643   156.461 -2.651  1.00 43.50  ? 1126 ILE B CG2   1 
ATOM   7759  C  CD1   . ILE B 1 372 ? 10.842  157.148 -5.261  1.00 50.26  ? 1126 ILE B CD1   1 
ATOM   7760  N  N     . ALA B 1 373 ? 8.384   158.191 -0.456  1.00 48.88  ? 1127 ALA B N     1 
ATOM   7761  C  CA    . ALA B 1 373 ? 6.978   158.253 -0.035  1.00 52.59  ? 1127 ALA B CA    1 
ATOM   7762  C  C     . ALA B 1 373 ? 6.557   159.700 0.198   1.00 51.52  ? 1127 ALA B C     1 
ATOM   7763  O  O     . ALA B 1 373 ? 5.422   160.108 -0.089  1.00 53.71  ? 1127 ALA B O     1 
ATOM   7764  C  CB    . ALA B 1 373 ? 6.761   157.443 1.224   1.00 48.51  ? 1127 ALA B CB    1 
ATOM   7765  N  N     . GLY B 1 374 ? 7.494   160.477 0.713   1.00 40.52  ? 1128 GLY B N     1 
ATOM   7766  C  CA    . GLY B 1 374 ? 7.261   161.888 0.893   1.00 40.61  ? 1128 GLY B CA    1 
ATOM   7767  C  C     . GLY B 1 374 ? 6.706   162.496 -0.365  1.00 51.53  ? 1128 GLY B C     1 
ATOM   7768  O  O     . GLY B 1 374 ? 5.827   163.367 -0.314  1.00 52.36  ? 1128 GLY B O     1 
ATOM   7769  N  N     . TYR B 1 375 ? 7.226   162.037 -1.503  1.00 55.30  ? 1129 TYR B N     1 
ATOM   7770  C  CA    . TYR B 1 375 ? 6.894   162.657 -2.776  1.00 44.77  ? 1129 TYR B CA    1 
ATOM   7771  C  C     . TYR B 1 375 ? 5.502   162.264 -3.246  1.00 46.94  ? 1129 TYR B C     1 
ATOM   7772  O  O     . TYR B 1 375 ? 4.877   163.012 -3.973  1.00 50.27  ? 1129 TYR B O     1 
ATOM   7773  C  CB    . TYR B 1 375 ? 7.960   162.365 -3.826  1.00 35.72  ? 1129 TYR B CB    1 
ATOM   7774  C  CG    . TYR B 1 375 ? 9.112   163.334 -3.782  1.00 45.33  ? 1129 TYR B CG    1 
ATOM   7775  C  CD1   . TYR B 1 375 ? 10.146  163.168 -2.868  1.00 47.47  ? 1129 TYR B CD1   1 
ATOM   7776  C  CD2   . TYR B 1 375 ? 9.178   164.417 -4.649  1.00 42.98  ? 1129 TYR B CD2   1 
ATOM   7777  C  CE1   . TYR B 1 375 ? 11.217  164.054 -2.812  1.00 43.20  ? 1129 TYR B CE1   1 
ATOM   7778  C  CE2   . TYR B 1 375 ? 10.239  165.313 -4.589  1.00 48.90  ? 1129 TYR B CE2   1 
ATOM   7779  C  CZ    . TYR B 1 375 ? 11.258  165.129 -3.662  1.00 50.71  ? 1129 TYR B CZ    1 
ATOM   7780  O  OH    . TYR B 1 375 ? 12.333  166.002 -3.593  1.00 54.28  ? 1129 TYR B OH    1 
ATOM   7781  N  N     . LEU B 1 376 ? 5.016   161.098 -2.822  1.00 45.86  ? 1130 LEU B N     1 
ATOM   7782  C  CA    . LEU B 1 376 ? 3.642   160.710 -3.118  1.00 47.82  ? 1130 LEU B CA    1 
ATOM   7783  C  C     . LEU B 1 376 ? 2.694   161.647 -2.398  1.00 55.66  ? 1130 LEU B C     1 
ATOM   7784  O  O     . LEU B 1 376 ? 1.530   161.796 -2.784  1.00 61.39  ? 1130 LEU B O     1 
ATOM   7785  C  CB    . LEU B 1 376 ? 3.355   159.299 -2.622  1.00 45.73  ? 1130 LEU B CB    1 
ATOM   7786  C  CG    . LEU B 1 376 ? 3.651   158.092 -3.495  1.00 45.53  ? 1130 LEU B CG    1 
ATOM   7787  C  CD1   . LEU B 1 376 ? 3.078   156.858 -2.821  1.00 45.44  ? 1130 LEU B CD1   1 
ATOM   7788  C  CD2   . LEU B 1 376 ? 3.025   158.284 -4.854  1.00 57.14  ? 1130 LEU B CD2   1 
ATOM   7789  N  N     . LEU B 1 377 ? 3.197   162.268 -1.337  1.00 50.22  ? 1131 LEU B N     1 
ATOM   7790  C  CA    . LEU B 1 377 ? 2.362   163.053 -0.440  1.00 47.91  ? 1131 LEU B CA    1 
ATOM   7791  C  C     . LEU B 1 377 ? 2.586   164.540 -0.598  1.00 51.61  ? 1131 LEU B C     1 
ATOM   7792  O  O     . LEU B 1 377 ? 1.904   165.358 0.025   1.00 53.54  ? 1131 LEU B O     1 
ATOM   7793  C  CB    . LEU B 1 377 ? 2.648   162.653 1.003   1.00 47.51  ? 1131 LEU B CB    1 
ATOM   7794  C  CG    . LEU B 1 377 ? 1.954   161.382 1.454   1.00 43.04  ? 1131 LEU B CG    1 
ATOM   7795  C  CD1   . LEU B 1 377 ? 2.583   160.860 2.722   1.00 45.50  ? 1131 LEU B CD1   1 
ATOM   7796  C  CD2   . LEU B 1 377 ? 0.503   161.757 1.683   1.00 42.60  ? 1131 LEU B CD2   1 
ATOM   7797  N  N     . GLN B 1 378 ? 3.563   164.878 -1.425  1.00 53.11  ? 1132 GLN B N     1 
ATOM   7798  C  CA    . GLN B 1 378 ? 4.000   166.249 -1.594  1.00 47.05  ? 1132 GLN B CA    1 
ATOM   7799  C  C     . GLN B 1 378 ? 2.814   167.121 -1.888  1.00 48.38  ? 1132 GLN B C     1 
ATOM   7800  O  O     . GLN B 1 378 ? 1.977   166.763 -2.721  1.00 57.45  ? 1132 GLN B O     1 
ATOM   7801  C  CB    . GLN B 1 378 ? 4.954   166.283 -2.758  1.00 51.02  ? 1132 GLN B CB    1 
ATOM   7802  C  CG    . GLN B 1 378 ? 5.648   167.573 -2.960  1.00 58.37  ? 1132 GLN B CG    1 
ATOM   7803  C  CD    . GLN B 1 378 ? 6.286   167.588 -4.320  1.00 69.73  ? 1132 GLN B CD    1 
ATOM   7804  O  OE1   . GLN B 1 378 ? 5.581   167.525 -5.341  1.00 85.25  ? 1132 GLN B OE1   1 
ATOM   7805  N  NE2   . GLN B 1 378 ? 7.626   167.633 -4.357  1.00 53.78  ? 1132 GLN B NE2   1 
ATOM   7806  N  N     . ASP B 1 379 ? 2.724   168.238 -1.174  1.00 56.55  ? 1133 ASP B N     1 
ATOM   7807  C  CA    . ASP B 1 379 ? 1.711   169.276 -1.412  1.00 67.17  ? 1133 ASP B CA    1 
ATOM   7808  C  C     . ASP B 1 379 ? 0.291   168.935 -0.961  1.00 62.93  ? 1133 ASP B C     1 
ATOM   7809  O  O     . ASP B 1 379 ? -0.650  169.671 -1.263  1.00 67.25  ? 1133 ASP B O     1 
ATOM   7810  C  CB    . ASP B 1 379 ? 1.704   169.724 -2.880  1.00 80.04  ? 1133 ASP B CB    1 
ATOM   7811  C  CG    . ASP B 1 379 ? 2.929   170.548 -3.249  1.00 90.66  ? 1133 ASP B CG    1 
ATOM   7812  O  OD1   . ASP B 1 379 ? 3.413   171.332 -2.396  1.00 99.15  ? 1133 ASP B OD1   1 
ATOM   7813  O  OD2   . ASP B 1 379 ? 3.408   170.404 -4.393  1.00 88.77  ? 1133 ASP B OD2   1 
ATOM   7814  N  N     . ILE B 1 380 ? 0.135   167.839 -0.229  1.00 55.75  ? 1134 ILE B N     1 
ATOM   7815  C  CA    . ILE B 1 380 ? -1.175  167.465 0.319   1.00 58.34  ? 1134 ILE B CA    1 
ATOM   7816  C  C     . ILE B 1 380 ? -1.792  168.526 1.256   1.00 53.31  ? 1134 ILE B C     1 
ATOM   7817  O  O     . ILE B 1 380 ? -3.004  168.686 1.310   1.00 51.75  ? 1134 ILE B O     1 
ATOM   7818  C  CB    . ILE B 1 380 ? -1.119  166.095 1.044   1.00 48.20  ? 1134 ILE B CB    1 
ATOM   7819  C  CG1   . ILE B 1 380 ? -2.497  165.458 1.099   1.00 41.51  ? 1134 ILE B CG1   1 
ATOM   7820  C  CG2   . ILE B 1 380 ? -0.511  166.214 2.442   1.00 36.22  ? 1134 ILE B CG2   1 
ATOM   7821  C  CD1   . ILE B 1 380 ? -2.377  163.982 1.251   1.00 42.41  ? 1134 ILE B CD1   1 
ATOM   7822  N  N     . GLU B 1 381 ? -0.963  169.261 1.982   1.00 55.08  ? 1135 GLU B N     1 
ATOM   7823  C  CA    . GLU B 1 381 ? -1.477  170.366 2.794   1.00 58.33  ? 1135 GLU B CA    1 
ATOM   7824  C  C     . GLU B 1 381 ? -2.091  171.527 1.987   1.00 61.36  ? 1135 GLU B C     1 
ATOM   7825  O  O     . GLU B 1 381 ? -2.784  172.375 2.545   1.00 70.05  ? 1135 GLU B O     1 
ATOM   7826  C  CB    . GLU B 1 381 ? -0.373  170.907 3.702   1.00 58.67  ? 1135 GLU B CB    1 
ATOM   7827  C  CG    . GLU B 1 381 ? 0.644   171.816 2.998   1.00 70.35  ? 1135 GLU B CG    1 
ATOM   7828  C  CD    . GLU B 1 381 ? 1.705   171.041 2.229   1.00 81.75  ? 1135 GLU B CD    1 
ATOM   7829  O  OE1   . GLU B 1 381 ? 1.593   169.787 2.140   1.00 75.07  ? 1135 GLU B OE1   1 
ATOM   7830  O  OE2   . GLU B 1 381 ? 2.650   171.695 1.716   1.00 92.56  ? 1135 GLU B OE2   1 
ATOM   7831  N  N     . LYS B 1 382 ? -1.833  171.568 0.683   1.00 57.80  ? 1136 LYS B N     1 
ATOM   7832  C  CA    . LYS B 1 382 ? -2.240  172.703 -0.145  1.00 56.73  ? 1136 LYS B CA    1 
ATOM   7833  C  C     . LYS B 1 382 ? -3.536  172.510 -0.963  1.00 56.81  ? 1136 LYS B C     1 
ATOM   7834  O  O     . LYS B 1 382 ? -3.683  173.084 -2.033  1.00 61.36  ? 1136 LYS B O     1 
ATOM   7835  C  CB    . LYS B 1 382 ? -1.101  173.070 -1.089  1.00 54.33  ? 1136 LYS B CB    1 
ATOM   7836  C  CG    . LYS B 1 382 ? 0.036   173.757 -0.421  1.00 50.58  ? 1136 LYS B CG    1 
ATOM   7837  C  CD    . LYS B 1 382 ? 1.252   173.816 -1.316  1.00 55.14  ? 1136 LYS B CD    1 
ATOM   7838  C  CE    . LYS B 1 382 ? 2.301   174.789 -0.759  1.00 62.92  ? 1136 LYS B CE    1 
ATOM   7839  N  NZ    . LYS B 1 382 ? 3.482   174.899 -1.673  1.00 68.22  ? 1136 LYS B NZ    1 
ATOM   7840  N  N     . LYS B 1 383 ? -4.473  171.718 -0.461  1.00 57.76  ? 1137 LYS B N     1 
ATOM   7841  C  CA    . LYS B 1 383 ? -5.810  171.619 -1.050  1.00 55.57  ? 1137 LYS B CA    1 
ATOM   7842  C  C     . LYS B 1 383 ? -5.779  171.177 -2.517  1.00 52.48  ? 1137 LYS B C     1 
ATOM   7843  O  O     . LYS B 1 383 ? -6.499  171.725 -3.362  1.00 56.14  ? 1137 LYS B O     1 
ATOM   7844  C  CB    . LYS B 1 383 ? -6.615  172.926 -0.847  1.00 51.40  ? 1137 LYS B CB    1 
ATOM   7845  C  CG    . LYS B 1 383 ? -6.867  173.273 0.628   1.00 54.06  ? 1137 LYS B CG    1 
ATOM   7846  C  CD    . LYS B 1 383 ? -8.157  174.086 0.867   1.00 59.43  ? 1137 LYS B CD    1 
ATOM   7847  N  N     . THR B 1 384 ? -4.969  170.155 -2.786  1.00 50.28  ? 1138 THR B N     1 
ATOM   7848  C  CA    . THR B 1 384 ? -4.660  169.716 -4.145  1.00 53.73  ? 1138 THR B CA    1 
ATOM   7849  C  C     . THR B 1 384 ? -5.379  168.436 -4.523  1.00 54.82  ? 1138 THR B C     1 
ATOM   7850  O  O     . THR B 1 384 ? -5.195  167.905 -5.612  1.00 69.27  ? 1138 THR B O     1 
ATOM   7851  C  CB    . THR B 1 384 ? -3.137  169.407 -4.308  1.00 61.71  ? 1138 THR B CB    1 
ATOM   7852  O  OG1   . THR B 1 384 ? -2.687  168.525 -3.253  1.00 51.55  ? 1138 THR B OG1   1 
ATOM   7853  C  CG2   . THR B 1 384 ? -2.303  170.695 -4.339  1.00 60.18  ? 1138 THR B CG2   1 
ATOM   7854  N  N     . VAL B 1 385 ? -6.197  167.930 -3.630  1.00 52.68  ? 1139 VAL B N     1 
ATOM   7855  C  CA    . VAL B 1 385 ? -6.724  166.595 -3.802  1.00 50.22  ? 1139 VAL B CA    1 
ATOM   7856  C  C     . VAL B 1 385 ? -8.044  166.474 -3.019  1.00 62.91  ? 1139 VAL B C     1 
ATOM   7857  O  O     . VAL B 1 385 ? -8.160  166.993 -1.907  1.00 65.84  ? 1139 VAL B O     1 
ATOM   7858  C  CB    . VAL B 1 385 ? -5.694  165.619 -3.251  1.00 46.26  ? 1139 VAL B CB    1 
ATOM   7859  C  CG1   . VAL B 1 385 ? -6.330  164.697 -2.254  1.00 50.68  ? 1139 VAL B CG1   1 
ATOM   7860  C  CG2   . VAL B 1 385 ? -4.997  164.866 -4.362  1.00 43.72  ? 1139 VAL B CG2   1 
ATOM   7861  N  N     . PRO B 1 386 ? -9.056  165.816 -3.603  1.00 59.68  ? 1140 PRO B N     1 
ATOM   7862  C  CA    . PRO B 1 386 ? -10.358 165.681 -2.928  1.00 64.21  ? 1140 PRO B CA    1 
ATOM   7863  C  C     . PRO B 1 386 ? -10.321 164.873 -1.607  1.00 64.24  ? 1140 PRO B C     1 
ATOM   7864  O  O     . PRO B 1 386 ? -9.731  163.786 -1.516  1.00 47.43  ? 1140 PRO B O     1 
ATOM   7865  C  CB    . PRO B 1 386 ? -11.222 164.968 -3.978  1.00 44.85  ? 1140 PRO B CB    1 
ATOM   7866  C  CG    . PRO B 1 386 ? -10.240 164.240 -4.813  1.00 49.13  ? 1140 PRO B CG    1 
ATOM   7867  C  CD    . PRO B 1 386 ? -9.045  165.141 -4.912  1.00 50.25  ? 1140 PRO B CD    1 
ATOM   7868  N  N     . PHE B 1 387 ? -10.973 165.419 -0.583  1.00 75.08  ? 1141 PHE B N     1 
ATOM   7869  C  CA    . PHE B 1 387 ? -11.060 164.768 0.725   1.00 68.34  ? 1141 PHE B CA    1 
ATOM   7870  C  C     . PHE B 1 387 ? -12.483 164.288 1.004   1.00 69.45  ? 1141 PHE B C     1 
ATOM   7871  O  O     . PHE B 1 387 ? -13.454 164.884 0.538   1.00 78.40  ? 1141 PHE B O     1 
ATOM   7872  C  CB    . PHE B 1 387 ? -10.605 165.723 1.836   1.00 65.28  ? 1141 PHE B CB    1 
ATOM   7873  C  CG    . PHE B 1 387 ? -9.126  165.699 2.094   1.00 63.58  ? 1141 PHE B CG    1 
ATOM   7874  C  CD1   . PHE B 1 387 ? -8.249  166.354 1.257   1.00 58.28  ? 1141 PHE B CD1   1 
ATOM   7875  C  CD2   . PHE B 1 387 ? -8.607  165.017 3.186   1.00 70.37  ? 1141 PHE B CD2   1 
ATOM   7876  C  CE1   . PHE B 1 387 ? -6.872  166.322 1.492   1.00 52.19  ? 1141 PHE B CE1   1 
ATOM   7877  C  CE2   . PHE B 1 387 ? -7.230  164.986 3.421   1.00 58.67  ? 1141 PHE B CE2   1 
ATOM   7878  C  CZ    . PHE B 1 387 ? -6.367  165.643 2.562   1.00 46.43  ? 1141 PHE B CZ    1 
ATOM   7879  N  N     . ALA B 1 388 ? -12.591 163.200 1.753   1.00 60.27  ? 1142 ALA B N     1 
ATOM   7880  C  CA    . ALA B 1 388 ? -13.874 162.676 2.180   1.00 61.80  ? 1142 ALA B CA    1 
ATOM   7881  C  C     . ALA B 1 388 ? -13.848 162.565 3.701   1.00 71.97  ? 1142 ALA B C     1 
ATOM   7882  O  O     . ALA B 1 388 ? -12.760 162.570 4.298   1.00 67.52  ? 1142 ALA B O     1 
ATOM   7883  C  CB    . ALA B 1 388 ? -14.092 161.340 1.571   1.00 49.22  ? 1142 ALA B CB    1 
ATOM   7884  N  N     . TRP B 1 389 ? -15.026 162.481 4.330   1.00 75.14  ? 1143 TRP B N     1 
ATOM   7885  C  CA    . TRP B 1 389 ? -15.088 162.206 5.770   1.00 76.58  ? 1143 TRP B CA    1 
ATOM   7886  C  C     . TRP B 1 389 ? -14.722 160.748 6.061   1.00 74.49  ? 1143 TRP B C     1 
ATOM   7887  O  O     . TRP B 1 389 ? -14.854 159.874 5.190   1.00 76.48  ? 1143 TRP B O     1 
ATOM   7888  C  CB    . TRP B 1 389 ? -16.468 162.522 6.356   1.00 82.22  ? 1143 TRP B CB    1 
ATOM   7889  C  CG    . TRP B 1 389 ? -16.746 163.982 6.505   1.00 85.50  ? 1143 TRP B CG    1 
ATOM   7890  C  CD1   . TRP B 1 389 ? -17.601 164.727 5.755   1.00 90.45  ? 1143 TRP B CD1   1 
ATOM   7891  C  CD2   . TRP B 1 389 ? -16.160 164.881 7.457   1.00 86.37  ? 1143 TRP B CD2   1 
ATOM   7892  N  NE1   . TRP B 1 389 ? -17.592 166.031 6.180   1.00 93.24  ? 1143 TRP B NE1   1 
ATOM   7893  C  CE2   . TRP B 1 389 ? -16.714 166.156 7.222   1.00 88.32  ? 1143 TRP B CE2   1 
ATOM   7894  C  CE3   . TRP B 1 389 ? -15.221 164.733 8.489   1.00 82.89  ? 1143 TRP B CE3   1 
ATOM   7895  C  CZ2   . TRP B 1 389 ? -16.369 167.279 7.981   1.00 83.88  ? 1143 TRP B CZ2   1 
ATOM   7896  C  CZ3   . TRP B 1 389 ? -14.872 165.858 9.244   1.00 77.32  ? 1143 TRP B CZ3   1 
ATOM   7897  C  CH2   . TRP B 1 389 ? -15.448 167.113 8.982   1.00 77.47  ? 1143 TRP B CH2   1 
ATOM   7898  N  N     . ASN B 1 390 ? -14.244 160.495 7.279   1.00 66.49  ? 1144 ASN B N     1 
ATOM   7899  C  CA    . ASN B 1 390 ? -13.928 159.136 7.710   1.00 66.99  ? 1144 ASN B CA    1 
ATOM   7900  C  C     . ASN B 1 390 ? -15.153 158.528 8.382   1.00 74.90  ? 1144 ASN B C     1 
ATOM   7901  O  O     . ASN B 1 390 ? -16.155 159.218 8.566   1.00 84.68  ? 1144 ASN B O     1 
ATOM   7902  C  CB    . ASN B 1 390 ? -12.737 159.151 8.669   1.00 72.80  ? 1144 ASN B CB    1 
ATOM   7903  C  CG    . ASN B 1 390 ? -13.055 159.824 10.024  1.00 81.41  ? 1144 ASN B CG    1 
ATOM   7904  O  OD1   . ASN B 1 390 ? -14.027 160.571 10.169  1.00 87.63  ? 1144 ASN B OD1   1 
ATOM   7905  N  ND2   . ASN B 1 390 ? -12.214 159.554 11.017  1.00 76.95  ? 1144 ASN B ND2   1 
ATOM   7906  N  N     . PHE B 1 391 ? -15.092 157.257 8.763   1.00 68.02  ? 1145 PHE B N     1 
ATOM   7907  C  CA    . PHE B 1 391 ? -16.243 156.619 9.417   1.00 72.37  ? 1145 PHE B CA    1 
ATOM   7908  C  C     . PHE B 1 391 ? -16.729 157.282 10.741  1.00 82.09  ? 1145 PHE B C     1 
ATOM   7909  O  O     . PHE B 1 391 ? -17.922 157.283 11.040  1.00 78.48  ? 1145 PHE B O     1 
ATOM   7910  C  CB    . PHE B 1 391 ? -15.958 155.139 9.637   1.00 74.53  ? 1145 PHE B CB    1 
ATOM   7911  C  CG    . PHE B 1 391 ? -14.768 154.887 10.502  1.00 69.34  ? 1145 PHE B CG    1 
ATOM   7912  C  CD1   . PHE B 1 391 ? -14.827 155.132 11.867  1.00 72.34  ? 1145 PHE B CD1   1 
ATOM   7913  C  CD2   . PHE B 1 391 ? -13.597 154.417 9.959   1.00 58.37  ? 1145 PHE B CD2   1 
ATOM   7914  C  CE1   . PHE B 1 391 ? -13.742 154.918 12.667  1.00 68.15  ? 1145 PHE B CE1   1 
ATOM   7915  C  CE2   . PHE B 1 391 ? -12.500 154.198 10.757  1.00 62.01  ? 1145 PHE B CE2   1 
ATOM   7916  C  CZ    . PHE B 1 391 ? -12.573 154.447 12.116  1.00 68.14  ? 1145 PHE B CZ    1 
ATOM   7917  N  N     . ASP B 1 392 ? -15.813 157.832 11.535  1.00 84.55  ? 1146 ASP B N     1 
ATOM   7918  C  CA    . ASP B 1 392 ? -16.187 158.602 12.721  1.00 85.15  ? 1146 ASP B CA    1 
ATOM   7919  C  C     . ASP B 1 392 ? -16.878 159.901 12.343  1.00 87.76  ? 1146 ASP B C     1 
ATOM   7920  O  O     . ASP B 1 392 ? -17.621 160.478 13.132  1.00 94.46  ? 1146 ASP B O     1 
ATOM   7921  C  CB    . ASP B 1 392 ? -14.944 158.983 13.517  1.00 97.17  ? 1146 ASP B CB    1 
ATOM   7922  C  CG    . ASP B 1 392 ? -14.536 157.925 14.504  1.00 109.72 ? 1146 ASP B CG    1 
ATOM   7923  O  OD1   . ASP B 1 392 ? -15.408 157.117 14.886  1.00 114.99 ? 1146 ASP B OD1   1 
ATOM   7924  O  OD2   . ASP B 1 392 ? -13.346 157.912 14.902  1.00 112.09 ? 1146 ASP B OD2   1 
ATOM   7925  N  N     . ASP B 1 393 ? -16.596 160.389 11.143  1.00 90.81  ? 1147 ASP B N     1 
ATOM   7926  C  CA    . ASP B 1 393 ? -17.003 161.734 10.775  1.00 91.20  ? 1147 ASP B CA    1 
ATOM   7927  C  C     . ASP B 1 393 ? -16.276 162.705 11.678  1.00 84.03  ? 1147 ASP B C     1 
ATOM   7928  O  O     . ASP B 1 393 ? -16.855 163.704 12.121  1.00 83.48  ? 1147 ASP B O     1 
ATOM   7929  C  CB    . ASP B 1 393 ? -18.510 161.907 10.939  1.00 98.62  ? 1147 ASP B CB    1 
ATOM   7930  C  CG    . ASP B 1 393 ? -19.270 161.629 9.658   1.00 105.41 ? 1147 ASP B CG    1 
ATOM   7931  O  OD1   . ASP B 1 393 ? -18.692 161.034 8.719   1.00 98.04  ? 1147 ASP B OD1   1 
ATOM   7932  O  OD2   . ASP B 1 393 ? -20.454 162.013 9.597   1.00 115.93 ? 1147 ASP B OD2   1 
ATOM   7933  N  N     . THR B 1 394 ? -15.007 162.405 11.958  1.00 78.47  ? 1148 THR B N     1 
ATOM   7934  C  CA    . THR B 1 394 ? -14.238 163.208 12.908  1.00 82.76  ? 1148 THR B CA    1 
ATOM   7935  C  C     . THR B 1 394 ? -12.983 163.776 12.277  1.00 70.19  ? 1148 THR B C     1 
ATOM   7936  O  O     . THR B 1 394 ? -12.401 164.730 12.784  1.00 74.45  ? 1148 THR B O     1 
ATOM   7937  C  CB    . THR B 1 394 ? -13.839 162.403 14.168  1.00 86.36  ? 1148 THR B CB    1 
ATOM   7938  O  OG1   . THR B 1 394 ? -12.975 161.321 13.797  1.00 87.37  ? 1148 THR B OG1   1 
ATOM   7939  C  CG2   . THR B 1 394 ? -15.075 161.859 14.865  1.00 87.56  ? 1148 THR B CG2   1 
ATOM   7940  N  N     . GLU B 1 395 ? -12.577 163.188 11.166  1.00 62.66  ? 1149 GLU B N     1 
ATOM   7941  C  CA    . GLU B 1 395 ? -11.345 163.573 10.493  1.00 62.79  ? 1149 GLU B CA    1 
ATOM   7942  C  C     . GLU B 1 395 ? -11.599 163.434 9.002   1.00 68.92  ? 1149 GLU B C     1 
ATOM   7943  O  O     . GLU B 1 395 ? -12.311 162.515 8.564   1.00 70.10  ? 1149 GLU B O     1 
ATOM   7944  C  CB    . GLU B 1 395 ? -10.218 162.629 10.926  1.00 60.83  ? 1149 GLU B CB    1 
ATOM   7945  C  CG    . GLU B 1 395 ? -8.822  163.144 10.703  1.00 83.50  ? 1149 GLU B CG    1 
ATOM   7946  C  CD    . GLU B 1 395 ? -7.799  162.513 11.650  1.00 108.86 ? 1149 GLU B CD    1 
ATOM   7947  O  OE1   . GLU B 1 395 ? -8.201  161.754 12.561  1.00 113.13 ? 1149 GLU B OE1   1 
ATOM   7948  O  OE2   . GLU B 1 395 ? -6.586  162.784 11.486  1.00 123.12 ? 1149 GLU B OE2   1 
ATOM   7949  N  N     . LYS B 1 396 ? -11.047 164.341 8.207   1.00 63.77  ? 1150 LYS B N     1 
ATOM   7950  C  CA    . LYS B 1 396 ? -11.088 164.119 6.769   1.00 58.45  ? 1150 LYS B CA    1 
ATOM   7951  C  C     . LYS B 1 396 ? -9.877  163.269 6.335   1.00 53.05  ? 1150 LYS B C     1 
ATOM   7952  O  O     . LYS B 1 396 ? -8.823  163.285 7.004   1.00 50.55  ? 1150 LYS B O     1 
ATOM   7953  C  CB    . LYS B 1 396 ? -11.251 165.434 5.990   1.00 56.09  ? 1150 LYS B CB    1 
ATOM   7954  C  CG    . LYS B 1 396 ? -12.724 165.889 5.896   1.00 67.43  ? 1150 LYS B CG    1 
ATOM   7955  C  CD    . LYS B 1 396 ? -12.933 167.069 4.947   1.00 79.86  ? 1150 LYS B CD    1 
ATOM   7956  C  CE    . LYS B 1 396 ? -14.282 166.967 4.206   1.00 85.32  ? 1150 LYS B CE    1 
ATOM   7957  N  NZ    . LYS B 1 396 ? -14.185 167.194 2.705   1.00 77.92  ? 1150 LYS B NZ    1 
ATOM   7958  N  N     . GLU B 1 397 ? -10.065 162.477 5.277   1.00 49.28  ? 1151 GLU B N     1 
ATOM   7959  C  CA    . GLU B 1 397 ? -8.971  161.728 4.646   1.00 53.97  ? 1151 GLU B CA    1 
ATOM   7960  C  C     . GLU B 1 397 ? -9.009  161.929 3.145   1.00 60.96  ? 1151 GLU B C     1 
ATOM   7961  O  O     . GLU B 1 397 ? -10.066 162.203 2.575   1.00 66.02  ? 1151 GLU B O     1 
ATOM   7962  C  CB    . GLU B 1 397 ? -9.055  160.229 4.926   1.00 52.80  ? 1151 GLU B CB    1 
ATOM   7963  C  CG    . GLU B 1 397 ? -10.278 159.575 4.324   1.00 62.43  ? 1151 GLU B CG    1 
ATOM   7964  C  CD    . GLU B 1 397 ? -10.304 158.070 4.541   1.00 69.86  ? 1151 GLU B CD    1 
ATOM   7965  O  OE1   . GLU B 1 397 ? -11.404 157.509 4.761   1.00 74.75  ? 1151 GLU B OE1   1 
ATOM   7966  O  OE2   . GLU B 1 397 ? -9.223  157.447 4.475   1.00 67.45  ? 1151 GLU B OE2   1 
ATOM   7967  N  N     . PRO B 1 398 ? -7.851  161.786 2.497   1.00 55.89  ? 1152 PRO B N     1 
ATOM   7968  C  CA    . PRO B 1 398 ? -7.715  161.993 1.060   1.00 52.56  ? 1152 PRO B CA    1 
ATOM   7969  C  C     . PRO B 1 398 ? -8.216  160.758 0.289   1.00 56.73  ? 1152 PRO B C     1 
ATOM   7970  O  O     . PRO B 1 398 ? -8.142  159.655 0.821   1.00 65.03  ? 1152 PRO B O     1 
ATOM   7971  C  CB    . PRO B 1 398 ? -6.210  162.184 0.903   1.00 43.53  ? 1152 PRO B CB    1 
ATOM   7972  C  CG    . PRO B 1 398 ? -5.612  161.336 1.961   1.00 38.79  ? 1152 PRO B CG    1 
ATOM   7973  C  CD    . PRO B 1 398 ? -6.577  161.386 3.122   1.00 48.86  ? 1152 PRO B CD    1 
ATOM   7974  N  N     . THR B 1 399 ? -8.738  160.953 -0.922  1.00 55.24  ? 1153 THR B N     1 
ATOM   7975  C  CA    . THR B 1 399 ? -9.363  159.877 -1.694  1.00 55.70  ? 1153 THR B CA    1 
ATOM   7976  C  C     . THR B 1 399 ? -8.398  159.385 -2.757  1.00 60.30  ? 1153 THR B C     1 
ATOM   7977  O  O     . THR B 1 399 ? -8.598  158.319 -3.342  1.00 64.18  ? 1153 THR B O     1 
ATOM   7978  C  CB    . THR B 1 399 ? -10.660 160.352 -2.406  1.00 54.51  ? 1153 THR B CB    1 
ATOM   7979  O  OG1   . THR B 1 399 ? -10.397 161.515 -3.208  1.00 62.09  ? 1153 THR B OG1   1 
ATOM   7980  C  CG2   . THR B 1 399 ? -11.727 160.706 -1.414  1.00 54.67  ? 1153 THR B CG2   1 
ATOM   7981  N  N     . VAL B 1 400 ? -7.371  160.200 -3.005  1.00 53.99  ? 1154 VAL B N     1 
ATOM   7982  C  CA    . VAL B 1 400 ? -6.279  159.914 -3.929  1.00 43.22  ? 1154 VAL B CA    1 
ATOM   7983  C  C     . VAL B 1 400 ? -5.091  160.765 -3.427  1.00 39.03  ? 1154 VAL B C     1 
ATOM   7984  O  O     . VAL B 1 400 ? -5.301  161.831 -2.876  1.00 35.23  ? 1154 VAL B O     1 
ATOM   7985  C  CB    . VAL B 1 400 ? -6.682  160.306 -5.385  1.00 46.48  ? 1154 VAL B CB    1 
ATOM   7986  C  CG1   . VAL B 1 400 ? -7.133  161.762 -5.450  1.00 45.50  ? 1154 VAL B CG1   1 
ATOM   7987  C  CG2   . VAL B 1 400 ? -5.543  160.094 -6.365  1.00 47.68  ? 1154 VAL B CG2   1 
ATOM   7988  N  N     . LEU B 1 401 ? -3.847  160.319 -3.570  1.00 41.98  ? 1155 LEU B N     1 
ATOM   7989  C  CA    . LEU B 1 401 ? -2.726  161.210 -3.199  1.00 47.89  ? 1155 LEU B CA    1 
ATOM   7990  C  C     . LEU B 1 401 ? -2.212  162.058 -4.364  1.00 53.38  ? 1155 LEU B C     1 
ATOM   7991  O  O     . LEU B 1 401 ? -2.458  161.738 -5.510  1.00 69.18  ? 1155 LEU B O     1 
ATOM   7992  C  CB    . LEU B 1 401 ? -1.572  160.421 -2.605  1.00 43.69  ? 1155 LEU B CB    1 
ATOM   7993  C  CG    . LEU B 1 401 ? -1.905  159.653 -1.336  1.00 44.54  ? 1155 LEU B CG    1 
ATOM   7994  C  CD1   . LEU B 1 401 ? -0.630  159.049 -0.772  1.00 49.13  ? 1155 LEU B CD1   1 
ATOM   7995  C  CD2   . LEU B 1 401 ? -2.546  160.577 -0.326  1.00 43.88  ? 1155 LEU B CD2   1 
ATOM   7996  N  N     . PRO B 1 402 ? -1.499  163.152 -4.071  1.00 52.67  ? 1156 PRO B N     1 
ATOM   7997  C  CA    . PRO B 1 402 ? -0.926  164.039 -5.098  1.00 57.08  ? 1156 PRO B CA    1 
ATOM   7998  C  C     . PRO B 1 402 ? 0.048   163.374 -6.078  1.00 57.82  ? 1156 PRO B C     1 
ATOM   7999  O  O     . PRO B 1 402 ? 0.245   163.916 -7.157  1.00 62.00  ? 1156 PRO B O     1 
ATOM   8000  C  CB    . PRO B 1 402 ? -0.191  165.103 -4.267  1.00 55.86  ? 1156 PRO B CB    1 
ATOM   8001  C  CG    . PRO B 1 402 ? -0.981  165.190 -3.056  1.00 57.15  ? 1156 PRO B CG    1 
ATOM   8002  C  CD    . PRO B 1 402 ? -1.407  163.762 -2.742  1.00 58.24  ? 1156 PRO B CD    1 
ATOM   8003  N  N     . ALA B 1 403 ? 0.673   162.265 -5.690  1.00 56.66  ? 1157 ALA B N     1 
ATOM   8004  C  CA    . ALA B 1 403 ? 1.480   161.444 -6.603  1.00 51.65  ? 1157 ALA B CA    1 
ATOM   8005  C  C     . ALA B 1 403 ? 2.499   162.206 -7.467  1.00 54.34  ? 1157 ALA B C     1 
ATOM   8006  O  O     . ALA B 1 403 ? 2.271   162.449 -8.637  1.00 63.97  ? 1157 ALA B O     1 
ATOM   8007  C  CB    . ALA B 1 403 ? 0.553   160.623 -7.486  1.00 49.88  ? 1157 ALA B CB    1 
ATOM   8008  N  N     . ALA B 1 404 ? 3.641   162.557 -6.906  1.00 51.27  ? 1158 ALA B N     1 
ATOM   8009  C  CA    . ALA B 1 404 ? 4.647   163.269 -7.683  1.00 48.23  ? 1158 ALA B CA    1 
ATOM   8010  C  C     . ALA B 1 404 ? 5.562   162.354 -8.538  1.00 58.33  ? 1158 ALA B C     1 
ATOM   8011  O  O     . ALA B 1 404 ? 6.457   162.839 -9.233  1.00 58.44  ? 1158 ALA B O     1 
ATOM   8012  C  CB    . ALA B 1 404 ? 5.455   164.178 -6.786  1.00 48.29  ? 1158 ALA B CB    1 
ATOM   8013  N  N     . PHE B 1 405 ? 5.339   161.042 -8.477  1.00 60.15  ? 1159 PHE B N     1 
ATOM   8014  C  CA    . PHE B 1 405 ? 5.887   160.104 -9.472  1.00 63.01  ? 1159 PHE B CA    1 
ATOM   8015  C  C     . PHE B 1 405 ? 4.797   159.067 -9.749  1.00 68.96  ? 1159 PHE B C     1 
ATOM   8016  O  O     . PHE B 1 405 ? 3.906   158.902 -8.913  1.00 77.43  ? 1159 PHE B O     1 
ATOM   8017  C  CB    . PHE B 1 405 ? 7.209   159.456 -9.017  1.00 64.62  ? 1159 PHE B CB    1 
ATOM   8018  C  CG    . PHE B 1 405 ? 7.058   158.440 -7.904  1.00 67.83  ? 1159 PHE B CG    1 
ATOM   8019  C  CD1   . PHE B 1 405 ? 6.742   157.115 -8.187  1.00 69.94  ? 1159 PHE B CD1   1 
ATOM   8020  C  CD2   . PHE B 1 405 ? 7.258   158.801 -6.588  1.00 62.48  ? 1159 PHE B CD2   1 
ATOM   8021  C  CE1   . PHE B 1 405 ? 6.606   156.173 -7.177  1.00 55.58  ? 1159 PHE B CE1   1 
ATOM   8022  C  CE2   . PHE B 1 405 ? 7.128   157.876 -5.581  1.00 62.33  ? 1159 PHE B CE2   1 
ATOM   8023  C  CZ    . PHE B 1 405 ? 6.794   156.556 -5.880  1.00 62.35  ? 1159 PHE B CZ    1 
ATOM   8024  N  N     . PRO B 1 406 ? 4.834   158.397 -10.925 1.00 66.95  ? 1160 PRO B N     1 
ATOM   8025  C  CA    . PRO B 1 406 ? 3.741   157.512 -11.371 1.00 68.58  ? 1160 PRO B CA    1 
ATOM   8026  C  C     . PRO B 1 406 ? 3.827   156.142 -10.716 1.00 65.01  ? 1160 PRO B C     1 
ATOM   8027  O  O     . PRO B 1 406 ? 4.380   155.180 -11.262 1.00 64.85  ? 1160 PRO B O     1 
ATOM   8028  C  CB    . PRO B 1 406 ? 3.953   157.402 -12.890 1.00 61.90  ? 1160 PRO B CB    1 
ATOM   8029  C  CG    . PRO B 1 406 ? 4.974   158.416 -13.219 1.00 67.89  ? 1160 PRO B CG    1 
ATOM   8030  C  CD    . PRO B 1 406 ? 5.832   158.554 -11.982 1.00 68.37  ? 1160 PRO B CD    1 
ATOM   8031  N  N     . ASN B 1 407 ? 3.262   156.072 -9.523  1.00 59.94  ? 1161 ASN B N     1 
ATOM   8032  C  CA    . ASN B 1 407 ? 3.543   154.968 -8.623  1.00 58.49  ? 1161 ASN B CA    1 
ATOM   8033  C  C     . ASN B 1 407 ? 2.942   153.658 -9.141  1.00 51.08  ? 1161 ASN B C     1 
ATOM   8034  O  O     . ASN B 1 407 ? 3.535   152.599 -8.924  1.00 53.72  ? 1161 ASN B O     1 
ATOM   8035  C  CB    . ASN B 1 407 ? 3.108   155.321 -7.177  1.00 45.80  ? 1161 ASN B CB    1 
ATOM   8036  C  CG    . ASN B 1 407 ? 3.336   154.195 -6.204  1.00 52.44  ? 1161 ASN B CG    1 
ATOM   8037  O  OD1   . ASN B 1 407 ? 4.479   153.815 -5.913  1.00 54.21  ? 1161 ASN B OD1   1 
ATOM   8038  N  ND2   . ASN B 1 407 ? 2.245   153.650 -5.681  1.00 59.23  ? 1161 ASN B ND2   1 
ATOM   8039  N  N     . LEU B 1 408 ? 1.806   153.729 -9.853  1.00 39.47  ? 1162 LEU B N     1 
ATOM   8040  C  CA    . LEU B 1 408 ? 1.170   152.508 -10.365 1.00 37.90  ? 1162 LEU B CA    1 
ATOM   8041  C  C     . LEU B 1 408 ? 2.168   151.650 -11.137 1.00 45.76  ? 1162 LEU B C     1 
ATOM   8042  O  O     . LEU B 1 408 ? 2.320   150.457 -10.847 1.00 48.74  ? 1162 LEU B O     1 
ATOM   8043  C  CB    . LEU B 1 408 ? -0.022  152.810 -11.268 1.00 41.60  ? 1162 LEU B CB    1 
ATOM   8044  C  CG    . LEU B 1 408 ? -1.249  151.891 -11.221 1.00 43.17  ? 1162 LEU B CG    1 
ATOM   8045  C  CD1   . LEU B 1 408 ? -1.806  151.632 -12.594 1.00 40.53  ? 1162 LEU B CD1   1 
ATOM   8046  C  CD2   . LEU B 1 408 ? -0.895  150.592 -10.587 1.00 54.78  ? 1162 LEU B CD2   1 
ATOM   8047  N  N     . LEU B 1 409 ? 2.868   152.257 -12.098 1.00 45.90  ? 1163 LEU B N     1 
ATOM   8048  C  CA    . LEU B 1 409 ? 3.794   151.482 -12.919 1.00 45.52  ? 1163 LEU B CA    1 
ATOM   8049  C  C     . LEU B 1 409 ? 5.082   151.152 -12.199 1.00 52.73  ? 1163 LEU B C     1 
ATOM   8050  O  O     . LEU B 1 409 ? 5.591   150.046 -12.322 1.00 63.68  ? 1163 LEU B O     1 
ATOM   8051  C  CB    . LEU B 1 409 ? 4.091   152.178 -14.248 1.00 49.56  ? 1163 LEU B CB    1 
ATOM   8052  C  CG    . LEU B 1 409 ? 2.925   152.088 -15.230 1.00 49.62  ? 1163 LEU B CG    1 
ATOM   8053  C  CD1   . LEU B 1 409 ? 3.115   153.088 -16.367 1.00 40.60  ? 1163 LEU B CD1   1 
ATOM   8054  C  CD2   . LEU B 1 409 ? 2.758   150.653 -15.703 1.00 37.02  ? 1163 LEU B CD2   1 
ATOM   8055  N  N     . VAL B 1 410 ? 5.620   152.105 -11.450 1.00 49.66  ? 1164 VAL B N     1 
ATOM   8056  C  CA    . VAL B 1 410 ? 6.886   151.870 -10.761 1.00 45.25  ? 1164 VAL B CA    1 
ATOM   8057  C  C     . VAL B 1 410 ? 6.798   150.734 -9.739  1.00 45.44  ? 1164 VAL B C     1 
ATOM   8058  O  O     . VAL B 1 410 ? 7.617   149.814 -9.746  1.00 49.66  ? 1164 VAL B O     1 
ATOM   8059  C  CB    . VAL B 1 410 ? 7.364   153.117 -10.038 1.00 46.45  ? 1164 VAL B CB    1 
ATOM   8060  C  CG1   . VAL B 1 410 ? 8.661   152.817 -9.283  1.00 57.50  ? 1164 VAL B CG1   1 
ATOM   8061  C  CG2   . VAL B 1 410 ? 7.539   154.266 -11.014 1.00 41.31  ? 1164 VAL B CG2   1 
ATOM   8062  N  N     . ASN B 1 411 ? 5.805   150.790 -8.861  1.00 43.21  ? 1165 ASN B N     1 
ATOM   8063  C  CA    . ASN B 1 411 ? 5.710   149.768 -7.828  1.00 48.23  ? 1165 ASN B CA    1 
ATOM   8064  C  C     . ASN B 1 411 ? 4.805   148.583 -8.147  1.00 58.06  ? 1165 ASN B C     1 
ATOM   8065  O  O     . ASN B 1 411 ? 5.002   147.498 -7.603  1.00 70.86  ? 1165 ASN B O     1 
ATOM   8066  C  CB    . ASN B 1 411 ? 5.383   150.375 -6.461  1.00 48.45  ? 1165 ASN B CB    1 
ATOM   8067  C  CG    . ASN B 1 411 ? 6.634   150.734 -5.671  1.00 47.72  ? 1165 ASN B CG    1 
ATOM   8068  O  OD1   . ASN B 1 411 ? 7.660   150.047 -5.747  1.00 50.87  ? 1165 ASN B OD1   1 
ATOM   8069  N  ND2   . ASN B 1 411 ? 6.553   151.814 -4.909  1.00 44.78  ? 1165 ASN B ND2   1 
ATOM   8070  N  N     . GLY B 1 412 ? 3.830   148.771 -9.029  1.00 49.32  ? 1166 GLY B N     1 
ATOM   8071  C  CA    . GLY B 1 412 ? 3.017   147.648 -9.456  1.00 48.55  ? 1166 GLY B CA    1 
ATOM   8072  C  C     . GLY B 1 412 ? 1.819   147.458 -8.563  1.00 53.74  ? 1166 GLY B C     1 
ATOM   8073  O  O     . GLY B 1 412 ? 1.528   148.311 -7.725  1.00 64.08  ? 1166 GLY B O     1 
ATOM   8074  N  N     . SER B 1 413 ? 1.122   146.343 -8.743  1.00 52.32  ? 1167 SER B N     1 
ATOM   8075  C  CA    . SER B 1 413 ? -0.022  146.027 -7.906  1.00 60.39  ? 1167 SER B CA    1 
ATOM   8076  C  C     . SER B 1 413 ? -0.531  144.626 -8.192  1.00 64.81  ? 1167 SER B C     1 
ATOM   8077  O  O     . SER B 1 413 ? -0.255  144.080 -9.241  1.00 75.30  ? 1167 SER B O     1 
ATOM   8078  C  CB    . SER B 1 413 ? -1.143  147.034 -8.147  1.00 65.19  ? 1167 SER B CB    1 
ATOM   8079  O  OG    . SER B 1 413 ? -2.019  147.081 -7.029  1.00 66.52  ? 1167 SER B OG    1 
ATOM   8080  N  N     . THR B 1 414 ? -1.306  144.068 -7.270  1.00 64.04  ? 1168 THR B N     1 
ATOM   8081  C  CA    . THR B 1 414 ? -1.877  142.729 -7.410  1.00 59.80  ? 1168 THR B CA    1 
ATOM   8082  C  C     . THR B 1 414 ? -2.628  142.501 -6.099  1.00 59.38  ? 1168 THR B C     1 
ATOM   8083  O  O     . THR B 1 414 ? -2.058  142.825 -5.049  1.00 72.60  ? 1168 THR B O     1 
ATOM   8084  C  CB    . THR B 1 414 ? -0.732  141.675 -7.568  1.00 66.62  ? 1168 THR B CB    1 
ATOM   8085  O  OG1   . THR B 1 414 ? -1.045  140.480 -6.850  1.00 72.34  ? 1168 THR B OG1   1 
ATOM   8086  C  CG2   . THR B 1 414 ? 0.588   142.213 -7.015  1.00 64.12  ? 1168 THR B CG2   1 
ATOM   8087  N  N     . GLY B 1 415 ? -3.898  142.055 -6.095  1.00 45.37  ? 1169 GLY B N     1 
ATOM   8088  C  CA    . GLY B 1 415 ? -4.804  141.995 -7.224  1.00 54.94  ? 1169 GLY B CA    1 
ATOM   8089  C  C     . GLY B 1 415 ? -5.823  140.846 -7.303  1.00 62.68  ? 1169 GLY B C     1 
ATOM   8090  O  O     . GLY B 1 415 ? -5.771  140.064 -8.264  1.00 69.01  ? 1169 GLY B O     1 
ATOM   8091  N  N     . ILE B 1 416 ? -6.744  140.735 -6.338  1.00 42.91  ? 1170 ILE B N     1 
ATOM   8092  C  CA    . ILE B 1 416 ? -7.933  139.850 -6.499  1.00 44.63  ? 1170 ILE B CA    1 
ATOM   8093  C  C     . ILE B 1 416 ? -9.253  140.386 -5.889  1.00 53.12  ? 1170 ILE B C     1 
ATOM   8094  O  O     . ILE B 1 416 ? -9.368  140.555 -4.684  1.00 60.53  ? 1170 ILE B O     1 
ATOM   8095  C  CB    . ILE B 1 416 ? -7.761  138.465 -5.868  1.00 47.46  ? 1170 ILE B CB    1 
ATOM   8096  C  CG1   . ILE B 1 416 ? -6.514  137.755 -6.377  1.00 51.25  ? 1170 ILE B CG1   1 
ATOM   8097  C  CG2   . ILE B 1 416 ? -9.040  137.632 -6.087  1.00 46.61  ? 1170 ILE B CG2   1 
ATOM   8098  C  CD1   . ILE B 1 416 ? -6.134  136.519 -5.540  1.00 42.93  ? 1170 ILE B CD1   1 
ATOM   8099  N  N     . SER B 1 417 ? -10.268 140.583 -6.715  1.00 52.52  ? 1171 SER B N     1 
ATOM   8100  C  CA    . SER B 1 417 ? -11.524 141.161 -6.254  1.00 50.34  ? 1171 SER B CA    1 
ATOM   8101  C  C     . SER B 1 417 ? -12.708 140.215 -6.491  1.00 63.66  ? 1171 SER B C     1 
ATOM   8102  O  O     . SER B 1 417 ? -12.607 138.998 -6.298  1.00 73.95  ? 1171 SER B O     1 
ATOM   8103  C  CB    . SER B 1 417 ? -11.756 142.473 -6.992  1.00 56.41  ? 1171 SER B CB    1 
ATOM   8104  O  OG    . SER B 1 417 ? -13.010 143.035 -6.679  1.00 70.43  ? 1171 SER B OG    1 
ATOM   8105  N  N     . ALA B 1 418 ? -13.837 140.789 -6.891  1.00 65.14  ? 1172 ALA B N     1 
ATOM   8106  C  CA    . ALA B 1 418 ? -14.962 140.013 -7.411  1.00 68.33  ? 1172 ALA B CA    1 
ATOM   8107  C  C     . ALA B 1 418 ? -15.199 140.353 -8.897  1.00 75.65  ? 1172 ALA B C     1 
ATOM   8108  O  O     . ALA B 1 418 ? -15.424 141.512 -9.251  1.00 75.03  ? 1172 ALA B O     1 
ATOM   8109  C  CB    . ALA B 1 418 ? -16.210 140.284 -6.601  1.00 67.91  ? 1172 ALA B CB    1 
ATOM   8110  N  N     . GLY B 1 419 ? -15.129 139.347 -9.765  1.00 76.70  ? 1173 GLY B N     1 
ATOM   8111  C  CA    . GLY B 1 419 ? -15.316 139.570 -11.187 1.00 75.18  ? 1173 GLY B CA    1 
ATOM   8112  C  C     . GLY B 1 419 ? -14.109 140.203 -11.864 1.00 73.08  ? 1173 GLY B C     1 
ATOM   8113  O  O     . GLY B 1 419 ? -14.025 140.238 -13.097 1.00 76.30  ? 1173 GLY B O     1 
ATOM   8114  N  N     . TYR B 1 420 ? -13.176 140.705 -11.057 1.00 66.81  ? 1174 TYR B N     1 
ATOM   8115  C  CA    . TYR B 1 420 ? -11.925 141.266 -11.564 1.00 65.19  ? 1174 TYR B CA    1 
ATOM   8116  C  C     . TYR B 1 420 ? -10.762 140.891 -10.664 1.00 65.41  ? 1174 TYR B C     1 
ATOM   8117  O  O     . TYR B 1 420 ? -10.915 140.748 -9.445  1.00 62.00  ? 1174 TYR B O     1 
ATOM   8118  C  CB    . TYR B 1 420 ? -12.007 142.795 -11.637 1.00 67.00  ? 1174 TYR B CB    1 
ATOM   8119  C  CG    . TYR B 1 420 ? -13.120 143.304 -12.515 1.00 72.35  ? 1174 TYR B CG    1 
ATOM   8120  C  CD1   . TYR B 1 420 ? -14.425 143.418 -12.029 1.00 76.41  ? 1174 TYR B CD1   1 
ATOM   8121  C  CD2   . TYR B 1 420 ? -12.874 143.666 -13.829 1.00 69.69  ? 1174 TYR B CD2   1 
ATOM   8122  C  CE1   . TYR B 1 420 ? -15.451 143.876 -12.832 1.00 76.35  ? 1174 TYR B CE1   1 
ATOM   8123  C  CE2   . TYR B 1 420 ? -13.891 144.121 -14.636 1.00 81.32  ? 1174 TYR B CE2   1 
ATOM   8124  C  CZ    . TYR B 1 420 ? -15.178 144.225 -14.142 1.00 87.12  ? 1174 TYR B CZ    1 
ATOM   8125  O  OH    . TYR B 1 420 ? -16.181 144.687 -14.977 1.00 99.88  ? 1174 TYR B OH    1 
ATOM   8126  N  N     . ALA B 1 421 ? -9.590  140.753 -11.266 1.00 67.55  ? 1175 ALA B N     1 
ATOM   8127  C  CA    . ALA B 1 421 ? -8.354  140.658 -10.497 1.00 61.09  ? 1175 ALA B CA    1 
ATOM   8128  C  C     . ALA B 1 421 ? -7.296  141.524 -11.184 1.00 61.34  ? 1175 ALA B C     1 
ATOM   8129  O  O     . ALA B 1 421 ? -7.548  142.075 -12.260 1.00 68.32  ? 1175 ALA B O     1 
ATOM   8130  C  CB    . ALA B 1 421 ? -7.909  139.221 -10.386 1.00 62.80  ? 1175 ALA B CB    1 
ATOM   8131  N  N     . THR B 1 422 ? -6.127  141.686 -10.572 1.00 53.56  ? 1176 THR B N     1 
ATOM   8132  C  CA    . THR B 1 422 ? -5.140  142.595 -11.158 1.00 57.04  ? 1176 THR B CA    1 
ATOM   8133  C  C     . THR B 1 422 ? -3.730  142.101 -10.941 1.00 58.80  ? 1176 THR B C     1 
ATOM   8134  O  O     . THR B 1 422 ? -3.399  141.599 -9.856  1.00 64.27  ? 1176 THR B O     1 
ATOM   8135  C  CB    . THR B 1 422 ? -5.265  144.056 -10.607 1.00 67.52  ? 1176 THR B CB    1 
ATOM   8136  O  OG1   . THR B 1 422 ? -4.547  144.963 -11.451 1.00 73.40  ? 1176 THR B OG1   1 
ATOM   8137  C  CG2   . THR B 1 422 ? -4.697  144.157 -9.222  1.00 60.68  ? 1176 THR B CG2   1 
ATOM   8138  N  N     . ASP B 1 423 ? -2.922  142.213 -11.994 1.00 58.58  ? 1177 ASP B N     1 
ATOM   8139  C  CA    . ASP B 1 423 ? -1.476  142.023 -11.900 1.00 61.32  ? 1177 ASP B CA    1 
ATOM   8140  C  C     . ASP B 1 423 ? -0.708  142.998 -12.789 1.00 60.61  ? 1177 ASP B C     1 
ATOM   8141  O  O     . ASP B 1 423 ? -0.796  142.963 -14.009 1.00 64.91  ? 1177 ASP B O     1 
ATOM   8142  C  CB    . ASP B 1 423 ? -1.051  140.570 -12.137 1.00 68.16  ? 1177 ASP B CB    1 
ATOM   8143  C  CG    . ASP B 1 423 ? -0.448  139.931 -10.882 1.00 85.80  ? 1177 ASP B CG    1 
ATOM   8144  O  OD1   . ASP B 1 423 ? 0.685   140.335 -10.461 1.00 88.53  ? 1177 ASP B OD1   1 
ATOM   8145  O  OD2   . ASP B 1 423 ? -1.120  139.029 -10.317 1.00 87.75  ? 1177 ASP B OD2   1 
ATOM   8146  N  N     . ILE B 1 424 ? 0.019   143.892 -12.139 1.00 61.90  ? 1178 ILE B N     1 
ATOM   8147  C  CA    . ILE B 1 424 ? 0.820   144.893 -12.803 1.00 53.01  ? 1178 ILE B CA    1 
ATOM   8148  C  C     . ILE B 1 424 ? 2.217   144.812 -12.221 1.00 51.04  ? 1178 ILE B C     1 
ATOM   8149  O  O     . ILE B 1 424 ? 2.420   145.046 -11.023 1.00 43.16  ? 1178 ILE B O     1 
ATOM   8150  C  CB    . ILE B 1 424 ? 0.332   146.286 -12.468 1.00 53.77  ? 1178 ILE B CB    1 
ATOM   8151  C  CG1   . ILE B 1 424 ? -1.054  146.550 -13.034 1.00 53.47  ? 1178 ILE B CG1   1 
ATOM   8152  C  CG2   . ILE B 1 424 ? 1.282   147.292 -13.023 1.00 61.56  ? 1178 ILE B CG2   1 
ATOM   8153  C  CD1   . ILE B 1 424 ? -1.558  147.959 -12.673 1.00 49.37  ? 1178 ILE B CD1   1 
ATOM   8154  N  N     . PRO B 1 425 ? 3.195   144.512 -13.069 1.00 53.97  ? 1179 PRO B N     1 
ATOM   8155  C  CA    . PRO B 1 425 ? 4.577   144.332 -12.621 1.00 51.55  ? 1179 PRO B CA    1 
ATOM   8156  C  C     . PRO B 1 425 ? 5.229   145.698 -12.385 1.00 48.38  ? 1179 PRO B C     1 
ATOM   8157  O  O     . PRO B 1 425 ? 4.775   146.686 -12.937 1.00 40.03  ? 1179 PRO B O     1 
ATOM   8158  C  CB    . PRO B 1 425 ? 5.221   143.620 -13.806 1.00 52.54  ? 1179 PRO B CB    1 
ATOM   8159  C  CG    . PRO B 1 425 ? 4.490   144.194 -15.003 1.00 53.61  ? 1179 PRO B CG    1 
ATOM   8160  C  CD    . PRO B 1 425 ? 3.085   144.577 -14.537 1.00 49.80  ? 1179 PRO B CD    1 
ATOM   8161  N  N     . PRO B 1 426 ? 6.274   145.751 -11.552 1.00 53.02  ? 1180 PRO B N     1 
ATOM   8162  C  CA    . PRO B 1 426 ? 6.996   146.993 -11.241 1.00 47.50  ? 1180 PRO B CA    1 
ATOM   8163  C  C     . PRO B 1 426 ? 7.842   147.473 -12.417 1.00 51.27  ? 1180 PRO B C     1 
ATOM   8164  O  O     . PRO B 1 426 ? 8.226   146.683 -13.277 1.00 45.44  ? 1180 PRO B O     1 
ATOM   8165  C  CB    . PRO B 1 426 ? 7.943   146.584 -10.112 1.00 49.93  ? 1180 PRO B CB    1 
ATOM   8166  C  CG    . PRO B 1 426 ? 7.540   145.177 -9.713  1.00 59.30  ? 1180 PRO B CG    1 
ATOM   8167  C  CD    . PRO B 1 426 ? 6.841   144.577 -10.867 1.00 58.38  ? 1180 PRO B CD    1 
ATOM   8168  N  N     . HIS B 1 427 ? 8.173   148.759 -12.407 1.00 55.24  ? 1181 HIS B N     1 
ATOM   8169  C  CA    . HIS B 1 427 ? 8.933   149.372 -13.480 1.00 53.67  ? 1181 HIS B CA    1 
ATOM   8170  C  C     . HIS B 1 427 ? 10.077  150.279 -13.000 1.00 55.67  ? 1181 HIS B C     1 
ATOM   8171  O  O     . HIS B 1 427 ? 10.070  150.767 -11.874 1.00 58.40  ? 1181 HIS B O     1 
ATOM   8172  C  CB    . HIS B 1 427 ? 7.981   150.165 -14.367 1.00 47.75  ? 1181 HIS B CB    1 
ATOM   8173  C  CG    . HIS B 1 427 ? 7.084   149.305 -15.205 1.00 49.95  ? 1181 HIS B CG    1 
ATOM   8174  N  ND1   . HIS B 1 427 ? 6.033   148.586 -14.676 1.00 50.94  ? 1181 HIS B ND1   1 
ATOM   8175  C  CD2   . HIS B 1 427 ? 7.092   149.041 -16.533 1.00 51.86  ? 1181 HIS B CD2   1 
ATOM   8176  C  CE1   . HIS B 1 427 ? 5.416   147.934 -15.647 1.00 48.56  ? 1181 HIS B CE1   1 
ATOM   8177  N  NE2   . HIS B 1 427 ? 6.036   148.194 -16.782 1.00 50.91  ? 1181 HIS B NE2   1 
ATOM   8178  N  N     . ASN B 1 428 ? 11.056  150.512 -13.866 1.00 52.86  ? 1182 ASN B N     1 
ATOM   8179  C  CA    . ASN B 1 428 ? 12.142  151.409 -13.525 1.00 50.01  ? 1182 ASN B CA    1 
ATOM   8180  C  C     . ASN B 1 428 ? 11.687  152.877 -13.478 1.00 58.39  ? 1182 ASN B C     1 
ATOM   8181  O  O     . ASN B 1 428 ? 11.305  153.452 -14.512 1.00 58.27  ? 1182 ASN B O     1 
ATOM   8182  C  CB    . ASN B 1 428 ? 13.288  151.250 -14.517 1.00 44.68  ? 1182 ASN B CB    1 
ATOM   8183  C  CG    . ASN B 1 428 ? 14.487  152.080 -14.136 1.00 56.05  ? 1182 ASN B CG    1 
ATOM   8184  O  OD1   . ASN B 1 428 ? 14.514  153.293 -14.350 1.00 64.47  ? 1182 ASN B OD1   1 
ATOM   8185  N  ND2   . ASN B 1 428 ? 15.483  151.437 -13.547 1.00 59.85  ? 1182 ASN B ND2   1 
ATOM   8186  N  N     . LEU B 1 429 ? 11.741  153.490 -12.291 1.00 59.52  ? 1183 LEU B N     1 
ATOM   8187  C  CA    . LEU B 1 429 ? 11.373  154.908 -12.150 1.00 54.79  ? 1183 LEU B CA    1 
ATOM   8188  C  C     . LEU B 1 429 ? 11.821  155.849 -13.299 1.00 59.93  ? 1183 LEU B C     1 
ATOM   8189  O  O     . LEU B 1 429 ? 11.033  156.693 -13.741 1.00 56.07  ? 1183 LEU B O     1 
ATOM   8190  C  CB    . LEU B 1 429 ? 11.894  155.473 -10.837 1.00 49.89  ? 1183 LEU B CB    1 
ATOM   8191  C  CG    . LEU B 1 429 ? 11.087  156.559 -10.125 1.00 48.03  ? 1183 LEU B CG    1 
ATOM   8192  C  CD1   . LEU B 1 429 ? 12.003  157.361 -9.274  1.00 45.97  ? 1183 LEU B CD1   1 
ATOM   8193  C  CD2   . LEU B 1 429 ? 10.414  157.463 -11.101 1.00 59.29  ? 1183 LEU B CD2   1 
ATOM   8194  N  N     . ALA B 1 430 ? 13.069  155.740 -13.767 1.00 59.04  ? 1184 ALA B N     1 
ATOM   8195  C  CA    . ALA B 1 430 ? 13.550  156.690 -14.790 1.00 53.31  ? 1184 ALA B CA    1 
ATOM   8196  C  C     . ALA B 1 430 ? 12.882  156.436 -16.122 1.00 57.67  ? 1184 ALA B C     1 
ATOM   8197  O  O     . ALA B 1 430 ? 12.467  157.377 -16.810 1.00 61.54  ? 1184 ALA B O     1 
ATOM   8198  C  CB    . ALA B 1 430 ? 15.058  156.661 -14.949 1.00 49.16  ? 1184 ALA B CB    1 
ATOM   8199  N  N     . GLU B 1 431 ? 12.757  155.163 -16.476 1.00 53.69  ? 1185 GLU B N     1 
ATOM   8200  C  CA    . GLU B 1 431 ? 11.993  154.809 -17.669 1.00 51.99  ? 1185 GLU B CA    1 
ATOM   8201  C  C     . GLU B 1 431 ? 10.538  155.303 -17.620 1.00 55.66  ? 1185 GLU B C     1 
ATOM   8202  O  O     . GLU B 1 431 ? 10.147  156.084 -18.495 1.00 64.83  ? 1185 GLU B O     1 
ATOM   8203  C  CB    . GLU B 1 431 ? 12.132  153.319 -17.986 1.00 49.69  ? 1185 GLU B CB    1 
ATOM   8204  C  CG    . GLU B 1 431 ? 13.610  152.928 -17.982 1.00 58.61  ? 1185 GLU B CG    1 
ATOM   8205  C  CD    . GLU B 1 431 ? 13.868  151.462 -18.217 1.00 69.66  ? 1185 GLU B CD    1 
ATOM   8206  O  OE1   . GLU B 1 431 ? 12.900  150.670 -18.197 1.00 81.42  ? 1185 GLU B OE1   1 
ATOM   8207  O  OE2   . GLU B 1 431 ? 15.056  151.104 -18.416 1.00 64.02  ? 1185 GLU B OE2   1 
ATOM   8208  N  N     . VAL B 1 432 ? 9.754   154.915 -16.603 1.00 45.87  ? 1186 VAL B N     1 
ATOM   8209  C  CA    . VAL B 1 432 ? 8.377   155.417 -16.497 1.00 48.02  ? 1186 VAL B CA    1 
ATOM   8210  C  C     . VAL B 1 432 ? 8.290   156.951 -16.654 1.00 56.36  ? 1186 VAL B C     1 
ATOM   8211  O  O     . VAL B 1 432 ? 7.456   157.463 -17.407 1.00 61.77  ? 1186 VAL B O     1 
ATOM   8212  C  CB    . VAL B 1 432 ? 7.676   154.995 -15.191 1.00 49.85  ? 1186 VAL B CB    1 
ATOM   8213  C  CG1   . VAL B 1 432 ? 6.199   155.456 -15.182 1.00 36.92  ? 1186 VAL B CG1   1 
ATOM   8214  C  CG2   . VAL B 1 432 ? 7.746   153.497 -15.010 1.00 55.60  ? 1186 VAL B CG2   1 
ATOM   8215  N  N     . ILE B 1 433 ? 9.153   157.682 -15.957 1.00 54.02  ? 1187 ILE B N     1 
ATOM   8216  C  CA    . ILE B 1 433 ? 9.164   159.138 -16.056 1.00 47.44  ? 1187 ILE B CA    1 
ATOM   8217  C  C     . ILE B 1 433 ? 9.542   159.601 -17.460 1.00 56.26  ? 1187 ILE B C     1 
ATOM   8218  O  O     . ILE B 1 433 ? 8.956   160.552 -17.988 1.00 64.83  ? 1187 ILE B O     1 
ATOM   8219  C  CB    . ILE B 1 433 ? 10.086  159.769 -14.988 1.00 49.24  ? 1187 ILE B CB    1 
ATOM   8220  C  CG1   . ILE B 1 433 ? 9.401   159.721 -13.627 1.00 55.85  ? 1187 ILE B CG1   1 
ATOM   8221  C  CG2   . ILE B 1 433 ? 10.383  161.221 -15.280 1.00 47.79  ? 1187 ILE B CG2   1 
ATOM   8222  C  CD1   . ILE B 1 433 ? 10.201  160.389 -12.549 1.00 61.52  ? 1187 ILE B CD1   1 
ATOM   8223  N  N     . ASP B 1 434 ? 10.492  158.925 -18.097 1.00 54.83  ? 1188 ASP B N     1 
ATOM   8224  C  CA    . ASP B 1 434 ? 10.806  159.312 -19.471 1.00 59.78  ? 1188 ASP B CA    1 
ATOM   8225  C  C     . ASP B 1 434 ? 9.592   159.171 -20.386 1.00 57.93  ? 1188 ASP B C     1 
ATOM   8226  O  O     . ASP B 1 434 ? 9.269   160.096 -21.137 1.00 62.75  ? 1188 ASP B O     1 
ATOM   8227  C  CB    . ASP B 1 434 ? 12.045  158.602 -20.009 1.00 64.46  ? 1188 ASP B CB    1 
ATOM   8228  C  CG    . ASP B 1 434 ? 13.321  159.085 -19.326 1.00 73.02  ? 1188 ASP B CG    1 
ATOM   8229  O  OD1   . ASP B 1 434 ? 13.265  160.170 -18.680 1.00 71.33  ? 1188 ASP B OD1   1 
ATOM   8230  O  OD2   . ASP B 1 434 ? 14.364  158.385 -19.422 1.00 78.11  ? 1188 ASP B OD2   1 
ATOM   8231  N  N     . ALA B 1 435 ? 8.892   158.046 -20.292 1.00 52.06  ? 1189 ALA B N     1 
ATOM   8232  C  CA    . ALA B 1 435 ? 7.668   157.872 -21.066 1.00 52.07  ? 1189 ALA B CA    1 
ATOM   8233  C  C     . ALA B 1 435 ? 6.697   159.019 -20.816 1.00 55.73  ? 1189 ALA B C     1 
ATOM   8234  O  O     . ALA B 1 435 ? 6.197   159.628 -21.755 1.00 63.94  ? 1189 ALA B O     1 
ATOM   8235  C  CB    . ALA B 1 435 ? 7.015   156.531 -20.766 1.00 49.51  ? 1189 ALA B CB    1 
ATOM   8236  N  N     . ALA B 1 436 ? 6.445   159.325 -19.549 1.00 50.56  ? 1190 ALA B N     1 
ATOM   8237  C  CA    . ALA B 1 436 ? 5.476   160.357 -19.199 1.00 51.75  ? 1190 ALA B CA    1 
ATOM   8238  C  C     . ALA B 1 436 ? 5.861   161.681 -19.817 1.00 57.20  ? 1190 ALA B C     1 
ATOM   8239  O  O     . ALA B 1 436 ? 5.024   162.390 -20.382 1.00 57.25  ? 1190 ALA B O     1 
ATOM   8240  C  CB    . ALA B 1 436 ? 5.353   160.511 -17.659 1.00 46.23  ? 1190 ALA B CB    1 
ATOM   8241  N  N     . VAL B 1 437 ? 7.131   162.039 -19.685 1.00 57.29  ? 1191 VAL B N     1 
ATOM   8242  C  CA    . VAL B 1 437 ? 7.562   163.324 -20.204 1.00 58.97  ? 1191 VAL B CA    1 
ATOM   8243  C  C     . VAL B 1 437 ? 7.372   163.359 -21.721 1.00 69.02  ? 1191 VAL B C     1 
ATOM   8244  O  O     . VAL B 1 437 ? 7.041   164.402 -22.287 1.00 75.98  ? 1191 VAL B O     1 
ATOM   8245  C  CB    . VAL B 1 437 ? 9.007   163.624 -19.813 1.00 54.62  ? 1191 VAL B CB    1 
ATOM   8246  C  CG1   . VAL B 1 437 ? 9.574   164.786 -20.630 1.00 47.69  ? 1191 VAL B CG1   1 
ATOM   8247  C  CG2   . VAL B 1 437 ? 9.060   163.929 -18.347 1.00 49.82  ? 1191 VAL B CG2   1 
ATOM   8248  N  N     . TYR B 1 438 ? 7.552   162.214 -22.376 1.00 64.13  ? 1192 TYR B N     1 
ATOM   8249  C  CA    . TYR B 1 438 ? 7.311   162.167 -23.808 1.00 62.91  ? 1192 TYR B CA    1 
ATOM   8250  C  C     . TYR B 1 438 ? 5.829   162.398 -24.086 1.00 60.23  ? 1192 TYR B C     1 
ATOM   8251  O  O     . TYR B 1 438 ? 5.456   163.267 -24.885 1.00 61.43  ? 1192 TYR B O     1 
ATOM   8252  C  CB    . TYR B 1 438 ? 7.772   160.845 -24.425 1.00 62.88  ? 1192 TYR B CB    1 
ATOM   8253  C  CG    . TYR B 1 438 ? 7.640   160.822 -25.941 1.00 68.79  ? 1192 TYR B CG    1 
ATOM   8254  C  CD1   . TYR B 1 438 ? 8.692   161.212 -26.759 1.00 72.88  ? 1192 TYR B CD1   1 
ATOM   8255  C  CD2   . TYR B 1 438 ? 6.467   160.411 -26.550 1.00 68.70  ? 1192 TYR B CD2   1 
ATOM   8256  C  CE1   . TYR B 1 438 ? 8.587   161.175 -28.136 1.00 75.82  ? 1192 TYR B CE1   1 
ATOM   8257  C  CE2   . TYR B 1 438 ? 6.348   160.379 -27.915 1.00 75.79  ? 1192 TYR B CE2   1 
ATOM   8258  C  CZ    . TYR B 1 438 ? 7.411   160.760 -28.713 1.00 79.37  ? 1192 TYR B CZ    1 
ATOM   8259  O  OH    . TYR B 1 438 ? 7.279   160.728 -30.094 1.00 79.68  ? 1192 TYR B OH    1 
ATOM   8260  N  N     . MET B 1 439 ? 4.988   161.613 -23.423 1.00 55.78  ? 1193 MET B N     1 
ATOM   8261  C  CA    . MET B 1 439 ? 3.564   161.685 -23.676 1.00 57.98  ? 1193 MET B CA    1 
ATOM   8262  C  C     . MET B 1 439 ? 3.008   163.083 -23.367 1.00 60.61  ? 1193 MET B C     1 
ATOM   8263  O  O     . MET B 1 439 ? 1.930   163.468 -23.828 1.00 59.96  ? 1193 MET B O     1 
ATOM   8264  C  CB    . MET B 1 439 ? 2.839   160.597 -22.896 1.00 46.26  ? 1193 MET B CB    1 
ATOM   8265  C  CG    . MET B 1 439 ? 1.367   160.610 -23.129 1.00 46.55  ? 1193 MET B CG    1 
ATOM   8266  S  SD    . MET B 1 439 ? 0.618   158.993 -22.997 1.00 83.37  ? 1193 MET B SD    1 
ATOM   8267  C  CE    . MET B 1 439 ? -1.115  159.469 -22.960 1.00 88.82  ? 1193 MET B CE    1 
ATOM   8268  N  N     . ILE B 1 440 ? 3.756   163.853 -22.591 1.00 55.99  ? 1194 ILE B N     1 
ATOM   8269  C  CA    . ILE B 1 440 ? 3.289   165.170 -22.224 1.00 52.97  ? 1194 ILE B CA    1 
ATOM   8270  C  C     . ILE B 1 440 ? 3.425   166.128 -23.403 1.00 56.37  ? 1194 ILE B C     1 
ATOM   8271  O  O     . ILE B 1 440 ? 2.523   166.908 -23.669 1.00 59.69  ? 1194 ILE B O     1 
ATOM   8272  C  CB    . ILE B 1 440 ? 3.991   165.677 -20.969 1.00 48.47  ? 1194 ILE B CB    1 
ATOM   8273  C  CG1   . ILE B 1 440 ? 3.265   165.112 -19.739 1.00 46.75  ? 1194 ILE B CG1   1 
ATOM   8274  C  CG2   . ILE B 1 440 ? 3.962   167.199 -20.919 1.00 48.20  ? 1194 ILE B CG2   1 
ATOM   8275  C  CD1   . ILE B 1 440 ? 4.102   165.058 -18.521 1.00 46.79  ? 1194 ILE B CD1   1 
ATOM   8276  N  N     . ASP B 1 441 ? 4.546   166.047 -24.113 1.00 59.91  ? 1195 ASP B N     1 
ATOM   8277  C  CA    . ASP B 1 441 ? 4.776   166.815 -25.334 1.00 66.15  ? 1195 ASP B CA    1 
ATOM   8278  C  C     . ASP B 1 441 ? 3.979   166.251 -26.527 1.00 68.71  ? 1195 ASP B C     1 
ATOM   8279  O  O     . ASP B 1 441 ? 3.650   166.965 -27.478 1.00 72.83  ? 1195 ASP B O     1 
ATOM   8280  C  CB    . ASP B 1 441 ? 6.266   166.784 -25.687 1.00 70.32  ? 1195 ASP B CB    1 
ATOM   8281  C  CG    . ASP B 1 441 ? 7.135   167.496 -24.659 1.00 71.64  ? 1195 ASP B CG    1 
ATOM   8282  O  OD1   . ASP B 1 441 ? 6.721   168.592 -24.209 1.00 69.27  ? 1195 ASP B OD1   1 
ATOM   8283  O  OD2   . ASP B 1 441 ? 8.233   166.960 -24.322 1.00 68.02  ? 1195 ASP B OD2   1 
ATOM   8284  N  N     . HIS B 1 442 ? 3.666   164.963 -26.459 1.00 68.93  ? 1196 HIS B N     1 
ATOM   8285  C  CA    . HIS B 1 442 ? 3.101   164.241 -27.583 1.00 64.39  ? 1196 HIS B CA    1 
ATOM   8286  C  C     . HIS B 1 442 ? 1.934   163.377 -27.140 1.00 62.62  ? 1196 HIS B C     1 
ATOM   8287  O  O     . HIS B 1 442 ? 2.060   162.160 -27.083 1.00 65.18  ? 1196 HIS B O     1 
ATOM   8288  C  CB    . HIS B 1 442 ? 4.182   163.344 -28.179 1.00 72.03  ? 1196 HIS B CB    1 
ATOM   8289  C  CG    . HIS B 1 442 ? 5.316   164.098 -28.801 1.00 75.82  ? 1196 HIS B CG    1 
ATOM   8290  N  ND1   . HIS B 1 442 ? 6.564   164.184 -28.216 1.00 68.90  ? 1196 HIS B ND1   1 
ATOM   8291  C  CD2   . HIS B 1 442 ? 5.393   164.803 -29.957 1.00 77.56  ? 1196 HIS B CD2   1 
ATOM   8292  C  CE1   . HIS B 1 442 ? 7.361   164.903 -28.985 1.00 70.16  ? 1196 HIS B CE1   1 
ATOM   8293  N  NE2   . HIS B 1 442 ? 6.673   165.293 -30.047 1.00 77.54  ? 1196 HIS B NE2   1 
ATOM   8294  N  N     . PRO B 1 443 ? 0.792   164.007 -26.825 1.00 64.54  ? 1197 PRO B N     1 
ATOM   8295  C  CA    . PRO B 1 443 ? -0.451  163.387 -26.337 1.00 53.10  ? 1197 PRO B CA    1 
ATOM   8296  C  C     . PRO B 1 443 ? -0.889  162.160 -27.136 1.00 68.39  ? 1197 PRO B C     1 
ATOM   8297  O  O     . PRO B 1 443 ? -1.432  161.220 -26.571 1.00 73.57  ? 1197 PRO B O     1 
ATOM   8298  C  CB    . PRO B 1 443 ? -1.487  164.491 -26.530 1.00 54.37  ? 1197 PRO B CB    1 
ATOM   8299  C  CG    . PRO B 1 443 ? -0.729  165.738 -26.443 1.00 55.04  ? 1197 PRO B CG    1 
ATOM   8300  C  CD    . PRO B 1 443 ? 0.659   165.465 -26.965 1.00 62.21  ? 1197 PRO B CD    1 
ATOM   8301  N  N     . THR B 1 444 ? -0.664  162.172 -28.441 1.00 70.90  ? 1198 THR B N     1 
ATOM   8302  C  CA    . THR B 1 444 ? -1.188  161.118 -29.305 1.00 72.74  ? 1198 THR B CA    1 
ATOM   8303  C  C     . THR B 1 444 ? -0.229  159.961 -29.556 1.00 72.29  ? 1198 THR B C     1 
ATOM   8304  O  O     . THR B 1 444 ? -0.419  159.192 -30.503 1.00 70.70  ? 1198 THR B O     1 
ATOM   8305  C  CB    . THR B 1 444 ? -1.571  161.683 -30.659 1.00 73.36  ? 1198 THR B CB    1 
ATOM   8306  O  OG1   . THR B 1 444 ? -0.640  162.725 -31.009 1.00 72.13  ? 1198 THR B OG1   1 
ATOM   8307  C  CG2   . THR B 1 444 ? -2.986  162.241 -30.601 1.00 74.46  ? 1198 THR B CG2   1 
ATOM   8308  N  N     . ALA B 1 445 ? 0.783   159.832 -28.704 1.00 68.50  ? 1199 ALA B N     1 
ATOM   8309  C  CA    . ALA B 1 445 ? 1.866   158.897 -28.972 1.00 72.50  ? 1199 ALA B CA    1 
ATOM   8310  C  C     . ALA B 1 445 ? 1.356   157.477 -28.952 1.00 77.01  ? 1199 ALA B C     1 
ATOM   8311  O  O     . ALA B 1 445 ? 0.485   157.134 -28.146 1.00 78.11  ? 1199 ALA B O     1 
ATOM   8312  C  CB    . ALA B 1 445 ? 3.012   159.080 -27.983 1.00 60.16  ? 1199 ALA B CB    1 
ATOM   8313  N  N     . LYS B 1 446 ? 1.898   156.672 -29.863 1.00 81.43  ? 1200 LYS B N     1 
ATOM   8314  C  CA    . LYS B 1 446 ? 1.561   155.262 -29.990 1.00 84.42  ? 1200 LYS B CA    1 
ATOM   8315  C  C     . LYS B 1 446 ? 2.531   154.419 -29.151 1.00 82.69  ? 1200 LYS B C     1 
ATOM   8316  O  O     . LYS B 1 446 ? 3.579   154.913 -28.736 1.00 87.46  ? 1200 LYS B O     1 
ATOM   8317  C  CB    . LYS B 1 446 ? 1.636   154.864 -31.462 1.00 87.04  ? 1200 LYS B CB    1 
ATOM   8318  N  N     . ILE B 1 447 ? 2.189   153.156 -28.907 1.00 76.01  ? 1201 ILE B N     1 
ATOM   8319  C  CA    . ILE B 1 447 ? 2.995   152.289 -28.030 1.00 74.17  ? 1201 ILE B CA    1 
ATOM   8320  C  C     . ILE B 1 447 ? 4.424   152.031 -28.498 1.00 86.47  ? 1201 ILE B C     1 
ATOM   8321  O  O     . ILE B 1 447 ? 5.367   152.065 -27.700 1.00 86.67  ? 1201 ILE B O     1 
ATOM   8322  C  CB    . ILE B 1 447 ? 2.366   150.914 -27.861 1.00 64.60  ? 1201 ILE B CB    1 
ATOM   8323  C  CG1   . ILE B 1 447 ? 1.348   150.954 -26.735 1.00 73.94  ? 1201 ILE B CG1   1 
ATOM   8324  C  CG2   . ILE B 1 447 ? 3.445   149.894 -27.567 1.00 55.72  ? 1201 ILE B CG2   1 
ATOM   8325  C  CD1   . ILE B 1 447 ? 0.205   151.896 -27.014 1.00 83.90  ? 1201 ILE B CD1   1 
ATOM   8326  N  N     . ASP B 1 448 ? 4.566   151.726 -29.782 1.00 88.58  ? 1202 ASP B N     1 
ATOM   8327  C  CA    . ASP B 1 448 ? 5.871   151.513 -30.383 1.00 88.91  ? 1202 ASP B CA    1 
ATOM   8328  C  C     . ASP B 1 448 ? 6.875   152.578 -29.963 1.00 83.67  ? 1202 ASP B C     1 
ATOM   8329  O  O     . ASP B 1 448 ? 8.030   152.262 -29.667 1.00 81.19  ? 1202 ASP B O     1 
ATOM   8330  C  CB    . ASP B 1 448 ? 5.749   151.493 -31.908 1.00 97.17  ? 1202 ASP B CB    1 
ATOM   8331  C  CG    . ASP B 1 448 ? 5.672   150.084 -32.473 1.00 102.38 ? 1202 ASP B CG    1 
ATOM   8332  O  OD1   . ASP B 1 448 ? 5.237   149.163 -31.742 1.00 98.56  ? 1202 ASP B OD1   1 
ATOM   8333  O  OD2   . ASP B 1 448 ? 6.056   149.897 -33.652 1.00 106.46 ? 1202 ASP B OD2   1 
ATOM   8334  N  N     . LYS B 1 449 ? 6.441   153.839 -29.947 1.00 78.46  ? 1203 LYS B N     1 
ATOM   8335  C  CA    . LYS B 1 449 ? 7.340   154.931 -29.572 1.00 72.20  ? 1203 LYS B CA    1 
ATOM   8336  C  C     . LYS B 1 449 ? 7.594   155.032 -28.058 1.00 78.98  ? 1203 LYS B C     1 
ATOM   8337  O  O     . LYS B 1 449 ? 8.749   155.174 -27.643 1.00 81.79  ? 1203 LYS B O     1 
ATOM   8338  C  CB    . LYS B 1 449 ? 6.898   156.279 -30.157 1.00 60.21  ? 1203 LYS B CB    1 
ATOM   8339  C  CG    . LYS B 1 449 ? 8.077   157.212 -30.520 1.00 58.73  ? 1203 LYS B CG    1 
ATOM   8340  N  N     . LEU B 1 450 ? 6.544   154.951 -27.235 1.00 74.01  ? 1204 LEU B N     1 
ATOM   8341  C  CA    . LEU B 1 450 ? 6.752   154.971 -25.784 1.00 64.72  ? 1204 LEU B CA    1 
ATOM   8342  C  C     . LEU B 1 450 ? 7.667   153.829 -25.378 1.00 66.90  ? 1204 LEU B C     1 
ATOM   8343  O  O     . LEU B 1 450 ? 8.364   153.916 -24.357 1.00 67.81  ? 1204 LEU B O     1 
ATOM   8344  C  CB    . LEU B 1 450 ? 5.452   154.849 -25.003 1.00 48.25  ? 1204 LEU B CB    1 
ATOM   8345  C  CG    . LEU B 1 450 ? 4.263   155.687 -25.435 1.00 53.23  ? 1204 LEU B CG    1 
ATOM   8346  C  CD1   . LEU B 1 450 ? 3.031   154.932 -25.050 1.00 51.00  ? 1204 LEU B CD1   1 
ATOM   8347  C  CD2   . LEU B 1 450 ? 4.259   157.057 -24.797 1.00 54.38  ? 1204 LEU B CD2   1 
ATOM   8348  N  N     . MET B 1 451 ? 7.686   152.755 -26.163 1.00 63.40  ? 1205 MET B N     1 
ATOM   8349  C  CA    . MET B 1 451 ? 8.533   151.639 -25.771 1.00 63.62  ? 1205 MET B CA    1 
ATOM   8350  C  C     . MET B 1 451 ? 10.024  151.875 -25.998 1.00 69.41  ? 1205 MET B C     1 
ATOM   8351  O  O     . MET B 1 451 ? 10.851  151.096 -25.524 1.00 70.87  ? 1205 MET B O     1 
ATOM   8352  C  CB    . MET B 1 451 ? 8.059   150.321 -26.367 1.00 61.87  ? 1205 MET B CB    1 
ATOM   8353  C  CG    . MET B 1 451 ? 6.875   149.723 -25.627 1.00 52.87  ? 1205 MET B CG    1 
ATOM   8354  S  SD    . MET B 1 451 ? 6.431   148.104 -26.250 1.00 75.52  ? 1205 MET B SD    1 
ATOM   8355  C  CE    . MET B 1 451 ? 7.902   147.205 -25.793 1.00 61.83  ? 1205 MET B CE    1 
ATOM   8356  N  N     . GLU B 1 452 ? 10.375  152.946 -26.706 1.00 70.39  ? 1206 GLU B N     1 
ATOM   8357  C  CA    . GLU B 1 452 ? 11.776  153.365 -26.743 1.00 71.56  ? 1206 GLU B CA    1 
ATOM   8358  C  C     . GLU B 1 452 ? 12.184  153.990 -25.378 1.00 70.86  ? 1206 GLU B C     1 
ATOM   8359  O  O     . GLU B 1 452 ? 13.349  153.963 -24.986 1.00 69.02  ? 1206 GLU B O     1 
ATOM   8360  C  CB    . GLU B 1 452 ? 12.070  154.276 -27.948 1.00 70.59  ? 1206 GLU B CB    1 
ATOM   8361  N  N     . PHE B 1 453 ? 11.212  154.504 -24.631 1.00 71.02  ? 1207 PHE B N     1 
ATOM   8362  C  CA    . PHE B 1 453 ? 11.491  155.049 -23.309 1.00 66.47  ? 1207 PHE B CA    1 
ATOM   8363  C  C     . PHE B 1 453 ? 11.213  154.039 -22.212 1.00 67.89  ? 1207 PHE B C     1 
ATOM   8364  O  O     . PHE B 1 453 ? 11.988  153.943 -21.242 1.00 69.51  ? 1207 PHE B O     1 
ATOM   8365  C  CB    . PHE B 1 453 ? 10.670  156.299 -23.081 1.00 57.54  ? 1207 PHE B CB    1 
ATOM   8366  C  CG    . PHE B 1 453 ? 10.923  157.335 -24.093 1.00 57.55  ? 1207 PHE B CG    1 
ATOM   8367  C  CD1   . PHE B 1 453 ? 12.118  158.027 -24.092 1.00 63.74  ? 1207 PHE B CD1   1 
ATOM   8368  C  CD2   . PHE B 1 453 ? 9.997   157.598 -25.088 1.00 55.59  ? 1207 PHE B CD2   1 
ATOM   8369  C  CE1   . PHE B 1 453 ? 12.366  158.974 -25.046 1.00 61.88  ? 1207 PHE B CE1   1 
ATOM   8370  C  CE2   . PHE B 1 453 ? 10.250  158.536 -26.030 1.00 52.36  ? 1207 PHE B CE2   1 
ATOM   8371  C  CZ    . PHE B 1 453 ? 11.431  159.226 -26.009 1.00 53.23  ? 1207 PHE B CZ    1 
ATOM   8372  N  N     . LEU B 1 454 ? 10.111  153.296 -22.379 1.00 59.43  ? 1208 LEU B N     1 
ATOM   8373  C  CA    . LEU B 1 454 ? 9.655   152.307 -21.403 1.00 60.22  ? 1208 LEU B CA    1 
ATOM   8374  C  C     . LEU B 1 454 ? 9.598   150.949 -22.056 1.00 62.64  ? 1208 LEU B C     1 
ATOM   8375  O  O     . LEU B 1 454 ? 8.552   150.544 -22.545 1.00 69.50  ? 1208 LEU B O     1 
ATOM   8376  C  CB    . LEU B 1 454 ? 8.260   152.662 -20.901 1.00 61.94  ? 1208 LEU B CB    1 
ATOM   8377  C  CG    . LEU B 1 454 ? 7.865   152.195 -19.498 1.00 56.30  ? 1208 LEU B CG    1 
ATOM   8378  C  CD1   . LEU B 1 454 ? 6.385   151.953 -19.437 1.00 47.68  ? 1208 LEU B CD1   1 
ATOM   8379  C  CD2   . LEU B 1 454 ? 8.613   150.950 -19.140 1.00 64.51  ? 1208 LEU B CD2   1 
ATOM   8380  N  N     . PRO B 1 455 ? 10.730  150.236 -22.054 1.00 62.17  ? 1209 PRO B N     1 
ATOM   8381  C  CA    . PRO B 1 455 ? 10.959  149.002 -22.822 1.00 59.40  ? 1209 PRO B CA    1 
ATOM   8382  C  C     . PRO B 1 455 ? 10.399  147.736 -22.175 1.00 62.63  ? 1209 PRO B C     1 
ATOM   8383  O  O     . PRO B 1 455 ? 10.311  146.691 -22.816 1.00 68.78  ? 1209 PRO B O     1 
ATOM   8384  C  CB    . PRO B 1 455 ? 12.482  148.917 -22.864 1.00 49.44  ? 1209 PRO B CB    1 
ATOM   8385  C  CG    . PRO B 1 455 ? 12.919  149.559 -21.575 1.00 52.57  ? 1209 PRO B CG    1 
ATOM   8386  C  CD    . PRO B 1 455 ? 11.924  150.654 -21.289 1.00 53.17  ? 1209 PRO B CD    1 
ATOM   8387  N  N     . GLY B 1 456 ? 10.043  147.824 -20.903 1.00 62.20  ? 1210 GLY B N     1 
ATOM   8388  C  CA    . GLY B 1 456 ? 9.573   146.666 -20.177 1.00 62.17  ? 1210 GLY B CA    1 
ATOM   8389  C  C     . GLY B 1 456 ? 9.730   146.766 -18.675 1.00 65.89  ? 1210 GLY B C     1 
ATOM   8390  O  O     . GLY B 1 456 ? 10.378  147.673 -18.135 1.00 66.70  ? 1210 GLY B O     1 
ATOM   8391  N  N     . PRO B 1 457 ? 9.108   145.819 -17.982 1.00 58.53  ? 1211 PRO B N     1 
ATOM   8392  C  CA    . PRO B 1 457 ? 9.150   145.637 -16.534 1.00 55.61  ? 1211 PRO B CA    1 
ATOM   8393  C  C     . PRO B 1 457 ? 10.589  145.586 -15.993 1.00 60.10  ? 1211 PRO B C     1 
ATOM   8394  O  O     . PRO B 1 457 ? 11.497  145.133 -16.693 1.00 59.66  ? 1211 PRO B O     1 
ATOM   8395  C  CB    . PRO B 1 457 ? 8.481   144.276 -16.363 1.00 54.06  ? 1211 PRO B CB    1 
ATOM   8396  C  CG    . PRO B 1 457 ? 7.524   144.199 -17.520 1.00 48.54  ? 1211 PRO B CG    1 
ATOM   8397  C  CD    . PRO B 1 457 ? 8.289   144.792 -18.647 1.00 57.15  ? 1211 PRO B CD    1 
ATOM   8398  N  N     . ASP B 1 458 ? 10.773  146.060 -14.760 1.00 56.43  ? 1212 ASP B N     1 
ATOM   8399  C  CA    . ASP B 1 458 ? 12.042  146.008 -14.041 1.00 54.74  ? 1212 ASP B CA    1 
ATOM   8400  C  C     . ASP B 1 458 ? 11.740  145.454 -12.651 1.00 58.32  ? 1212 ASP B C     1 
ATOM   8401  O  O     . ASP B 1 458 ? 11.344  146.201 -11.756 1.00 65.13  ? 1212 ASP B O     1 
ATOM   8402  C  CB    . ASP B 1 458 ? 12.603  147.427 -13.904 1.00 59.50  ? 1212 ASP B CB    1 
ATOM   8403  C  CG    . ASP B 1 458 ? 14.079  147.456 -13.502 1.00 63.60  ? 1212 ASP B CG    1 
ATOM   8404  O  OD1   . ASP B 1 458 ? 14.817  146.483 -13.809 1.00 65.20  ? 1212 ASP B OD1   1 
ATOM   8405  O  OD2   . ASP B 1 458 ? 14.495  148.471 -12.888 1.00 61.47  ? 1212 ASP B OD2   1 
ATOM   8406  N  N     . PHE B 1 459 ? 11.891  144.149 -12.462 1.00 55.17  ? 1213 PHE B N     1 
ATOM   8407  C  CA    . PHE B 1 459 ? 11.578  143.554 -11.165 1.00 53.61  ? 1213 PHE B CA    1 
ATOM   8408  C  C     . PHE B 1 459 ? 12.680  143.831 -10.152 1.00 57.29  ? 1213 PHE B C     1 
ATOM   8409  O  O     . PHE B 1 459 ? 13.859  143.740 -10.466 1.00 65.03  ? 1213 PHE B O     1 
ATOM   8410  C  CB    . PHE B 1 459 ? 11.445  142.055 -11.289 1.00 56.74  ? 1213 PHE B CB    1 
ATOM   8411  C  CG    . PHE B 1 459 ? 10.372  141.601 -12.215 1.00 51.53  ? 1213 PHE B CG    1 
ATOM   8412  C  CD1   . PHE B 1 459 ? 9.040   141.789 -11.894 1.00 45.10  ? 1213 PHE B CD1   1 
ATOM   8413  C  CD2   . PHE B 1 459 ? 10.700  140.915 -13.381 1.00 54.89  ? 1213 PHE B CD2   1 
ATOM   8414  C  CE1   . PHE B 1 459 ? 8.038   141.332 -12.731 1.00 52.39  ? 1213 PHE B CE1   1 
ATOM   8415  C  CE2   . PHE B 1 459 ? 9.710   140.448 -14.235 1.00 58.35  ? 1213 PHE B CE2   1 
ATOM   8416  C  CZ    . PHE B 1 459 ? 8.368   140.665 -13.916 1.00 55.90  ? 1213 PHE B CZ    1 
ATOM   8417  N  N     . PRO B 1 460 ? 12.303  144.126 -8.910  1.00 57.26  ? 1214 PRO B N     1 
ATOM   8418  C  CA    . PRO B 1 460 ? 13.303  144.475 -7.899  1.00 48.48  ? 1214 PRO B CA    1 
ATOM   8419  C  C     . PRO B 1 460 ? 14.226  143.312 -7.626  1.00 46.96  ? 1214 PRO B C     1 
ATOM   8420  O  O     . PRO B 1 460 ? 15.269  143.502 -7.029  1.00 50.42  ? 1214 PRO B O     1 
ATOM   8421  C  CB    . PRO B 1 460 ? 12.456  144.747 -6.667  1.00 48.80  ? 1214 PRO B CB    1 
ATOM   8422  C  CG    . PRO B 1 460 ? 11.251  143.921 -6.856  1.00 52.37  ? 1214 PRO B CG    1 
ATOM   8423  C  CD    . PRO B 1 460 ? 10.962  143.985 -8.327  1.00 57.58  ? 1214 PRO B CD    1 
ATOM   8424  N  N     . THR B 1 461 ? 13.841  142.133 -8.089  1.00 42.25  ? 1215 THR B N     1 
ATOM   8425  C  CA    . THR B 1 461 ? 14.573  140.913 -7.839  1.00 50.72  ? 1215 THR B CA    1 
ATOM   8426  C  C     . THR B 1 461 ? 15.432  140.551 -9.033  1.00 64.45  ? 1215 THR B C     1 
ATOM   8427  O  O     . THR B 1 461 ? 16.162  139.553 -9.003  1.00 75.47  ? 1215 THR B O     1 
ATOM   8428  C  CB    . THR B 1 461 ? 13.589  139.756 -7.653  1.00 62.64  ? 1215 THR B CB    1 
ATOM   8429  O  OG1   . THR B 1 461 ? 12.510  139.914 -8.577  1.00 65.77  ? 1215 THR B OG1   1 
ATOM   8430  C  CG2   . THR B 1 461 ? 13.017  139.742 -6.255  1.00 69.95  ? 1215 THR B CG2   1 
ATOM   8431  N  N     . GLY B 1 462 ? 15.297  141.332 -10.103 1.00 61.54  ? 1216 GLY B N     1 
ATOM   8432  C  CA    . GLY B 1 462 ? 16.216  141.268 -11.229 1.00 59.21  ? 1216 GLY B CA    1 
ATOM   8433  C  C     . GLY B 1 462 ? 15.828  140.263 -12.279 1.00 60.20  ? 1216 GLY B C     1 
ATOM   8434  O  O     . GLY B 1 462 ? 14.714  140.302 -12.766 1.00 66.87  ? 1216 GLY B O     1 
ATOM   8435  N  N     . ALA B 1 463 ? 16.758  139.375 -12.625 1.00 56.03  ? 1217 ALA B N     1 
ATOM   8436  C  CA    . ALA B 1 463 ? 16.553  138.300 -13.613 1.00 57.91  ? 1217 ALA B CA    1 
ATOM   8437  C  C     . ALA B 1 463 ? 16.471  138.751 -15.056 1.00 69.15  ? 1217 ALA B C     1 
ATOM   8438  O  O     . ALA B 1 463 ? 16.782  139.891 -15.396 1.00 82.38  ? 1217 ALA B O     1 
ATOM   8439  C  CB    . ALA B 1 463 ? 15.353  137.480 -13.292 1.00 51.31  ? 1217 ALA B CB    1 
ATOM   8440  N  N     . ILE B 1 464 ? 16.040  137.832 -15.905 1.00 62.68  ? 1218 ILE B N     1 
ATOM   8441  C  CA    . ILE B 1 464 ? 15.939  138.105 -17.328 1.00 62.50  ? 1218 ILE B CA    1 
ATOM   8442  C  C     . ILE B 1 464 ? 14.474  138.023 -17.732 1.00 64.64  ? 1218 ILE B C     1 
ATOM   8443  O  O     . ILE B 1 464 ? 13.758  137.122 -17.299 1.00 71.63  ? 1218 ILE B O     1 
ATOM   8444  C  CB    . ILE B 1 464 ? 16.732  137.071 -18.121 1.00 66.34  ? 1218 ILE B CB    1 
ATOM   8445  C  CG1   . ILE B 1 464 ? 18.213  137.153 -17.754 1.00 66.33  ? 1218 ILE B CG1   1 
ATOM   8446  C  CG2   . ILE B 1 464 ? 16.494  137.243 -19.609 1.00 64.50  ? 1218 ILE B CG2   1 
ATOM   8447  C  CD1   . ILE B 1 464 ? 18.935  135.829 -17.901 1.00 60.39  ? 1218 ILE B CD1   1 
ATOM   8448  N  N     . ILE B 1 465 ? 14.025  138.974 -18.539 1.00 61.62  ? 1219 ILE B N     1 
ATOM   8449  C  CA    . ILE B 1 465 ? 12.654  138.972 -19.039 1.00 63.86  ? 1219 ILE B CA    1 
ATOM   8450  C  C     . ILE B 1 465 ? 12.616  138.783 -20.554 1.00 68.73  ? 1219 ILE B C     1 
ATOM   8451  O  O     . ILE B 1 465 ? 13.216  139.570 -21.284 1.00 70.73  ? 1219 ILE B O     1 
ATOM   8452  C  CB    . ILE B 1 465 ? 11.964  140.289 -18.746 1.00 59.18  ? 1219 ILE B CB    1 
ATOM   8453  C  CG1   . ILE B 1 465 ? 12.131  140.643 -17.269 1.00 56.57  ? 1219 ILE B CG1   1 
ATOM   8454  C  CG2   . ILE B 1 465 ? 10.509  140.198 -19.145 1.00 57.64  ? 1219 ILE B CG2   1 
ATOM   8455  C  CD1   . ILE B 1 465 ? 11.422  141.914 -16.858 1.00 58.54  ? 1219 ILE B CD1   1 
ATOM   8456  N  N     . GLN B 1 466 ? 11.906  137.750 -21.012 1.00 68.09  ? 1220 GLN B N     1 
ATOM   8457  C  CA    . GLN B 1 466 ? 11.846  137.396 -22.426 1.00 67.81  ? 1220 GLN B CA    1 
ATOM   8458  C  C     . GLN B 1 466 ? 10.440  137.576 -23.023 1.00 73.72  ? 1220 GLN B C     1 
ATOM   8459  O  O     . GLN B 1 466 ? 9.468   137.029 -22.498 1.00 77.48  ? 1220 GLN B O     1 
ATOM   8460  C  CB    . GLN B 1 466 ? 12.314  135.954 -22.626 1.00 69.81  ? 1220 GLN B CB    1 
ATOM   8461  C  CG    . GLN B 1 466 ? 13.736  135.692 -22.147 1.00 85.83  ? 1220 GLN B CG    1 
ATOM   8462  C  CD    . GLN B 1 466 ? 14.193  134.232 -22.357 1.00 94.98  ? 1220 GLN B CD    1 
ATOM   8463  O  OE1   . GLN B 1 466 ? 13.370  133.316 -22.459 1.00 96.20  ? 1220 GLN B OE1   1 
ATOM   8464  N  NE2   . GLN B 1 466 ? 15.516  134.022 -22.414 1.00 91.04  ? 1220 GLN B NE2   1 
ATOM   8465  N  N     . GLY B 1 467 ? 10.338  138.344 -24.113 1.00 71.76  ? 1221 GLY B N     1 
ATOM   8466  C  CA    . GLY B 1 467 ? 9.105   138.434 -24.870 1.00 57.71  ? 1221 GLY B CA    1 
ATOM   8467  C  C     . GLY B 1 467 ? 8.754   139.832 -25.330 1.00 83.65  ? 1221 GLY B C     1 
ATOM   8468  O  O     . GLY B 1 467 ? 7.679   140.323 -24.994 1.00 86.96  ? 1221 GLY B O     1 
ATOM   8469  N  N     . ARG B 1 468 ? 9.627   140.481 -26.104 1.00 83.16  ? 1222 ARG B N     1 
ATOM   8470  C  CA    . ARG B 1 468 ? 9.318   141.831 -26.591 1.00 75.36  ? 1222 ARG B CA    1 
ATOM   8471  C  C     . ARG B 1 468 ? 7.899   141.900 -27.169 1.00 76.67  ? 1222 ARG B C     1 
ATOM   8472  O  O     . ARG B 1 468 ? 7.184   142.869 -26.915 1.00 74.71  ? 1222 ARG B O     1 
ATOM   8473  C  CB    . ARG B 1 468 ? 10.356  142.348 -27.608 1.00 75.58  ? 1222 ARG B CB    1 
ATOM   8474  C  CG    . ARG B 1 468 ? 10.051  143.756 -28.236 1.00 59.61  ? 1222 ARG B CG    1 
ATOM   8475  N  N     . ASP B 1 469 ? 7.486   140.873 -27.922 1.00 83.54  ? 1223 ASP B N     1 
ATOM   8476  C  CA    . ASP B 1 469 ? 6.150   140.866 -28.538 1.00 77.03  ? 1223 ASP B CA    1 
ATOM   8477  C  C     . ASP B 1 469 ? 5.034   140.869 -27.491 1.00 76.61  ? 1223 ASP B C     1 
ATOM   8478  O  O     . ASP B 1 469 ? 4.186   141.767 -27.473 1.00 68.85  ? 1223 ASP B O     1 
ATOM   8479  C  CB    . ASP B 1 469 ? 5.985   139.695 -29.509 1.00 73.58  ? 1223 ASP B CB    1 
ATOM   8480  N  N     . GLU B 1 470 ? 5.043   139.884 -26.600 1.00 78.95  ? 1224 GLU B N     1 
ATOM   8481  C  CA    . GLU B 1 470 ? 4.039   139.840 -25.541 1.00 77.12  ? 1224 GLU B CA    1 
ATOM   8482  C  C     . GLU B 1 470 ? 4.022   141.071 -24.593 1.00 75.54  ? 1224 GLU B C     1 
ATOM   8483  O  O     . GLU B 1 470 ? 2.965   141.446 -24.054 1.00 72.58  ? 1224 GLU B O     1 
ATOM   8484  C  CB    . GLU B 1 470 ? 4.127   138.522 -24.774 1.00 76.43  ? 1224 GLU B CB    1 
ATOM   8485  C  CG    . GLU B 1 470 ? 3.576   137.341 -25.560 1.00 86.87  ? 1224 GLU B CG    1 
ATOM   8486  C  CD    . GLU B 1 470 ? 2.050   137.328 -25.655 1.00 92.45  ? 1224 GLU B CD    1 
ATOM   8487  O  OE1   . GLU B 1 470 ? 1.392   137.340 -24.591 1.00 91.54  ? 1224 GLU B OE1   1 
ATOM   8488  O  OE2   . GLU B 1 470 ? 1.510   137.293 -26.790 1.00 95.01  ? 1224 GLU B OE2   1 
ATOM   8489  N  N     . ILE B 1 471 ? 5.175   141.703 -24.391 1.00 68.60  ? 1225 ILE B N     1 
ATOM   8490  C  CA    . ILE B 1 471 ? 5.204   142.966 -23.654 1.00 64.72  ? 1225 ILE B CA    1 
ATOM   8491  C  C     . ILE B 1 471 ? 4.387   144.043 -24.407 1.00 70.85  ? 1225 ILE B C     1 
ATOM   8492  O  O     . ILE B 1 471 ? 3.595   144.763 -23.793 1.00 71.50  ? 1225 ILE B O     1 
ATOM   8493  C  CB    . ILE B 1 471 ? 6.655   143.440 -23.391 1.00 58.38  ? 1225 ILE B CB    1 
ATOM   8494  C  CG1   . ILE B 1 471 ? 7.337   142.550 -22.360 1.00 49.62  ? 1225 ILE B CG1   1 
ATOM   8495  C  CG2   . ILE B 1 471 ? 6.708   144.892 -22.923 1.00 48.49  ? 1225 ILE B CG2   1 
ATOM   8496  C  CD1   . ILE B 1 471 ? 8.794   142.899 -22.211 1.00 49.79  ? 1225 ILE B CD1   1 
ATOM   8497  N  N     . LYS B 1 472 ? 4.558   144.148 -25.727 1.00 59.59  ? 1226 LYS B N     1 
ATOM   8498  C  CA    . LYS B 1 472 ? 3.757   145.106 -26.482 1.00 55.82  ? 1226 LYS B CA    1 
ATOM   8499  C  C     . LYS B 1 472 ? 2.296   144.732 -26.303 1.00 60.08  ? 1226 LYS B C     1 
ATOM   8500  O  O     . LYS B 1 472 ? 1.484   145.567 -25.935 1.00 66.79  ? 1226 LYS B O     1 
ATOM   8501  C  CB    . LYS B 1 472 ? 4.144   145.199 -27.976 1.00 55.35  ? 1226 LYS B CB    1 
ATOM   8502  N  N     . LYS B 1 473 ? 1.952   143.474 -26.533 1.00 60.73  ? 1227 LYS B N     1 
ATOM   8503  C  CA    . LYS B 1 473 ? 0.545   143.091 -26.411 1.00 66.28  ? 1227 LYS B CA    1 
ATOM   8504  C  C     . LYS B 1 473 ? 0.016   143.634 -25.071 1.00 68.42  ? 1227 LYS B C     1 
ATOM   8505  O  O     . LYS B 1 473 ? -0.955  144.411 -25.026 1.00 68.96  ? 1227 LYS B O     1 
ATOM   8506  C  CB    . LYS B 1 473 ? 0.386   141.569 -26.522 1.00 68.12  ? 1227 LYS B CB    1 
ATOM   8507  C  CG    . LYS B 1 473 ? -1.036  141.053 -26.662 1.00 65.39  ? 1227 LYS B CG    1 
ATOM   8508  C  CD    . LYS B 1 473 ? -1.047  139.504 -26.814 1.00 64.40  ? 1227 LYS B CD    1 
ATOM   8509  N  N     . ALA B 1 474 ? 0.685   143.271 -23.983 1.00 66.77  ? 1228 ALA B N     1 
ATOM   8510  C  CA    . ALA B 1 474 ? 0.260   143.744 -22.664 1.00 65.48  ? 1228 ALA B CA    1 
ATOM   8511  C  C     . ALA B 1 474 ? 0.249   145.267 -22.563 1.00 62.86  ? 1228 ALA B C     1 
ATOM   8512  O  O     . ALA B 1 474 ? -0.722  145.848 -22.100 1.00 69.72  ? 1228 ALA B O     1 
ATOM   8513  C  CB    . ALA B 1 474 ? 1.112   143.141 -21.565 1.00 67.85  ? 1228 ALA B CB    1 
ATOM   8514  N  N     . TYR B 1 475 ? 1.314   145.923 -22.998 1.00 59.69  ? 1229 TYR B N     1 
ATOM   8515  C  CA    . TYR B 1 475 ? 1.327   147.387 -22.947 1.00 60.64  ? 1229 TYR B CA    1 
ATOM   8516  C  C     . TYR B 1 475 ? 0.198   148.005 -23.769 1.00 63.25  ? 1229 TYR B C     1 
ATOM   8517  O  O     . TYR B 1 475 ? -0.127  149.185 -23.604 1.00 60.87  ? 1229 TYR B O     1 
ATOM   8518  C  CB    . TYR B 1 475 ? 2.672   147.943 -23.414 1.00 62.82  ? 1229 TYR B CB    1 
ATOM   8519  C  CG    . TYR B 1 475 ? 3.735   147.927 -22.352 1.00 58.23  ? 1229 TYR B CG    1 
ATOM   8520  C  CD1   . TYR B 1 475 ? 3.424   147.601 -21.053 1.00 55.92  ? 1229 TYR B CD1   1 
ATOM   8521  C  CD2   . TYR B 1 475 ? 5.046   148.250 -22.648 1.00 64.44  ? 1229 TYR B CD2   1 
ATOM   8522  C  CE1   . TYR B 1 475 ? 4.395   147.580 -20.070 1.00 61.37  ? 1229 TYR B CE1   1 
ATOM   8523  C  CE2   . TYR B 1 475 ? 6.023   148.252 -21.671 1.00 67.38  ? 1229 TYR B CE2   1 
ATOM   8524  C  CZ    . TYR B 1 475 ? 5.690   147.919 -20.378 1.00 64.54  ? 1229 TYR B CZ    1 
ATOM   8525  O  OH    . TYR B 1 475 ? 6.646   147.904 -19.384 1.00 64.97  ? 1229 TYR B OH    1 
ATOM   8526  N  N     . GLU B 1 476 ? -0.397  147.203 -24.650 1.00 68.57  ? 1230 GLU B N     1 
ATOM   8527  C  CA    . GLU B 1 476 ? -1.429  147.698 -25.552 1.00 65.47  ? 1230 GLU B CA    1 
ATOM   8528  C  C     . GLU B 1 476 ? -2.832  147.316 -25.089 1.00 66.08  ? 1230 GLU B C     1 
ATOM   8529  O  O     . GLU B 1 476 ? -3.762  148.099 -25.262 1.00 67.65  ? 1230 GLU B O     1 
ATOM   8530  C  CB    . GLU B 1 476 ? -1.177  147.229 -26.989 1.00 63.59  ? 1230 GLU B CB    1 
ATOM   8531  C  CG    . GLU B 1 476 ? -1.254  148.347 -28.023 1.00 80.50  ? 1230 GLU B CG    1 
ATOM   8532  C  CD    . GLU B 1 476 ? -0.913  147.894 -29.450 1.00 101.04 ? 1230 GLU B CD    1 
ATOM   8533  O  OE1   . GLU B 1 476 ? -0.403  146.758 -29.614 1.00 108.74 ? 1230 GLU B OE1   1 
ATOM   8534  O  OE2   . GLU B 1 476 ? -1.155  148.682 -30.404 1.00 98.30  ? 1230 GLU B OE2   1 
ATOM   8535  N  N     . THR B 1 477 ? -2.979  146.141 -24.473 1.00 64.46  ? 1231 THR B N     1 
ATOM   8536  C  CA    . THR B 1 477 ? -4.302  145.644 -24.067 1.00 65.68  ? 1231 THR B CA    1 
ATOM   8537  C  C     . THR B 1 477 ? -4.494  145.413 -22.574 1.00 67.19  ? 1231 THR B C     1 
ATOM   8538  O  O     . THR B 1 477 ? -5.596  145.097 -22.132 1.00 68.35  ? 1231 THR B O     1 
ATOM   8539  C  CB    . THR B 1 477 ? -4.591  144.288 -24.709 1.00 62.67  ? 1231 THR B CB    1 
ATOM   8540  O  OG1   . THR B 1 477 ? -3.715  143.296 -24.142 1.00 67.35  ? 1231 THR B OG1   1 
ATOM   8541  C  CG2   . THR B 1 477 ? -4.378  144.361 -26.191 1.00 61.45  ? 1231 THR B CG2   1 
ATOM   8542  N  N     . GLY B 1 478 ? -3.422  145.514 -21.801 1.00 67.99  ? 1232 GLY B N     1 
ATOM   8543  C  CA    . GLY B 1 478 ? -3.482  145.193 -20.382 1.00 65.03  ? 1232 GLY B CA    1 
ATOM   8544  C  C     . GLY B 1 478 ? -3.242  143.721 -20.070 1.00 71.90  ? 1232 GLY B C     1 
ATOM   8545  O  O     . GLY B 1 478 ? -2.962  143.369 -18.912 1.00 78.27  ? 1232 GLY B O     1 
ATOM   8546  N  N     . LYS B 1 479 ? -3.358  142.855 -21.079 1.00 64.32  ? 1233 LYS B N     1 
ATOM   8547  C  CA    . LYS B 1 479 ? -3.029  141.434 -20.897 1.00 65.33  ? 1233 LYS B CA    1 
ATOM   8548  C  C     . LYS B 1 479 ? -1.901  140.991 -21.818 1.00 71.32  ? 1233 LYS B C     1 
ATOM   8549  O  O     . LYS B 1 479 ? -1.795  141.450 -22.965 1.00 84.21  ? 1233 LYS B O     1 
ATOM   8550  C  CB    . LYS B 1 479 ? -4.243  140.507 -21.098 1.00 61.28  ? 1233 LYS B CB    1 
ATOM   8551  C  CG    . LYS B 1 479 ? -5.439  140.758 -20.174 1.00 55.25  ? 1233 LYS B CG    1 
ATOM   8552  C  CD    . LYS B 1 479 ? -6.350  139.517 -20.097 1.00 68.06  ? 1233 LYS B CD    1 
ATOM   8553  C  CE    . LYS B 1 479 ? -7.391  139.676 -18.984 1.00 84.22  ? 1233 LYS B CE    1 
ATOM   8554  N  NZ    . LYS B 1 479 ? -7.934  138.393 -18.439 1.00 89.81  ? 1233 LYS B NZ    1 
ATOM   8555  N  N     . GLY B 1 480 ? -1.073  140.083 -21.312 1.00 67.89  ? 1234 GLY B N     1 
ATOM   8556  C  CA    . GLY B 1 480 ? 0.081   139.568 -22.031 1.00 70.07  ? 1234 GLY B CA    1 
ATOM   8557  C  C     . GLY B 1 480 ? 0.834   138.581 -21.164 1.00 71.26  ? 1234 GLY B C     1 
ATOM   8558  O  O     . GLY B 1 480 ? 0.765   138.655 -19.933 1.00 73.25  ? 1234 GLY B O     1 
ATOM   8559  N  N     . ARG B 1 481 ? 1.539   137.645 -21.790 1.00 69.41  ? 1235 ARG B N     1 
ATOM   8560  C  CA    . ARG B 1 481 ? 2.315   136.666 -21.030 1.00 62.19  ? 1235 ARG B CA    1 
ATOM   8561  C  C     . ARG B 1 481 ? 3.780   136.763 -21.407 1.00 66.73  ? 1235 ARG B C     1 
ATOM   8562  O  O     . ARG B 1 481 ? 4.143   136.652 -22.572 1.00 82.78  ? 1235 ARG B O     1 
ATOM   8563  C  CB    . ARG B 1 481 ? 1.797   135.246 -21.268 1.00 56.07  ? 1235 ARG B CB    1 
ATOM   8564  C  CG    . ARG B 1 481 ? 2.539   134.176 -20.507 1.00 62.41  ? 1235 ARG B CG    1 
ATOM   8565  C  CD    . ARG B 1 481 ? 2.442   132.805 -21.193 1.00 85.75  ? 1235 ARG B CD    1 
ATOM   8566  N  NE    . ARG B 1 481 ? 1.059   132.358 -21.369 1.00 105.00 ? 1235 ARG B NE    1 
ATOM   8567  C  CZ    . ARG B 1 481 ? 0.354   131.682 -20.462 1.00 120.69 ? 1235 ARG B CZ    1 
ATOM   8568  N  NH1   . ARG B 1 481 ? 0.890   131.366 -19.286 1.00 127.75 ? 1235 ARG B NH1   1 
ATOM   8569  N  NH2   . ARG B 1 481 ? -0.898  131.325 -20.730 1.00 123.64 ? 1235 ARG B NH2   1 
ATOM   8570  N  N     . VAL B 1 482 ? 4.628   136.981 -20.420 1.00 58.79  ? 1236 VAL B N     1 
ATOM   8571  C  CA    . VAL B 1 482 ? 6.053   137.113 -20.680 1.00 64.12  ? 1236 VAL B CA    1 
ATOM   8572  C  C     . VAL B 1 482 ? 6.779   136.001 -19.927 1.00 63.08  ? 1236 VAL B C     1 
ATOM   8573  O  O     . VAL B 1 482 ? 6.179   135.322 -19.100 1.00 69.76  ? 1236 VAL B O     1 
ATOM   8574  C  CB    . VAL B 1 482 ? 6.550   138.489 -20.212 1.00 65.25  ? 1236 VAL B CB    1 
ATOM   8575  C  CG1   . VAL B 1 482 ? 6.863   138.446 -18.738 1.00 57.18  ? 1236 VAL B CG1   1 
ATOM   8576  C  CG2   . VAL B 1 482 ? 7.778   138.920 -20.993 1.00 76.26  ? 1236 VAL B CG2   1 
ATOM   8577  N  N     . VAL B 1 483 ? 8.058   135.795 -20.209 1.00 56.39  ? 1237 VAL B N     1 
ATOM   8578  C  CA    . VAL B 1 483 ? 8.818   134.774 -19.487 1.00 57.18  ? 1237 VAL B CA    1 
ATOM   8579  C  C     . VAL B 1 483 ? 9.892   135.350 -18.567 1.00 67.02  ? 1237 VAL B C     1 
ATOM   8580  O  O     . VAL B 1 483 ? 10.714  136.150 -19.004 1.00 77.75  ? 1237 VAL B O     1 
ATOM   8581  C  CB    . VAL B 1 483 ? 9.526   133.840 -20.454 1.00 57.77  ? 1237 VAL B CB    1 
ATOM   8582  C  CG1   . VAL B 1 483 ? 10.655  133.106 -19.738 1.00 58.65  ? 1237 VAL B CG1   1 
ATOM   8583  C  CG2   . VAL B 1 483 ? 8.530   132.878 -21.067 1.00 59.35  ? 1237 VAL B CG2   1 
ATOM   8584  N  N     . VAL B 1 484 ? 9.912   134.940 -17.301 1.00 62.04  ? 1238 VAL B N     1 
ATOM   8585  C  CA    . VAL B 1 484 ? 11.014  135.352 -16.431 1.00 53.62  ? 1238 VAL B CA    1 
ATOM   8586  C  C     . VAL B 1 484 ? 11.933  134.205 -16.033 1.00 58.71  ? 1238 VAL B C     1 
ATOM   8587  O  O     . VAL B 1 484 ? 11.476  133.145 -15.597 1.00 69.60  ? 1238 VAL B O     1 
ATOM   8588  C  CB    . VAL B 1 484 ? 10.540  136.069 -15.184 1.00 54.54  ? 1238 VAL B CB    1 
ATOM   8589  C  CG1   . VAL B 1 484 ? 11.743  136.675 -14.474 1.00 53.50  ? 1238 VAL B CG1   1 
ATOM   8590  C  CG2   . VAL B 1 484 ? 9.517   137.153 -15.540 1.00 49.06  ? 1238 VAL B CG2   1 
ATOM   8591  N  N     . ARG B 1 485 ? 13.233  134.426 -16.189 1.00 51.99  ? 1239 ARG B N     1 
ATOM   8592  C  CA    . ARG B 1 485 ? 14.224  133.363 -16.058 1.00 57.99  ? 1239 ARG B CA    1 
ATOM   8593  C  C     . ARG B 1 485 ? 15.396  133.824 -15.210 1.00 61.87  ? 1239 ARG B C     1 
ATOM   8594  O  O     . ARG B 1 485 ? 15.883  134.955 -15.355 1.00 67.08  ? 1239 ARG B O     1 
ATOM   8595  C  CB    . ARG B 1 485 ? 14.726  132.945 -17.449 1.00 66.10  ? 1239 ARG B CB    1 
ATOM   8596  C  CG    . ARG B 1 485 ? 16.014  132.120 -17.489 1.00 63.86  ? 1239 ARG B CG    1 
ATOM   8597  C  CD    . ARG B 1 485 ? 16.639  132.201 -18.867 1.00 74.56  ? 1239 ARG B CD    1 
ATOM   8598  N  NE    . ARG B 1 485 ? 15.819  131.517 -19.859 1.00 89.44  ? 1239 ARG B NE    1 
ATOM   8599  C  CZ    . ARG B 1 485 ? 16.069  130.293 -20.317 1.00 103.95 ? 1239 ARG B CZ    1 
ATOM   8600  N  NH1   . ARG B 1 485 ? 17.130  129.627 -19.886 1.00 104.41 ? 1239 ARG B NH1   1 
ATOM   8601  N  NH2   . ARG B 1 485 ? 15.267  129.734 -21.216 1.00 111.05 ? 1239 ARG B NH2   1 
ATOM   8602  N  N     . SER B 1 486 ? 15.854  132.924 -14.346 1.00 54.14  ? 1240 SER B N     1 
ATOM   8603  C  CA    . SER B 1 486 ? 16.920  133.203 -13.396 1.00 58.41  ? 1240 SER B CA    1 
ATOM   8604  C  C     . SER B 1 486 ? 18.281  133.518 -14.016 1.00 61.94  ? 1240 SER B C     1 
ATOM   8605  O  O     . SER B 1 486 ? 18.705  132.871 -14.975 1.00 69.48  ? 1240 SER B O     1 
ATOM   8606  C  CB    . SER B 1 486 ? 17.057  132.024 -12.435 1.00 66.44  ? 1240 SER B CB    1 
ATOM   8607  O  OG    . SER B 1 486 ? 15.864  131.838 -11.699 1.00 70.91  ? 1240 SER B OG    1 
ATOM   8608  N  N     . LYS B 1 487 ? 18.961  134.507 -13.436 1.00 65.03  ? 1241 LYS B N     1 
ATOM   8609  C  CA    . LYS B 1 487 ? 20.315  134.888 -13.830 1.00 70.19  ? 1241 LYS B CA    1 
ATOM   8610  C  C     . LYS B 1 487 ? 21.281  133.873 -13.277 1.00 72.16  ? 1241 LYS B C     1 
ATOM   8611  O  O     . LYS B 1 487 ? 21.377  133.726 -12.063 1.00 78.88  ? 1241 LYS B O     1 
ATOM   8612  C  CB    . LYS B 1 487 ? 20.667  136.268 -13.270 1.00 75.03  ? 1241 LYS B CB    1 
ATOM   8613  C  CG    . LYS B 1 487 ? 22.065  136.782 -13.622 1.00 85.51  ? 1241 LYS B CG    1 
ATOM   8614  C  CD    . LYS B 1 487 ? 22.029  138.292 -13.903 1.00 96.11  ? 1241 LYS B CD    1 
ATOM   8615  C  CE    . LYS B 1 487 ? 23.417  138.907 -13.998 1.00 101.72 ? 1241 LYS B CE    1 
ATOM   8616  N  NZ    . LYS B 1 487 ? 24.045  139.035 -12.656 1.00 102.66 ? 1241 LYS B NZ    1 
ATOM   8617  N  N     . THR B 1 488 ? 21.990  133.178 -14.163 1.00 76.42  ? 1242 THR B N     1 
ATOM   8618  C  CA    . THR B 1 488 ? 22.904  132.103 -13.762 1.00 76.18  ? 1242 THR B CA    1 
ATOM   8619  C  C     . THR B 1 488 ? 24.358  132.332 -14.210 1.00 73.80  ? 1242 THR B C     1 
ATOM   8620  O  O     . THR B 1 488 ? 24.664  133.325 -14.861 1.00 82.57  ? 1242 THR B O     1 
ATOM   8621  C  CB    . THR B 1 488 ? 22.409  130.728 -14.260 1.00 73.07  ? 1242 THR B CB    1 
ATOM   8622  O  OG1   . THR B 1 488 ? 22.214  130.768 -15.674 1.00 65.96  ? 1242 THR B OG1   1 
ATOM   8623  C  CG2   . THR B 1 488 ? 21.097  130.390 -13.610 1.00 77.64  ? 1242 THR B CG2   1 
ATOM   8624  N  N     . GLU B 1 489 ? 25.247  131.418 -13.833 1.00 64.31  ? 1243 GLU B N     1 
ATOM   8625  C  CA    . GLU B 1 489 ? 26.670  131.514 -14.142 1.00 71.37  ? 1243 GLU B CA    1 
ATOM   8626  C  C     . GLU B 1 489 ? 27.265  130.141 -13.856 1.00 81.53  ? 1243 GLU B C     1 
ATOM   8627  O  O     . GLU B 1 489 ? 26.758  129.414 -12.992 1.00 85.71  ? 1243 GLU B O     1 
ATOM   8628  C  CB    . GLU B 1 489 ? 27.366  132.598 -13.303 1.00 56.31  ? 1243 GLU B CB    1 
ATOM   8629  N  N     . ILE B 1 490 ? 28.312  129.761 -14.587 1.00 77.11  ? 1244 ILE B N     1 
ATOM   8630  C  CA    . ILE B 1 490 ? 28.961  128.484 -14.308 1.00 73.00  ? 1244 ILE B CA    1 
ATOM   8631  C  C     . ILE B 1 490 ? 30.327  128.656 -13.700 1.00 80.77  ? 1244 ILE B C     1 
ATOM   8632  O  O     . ILE B 1 490 ? 31.178  129.335 -14.261 1.00 92.13  ? 1244 ILE B O     1 
ATOM   8633  C  CB    . ILE B 1 490 ? 29.178  127.642 -15.548 1.00 68.66  ? 1244 ILE B CB    1 
ATOM   8634  C  CG1   . ILE B 1 490 ? 27.948  127.677 -16.457 1.00 69.31  ? 1244 ILE B CG1   1 
ATOM   8635  C  CG2   . ILE B 1 490 ? 29.528  126.237 -15.107 1.00 62.90  ? 1244 ILE B CG2   1 
ATOM   8636  C  CD1   . ILE B 1 490 ? 26.819  126.792 -15.991 1.00 66.69  ? 1244 ILE B CD1   1 
ATOM   8637  N  N     . GLU B 1 491 ? 30.546  128.016 -12.564 1.00 85.45  ? 1245 GLU B N     1 
ATOM   8638  C  CA    . GLU B 1 491 ? 31.856  128.034 -11.934 1.00 97.63  ? 1245 GLU B CA    1 
ATOM   8639  C  C     . GLU B 1 491 ? 32.483  126.662 -12.063 1.00 95.63  ? 1245 GLU B C     1 
ATOM   8640  O  O     . GLU B 1 491 ? 31.810  125.650 -11.876 1.00 94.16  ? 1245 GLU B O     1 
ATOM   8641  C  CB    . GLU B 1 491 ? 31.750  128.425 -10.459 1.00 107.50 ? 1245 GLU B CB    1 
ATOM   8642  C  CG    . GLU B 1 491 ? 31.479  129.902 -10.212 1.00 113.90 ? 1245 GLU B CG    1 
ATOM   8643  C  CD    . GLU B 1 491 ? 31.359  130.241 -8.728  1.00 117.56 ? 1245 GLU B CD    1 
ATOM   8644  O  OE1   . GLU B 1 491 ? 31.321  129.302 -7.899  1.00 119.34 ? 1245 GLU B OE1   1 
ATOM   8645  O  OE2   . GLU B 1 491 ? 31.299  131.447 -8.394  1.00 117.15 ? 1245 GLU B OE2   1 
ATOM   8646  N  N     . LYS B 1 492 ? 33.769  126.624 -12.395 1.00 95.67  ? 1246 LYS B N     1 
ATOM   8647  C  CA    . LYS B 1 492 ? 34.471  125.350 -12.469 1.00 90.63  ? 1246 LYS B CA    1 
ATOM   8648  C  C     . LYS B 1 492 ? 35.095  125.048 -11.115 1.00 91.25  ? 1246 LYS B C     1 
ATOM   8649  O  O     . LYS B 1 492 ? 35.483  125.962 -10.387 1.00 91.40  ? 1246 LYS B O     1 
ATOM   8650  C  CB    . LYS B 1 492 ? 35.508  125.358 -13.597 1.00 81.56  ? 1246 LYS B CB    1 
ATOM   8651  C  CG    . LYS B 1 492 ? 34.887  125.412 -14.999 1.00 74.87  ? 1246 LYS B CG    1 
ATOM   8652  N  N     . LEU B 1 493 ? 35.147  123.768 -10.761 1.00 94.24  ? 1247 LEU B N     1 
ATOM   8653  C  CA    . LEU B 1 493 ? 35.730  123.341 -9.487  1.00 97.70  ? 1247 LEU B CA    1 
ATOM   8654  C  C     . LEU B 1 493 ? 36.839  122.303 -9.718  1.00 103.40 ? 1247 LEU B C     1 
ATOM   8655  O  O     . LEU B 1 493 ? 36.918  121.685 -10.789 1.00 101.81 ? 1247 LEU B O     1 
ATOM   8656  C  CB    . LEU B 1 493 ? 34.648  122.760 -8.563  1.00 94.00  ? 1247 LEU B CB    1 
ATOM   8657  C  CG    . LEU B 1 493 ? 33.312  123.515 -8.456  1.00 94.63  ? 1247 LEU B CG    1 
ATOM   8658  C  CD1   . LEU B 1 493 ? 32.187  122.621 -7.914  1.00 87.74  ? 1247 LEU B CD1   1 
ATOM   8659  C  CD2   . LEU B 1 493 ? 33.433  124.796 -7.618  1.00 98.25  ? 1247 LEU B CD2   1 
ATOM   8660  N  N     . LYS B 1 494 ? 37.694  122.120 -8.713  1.00 109.86 ? 1248 LYS B N     1 
ATOM   8661  C  CA    . LYS B 1 494 ? 38.743  121.107 -8.776  1.00 112.77 ? 1248 LYS B CA    1 
ATOM   8662  C  C     . LYS B 1 494 ? 38.077  119.751 -8.921  1.00 115.93 ? 1248 LYS B C     1 
ATOM   8663  O  O     . LYS B 1 494 ? 36.925  119.575 -8.516  1.00 117.51 ? 1248 LYS B O     1 
ATOM   8664  C  CB    . LYS B 1 494 ? 39.623  121.142 -7.523  1.00 108.52 ? 1248 LYS B CB    1 
ATOM   8665  N  N     . GLY B 1 495 ? 38.793  118.799 -9.508  1.00 116.85 ? 1249 GLY B N     1 
ATOM   8666  C  CA    . GLY B 1 495 ? 38.245  117.476 -9.737  1.00 119.17 ? 1249 GLY B CA    1 
ATOM   8667  C  C     . GLY B 1 495 ? 37.518  117.372 -11.065 1.00 123.18 ? 1249 GLY B C     1 
ATOM   8668  O  O     . GLY B 1 495 ? 36.883  116.354 -11.347 1.00 124.75 ? 1249 GLY B O     1 
ATOM   8669  N  N     . GLY B 1 496 ? 37.615  118.426 -11.879 1.00 123.00 ? 1250 GLY B N     1 
ATOM   8670  C  CA    . GLY B 1 496 ? 36.984  118.467 -13.190 1.00 118.85 ? 1250 GLY B CA    1 
ATOM   8671  C  C     . GLY B 1 496 ? 35.464  118.428 -13.154 1.00 114.73 ? 1250 GLY B C     1 
ATOM   8672  O  O     . GLY B 1 496 ? 34.833  117.839 -14.039 1.00 113.97 ? 1250 GLY B O     1 
ATOM   8673  N  N     . LYS B 1 497 ? 34.878  119.053 -12.130 1.00 106.97 ? 1251 LYS B N     1 
ATOM   8674  C  CA    . LYS B 1 497 ? 33.427  119.053 -11.932 1.00 91.68  ? 1251 LYS B CA    1 
ATOM   8675  C  C     . LYS B 1 497 ? 32.906  120.492 -11.922 1.00 97.98  ? 1251 LYS B C     1 
ATOM   8676  O  O     . LYS B 1 497 ? 33.490  121.356 -11.276 1.00 103.19 ? 1251 LYS B O     1 
ATOM   8677  C  CB    . LYS B 1 497 ? 33.057  118.314 -10.640 1.00 74.18  ? 1251 LYS B CB    1 
ATOM   8678  N  N     . GLU B 1 498 ? 31.827  120.748 -12.665 1.00 99.04  ? 1252 GLU B N     1 
ATOM   8679  C  CA    . GLU B 1 498 ? 31.253  122.100 -12.801 1.00 91.04  ? 1252 GLU B CA    1 
ATOM   8680  C  C     . GLU B 1 498 ? 30.225  122.442 -11.707 1.00 89.41  ? 1252 GLU B C     1 
ATOM   8681  O  O     . GLU B 1 498 ? 29.883  121.609 -10.866 1.00 92.16  ? 1252 GLU B O     1 
ATOM   8682  C  CB    . GLU B 1 498 ? 30.637  122.290 -14.200 1.00 86.58  ? 1252 GLU B CB    1 
ATOM   8683  C  CG    . GLU B 1 498 ? 31.667  122.474 -15.312 1.00 104.59 ? 1252 GLU B CG    1 
ATOM   8684  C  CD    . GLU B 1 498 ? 31.048  122.701 -16.699 1.00 113.89 ? 1252 GLU B CD    1 
ATOM   8685  O  OE1   . GLU B 1 498 ? 29.864  123.100 -16.769 1.00 111.98 ? 1252 GLU B OE1   1 
ATOM   8686  O  OE2   . GLU B 1 498 ? 31.753  122.475 -17.719 1.00 116.10 ? 1252 GLU B OE2   1 
ATOM   8687  N  N     . GLN B 1 499 ? 29.727  123.672 -11.717 1.00 83.29  ? 1253 GLN B N     1 
ATOM   8688  C  CA    . GLN B 1 499 ? 28.798  124.108 -10.675 1.00 73.36  ? 1253 GLN B CA    1 
ATOM   8689  C  C     . GLN B 1 499 ? 27.912  125.244 -11.155 1.00 67.43  ? 1253 GLN B C     1 
ATOM   8690  O  O     . GLN B 1 499 ? 28.394  126.331 -11.474 1.00 67.64  ? 1253 GLN B O     1 
ATOM   8691  C  CB    . GLN B 1 499 ? 29.572  124.550 -9.434  1.00 77.83  ? 1253 GLN B CB    1 
ATOM   8692  C  CG    . GLN B 1 499 ? 28.707  124.769 -8.222  1.00 83.04  ? 1253 GLN B CG    1 
ATOM   8693  C  CD    . GLN B 1 499 ? 29.489  125.274 -7.029  1.00 90.91  ? 1253 GLN B CD    1 
ATOM   8694  O  OE1   . GLN B 1 499 ? 29.475  124.656 -5.959  1.00 94.68  ? 1253 GLN B OE1   1 
ATOM   8695  N  NE2   . GLN B 1 499 ? 30.163  126.413 -7.197  1.00 90.98  ? 1253 GLN B NE2   1 
ATOM   8696  N  N     . ILE B 1 500 ? 26.612  125.000 -11.222 1.00 67.19  ? 1254 ILE B N     1 
ATOM   8697  C  CA    . ILE B 1 500 ? 25.692  126.063 -11.611 1.00 72.84  ? 1254 ILE B CA    1 
ATOM   8698  C  C     . ILE B 1 500 ? 25.429  127.009 -10.443 1.00 77.24  ? 1254 ILE B C     1 
ATOM   8699  O  O     . ILE B 1 500 ? 25.161  126.567 -9.319  1.00 85.47  ? 1254 ILE B O     1 
ATOM   8700  C  CB    . ILE B 1 500 ? 24.351  125.518 -12.062 1.00 70.53  ? 1254 ILE B CB    1 
ATOM   8701  C  CG1   . ILE B 1 500 ? 24.503  124.759 -13.372 1.00 74.78  ? 1254 ILE B CG1   1 
ATOM   8702  C  CG2   . ILE B 1 500 ? 23.384  126.662 -12.246 1.00 71.13  ? 1254 ILE B CG2   1 
ATOM   8703  C  CD1   . ILE B 1 500 ? 23.183  124.421 -14.012 1.00 76.98  ? 1254 ILE B CD1   1 
ATOM   8704  N  N     . VAL B 1 501 ? 25.495  128.309 -10.696 1.00 66.33  ? 1255 VAL B N     1 
ATOM   8705  C  CA    . VAL B 1 501 ? 25.319  129.258 -9.614  1.00 64.19  ? 1255 VAL B CA    1 
ATOM   8706  C  C     . VAL B 1 501 ? 24.227  130.240 -9.965  1.00 69.48  ? 1255 VAL B C     1 
ATOM   8707  O  O     . VAL B 1 501 ? 24.287  130.903 -10.990 1.00 75.65  ? 1255 VAL B O     1 
ATOM   8708  C  CB    . VAL B 1 501 ? 26.637  129.998 -9.300  1.00 62.99  ? 1255 VAL B CB    1 
ATOM   8709  C  CG1   . VAL B 1 501 ? 26.411  131.112 -8.269  1.00 56.04  ? 1255 VAL B CG1   1 
ATOM   8710  C  CG2   . VAL B 1 501 ? 27.708  129.000 -8.825  1.00 61.82  ? 1255 VAL B CG2   1 
ATOM   8711  N  N     . ILE B 1 502 ? 23.214  130.327 -9.120  1.00 66.16  ? 1256 ILE B N     1 
ATOM   8712  C  CA    . ILE B 1 502 ? 22.097  131.206 -9.417  1.00 65.45  ? 1256 ILE B CA    1 
ATOM   8713  C  C     . ILE B 1 502 ? 22.173  132.469 -8.587  1.00 64.27  ? 1256 ILE B C     1 
ATOM   8714  O  O     . ILE B 1 502 ? 22.262  132.393 -7.361  1.00 70.51  ? 1256 ILE B O     1 
ATOM   8715  C  CB    . ILE B 1 502 ? 20.771  130.526 -9.106  1.00 63.97  ? 1256 ILE B CB    1 
ATOM   8716  C  CG1   . ILE B 1 502 ? 20.662  129.202 -9.858  1.00 64.37  ? 1256 ILE B CG1   1 
ATOM   8717  C  CG2   . ILE B 1 502 ? 19.627  131.453 -9.471  1.00 65.65  ? 1256 ILE B CG2   1 
ATOM   8718  C  CD1   . ILE B 1 502 ? 19.541  128.331 -9.334  1.00 68.72  ? 1256 ILE B CD1   1 
ATOM   8719  N  N     . THR B 1 503 ? 22.112  133.633 -9.224  1.00 63.62  ? 1257 THR B N     1 
ATOM   8720  C  CA    . THR B 1 503 ? 22.252  134.870 -8.448  1.00 69.18  ? 1257 THR B CA    1 
ATOM   8721  C  C     . THR B 1 503 ? 21.075  135.819 -8.474  1.00 71.52  ? 1257 THR B C     1 
ATOM   8722  O  O     . THR B 1 503 ? 21.053  136.783 -7.705  1.00 78.23  ? 1257 THR B O     1 
ATOM   8723  C  CB    . THR B 1 503 ? 23.506  135.657 -8.808  1.00 69.76  ? 1257 THR B CB    1 
ATOM   8724  O  OG1   . THR B 1 503 ? 23.431  136.102 -10.177 1.00 74.08  ? 1257 THR B OG1   1 
ATOM   8725  C  CG2   . THR B 1 503 ? 24.721  134.788 -8.576  1.00 68.66  ? 1257 THR B CG2   1 
ATOM   8726  N  N     . GLU B 1 504 ? 20.109  135.557 -9.348  1.00 65.40  ? 1258 GLU B N     1 
ATOM   8727  C  CA    . GLU B 1 504 ? 18.862  136.317 -9.349  1.00 67.44  ? 1258 GLU B CA    1 
ATOM   8728  C  C     . GLU B 1 504 ? 17.734  135.358 -9.678  1.00 67.42  ? 1258 GLU B C     1 
ATOM   8729  O  O     . GLU B 1 504 ? 17.904  134.461 -10.490 1.00 68.99  ? 1258 GLU B O     1 
ATOM   8730  C  CB    . GLU B 1 504 ? 18.932  137.502 -10.331 1.00 67.19  ? 1258 GLU B CB    1 
ATOM   8731  C  CG    . GLU B 1 504 ? 20.213  138.353 -10.151 1.00 79.01  ? 1258 GLU B CG    1 
ATOM   8732  C  CD    . GLU B 1 504 ? 20.356  139.557 -11.095 1.00 92.00  ? 1258 GLU B CD    1 
ATOM   8733  O  OE1   . GLU B 1 504 ? 19.408  139.913 -11.836 1.00 95.53  ? 1258 GLU B OE1   1 
ATOM   8734  O  OE2   . GLU B 1 504 ? 21.451  140.157 -11.083 1.00 96.21  ? 1258 GLU B OE2   1 
ATOM   8735  N  N     . ILE B 1 505 ? 16.599  135.514 -9.013  1.00 67.76  ? 1259 ILE B N     1 
ATOM   8736  C  CA    . ILE B 1 505 ? 15.438  134.669 -9.296  1.00 63.96  ? 1259 ILE B CA    1 
ATOM   8737  C  C     . ILE B 1 505 ? 14.176  135.478 -9.619  1.00 63.05  ? 1259 ILE B C     1 
ATOM   8738  O  O     . ILE B 1 505 ? 14.138  136.706 -9.494  1.00 76.46  ? 1259 ILE B O     1 
ATOM   8739  C  CB    . ILE B 1 505 ? 15.158  133.672 -8.160  1.00 59.02  ? 1259 ILE B CB    1 
ATOM   8740  C  CG1   . ILE B 1 505 ? 14.870  134.414 -6.846  1.00 64.61  ? 1259 ILE B CG1   1 
ATOM   8741  C  CG2   . ILE B 1 505 ? 16.338  132.774 -7.978  1.00 52.50  ? 1259 ILE B CG2   1 
ATOM   8742  C  CD1   . ILE B 1 505 ? 14.180  133.566 -5.802  1.00 59.34  ? 1259 ILE B CD1   1 
ATOM   8743  N  N     . PRO B 1 506 ? 13.138  134.788 -10.064 1.00 50.34  ? 1260 PRO B N     1 
ATOM   8744  C  CA    . PRO B 1 506 ? 12.021  135.529 -10.665 1.00 51.78  ? 1260 PRO B CA    1 
ATOM   8745  C  C     . PRO B 1 506 ? 11.067  136.129 -9.656  1.00 53.22  ? 1260 PRO B C     1 
ATOM   8746  O  O     . PRO B 1 506 ? 10.733  135.491 -8.669  1.00 54.34  ? 1260 PRO B O     1 
ATOM   8747  C  CB    . PRO B 1 506 ? 11.311  134.471 -11.515 1.00 51.48  ? 1260 PRO B CB    1 
ATOM   8748  C  CG    . PRO B 1 506 ? 12.359  133.388 -11.718 1.00 56.20  ? 1260 PRO B CG    1 
ATOM   8749  C  CD    . PRO B 1 506 ? 13.164  133.375 -10.457 1.00 53.99  ? 1260 PRO B CD    1 
ATOM   8750  N  N     . TYR B 1 507 ? 10.637  137.357 -9.921  1.00 49.69  ? 1261 TYR B N     1 
ATOM   8751  C  CA    . TYR B 1 507 ? 9.650   138.050 -9.091  1.00 54.48  ? 1261 TYR B CA    1 
ATOM   8752  C  C     . TYR B 1 507 ? 8.613   137.129 -8.469  1.00 60.70  ? 1261 TYR B C     1 
ATOM   8753  O  O     . TYR B 1 507 ? 8.082   136.244 -9.133  1.00 48.52  ? 1261 TYR B O     1 
ATOM   8754  C  CB    . TYR B 1 507 ? 8.951   139.131 -9.900  1.00 51.55  ? 1261 TYR B CB    1 
ATOM   8755  C  CG    . TYR B 1 507 ? 8.204   140.146 -9.078  1.00 53.06  ? 1261 TYR B CG    1 
ATOM   8756  C  CD1   . TYR B 1 507 ? 8.874   141.003 -8.203  1.00 55.95  ? 1261 TYR B CD1   1 
ATOM   8757  C  CD2   . TYR B 1 507 ? 6.835   140.294 -9.203  1.00 55.76  ? 1261 TYR B CD2   1 
ATOM   8758  C  CE1   . TYR B 1 507 ? 8.190   141.955 -7.462  1.00 55.45  ? 1261 TYR B CE1   1 
ATOM   8759  C  CE2   . TYR B 1 507 ? 6.151   141.258 -8.476  1.00 60.76  ? 1261 TYR B CE2   1 
ATOM   8760  C  CZ    . TYR B 1 507 ? 6.830   142.078 -7.605  1.00 56.55  ? 1261 TYR B CZ    1 
ATOM   8761  O  OH    . TYR B 1 507 ? 6.129   143.021 -6.869  1.00 59.00  ? 1261 TYR B OH    1 
ATOM   8762  N  N     . GLU B 1 508 ? 8.355   137.346 -7.178  1.00 65.14  ? 1262 GLU B N     1 
ATOM   8763  C  CA    . GLU B 1 508 ? 7.283   136.672 -6.450  1.00 63.27  ? 1262 GLU B CA    1 
ATOM   8764  C  C     . GLU B 1 508 ? 7.535   135.194 -6.194  1.00 62.73  ? 1262 GLU B C     1 
ATOM   8765  O  O     . GLU B 1 508 ? 6.622   134.459 -5.823  1.00 71.18  ? 1262 GLU B O     1 
ATOM   8766  C  CB    . GLU B 1 508 ? 5.954   136.840 -7.176  1.00 70.73  ? 1262 GLU B CB    1 
ATOM   8767  C  CG    . GLU B 1 508 ? 5.349   138.197 -7.018  1.00 85.97  ? 1262 GLU B CG    1 
ATOM   8768  C  CD    . GLU B 1 508 ? 3.886   138.207 -7.397  1.00 104.72 ? 1262 GLU B CD    1 
ATOM   8769  O  OE1   . GLU B 1 508 ? 3.567   137.870 -8.576  1.00 102.30 ? 1262 GLU B OE1   1 
ATOM   8770  O  OE2   . GLU B 1 508 ? 3.067   138.548 -6.501  1.00 116.76 ? 1262 GLU B OE2   1 
ATOM   8771  N  N     . ILE B 1 509 ? 8.767   134.756 -6.380  1.00 46.60  ? 1263 ILE B N     1 
ATOM   8772  C  CA    . ILE B 1 509 ? 9.096   133.365 -6.110  1.00 52.62  ? 1263 ILE B CA    1 
ATOM   8773  C  C     . ILE B 1 509 ? 9.815   133.236 -4.783  1.00 57.15  ? 1263 ILE B C     1 
ATOM   8774  O  O     . ILE B 1 509 ? 10.722  134.012 -4.488  1.00 59.53  ? 1263 ILE B O     1 
ATOM   8775  C  CB    . ILE B 1 509 ? 9.951   132.756 -7.229  1.00 53.49  ? 1263 ILE B CB    1 
ATOM   8776  C  CG1   . ILE B 1 509 ? 9.074   132.544 -8.452  1.00 54.18  ? 1263 ILE B CG1   1 
ATOM   8777  C  CG2   . ILE B 1 509 ? 10.548  131.413 -6.794  1.00 43.72  ? 1263 ILE B CG2   1 
ATOM   8778  C  CD1   . ILE B 1 509 ? 7.883   131.627 -8.192  1.00 47.75  ? 1263 ILE B CD1   1 
ATOM   8779  N  N     . ASN B 1 510 ? 9.400   132.252 -3.990  1.00 57.29  ? 1264 ASN B N     1 
ATOM   8780  C  CA    . ASN B 1 510 ? 9.961   132.015 -2.656  1.00 53.81  ? 1264 ASN B CA    1 
ATOM   8781  C  C     . ASN B 1 510 ? 11.288  131.228 -2.705  1.00 59.63  ? 1264 ASN B C     1 
ATOM   8782  O  O     . ASN B 1 510 ? 11.298  130.040 -3.051  1.00 64.76  ? 1264 ASN B O     1 
ATOM   8783  C  CB    . ASN B 1 510 ? 8.917   131.263 -1.831  1.00 53.47  ? 1264 ASN B CB    1 
ATOM   8784  C  CG    . ASN B 1 510 ? 9.332   131.065 -0.399  1.00 63.45  ? 1264 ASN B CG    1 
ATOM   8785  O  OD1   . ASN B 1 510 ? 10.266  130.300 -0.101  1.00 66.65  ? 1264 ASN B OD1   1 
ATOM   8786  N  ND2   . ASN B 1 510 ? 8.619   131.732 0.516   1.00 67.52  ? 1264 ASN B ND2   1 
ATOM   8787  N  N     . LYS B 1 511 ? 12.401  131.872 -2.351  1.00 56.64  ? 1265 LYS B N     1 
ATOM   8788  C  CA    . LYS B 1 511 ? 13.721  131.245 -2.516  1.00 51.28  ? 1265 LYS B CA    1 
ATOM   8789  C  C     . LYS B 1 511 ? 13.787  129.873 -1.849  1.00 57.55  ? 1265 LYS B C     1 
ATOM   8790  O  O     . LYS B 1 511 ? 14.380  128.932 -2.371  1.00 61.75  ? 1265 LYS B O     1 
ATOM   8791  C  CB    . LYS B 1 511 ? 14.838  132.150 -1.976  1.00 48.00  ? 1265 LYS B CB    1 
ATOM   8792  C  CG    . LYS B 1 511 ? 16.262  131.639 -2.247  1.00 50.01  ? 1265 LYS B CG    1 
ATOM   8793  C  CD    . LYS B 1 511 ? 17.362  132.594 -1.724  1.00 55.85  ? 1265 LYS B CD    1 
ATOM   8794  C  CE    . LYS B 1 511 ? 17.353  132.731 -0.183  1.00 47.10  ? 1265 LYS B CE    1 
ATOM   8795  N  N     . ALA B 1 512 ? 13.159  129.760 -0.690  1.00 65.04  ? 1266 ALA B N     1 
ATOM   8796  C  CA    . ALA B 1 512 ? 13.308  128.568 0.127   1.00 56.04  ? 1266 ALA B CA    1 
ATOM   8797  C  C     . ALA B 1 512 ? 12.685  127.377 -0.556  1.00 56.76  ? 1266 ALA B C     1 
ATOM   8798  O  O     . ALA B 1 512 ? 13.297  126.317 -0.606  1.00 63.48  ? 1266 ALA B O     1 
ATOM   8799  C  CB    . ALA B 1 512 ? 12.695  128.787 1.485   1.00 56.96  ? 1266 ALA B CB    1 
ATOM   8800  N  N     . ASN B 1 513 ? 11.475  127.561 -1.088  1.00 56.81  ? 1267 ASN B N     1 
ATOM   8801  C  CA    . ASN B 1 513 ? 10.759  126.484 -1.782  1.00 60.60  ? 1267 ASN B CA    1 
ATOM   8802  C  C     . ASN B 1 513 ? 11.466  126.103 -3.054  1.00 63.74  ? 1267 ASN B C     1 
ATOM   8803  O  O     . ASN B 1 513 ? 11.699  124.928 -3.311  1.00 68.95  ? 1267 ASN B O     1 
ATOM   8804  C  CB    . ASN B 1 513 ? 9.312   126.870 -2.091  1.00 60.32  ? 1267 ASN B CB    1 
ATOM   8805  C  CG    . ASN B 1 513 ? 8.542   127.240 -0.849  1.00 82.31  ? 1267 ASN B CG    1 
ATOM   8806  O  OD1   . ASN B 1 513 ? 8.800   126.705 0.239   1.00 87.66  ? 1267 ASN B OD1   1 
ATOM   8807  N  ND2   . ASN B 1 513 ? 7.606   128.174 -0.988  1.00 92.03  ? 1267 ASN B ND2   1 
ATOM   8808  N  N     . LEU B 1 514 ? 11.802  127.114 -3.847  1.00 66.79  ? 1268 LEU B N     1 
ATOM   8809  C  CA    . LEU B 1 514 ? 12.584  126.929 -5.060  1.00 63.03  ? 1268 LEU B CA    1 
ATOM   8810  C  C     . LEU B 1 514 ? 13.722  125.963 -4.791  1.00 66.99  ? 1268 LEU B C     1 
ATOM   8811  O  O     . LEU B 1 514 ? 13.830  124.920 -5.451  1.00 72.59  ? 1268 LEU B O     1 
ATOM   8812  C  CB    . LEU B 1 514 ? 13.169  128.261 -5.510  1.00 59.05  ? 1268 LEU B CB    1 
ATOM   8813  C  CG    . LEU B 1 514 ? 13.343  128.484 -7.008  1.00 53.15  ? 1268 LEU B CG    1 
ATOM   8814  C  CD1   . LEU B 1 514 ? 14.448  129.505 -7.249  1.00 51.66  ? 1268 LEU B CD1   1 
ATOM   8815  C  CD2   . LEU B 1 514 ? 13.639  127.171 -7.705  1.00 54.64  ? 1268 LEU B CD2   1 
ATOM   8816  N  N     . VAL B 1 515 ? 14.575  126.310 -3.825  1.00 58.98  ? 1269 VAL B N     1 
ATOM   8817  C  CA    . VAL B 1 515 ? 15.639  125.399 -3.425  1.00 56.95  ? 1269 VAL B CA    1 
ATOM   8818  C  C     . VAL B 1 515 ? 15.119  124.001 -3.049  1.00 58.89  ? 1269 VAL B C     1 
ATOM   8819  O  O     . VAL B 1 515 ? 15.680  123.007 -3.518  1.00 59.66  ? 1269 VAL B O     1 
ATOM   8820  C  CB    . VAL B 1 515 ? 16.514  125.938 -2.295  1.00 52.24  ? 1269 VAL B CB    1 
ATOM   8821  C  CG1   . VAL B 1 515 ? 17.462  124.864 -1.863  1.00 45.01  ? 1269 VAL B CG1   1 
ATOM   8822  C  CG2   . VAL B 1 515 ? 17.276  127.142 -2.762  1.00 47.73  ? 1269 VAL B CG2   1 
ATOM   8823  N  N     . LYS B 1 516 ? 14.058  123.900 -2.236  1.00 57.89  ? 1270 LYS B N     1 
ATOM   8824  C  CA    . LYS B 1 516 ? 13.540  122.565 -1.915  1.00 56.53  ? 1270 LYS B CA    1 
ATOM   8825  C  C     . LYS B 1 516 ? 13.139  121.828 -3.190  1.00 56.29  ? 1270 LYS B C     1 
ATOM   8826  O  O     . LYS B 1 516 ? 13.519  120.678 -3.386  1.00 59.52  ? 1270 LYS B O     1 
ATOM   8827  C  CB    . LYS B 1 516 ? 12.388  122.571 -0.902  1.00 57.35  ? 1270 LYS B CB    1 
ATOM   8828  C  CG    . LYS B 1 516 ? 12.132  121.177 -0.246  1.00 49.55  ? 1270 LYS B CG    1 
ATOM   8829  N  N     . LYS B 1 517 ? 12.414  122.512 -4.070  1.00 59.03  ? 1271 LYS B N     1 
ATOM   8830  C  CA    . LYS B 1 517 ? 11.916  121.905 -5.299  1.00 62.53  ? 1271 LYS B CA    1 
ATOM   8831  C  C     . LYS B 1 517 ? 13.040  121.477 -6.253  1.00 69.67  ? 1271 LYS B C     1 
ATOM   8832  O  O     . LYS B 1 517 ? 12.889  120.489 -6.979  1.00 73.31  ? 1271 LYS B O     1 
ATOM   8833  C  CB    . LYS B 1 517 ? 10.881  122.802 -5.979  1.00 42.84  ? 1271 LYS B CB    1 
ATOM   8834  N  N     . ILE B 1 518 ? 14.178  122.175 -6.223  1.00 66.99  ? 1272 ILE B N     1 
ATOM   8835  C  CA    . ILE B 1 518 ? 15.326  121.768 -7.043  1.00 63.94  ? 1272 ILE B CA    1 
ATOM   8836  C  C     . ILE B 1 518 ? 15.984  120.553 -6.447  1.00 66.86  ? 1272 ILE B C     1 
ATOM   8837  O  O     . ILE B 1 518 ? 16.328  119.617 -7.162  1.00 73.78  ? 1272 ILE B O     1 
ATOM   8838  C  CB    . ILE B 1 518 ? 16.404  122.855 -7.161  1.00 61.55  ? 1272 ILE B CB    1 
ATOM   8839  C  CG1   . ILE B 1 518 ? 15.832  124.114 -7.816  1.00 59.39  ? 1272 ILE B CG1   1 
ATOM   8840  C  CG2   . ILE B 1 518 ? 17.572  122.351 -7.989  1.00 48.90  ? 1272 ILE B CG2   1 
ATOM   8841  C  CD1   . ILE B 1 518 ? 16.868  125.183 -8.060  1.00 55.72  ? 1272 ILE B CD1   1 
ATOM   8842  N  N     . ASP B 1 519 ? 16.164  120.560 -5.130  1.00 65.49  ? 1273 ASP B N     1 
ATOM   8843  C  CA    . ASP B 1 519 ? 16.745  119.398 -4.467  1.00 63.52  ? 1273 ASP B CA    1 
ATOM   8844  C  C     . ASP B 1 519 ? 15.842  118.182 -4.669  1.00 62.69  ? 1273 ASP B C     1 
ATOM   8845  O  O     . ASP B 1 519 ? 16.317  117.054 -4.824  1.00 62.38  ? 1273 ASP B O     1 
ATOM   8846  C  CB    . ASP B 1 519 ? 17.009  119.673 -2.990  1.00 64.66  ? 1273 ASP B CB    1 
ATOM   8847  C  CG    . ASP B 1 519 ? 17.841  118.580 -2.327  1.00 76.64  ? 1273 ASP B CG    1 
ATOM   8848  O  OD1   . ASP B 1 519 ? 19.064  118.477 -2.621  1.00 74.37  ? 1273 ASP B OD1   1 
ATOM   8849  O  OD2   . ASP B 1 519 ? 17.263  117.834 -1.497  1.00 83.37  ? 1273 ASP B OD2   1 
ATOM   8850  N  N     . ASP B 1 520 ? 14.538  118.413 -4.708  1.00 64.51  ? 1274 ASP B N     1 
ATOM   8851  C  CA    . ASP B 1 520 ? 13.614  117.343 -5.062  1.00 71.91  ? 1274 ASP B CA    1 
ATOM   8852  C  C     . ASP B 1 520 ? 13.941  116.722 -6.417  1.00 67.84  ? 1274 ASP B C     1 
ATOM   8853  O  O     . ASP B 1 520 ? 13.903  115.500 -6.574  1.00 70.36  ? 1274 ASP B O     1 
ATOM   8854  C  CB    . ASP B 1 520 ? 12.172  117.836 -5.025  1.00 86.37  ? 1274 ASP B CB    1 
ATOM   8855  C  CG    . ASP B 1 520 ? 11.544  117.664 -3.652  1.00 102.42 ? 1274 ASP B CG    1 
ATOM   8856  O  OD1   . ASP B 1 520 ? 11.726  116.571 -3.049  1.00 103.12 ? 1274 ASP B OD1   1 
ATOM   8857  O  OD2   . ASP B 1 520 ? 10.887  118.624 -3.175  1.00 111.10 ? 1274 ASP B OD2   1 
ATOM   8858  N  N     . VAL B 1 521 ? 14.275  117.554 -7.396  1.00 65.80  ? 1275 VAL B N     1 
ATOM   8859  C  CA    . VAL B 1 521 ? 14.658  117.026 -8.695  1.00 59.14  ? 1275 VAL B CA    1 
ATOM   8860  C  C     . VAL B 1 521 ? 15.879  116.129 -8.547  1.00 66.85  ? 1275 VAL B C     1 
ATOM   8861  O  O     . VAL B 1 521 ? 15.947  115.070 -9.172  1.00 76.52  ? 1275 VAL B O     1 
ATOM   8862  C  CB    . VAL B 1 521 ? 14.958  118.127 -9.716  1.00 52.56  ? 1275 VAL B CB    1 
ATOM   8863  C  CG1   . VAL B 1 521 ? 15.698  117.545 -10.917 1.00 51.26  ? 1275 VAL B CG1   1 
ATOM   8864  C  CG2   . VAL B 1 521 ? 13.671  118.838 -10.117 1.00 47.06  ? 1275 VAL B CG2   1 
ATOM   8865  N  N     . ARG B 1 522 ? 16.837  116.539 -7.714  1.00 64.41  ? 1276 ARG B N     1 
ATOM   8866  C  CA    . ARG B 1 522 ? 18.019  115.707 -7.491  1.00 60.40  ? 1276 ARG B CA    1 
ATOM   8867  C  C     . ARG B 1 522 ? 17.662  114.421 -6.778  1.00 56.60  ? 1276 ARG B C     1 
ATOM   8868  O  O     . ARG B 1 522 ? 18.111  113.343 -7.163  1.00 62.40  ? 1276 ARG B O     1 
ATOM   8869  C  CB    . ARG B 1 522 ? 19.090  116.423 -6.676  1.00 59.34  ? 1276 ARG B CB    1 
ATOM   8870  C  CG    . ARG B 1 522 ? 20.272  115.523 -6.333  1.00 62.10  ? 1276 ARG B CG    1 
ATOM   8871  C  CD    . ARG B 1 522 ? 21.056  116.071 -5.147  1.00 72.18  ? 1276 ARG B CD    1 
ATOM   8872  N  NE    . ARG B 1 522 ? 20.263  116.046 -3.922  1.00 72.99  ? 1276 ARG B NE    1 
ATOM   8873  C  CZ    . ARG B 1 522 ? 20.263  115.034 -3.063  1.00 74.81  ? 1276 ARG B CZ    1 
ATOM   8874  N  NH1   . ARG B 1 522 ? 21.024  113.965 -3.282  1.00 74.40  ? 1276 ARG B NH1   1 
ATOM   8875  N  NH2   . ARG B 1 522 ? 19.502  115.092 -1.986  1.00 75.90  ? 1276 ARG B NH2   1 
ATOM   8876  N  N     . VAL B 1 523 ? 16.871  114.534 -5.723  1.00 59.56  ? 1277 VAL B N     1 
ATOM   8877  C  CA    . VAL B 1 523 ? 16.538  113.355 -4.933  1.00 67.28  ? 1277 VAL B CA    1 
ATOM   8878  C  C     . VAL B 1 523 ? 15.756  112.329 -5.743  1.00 68.97  ? 1277 VAL B C     1 
ATOM   8879  O  O     . VAL B 1 523 ? 15.954  111.123 -5.575  1.00 62.06  ? 1277 VAL B O     1 
ATOM   8880  C  CB    . VAL B 1 523 ? 15.741  113.710 -3.671  1.00 59.87  ? 1277 VAL B CB    1 
ATOM   8881  C  CG1   . VAL B 1 523 ? 15.023  112.488 -3.169  1.00 52.77  ? 1277 VAL B CG1   1 
ATOM   8882  C  CG2   . VAL B 1 523 ? 16.667  114.272 -2.620  1.00 59.24  ? 1277 VAL B CG2   1 
ATOM   8883  N  N     . ASN B 1 524 ? 14.872  112.822 -6.613  1.00 64.77  ? 1278 ASN B N     1 
ATOM   8884  C  CA    . ASN B 1 524 ? 14.062  111.959 -7.459  1.00 64.89  ? 1278 ASN B CA    1 
ATOM   8885  C  C     . ASN B 1 524 ? 14.812  111.626 -8.721  1.00 66.86  ? 1278 ASN B C     1 
ATOM   8886  O  O     . ASN B 1 524 ? 14.343  110.854 -9.557  1.00 67.39  ? 1278 ASN B O     1 
ATOM   8887  C  CB    . ASN B 1 524 ? 12.731  112.611 -7.808  1.00 65.98  ? 1278 ASN B CB    1 
ATOM   8888  C  CG    . ASN B 1 524 ? 11.827  112.722 -6.622  1.00 78.71  ? 1278 ASN B CG    1 
ATOM   8889  O  OD1   . ASN B 1 524 ? 11.342  111.723 -6.107  1.00 82.17  ? 1278 ASN B OD1   1 
ATOM   8890  N  ND2   . ASN B 1 524 ? 11.595  113.943 -6.171  1.00 89.83  ? 1278 ASN B ND2   1 
ATOM   8891  N  N     . ASN B 1 525 ? 15.991  112.214 -8.863  1.00 66.89  ? 1279 ASN B N     1 
ATOM   8892  C  CA    . ASN B 1 525 ? 16.841  111.871 -9.992  1.00 64.85  ? 1279 ASN B CA    1 
ATOM   8893  C  C     . ASN B 1 525 ? 16.093  112.069 -11.291 1.00 63.86  ? 1279 ASN B C     1 
ATOM   8894  O  O     . ASN B 1 525 ? 16.157  111.226 -12.184 1.00 72.10  ? 1279 ASN B O     1 
ATOM   8895  C  CB    . ASN B 1 525 ? 17.255  110.420 -9.880  1.00 65.95  ? 1279 ASN B CB    1 
ATOM   8896  C  CG    . ASN B 1 525 ? 18.525  110.134 -10.603 1.00 68.16  ? 1279 ASN B CG    1 
ATOM   8897  O  OD1   . ASN B 1 525 ? 18.907  110.865 -11.519 1.00 74.67  ? 1279 ASN B OD1   1 
ATOM   8898  N  ND2   . ASN B 1 525 ? 19.202  109.063 -10.203 1.00 65.03  ? 1279 ASN B ND2   1 
ATOM   8899  N  N     . LYS B 1 526 ? 15.366  113.181 -11.379 1.00 64.62  ? 1280 LYS B N     1 
ATOM   8900  C  CA    . LYS B 1 526 ? 14.535  113.461 -12.542 1.00 83.57  ? 1280 LYS B CA    1 
ATOM   8901  C  C     . LYS B 1 526 ? 15.418  113.691 -13.777 1.00 90.12  ? 1280 LYS B C     1 
ATOM   8902  O  O     . LYS B 1 526 ? 15.106  113.207 -14.869 1.00 94.31  ? 1280 LYS B O     1 
ATOM   8903  C  CB    . LYS B 1 526 ? 13.577  114.638 -12.265 1.00 86.22  ? 1280 LYS B CB    1 
ATOM   8904  C  CG    . LYS B 1 526 ? 12.285  114.262 -11.498 1.00 77.86  ? 1280 LYS B CG    1 
ATOM   8905  N  N     . VAL B 1 527 ? 16.533  114.397 -13.576 1.00 85.36  ? 1281 VAL B N     1 
ATOM   8906  C  CA    . VAL B 1 527 ? 17.558  114.597 -14.606 1.00 74.88  ? 1281 VAL B CA    1 
ATOM   8907  C  C     . VAL B 1 527 ? 18.950  114.237 -14.063 1.00 74.80  ? 1281 VAL B C     1 
ATOM   8908  O  O     . VAL B 1 527 ? 19.282  114.539 -12.910 1.00 73.39  ? 1281 VAL B O     1 
ATOM   8909  C  CB    . VAL B 1 527 ? 17.564  116.047 -15.111 1.00 68.06  ? 1281 VAL B CB    1 
ATOM   8910  C  CG1   . VAL B 1 527 ? 17.789  116.989 -13.960 1.00 78.62  ? 1281 VAL B CG1   1 
ATOM   8911  C  CG2   . VAL B 1 527 ? 18.640  116.241 -16.123 1.00 71.96  ? 1281 VAL B CG2   1 
ATOM   8912  N  N     . ALA B 1 528 ? 19.768  113.594 -14.890 1.00 71.78  ? 1282 ALA B N     1 
ATOM   8913  C  CA    . ALA B 1 528 ? 21.050  113.076 -14.417 1.00 72.57  ? 1282 ALA B CA    1 
ATOM   8914  C  C     . ALA B 1 528 ? 22.086  114.157 -14.086 1.00 78.09  ? 1282 ALA B C     1 
ATOM   8915  O  O     . ALA B 1 528 ? 22.182  115.155 -14.786 1.00 79.77  ? 1282 ALA B O     1 
ATOM   8916  C  CB    . ALA B 1 528 ? 21.611  112.116 -15.429 1.00 75.74  ? 1282 ALA B CB    1 
ATOM   8917  N  N     . GLY B 1 529 ? 22.855  113.960 -13.014 1.00 81.58  ? 1283 GLY B N     1 
ATOM   8918  C  CA    . GLY B 1 529 ? 24.052  114.759 -12.790 1.00 81.87  ? 1283 GLY B CA    1 
ATOM   8919  C  C     . GLY B 1 529 ? 24.103  115.667 -11.571 1.00 83.54  ? 1283 GLY B C     1 
ATOM   8920  O  O     . GLY B 1 529 ? 25.099  116.369 -11.357 1.00 90.18  ? 1283 GLY B O     1 
ATOM   8921  N  N     . ILE B 1 530 ? 23.052  115.671 -10.759 1.00 75.49  ? 1284 ILE B N     1 
ATOM   8922  C  CA    . ILE B 1 530 ? 23.043  116.574 -9.614  1.00 72.91  ? 1284 ILE B CA    1 
ATOM   8923  C  C     . ILE B 1 530 ? 23.671  116.003 -8.324  1.00 78.87  ? 1284 ILE B C     1 
ATOM   8924  O  O     . ILE B 1 530 ? 23.139  115.091 -7.686  1.00 84.27  ? 1284 ILE B O     1 
ATOM   8925  C  CB    . ILE B 1 530 ? 21.648  117.180 -9.381  1.00 68.91  ? 1284 ILE B CB    1 
ATOM   8926  C  CG1   . ILE B 1 530 ? 21.287  118.087 -10.559 1.00 65.23  ? 1284 ILE B CG1   1 
ATOM   8927  C  CG2   . ILE B 1 530 ? 21.628  118.001 -8.117  1.00 70.22  ? 1284 ILE B CG2   1 
ATOM   8928  C  CD1   . ILE B 1 530 ? 19.991  118.858 -10.385 1.00 57.19  ? 1284 ILE B CD1   1 
ATOM   8929  N  N     . ALA B 1 531 ? 24.822  116.565 -7.965  1.00 76.85  ? 1285 ALA B N     1 
ATOM   8930  C  CA    . ALA B 1 531 ? 25.550  116.217 -6.747  1.00 72.98  ? 1285 ALA B CA    1 
ATOM   8931  C  C     . ALA B 1 531 ? 24.922  116.798 -5.472  1.00 74.25  ? 1285 ALA B C     1 
ATOM   8932  O  O     . ALA B 1 531 ? 24.730  116.094 -4.480  1.00 74.93  ? 1285 ALA B O     1 
ATOM   8933  C  CB    . ALA B 1 531 ? 26.979  116.698 -6.866  1.00 68.17  ? 1285 ALA B CB    1 
ATOM   8934  N  N     . GLU B 1 532 ? 24.615  118.089 -5.487  1.00 68.20  ? 1286 GLU B N     1 
ATOM   8935  C  CA    . GLU B 1 532 ? 24.170  118.736 -4.269  1.00 70.13  ? 1286 GLU B CA    1 
ATOM   8936  C  C     . GLU B 1 532 ? 23.564  120.127 -4.528  1.00 72.87  ? 1286 GLU B C     1 
ATOM   8937  O  O     . GLU B 1 532 ? 24.105  120.918 -5.293  1.00 86.46  ? 1286 GLU B O     1 
ATOM   8938  C  CB    . GLU B 1 532 ? 25.355  118.827 -3.295  1.00 76.15  ? 1286 GLU B CB    1 
ATOM   8939  C  CG    . GLU B 1 532 ? 24.980  119.220 -1.860  1.00 92.13  ? 1286 GLU B CG    1 
ATOM   8940  C  CD    . GLU B 1 532 ? 26.176  119.690 -1.039  1.00 104.23 ? 1286 GLU B CD    1 
ATOM   8941  O  OE1   . GLU B 1 532 ? 27.252  119.904 -1.642  1.00 113.52 ? 1286 GLU B OE1   1 
ATOM   8942  O  OE2   . GLU B 1 532 ? 26.041  119.849 0.199   1.00 102.60 ? 1286 GLU B OE2   1 
ATOM   8943  N  N     . VAL B 1 533 ? 22.437  120.423 -3.898  1.00 64.92  ? 1287 VAL B N     1 
ATOM   8944  C  CA    . VAL B 1 533 ? 21.909  121.783 -3.908  1.00 65.10  ? 1287 VAL B CA    1 
ATOM   8945  C  C     . VAL B 1 533 ? 22.211  122.487 -2.576  1.00 70.56  ? 1287 VAL B C     1 
ATOM   8946  O  O     . VAL B 1 533 ? 22.010  121.913 -1.513  1.00 81.20  ? 1287 VAL B O     1 
ATOM   8947  C  CB    . VAL B 1 533 ? 20.387  121.782 -4.081  1.00 64.48  ? 1287 VAL B CB    1 
ATOM   8948  C  CG1   . VAL B 1 533 ? 19.869  123.191 -4.038  1.00 65.53  ? 1287 VAL B CG1   1 
ATOM   8949  C  CG2   . VAL B 1 533 ? 19.984  121.085 -5.380  1.00 60.69  ? 1287 VAL B CG2   1 
ATOM   8950  N  N     . ARG B 1 534 ? 22.675  123.729 -2.629  1.00 67.58  ? 1288 ARG B N     1 
ATOM   8951  C  CA    . ARG B 1 534 ? 23.022  124.467 -1.420  1.00 66.31  ? 1288 ARG B CA    1 
ATOM   8952  C  C     . ARG B 1 534 ? 22.641  125.939 -1.506  1.00 76.82  ? 1288 ARG B C     1 
ATOM   8953  O  O     . ARG B 1 534 ? 23.129  126.653 -2.378  1.00 79.46  ? 1288 ARG B O     1 
ATOM   8954  C  CB    . ARG B 1 534 ? 24.522  124.383 -1.178  1.00 62.64  ? 1288 ARG B CB    1 
ATOM   8955  C  CG    . ARG B 1 534 ? 24.975  123.134 -0.500  1.00 70.24  ? 1288 ARG B CG    1 
ATOM   8956  C  CD    . ARG B 1 534 ? 26.481  123.157 -0.349  1.00 82.08  ? 1288 ARG B CD    1 
ATOM   8957  N  NE    . ARG B 1 534 ? 27.149  122.868 -1.616  1.00 87.10  ? 1288 ARG B NE    1 
ATOM   8958  C  CZ    . ARG B 1 534 ? 27.876  123.745 -2.295  1.00 87.87  ? 1288 ARG B CZ    1 
ATOM   8959  N  NH1   . ARG B 1 534 ? 28.038  124.969 -1.818  1.00 85.37  ? 1288 ARG B NH1   1 
ATOM   8960  N  NH2   . ARG B 1 534 ? 28.447  123.391 -3.440  1.00 89.06  ? 1288 ARG B NH2   1 
ATOM   8961  N  N     . ASP B 1 535 ? 21.777  126.402 -0.604  1.00 78.46  ? 1289 ASP B N     1 
ATOM   8962  C  CA    . ASP B 1 535 ? 21.511  127.837 -0.506  1.00 68.02  ? 1289 ASP B CA    1 
ATOM   8963  C  C     . ASP B 1 535 ? 22.718  128.444 0.200   1.00 68.64  ? 1289 ASP B C     1 
ATOM   8964  O  O     . ASP B 1 535 ? 23.125  127.982 1.261   1.00 74.39  ? 1289 ASP B O     1 
ATOM   8965  C  CB    . ASP B 1 535 ? 20.195  128.119 0.237   1.00 62.59  ? 1289 ASP B CB    1 
ATOM   8966  C  CG    . ASP B 1 535 ? 19.686  129.566 0.042   1.00 76.22  ? 1289 ASP B CG    1 
ATOM   8967  O  OD1   . ASP B 1 535 ? 20.340  130.350 -0.687  1.00 75.92  ? 1289 ASP B OD1   1 
ATOM   8968  O  OD2   . ASP B 1 535 ? 18.616  129.918 0.612   1.00 82.97  ? 1289 ASP B OD2   1 
ATOM   8969  N  N     . GLU B 1 536 ? 23.334  129.437 -0.422  1.00 68.42  ? 1290 GLU B N     1 
ATOM   8970  C  CA    . GLU B 1 536 ? 24.542  130.026 0.131   1.00 71.28  ? 1290 GLU B CA    1 
ATOM   8971  C  C     . GLU B 1 536 ? 24.370  131.513 0.249   1.00 72.00  ? 1290 GLU B C     1 
ATOM   8972  O  O     . GLU B 1 536 ? 25.356  132.258 0.301   1.00 70.57  ? 1290 GLU B O     1 
ATOM   8973  C  CB    . GLU B 1 536 ? 25.744  129.733 -0.756  1.00 71.92  ? 1290 GLU B CB    1 
ATOM   8974  C  CG    . GLU B 1 536 ? 26.201  128.294 -0.713  1.00 78.77  ? 1290 GLU B CG    1 
ATOM   8975  C  CD    . GLU B 1 536 ? 27.539  128.088 -1.407  1.00 94.49  ? 1290 GLU B CD    1 
ATOM   8976  O  OE1   . GLU B 1 536 ? 28.017  129.024 -2.102  1.00 95.21  ? 1290 GLU B OE1   1 
ATOM   8977  O  OE2   . GLU B 1 536 ? 28.116  126.987 -1.244  1.00 104.58 ? 1290 GLU B OE2   1 
ATOM   8978  N  N     . SER B 1 537 ? 23.112  131.943 0.277   1.00 73.96  ? 1291 SER B N     1 
ATOM   8979  C  CA    . SER B 1 537 ? 22.803  133.363 0.344   1.00 75.02  ? 1291 SER B CA    1 
ATOM   8980  C  C     . SER B 1 537 ? 23.149  133.880 1.729   1.00 80.27  ? 1291 SER B C     1 
ATOM   8981  O  O     . SER B 1 537 ? 22.931  133.205 2.736   1.00 93.96  ? 1291 SER B O     1 
ATOM   8982  C  CB    . SER B 1 537 ? 21.330  133.626 0.023   1.00 69.93  ? 1291 SER B CB    1 
ATOM   8983  O  OG    . SER B 1 537 ? 20.947  132.989 -1.187  1.00 66.46  ? 1291 SER B OG    1 
ATOM   8984  N  N     . ASP B 1 538 ? 23.718  135.072 1.779   1.00 70.43  ? 1292 ASP B N     1 
ATOM   8985  C  CA    . ASP B 1 538 ? 23.988  135.697 3.052   1.00 71.34  ? 1292 ASP B CA    1 
ATOM   8986  C  C     . ASP B 1 538 ? 23.548  137.169 3.037   1.00 78.49  ? 1292 ASP B C     1 
ATOM   8987  O  O     . ASP B 1 538 ? 23.248  137.724 1.977   1.00 74.44  ? 1292 ASP B O     1 
ATOM   8988  C  CB    . ASP B 1 538 ? 25.453  135.488 3.471   1.00 72.98  ? 1292 ASP B CB    1 
ATOM   8989  C  CG    . ASP B 1 538 ? 26.412  136.435 2.787   1.00 81.78  ? 1292 ASP B CG    1 
ATOM   8990  O  OD1   . ASP B 1 538 ? 26.007  137.107 1.809   1.00 84.04  ? 1292 ASP B OD1   1 
ATOM   8991  O  OD2   . ASP B 1 538 ? 27.586  136.493 3.232   1.00 87.89  ? 1292 ASP B OD2   1 
ATOM   8992  N  N     . ARG B 1 539 ? 23.479  137.777 4.221   1.00 87.78  ? 1293 ARG B N     1 
ATOM   8993  C  CA    . ARG B 1 539 ? 22.896  139.106 4.380   1.00 85.51  ? 1293 ARG B CA    1 
ATOM   8994  C  C     . ARG B 1 539 ? 23.185  140.061 3.199   1.00 85.20  ? 1293 ARG B C     1 
ATOM   8995  O  O     . ARG B 1 539 ? 22.374  140.929 2.882   1.00 86.17  ? 1293 ARG B O     1 
ATOM   8996  C  CB    . ARG B 1 539 ? 23.293  139.713 5.737   1.00 85.29  ? 1293 ARG B CB    1 
ATOM   8997  C  CG    . ARG B 1 539 ? 24.752  140.080 5.847   1.00 87.66  ? 1293 ARG B CG    1 
ATOM   8998  C  CD    . ARG B 1 539 ? 25.257  139.912 7.248   1.00 93.56  ? 1293 ARG B CD    1 
ATOM   8999  N  NE    . ARG B 1 539 ? 26.504  139.156 7.253   1.00 98.46  ? 1293 ARG B NE    1 
ATOM   9000  C  CZ    . ARG B 1 539 ? 26.564  137.830 7.190   1.00 96.49  ? 1293 ARG B CZ    1 
ATOM   9001  N  NH1   . ARG B 1 539 ? 25.440  137.127 7.110   1.00 97.85  ? 1293 ARG B NH1   1 
ATOM   9002  N  NH2   . ARG B 1 539 ? 27.739  137.209 7.202   1.00 90.81  ? 1293 ARG B NH2   1 
ATOM   9003  N  N     . ASP B 1 540 ? 24.312  139.895 2.521   1.00 87.70  ? 1294 ASP B N     1 
ATOM   9004  C  CA    . ASP B 1 540 ? 24.573  140.749 1.361   1.00 94.54  ? 1294 ASP B CA    1 
ATOM   9005  C  C     . ASP B 1 540 ? 24.775  140.016 0.027   1.00 88.61  ? 1294 ASP B C     1 
ATOM   9006  O  O     . ASP B 1 540 ? 25.848  140.075 -0.570  1.00 95.79  ? 1294 ASP B O     1 
ATOM   9007  C  CB    . ASP B 1 540 ? 25.709  141.751 1.640   1.00 108.69 ? 1294 ASP B CB    1 
ATOM   9008  C  CG    . ASP B 1 540 ? 26.854  141.153 2.451   1.00 110.16 ? 1294 ASP B CG    1 
ATOM   9009  O  OD1   . ASP B 1 540 ? 27.224  139.980 2.204   1.00 108.71 ? 1294 ASP B OD1   1 
ATOM   9010  O  OD2   . ASP B 1 540 ? 27.391  141.875 3.329   1.00 106.49 ? 1294 ASP B OD2   1 
ATOM   9011  N  N     . GLY B 1 541 ? 23.727  139.346 -0.446  1.00 76.78  ? 1295 GLY B N     1 
ATOM   9012  C  CA    . GLY B 1 541 ? 23.786  138.663 -1.727  1.00 75.13  ? 1295 GLY B CA    1 
ATOM   9013  C  C     . GLY B 1 541 ? 23.068  137.322 -1.798  1.00 74.71  ? 1295 GLY B C     1 
ATOM   9014  O  O     . GLY B 1 541 ? 23.091  136.516 -0.861  1.00 78.31  ? 1295 GLY B O     1 
ATOM   9015  N  N     . LEU B 1 542 ? 22.422  137.075 -2.929  1.00 67.49  ? 1296 LEU B N     1 
ATOM   9016  C  CA    . LEU B 1 542 ? 21.747  135.804 -3.147  1.00 56.79  ? 1296 LEU B CA    1 
ATOM   9017  C  C     . LEU B 1 542 ? 22.680  134.846 -3.901  1.00 59.73  ? 1296 LEU B C     1 
ATOM   9018  O  O     . LEU B 1 542 ? 23.479  135.273 -4.738  1.00 67.17  ? 1296 LEU B O     1 
ATOM   9019  C  CB    . LEU B 1 542 ? 20.428  136.031 -3.893  1.00 50.43  ? 1296 LEU B CB    1 
ATOM   9020  C  CG    . LEU B 1 542 ? 19.563  134.813 -4.195  1.00 62.78  ? 1296 LEU B CG    1 
ATOM   9021  C  CD1   . LEU B 1 542 ? 18.127  135.230 -4.506  1.00 64.56  ? 1296 LEU B CD1   1 
ATOM   9022  C  CD2   . LEU B 1 542 ? 20.170  133.988 -5.342  1.00 67.31  ? 1296 LEU B CD2   1 
ATOM   9023  N  N     . ARG B 1 543 ? 22.603  133.559 -3.573  1.00 53.43  ? 1297 ARG B N     1 
ATOM   9024  C  CA    . ARG B 1 543 ? 23.462  132.547 -4.192  1.00 57.68  ? 1297 ARG B CA    1 
ATOM   9025  C  C     . ARG B 1 543 ? 22.997  131.124 -3.889  1.00 62.74  ? 1297 ARG B C     1 
ATOM   9026  O  O     . ARG B 1 543 ? 23.123  130.642 -2.764  1.00 64.09  ? 1297 ARG B O     1 
ATOM   9027  C  CB    . ARG B 1 543 ? 24.931  132.721 -3.770  1.00 58.91  ? 1297 ARG B CB    1 
ATOM   9028  C  CG    . ARG B 1 543 ? 25.840  131.525 -4.098  1.00 60.52  ? 1297 ARG B CG    1 
ATOM   9029  C  CD    . ARG B 1 543 ? 27.275  131.722 -3.576  1.00 63.80  ? 1297 ARG B CD    1 
ATOM   9030  N  NE    . ARG B 1 543 ? 28.213  131.810 -4.686  1.00 67.10  ? 1297 ARG B NE    1 
ATOM   9031  C  CZ    . ARG B 1 543 ? 29.068  130.852 -5.002  1.00 81.93  ? 1297 ARG B CZ    1 
ATOM   9032  N  NH1   . ARG B 1 543 ? 29.126  129.753 -4.264  1.00 91.12  ? 1297 ARG B NH1   1 
ATOM   9033  N  NH2   . ARG B 1 543 ? 29.868  130.994 -6.048  1.00 84.54  ? 1297 ARG B NH2   1 
ATOM   9034  N  N     . ILE B 1 544 ? 22.452  130.472 -4.909  1.00 62.35  ? 1298 ILE B N     1 
ATOM   9035  C  CA    . ILE B 1 544 ? 22.109  129.062 -4.858  1.00 58.30  ? 1298 ILE B CA    1 
ATOM   9036  C  C     . ILE B 1 544 ? 23.120  128.339 -5.756  1.00 71.27  ? 1298 ILE B C     1 
ATOM   9037  O  O     . ILE B 1 544 ? 23.153  128.569 -6.971  1.00 74.14  ? 1298 ILE B O     1 
ATOM   9038  C  CB    . ILE B 1 544 ? 20.673  128.850 -5.380  1.00 51.61  ? 1298 ILE B CB    1 
ATOM   9039  C  CG1   . ILE B 1 544 ? 19.729  129.821 -4.684  1.00 58.46  ? 1298 ILE B CG1   1 
ATOM   9040  C  CG2   . ILE B 1 544 ? 20.191  127.434 -5.158  1.00 49.94  ? 1298 ILE B CG2   1 
ATOM   9041  C  CD1   . ILE B 1 544 ? 18.370  129.971 -5.364  1.00 61.01  ? 1298 ILE B CD1   1 
ATOM   9042  N  N     . ALA B 1 545 ? 23.966  127.509 -5.139  1.00 71.59  ? 1299 ALA B N     1 
ATOM   9043  C  CA    . ALA B 1 545 ? 24.973  126.713 -5.838  1.00 57.37  ? 1299 ALA B CA    1 
ATOM   9044  C  C     . ALA B 1 545 ? 24.368  125.356 -6.154  1.00 61.63  ? 1299 ALA B C     1 
ATOM   9045  O  O     . ALA B 1 545 ? 23.874  124.672 -5.264  1.00 70.58  ? 1299 ALA B O     1 
ATOM   9046  N  N     . ILE B 1 546 ? 24.372  124.973 -7.423  1.00 61.12  ? 1300 ILE B N     1 
ATOM   9047  C  CA    . ILE B 1 546 ? 23.952  123.623 -7.799  1.00 62.61  ? 1300 ILE B CA    1 
ATOM   9048  C  C     . ILE B 1 546 ? 25.163  122.871 -8.316  1.00 69.70  ? 1300 ILE B C     1 
ATOM   9049  O  O     . ILE B 1 546 ? 25.623  123.113 -9.432  1.00 79.59  ? 1300 ILE B O     1 
ATOM   9050  C  CB    . ILE B 1 546 ? 22.871  123.621 -8.898  1.00 57.31  ? 1300 ILE B CB    1 
ATOM   9051  C  CG1   . ILE B 1 546 ? 21.664  124.437 -8.469  1.00 55.36  ? 1300 ILE B CG1   1 
ATOM   9052  C  CG2   . ILE B 1 546 ? 22.413  122.213 -9.201  1.00 54.39  ? 1300 ILE B CG2   1 
ATOM   9053  C  CD1   . ILE B 1 546 ? 20.585  124.439 -9.512  1.00 56.33  ? 1300 ILE B CD1   1 
ATOM   9054  N  N     . GLU B 1 547 ? 25.673  121.960 -7.500  1.00 68.06  ? 1301 GLU B N     1 
ATOM   9055  C  CA    . GLU B 1 547 ? 26.926  121.273 -7.787  1.00 74.75  ? 1301 GLU B CA    1 
ATOM   9056  C  C     . GLU B 1 547 ? 26.675  120.024 -8.597  1.00 76.97  ? 1301 GLU B C     1 
ATOM   9057  O  O     . GLU B 1 547 ? 25.978  119.121 -8.150  1.00 81.83  ? 1301 GLU B O     1 
ATOM   9058  C  CB    . GLU B 1 547 ? 27.628  120.922 -6.476  1.00 81.19  ? 1301 GLU B CB    1 
ATOM   9059  C  CG    . GLU B 1 547 ? 28.862  120.083 -6.628  1.00 89.81  ? 1301 GLU B CG    1 
ATOM   9060  C  CD    . GLU B 1 547 ? 29.732  120.122 -5.390  1.00 97.31  ? 1301 GLU B CD    1 
ATOM   9061  O  OE1   . GLU B 1 547 ? 30.231  119.046 -4.978  1.00 95.37  ? 1301 GLU B OE1   1 
ATOM   9062  O  OE2   . GLU B 1 547 ? 29.916  121.234 -4.839  1.00 103.19 ? 1301 GLU B OE2   1 
ATOM   9063  N  N     . LEU B 1 548 ? 27.249  119.975 -9.792  1.00 79.22  ? 1302 LEU B N     1 
ATOM   9064  C  CA    . LEU B 1 548 ? 27.032  118.855 -10.703 1.00 79.24  ? 1302 LEU B CA    1 
ATOM   9065  C  C     . LEU B 1 548 ? 28.002  117.710 -10.456 1.00 84.94  ? 1302 LEU B C     1 
ATOM   9066  O  O     . LEU B 1 548 ? 28.933  117.839 -9.668  1.00 89.64  ? 1302 LEU B O     1 
ATOM   9067  C  CB    . LEU B 1 548 ? 27.127  119.342 -12.144 1.00 77.63  ? 1302 LEU B CB    1 
ATOM   9068  C  CG    . LEU B 1 548 ? 25.964  120.271 -12.493 1.00 80.92  ? 1302 LEU B CG    1 
ATOM   9069  C  CD1   . LEU B 1 548 ? 26.262  121.106 -13.707 1.00 80.89  ? 1302 LEU B CD1   1 
ATOM   9070  C  CD2   . LEU B 1 548 ? 24.708  119.452 -12.717 1.00 85.89  ? 1302 LEU B CD2   1 
ATOM   9071  N  N     . LYS B 1 549 ? 27.784  116.581 -11.117 1.00 88.64  ? 1303 LYS B N     1 
ATOM   9072  C  CA    . LYS B 1 549 ? 28.634  115.418 -10.886 1.00 95.42  ? 1303 LYS B CA    1 
ATOM   9073  C  C     . LYS B 1 549 ? 29.820  115.389 -11.850 1.00 109.24 ? 1303 LYS B C     1 
ATOM   9074  O  O     . LYS B 1 549 ? 30.047  116.353 -12.592 1.00 114.11 ? 1303 LYS B O     1 
ATOM   9075  C  CB    . LYS B 1 549 ? 27.828  114.118 -10.963 1.00 93.61  ? 1303 LYS B CB    1 
ATOM   9076  C  CG    . LYS B 1 549 ? 26.831  113.891 -9.817  1.00 90.23  ? 1303 LYS B CG    1 
ATOM   9077  C  CD    . LYS B 1 549 ? 26.187  112.506 -9.942  1.00 93.38  ? 1303 LYS B CD    1 
ATOM   9078  C  CE    . LYS B 1 549 ? 24.805  112.417 -9.289  1.00 91.50  ? 1303 LYS B CE    1 
ATOM   9079  N  NZ    . LYS B 1 549 ? 24.263  111.015 -9.350  1.00 92.27  ? 1303 LYS B NZ    1 
ATOM   9080  N  N     . LYS B 1 550 ? 30.565  114.279 -11.826 1.00 111.35 ? 1304 LYS B N     1 
ATOM   9081  C  CA    . LYS B 1 550 ? 31.802  114.119 -12.599 1.00 108.60 ? 1304 LYS B CA    1 
ATOM   9082  C  C     . LYS B 1 550 ? 31.672  114.531 -14.059 1.00 105.13 ? 1304 LYS B C     1 
ATOM   9083  O  O     . LYS B 1 550 ? 32.329  115.475 -14.510 1.00 112.88 ? 1304 LYS B O     1 
ATOM   9084  C  CB    . LYS B 1 550 ? 32.320  112.679 -12.511 1.00 110.01 ? 1304 LYS B CB    1 
ATOM   9085  N  N     . ASP B 1 551 ? 30.831  113.825 -14.803 1.00 93.47  ? 1305 ASP B N     1 
ATOM   9086  C  CA    . ASP B 1 551 ? 30.696  114.104 -16.227 1.00 88.38  ? 1305 ASP B CA    1 
ATOM   9087  C  C     . ASP B 1 551 ? 29.242  114.376 -16.593 1.00 90.53  ? 1305 ASP B C     1 
ATOM   9088  O  O     . ASP B 1 551 ? 28.696  113.780 -17.520 1.00 95.42  ? 1305 ASP B O     1 
ATOM   9089  C  CB    . ASP B 1 551 ? 31.277  112.954 -17.063 1.00 79.07  ? 1305 ASP B CB    1 
ATOM   9090  N  N     . ALA B 1 552 ? 28.618  115.286 -15.857 1.00 85.66  ? 1306 ALA B N     1 
ATOM   9091  C  CA    . ALA B 1 552 ? 27.221  115.629 -16.093 1.00 88.63  ? 1306 ALA B CA    1 
ATOM   9092  C  C     . ALA B 1 552 ? 27.039  116.588 -17.274 1.00 90.80  ? 1306 ALA B C     1 
ATOM   9093  O  O     . ALA B 1 552 ? 27.808  117.542 -17.430 1.00 89.30  ? 1306 ALA B O     1 
ATOM   9094  C  CB    . ALA B 1 552 ? 26.618  116.215 -14.835 1.00 89.98  ? 1306 ALA B CB    1 
ATOM   9095  N  N     . ASN B 1 553 ? 26.024  116.336 -18.104 1.00 90.96  ? 1307 ASN B N     1 
ATOM   9096  C  CA    . ASN B 1 553 ? 25.709  117.246 -19.208 1.00 95.01  ? 1307 ASN B CA    1 
ATOM   9097  C  C     . ASN B 1 553 ? 25.150  118.544 -18.642 1.00 97.82  ? 1307 ASN B C     1 
ATOM   9098  O  O     . ASN B 1 553 ? 23.947  118.659 -18.391 1.00 95.49  ? 1307 ASN B O     1 
ATOM   9099  C  CB    . ASN B 1 553 ? 24.703  116.622 -20.179 1.00 98.35  ? 1307 ASN B CB    1 
ATOM   9100  C  CG    . ASN B 1 553 ? 24.521  117.448 -21.461 1.00 105.10 ? 1307 ASN B CG    1 
ATOM   9101  O  OD1   . ASN B 1 553 ? 24.680  118.673 -21.465 1.00 104.91 ? 1307 ASN B OD1   1 
ATOM   9102  N  ND2   . ASN B 1 553 ? 24.183  116.768 -22.557 1.00 110.43 ? 1307 ASN B ND2   1 
ATOM   9103  N  N     . THR B 1 554 ? 26.022  119.525 -18.441 1.00 96.53  ? 1308 THR B N     1 
ATOM   9104  C  CA    . THR B 1 554 ? 25.642  120.680 -17.641 1.00 87.73  ? 1308 THR B CA    1 
ATOM   9105  C  C     . THR B 1 554 ? 24.548  121.535 -18.285 1.00 81.89  ? 1308 THR B C     1 
ATOM   9106  O  O     . THR B 1 554 ? 23.753  122.165 -17.574 1.00 78.35  ? 1308 THR B O     1 
ATOM   9107  C  CB    . THR B 1 554 ? 26.873  121.507 -17.198 1.00 85.04  ? 1308 THR B CB    1 
ATOM   9108  O  OG1   . THR B 1 554 ? 26.545  122.902 -17.186 1.00 72.81  ? 1308 THR B OG1   1 
ATOM   9109  C  CG2   . THR B 1 554 ? 28.043  121.249 -18.137 1.00 96.35  ? 1308 THR B CG2   1 
ATOM   9110  N  N     . GLU B 1 555 ? 24.474  121.540 -19.614 1.00 79.93  ? 1309 GLU B N     1 
ATOM   9111  C  CA    . GLU B 1 555 ? 23.379  122.270 -20.263 1.00 82.47  ? 1309 GLU B CA    1 
ATOM   9112  C  C     . GLU B 1 555 ? 22.085  121.465 -20.171 1.00 85.47  ? 1309 GLU B C     1 
ATOM   9113  O  O     . GLU B 1 555 ? 20.991  122.023 -20.120 1.00 86.85  ? 1309 GLU B O     1 
ATOM   9114  C  CB    . GLU B 1 555 ? 23.699  122.671 -21.714 1.00 81.03  ? 1309 GLU B CB    1 
ATOM   9115  N  N     . LEU B 1 556 ? 22.210  120.148 -20.117 1.00 86.61  ? 1310 LEU B N     1 
ATOM   9116  C  CA    . LEU B 1 556 ? 21.031  119.303 -20.012 1.00 90.96  ? 1310 LEU B CA    1 
ATOM   9117  C  C     . LEU B 1 556 ? 20.277  119.553 -18.694 1.00 88.52  ? 1310 LEU B C     1 
ATOM   9118  O  O     . LEU B 1 556 ? 19.043  119.606 -18.672 1.00 85.92  ? 1310 LEU B O     1 
ATOM   9119  C  CB    . LEU B 1 556 ? 21.424  117.834 -20.145 1.00 90.19  ? 1310 LEU B CB    1 
ATOM   9120  C  CG    . LEU B 1 556 ? 20.424  116.932 -20.860 1.00 88.07  ? 1310 LEU B CG    1 
ATOM   9121  C  CD1   . LEU B 1 556 ? 20.425  115.584 -20.168 1.00 83.04  ? 1310 LEU B CD1   1 
ATOM   9122  C  CD2   . LEU B 1 556 ? 19.018  117.543 -20.878 1.00 91.57  ? 1310 LEU B CD2   1 
ATOM   9123  N  N     . VAL B 1 557 ? 21.036  119.713 -17.611 1.00 86.75  ? 1311 VAL B N     1 
ATOM   9124  C  CA    . VAL B 1 557 ? 20.493  119.999 -16.283 1.00 79.41  ? 1311 VAL B CA    1 
ATOM   9125  C  C     . VAL B 1 557 ? 19.820  121.357 -16.227 1.00 85.60  ? 1311 VAL B C     1 
ATOM   9126  O  O     . VAL B 1 557 ? 18.631  121.471 -15.924 1.00 84.37  ? 1311 VAL B O     1 
ATOM   9127  C  CB    . VAL B 1 557 ? 21.602  120.037 -15.219 1.00 66.26  ? 1311 VAL B CB    1 
ATOM   9128  C  CG1   . VAL B 1 557 ? 21.052  120.583 -13.905 1.00 66.63  ? 1311 VAL B CG1   1 
ATOM   9129  C  CG2   . VAL B 1 557 ? 22.175  118.669 -15.010 1.00 58.24  ? 1311 VAL B CG2   1 
ATOM   9130  N  N     . LEU B 1 558 ? 20.606  122.392 -16.494 1.00 88.10  ? 1312 LEU B N     1 
ATOM   9131  C  CA    . LEU B 1 558 ? 20.112  123.759 -16.463 1.00 79.58  ? 1312 LEU B CA    1 
ATOM   9132  C  C     . LEU B 1 558 ? 18.792  123.856 -17.200 1.00 87.07  ? 1312 LEU B C     1 
ATOM   9133  O  O     . LEU B 1 558 ? 17.863  124.513 -16.741 1.00 87.76  ? 1312 LEU B O     1 
ATOM   9134  C  CB    . LEU B 1 558 ? 21.117  124.666 -17.134 1.00 67.53  ? 1312 LEU B CB    1 
ATOM   9135  C  CG    . LEU B 1 558 ? 20.916  126.147 -16.917 1.00 68.67  ? 1312 LEU B CG    1 
ATOM   9136  C  CD1   . LEU B 1 558 ? 21.035  126.487 -15.430 1.00 70.45  ? 1312 LEU B CD1   1 
ATOM   9137  C  CD2   . LEU B 1 558 ? 21.985  126.832 -17.707 1.00 74.27  ? 1312 LEU B CD2   1 
ATOM   9138  N  N     . ASN B 1 559 ? 18.719  123.188 -18.348 1.00 90.29  ? 1313 ASN B N     1 
ATOM   9139  C  CA    . ASN B 1 559 ? 17.512  123.175 -19.164 1.00 84.30  ? 1313 ASN B CA    1 
ATOM   9140  C  C     . ASN B 1 559 ? 16.312  122.539 -18.486 1.00 80.05  ? 1313 ASN B C     1 
ATOM   9141  O  O     . ASN B 1 559 ? 15.240  123.152 -18.420 1.00 81.22  ? 1313 ASN B O     1 
ATOM   9142  C  CB    . ASN B 1 559 ? 17.780  122.506 -20.501 1.00 87.48  ? 1313 ASN B CB    1 
ATOM   9143  C  CG    . ASN B 1 559 ? 18.256  123.487 -21.538 1.00 90.98  ? 1313 ASN B CG    1 
ATOM   9144  O  OD1   . ASN B 1 559 ? 18.054  124.699 -21.394 1.00 83.21  ? 1313 ASN B OD1   1 
ATOM   9145  N  ND2   . ASN B 1 559 ? 18.884  122.978 -22.601 1.00 96.15  ? 1313 ASN B ND2   1 
ATOM   9146  N  N     . TYR B 1 560 ? 16.494  121.318 -17.982 1.00 73.06  ? 1314 TYR B N     1 
ATOM   9147  C  CA    . TYR B 1 560 ? 15.452  120.644 -17.214 1.00 63.70  ? 1314 TYR B CA    1 
ATOM   9148  C  C     . TYR B 1 560 ? 14.972  121.513 -16.023 1.00 73.80  ? 1314 TYR B C     1 
ATOM   9149  O  O     . TYR B 1 560 ? 13.772  121.562 -15.718 1.00 75.15  ? 1314 TYR B O     1 
ATOM   9150  C  CB    . TYR B 1 560 ? 15.904  119.244 -16.748 1.00 55.65  ? 1314 TYR B CB    1 
ATOM   9151  C  CG    . TYR B 1 560 ? 14.794  118.496 -16.054 1.00 59.41  ? 1314 TYR B CG    1 
ATOM   9152  C  CD1   . TYR B 1 560 ? 14.461  118.772 -14.712 1.00 54.15  ? 1314 TYR B CD1   1 
ATOM   9153  C  CD2   . TYR B 1 560 ? 14.047  117.534 -16.735 1.00 59.86  ? 1314 TYR B CD2   1 
ATOM   9154  C  CE1   . TYR B 1 560 ? 13.414  118.099 -14.083 1.00 54.33  ? 1314 TYR B CE1   1 
ATOM   9155  C  CE2   . TYR B 1 560 ? 12.992  116.857 -16.107 1.00 64.68  ? 1314 TYR B CE2   1 
ATOM   9156  C  CZ    . TYR B 1 560 ? 12.684  117.147 -14.791 1.00 65.26  ? 1314 TYR B CZ    1 
ATOM   9157  O  OH    . TYR B 1 560 ? 11.649  116.482 -14.185 1.00 70.59  ? 1314 TYR B OH    1 
ATOM   9158  N  N     . LEU B 1 561 ? 15.896  122.218 -15.373 1.00 67.01  ? 1315 LEU B N     1 
ATOM   9159  C  CA    . LEU B 1 561 ? 15.528  123.018 -14.203 1.00 63.51  ? 1315 LEU B CA    1 
ATOM   9160  C  C     . LEU B 1 561 ? 14.675  124.210 -14.584 1.00 66.25  ? 1315 LEU B C     1 
ATOM   9161  O  O     . LEU B 1 561 ? 13.724  124.531 -13.881 1.00 69.71  ? 1315 LEU B O     1 
ATOM   9162  C  CB    . LEU B 1 561 ? 16.749  123.466 -13.399 1.00 62.91  ? 1315 LEU B CB    1 
ATOM   9163  C  CG    . LEU B 1 561 ? 17.491  122.324 -12.711 1.00 61.97  ? 1315 LEU B CG    1 
ATOM   9164  C  CD1   . LEU B 1 561 ? 18.777  122.802 -12.040 1.00 56.47  ? 1315 LEU B CD1   1 
ATOM   9165  C  CD2   . LEU B 1 561 ? 16.562  121.668 -11.725 1.00 61.55  ? 1315 LEU B CD2   1 
ATOM   9166  N  N     . PHE B 1 562 ? 15.008  124.859 -15.697 1.00 67.00  ? 1316 PHE B N     1 
ATOM   9167  C  CA    . PHE B 1 562 ? 14.153  125.916 -16.242 1.00 67.24  ? 1316 PHE B CA    1 
ATOM   9168  C  C     . PHE B 1 562 ? 12.732  125.408 -16.537 1.00 66.53  ? 1316 PHE B C     1 
ATOM   9169  O  O     . PHE B 1 562 ? 11.731  126.046 -16.167 1.00 71.26  ? 1316 PHE B O     1 
ATOM   9170  C  CB    . PHE B 1 562 ? 14.762  126.505 -17.516 1.00 63.58  ? 1316 PHE B CB    1 
ATOM   9171  C  CG    . PHE B 1 562 ? 15.890  127.456 -17.264 1.00 64.54  ? 1316 PHE B CG    1 
ATOM   9172  C  CD1   . PHE B 1 562 ? 15.822  128.370 -16.224 1.00 70.24  ? 1316 PHE B CD1   1 
ATOM   9173  C  CD2   . PHE B 1 562 ? 17.030  127.430 -18.057 1.00 62.70  ? 1316 PHE B CD2   1 
ATOM   9174  C  CE1   . PHE B 1 562 ? 16.873  129.255 -15.978 1.00 71.54  ? 1316 PHE B CE1   1 
ATOM   9175  C  CE2   . PHE B 1 562 ? 18.090  128.302 -17.813 1.00 66.73  ? 1316 PHE B CE2   1 
ATOM   9176  C  CZ    . PHE B 1 562 ? 18.008  129.221 -16.773 1.00 71.26  ? 1316 PHE B CZ    1 
ATOM   9177  N  N     . LYS B 1 563 ? 12.647  124.258 -17.199 1.00 55.37  ? 1317 LYS B N     1 
ATOM   9178  C  CA    . LYS B 1 563 ? 11.359  123.783 -17.683 1.00 59.02  ? 1317 LYS B CA    1 
ATOM   9179  C  C     . LYS B 1 563 ? 10.493  123.258 -16.549 1.00 61.64  ? 1317 LYS B C     1 
ATOM   9180  O  O     . LYS B 1 563 ? 9.283   123.476 -16.548 1.00 62.93  ? 1317 LYS B O     1 
ATOM   9181  C  CB    . LYS B 1 563 ? 11.515  122.720 -18.796 1.00 63.12  ? 1317 LYS B CB    1 
ATOM   9182  C  CG    . LYS B 1 563 ? 10.176  122.248 -19.400 1.00 64.24  ? 1317 LYS B CG    1 
ATOM   9183  C  CD    . LYS B 1 563 ? 10.324  121.341 -20.635 1.00 61.55  ? 1317 LYS B CD    1 
ATOM   9184  N  N     . TYR B 1 564 ? 11.108  122.578 -15.581 1.00 58.81  ? 1318 TYR B N     1 
ATOM   9185  C  CA    . TYR B 1 564 ? 10.326  121.858 -14.578 1.00 59.56  ? 1318 TYR B CA    1 
ATOM   9186  C  C     . TYR B 1 564 ? 10.333  122.416 -13.142 1.00 62.22  ? 1318 TYR B C     1 
ATOM   9187  O  O     . TYR B 1 564 ? 9.605   121.913 -12.278 1.00 59.92  ? 1318 TYR B O     1 
ATOM   9188  C  CB    . TYR B 1 564 ? 10.651  120.366 -14.618 1.00 61.65  ? 1318 TYR B CB    1 
ATOM   9189  C  CG    . TYR B 1 564 ? 10.125  119.708 -15.862 1.00 74.12  ? 1318 TYR B CG    1 
ATOM   9190  C  CD1   . TYR B 1 564 ? 8.812   119.258 -15.926 1.00 80.40  ? 1318 TYR B CD1   1 
ATOM   9191  C  CD2   . TYR B 1 564 ? 10.935  119.547 -16.986 1.00 76.91  ? 1318 TYR B CD2   1 
ATOM   9192  C  CE1   . TYR B 1 564 ? 8.319   118.647 -17.082 1.00 90.96  ? 1318 TYR B CE1   1 
ATOM   9193  C  CE2   . TYR B 1 564 ? 10.451  118.941 -18.150 1.00 82.98  ? 1318 TYR B CE2   1 
ATOM   9194  C  CZ    . TYR B 1 564 ? 9.143   118.493 -18.195 1.00 89.57  ? 1318 TYR B CZ    1 
ATOM   9195  O  OH    . TYR B 1 564 ? 8.647   117.898 -19.343 1.00 84.71  ? 1318 TYR B OH    1 
ATOM   9196  N  N     . THR B 1 565 ? 11.133  123.451 -12.892 1.00 60.27  ? 1319 THR B N     1 
ATOM   9197  C  CA    . THR B 1 565 ? 10.981  124.242 -11.672 1.00 56.08  ? 1319 THR B CA    1 
ATOM   9198  C  C     . THR B 1 565 ? 10.809  125.732 -11.940 1.00 61.93  ? 1319 THR B C     1 
ATOM   9199  O  O     . THR B 1 565 ? 10.828  126.197 -13.092 1.00 70.60  ? 1319 THR B O     1 
ATOM   9200  C  CB    . THR B 1 565 ? 12.178  124.116 -10.723 1.00 59.57  ? 1319 THR B CB    1 
ATOM   9201  O  OG1   . THR B 1 565 ? 13.238  124.962 -11.191 1.00 59.89  ? 1319 THR B OG1   1 
ATOM   9202  C  CG2   . THR B 1 565 ? 12.639  122.673 -10.582 1.00 56.42  ? 1319 THR B CG2   1 
ATOM   9203  N  N     . ASP B 1 566 ? 10.652  126.484 -10.855 1.00 62.57  ? 1320 ASP B N     1 
ATOM   9204  C  CA    . ASP B 1 566 ? 10.391  127.910 -10.951 1.00 62.27  ? 1320 ASP B CA    1 
ATOM   9205  C  C     . ASP B 1 566 ? 11.661  128.712 -11.153 1.00 66.35  ? 1320 ASP B C     1 
ATOM   9206  O  O     . ASP B 1 566 ? 11.623  129.938 -11.067 1.00 69.61  ? 1320 ASP B O     1 
ATOM   9207  C  CB    . ASP B 1 566 ? 9.640   128.424 -9.727  1.00 66.35  ? 1320 ASP B CB    1 
ATOM   9208  C  CG    . ASP B 1 566 ? 8.160   128.124 -9.788  1.00 79.42  ? 1320 ASP B CG    1 
ATOM   9209  O  OD1   . ASP B 1 566 ? 7.687   127.844 -10.908 1.00 83.09  ? 1320 ASP B OD1   1 
ATOM   9210  O  OD2   . ASP B 1 566 ? 7.470   128.180 -8.734  1.00 84.12  ? 1320 ASP B OD2   1 
ATOM   9211  N  N     . LEU B 1 567 ? 12.782  128.035 -11.405 1.00 60.92  ? 1321 LEU B N     1 
ATOM   9212  C  CA    . LEU B 1 567 ? 13.974  128.735 -11.886 1.00 66.54  ? 1321 LEU B CA    1 
ATOM   9213  C  C     . LEU B 1 567 ? 13.624  129.614 -13.102 1.00 68.21  ? 1321 LEU B C     1 
ATOM   9214  O  O     . LEU B 1 567 ? 14.359  130.545 -13.463 1.00 68.57  ? 1321 LEU B O     1 
ATOM   9215  C  CB    . LEU B 1 567 ? 15.059  127.742 -12.274 1.00 68.85  ? 1321 LEU B CB    1 
ATOM   9216  C  CG    . LEU B 1 567 ? 16.322  127.783 -11.428 1.00 69.23  ? 1321 LEU B CG    1 
ATOM   9217  C  CD1   . LEU B 1 567 ? 17.516  127.520 -12.328 1.00 67.55  ? 1321 LEU B CD1   1 
ATOM   9218  C  CD2   . LEU B 1 567 ? 16.450  129.104 -10.648 1.00 64.11  ? 1321 LEU B CD2   1 
ATOM   9219  N  N     . GLN B 1 568 ? 12.500  129.285 -13.735 1.00 65.02  ? 1322 GLN B N     1 
ATOM   9220  C  CA    . GLN B 1 568 ? 11.950  130.066 -14.831 1.00 68.64  ? 1322 GLN B CA    1 
ATOM   9221  C  C     . GLN B 1 568 ? 10.442  129.864 -14.850 1.00 69.00  ? 1322 GLN B C     1 
ATOM   9222  O  O     . GLN B 1 568 ? 9.958   128.710 -14.782 1.00 72.95  ? 1322 GLN B O     1 
ATOM   9223  C  CB    . GLN B 1 568 ? 12.531  129.624 -16.168 1.00 75.47  ? 1322 GLN B CB    1 
ATOM   9224  C  CG    . GLN B 1 568 ? 11.960  130.408 -17.339 1.00 76.87  ? 1322 GLN B CG    1 
ATOM   9225  C  CD    . GLN B 1 568 ? 12.162  129.717 -18.671 1.00 77.43  ? 1322 GLN B CD    1 
ATOM   9226  O  OE1   . GLN B 1 568 ? 13.281  129.628 -19.185 1.00 73.45  ? 1322 GLN B OE1   1 
ATOM   9227  N  NE2   . GLN B 1 568 ? 11.074  129.225 -19.241 1.00 80.60  ? 1322 GLN B NE2   1 
ATOM   9228  N  N     . ILE B 1 569 ? 9.719   130.980 -14.960 1.00 56.77  ? 1323 ILE B N     1 
ATOM   9229  C  CA    . ILE B 1 569 ? 8.263   130.990 -14.884 1.00 61.21  ? 1323 ILE B CA    1 
ATOM   9230  C  C     . ILE B 1 569 ? 7.635   131.894 -15.945 1.00 65.76  ? 1323 ILE B C     1 
ATOM   9231  O  O     . ILE B 1 569 ? 8.339   132.672 -16.595 1.00 59.89  ? 1323 ILE B O     1 
ATOM   9232  C  CB    . ILE B 1 569 ? 7.827   131.574 -13.559 1.00 57.78  ? 1323 ILE B CB    1 
ATOM   9233  C  CG1   . ILE B 1 569 ? 7.917   133.103 -13.623 1.00 53.48  ? 1323 ILE B CG1   1 
ATOM   9234  C  CG2   . ILE B 1 569 ? 8.685   131.024 -12.453 1.00 56.09  ? 1323 ILE B CG2   1 
ATOM   9235  C  CD1   . ILE B 1 569 ? 7.799   133.763 -12.295 1.00 52.22  ? 1323 ILE B CD1   1 
ATOM   9236  N  N     . ASN B 1 570 ? 6.309   131.805 -16.104 1.00 69.51  ? 1324 ASN B N     1 
ATOM   9237  C  CA    . ASN B 1 570 ? 5.557   132.803 -16.889 1.00 69.38  ? 1324 ASN B CA    1 
ATOM   9238  C  C     . ASN B 1 570 ? 4.941   133.885 -16.001 1.00 64.26  ? 1324 ASN B C     1 
ATOM   9239  O  O     . ASN B 1 570 ? 4.191   133.564 -15.088 1.00 72.54  ? 1324 ASN B O     1 
ATOM   9240  C  CB    . ASN B 1 570 ? 4.427   132.167 -17.714 1.00 64.92  ? 1324 ASN B CB    1 
ATOM   9241  C  CG    . ASN B 1 570 ? 4.884   130.966 -18.513 1.00 73.55  ? 1324 ASN B CG    1 
ATOM   9242  O  OD1   . ASN B 1 570 ? 6.051   130.856 -18.892 1.00 84.84  ? 1324 ASN B OD1   1 
ATOM   9243  N  ND2   . ASN B 1 570 ? 3.957   130.048 -18.773 1.00 74.61  ? 1324 ASN B ND2   1 
ATOM   9244  N  N     . TYR B 1 571 ? 5.254   135.156 -16.265 1.00 56.09  ? 1325 TYR B N     1 
ATOM   9245  C  CA    . TYR B 1 571 ? 4.576   136.259 -15.580 1.00 56.59  ? 1325 TYR B CA    1 
ATOM   9246  C  C     . TYR B 1 571 ? 3.434   136.756 -16.456 1.00 59.59  ? 1325 TYR B C     1 
ATOM   9247  O  O     . TYR B 1 571 ? 3.638   137.002 -17.637 1.00 58.72  ? 1325 TYR B O     1 
ATOM   9248  C  CB    . TYR B 1 571 ? 5.525   137.425 -15.266 1.00 51.37  ? 1325 TYR B CB    1 
ATOM   9249  C  CG    . TYR B 1 571 ? 4.773   138.575 -14.657 1.00 56.79  ? 1325 TYR B CG    1 
ATOM   9250  C  CD1   . TYR B 1 571 ? 4.056   139.465 -15.448 1.00 72.83  ? 1325 TYR B CD1   1 
ATOM   9251  C  CD2   . TYR B 1 571 ? 4.728   138.742 -13.277 1.00 55.47  ? 1325 TYR B CD2   1 
ATOM   9252  C  CE1   . TYR B 1 571 ? 3.332   140.511 -14.871 1.00 78.98  ? 1325 TYR B CE1   1 
ATOM   9253  C  CE2   . TYR B 1 571 ? 4.021   139.767 -12.691 1.00 56.43  ? 1325 TYR B CE2   1 
ATOM   9254  C  CZ    . TYR B 1 571 ? 3.313   140.650 -13.480 1.00 70.60  ? 1325 TYR B CZ    1 
ATOM   9255  O  OH    . TYR B 1 571 ? 2.604   141.676 -12.871 1.00 74.18  ? 1325 TYR B OH    1 
ATOM   9256  N  N     . ASN B 1 572 ? 2.235   136.895 -15.890 1.00 65.52  ? 1326 ASN B N     1 
ATOM   9257  C  CA    . ASN B 1 572 ? 1.081   137.361 -16.671 1.00 61.45  ? 1326 ASN B CA    1 
ATOM   9258  C  C     . ASN B 1 572 ? 0.616   138.760 -16.315 1.00 64.47  ? 1326 ASN B C     1 
ATOM   9259  O  O     . ASN B 1 572 ? 0.199   139.014 -15.202 1.00 66.53  ? 1326 ASN B O     1 
ATOM   9260  C  CB    . ASN B 1 572 ? -0.105  136.397 -16.565 1.00 63.47  ? 1326 ASN B CB    1 
ATOM   9261  C  CG    . ASN B 1 572 ? 0.058   135.170 -17.447 1.00 79.13  ? 1326 ASN B CG    1 
ATOM   9262  O  OD1   . ASN B 1 572 ? -0.215  135.211 -18.655 1.00 90.19  ? 1326 ASN B OD1   1 
ATOM   9263  N  ND2   . ASN B 1 572 ? 0.495   134.067 -16.849 1.00 81.29  ? 1326 ASN B ND2   1 
ATOM   9264  N  N     . PHE B 1 573 ? 0.698   139.671 -17.272 1.00 66.40  ? 1327 PHE B N     1 
ATOM   9265  C  CA    . PHE B 1 573 ? 0.097   140.977 -17.102 1.00 64.99  ? 1327 PHE B CA    1 
ATOM   9266  C  C     . PHE B 1 573 ? -1.427  140.844 -17.050 1.00 71.01  ? 1327 PHE B C     1 
ATOM   9267  O  O     . PHE B 1 573 ? -2.047  140.289 -17.973 1.00 81.57  ? 1327 PHE B O     1 
ATOM   9268  C  CB    . PHE B 1 573 ? 0.438   141.867 -18.286 1.00 63.52  ? 1327 PHE B CB    1 
ATOM   9269  C  CG    . PHE B 1 573 ? 1.884   142.269 -18.374 1.00 62.03  ? 1327 PHE B CG    1 
ATOM   9270  C  CD1   . PHE B 1 573 ? 2.814   141.438 -18.966 1.00 60.31  ? 1327 PHE B CD1   1 
ATOM   9271  C  CD2   . PHE B 1 573 ? 2.296   143.519 -17.938 1.00 60.21  ? 1327 PHE B CD2   1 
ATOM   9272  C  CE1   . PHE B 1 573 ? 4.140   141.827 -19.082 1.00 59.32  ? 1327 PHE B CE1   1 
ATOM   9273  C  CE2   . PHE B 1 573 ? 3.622   143.913 -18.047 1.00 57.23  ? 1327 PHE B CE2   1 
ATOM   9274  C  CZ    . PHE B 1 573 ? 4.546   143.061 -18.613 1.00 56.62  ? 1327 PHE B CZ    1 
ATOM   9275  N  N     . ASN B 1 574 ? -2.032  141.350 -15.978 1.00 57.83  ? 1328 ASN B N     1 
ATOM   9276  C  CA    . ASN B 1 574 ? -3.462  141.638 -16.009 1.00 53.73  ? 1328 ASN B CA    1 
ATOM   9277  C  C     . ASN B 1 574 ? -3.731  143.014 -15.413 1.00 55.09  ? 1328 ASN B C     1 
ATOM   9278  O  O     . ASN B 1 574 ? -4.109  143.128 -14.259 1.00 60.61  ? 1328 ASN B O     1 
ATOM   9279  C  CB    . ASN B 1 574 ? -4.252  140.565 -15.271 1.00 60.84  ? 1328 ASN B CB    1 
ATOM   9280  C  CG    . ASN B 1 574 ? -5.743  140.676 -15.504 1.00 65.65  ? 1328 ASN B CG    1 
ATOM   9281  O  OD1   . ASN B 1 574 ? -6.180  141.350 -16.443 1.00 63.30  ? 1328 ASN B OD1   1 
ATOM   9282  N  ND2   . ASN B 1 574 ? -6.539  140.010 -14.652 1.00 66.97  ? 1328 ASN B ND2   1 
ATOM   9283  N  N     . MET B 1 575 ? -3.526  144.062 -16.200 1.00 52.62  ? 1329 MET B N     1 
ATOM   9284  C  CA    . MET B 1 575 ? -3.492  145.415 -15.645 1.00 56.42  ? 1329 MET B CA    1 
ATOM   9285  C  C     . MET B 1 575 ? -4.870  146.059 -15.515 1.00 65.55  ? 1329 MET B C     1 
ATOM   9286  O  O     . MET B 1 575 ? -5.363  146.726 -16.434 1.00 66.28  ? 1329 MET B O     1 
ATOM   9287  C  CB    . MET B 1 575 ? -2.563  146.322 -16.458 1.00 63.07  ? 1329 MET B CB    1 
ATOM   9288  C  CG    . MET B 1 575 ? -1.239  145.680 -16.865 1.00 69.59  ? 1329 MET B CG    1 
ATOM   9289  S  SD    . MET B 1 575 ? 0.062   146.882 -17.248 1.00 68.65  ? 1329 MET B SD    1 
ATOM   9290  C  CE    . MET B 1 575 ? -0.630  147.705 -18.689 1.00 77.66  ? 1329 MET B CE    1 
ATOM   9291  N  N     . VAL B 1 576 ? -5.475  145.870 -14.350 1.00 68.20  ? 1330 VAL B N     1 
ATOM   9292  C  CA    . VAL B 1 576 ? -6.755  146.487 -14.038 1.00 67.07  ? 1330 VAL B CA    1 
ATOM   9293  C  C     . VAL B 1 576 ? -6.630  147.476 -12.877 1.00 59.51  ? 1330 VAL B C     1 
ATOM   9294  O  O     . VAL B 1 576 ? -6.056  147.158 -11.837 1.00 64.94  ? 1330 VAL B O     1 
ATOM   9295  C  CB    . VAL B 1 576 ? -7.772  145.419 -13.684 1.00 67.72  ? 1330 VAL B CB    1 
ATOM   9296  C  CG1   . VAL B 1 576 ? -9.148  146.031 -13.542 1.00 69.31  ? 1330 VAL B CG1   1 
ATOM   9297  C  CG2   . VAL B 1 576 ? -7.757  144.371 -14.760 1.00 75.55  ? 1330 VAL B CG2   1 
ATOM   9298  N  N     . ALA B 1 577 ? -7.151  148.680 -13.073 1.00 47.41  ? 1331 ALA B N     1 
ATOM   9299  C  CA    . ALA B 1 577 ? -7.110  149.723 -12.056 1.00 48.16  ? 1331 ALA B CA    1 
ATOM   9300  C  C     . ALA B 1 577 ? -8.468  150.391 -11.994 1.00 54.47  ? 1331 ALA B C     1 
ATOM   9301  O  O     . ALA B 1 577 ? -9.354  150.099 -12.797 1.00 55.57  ? 1331 ALA B O     1 
ATOM   9302  C  CB    . ALA B 1 577 ? -6.033  150.762 -12.376 1.00 46.17  ? 1331 ALA B CB    1 
ATOM   9303  N  N     . ILE B 1 578 ? -8.636  151.289 -11.037 1.00 50.45  ? 1332 ILE B N     1 
ATOM   9304  C  CA    . ILE B 1 578 ? -9.914  151.937 -10.877 1.00 51.88  ? 1332 ILE B CA    1 
ATOM   9305  C  C     . ILE B 1 578 ? -9.805  153.308 -11.485 1.00 54.95  ? 1332 ILE B C     1 
ATOM   9306  O  O     . ILE B 1 578 ? -9.046  154.158 -11.020 1.00 58.08  ? 1332 ILE B O     1 
ATOM   9307  C  CB    . ILE B 1 578 ? -10.324 152.065 -9.406  1.00 50.38  ? 1332 ILE B CB    1 
ATOM   9308  C  CG1   . ILE B 1 578 ? -10.346 150.696 -8.727  1.00 54.39  ? 1332 ILE B CG1   1 
ATOM   9309  C  CG2   . ILE B 1 578 ? -11.685 152.702 -9.319  1.00 42.86  ? 1332 ILE B CG2   1 
ATOM   9310  C  CD1   . ILE B 1 578 ? -11.512 149.811 -9.141  1.00 56.71  ? 1332 ILE B CD1   1 
ATOM   9311  N  N     . ASP B 1 579 ? -10.571 153.507 -12.542 1.00 59.50  ? 1333 ASP B N     1 
ATOM   9312  C  CA    . ASP B 1 579 ? -10.596 154.768 -13.258 1.00 59.05  ? 1333 ASP B CA    1 
ATOM   9313  C  C     . ASP B 1 579 ? -12.019 155.281 -13.145 1.00 61.68  ? 1333 ASP B C     1 
ATOM   9314  O  O     . ASP B 1 579 ? -12.983 154.529 -13.328 1.00 67.39  ? 1333 ASP B O     1 
ATOM   9315  C  CB    . ASP B 1 579 ? -10.184 154.558 -14.722 1.00 61.48  ? 1333 ASP B CB    1 
ATOM   9316  C  CG    . ASP B 1 579 ? -10.164 155.838 -15.509 1.00 79.41  ? 1333 ASP B CG    1 
ATOM   9317  O  OD1   . ASP B 1 579 ? -9.569  156.828 -15.030 1.00 84.26  ? 1333 ASP B OD1   1 
ATOM   9318  O  OD2   . ASP B 1 579 ? -10.751 155.854 -16.612 1.00 86.22  ? 1333 ASP B OD2   1 
ATOM   9319  N  N     . ASN B 1 580 ? -12.150 156.554 -12.810 1.00 58.93  ? 1334 ASN B N     1 
ATOM   9320  C  CA    . ASN B 1 580 ? -13.462 157.135 -12.570 1.00 60.75  ? 1334 ASN B CA    1 
ATOM   9321  C  C     . ASN B 1 580 ? -14.416 156.208 -11.823 1.00 63.48  ? 1334 ASN B C     1 
ATOM   9322  O  O     . ASN B 1 580 ? -15.496 155.904 -12.328 1.00 62.84  ? 1334 ASN B O     1 
ATOM   9323  C  CB    . ASN B 1 580 ? -14.094 157.571 -13.888 1.00 64.94  ? 1334 ASN B CB    1 
ATOM   9324  C  CG    . ASN B 1 580 ? -15.430 158.226 -13.685 1.00 77.36  ? 1334 ASN B CG    1 
ATOM   9325  O  OD1   . ASN B 1 580 ? -15.704 158.790 -12.624 1.00 85.57  ? 1334 ASN B OD1   1 
ATOM   9326  N  ND2   . ASN B 1 580 ? -16.280 158.143 -14.688 1.00 80.56  ? 1334 ASN B ND2   1 
ATOM   9327  N  N     . PHE B 1 581 ? -13.998 155.743 -10.640 1.00 65.09  ? 1335 PHE B N     1 
ATOM   9328  C  CA    . PHE B 1 581 ? -14.820 154.874 -9.773  1.00 64.42  ? 1335 PHE B CA    1 
ATOM   9329  C  C     . PHE B 1 581 ? -15.130 153.437 -10.226 1.00 68.04  ? 1335 PHE B C     1 
ATOM   9330  O  O     . PHE B 1 581 ? -15.740 152.681 -9.477  1.00 70.78  ? 1335 PHE B O     1 
ATOM   9331  C  CB    . PHE B 1 581 ? -16.142 155.564 -9.454  1.00 67.68  ? 1335 PHE B CB    1 
ATOM   9332  C  CG    . PHE B 1 581 ? -15.971 156.927 -8.927  1.00 77.75  ? 1335 PHE B CG    1 
ATOM   9333  C  CD1   . PHE B 1 581 ? -15.591 157.121 -7.606  1.00 77.79  ? 1335 PHE B CD1   1 
ATOM   9334  C  CD2   . PHE B 1 581 ? -16.154 158.027 -9.748  1.00 85.69  ? 1335 PHE B CD2   1 
ATOM   9335  C  CE1   . PHE B 1 581 ? -15.412 158.399 -7.102  1.00 81.42  ? 1335 PHE B CE1   1 
ATOM   9336  C  CE2   . PHE B 1 581 ? -15.975 159.312 -9.257  1.00 89.28  ? 1335 PHE B CE2   1 
ATOM   9337  C  CZ    . PHE B 1 581 ? -15.606 159.499 -7.930  1.00 84.72  ? 1335 PHE B CZ    1 
ATOM   9338  N  N     . THR B 1 582 ? -14.766 153.063 -11.446 1.00 72.40  ? 1336 THR B N     1 
ATOM   9339  C  CA    . THR B 1 582 ? -15.104 151.728 -11.938 1.00 72.55  ? 1336 THR B CA    1 
ATOM   9340  C  C     . THR B 1 582 ? -13.845 150.981 -12.394 1.00 64.45  ? 1336 THR B C     1 
ATOM   9341  O  O     . THR B 1 582 ? -12.856 151.600 -12.791 1.00 56.74  ? 1336 THR B O     1 
ATOM   9342  C  CB    . THR B 1 582 ? -16.144 151.760 -13.115 1.00 68.18  ? 1336 THR B CB    1 
ATOM   9343  O  OG1   . THR B 1 582 ? -15.479 151.462 -14.342 1.00 75.18  ? 1336 THR B OG1   1 
ATOM   9344  C  CG2   . THR B 1 582 ? -16.857 153.118 -13.253 1.00 55.18  ? 1336 THR B CG2   1 
ATOM   9345  N  N     . PRO B 1 583 ? -13.880 149.645 -12.337 1.00 62.86  ? 1337 PRO B N     1 
ATOM   9346  C  CA    . PRO B 1 583 ? -12.780 148.802 -12.825 1.00 59.59  ? 1337 PRO B CA    1 
ATOM   9347  C  C     . PRO B 1 583 ? -12.565 148.982 -14.337 1.00 66.60  ? 1337 PRO B C     1 
ATOM   9348  O  O     . PRO B 1 583 ? -13.544 149.175 -15.068 1.00 64.62  ? 1337 PRO B O     1 
ATOM   9349  C  CB    . PRO B 1 583 ? -13.277 147.384 -12.536 1.00 58.75  ? 1337 PRO B CB    1 
ATOM   9350  C  CG    . PRO B 1 583 ? -14.784 147.504 -12.517 1.00 60.04  ? 1337 PRO B CG    1 
ATOM   9351  C  CD    . PRO B 1 583 ? -15.039 148.852 -11.893 1.00 62.00  ? 1337 PRO B CD    1 
ATOM   9352  N  N     . ARG B 1 584 ? -11.307 148.905 -14.784 1.00 65.19  ? 1338 ARG B N     1 
ATOM   9353  C  CA    . ARG B 1 584 ? -10.923 149.152 -16.178 1.00 52.60  ? 1338 ARG B CA    1 
ATOM   9354  C  C     . ARG B 1 584 ? -9.657  148.405 -16.534 1.00 62.73  ? 1338 ARG B C     1 
ATOM   9355  O  O     . ARG B 1 584 ? -8.594  148.680 -15.981 1.00 63.01  ? 1338 ARG B O     1 
ATOM   9356  C  CB    . ARG B 1 584 ? -10.644 150.628 -16.402 1.00 45.27  ? 1338 ARG B CB    1 
ATOM   9357  C  CG    . ARG B 1 584 ? -11.726 151.376 -17.095 1.00 60.41  ? 1338 ARG B CG    1 
ATOM   9358  C  CD    . ARG B 1 584 ? -11.240 151.771 -18.495 1.00 84.54  ? 1338 ARG B CD    1 
ATOM   9359  N  NE    . ARG B 1 584 ? -10.349 152.932 -18.489 1.00 89.93  ? 1338 ARG B NE    1 
ATOM   9360  C  CZ    . ARG B 1 584 ? -9.895  153.529 -19.587 1.00 94.31  ? 1338 ARG B CZ    1 
ATOM   9361  N  NH1   . ARG B 1 584 ? -10.238 153.064 -20.782 1.00 97.02  ? 1338 ARG B NH1   1 
ATOM   9362  N  NH2   . ARG B 1 584 ? -9.095  154.585 -19.494 1.00 92.39  ? 1338 ARG B NH2   1 
ATOM   9363  N  N     . GLN B 1 585 ? -9.764  147.458 -17.458 1.00 71.09  ? 1339 GLN B N     1 
ATOM   9364  C  CA    . GLN B 1 585 ? -8.581  146.813 -18.007 1.00 64.96  ? 1339 GLN B CA    1 
ATOM   9365  C  C     . GLN B 1 585 ? -7.906  147.855 -18.877 1.00 64.12  ? 1339 GLN B C     1 
ATOM   9366  O  O     . GLN B 1 585 ? -8.532  148.409 -19.773 1.00 66.83  ? 1339 GLN B O     1 
ATOM   9367  C  CB    . GLN B 1 585 ? -8.992  145.629 -18.846 1.00 57.96  ? 1339 GLN B CB    1 
ATOM   9368  C  CG    . GLN B 1 585 ? -7.867  144.792 -19.306 1.00 67.01  ? 1339 GLN B CG    1 
ATOM   9369  C  CD    . GLN B 1 585 ? -8.292  143.345 -19.469 1.00 84.62  ? 1339 GLN B CD    1 
ATOM   9370  O  OE1   . GLN B 1 585 ? -8.662  142.666 -18.483 1.00 91.46  ? 1339 GLN B OE1   1 
ATOM   9371  N  NE2   . GLN B 1 585 ? -8.254  142.858 -20.710 1.00 79.08  ? 1339 GLN B NE2   1 
ATOM   9372  N  N     . VAL B 1 586 ? -6.640  148.144 -18.596 1.00 60.21  ? 1340 VAL B N     1 
ATOM   9373  C  CA    . VAL B 1 586 ? -5.996  149.312 -19.184 1.00 59.37  ? 1340 VAL B CA    1 
ATOM   9374  C  C     . VAL B 1 586 ? -4.551  149.060 -19.576 1.00 60.65  ? 1340 VAL B C     1 
ATOM   9375  O  O     . VAL B 1 586 ? -3.884  148.161 -19.054 1.00 74.88  ? 1340 VAL B O     1 
ATOM   9376  C  CB    . VAL B 1 586 ? -6.041  150.519 -18.214 1.00 56.72  ? 1340 VAL B CB    1 
ATOM   9377  C  CG1   . VAL B 1 586 ? -7.497  150.923 -17.913 1.00 61.60  ? 1340 VAL B CG1   1 
ATOM   9378  C  CG2   . VAL B 1 586 ? -5.292  150.190 -16.926 1.00 46.88  ? 1340 VAL B CG2   1 
ATOM   9379  N  N     . GLY B 1 587 ? -4.056  149.873 -20.493 1.00 51.83  ? 1341 GLY B N     1 
ATOM   9380  C  CA    . GLY B 1 587 ? -2.693  149.703 -20.941 1.00 62.00  ? 1341 GLY B CA    1 
ATOM   9381  C  C     . GLY B 1 587 ? -1.837  150.926 -20.713 1.00 68.51  ? 1341 GLY B C     1 
ATOM   9382  O  O     . GLY B 1 587 ? -2.319  151.974 -20.283 1.00 71.52  ? 1341 GLY B O     1 
ATOM   9383  N  N     . ILE B 1 588 ? -0.558  150.792 -21.033 1.00 63.17  ? 1342 ILE B N     1 
ATOM   9384  C  CA    . ILE B 1 588 ? 0.392   151.869 -20.851 1.00 55.31  ? 1342 ILE B CA    1 
ATOM   9385  C  C     . ILE B 1 588 ? -0.154  153.276 -21.133 1.00 68.93  ? 1342 ILE B C     1 
ATOM   9386  O  O     . ILE B 1 588 ? 0.286   154.243 -20.512 1.00 75.55  ? 1342 ILE B O     1 
ATOM   9387  C  CB    . ILE B 1 588 ? 1.627   151.634 -21.697 1.00 59.48  ? 1342 ILE B CB    1 
ATOM   9388  C  CG1   . ILE B 1 588 ? 2.839   151.882 -20.836 1.00 62.95  ? 1342 ILE B CG1   1 
ATOM   9389  C  CG2   . ILE B 1 588 ? 1.604   152.481 -22.960 1.00 70.01  ? 1342 ILE B CG2   1 
ATOM   9390  C  CD1   . ILE B 1 588 ? 2.701   151.145 -19.532 1.00 67.48  ? 1342 ILE B CD1   1 
ATOM   9391  N  N     . VAL B 1 589 ? -1.110  153.408 -22.049 1.00 65.22  ? 1343 VAL B N     1 
ATOM   9392  C  CA    . VAL B 1 589 ? -1.541  154.748 -22.435 1.00 64.19  ? 1343 VAL B CA    1 
ATOM   9393  C  C     . VAL B 1 589 ? -2.646  155.345 -21.577 1.00 63.63  ? 1343 VAL B C     1 
ATOM   9394  O  O     . VAL B 1 589 ? -2.573  156.510 -21.189 1.00 71.08  ? 1343 VAL B O     1 
ATOM   9395  C  CB    . VAL B 1 589 ? -1.906  154.841 -23.920 1.00 60.73  ? 1343 VAL B CB    1 
ATOM   9396  C  CG1   . VAL B 1 589 ? -2.945  155.909 -24.127 1.00 59.43  ? 1343 VAL B CG1   1 
ATOM   9397  C  CG2   . VAL B 1 589 ? -0.680  155.169 -24.706 1.00 50.51  ? 1343 VAL B CG2   1 
ATOM   9398  N  N     . PRO B 1 590 ? -3.688  154.563 -21.302 1.00 57.79  ? 1344 PRO B N     1 
ATOM   9399  C  CA    . PRO B 1 590 ? -4.700  154.984 -20.318 1.00 62.39  ? 1344 PRO B CA    1 
ATOM   9400  C  C     . PRO B 1 590 ? -4.065  155.300 -18.957 1.00 61.31  ? 1344 PRO B C     1 
ATOM   9401  O  O     . PRO B 1 590 ? -4.451  156.268 -18.321 1.00 64.76  ? 1344 PRO B O     1 
ATOM   9402  C  CB    . PRO B 1 590 ? -5.631  153.773 -20.217 1.00 52.41  ? 1344 PRO B CB    1 
ATOM   9403  C  CG    . PRO B 1 590 ? -5.496  153.115 -21.537 1.00 61.74  ? 1344 PRO B CG    1 
ATOM   9404  C  CD    . PRO B 1 590 ? -4.071  153.340 -22.007 1.00 54.34  ? 1344 PRO B CD    1 
ATOM   9405  N  N     . ILE B 1 591 ? -3.094  154.496 -18.540 1.00 56.07  ? 1345 ILE B N     1 
ATOM   9406  C  CA    . ILE B 1 591 ? -2.351  154.758 -17.326 1.00 55.50  ? 1345 ILE B CA    1 
ATOM   9407  C  C     . ILE B 1 591 ? -1.588  156.090 -17.391 1.00 62.13  ? 1345 ILE B C     1 
ATOM   9408  O  O     . ILE B 1 591 ? -1.851  156.997 -16.602 1.00 68.70  ? 1345 ILE B O     1 
ATOM   9409  C  CB    . ILE B 1 591 ? -1.379  153.617 -17.038 1.00 53.39  ? 1345 ILE B CB    1 
ATOM   9410  C  CG1   . ILE B 1 591 ? -2.155  152.354 -16.660 1.00 49.01  ? 1345 ILE B CG1   1 
ATOM   9411  C  CG2   . ILE B 1 591 ? -0.427  154.008 -15.922 1.00 56.55  ? 1345 ILE B CG2   1 
ATOM   9412  C  CD1   . ILE B 1 591 ? -1.315  151.084 -16.704 1.00 45.51  ? 1345 ILE B CD1   1 
ATOM   9413  N  N     . LEU B 1 592 ? -0.653  156.222 -18.326 1.00 49.40  ? 1346 LEU B N     1 
ATOM   9414  C  CA    . LEU B 1 592 ? 0.171   157.424 -18.366 1.00 44.97  ? 1346 LEU B CA    1 
ATOM   9415  C  C     . LEU B 1 592 ? -0.625  158.713 -18.514 1.00 55.48  ? 1346 LEU B C     1 
ATOM   9416  O  O     . LEU B 1 592 ? -0.254  159.753 -17.968 1.00 66.85  ? 1346 LEU B O     1 
ATOM   9417  C  CB    . LEU B 1 592 ? 1.202   157.336 -19.471 1.00 52.14  ? 1346 LEU B CB    1 
ATOM   9418  C  CG    . LEU B 1 592 ? 2.324   156.365 -19.148 1.00 56.78  ? 1346 LEU B CG    1 
ATOM   9419  C  CD1   . LEU B 1 592 ? 3.441   156.428 -20.202 1.00 47.94  ? 1346 LEU B CD1   1 
ATOM   9420  C  CD2   . LEU B 1 592 ? 2.832   156.668 -17.748 1.00 52.02  ? 1346 LEU B CD2   1 
ATOM   9421  N  N     . SER B 1 593 ? -1.716  158.663 -19.257 1.00 54.67  ? 1347 SER B N     1 
ATOM   9422  C  CA    . SER B 1 593 ? -2.454  159.893 -19.502 1.00 54.25  ? 1347 SER B CA    1 
ATOM   9423  C  C     . SER B 1 593 ? -3.247  160.200 -18.243 1.00 57.95  ? 1347 SER B C     1 
ATOM   9424  O  O     . SER B 1 593 ? -3.293  161.336 -17.793 1.00 65.67  ? 1347 SER B O     1 
ATOM   9425  C  CB    . SER B 1 593 ? -3.386  159.751 -20.696 1.00 51.12  ? 1347 SER B CB    1 
ATOM   9426  O  OG    . SER B 1 593 ? -4.564  159.085 -20.276 1.00 59.66  ? 1347 SER B OG    1 
ATOM   9427  N  N     . SER B 1 594 ? -3.858  159.174 -17.669 1.00 54.66  ? 1348 SER B N     1 
ATOM   9428  C  CA    . SER B 1 594 ? -4.538  159.323 -16.383 1.00 58.81  ? 1348 SER B CA    1 
ATOM   9429  C  C     . SER B 1 594 ? -3.660  159.966 -15.306 1.00 58.98  ? 1348 SER B C     1 
ATOM   9430  O  O     . SER B 1 594 ? -4.150  160.807 -14.535 1.00 55.64  ? 1348 SER B O     1 
ATOM   9431  C  CB    . SER B 1 594 ? -5.070  157.984 -15.880 1.00 60.95  ? 1348 SER B CB    1 
ATOM   9432  O  OG    . SER B 1 594 ? -6.431  157.827 -16.233 1.00 69.24  ? 1348 SER B OG    1 
ATOM   9433  N  N     . TYR B 1 595 ? -2.385  159.555 -15.263 1.00 54.79  ? 1349 TYR B N     1 
ATOM   9434  C  CA    . TYR B 1 595 ? -1.385  160.159 -14.391 1.00 47.50  ? 1349 TYR B CA    1 
ATOM   9435  C  C     . TYR B 1 595 ? -1.209  161.628 -14.730 1.00 50.34  ? 1349 TYR B C     1 
ATOM   9436  O  O     . TYR B 1 595 ? -1.357  162.504 -13.855 1.00 52.28  ? 1349 TYR B O     1 
ATOM   9437  C  CB    . TYR B 1 595 ? -0.026  159.459 -14.494 1.00 37.91  ? 1349 TYR B CB    1 
ATOM   9438  C  CG    . TYR B 1 595 ? 1.002   160.100 -13.595 1.00 42.95  ? 1349 TYR B CG    1 
ATOM   9439  C  CD1   . TYR B 1 595 ? 0.937   159.935 -12.213 1.00 40.70  ? 1349 TYR B CD1   1 
ATOM   9440  C  CD2   . TYR B 1 595 ? 2.004   160.905 -14.105 1.00 49.53  ? 1349 TYR B CD2   1 
ATOM   9441  C  CE1   . TYR B 1 595 ? 1.853   160.541 -11.367 1.00 46.22  ? 1349 TYR B CE1   1 
ATOM   9442  C  CE2   . TYR B 1 595 ? 2.936   161.518 -13.266 1.00 51.02  ? 1349 TYR B CE2   1 
ATOM   9443  C  CZ    . TYR B 1 595 ? 2.840   161.340 -11.899 1.00 50.53  ? 1349 TYR B CZ    1 
ATOM   9444  O  OH    . TYR B 1 595 ? 3.737   161.945 -11.055 1.00 56.48  ? 1349 TYR B OH    1 
ATOM   9445  N  N     . ILE B 1 596 ? -0.881  161.891 -15.994 1.00 48.39  ? 1350 ILE B N     1 
ATOM   9446  C  CA    . ILE B 1 596 ? -0.738  163.261 -16.479 1.00 49.53  ? 1350 ILE B CA    1 
ATOM   9447  C  C     . ILE B 1 596 ? -1.942  164.164 -16.145 1.00 48.23  ? 1350 ILE B C     1 
ATOM   9448  O  O     . ILE B 1 596 ? -1.774  165.313 -15.716 1.00 48.15  ? 1350 ILE B O     1 
ATOM   9449  C  CB    . ILE B 1 596 ? -0.441  163.262 -17.987 1.00 42.66  ? 1350 ILE B CB    1 
ATOM   9450  C  CG1   . ILE B 1 596 ? 0.923   162.594 -18.200 1.00 41.06  ? 1350 ILE B CG1   1 
ATOM   9451  C  CG2   . ILE B 1 596 ? -0.485  164.681 -18.576 1.00 35.87  ? 1350 ILE B CG2   1 
ATOM   9452  C  CD1   . ILE B 1 596 ? 1.383   162.542 -19.617 1.00 50.82  ? 1350 ILE B CD1   1 
ATOM   9453  N  N     . ALA B 1 597 ? -3.146  163.632 -16.323 1.00 51.07  ? 1351 ALA B N     1 
ATOM   9454  C  CA    . ALA B 1 597 ? -4.369  164.402 -16.127 1.00 49.07  ? 1351 ALA B CA    1 
ATOM   9455  C  C     . ALA B 1 597 ? -4.485  164.789 -14.688 1.00 50.39  ? 1351 ALA B C     1 
ATOM   9456  O  O     . ALA B 1 597 ? -4.855  165.925 -14.366 1.00 54.32  ? 1351 ALA B O     1 
ATOM   9457  C  CB    . ALA B 1 597 ? -5.565  163.578 -16.496 1.00 37.41  ? 1351 ALA B CB    1 
ATOM   9458  N  N     . HIS B 1 598 ? -4.211  163.790 -13.846 1.00 46.90  ? 1352 HIS B N     1 
ATOM   9459  C  CA    . HIS B 1 598 ? -4.153  163.920 -12.404 1.00 40.39  ? 1352 HIS B CA    1 
ATOM   9460  C  C     . HIS B 1 598 ? -3.143  164.947 -11.950 1.00 43.32  ? 1352 HIS B C     1 
ATOM   9461  O  O     . HIS B 1 598 ? -3.500  165.875 -11.216 1.00 45.65  ? 1352 HIS B O     1 
ATOM   9462  C  CB    . HIS B 1 598 ? -3.772  162.590 -11.792 1.00 44.92  ? 1352 HIS B CB    1 
ATOM   9463  C  CG    . HIS B 1 598 ? -3.668  162.635 -10.310 1.00 48.99  ? 1352 HIS B CG    1 
ATOM   9464  N  ND1   . HIS B 1 598 ? -4.739  162.957 -9.508  1.00 53.62  ? 1352 HIS B ND1   1 
ATOM   9465  C  CD2   . HIS B 1 598 ? -2.614  162.433 -9.483  1.00 49.63  ? 1352 HIS B CD2   1 
ATOM   9466  C  CE1   . HIS B 1 598 ? -4.348  162.935 -8.245  1.00 59.96  ? 1352 HIS B CE1   1 
ATOM   9467  N  NE2   . HIS B 1 598 ? -3.064  162.627 -8.204  1.00 53.64  ? 1352 HIS B NE2   1 
ATOM   9468  N  N     . ARG B 1 599 ? -1.886  164.783 -12.369 1.00 37.51  ? 1353 ARG B N     1 
ATOM   9469  C  CA    . ARG B 1 599 ? -0.864  165.779 -12.047 1.00 33.90  ? 1353 ARG B CA    1 
ATOM   9470  C  C     . ARG B 1 599 ? -1.294  167.170 -12.437 1.00 52.70  ? 1353 ARG B C     1 
ATOM   9471  O  O     . ARG B 1 599 ? -0.788  168.150 -11.909 1.00 59.82  ? 1353 ARG B O     1 
ATOM   9472  C  CB    . ARG B 1 599 ? 0.458   165.479 -12.736 1.00 40.23  ? 1353 ARG B CB    1 
ATOM   9473  C  CG    . ARG B 1 599 ? 1.247   164.320 -12.148 1.00 46.99  ? 1353 ARG B CG    1 
ATOM   9474  C  CD    . ARG B 1 599 ? 1.513   164.566 -10.701 1.00 50.35  ? 1353 ARG B CD    1 
ATOM   9475  N  NE    . ARG B 1 599 ? 2.361   165.735 -10.469 1.00 57.84  ? 1353 ARG B NE    1 
ATOM   9476  C  CZ    . ARG B 1 599 ? 2.552   166.289 -9.266  1.00 57.98  ? 1353 ARG B CZ    1 
ATOM   9477  N  NH1   . ARG B 1 599 ? 1.937   165.806 -8.184  1.00 51.44  ? 1353 ARG B NH1   1 
ATOM   9478  N  NH2   . ARG B 1 599 ? 3.350   167.340 -9.144  1.00 64.70  ? 1353 ARG B NH2   1 
ATOM   9479  N  N     . ARG B 1 600 ? -2.208  167.262 -13.393 1.00 50.49  ? 1354 ARG B N     1 
ATOM   9480  C  CA    . ARG B 1 600 ? -2.612  168.554 -13.922 1.00 51.15  ? 1354 ARG B CA    1 
ATOM   9481  C  C     . ARG B 1 600 ? -3.593  169.185 -12.941 1.00 51.82  ? 1354 ARG B C     1 
ATOM   9482  O  O     . ARG B 1 600 ? -3.452  170.339 -12.530 1.00 44.88  ? 1354 ARG B O     1 
ATOM   9483  C  CB    . ARG B 1 600 ? -3.269  168.373 -15.284 1.00 56.60  ? 1354 ARG B CB    1 
ATOM   9484  C  CG    . ARG B 1 600 ? -3.740  169.671 -15.949 1.00 58.35  ? 1354 ARG B CG    1 
ATOM   9485  C  CD    . ARG B 1 600 ? -5.098  169.497 -16.626 1.00 53.86  ? 1354 ARG B CD    1 
ATOM   9486  N  NE    . ARG B 1 600 ? -5.545  170.750 -17.221 1.00 55.45  ? 1354 ARG B NE    1 
ATOM   9487  C  CZ    . ARG B 1 600 ? -6.730  171.313 -16.991 1.00 58.16  ? 1354 ARG B CZ    1 
ATOM   9488  N  NH1   . ARG B 1 600 ? -7.592  170.709 -16.185 1.00 66.55  ? 1354 ARG B NH1   1 
ATOM   9489  N  NH2   . ARG B 1 600 ? -7.053  172.479 -17.557 1.00 53.40  ? 1354 ARG B NH2   1 
ATOM   9490  N  N     . GLU B 1 601 ? -4.593  168.411 -12.561 1.00 55.27  ? 1355 GLU B N     1 
ATOM   9491  C  CA    . GLU B 1 601 ? -5.515  168.841 -11.538 1.00 49.51  ? 1355 GLU B CA    1 
ATOM   9492  C  C     . GLU B 1 601 ? -4.780  169.336 -10.282 1.00 54.56  ? 1355 GLU B C     1 
ATOM   9493  O  O     . GLU B 1 601 ? -5.110  170.406 -9.751  1.00 64.95  ? 1355 GLU B O     1 
ATOM   9494  C  CB    . GLU B 1 601 ? -6.476  167.710 -11.195 1.00 43.55  ? 1355 GLU B CB    1 
ATOM   9495  C  CG    . GLU B 1 601 ? -7.616  167.519 -12.194 1.00 62.26  ? 1355 GLU B CG    1 
ATOM   9496  C  CD    . GLU B 1 601 ? -8.285  168.817 -12.587 1.00 85.51  ? 1355 GLU B CD    1 
ATOM   9497  O  OE1   . GLU B 1 601 ? -8.980  168.835 -13.632 1.00 92.26  ? 1355 GLU B OE1   1 
ATOM   9498  O  OE2   . GLU B 1 601 ? -8.114  169.818 -11.854 1.00 96.34  ? 1355 GLU B OE2   1 
ATOM   9499  N  N     . VAL B 1 602 ? -3.784  168.569 -9.833  1.00 43.77  ? 1356 VAL B N     1 
ATOM   9500  C  CA    . VAL B 1 602 ? -2.996  168.895 -8.636  1.00 44.07  ? 1356 VAL B CA    1 
ATOM   9501  C  C     . VAL B 1 602 ? -2.236  170.220 -8.792  1.00 49.65  ? 1356 VAL B C     1 
ATOM   9502  O  O     . VAL B 1 602 ? -2.531  171.193 -8.115  1.00 57.77  ? 1356 VAL B O     1 
ATOM   9503  C  CB    . VAL B 1 602 ? -1.988  167.754 -8.298  1.00 51.64  ? 1356 VAL B CB    1 
ATOM   9504  C  CG1   . VAL B 1 602 ? -1.044  168.167 -7.206  1.00 43.26  ? 1356 VAL B CG1   1 
ATOM   9505  C  CG2   . VAL B 1 602 ? -2.725  166.470 -7.906  1.00 56.69  ? 1356 VAL B CG2   1 
ATOM   9506  N  N     . ILE B 1 603 ? -1.257  170.257 -9.687  1.00 48.81  ? 1357 ILE B N     1 
ATOM   9507  C  CA    . ILE B 1 603 ? -0.519  171.488 -9.980  1.00 45.84  ? 1357 ILE B CA    1 
ATOM   9508  C  C     . ILE B 1 603 ? -1.379  172.759 -10.172 1.00 52.81  ? 1357 ILE B C     1 
ATOM   9509  O  O     . ILE B 1 603 ? -0.971  173.865 -9.790  1.00 52.23  ? 1357 ILE B O     1 
ATOM   9510  C  CB    . ILE B 1 603 ? 0.296   171.313 -11.229 1.00 37.91  ? 1357 ILE B CB    1 
ATOM   9511  C  CG1   . ILE B 1 603 ? 1.385   170.281 -10.978 1.00 45.36  ? 1357 ILE B CG1   1 
ATOM   9512  C  CG2   . ILE B 1 603 ? 0.899   172.642 -11.632 1.00 39.21  ? 1357 ILE B CG2   1 
ATOM   9513  C  CD1   . ILE B 1 603 ? 2.355   170.152 -12.110 1.00 58.02  ? 1357 ILE B CD1   1 
ATOM   9514  N  N     . LEU B 1 604 ? -2.552  172.617 -10.782 1.00 47.95  ? 1358 LEU B N     1 
ATOM   9515  C  CA    . LEU B 1 604 ? -3.456  173.753 -10.851 1.00 45.89  ? 1358 LEU B CA    1 
ATOM   9516  C  C     . LEU B 1 604 ? -3.981  174.081 -9.447  1.00 51.32  ? 1358 LEU B C     1 
ATOM   9517  O  O     . LEU B 1 604 ? -3.774  175.182 -8.955  1.00 57.79  ? 1358 LEU B O     1 
ATOM   9518  C  CB    . LEU B 1 604 ? -4.597  173.528 -11.854 1.00 38.88  ? 1358 LEU B CB    1 
ATOM   9519  C  CG    . LEU B 1 604 ? -4.224  173.489 -13.351 1.00 42.89  ? 1358 LEU B CG    1 
ATOM   9520  C  CD1   . LEU B 1 604 ? -5.419  173.222 -14.235 1.00 37.04  ? 1358 LEU B CD1   1 
ATOM   9521  C  CD2   . LEU B 1 604 ? -3.492  174.760 -13.778 1.00 41.32  ? 1358 LEU B CD2   1 
ATOM   9522  N  N     . ALA B 1 605 ? -4.636  173.122 -8.797  1.00 46.09  ? 1359 ALA B N     1 
ATOM   9523  C  CA    . ALA B 1 605 ? -5.036  173.270 -7.386  1.00 44.50  ? 1359 ALA B CA    1 
ATOM   9524  C  C     . ALA B 1 605 ? -3.956  173.887 -6.499  1.00 49.15  ? 1359 ALA B C     1 
ATOM   9525  O  O     . ALA B 1 605 ? -4.229  174.801 -5.714  1.00 54.30  ? 1359 ALA B O     1 
ATOM   9526  C  CB    . ALA B 1 605 ? -5.451  171.930 -6.796  1.00 38.61  ? 1359 ALA B CB    1 
ATOM   9527  N  N     . ARG B 1 606 ? -2.741  173.362 -6.596  1.00 43.88  ? 1360 ARG B N     1 
ATOM   9528  C  CA    . ARG B 1 606 ? -1.648  173.863 -5.785  1.00 40.22  ? 1360 ARG B CA    1 
ATOM   9529  C  C     . ARG B 1 606 ? -1.467  175.335 -6.051  1.00 43.30  ? 1360 ARG B C     1 
ATOM   9530  O  O     . ARG B 1 606 ? -1.504  176.147 -5.138  1.00 50.83  ? 1360 ARG B O     1 
ATOM   9531  C  CB    . ARG B 1 606 ? -0.362  173.126 -6.112  1.00 46.16  ? 1360 ARG B CB    1 
ATOM   9532  C  CG    . ARG B 1 606 ? 0.763   173.483 -5.200  1.00 52.98  ? 1360 ARG B CG    1 
ATOM   9533  C  CD    . ARG B 1 606 ? 2.017   173.650 -6.008  1.00 65.78  ? 1360 ARG B CD    1 
ATOM   9534  N  NE    . ARG B 1 606 ? 2.515   172.372 -6.503  1.00 62.71  ? 1360 ARG B NE    1 
ATOM   9535  C  CZ    . ARG B 1 606 ? 3.270   172.246 -7.585  1.00 60.12  ? 1360 ARG B CZ    1 
ATOM   9536  N  NH1   . ARG B 1 606 ? 3.596   173.319 -8.308  1.00 54.84  ? 1360 ARG B NH1   1 
ATOM   9537  N  NH2   . ARG B 1 606 ? 3.688   171.046 -7.959  1.00 71.59  ? 1360 ARG B NH2   1 
ATOM   9538  N  N     . SER B 1 607 ? -1.304  175.672 -7.325  1.00 50.59  ? 1361 SER B N     1 
ATOM   9539  C  CA    . SER B 1 607 ? -1.077  177.052 -7.745  1.00 48.52  ? 1361 SER B CA    1 
ATOM   9540  C  C     . SER B 1 607 ? -2.173  178.048 -7.324  1.00 46.47  ? 1361 SER B C     1 
ATOM   9541  O  O     . SER B 1 607 ? -1.875  179.173 -6.922  1.00 44.45  ? 1361 SER B O     1 
ATOM   9542  C  CB    . SER B 1 607 ? -0.854  177.088 -9.253  1.00 50.33  ? 1361 SER B CB    1 
ATOM   9543  O  OG    . SER B 1 607 ? 0.245   176.261 -9.583  1.00 54.26  ? 1361 SER B OG    1 
ATOM   9544  N  N     . ARG B 1 608 ? -3.434  177.643 -7.439  1.00 44.70  ? 1362 ARG B N     1 
ATOM   9545  C  CA    . ARG B 1 608 ? -4.532  178.460 -6.960  1.00 46.77  ? 1362 ARG B CA    1 
ATOM   9546  C  C     . ARG B 1 608 ? -4.320  178.743 -5.468  1.00 58.42  ? 1362 ARG B C     1 
ATOM   9547  O  O     . ARG B 1 608 ? -4.408  179.891 -5.015  1.00 66.40  ? 1362 ARG B O     1 
ATOM   9548  C  CB    . ARG B 1 608 ? -5.884  177.773 -7.209  1.00 39.20  ? 1362 ARG B CB    1 
ATOM   9549  C  CG    . ARG B 1 608 ? -6.372  177.870 -8.665  1.00 53.65  ? 1362 ARG B CG    1 
ATOM   9550  C  CD    . ARG B 1 608 ? -7.774  177.256 -8.889  1.00 63.18  ? 1362 ARG B CD    1 
ATOM   9551  N  NE    . ARG B 1 608 ? -7.708  176.112 -9.804  1.00 76.07  ? 1362 ARG B NE    1 
ATOM   9552  C  CZ    . ARG B 1 608 ? -7.669  174.838 -9.411  1.00 88.68  ? 1362 ARG B CZ    1 
ATOM   9553  N  NH1   . ARG B 1 608 ? -7.717  174.533 -8.127  1.00 89.33  ? 1362 ARG B NH1   1 
ATOM   9554  N  NH2   . ARG B 1 608 ? -7.594  173.859 -10.300 1.00 100.47 ? 1362 ARG B NH2   1 
ATOM   9555  N  N     . PHE B 1 609 ? -4.004  177.692 -4.717  1.00 52.86  ? 1363 PHE B N     1 
ATOM   9556  C  CA    . PHE B 1 609 ? -3.806  177.812 -3.282  1.00 45.67  ? 1363 PHE B CA    1 
ATOM   9557  C  C     . PHE B 1 609 ? -2.716  178.814 -2.931  1.00 50.06  ? 1363 PHE B C     1 
ATOM   9558  O  O     . PHE B 1 609 ? -2.969  179.772 -2.208  1.00 60.63  ? 1363 PHE B O     1 
ATOM   9559  C  CB    . PHE B 1 609 ? -3.489  176.457 -2.682  1.00 42.47  ? 1363 PHE B CB    1 
ATOM   9560  C  CG    . PHE B 1 609 ? -3.342  176.467 -1.195  1.00 53.62  ? 1363 PHE B CG    1 
ATOM   9561  C  CD1   . PHE B 1 609 ? -4.450  176.286 -0.377  1.00 54.71  ? 1363 PHE B CD1   1 
ATOM   9562  C  CD2   . PHE B 1 609 ? -2.086  176.624 -0.603  1.00 54.77  ? 1363 PHE B CD2   1 
ATOM   9563  C  CE1   . PHE B 1 609 ? -4.319  176.267 1.001   1.00 45.11  ? 1363 PHE B CE1   1 
ATOM   9564  C  CE2   . PHE B 1 609 ? -1.951  176.621 0.773   1.00 39.29  ? 1363 PHE B CE2   1 
ATOM   9565  C  CZ    . PHE B 1 609 ? -3.071  176.442 1.576   1.00 37.43  ? 1363 PHE B CZ    1 
ATOM   9566  N  N     . ASP B 1 610 ? -1.510  178.606 -3.440  1.00 47.33  ? 1364 ASP B N     1 
ATOM   9567  C  CA    . ASP B 1 610 ? -0.407  179.521 -3.153  1.00 50.99  ? 1364 ASP B CA    1 
ATOM   9568  C  C     . ASP B 1 610 ? -0.667  180.958 -3.631  1.00 57.25  ? 1364 ASP B C     1 
ATOM   9569  O  O     . ASP B 1 610 ? -0.161  181.929 -3.041  1.00 58.16  ? 1364 ASP B O     1 
ATOM   9570  C  CB    . ASP B 1 610 ? 0.905   178.993 -3.730  1.00 60.12  ? 1364 ASP B CB    1 
ATOM   9571  C  CG    . ASP B 1 610 ? 1.455   177.792 -2.948  1.00 83.71  ? 1364 ASP B CG    1 
ATOM   9572  O  OD1   . ASP B 1 610 ? 1.006   177.536 -1.796  1.00 91.04  ? 1364 ASP B OD1   1 
ATOM   9573  O  OD2   . ASP B 1 610 ? 2.357   177.112 -3.492  1.00 88.60  ? 1364 ASP B OD2   1 
ATOM   9574  N  N     . LYS B 1 611 ? -1.463  181.106 -4.686  1.00 57.53  ? 1365 LYS B N     1 
ATOM   9575  C  CA    . LYS B 1 611 ? -1.693  182.438 -5.217  1.00 50.31  ? 1365 LYS B CA    1 
ATOM   9576  C  C     . LYS B 1 611 ? -2.587  183.211 -4.269  1.00 51.89  ? 1365 LYS B C     1 
ATOM   9577  O  O     . LYS B 1 611 ? -2.375  184.398 -4.061  1.00 60.75  ? 1365 LYS B O     1 
ATOM   9578  C  CB    . LYS B 1 611 ? -2.300  182.403 -6.627  1.00 45.67  ? 1365 LYS B CB    1 
ATOM   9579  C  CG    . LYS B 1 611 ? -2.399  183.790 -7.295  1.00 44.35  ? 1365 LYS B CG    1 
ATOM   9580  C  CD    . LYS B 1 611 ? -2.929  183.729 -8.718  1.00 40.38  ? 1365 LYS B CD    1 
ATOM   9581  C  CE    . LYS B 1 611 ? -4.429  183.815 -8.769  1.00 45.90  ? 1365 LYS B CE    1 
ATOM   9582  N  NZ    . LYS B 1 611 ? -4.911  185.237 -8.670  1.00 57.40  ? 1365 LYS B NZ    1 
ATOM   9583  N  N     . GLU B 1 612 ? -3.579  182.534 -3.691  1.00 44.11  ? 1366 GLU B N     1 
ATOM   9584  C  CA    . GLU B 1 612 ? -4.529  183.194 -2.809  1.00 53.13  ? 1366 GLU B CA    1 
ATOM   9585  C  C     . GLU B 1 612 ? -3.816  183.611 -1.536  1.00 58.31  ? 1366 GLU B C     1 
ATOM   9586  O  O     . GLU B 1 612 ? -4.038  184.699 -0.997  1.00 65.62  ? 1366 GLU B O     1 
ATOM   9587  C  CB    . GLU B 1 612 ? -5.723  182.294 -2.499  1.00 35.59  ? 1366 GLU B CB    1 
ATOM   9588  C  CG    . GLU B 1 612 ? -6.611  182.863 -1.424  1.00 82.83  ? 1366 GLU B CG    1 
ATOM   9589  C  CD    . GLU B 1 612 ? -7.847  182.022 -1.203  1.00 105.38 ? 1366 GLU B CD    1 
ATOM   9590  O  OE1   . GLU B 1 612 ? -8.339  181.975 -0.047  1.00 116.67 ? 1366 GLU B OE1   1 
ATOM   9591  O  OE2   . GLU B 1 612 ? -8.319  181.408 -2.191  1.00 107.99 ? 1366 GLU B OE2   1 
ATOM   9592  N  N     . LYS B 1 613 ? -2.932  182.736 -1.083  1.00 56.46  ? 1367 LYS B N     1 
ATOM   9593  C  CA    . LYS B 1 613 ? -2.162  182.948 0.127   1.00 52.09  ? 1367 LYS B CA    1 
ATOM   9594  C  C     . LYS B 1 613 ? -1.243  184.137 -0.108  1.00 49.93  ? 1367 LYS B C     1 
ATOM   9595  O  O     . LYS B 1 613 ? -1.003  184.939 0.797   1.00 63.74  ? 1367 LYS B O     1 
ATOM   9596  C  CB    . LYS B 1 613 ? -1.362  181.683 0.436   1.00 45.82  ? 1367 LYS B CB    1 
ATOM   9597  C  CG    . LYS B 1 613 ? -0.849  181.538 1.829   1.00 65.90  ? 1367 LYS B CG    1 
ATOM   9598  C  CD    . LYS B 1 613 ? 0.150   180.361 1.950   1.00 74.53  ? 1367 LYS B CD    1 
ATOM   9599  N  N     . ALA B 1 614 ? -0.745  184.274 -1.331  1.00 43.48  ? 1368 ALA B N     1 
ATOM   9600  C  CA    . ALA B 1 614 ? 0.147   185.398 -1.614  1.00 44.45  ? 1368 ALA B CA    1 
ATOM   9601  C  C     . ALA B 1 614 ? -0.589  186.730 -1.798  1.00 50.95  ? 1368 ALA B C     1 
ATOM   9602  O  O     . ALA B 1 614 ? -0.073  187.782 -1.421  1.00 58.26  ? 1368 ALA B O     1 
ATOM   9603  C  CB    . ALA B 1 614 ? 1.021   185.106 -2.775  1.00 36.07  ? 1368 ALA B CB    1 
ATOM   9604  N  N     . GLU B 1 615 ? -1.790  186.680 -2.366  1.00 51.86  ? 1369 GLU B N     1 
ATOM   9605  C  CA    . GLU B 1 615 ? -2.620  187.871 -2.520  1.00 55.05  ? 1369 GLU B CA    1 
ATOM   9606  C  C     . GLU B 1 615 ? -2.994  188.417 -1.153  1.00 63.49  ? 1369 GLU B C     1 
ATOM   9607  O  O     . GLU B 1 615 ? -2.888  189.629 -0.911  1.00 70.81  ? 1369 GLU B O     1 
ATOM   9608  C  CB    . GLU B 1 615 ? -3.894  187.560 -3.306  1.00 61.70  ? 1369 GLU B CB    1 
ATOM   9609  C  CG    . GLU B 1 615 ? -3.685  187.461 -4.806  1.00 79.25  ? 1369 GLU B CG    1 
ATOM   9610  C  CD    . GLU B 1 615 ? -4.945  187.051 -5.544  1.00 100.98 ? 1369 GLU B CD    1 
ATOM   9611  O  OE1   . GLU B 1 615 ? -5.136  187.528 -6.692  1.00 115.62 ? 1369 GLU B OE1   1 
ATOM   9612  O  OE2   . GLU B 1 615 ? -5.737  186.254 -4.977  1.00 99.77  ? 1369 GLU B OE2   1 
ATOM   9613  N  N     . LYS B 1 616 ? -3.422  187.521 -0.258  1.00 54.84  ? 1370 LYS B N     1 
ATOM   9614  C  CA    . LYS B 1 616 ? -3.858  187.938 1.071   1.00 50.28  ? 1370 LYS B CA    1 
ATOM   9615  C  C     . LYS B 1 616 ? -2.715  188.668 1.764   1.00 50.39  ? 1370 LYS B C     1 
ATOM   9616  O  O     . LYS B 1 616 ? -2.876  189.791 2.272   1.00 61.19  ? 1370 LYS B O     1 
ATOM   9617  C  CB    . LYS B 1 616 ? -4.438  186.763 1.863   1.00 34.81  ? 1370 LYS B CB    1 
ATOM   9618  C  CG    . LYS B 1 616 ? -5.962  186.699 1.658   1.00 49.60  ? 1370 LYS B CG    1 
ATOM   9619  C  CD    . LYS B 1 616 ? -6.658  185.340 1.842   1.00 41.18  ? 1370 LYS B CD    1 
ATOM   9620  N  N     . ARG B 1 617 ? -1.539  188.065 1.713   1.00 41.18  ? 1371 ARG B N     1 
ATOM   9621  C  CA    . ARG B 1 617 ? -0.364  188.659 2.329   1.00 46.14  ? 1371 ARG B CA    1 
ATOM   9622  C  C     . ARG B 1 617 ? -0.004  189.990 1.692   1.00 54.16  ? 1371 ARG B C     1 
ATOM   9623  O  O     . ARG B 1 617 ? 0.253   190.984 2.384   1.00 55.00  ? 1371 ARG B O     1 
ATOM   9624  C  CB    . ARG B 1 617 ? 0.814   187.716 2.185   1.00 38.31  ? 1371 ARG B CB    1 
ATOM   9625  C  CG    . ARG B 1 617 ? 2.097   188.335 2.628   1.00 36.59  ? 1371 ARG B CG    1 
ATOM   9626  C  CD    . ARG B 1 617 ? 2.161   188.374 4.138   1.00 48.73  ? 1371 ARG B CD    1 
ATOM   9627  N  NE    . ARG B 1 617 ? 3.315   189.148 4.583   1.00 55.17  ? 1371 ARG B NE    1 
ATOM   9628  C  CZ    . ARG B 1 617 ? 3.339   189.854 5.706   1.00 52.06  ? 1371 ARG B CZ    1 
ATOM   9629  N  NH1   . ARG B 1 617 ? 2.254   189.870 6.516   1.00 46.16  ? 1371 ARG B NH1   1 
ATOM   9630  N  NH2   . ARG B 1 617 ? 4.441   190.542 6.010   1.00 39.89  ? 1371 ARG B NH2   1 
ATOM   9631  N  N     . LEU B 1 618 ? 0.044   189.985 0.361   1.00 53.03  ? 1372 LEU B N     1 
ATOM   9632  C  CA    . LEU B 1 618 ? 0.359   191.178 -0.400  1.00 51.14  ? 1372 LEU B CA    1 
ATOM   9633  C  C     . LEU B 1 618 ? -0.552  192.315 0.058   1.00 52.41  ? 1372 LEU B C     1 
ATOM   9634  O  O     . LEU B 1 618 ? -0.097  193.452 0.245   1.00 50.59  ? 1372 LEU B O     1 
ATOM   9635  C  CB    . LEU B 1 618 ? 0.125   190.919 -1.884  1.00 50.94  ? 1372 LEU B CB    1 
ATOM   9636  C  CG    . LEU B 1 618 ? 0.820   191.859 -2.871  1.00 46.77  ? 1372 LEU B CG    1 
ATOM   9637  C  CD1   . LEU B 1 618 ? -0.048  192.071 -4.080  1.00 37.91  ? 1372 LEU B CD1   1 
ATOM   9638  C  CD2   . LEU B 1 618 ? 1.186   193.187 -2.219  1.00 46.03  ? 1372 LEU B CD2   1 
ATOM   9639  N  N     . HIS B 1 619 ? -1.840  191.997 0.238   1.00 43.33  ? 1373 HIS B N     1 
ATOM   9640  C  CA    . HIS B 1 619 ? -2.820  192.989 0.656   1.00 41.99  ? 1373 HIS B CA    1 
ATOM   9641  C  C     . HIS B 1 619 ? -2.399  193.578 1.997   1.00 52.19  ? 1373 HIS B C     1 
ATOM   9642  O  O     . HIS B 1 619 ? -2.421  194.806 2.157   1.00 47.94  ? 1373 HIS B O     1 
ATOM   9643  C  CB    . HIS B 1 619 ? -4.230  192.377 0.742   1.00 37.95  ? 1373 HIS B CB    1 
ATOM   9644  C  CG    . HIS B 1 619 ? -5.337  193.382 0.912   1.00 45.15  ? 1373 HIS B CG    1 
ATOM   9645  N  ND1   . HIS B 1 619 ? -5.336  194.615 0.298   1.00 59.51  ? 1373 HIS B ND1   1 
ATOM   9646  C  CD2   . HIS B 1 619 ? -6.503  193.313 1.602   1.00 49.05  ? 1373 HIS B CD2   1 
ATOM   9647  C  CE1   . HIS B 1 619 ? -6.438  195.272 0.621   1.00 58.84  ? 1373 HIS B CE1   1 
ATOM   9648  N  NE2   . HIS B 1 619 ? -7.167  194.500 1.407   1.00 49.67  ? 1373 HIS B NE2   1 
ATOM   9649  N  N     . ILE B 1 620 ? -2.017  192.709 2.950   1.00 47.05  ? 1374 ILE B N     1 
ATOM   9650  C  CA    . ILE B 1 620 ? -1.613  193.171 4.270   1.00 35.96  ? 1374 ILE B CA    1 
ATOM   9651  C  C     . ILE B 1 620 ? -0.370  194.069 4.128   1.00 45.13  ? 1374 ILE B C     1 
ATOM   9652  O  O     . ILE B 1 620 ? -0.265  195.138 4.754   1.00 51.17  ? 1374 ILE B O     1 
ATOM   9653  C  CB    . ILE B 1 620 ? -1.286  191.982 5.214   1.00 42.35  ? 1374 ILE B CB    1 
ATOM   9654  C  CG1   . ILE B 1 620 ? -2.538  191.185 5.551   1.00 34.14  ? 1374 ILE B CG1   1 
ATOM   9655  C  CG2   . ILE B 1 620 ? -0.662  192.469 6.494   1.00 36.13  ? 1374 ILE B CG2   1 
ATOM   9656  C  CD1   . ILE B 1 620 ? -3.592  192.049 6.013   1.00 40.81  ? 1374 ILE B CD1   1 
ATOM   9657  N  N     . VAL B 1 621 ? 0.576   193.618 3.309   1.00 41.27  ? 1375 VAL B N     1 
ATOM   9658  C  CA    . VAL B 1 621 ? 1.851   194.299 3.172   1.00 43.45  ? 1375 VAL B CA    1 
ATOM   9659  C  C     . VAL B 1 621 ? 1.651   195.686 2.560   1.00 49.33  ? 1375 VAL B C     1 
ATOM   9660  O  O     . VAL B 1 621 ? 2.262   196.659 2.991   1.00 52.52  ? 1375 VAL B O     1 
ATOM   9661  C  CB    . VAL B 1 621 ? 2.826   193.471 2.307   1.00 44.02  ? 1375 VAL B CB    1 
ATOM   9662  C  CG1   . VAL B 1 621 ? 3.959   194.356 1.773   1.00 35.63  ? 1375 VAL B CG1   1 
ATOM   9663  C  CG2   . VAL B 1 621 ? 3.347   192.258 3.088   1.00 37.60  ? 1375 VAL B CG2   1 
ATOM   9664  N  N     . GLU B 1 622 ? 0.785   195.776 1.558   1.00 49.85  ? 1376 GLU B N     1 
ATOM   9665  C  CA    . GLU B 1 622 ? 0.409   197.075 1.034   1.00 47.43  ? 1376 GLU B CA    1 
ATOM   9666  C  C     . GLU B 1 622 ? -0.101  197.958 2.174   1.00 48.46  ? 1376 GLU B C     1 
ATOM   9667  O  O     . GLU B 1 622 ? 0.247   199.135 2.264   1.00 54.76  ? 1376 GLU B O     1 
ATOM   9668  C  CB    . GLU B 1 622 ? -0.630  196.950 -0.091  1.00 54.23  ? 1376 GLU B CB    1 
ATOM   9669  C  CG    . GLU B 1 622 ? -0.087  196.265 -1.348  1.00 68.66  ? 1376 GLU B CG    1 
ATOM   9670  C  CD    . GLU B 1 622 ? -1.167  195.845 -2.369  1.00 87.59  ? 1376 GLU B CD    1 
ATOM   9671  O  OE1   . GLU B 1 622 ? -2.342  195.596 -1.980  1.00 88.86  ? 1376 GLU B OE1   1 
ATOM   9672  O  OE2   . GLU B 1 622 ? -0.818  195.754 -3.574  1.00 94.89  ? 1376 GLU B OE2   1 
ATOM   9673  N  N     . GLY B 1 623 ? -0.913  197.378 3.054   1.00 53.41  ? 1377 GLY B N     1 
ATOM   9674  C  CA    . GLY B 1 623 ? -1.480  198.106 4.182   1.00 49.41  ? 1377 GLY B CA    1 
ATOM   9675  C  C     . GLY B 1 623 ? -0.401  198.621 5.124   1.00 48.69  ? 1377 GLY B C     1 
ATOM   9676  O  O     . GLY B 1 623 ? -0.406  199.800 5.518   1.00 45.10  ? 1377 GLY B O     1 
ATOM   9677  N  N     . LEU B 1 624 ? 0.532   197.738 5.479   1.00 41.64  ? 1378 LEU B N     1 
ATOM   9678  C  CA    . LEU B 1 624 ? 1.562   198.086 6.438   1.00 38.34  ? 1378 LEU B CA    1 
ATOM   9679  C  C     . LEU B 1 624 ? 2.467   199.187 5.898   1.00 52.31  ? 1378 LEU B C     1 
ATOM   9680  O  O     . LEU B 1 624 ? 2.939   200.038 6.649   1.00 62.48  ? 1378 LEU B O     1 
ATOM   9681  C  CB    . LEU B 1 624 ? 2.387   196.859 6.801   1.00 37.44  ? 1378 LEU B CB    1 
ATOM   9682  C  CG    . LEU B 1 624 ? 1.706   195.680 7.498   1.00 41.25  ? 1378 LEU B CG    1 
ATOM   9683  C  CD1   . LEU B 1 624 ? 2.722   194.569 7.726   1.00 44.95  ? 1378 LEU B CD1   1 
ATOM   9684  C  CD2   . LEU B 1 624 ? 1.150   196.106 8.794   1.00 32.26  ? 1378 LEU B CD2   1 
ATOM   9685  N  N     . ILE B 1 625 ? 2.702   199.171 4.590   1.00 49.34  ? 1379 ILE B N     1 
ATOM   9686  C  CA    . ILE B 1 625 ? 3.526   200.192 3.949   1.00 46.74  ? 1379 ILE B CA    1 
ATOM   9687  C  C     . ILE B 1 625 ? 2.916   201.591 4.111   1.00 42.76  ? 1379 ILE B C     1 
ATOM   9688  O  O     . ILE B 1 625 ? 3.628   202.544 4.413   1.00 51.32  ? 1379 ILE B O     1 
ATOM   9689  C  CB    . ILE B 1 625 ? 3.780   199.835 2.465   1.00 53.96  ? 1379 ILE B CB    1 
ATOM   9690  C  CG1   . ILE B 1 625 ? 4.520   198.516 2.397   1.00 58.04  ? 1379 ILE B CG1   1 
ATOM   9691  C  CG2   . ILE B 1 625 ? 4.633   200.863 1.750   1.00 35.07  ? 1379 ILE B CG2   1 
ATOM   9692  C  CD1   . ILE B 1 625 ? 5.180   198.323 1.109   1.00 62.67  ? 1379 ILE B CD1   1 
ATOM   9693  N  N     . ARG B 1 626 ? 1.603   201.711 3.940   1.00 36.96  ? 1380 ARG B N     1 
ATOM   9694  C  CA    . ARG B 1 626 ? 0.909   202.975 4.182   1.00 43.68  ? 1380 ARG B CA    1 
ATOM   9695  C  C     . ARG B 1 626 ? 0.963   203.371 5.654   1.00 55.31  ? 1380 ARG B C     1 
ATOM   9696  O  O     . ARG B 1 626 ? 1.159   204.548 5.996   1.00 57.06  ? 1380 ARG B O     1 
ATOM   9697  C  CB    . ARG B 1 626 ? -0.563  202.849 3.806   1.00 36.65  ? 1380 ARG B CB    1 
ATOM   9698  C  CG    . ARG B 1 626 ? -0.861  203.089 2.402   1.00 53.79  ? 1380 ARG B CG    1 
ATOM   9699  C  CD    . ARG B 1 626 ? -2.009  204.035 2.279   1.00 54.71  ? 1380 ARG B CD    1 
ATOM   9700  N  NE    . ARG B 1 626 ? -3.255  203.339 2.528   1.00 56.88  ? 1380 ARG B NE    1 
ATOM   9701  C  CZ    . ARG B 1 626 ? -4.346  203.943 2.980   1.00 68.91  ? 1380 ARG B CZ    1 
ATOM   9702  N  NH1   . ARG B 1 626 ? -4.339  205.265 3.226   1.00 55.72  ? 1380 ARG B NH1   1 
ATOM   9703  N  NH2   . ARG B 1 626 ? -5.444  203.222 3.189   1.00 81.65  ? 1380 ARG B NH2   1 
ATOM   9704  N  N     . VAL B 1 627 ? 0.728   202.384 6.522   1.00 55.25  ? 1381 VAL B N     1 
ATOM   9705  C  CA    . VAL B 1 627 ? 0.646   202.633 7.951   1.00 53.67  ? 1381 VAL B CA    1 
ATOM   9706  C  C     . VAL B 1 627 ? 1.916   203.344 8.350   1.00 58.12  ? 1381 VAL B C     1 
ATOM   9707  O  O     . VAL B 1 627 ? 1.884   204.394 8.992   1.00 68.58  ? 1381 VAL B O     1 
ATOM   9708  C  CB    . VAL B 1 627 ? 0.509   201.324 8.755   1.00 46.36  ? 1381 VAL B CB    1 
ATOM   9709  C  CG1   . VAL B 1 627 ? 1.152   201.455 10.127  1.00 48.09  ? 1381 VAL B CG1   1 
ATOM   9710  C  CG2   . VAL B 1 627 ? -0.947  200.936 8.897   1.00 40.63  ? 1381 VAL B CG2   1 
ATOM   9711  N  N     . ILE B 1 628 ? 3.036   202.778 7.929   1.00 48.20  ? 1382 ILE B N     1 
ATOM   9712  C  CA    . ILE B 1 628 ? 4.328   203.304 8.322   1.00 49.54  ? 1382 ILE B CA    1 
ATOM   9713  C  C     . ILE B 1 628 ? 4.471   204.810 8.116   1.00 54.59  ? 1382 ILE B C     1 
ATOM   9714  O  O     . ILE B 1 628 ? 5.132   205.492 8.901   1.00 61.53  ? 1382 ILE B O     1 
ATOM   9715  C  CB    . ILE B 1 628 ? 5.483   202.592 7.602   1.00 43.55  ? 1382 ILE B CB    1 
ATOM   9716  C  CG1   . ILE B 1 628 ? 5.590   201.146 8.097   1.00 47.56  ? 1382 ILE B CG1   1 
ATOM   9717  C  CG2   . ILE B 1 628 ? 6.770   203.336 7.863   1.00 37.11  ? 1382 ILE B CG2   1 
ATOM   9718  C  CD1   . ILE B 1 628 ? 7.012   200.544 8.047   1.00 49.00  ? 1382 ILE B CD1   1 
ATOM   9719  N  N     . SER B 1 629 ? 3.867   205.338 7.063   1.00 48.34  ? 1383 SER B N     1 
ATOM   9720  C  CA    . SER B 1 629 ? 4.120   206.741 6.729   1.00 60.21  ? 1383 SER B CA    1 
ATOM   9721  C  C     . SER B 1 629 ? 3.215   207.650 7.554   1.00 59.10  ? 1383 SER B C     1 
ATOM   9722  O  O     . SER B 1 629 ? 3.461   208.857 7.675   1.00 62.81  ? 1383 SER B O     1 
ATOM   9723  C  CB    . SER B 1 629 ? 3.973   207.006 5.217   1.00 56.41  ? 1383 SER B CB    1 
ATOM   9724  O  OG    . SER B 1 629 ? 2.609   207.218 4.863   1.00 60.89  ? 1383 SER B OG    1 
ATOM   9725  N  N     . ILE B 1 630 ? 2.164   207.055 8.115   1.00 53.26  ? 1384 ILE B N     1 
ATOM   9726  C  CA    . ILE B 1 630 ? 1.245   207.772 8.985   1.00 53.20  ? 1384 ILE B CA    1 
ATOM   9727  C  C     . ILE B 1 630 ? 1.154   207.129 10.375  1.00 58.23  ? 1384 ILE B C     1 
ATOM   9728  O  O     . ILE B 1 630 ? 0.097   207.184 11.029  1.00 60.91  ? 1384 ILE B O     1 
ATOM   9729  C  CB    . ILE B 1 630 ? -0.158  207.855 8.372   1.00 42.41  ? 1384 ILE B CB    1 
ATOM   9730  C  CG1   . ILE B 1 630 ? -0.756  206.463 8.125   1.00 39.96  ? 1384 ILE B CG1   1 
ATOM   9731  C  CG2   . ILE B 1 630 ? -0.109  208.593 7.116   1.00 31.37  ? 1384 ILE B CG2   1 
ATOM   9732  C  CD1   . ILE B 1 630 ? -2.283  206.532 7.682   1.00 41.00  ? 1384 ILE B CD1   1 
ATOM   9733  N  N     . LEU B 1 631 ? 2.263   206.535 10.822  1.00 53.54  ? 1385 LEU B N     1 
ATOM   9734  C  CA    . LEU B 1 631 ? 2.288   205.768 12.069  1.00 52.07  ? 1385 LEU B CA    1 
ATOM   9735  C  C     . LEU B 1 631 ? 1.701   206.563 13.224  1.00 62.90  ? 1385 LEU B C     1 
ATOM   9736  O  O     . LEU B 1 631 ? 0.884   206.052 13.979  1.00 66.91  ? 1385 LEU B O     1 
ATOM   9737  C  CB    . LEU B 1 631 ? 3.711   205.357 12.438  1.00 50.21  ? 1385 LEU B CB    1 
ATOM   9738  C  CG    . LEU B 1 631 ? 4.003   203.887 12.765  1.00 47.26  ? 1385 LEU B CG    1 
ATOM   9739  C  CD1   . LEU B 1 631 ? 5.221   203.821 13.655  1.00 40.51  ? 1385 LEU B CD1   1 
ATOM   9740  C  CD2   . LEU B 1 631 ? 2.816   203.118 13.385  1.00 44.01  ? 1385 LEU B CD2   1 
ATOM   9741  N  N     . ASP B 1 632 ? 2.113   207.817 13.352  1.00 64.61  ? 1386 ASP B N     1 
ATOM   9742  C  CA    . ASP B 1 632 ? 1.756   208.605 14.523  1.00 64.76  ? 1386 ASP B CA    1 
ATOM   9743  C  C     . ASP B 1 632 ? 0.276   208.922 14.546  1.00 61.57  ? 1386 ASP B C     1 
ATOM   9744  O  O     . ASP B 1 632 ? -0.394  208.768 15.582  1.00 66.45  ? 1386 ASP B O     1 
ATOM   9745  C  CB    . ASP B 1 632 ? 2.598   209.878 14.602  1.00 76.25  ? 1386 ASP B CB    1 
ATOM   9746  C  CG    . ASP B 1 632 ? 4.077   209.586 14.869  1.00 88.96  ? 1386 ASP B CG    1 
ATOM   9747  O  OD1   . ASP B 1 632 ? 4.441   209.330 16.053  1.00 87.83  ? 1386 ASP B OD1   1 
ATOM   9748  O  OD2   . ASP B 1 632 ? 4.869   209.610 13.889  1.00 95.43  ? 1386 ASP B OD2   1 
ATOM   9749  N  N     . GLU B 1 633 ? -0.232  209.353 13.399  1.00 55.67  ? 1387 GLU B N     1 
ATOM   9750  C  CA    . GLU B 1 633 ? -1.650  209.615 13.250  1.00 53.28  ? 1387 GLU B CA    1 
ATOM   9751  C  C     . GLU B 1 633 ? -2.438  208.362 13.616  1.00 55.47  ? 1387 GLU B C     1 
ATOM   9752  O  O     . GLU B 1 633 ? -3.477  208.447 14.258  1.00 65.45  ? 1387 GLU B O     1 
ATOM   9753  C  CB    . GLU B 1 633 ? -1.976  210.055 11.821  1.00 53.83  ? 1387 GLU B CB    1 
ATOM   9754  C  CG    . GLU B 1 633 ? -1.381  211.396 11.418  1.00 70.60  ? 1387 GLU B CG    1 
ATOM   9755  C  CD    . GLU B 1 633 ? 0.078   211.312 10.980  1.00 87.40  ? 1387 GLU B CD    1 
ATOM   9756  O  OE1   . GLU B 1 633 ? 0.740   210.293 11.276  1.00 99.51  ? 1387 GLU B OE1   1 
ATOM   9757  O  OE2   . GLU B 1 633 ? 0.561   212.271 10.334  1.00 88.51  ? 1387 GLU B OE2   1 
ATOM   9758  N  N     . VAL B 1 634 ? -1.933  207.198 13.218  1.00 46.79  ? 1388 VAL B N     1 
ATOM   9759  C  CA    . VAL B 1 634 ? -2.648  205.943 13.449  1.00 47.18  ? 1388 VAL B CA    1 
ATOM   9760  C  C     . VAL B 1 634 ? -2.689  205.573 14.933  1.00 59.38  ? 1388 VAL B C     1 
ATOM   9761  O  O     . VAL B 1 634 ? -3.738  205.204 15.465  1.00 72.76  ? 1388 VAL B O     1 
ATOM   9762  C  CB    . VAL B 1 634 ? -2.042  204.798 12.619  1.00 42.72  ? 1388 VAL B CB    1 
ATOM   9763  C  CG1   . VAL B 1 634 ? -2.671  203.478 12.975  1.00 40.96  ? 1388 VAL B CG1   1 
ATOM   9764  C  CG2   . VAL B 1 634 ? -2.245  205.087 11.145  1.00 52.52  ? 1388 VAL B CG2   1 
ATOM   9765  N  N     . ILE B 1 635 ? -1.549  205.678 15.604  1.00 51.30  ? 1389 ILE B N     1 
ATOM   9766  C  CA    . ILE B 1 635 ? -1.524  205.437 17.027  1.00 48.79  ? 1389 ILE B CA    1 
ATOM   9767  C  C     . ILE B 1 635 ? -2.486  206.413 17.719  1.00 54.00  ? 1389 ILE B C     1 
ATOM   9768  O  O     . ILE B 1 635 ? -3.319  206.015 18.543  1.00 49.90  ? 1389 ILE B O     1 
ATOM   9769  C  CB    . ILE B 1 635 ? -0.113  205.582 17.600  1.00 52.05  ? 1389 ILE B CB    1 
ATOM   9770  C  CG1   . ILE B 1 635 ? 0.772   204.451 17.101  1.00 56.39  ? 1389 ILE B CG1   1 
ATOM   9771  C  CG2   . ILE B 1 635 ? -0.146  205.502 19.117  1.00 58.24  ? 1389 ILE B CG2   1 
ATOM   9772  C  CD1   . ILE B 1 635 ? 2.233   204.647 17.456  1.00 56.65  ? 1389 ILE B CD1   1 
ATOM   9773  N  N     . ALA B 1 636 ? -2.387  207.691 17.375  1.00 47.28  ? 1390 ALA B N     1 
ATOM   9774  C  CA    . ALA B 1 636 ? -3.258  208.680 17.998  1.00 45.08  ? 1390 ALA B CA    1 
ATOM   9775  C  C     . ALA B 1 636 ? -4.712  208.276 17.844  1.00 51.59  ? 1390 ALA B C     1 
ATOM   9776  O  O     . ALA B 1 636 ? -5.522  208.431 18.780  1.00 54.72  ? 1390 ALA B O     1 
ATOM   9777  C  CB    . ALA B 1 636 ? -3.046  210.014 17.372  1.00 41.70  ? 1390 ALA B CB    1 
ATOM   9778  N  N     . LEU B 1 637 ? -5.031  207.768 16.650  1.00 53.15  ? 1391 LEU B N     1 
ATOM   9779  C  CA    . LEU B 1 637 ? -6.399  207.460 16.276  1.00 52.68  ? 1391 LEU B CA    1 
ATOM   9780  C  C     . LEU B 1 637 ? -6.881  206.205 16.997  1.00 51.52  ? 1391 LEU B C     1 
ATOM   9781  O  O     . LEU B 1 637 ? -8.027  206.136 17.461  1.00 57.09  ? 1391 LEU B O     1 
ATOM   9782  C  CB    . LEU B 1 637 ? -6.516  207.322 14.762  1.00 51.01  ? 1391 LEU B CB    1 
ATOM   9783  C  CG    . LEU B 1 637 ? -7.809  206.822 14.122  1.00 50.78  ? 1391 LEU B CG    1 
ATOM   9784  C  CD1   . LEU B 1 637 ? -7.713  207.038 12.640  1.00 57.86  ? 1391 LEU B CD1   1 
ATOM   9785  C  CD2   . LEU B 1 637 ? -7.935  205.348 14.394  1.00 56.10  ? 1391 LEU B CD2   1 
ATOM   9786  N  N     . ILE B 1 638 ? -6.005  205.219 17.108  1.00 41.18  ? 1392 ILE B N     1 
ATOM   9787  C  CA    . ILE B 1 638 ? -6.336  204.047 17.891  1.00 46.46  ? 1392 ILE B CA    1 
ATOM   9788  C  C     . ILE B 1 638 ? -6.504  204.400 19.384  1.00 60.66  ? 1392 ILE B C     1 
ATOM   9789  O  O     . ILE B 1 638 ? -7.446  203.933 20.036  1.00 64.14  ? 1392 ILE B O     1 
ATOM   9790  C  CB    . ILE B 1 638 ? -5.280  202.973 17.708  1.00 38.19  ? 1392 ILE B CB    1 
ATOM   9791  C  CG1   . ILE B 1 638 ? -5.241  202.525 16.261  1.00 36.78  ? 1392 ILE B CG1   1 
ATOM   9792  C  CG2   . ILE B 1 638 ? -5.553  201.770 18.594  1.00 44.51  ? 1392 ILE B CG2   1 
ATOM   9793  C  CD1   . ILE B 1 638 ? -4.382  201.341 16.083  1.00 45.05  ? 1392 ILE B CD1   1 
ATOM   9794  N  N     . ARG B 1 639 ? -5.601  205.226 19.918  1.00 64.38  ? 1393 ARG B N     1 
ATOM   9795  C  CA    . ARG B 1 639 ? -5.718  205.695 21.300  1.00 69.57  ? 1393 ARG B CA    1 
ATOM   9796  C  C     . ARG B 1 639 ? -7.069  206.354 21.491  1.00 70.39  ? 1393 ARG B C     1 
ATOM   9797  O  O     . ARG B 1 639 ? -7.616  206.368 22.592  1.00 80.10  ? 1393 ARG B O     1 
ATOM   9798  C  CB    . ARG B 1 639 ? -4.646  206.740 21.649  1.00 70.84  ? 1393 ARG B CB    1 
ATOM   9799  C  CG    . ARG B 1 639 ? -3.365  206.214 22.292  1.00 67.19  ? 1393 ARG B CG    1 
ATOM   9800  C  CD    . ARG B 1 639 ? -3.065  206.945 23.604  1.00 59.62  ? 1393 ARG B CD    1 
ATOM   9801  N  NE    . ARG B 1 639 ? -4.059  206.558 24.594  1.00 70.96  ? 1393 ARG B NE    1 
ATOM   9802  C  CZ    . ARG B 1 639 ? -4.214  207.131 25.778  1.00 84.55  ? 1393 ARG B CZ    1 
ATOM   9803  N  NH1   . ARG B 1 639 ? -5.171  206.692 26.588  1.00 94.06  ? 1393 ARG B NH1   1 
ATOM   9804  N  NH2   . ARG B 1 639 ? -3.428  208.139 26.146  1.00 82.08  ? 1393 ARG B NH2   1 
ATOM   9805  N  N     . ALA B 1 640 ? -7.596  206.918 20.412  1.00 58.86  ? 1394 ALA B N     1 
ATOM   9806  C  CA    . ALA B 1 640 ? -8.784  207.738 20.512  1.00 60.56  ? 1394 ALA B CA    1 
ATOM   9807  C  C     . ALA B 1 640 ? -10.059 206.922 20.418  1.00 59.47  ? 1394 ALA B C     1 
ATOM   9808  O  O     . ALA B 1 640 ? -11.144 207.447 20.678  1.00 67.69  ? 1394 ALA B O     1 
ATOM   9809  C  CB    . ALA B 1 640 ? -8.767  208.828 19.452  1.00 44.90  ? 1394 ALA B CB    1 
ATOM   9810  N  N     . SER B 1 641 ? -9.937  205.646 20.058  1.00 46.42  ? 1395 SER B N     1 
ATOM   9811  C  CA    . SER B 1 641 ? -11.117 204.813 19.846  1.00 53.70  ? 1395 SER B CA    1 
ATOM   9812  C  C     . SER B 1 641 ? -11.569 204.196 21.165  1.00 67.14  ? 1395 SER B C     1 
ATOM   9813  O  O     . SER B 1 641 ? -10.856 204.286 22.163  1.00 77.11  ? 1395 SER B O     1 
ATOM   9814  C  CB    . SER B 1 641 ? -10.819 203.736 18.811  1.00 53.57  ? 1395 SER B CB    1 
ATOM   9815  O  OG    . SER B 1 641 ? -10.098 204.292 17.716  1.00 53.17  ? 1395 SER B OG    1 
ATOM   9816  N  N     . GLU B 1 642 ? -12.751 203.588 21.195  1.00 62.83  ? 1396 GLU B N     1 
ATOM   9817  C  CA    . GLU B 1 642 ? -13.267 203.050 22.454  1.00 63.09  ? 1396 GLU B CA    1 
ATOM   9818  C  C     . GLU B 1 642 ? -12.793 201.624 22.701  1.00 71.94  ? 1396 GLU B C     1 
ATOM   9819  O  O     . GLU B 1 642 ? -12.575 201.217 23.845  1.00 77.94  ? 1396 GLU B O     1 
ATOM   9820  C  CB    . GLU B 1 642 ? -14.797 203.101 22.498  1.00 68.90  ? 1396 GLU B CB    1 
ATOM   9821  C  CG    . GLU B 1 642 ? -15.400 204.505 22.595  1.00 81.68  ? 1396 GLU B CG    1 
ATOM   9822  C  CD    . GLU B 1 642 ? -15.391 205.103 24.009  1.00 90.39  ? 1396 GLU B CD    1 
ATOM   9823  O  OE1   . GLU B 1 642 ? -16.371 205.802 24.363  1.00 91.66  ? 1396 GLU B OE1   1 
ATOM   9824  O  OE2   . GLU B 1 642 ? -14.405 204.904 24.755  1.00 94.84  ? 1396 GLU B OE2   1 
ATOM   9825  N  N     . ASN B 1 643 ? -12.622 200.875 21.617  1.00 72.90  ? 1397 ASN B N     1 
ATOM   9826  C  CA    . ASN B 1 643 ? -12.330 199.447 21.687  1.00 71.34  ? 1397 ASN B CA    1 
ATOM   9827  C  C     . ASN B 1 643 ? -11.850 198.936 20.338  1.00 69.32  ? 1397 ASN B C     1 
ATOM   9828  O  O     . ASN B 1 643 ? -11.632 199.719 19.410  1.00 69.83  ? 1397 ASN B O     1 
ATOM   9829  C  CB    . ASN B 1 643 ? -13.593 198.687 22.055  1.00 71.66  ? 1397 ASN B CB    1 
ATOM   9830  C  CG    . ASN B 1 643 ? -14.722 198.943 21.079  1.00 72.40  ? 1397 ASN B CG    1 
ATOM   9831  O  OD1   . ASN B 1 643 ? -14.858 198.242 20.081  1.00 82.24  ? 1397 ASN B OD1   1 
ATOM   9832  N  ND2   . ASN B 1 643 ? -15.524 199.962 21.353  1.00 68.25  ? 1397 ASN B ND2   1 
ATOM   9833  N  N     . LYS B 1 644 ? -11.727 197.619 20.215  1.00 66.57  ? 1398 LYS B N     1 
ATOM   9834  C  CA    . LYS B 1 644 ? -11.242 197.045 18.971  1.00 58.22  ? 1398 LYS B CA    1 
ATOM   9835  C  C     . LYS B 1 644 ? -12.083 197.477 17.766  1.00 60.20  ? 1398 LYS B C     1 
ATOM   9836  O  O     . LYS B 1 644 ? -11.568 198.089 16.837  1.00 54.63  ? 1398 LYS B O     1 
ATOM   9837  C  CB    . LYS B 1 644 ? -11.125 195.513 19.052  1.00 48.64  ? 1398 LYS B CB    1 
ATOM   9838  C  CG    . LYS B 1 644 ? -9.993  194.955 18.204  1.00 43.59  ? 1398 LYS B CG    1 
ATOM   9839  C  CD    . LYS B 1 644 ? -9.784  193.475 18.392  1.00 57.93  ? 1398 LYS B CD    1 
ATOM   9840  C  CE    . LYS B 1 644 ? -9.633  192.759 17.060  1.00 62.40  ? 1398 LYS B CE    1 
ATOM   9841  N  NZ    . LYS B 1 644 ? -9.456  191.308 17.265  1.00 68.88  ? 1398 LYS B NZ    1 
ATOM   9842  N  N     . ALA B 1 645 ? -13.376 197.168 17.777  1.00 63.01  ? 1399 ALA B N     1 
ATOM   9843  C  CA    . ALA B 1 645 ? -14.191 197.404 16.591  1.00 60.37  ? 1399 ALA B CA    1 
ATOM   9844  C  C     . ALA B 1 645 ? -14.146 198.866 16.222  1.00 63.23  ? 1399 ALA B C     1 
ATOM   9845  O  O     . ALA B 1 645 ? -13.934 199.224 15.045  1.00 63.16  ? 1399 ALA B O     1 
ATOM   9846  C  CB    . ALA B 1 645 ? -15.588 196.982 16.818  1.00 51.31  ? 1399 ALA B CB    1 
ATOM   9847  N  N     . ASP B 1 646 ? -14.341 199.710 17.231  1.00 55.74  ? 1400 ASP B N     1 
ATOM   9848  C  CA    . ASP B 1 646 ? -14.321 201.144 17.005  1.00 58.27  ? 1400 ASP B CA    1 
ATOM   9849  C  C     . ASP B 1 646 ? -13.022 201.597 16.331  1.00 58.59  ? 1400 ASP B C     1 
ATOM   9850  O  O     . ASP B 1 646 ? -13.025 202.493 15.486  1.00 59.04  ? 1400 ASP B O     1 
ATOM   9851  C  CB    . ASP B 1 646 ? -14.519 201.892 18.313  1.00 67.25  ? 1400 ASP B CB    1 
ATOM   9852  C  CG    . ASP B 1 646 ? -14.821 203.367 18.095  1.00 73.89  ? 1400 ASP B CG    1 
ATOM   9853  O  OD1   . ASP B 1 646 ? -15.710 203.687 17.258  1.00 64.88  ? 1400 ASP B OD1   1 
ATOM   9854  O  OD2   . ASP B 1 646 ? -14.154 204.198 18.757  1.00 79.51  ? 1400 ASP B OD2   1 
ATOM   9855  N  N     . ALA B 1 647 ? -11.909 200.976 16.705  1.00 58.19  ? 1401 ALA B N     1 
ATOM   9856  C  CA    . ALA B 1 647 ? -10.620 201.328 16.127  1.00 52.29  ? 1401 ALA B CA    1 
ATOM   9857  C  C     . ALA B 1 647 ? -10.592 200.979 14.643  1.00 60.99  ? 1401 ALA B C     1 
ATOM   9858  O  O     . ALA B 1 647 ? -10.133 201.766 13.822  1.00 70.80  ? 1401 ALA B O     1 
ATOM   9859  C  CB    . ALA B 1 647 ? -9.494  200.630 16.867  1.00 41.43  ? 1401 ALA B CB    1 
ATOM   9860  N  N     . LYS B 1 648 ? -11.099 199.803 14.295  1.00 55.59  ? 1402 LYS B N     1 
ATOM   9861  C  CA    . LYS B 1 648 ? -11.159 199.417 12.896  1.00 47.76  ? 1402 LYS B CA    1 
ATOM   9862  C  C     . LYS B 1 648 ? -12.060 200.347 12.062  1.00 49.20  ? 1402 LYS B C     1 
ATOM   9863  O  O     . LYS B 1 648 ? -11.646 200.817 11.012  1.00 48.22  ? 1402 LYS B O     1 
ATOM   9864  C  CB    . LYS B 1 648 ? -11.539 197.945 12.762  1.00 39.80  ? 1402 LYS B CB    1 
ATOM   9865  C  CG    . LYS B 1 648 ? -10.589 197.072 13.542  1.00 44.99  ? 1402 LYS B CG    1 
ATOM   9866  C  CD    . LYS B 1 648 ? -10.558 195.653 13.055  1.00 50.00  ? 1402 LYS B CD    1 
ATOM   9867  C  CE    . LYS B 1 648 ? -11.949 195.093 12.865  1.00 56.70  ? 1402 LYS B CE    1 
ATOM   9868  N  NZ    . LYS B 1 648 ? -11.823 193.641 12.549  1.00 60.99  ? 1402 LYS B NZ    1 
ATOM   9869  N  N     . GLU B 1 649 ? -13.270 200.644 12.525  1.00 49.69  ? 1403 GLU B N     1 
ATOM   9870  C  CA    . GLU B 1 649 ? -14.100 201.558 11.754  1.00 58.44  ? 1403 GLU B CA    1 
ATOM   9871  C  C     . GLU B 1 649 ? -13.347 202.885 11.544  1.00 59.74  ? 1403 GLU B C     1 
ATOM   9872  O  O     . GLU B 1 649 ? -13.327 203.440 10.441  1.00 63.58  ? 1403 GLU B O     1 
ATOM   9873  C  CB    . GLU B 1 649 ? -15.483 201.763 12.389  1.00 48.41  ? 1403 GLU B CB    1 
ATOM   9874  N  N     . ASN B 1 650 ? -12.705 203.397 12.583  1.00 58.63  ? 1404 ASN B N     1 
ATOM   9875  C  CA    . ASN B 1 650 ? -12.017 204.673 12.411  1.00 57.85  ? 1404 ASN B CA    1 
ATOM   9876  C  C     . ASN B 1 650 ? -10.883 204.535 11.406  1.00 53.07  ? 1404 ASN B C     1 
ATOM   9877  O  O     . ASN B 1 650 ? -10.590 205.464 10.676  1.00 57.59  ? 1404 ASN B O     1 
ATOM   9878  C  CB    . ASN B 1 650 ? -11.505 205.232 13.741  1.00 57.23  ? 1404 ASN B CB    1 
ATOM   9879  C  CG    . ASN B 1 650 ? -12.622 205.763 14.621  1.00 68.64  ? 1404 ASN B CG    1 
ATOM   9880  O  OD1   . ASN B 1 650 ? -13.537 206.448 14.164  1.00 67.07  ? 1404 ASN B OD1   1 
ATOM   9881  N  ND2   . ASN B 1 650 ? -12.546 205.448 15.896  1.00 80.37  ? 1404 ASN B ND2   1 
ATOM   9882  N  N     . LEU B 1 651 ? -10.259 203.361 11.368  1.00 48.76  ? 1405 LEU B N     1 
ATOM   9883  C  CA    . LEU B 1 651 ? -9.172  203.101 10.436  1.00 45.71  ? 1405 LEU B CA    1 
ATOM   9884  C  C     . LEU B 1 651 ? -9.701  203.101 9.000   1.00 54.14  ? 1405 LEU B C     1 
ATOM   9885  O  O     . LEU B 1 651 ? -9.123  203.738 8.107   1.00 56.57  ? 1405 LEU B O     1 
ATOM   9886  C  CB    . LEU B 1 651 ? -8.493  201.765 10.751  1.00 34.27  ? 1405 LEU B CB    1 
ATOM   9887  C  CG    . LEU B 1 651 ? -7.330  201.865 11.735  1.00 38.59  ? 1405 LEU B CG    1 
ATOM   9888  C  CD1   . LEU B 1 651 ? -6.623  200.536 11.821  1.00 44.50  ? 1405 LEU B CD1   1 
ATOM   9889  C  CD2   . LEU B 1 651 ? -6.348  202.964 11.340  1.00 33.18  ? 1405 LEU B CD2   1 
ATOM   9890  N  N     . LYS B 1 652 ? -10.802 202.381 8.790   1.00 54.95  ? 1406 LYS B N     1 
ATOM   9891  C  CA    . LYS B 1 652 ? -11.473 202.347 7.503   1.00 48.56  ? 1406 LYS B CA    1 
ATOM   9892  C  C     . LYS B 1 652 ? -11.914 203.754 7.079   1.00 56.52  ? 1406 LYS B C     1 
ATOM   9893  O  O     . LYS B 1 652 ? -11.512 204.253 6.018   1.00 68.01  ? 1406 LYS B O     1 
ATOM   9894  C  CB    . LYS B 1 652 ? -12.678 201.427 7.574   1.00 45.12  ? 1406 LYS B CB    1 
ATOM   9895  C  CG    . LYS B 1 652 ? -12.367 199.983 7.951   1.00 48.21  ? 1406 LYS B CG    1 
ATOM   9896  C  CD    . LYS B 1 652 ? -13.648 199.162 7.839   1.00 62.78  ? 1406 LYS B CD    1 
ATOM   9897  C  CE    . LYS B 1 652 ? -13.464 197.706 8.199   1.00 75.76  ? 1406 LYS B CE    1 
ATOM   9898  N  NZ    . LYS B 1 652 ? -14.760 196.974 8.042   1.00 87.61  ? 1406 LYS B NZ    1 
ATOM   9899  N  N     . VAL B 1 653 ? -12.727 204.399 7.913   1.00 51.08  ? 1407 VAL B N     1 
ATOM   9900  C  CA    . VAL B 1 653 ? -13.287 205.707 7.574   1.00 51.95  ? 1407 VAL B CA    1 
ATOM   9901  C  C     . VAL B 1 653 ? -12.239 206.829 7.417   1.00 51.02  ? 1407 VAL B C     1 
ATOM   9902  O  O     . VAL B 1 653 ? -12.348 207.699 6.571   1.00 52.79  ? 1407 VAL B O     1 
ATOM   9903  C  CB    . VAL B 1 653 ? -14.337 206.129 8.609   1.00 52.63  ? 1407 VAL B CB    1 
ATOM   9904  C  CG1   . VAL B 1 653 ? -14.755 207.553 8.368   1.00 51.27  ? 1407 VAL B CG1   1 
ATOM   9905  C  CG2   . VAL B 1 653 ? -15.537 205.188 8.581   1.00 52.48  ? 1407 VAL B CG2   1 
ATOM   9906  N  N     . SER B 1 654 ? -11.205 206.815 8.227   1.00 50.59  ? 1408 SER B N     1 
ATOM   9907  C  CA    . SER B 1 654 ? -10.298 207.939 8.178   1.00 54.18  ? 1408 SER B CA    1 
ATOM   9908  C  C     . SER B 1 654 ? -9.235  207.762 7.103   1.00 53.31  ? 1408 SER B C     1 
ATOM   9909  O  O     . SER B 1 654 ? -8.751  208.738 6.563   1.00 60.54  ? 1408 SER B O     1 
ATOM   9910  C  CB    . SER B 1 654 ? -9.663  208.184 9.560   1.00 56.27  ? 1408 SER B CB    1 
ATOM   9911  O  OG    . SER B 1 654 ? -10.628 208.674 10.495  1.00 61.51  ? 1408 SER B OG    1 
ATOM   9912  N  N     . TYR B 1 655 ? -8.867  206.522 6.803   1.00 52.34  ? 1409 TYR B N     1 
ATOM   9913  C  CA    . TYR B 1 655 ? -7.753  206.259 5.886   1.00 51.14  ? 1409 TYR B CA    1 
ATOM   9914  C  C     . TYR B 1 655 ? -8.036  205.210 4.806   1.00 59.50  ? 1409 TYR B C     1 
ATOM   9915  O  O     . TYR B 1 655 ? -7.126  204.770 4.117   1.00 63.09  ? 1409 TYR B O     1 
ATOM   9916  C  CB    . TYR B 1 655 ? -6.514  205.852 6.675   1.00 47.92  ? 1409 TYR B CB    1 
ATOM   9917  C  CG    . TYR B 1 655 ? -6.026  206.967 7.539   1.00 53.40  ? 1409 TYR B CG    1 
ATOM   9918  C  CD1   . TYR B 1 655 ? -5.313  208.010 6.987   1.00 54.31  ? 1409 TYR B CD1   1 
ATOM   9919  C  CD2   . TYR B 1 655 ? -6.305  206.997 8.906   1.00 57.93  ? 1409 TYR B CD2   1 
ATOM   9920  C  CE1   . TYR B 1 655 ? -4.879  209.043 7.750   1.00 61.51  ? 1409 TYR B CE1   1 
ATOM   9921  C  CE2   . TYR B 1 655 ? -5.863  208.026 9.691   1.00 61.73  ? 1409 TYR B CE2   1 
ATOM   9922  C  CZ    . TYR B 1 655 ? -5.151  209.060 9.106   1.00 67.48  ? 1409 TYR B CZ    1 
ATOM   9923  O  OH    . TYR B 1 655 ? -4.687  210.124 9.853   1.00 73.18  ? 1409 TYR B OH    1 
ATOM   9924  N  N     . ASP B 1 656 ? -9.292  204.812 4.661   1.00 60.74  ? 1410 ASP B N     1 
ATOM   9925  C  CA    . ASP B 1 656 ? -9.656  203.847 3.640   1.00 62.27  ? 1410 ASP B CA    1 
ATOM   9926  C  C     . ASP B 1 656 ? -8.882  202.545 3.680   1.00 54.61  ? 1410 ASP B C     1 
ATOM   9927  O  O     . ASP B 1 656 ? -8.644  201.958 2.631   1.00 66.09  ? 1410 ASP B O     1 
ATOM   9928  C  CB    . ASP B 1 656 ? -9.495  204.453 2.249   1.00 81.06  ? 1410 ASP B CB    1 
ATOM   9929  C  CG    . ASP B 1 656 ? -10.570 205.455 1.927   1.00 113.71 ? 1410 ASP B CG    1 
ATOM   9930  O  OD1   . ASP B 1 656 ? -11.718 205.025 1.682   1.00 126.75 ? 1410 ASP B OD1   1 
ATOM   9931  O  OD2   . ASP B 1 656 ? -10.269 206.671 1.910   1.00 126.12 ? 1410 ASP B OD2   1 
ATOM   9932  N  N     . PHE B 1 657 ? -8.485  202.068 4.852   1.00 40.05  ? 1411 PHE B N     1 
ATOM   9933  C  CA    . PHE B 1 657 ? -7.986  200.689 4.890   1.00 41.11  ? 1411 PHE B CA    1 
ATOM   9934  C  C     . PHE B 1 657 ? -9.187  199.775 4.752   1.00 40.53  ? 1411 PHE B C     1 
ATOM   9935  O  O     . PHE B 1 657 ? -10.313 200.196 5.012   1.00 52.07  ? 1411 PHE B O     1 
ATOM   9936  C  CB    . PHE B 1 657 ? -7.244  200.363 6.177   1.00 42.72  ? 1411 PHE B CB    1 
ATOM   9937  C  CG    . PHE B 1 657 ? -5.932  201.089 6.341   1.00 44.24  ? 1411 PHE B CG    1 
ATOM   9938  C  CD1   . PHE B 1 657 ? -4.765  200.572 5.797   1.00 39.66  ? 1411 PHE B CD1   1 
ATOM   9939  C  CD2   . PHE B 1 657 ? -5.860  202.270 7.075   1.00 46.24  ? 1411 PHE B CD2   1 
ATOM   9940  C  CE1   . PHE B 1 657 ? -3.536  201.226 5.959   1.00 37.42  ? 1411 PHE B CE1   1 
ATOM   9941  C  CE2   . PHE B 1 657 ? -4.644  202.933 7.238   1.00 48.61  ? 1411 PHE B CE2   1 
ATOM   9942  C  CZ    . PHE B 1 657 ? -3.480  202.403 6.669   1.00 44.55  ? 1411 PHE B CZ    1 
ATOM   9943  N  N     . THR B 1 658 ? -8.954  198.543 4.310   1.00 40.74  ? 1412 THR B N     1 
ATOM   9944  C  CA    . THR B 1 658 ? -10.004 197.522 4.268   1.00 48.60  ? 1412 THR B CA    1 
ATOM   9945  C  C     . THR B 1 658 ? -10.111 196.794 5.620   1.00 51.69  ? 1412 THR B C     1 
ATOM   9946  O  O     . THR B 1 658 ? -9.196  196.852 6.455   1.00 45.70  ? 1412 THR B O     1 
ATOM   9947  C  CB    . THR B 1 658 ? -9.698  196.452 3.199   1.00 47.20  ? 1412 THR B CB    1 
ATOM   9948  O  OG1   . THR B 1 658 ? -8.725  195.517 3.699   1.00 53.95  ? 1412 THR B OG1   1 
ATOM   9949  C  CG2   . THR B 1 658 ? -9.136  197.085 2.015   1.00 36.88  ? 1412 THR B CG2   1 
ATOM   9950  N  N     . GLU B 1 659 ? -11.215 196.089 5.821   1.00 50.63  ? 1413 GLU B N     1 
ATOM   9951  C  CA    . GLU B 1 659 ? -11.367 195.257 7.004   1.00 47.04  ? 1413 GLU B CA    1 
ATOM   9952  C  C     . GLU B 1 659 ? -10.113 194.413 7.264   1.00 51.29  ? 1413 GLU B C     1 
ATOM   9953  O  O     . GLU B 1 659 ? -9.538  194.455 8.362   1.00 58.32  ? 1413 GLU B O     1 
ATOM   9954  C  CB    . GLU B 1 659 ? -12.607 194.373 6.886   1.00 47.99  ? 1413 GLU B CB    1 
ATOM   9955  C  CG    . GLU B 1 659 ? -12.605 193.166 7.768   1.00 64.97  ? 1413 GLU B CG    1 
ATOM   9956  C  CD    . GLU B 1 659 ? -12.911 193.487 9.224   1.00 80.22  ? 1413 GLU B CD    1 
ATOM   9957  O  OE1   . GLU B 1 659 ? -12.752 192.559 10.058  1.00 87.12  ? 1413 GLU B OE1   1 
ATOM   9958  O  OE2   . GLU B 1 659 ? -13.312 194.644 9.523   1.00 76.65  ? 1413 GLU B OE2   1 
ATOM   9959  N  N     . GLU B 1 660 ? -9.682  193.656 6.262   1.00 49.54  ? 1414 GLU B N     1 
ATOM   9960  C  CA    . GLU B 1 660 ? -8.583  192.716 6.466   1.00 53.81  ? 1414 GLU B CA    1 
ATOM   9961  C  C     . GLU B 1 660 ? -7.292  193.452 6.857   1.00 49.64  ? 1414 GLU B C     1 
ATOM   9962  O  O     . GLU B 1 660 ? -6.507  192.972 7.685   1.00 43.47  ? 1414 GLU B O     1 
ATOM   9963  C  CB    . GLU B 1 660 ? -8.399  191.724 5.283   1.00 44.17  ? 1414 GLU B CB    1 
ATOM   9964  C  CG    . GLU B 1 660 ? -9.014  192.142 3.954   1.00 71.57  ? 1414 GLU B CG    1 
ATOM   9965  C  CD    . GLU B 1 660 ? -10.540 192.083 3.931   1.00 79.59  ? 1414 GLU B CD    1 
ATOM   9966  O  OE1   . GLU B 1 660 ? -11.137 193.050 3.397   1.00 76.65  ? 1414 GLU B OE1   1 
ATOM   9967  O  OE2   . GLU B 1 660 ? -11.130 191.081 4.422   1.00 77.82  ? 1414 GLU B OE2   1 
ATOM   9968  N  N     . GLN B 1 661 ? -7.090  194.636 6.302   1.00 43.52  ? 1415 GLN B N     1 
ATOM   9969  C  CA    . GLN B 1 661 ? -5.944  195.423 6.715   1.00 47.39  ? 1415 GLN B CA    1 
ATOM   9970  C  C     . GLN B 1 661 ? -6.135  195.950 8.138   1.00 51.31  ? 1415 GLN B C     1 
ATOM   9971  O  O     . GLN B 1 661 ? -5.254  195.801 9.001   1.00 49.73  ? 1415 GLN B O     1 
ATOM   9972  C  CB    . GLN B 1 661 ? -5.710  196.564 5.739   1.00 53.18  ? 1415 GLN B CB    1 
ATOM   9973  C  CG    . GLN B 1 661 ? -5.030  196.101 4.490   1.00 58.86  ? 1415 GLN B CG    1 
ATOM   9974  C  CD    . GLN B 1 661 ? -5.146  197.073 3.349   1.00 53.60  ? 1415 GLN B CD    1 
ATOM   9975  O  OE1   . GLN B 1 661 ? -6.020  197.942 3.325   1.00 54.92  ? 1415 GLN B OE1   1 
ATOM   9976  N  NE2   . GLN B 1 661 ? -4.264  196.924 2.385   1.00 47.32  ? 1415 GLN B NE2   1 
ATOM   9977  N  N     . ALA B 1 662 ? -7.289  196.570 8.377   1.00 49.81  ? 1416 ALA B N     1 
ATOM   9978  C  CA    . ALA B 1 662 ? -7.596  197.105 9.694   1.00 44.59  ? 1416 ALA B CA    1 
ATOM   9979  C  C     . ALA B 1 662 ? -7.366  196.054 10.791  1.00 48.91  ? 1416 ALA B C     1 
ATOM   9980  O  O     . ALA B 1 662 ? -6.677  196.333 11.776  1.00 51.87  ? 1416 ALA B O     1 
ATOM   9981  C  CB    . ALA B 1 662 ? -8.989  197.628 9.733   1.00 42.74  ? 1416 ALA B CB    1 
ATOM   9982  N  N     . GLU B 1 663 ? -7.904  194.845 10.615  1.00 44.67  ? 1417 GLU B N     1 
ATOM   9983  C  CA    . GLU B 1 663 ? -7.630  193.780 11.583  1.00 47.99  ? 1417 GLU B CA    1 
ATOM   9984  C  C     . GLU B 1 663 ? -6.145  193.544 11.755  1.00 52.37  ? 1417 GLU B C     1 
ATOM   9985  O  O     . GLU B 1 663 ? -5.638  193.535 12.873  1.00 61.56  ? 1417 GLU B O     1 
ATOM   9986  C  CB    . GLU B 1 663 ? -8.278  192.469 11.202  1.00 33.08  ? 1417 GLU B CB    1 
ATOM   9987  C  CG    . GLU B 1 663 ? -8.012  191.388 12.213  1.00 54.86  ? 1417 GLU B CG    1 
ATOM   9988  C  CD    . GLU B 1 663 ? -9.000  191.405 13.383  1.00 71.10  ? 1417 GLU B CD    1 
ATOM   9989  O  OE1   . GLU B 1 663 ? -9.983  192.196 13.336  1.00 70.44  ? 1417 GLU B OE1   1 
ATOM   9990  O  OE2   . GLU B 1 663 ? -8.785  190.617 14.342  1.00 75.04  ? 1417 GLU B OE2   1 
ATOM   9991  N  N     . ALA B 1 664 ? -5.440  193.358 10.649  1.00 49.64  ? 1418 ALA B N     1 
ATOM   9992  C  CA    . ALA B 1 664 ? -3.989  193.203 10.720  1.00 48.59  ? 1418 ALA B CA    1 
ATOM   9993  C  C     . ALA B 1 664 ? -3.278  194.299 11.536  1.00 51.37  ? 1418 ALA B C     1 
ATOM   9994  O  O     . ALA B 1 664 ? -2.448  193.996 12.403  1.00 57.85  ? 1418 ALA B O     1 
ATOM   9995  C  CB    . ALA B 1 664 ? -3.390  193.114 9.334   1.00 40.51  ? 1418 ALA B CB    1 
ATOM   9996  N  N     . ILE B 1 665 ? -3.591  195.557 11.242  1.00 41.08  ? 1419 ILE B N     1 
ATOM   9997  C  CA    . ILE B 1 665 ? -2.924  196.689 11.874  1.00 44.73  ? 1419 ILE B CA    1 
ATOM   9998  C  C     . ILE B 1 665 ? -3.221  196.711 13.370  1.00 53.42  ? 1419 ILE B C     1 
ATOM   9999  O  O     . ILE B 1 665 ? -2.334  196.775 14.221  1.00 58.68  ? 1419 ILE B O     1 
ATOM   10000 C  CB    . ILE B 1 665 ? -3.429  198.017 11.275  1.00 42.15  ? 1419 ILE B CB    1 
ATOM   10001 C  CG1   . ILE B 1 665 ? -3.141  198.087 9.773   1.00 41.70  ? 1419 ILE B CG1   1 
ATOM   10002 C  CG2   . ILE B 1 665 ? -2.799  199.179 11.971  1.00 23.88  ? 1419 ILE B CG2   1 
ATOM   10003 C  CD1   . ILE B 1 665 ? -3.529  199.401 9.147   1.00 44.23  ? 1419 ILE B CD1   1 
ATOM   10004 N  N     . VAL B 1 666 ? -4.492  196.628 13.685  1.00 49.15  ? 1420 VAL B N     1 
ATOM   10005 C  CA    . VAL B 1 666 ? -4.947  196.747 15.050  1.00 36.59  ? 1420 VAL B CA    1 
ATOM   10006 C  C     . VAL B 1 666 ? -4.530  195.593 15.977  1.00 41.50  ? 1420 VAL B C     1 
ATOM   10007 O  O     . VAL B 1 666 ? -4.670  195.701 17.202  1.00 51.01  ? 1420 VAL B O     1 
ATOM   10008 C  CB    . VAL B 1 666 ? -6.457  196.900 15.014  1.00 37.78  ? 1420 VAL B CB    1 
ATOM   10009 C  CG1   . VAL B 1 666 ? -7.156  195.757 15.731  1.00 30.85  ? 1420 VAL B CG1   1 
ATOM   10010 C  CG2   . VAL B 1 666 ? -6.842  198.308 15.455  1.00 35.04  ? 1420 VAL B CG2   1 
ATOM   10011 N  N     . THR B 1 667 ? -3.994  194.510 15.409  1.00 40.38  ? 1421 THR B N     1 
ATOM   10012 C  CA    . THR B 1 667 ? -3.592  193.350 16.205  1.00 40.47  ? 1421 THR B CA    1 
ATOM   10013 C  C     . THR B 1 667 ? -2.084  193.105 16.168  1.00 46.10  ? 1421 THR B C     1 
ATOM   10014 O  O     . THR B 1 667 ? -1.627  192.035 16.603  1.00 48.26  ? 1421 THR B O     1 
ATOM   10015 C  CB    . THR B 1 667 ? -4.322  192.044 15.782  1.00 42.54  ? 1421 THR B CB    1 
ATOM   10016 O  OG1   . THR B 1 667 ? -3.923  191.660 14.458  1.00 49.96  ? 1421 THR B OG1   1 
ATOM   10017 C  CG2   . THR B 1 667 ? -5.812  192.236 15.772  1.00 53.68  ? 1421 THR B CG2   1 
ATOM   10018 N  N     . LEU B 1 668 ? -1.319  194.070 15.645  1.00 43.28  ? 1422 LEU B N     1 
ATOM   10019 C  CA    . LEU B 1 668 ? 0.148   194.025 15.754  1.00 50.88  ? 1422 LEU B CA    1 
ATOM   10020 C  C     . LEU B 1 668 ? 0.495   194.154 17.245  1.00 54.69  ? 1422 LEU B C     1 
ATOM   10021 O  O     . LEU B 1 668 ? -0.175  194.909 17.967  1.00 57.98  ? 1422 LEU B O     1 
ATOM   10022 C  CB    . LEU B 1 668 ? 0.826   195.179 14.980  1.00 39.32  ? 1422 LEU B CB    1 
ATOM   10023 C  CG    . LEU B 1 668 ? 0.693   195.388 13.463  1.00 42.09  ? 1422 LEU B CG    1 
ATOM   10024 C  CD1   . LEU B 1 668 ? 1.168   196.793 12.997  1.00 27.29  ? 1422 LEU B CD1   1 
ATOM   10025 C  CD2   . LEU B 1 668 ? 1.459   194.335 12.737  1.00 42.73  ? 1422 LEU B CD2   1 
ATOM   10026 N  N     . GLN B 1 669 ? 1.527   193.447 17.714  1.00 49.35  ? 1423 GLN B N     1 
ATOM   10027 C  CA    . GLN B 1 669 ? 1.994   193.667 19.091  1.00 51.34  ? 1423 GLN B CA    1 
ATOM   10028 C  C     . GLN B 1 669 ? 2.837   194.946 19.171  1.00 53.03  ? 1423 GLN B C     1 
ATOM   10029 O  O     . GLN B 1 669 ? 3.452   195.335 18.188  1.00 41.66  ? 1423 GLN B O     1 
ATOM   10030 C  CB    . GLN B 1 669 ? 2.772   192.468 19.619  1.00 43.43  ? 1423 GLN B CB    1 
ATOM   10031 C  CG    . GLN B 1 669 ? 1.970   191.199 19.673  1.00 43.96  ? 1423 GLN B CG    1 
ATOM   10032 C  CD    . GLN B 1 669 ? 2.850   189.983 19.751  1.00 60.11  ? 1423 GLN B CD    1 
ATOM   10033 O  OE1   . GLN B 1 669 ? 3.015   189.403 20.812  1.00 74.78  ? 1423 GLN B OE1   1 
ATOM   10034 N  NE2   . GLN B 1 669 ? 3.436   189.594 18.624  1.00 66.05  ? 1423 GLN B NE2   1 
ATOM   10035 N  N     . LEU B 1 670 ? 2.850   195.607 20.331  1.00 58.17  ? 1424 LEU B N     1 
ATOM   10036 C  CA    . LEU B 1 670 ? 3.550   196.891 20.471  1.00 52.60  ? 1424 LEU B CA    1 
ATOM   10037 C  C     . LEU B 1 670 ? 4.977   196.880 19.930  1.00 56.41  ? 1424 LEU B C     1 
ATOM   10038 O  O     . LEU B 1 670 ? 5.410   197.848 19.310  1.00 63.48  ? 1424 LEU B O     1 
ATOM   10039 C  CB    . LEU B 1 670 ? 3.571   197.355 21.927  1.00 49.93  ? 1424 LEU B CB    1 
ATOM   10040 C  CG    . LEU B 1 670 ? 2.259   197.933 22.429  1.00 52.66  ? 1424 LEU B CG    1 
ATOM   10041 C  CD1   . LEU B 1 670 ? 2.393   198.460 23.852  1.00 44.95  ? 1424 LEU B CD1   1 
ATOM   10042 C  CD2   . LEU B 1 670 ? 1.815   199.025 21.475  1.00 57.78  ? 1424 LEU B CD2   1 
ATOM   10043 N  N     . TYR B 1 671 ? 5.718   195.799 20.165  1.00 51.22  ? 1425 TYR B N     1 
ATOM   10044 C  CA    . TYR B 1 671 ? 7.125   195.812 19.803  1.00 54.28  ? 1425 TYR B CA    1 
ATOM   10045 C  C     . TYR B 1 671 ? 7.318   196.069 18.311  1.00 61.43  ? 1425 TYR B C     1 
ATOM   10046 O  O     . TYR B 1 671 ? 8.342   196.615 17.903  1.00 61.69  ? 1425 TYR B O     1 
ATOM   10047 C  CB    . TYR B 1 671 ? 7.864   194.552 20.273  1.00 57.40  ? 1425 TYR B CB    1 
ATOM   10048 C  CG    . TYR B 1 671 ? 7.566   193.273 19.533  1.00 62.32  ? 1425 TYR B CG    1 
ATOM   10049 C  CD1   . TYR B 1 671 ? 8.210   192.966 18.351  1.00 55.32  ? 1425 TYR B CD1   1 
ATOM   10050 C  CD2   . TYR B 1 671 ? 6.678   192.342 20.057  1.00 73.99  ? 1425 TYR B CD2   1 
ATOM   10051 C  CE1   . TYR B 1 671 ? 7.954   191.777 17.691  1.00 63.47  ? 1425 TYR B CE1   1 
ATOM   10052 C  CE2   . TYR B 1 671 ? 6.412   191.153 19.414  1.00 75.05  ? 1425 TYR B CE2   1 
ATOM   10053 C  CZ    . TYR B 1 671 ? 7.051   190.870 18.228  1.00 75.50  ? 1425 TYR B CZ    1 
ATOM   10054 O  OH    . TYR B 1 671 ? 6.769   189.680 17.578  1.00 80.28  ? 1425 TYR B OH    1 
ATOM   10055 N  N     . ARG B 1 672 ? 6.318   195.704 17.512  1.00 60.99  ? 1426 ARG B N     1 
ATOM   10056 C  CA    . ARG B 1 672 ? 6.370   195.945 16.082  1.00 55.79  ? 1426 ARG B CA    1 
ATOM   10057 C  C     . ARG B 1 672 ? 6.651   197.404 15.693  1.00 62.45  ? 1426 ARG B C     1 
ATOM   10058 O  O     . ARG B 1 672 ? 7.319   197.644 14.684  1.00 67.92  ? 1426 ARG B O     1 
ATOM   10059 C  CB    . ARG B 1 672 ? 5.100   195.454 15.408  1.00 50.32  ? 1426 ARG B CB    1 
ATOM   10060 C  CG    . ARG B 1 672 ? 5.030   193.984 15.292  1.00 55.26  ? 1426 ARG B CG    1 
ATOM   10061 C  CD    . ARG B 1 672 ? 6.196   193.489 14.512  1.00 73.09  ? 1426 ARG B CD    1 
ATOM   10062 N  NE    . ARG B 1 672 ? 6.292   192.046 14.653  1.00 79.72  ? 1426 ARG B NE    1 
ATOM   10063 C  CZ    . ARG B 1 672 ? 5.624   191.190 13.899  1.00 74.62  ? 1426 ARG B CZ    1 
ATOM   10064 N  NH1   . ARG B 1 672 ? 4.824   191.646 12.944  1.00 71.47  ? 1426 ARG B NH1   1 
ATOM   10065 N  NH2   . ARG B 1 672 ? 5.762   189.889 14.100  1.00 73.84  ? 1426 ARG B NH2   1 
ATOM   10066 N  N     . LEU B 1 673 ? 6.161   198.372 16.466  1.00 55.17  ? 1427 LEU B N     1 
ATOM   10067 C  CA    . LEU B 1 673 ? 6.512   199.781 16.207  1.00 56.63  ? 1427 LEU B CA    1 
ATOM   10068 C  C     . LEU B 1 673 ? 8.005   200.122 16.343  1.00 68.54  ? 1427 LEU B C     1 
ATOM   10069 O  O     . LEU B 1 673 ? 8.363   201.304 16.481  1.00 72.97  ? 1427 LEU B O     1 
ATOM   10070 C  CB    . LEU B 1 673 ? 5.762   200.714 17.145  1.00 51.69  ? 1427 LEU B CB    1 
ATOM   10071 C  CG    . LEU B 1 673 ? 4.277   200.474 17.299  1.00 53.08  ? 1427 LEU B CG    1 
ATOM   10072 C  CD1   . LEU B 1 673 ? 3.792   201.295 18.489  1.00 52.18  ? 1427 LEU B CD1   1 
ATOM   10073 C  CD2   . LEU B 1 673 ? 3.569   200.854 16.013  1.00 51.83  ? 1427 LEU B CD2   1 
ATOM   10074 N  N     . THR B 1 674 ? 8.867   199.108 16.342  1.00 72.30  ? 1428 THR B N     1 
ATOM   10075 C  CA    . THR B 1 674 ? 10.308  199.342 16.312  1.00 88.28  ? 1428 THR B CA    1 
ATOM   10076 C  C     . THR B 1 674 ? 10.886  198.973 14.945  1.00 102.84 ? 1428 THR B C     1 
ATOM   10077 O  O     . THR B 1 674 ? 11.672  199.734 14.383  1.00 107.82 ? 1428 THR B O     1 
ATOM   10078 C  CB    . THR B 1 674 ? 11.084  198.569 17.422  1.00 77.16  ? 1428 THR B CB    1 
ATOM   10079 O  OG1   . THR B 1 674 ? 10.955  197.154 17.215  1.00 79.55  ? 1428 THR B OG1   1 
ATOM   10080 C  CG2   . THR B 1 674 ? 10.610  198.963 18.825  1.00 65.50  ? 1428 THR B CG2   1 
ATOM   10081 N  N     . ASN B 1 675 ? 10.505  197.808 14.418  1.00 112.94 ? 1429 ASN B N     1 
ATOM   10082 C  CA    . ASN B 1 675 ? 10.927  197.407 13.072  1.00 125.81 ? 1429 ASN B CA    1 
ATOM   10083 C  C     . ASN B 1 675 ? 10.194  198.191 11.982  1.00 119.01 ? 1429 ASN B C     1 
ATOM   10084 O  O     . ASN B 1 675 ? 9.695   197.626 11.006  1.00 123.53 ? 1429 ASN B O     1 
ATOM   10085 C  CB    . ASN B 1 675 ? 10.763  195.896 12.846  1.00 134.21 ? 1429 ASN B CB    1 
ATOM   10086 C  CG    . ASN B 1 675 ? 11.313  195.438 11.485  1.00 135.87 ? 1429 ASN B CG    1 
ATOM   10087 O  OD1   . ASN B 1 675 ? 11.967  196.204 10.767  1.00 137.55 ? 1429 ASN B OD1   1 
ATOM   10088 N  ND2   . ASN B 1 675 ? 11.050  194.182 11.136  1.00 132.18 ? 1429 ASN B ND2   1 
ATOM   10089 N  N     . THR B 1 676 ? 10.152  199.504 12.157  1.00 128.16 ? 1430 THR B N     1 
ATOM   10090 C  CA    . THR B 1 676 ? 9.468   200.398 11.240  1.00 113.61 ? 1430 THR B CA    1 
ATOM   10091 C  C     . THR B 1 676 ? 10.318  200.613 9.981   1.00 111.46 ? 1430 THR B C     1 
ATOM   10092 O  O     . THR B 1 676 ? 10.863  201.691 9.771   1.00 117.91 ? 1430 THR B O     1 
ATOM   10093 C  CB    . THR B 1 676 ? 9.160   201.738 11.971  1.00 96.45  ? 1430 THR B CB    1 
ATOM   10094 O  OG1   . THR B 1 676 ? 8.436   202.626 11.114  1.00 99.80  ? 1430 THR B OG1   1 
ATOM   10095 C  CG2   . THR B 1 676 ? 10.450  202.411 12.473  1.00 98.19  ? 1430 THR B CG2   1 
ATOM   10096 N  N     . ASP B 1 677 ? 10.437  199.579 9.148   1.00 104.83 ? 1431 ASP B N     1 
ATOM   10097 C  CA    . ASP B 1 677 ? 11.367  199.593 8.010   1.00 92.90  ? 1431 ASP B CA    1 
ATOM   10098 C  C     . ASP B 1 677 ? 10.671  199.278 6.677   1.00 85.61  ? 1431 ASP B C     1 
ATOM   10099 O  O     . ASP B 1 677 ? 10.332  198.122 6.396   1.00 89.99  ? 1431 ASP B O     1 
ATOM   10100 C  CB    . ASP B 1 677 ? 12.513  198.602 8.261   1.00 101.32 ? 1431 ASP B CB    1 
ATOM   10101 C  CG    . ASP B 1 677 ? 13.541  198.554 7.111   1.00 114.36 ? 1431 ASP B CG    1 
ATOM   10102 O  OD1   . ASP B 1 677 ? 13.298  199.136 6.026   1.00 119.75 ? 1431 ASP B OD1   1 
ATOM   10103 O  OD2   . ASP B 1 677 ? 14.598  197.901 7.291   1.00 116.62 ? 1431 ASP B OD2   1 
ATOM   10104 N  N     . VAL B 1 678 ? 10.494  200.302 5.845   1.00 76.50  ? 1432 VAL B N     1 
ATOM   10105 C  CA    . VAL B 1 678 ? 9.696   200.174 4.628   1.00 74.18  ? 1432 VAL B CA    1 
ATOM   10106 C  C     . VAL B 1 678 ? 10.420  199.625 3.390   1.00 78.07  ? 1432 VAL B C     1 
ATOM   10107 O  O     . VAL B 1 678 ? 9.786   199.082 2.489   1.00 79.74  ? 1432 VAL B O     1 
ATOM   10108 C  CB    . VAL B 1 678 ? 8.948   201.497 4.273   1.00 64.61  ? 1432 VAL B CB    1 
ATOM   10109 C  CG1   . VAL B 1 678 ? 9.438   202.652 5.128   1.00 69.33  ? 1432 VAL B CG1   1 
ATOM   10110 C  CG2   . VAL B 1 678 ? 9.103   201.812 2.811   1.00 54.37  ? 1432 VAL B CG2   1 
ATOM   10111 N  N     . VAL B 1 679 ? 11.734  199.756 3.323   1.00 80.20  ? 1433 VAL B N     1 
ATOM   10112 C  CA    . VAL B 1 679 ? 12.430  199.213 2.159   1.00 76.11  ? 1433 VAL B CA    1 
ATOM   10113 C  C     . VAL B 1 679 ? 12.412  197.688 2.208   1.00 68.67  ? 1433 VAL B C     1 
ATOM   10114 O  O     . VAL B 1 679 ? 12.414  197.016 1.172   1.00 67.38  ? 1433 VAL B O     1 
ATOM   10115 C  CB    . VAL B 1 679 ? 13.873  199.776 2.017   1.00 67.33  ? 1433 VAL B CB    1 
ATOM   10116 C  CG1   . VAL B 1 679 ? 14.830  198.751 1.377   1.00 58.62  ? 1433 VAL B CG1   1 
ATOM   10117 C  CG2   . VAL B 1 679 ? 13.850  201.084 1.232   1.00 70.65  ? 1433 VAL B CG2   1 
ATOM   10118 N  N     . VAL B 1 680 ? 12.376  197.131 3.410   1.00 67.41  ? 1434 VAL B N     1 
ATOM   10119 C  CA    . VAL B 1 680 ? 12.378  195.680 3.501   1.00 73.30  ? 1434 VAL B CA    1 
ATOM   10120 C  C     . VAL B 1 680 ? 10.983  195.131 3.193   1.00 69.92  ? 1434 VAL B C     1 
ATOM   10121 O  O     . VAL B 1 680 ? 10.854  194.078 2.582   1.00 69.25  ? 1434 VAL B O     1 
ATOM   10122 C  CB    . VAL B 1 680 ? 12.928  195.182 4.854   1.00 73.36  ? 1434 VAL B CB    1 
ATOM   10123 C  CG1   . VAL B 1 680 ? 12.564  196.152 5.929   1.00 85.08  ? 1434 VAL B CG1   1 
ATOM   10124 C  CG2   . VAL B 1 680 ? 12.394  193.804 5.180   1.00 62.26  ? 1434 VAL B CG2   1 
ATOM   10125 N  N     . LEU B 1 681 ? 9.945   195.857 3.598   1.00 63.17  ? 1435 LEU B N     1 
ATOM   10126 C  CA    . LEU B 1 681 ? 8.591   195.490 3.213   1.00 55.66  ? 1435 LEU B CA    1 
ATOM   10127 C  C     . LEU B 1 681 ? 8.424   195.589 1.692   1.00 56.59  ? 1435 LEU B C     1 
ATOM   10128 O  O     . LEU B 1 681 ? 7.854   194.701 1.060   1.00 63.35  ? 1435 LEU B O     1 
ATOM   10129 C  CB    . LEU B 1 681 ? 7.563   196.370 3.925   1.00 46.43  ? 1435 LEU B CB    1 
ATOM   10130 C  CG    . LEU B 1 681 ? 7.097   195.866 5.285   1.00 46.67  ? 1435 LEU B CG    1 
ATOM   10131 C  CD1   . LEU B 1 681 ? 6.331   196.922 6.008   1.00 47.54  ? 1435 LEU B CD1   1 
ATOM   10132 C  CD2   . LEU B 1 681 ? 6.226   194.671 5.068   1.00 61.49  ? 1435 LEU B CD2   1 
ATOM   10133 N  N     . GLN B 1 682 ? 8.926   196.665 1.098   1.00 54.24  ? 1436 GLN B N     1 
ATOM   10134 C  CA    . GLN B 1 682 ? 8.855   196.810 -0.359  1.00 55.38  ? 1436 GLN B CA    1 
ATOM   10135 C  C     . GLN B 1 682 ? 9.516   195.647 -1.097  1.00 59.25  ? 1436 GLN B C     1 
ATOM   10136 O  O     . GLN B 1 682 ? 9.009   195.222 -2.139  1.00 66.61  ? 1436 GLN B O     1 
ATOM   10137 C  CB    . GLN B 1 682 ? 9.416   198.153 -0.821  1.00 55.60  ? 1436 GLN B CB    1 
ATOM   10138 C  CG    . GLN B 1 682 ? 8.642   199.314 -0.226  1.00 59.43  ? 1436 GLN B CG    1 
ATOM   10139 C  CD    . GLN B 1 682 ? 9.217   200.666 -0.555  1.00 59.92  ? 1436 GLN B CD    1 
ATOM   10140 O  OE1   . GLN B 1 682 ? 10.431  200.853 -0.611  1.00 65.55  ? 1436 GLN B OE1   1 
ATOM   10141 N  NE2   . GLN B 1 682 ? 8.340   201.628 -0.760  1.00 62.75  ? 1436 GLN B NE2   1 
ATOM   10142 N  N     . GLU B 1 683 ? 10.617  195.116 -0.558  1.00 53.74  ? 1437 GLU B N     1 
ATOM   10143 C  CA    . GLU B 1 683 ? 11.192  193.893 -1.127  1.00 62.51  ? 1437 GLU B CA    1 
ATOM   10144 C  C     . GLU B 1 683 ? 10.185  192.736 -1.073  1.00 62.67  ? 1437 GLU B C     1 
ATOM   10145 O  O     . GLU B 1 683 ? 9.993   192.024 -2.061  1.00 64.46  ? 1437 GLU B O     1 
ATOM   10146 C  CB    . GLU B 1 683 ? 12.536  193.513 -0.477  1.00 74.16  ? 1437 GLU B CB    1 
ATOM   10147 C  CG    . GLU B 1 683 ? 13.742  194.373 -0.923  1.00 81.74  ? 1437 GLU B CG    1 
ATOM   10148 C  CD    . GLU B 1 683 ? 15.008  194.102 -0.121  1.00 80.85  ? 1437 GLU B CD    1 
ATOM   10149 N  N     . GLU B 1 684 ? 9.524   192.553 0.064   1.00 60.20  ? 1438 GLU B N     1 
ATOM   10150 C  CA    . GLU B 1 684 ? 8.519   191.493 0.164   1.00 56.85  ? 1438 GLU B CA    1 
ATOM   10151 C  C     . GLU B 1 684 ? 7.384   191.730 -0.854  1.00 56.62  ? 1438 GLU B C     1 
ATOM   10152 O  O     . GLU B 1 684 ? 6.959   190.814 -1.558  1.00 52.27  ? 1438 GLU B O     1 
ATOM   10153 C  CB    . GLU B 1 684 ? 7.985   191.350 1.605   1.00 44.21  ? 1438 GLU B CB    1 
ATOM   10154 C  CG    . GLU B 1 684 ? 7.039   190.163 1.788   1.00 60.62  ? 1438 GLU B CG    1 
ATOM   10155 C  CD    . GLU B 1 684 ? 6.517   190.023 3.207   1.00 76.38  ? 1438 GLU B CD    1 
ATOM   10156 O  OE1   . GLU B 1 684 ? 5.812   189.015 3.486   1.00 78.38  ? 1438 GLU B OE1   1 
ATOM   10157 O  OE2   . GLU B 1 684 ? 6.824   190.913 4.040   1.00 81.31  ? 1438 GLU B OE2   1 
ATOM   10158 N  N     . GLU B 1 685 ? 6.908   192.968 -0.934  1.00 49.66  ? 1439 GLU B N     1 
ATOM   10159 C  CA    . GLU B 1 685 ? 5.914   193.329 -1.926  1.00 45.91  ? 1439 GLU B CA    1 
ATOM   10160 C  C     . GLU B 1 685 ? 6.352   192.824 -3.309  1.00 55.11  ? 1439 GLU B C     1 
ATOM   10161 O  O     . GLU B 1 685 ? 5.636   192.067 -3.957  1.00 63.86  ? 1439 GLU B O     1 
ATOM   10162 C  CB    . GLU B 1 685 ? 5.722   194.838 -1.936  1.00 44.79  ? 1439 GLU B CB    1 
ATOM   10163 C  CG    . GLU B 1 685 ? 4.389   195.288 -2.433  1.00 60.26  ? 1439 GLU B CG    1 
ATOM   10164 C  CD    . GLU B 1 685 ? 4.374   196.776 -2.713  1.00 80.82  ? 1439 GLU B CD    1 
ATOM   10165 O  OE1   . GLU B 1 685 ? 3.298   197.301 -3.080  1.00 91.09  ? 1439 GLU B OE1   1 
ATOM   10166 O  OE2   . GLU B 1 685 ? 5.444   197.418 -2.574  1.00 83.85  ? 1439 GLU B OE2   1 
ATOM   10167 N  N     . ALA B 1 686 ? 7.539   193.217 -3.751  1.00 55.49  ? 1440 ALA B N     1 
ATOM   10168 C  CA    . ALA B 1 686 ? 8.039   192.773 -5.056  1.00 57.84  ? 1440 ALA B CA    1 
ATOM   10169 C  C     . ALA B 1 686 ? 8.096   191.266 -5.169  1.00 55.85  ? 1440 ALA B C     1 
ATOM   10170 O  O     . ALA B 1 686 ? 7.667   190.701 -6.173  1.00 61.88  ? 1440 ALA B O     1 
ATOM   10171 C  CB    . ALA B 1 686 ? 9.396   193.344 -5.338  1.00 47.06  ? 1440 ALA B CB    1 
ATOM   10172 N  N     . GLU B 1 687 ? 8.636   190.608 -4.152  1.00 53.53  ? 1441 GLU B N     1 
ATOM   10173 C  CA    . GLU B 1 687 ? 8.747   189.162 -4.211  1.00 58.15  ? 1441 GLU B CA    1 
ATOM   10174 C  C     . GLU B 1 687 ? 7.356   188.607 -4.496  1.00 60.41  ? 1441 GLU B C     1 
ATOM   10175 O  O     . GLU B 1 687 ? 7.183   187.744 -5.354  1.00 70.88  ? 1441 GLU B O     1 
ATOM   10176 C  CB    . GLU B 1 687 ? 9.317   188.608 -2.908  1.00 61.88  ? 1441 GLU B CB    1 
ATOM   10177 C  CG    . GLU B 1 687 ? 9.975   187.243 -3.016  1.00 61.25  ? 1441 GLU B CG    1 
ATOM   10178 N  N     . LEU B 1 688 ? 6.357   189.153 -3.813  1.00 53.98  ? 1442 LEU B N     1 
ATOM   10179 C  CA    . LEU B 1 688 ? 4.992   188.638 -3.891  1.00 50.03  ? 1442 LEU B CA    1 
ATOM   10180 C  C     . LEU B 1 688 ? 4.334   188.868 -5.251  1.00 51.92  ? 1442 LEU B C     1 
ATOM   10181 O  O     . LEU B 1 688 ? 3.716   187.954 -5.807  1.00 50.20  ? 1442 LEU B O     1 
ATOM   10182 C  CB    . LEU B 1 688 ? 4.133   189.226 -2.759  1.00 47.35  ? 1442 LEU B CB    1 
ATOM   10183 C  CG    . LEU B 1 688 ? 4.384   188.577 -1.395  1.00 40.39  ? 1442 LEU B CG    1 
ATOM   10184 C  CD1   . LEU B 1 688 ? 3.782   189.391 -0.304  1.00 46.46  ? 1442 LEU B CD1   1 
ATOM   10185 C  CD2   . LEU B 1 688 ? 3.771   187.198 -1.379  1.00 40.68  ? 1442 LEU B CD2   1 
ATOM   10186 N  N     . ARG B 1 689 ? 4.466   190.085 -5.783  1.00 46.38  ? 1443 ARG B N     1 
ATOM   10187 C  CA    . ARG B 1 689 ? 3.930   190.399 -7.115  1.00 41.59  ? 1443 ARG B CA    1 
ATOM   10188 C  C     . ARG B 1 689 ? 4.518   189.427 -8.122  1.00 50.95  ? 1443 ARG B C     1 
ATOM   10189 O  O     . ARG B 1 689 ? 3.784   188.824 -8.892  1.00 59.07  ? 1443 ARG B O     1 
ATOM   10190 C  CB    . ARG B 1 689 ? 4.211   191.843 -7.535  1.00 41.85  ? 1443 ARG B CB    1 
ATOM   10191 C  CG    . ARG B 1 689 ? 3.671   192.879 -6.601  1.00 42.21  ? 1443 ARG B CG    1 
ATOM   10192 C  CD    . ARG B 1 689 ? 3.860   194.300 -7.115  1.00 53.42  ? 1443 ARG B CD    1 
ATOM   10193 N  NE    . ARG B 1 689 ? 2.734   194.718 -7.944  1.00 70.65  ? 1443 ARG B NE    1 
ATOM