data_4Z7Z
# 
_entry.id   4Z7Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.285 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4Z7Z         
WWPDB D_1000208788 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4XEG PDB . 
unspecified 4Z3A PDB . 
unspecified 4Z47 PDB . 
unspecified 4Z7B PDB . 
unspecified 5CYS PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4Z7Z 
_pdbx_database_status.recvd_initial_deposition_date   2015-04-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pozharski, E.' 1 
'Malik, S.S.'   2 
'Drohat, A.C.'  3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            43 
_citation.language                  ? 
_citation.page_first                9541 
_citation.page_last                 9552 
_citation.title                     
'Thymine DNA glycosylase exhibits negligible affinity for nucleobases that it removes from DNA.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkv890 
_citation.pdbx_database_id_PubMed   26358812 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Malik, S.S.'   1 
primary 'Coey, C.T.'    2 
primary 'Varney, K.M.'  3 
primary 'Pozharski, E.' 4 
primary 'Drohat, A.C.'  5 
# 
_cell.entry_id           4Z7Z 
_cell.length_a           90.729 
_cell.length_b           53.460 
_cell.length_c           82.033 
_cell.angle_alpha        90.00 
_cell.angle_beta         95.54 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4Z7Z 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'G/T mismatch-specific thymine DNA glycosylase' 23070.670 1   3.2.2.29 ? 'UNP residues 111-308' ? 
2 polymer     syn 'DNA (28-MER)'                                  8646.565  1   ?        ? ?                      ? 
3 polymer     syn 'DNA (28-MER)'                                  8473.431  1   ?        ? ?                      ? 
4 non-polymer syn 1,2-ETHANEDIOL                                  62.068    1   ?        ? ?                      ? 
5 non-polymer syn 'ACETIC ACID'                                   60.052    1   ?        ? ?                      ? 
6 water       nat water                                           18.015    205 ?        ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Thymine-DNA glycosylase,hTDG' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;GSHMASFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGK
YGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTET
LCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDV
;
;GSHMASFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGK
YGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTET
LCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDV
;
A ? 
2 polydeoxyribonucleotide no no  
;(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DA)(DG)(DC)(DG)(DA)(DT)
(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DT)
;
CAGCTCTGTACGTGAGCGATGGACAGCT C ? 
3 polydeoxyribonucleotide no yes 
;(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DA)(DT)(DC)(DG)(DC)(DT)(DC)(DA)(ORP)(DG)(DT)
(DA)(DC)(DA)(DG)(DA)(DG)(DC)(DT)(DG)
;
AGCTGTCCATCGCTCAXGTACAGAGCTG D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   SER n 
1 7   PHE n 
1 8   ASN n 
1 9   GLY n 
1 10  VAL n 
1 11  SER n 
1 12  GLU n 
1 13  ALA n 
1 14  GLU n 
1 15  LEU n 
1 16  LEU n 
1 17  THR n 
1 18  LYS n 
1 19  THR n 
1 20  LEU n 
1 21  PRO n 
1 22  ASP n 
1 23  ILE n 
1 24  LEU n 
1 25  THR n 
1 26  PHE n 
1 27  ASN n 
1 28  LEU n 
1 29  ASP n 
1 30  ILE n 
1 31  VAL n 
1 32  ILE n 
1 33  ILE n 
1 34  GLY n 
1 35  ILE n 
1 36  ASN n 
1 37  PRO n 
1 38  GLY n 
1 39  LEU n 
1 40  MET n 
1 41  ALA n 
1 42  ALA n 
1 43  TYR n 
1 44  LYS n 
1 45  GLY n 
1 46  HIS n 
1 47  HIS n 
1 48  TYR n 
1 49  PRO n 
1 50  GLY n 
1 51  PRO n 
1 52  GLY n 
1 53  ASN n 
1 54  HIS n 
1 55  PHE n 
1 56  TRP n 
1 57  LYS n 
1 58  CYS n 
1 59  LEU n 
1 60  PHE n 
1 61  MET n 
1 62  SER n 
1 63  GLY n 
1 64  LEU n 
1 65  SER n 
1 66  GLU n 
1 67  VAL n 
1 68  GLN n 
1 69  LEU n 
1 70  ASN n 
1 71  HIS n 
1 72  MET n 
1 73  ASP n 
1 74  ASP n 
1 75  HIS n 
1 76  THR n 
1 77  LEU n 
1 78  PRO n 
1 79  GLY n 
1 80  LYS n 
1 81  TYR n 
1 82  GLY n 
1 83  ILE n 
1 84  GLY n 
1 85  PHE n 
1 86  THR n 
1 87  ASN n 
1 88  MET n 
1 89  VAL n 
1 90  GLU n 
1 91  ARG n 
1 92  THR n 
1 93  THR n 
1 94  PRO n 
1 95  GLY n 
1 96  SER n 
1 97  LYS n 
1 98  ASP n 
1 99  LEU n 
1 100 SER n 
1 101 SER n 
1 102 LYS n 
1 103 GLU n 
1 104 PHE n 
1 105 ARG n 
1 106 GLU n 
1 107 GLY n 
1 108 GLY n 
1 109 ARG n 
1 110 ILE n 
1 111 LEU n 
1 112 VAL n 
1 113 GLN n 
1 114 LYS n 
1 115 LEU n 
1 116 GLN n 
1 117 LYS n 
1 118 TYR n 
1 119 GLN n 
1 120 PRO n 
1 121 ARG n 
1 122 ILE n 
1 123 ALA n 
1 124 VAL n 
1 125 PHE n 
1 126 ASN n 
1 127 GLY n 
1 128 LYS n 
1 129 CYS n 
1 130 ILE n 
1 131 TYR n 
1 132 GLU n 
1 133 ILE n 
1 134 PHE n 
1 135 SER n 
1 136 LYS n 
1 137 GLU n 
1 138 VAL n 
1 139 PHE n 
1 140 GLY n 
1 141 VAL n 
1 142 LYS n 
1 143 VAL n 
1 144 LYS n 
1 145 ASN n 
1 146 LEU n 
1 147 GLU n 
1 148 PHE n 
1 149 GLY n 
1 150 LEU n 
1 151 GLN n 
1 152 PRO n 
1 153 HIS n 
1 154 LYS n 
1 155 ILE n 
1 156 PRO n 
1 157 ASP n 
1 158 THR n 
1 159 GLU n 
1 160 THR n 
1 161 LEU n 
1 162 CYS n 
1 163 TYR n 
1 164 VAL n 
1 165 MET n 
1 166 PRO n 
1 167 SER n 
1 168 SER n 
1 169 SER n 
1 170 ALA n 
1 171 ARG n 
1 172 CYS n 
1 173 ALA n 
1 174 GLN n 
1 175 PHE n 
1 176 PRO n 
1 177 ARG n 
1 178 ALA n 
1 179 GLN n 
1 180 ASP n 
1 181 LYS n 
1 182 VAL n 
1 183 HIS n 
1 184 TYR n 
1 185 TYR n 
1 186 ILE n 
1 187 LYS n 
1 188 LEU n 
1 189 LYS n 
1 190 ASP n 
1 191 LEU n 
1 192 ARG n 
1 193 ASP n 
1 194 GLN n 
1 195 LEU n 
1 196 LYS n 
1 197 GLY n 
1 198 ILE n 
1 199 GLU n 
1 200 ARG n 
1 201 ASN n 
1 202 MET n 
1 203 ASP n 
1 204 VAL n 
2 1   DC  n 
2 2   DA  n 
2 3   DG  n 
2 4   DC  n 
2 5   DT  n 
2 6   DC  n 
2 7   DT  n 
2 8   DG  n 
2 9   DT  n 
2 10  DA  n 
2 11  DC  n 
2 12  DG  n 
2 13  DT  n 
2 14  DG  n 
2 15  DA  n 
2 16  DG  n 
2 17  DC  n 
2 18  DG  n 
2 19  DA  n 
2 20  DT  n 
2 21  DG  n 
2 22  DG  n 
2 23  DA  n 
2 24  DC  n 
2 25  DA  n 
2 26  DG  n 
2 27  DC  n 
2 28  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DT  n 
3 5   DG  n 
3 6   DT  n 
3 7   DC  n 
3 8   DC  n 
3 9   DA  n 
3 10  DT  n 
3 11  DC  n 
3 12  DG  n 
3 13  DC  n 
3 14  DT  n 
3 15  DC  n 
3 16  DA  n 
3 17  ORP n 
3 18  DG  n 
3 19  DT  n 
3 20  DA  n 
3 21  DC  n 
3 22  DA  n 
3 23  DG  n 
3 24  DA  n 
3 25  DG  n 
3 26  DC  n 
3 27  DT  n 
3 28  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   204 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TDG 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 28 'synthetic construct' ? 32630 ? 
3 1 sample 1 28 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP TDG_HUMAN Q13569 ? 1 
;FNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFT
NMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMP
SSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDV
;
111 
2 PDB 4Z7Z      4Z7Z   ? 2 ? 1   
3 PDB 4Z7Z      4Z7Z   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4Z7Z A 7 ? 204 ? Q13569 111 ? 308 ? 111 308 
2 2 4Z7Z C 1 ? 28  ? 4Z7Z   1   ? 28  ? 1   28  
3 3 4Z7Z D 1 ? 28  ? 4Z7Z   1   ? 28  ? 1   28  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4Z7Z GLY A 1 ? UNP Q13569 ? ? 'expression tag' 105 1 
1 4Z7Z SER A 2 ? UNP Q13569 ? ? 'expression tag' 106 2 
1 4Z7Z HIS A 3 ? UNP Q13569 ? ? 'expression tag' 107 3 
1 4Z7Z MET A 4 ? UNP Q13569 ? ? 'expression tag' 108 4 
1 4Z7Z ALA A 5 ? UNP Q13569 ? ? 'expression tag' 109 5 
1 4Z7Z SER A 6 ? UNP Q13569 ? ? 'expression tag' 110 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACY non-polymer         . 'ACETIC ACID'                        ?                 'C2 H4 O2'        60.052  
ALA 'L-peptide linking' y ALANINE                              ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                 'C10 H15 N2 O8 P' 322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                       'ETHYLENE GLYCOL' 'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE                            ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                 'C5 H11 N O2 S'   149.211 
ORP saccharide          . 2-DEOXY-5-PHOSPHONO-RIBOSE           ?                 'C5 H11 O7 P'     214.110 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4Z7Z 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.48 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.34 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '30% PEG 4000, 0.2M ammonium acetate, 0.1M sodium acetate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-15 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.0000 1.0 
2 1.00   1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4Z7Z 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             39.260 
_reflns.d_resolution_high            1.830 
_reflns.number_obs                   34165 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.2000 
_reflns.B_iso_Wilson_estimate        34.67 
_reflns.pdbx_redundancy              8.800 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.83 
_reflns_shell.d_res_low              1.87 
_reflns_shell.percent_possible_all   91.5 
_reflns_shell.Rmerge_I_obs           0.05700 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    0.400 
_reflns_shell.pdbx_redundancy        3.00 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4Z7Z 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     34036 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.26 
_refine.ls_d_res_high                            1.83 
_refine.ls_percent_reflns_obs                    98.1 
_refine.ls_R_factor_obs                          0.195 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.193 
_refine.ls_R_factor_R_free                       0.237 
_refine.ls_R_factor_R_free_error                 0.009 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.880 
_refine.ls_number_reflns_R_free                  1660 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.939 
_refine.B_iso_mean                               55.85 
_refine.aniso_B[1][1]                            -13.58600 
_refine.aniso_B[2][2]                            2.01910 
_refine.aniso_B[3][3]                            11.56690 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            1.86570 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4FNC 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             0.128 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.127 
_refine.pdbx_overall_SU_R_Blow_DPI               0.139 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.134 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        4Z7Z 
_refine_analyze.Luzzati_coordinate_error_obs    0.441 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1535 
_refine_hist.pdbx_number_atoms_nucleic_acid   894 
_refine_hist.pdbx_number_atoms_ligand         249 
_refine_hist.number_atoms_solvent             205 
_refine_hist.number_atoms_total               2883 
_refine_hist.d_res_high                       1.83 
_refine_hist.d_res_low                        39.26 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.000  2927 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               0.99  ? 2.000  4202 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.000  857  'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.000  36   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.000  297  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.000 2927 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           3.35  ? ?      ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           21.74 ? ?      ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.000  376  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?      ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.000  3189 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.83 
_refine_ls_shell.d_res_low                        1.89 
_refine_ls_shell.number_reflns_R_work             2781 
_refine_ls_shell.R_factor_R_work                  0.2570 
_refine_ls_shell.percent_reflns_obs               98.07 
_refine_ls_shell.R_factor_R_free                  0.2667 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            5.66 
_refine_ls_shell.number_reflns_R_free             167 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     4Z7Z 
_struct.title                        
'Structure of the enzyme-product complex resulting from TDG action on a GT mismatch in the presence of excess base' 
_struct.pdbx_descriptor              'G/T mismatch-specific thymine DNA glycosylase/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4Z7Z 
_struct_keywords.text            'protein-DNA complex, Hydrolase-DNA complex' 
_struct_keywords.pdbx_keywords   Hydrolase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 11  ? LEU A 16  ? SER A 115 LEU A 120 1 ? 6  
HELX_P HELX_P2 AA2 GLY A 38  ? GLY A 45  ? GLY A 142 GLY A 149 1 ? 8  
HELX_P HELX_P3 AA3 HIS A 54  ? SER A 62  ? HIS A 158 SER A 166 1 ? 9  
HELX_P HELX_P4 AA4 ASN A 70  ? HIS A 75  ? ASN A 174 HIS A 179 5 ? 6  
HELX_P HELX_P5 AA5 THR A 76  ? GLY A 82  ? THR A 180 GLY A 186 1 ? 7  
HELX_P HELX_P6 AA6 GLY A 95  ? LEU A 99  ? GLY A 199 LEU A 203 5 ? 5  
HELX_P HELX_P7 AA7 SER A 100 ? GLN A 119 ? SER A 204 GLN A 223 1 ? 20 
HELX_P HELX_P8 AA8 GLY A 127 ? PHE A 139 ? GLY A 231 PHE A 243 1 ? 13 
HELX_P HELX_P9 AA9 ARG A 177 ? ASN A 201 ? ARG A 281 ASN A 305 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? C DA  16 "O3'" ? ? ? 1_555 C ORP 17 P  ? ? D DA  16 D ORP 17 1_555 ? ? ? ? ? ? ?            1.606 ? 
covale2  covale one  ? C ORP 17 O3    ? ? ? 1_555 C DG  18 P  ? ? D ORP 17 D DG  18 1_555 ? ? ? ? ? ? ?            1.572 ? 
hydrog1  hydrog ?    ? B DC  1  N3    ? ? ? 1_555 C DG  28 N1 ? ? C DC  1  D DG  28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? B DC  1  N4    ? ? ? 1_555 C DG  28 O6 ? ? C DC  1  D DG  28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? B DC  1  O2    ? ? ? 1_555 C DG  28 N2 ? ? C DC  1  D DG  28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? B DA  2  N1    ? ? ? 1_555 C DT  27 N3 ? ? C DA  2  D DT  27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? B DA  2  N6    ? ? ? 1_555 C DT  27 O4 ? ? C DA  2  D DT  27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? B DG  3  N1    ? ? ? 1_555 C DC  26 N3 ? ? C DG  3  D DC  26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? B DG  3  N2    ? ? ? 1_555 C DC  26 O2 ? ? C DG  3  D DC  26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? B DG  3  O6    ? ? ? 1_555 C DC  26 N4 ? ? C DG  3  D DC  26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? B DC  4  N3    ? ? ? 1_555 C DG  25 N1 ? ? C DC  4  D DG  25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? B DC  4  N4    ? ? ? 1_555 C DG  25 O6 ? ? C DC  4  D DG  25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? B DC  4  O2    ? ? ? 1_555 C DG  25 N2 ? ? C DC  4  D DG  25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? B DT  5  N3    ? ? ? 1_555 C DA  24 N1 ? ? C DT  5  D DA  24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? B DT  5  O4    ? ? ? 1_555 C DA  24 N6 ? ? C DT  5  D DA  24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? B DC  6  N3    ? ? ? 1_555 C DG  23 N1 ? ? C DC  6  D DG  23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? B DC  6  N4    ? ? ? 1_555 C DG  23 O6 ? ? C DC  6  D DG  23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? B DC  6  O2    ? ? ? 1_555 C DG  23 N2 ? ? C DC  6  D DG  23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? B DT  7  N3    ? ? ? 1_555 C DA  22 N1 ? ? C DT  7  D DA  22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? B DT  7  O4    ? ? ? 1_555 C DA  22 N6 ? ? C DT  7  D DA  22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? B DG  8  N1    ? ? ? 1_555 C DC  21 N3 ? ? C DG  8  D DC  21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? B DG  8  N2    ? ? ? 1_555 C DC  21 O2 ? ? C DG  8  D DC  21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? B DG  8  O6    ? ? ? 1_555 C DC  21 N4 ? ? C DG  8  D DC  21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? B DT  9  N3    ? ? ? 1_555 C DA  20 N1 ? ? C DT  9  D DA  20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? B DT  9  O4    ? ? ? 1_555 C DA  20 N6 ? ? C DT  9  D DA  20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? B DA  10 N1    ? ? ? 1_555 C DT  19 N3 ? ? C DA  10 D DT  19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? B DA  10 N6    ? ? ? 1_555 C DT  19 O4 ? ? C DA  10 D DT  19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? B DC  11 N3    ? ? ? 1_555 C DG  18 N1 ? ? C DC  11 D DG  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? B DC  11 N4    ? ? ? 1_555 C DG  18 O6 ? ? C DC  11 D DG  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? B DC  11 O2    ? ? ? 1_555 C DG  18 N2 ? ? C DC  11 D DG  18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? B DT  13 N3    ? ? ? 1_555 C DA  16 N1 ? ? C DT  13 D DA  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? B DT  13 O4    ? ? ? 1_555 C DA  16 N6 ? ? C DT  13 D DA  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? B DG  14 N1    ? ? ? 1_555 C DC  15 N3 ? ? C DG  14 D DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? B DG  14 N2    ? ? ? 1_555 C DC  15 O2 ? ? C DG  14 D DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? B DG  14 O6    ? ? ? 1_555 C DC  15 N4 ? ? C DG  14 D DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? B DA  15 N1    ? ? ? 1_555 C DT  14 N3 ? ? C DA  15 D DT  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? B DA  15 N6    ? ? ? 1_555 C DT  14 O4 ? ? C DA  15 D DT  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? B DG  16 N1    ? ? ? 1_555 C DC  13 N3 ? ? C DG  16 D DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? B DG  16 N2    ? ? ? 1_555 C DC  13 O2 ? ? C DG  16 D DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? B DG  16 O6    ? ? ? 1_555 C DC  13 N4 ? ? C DG  16 D DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? B DC  17 N3    ? ? ? 1_555 C DG  12 N1 A ? C DC  17 D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? B DC  17 N4    ? ? ? 1_555 C DG  12 O6 A ? C DC  17 D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? B DC  17 O2    ? ? ? 1_555 C DG  12 N2 A ? C DC  17 D DG  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? B DG  18 N1    ? ? ? 1_555 C DC  11 N3 A ? C DG  18 D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? B DG  18 N2    ? ? ? 1_555 C DC  11 O2 A ? C DG  18 D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? B DG  18 O6    ? ? ? 1_555 C DC  11 N4 A ? C DG  18 D DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? B DA  19 N1    ? ? ? 1_555 C DT  10 N3 ? ? C DA  19 D DT  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? B DA  19 N6    ? ? ? 1_555 C DT  10 O4 ? ? C DA  19 D DT  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? B DT  20 N3    ? ? ? 1_555 C DA  9  N1 ? ? C DT  20 D DA  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? B DT  20 O4    ? ? ? 1_555 C DA  9  N6 ? ? C DT  20 D DA  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? B DG  21 N1    ? ? ? 1_555 C DC  8  N3 ? ? C DG  21 D DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? B DG  21 N2    ? ? ? 1_555 C DC  8  O2 ? ? C DG  21 D DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ?    ? B DG  21 O6    ? ? ? 1_555 C DC  8  N4 ? ? C DG  21 D DC  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ?    ? B DG  22 N1    ? ? ? 1_555 C DC  7  N3 ? ? C DG  22 D DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ?    ? B DG  22 N2    ? ? ? 1_555 C DC  7  O2 ? ? C DG  22 D DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ?    ? B DG  22 O6    ? ? ? 1_555 C DC  7  N4 ? ? C DG  22 D DC  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ?    ? B DA  23 N1    ? ? ? 1_555 C DT  6  N3 ? ? C DA  23 D DT  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ?    ? B DA  23 N6    ? ? ? 1_555 C DT  6  O4 ? ? C DA  23 D DT  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ?    ? B DC  24 N3    ? ? ? 1_555 C DG  5  N1 ? ? C DC  24 D DG  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ?    ? B DC  24 N4    ? ? ? 1_555 C DG  5  O6 ? ? C DC  24 D DG  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ?    ? B DC  24 O2    ? ? ? 1_555 C DG  5  N2 ? ? C DC  24 D DG  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ?    ? B DA  25 N1    ? ? ? 1_555 C DT  4  N3 ? ? C DA  25 D DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ?    ? B DA  25 N6    ? ? ? 1_555 C DT  4  O4 ? ? C DA  25 D DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ?    ? B DG  26 N1    ? ? ? 1_555 C DC  3  N3 ? ? C DG  26 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ?    ? B DG  26 N2    ? ? ? 1_555 C DC  3  O2 ? ? C DG  26 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ?    ? B DG  26 O6    ? ? ? 1_555 C DC  3  N4 ? ? C DG  26 D DC  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ?    ? B DC  27 N3    ? ? ? 1_555 C DG  2  N1 ? ? C DC  27 D DG  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ?    ? B DC  27 N4    ? ? ? 1_555 C DG  2  O6 ? ? C DC  27 D DG  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67 hydrog ?    ? B DC  27 O2    ? ? ? 1_555 C DG  2  N2 ? ? C DC  27 D DG  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68 hydrog ?    ? B DT  28 N3    ? ? ? 1_555 C DA  1  N1 ? ? C DT  28 D DA  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69 hydrog ?    ? B DT  28 O4    ? ? ? 1_555 C DA  1  N6 ? ? C DT  28 D DA  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 83  ? ASN A 87  ? ILE A 187 ASN A 191 
AA1 2 ILE A 30  ? GLY A 34  ? ILE A 134 GLY A 138 
AA1 3 ILE A 122 ? ASN A 126 ? ILE A 226 ASN A 230 
AA1 4 LEU A 161 ? MET A 165 ? LEU A 265 MET A 269 
AA1 5 GLY A 149 ? LEU A 150 ? GLY A 253 LEU A 254 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLY A 84  ? O GLY A 188 N ILE A 32  ? N ILE A 136 
AA1 2 3 N VAL A 31  ? N VAL A 135 O VAL A 124 ? O VAL A 228 
AA1 3 4 N ALA A 123 ? N ALA A 227 O LEU A 161 ? O LEU A 265 
AA1 4 5 O VAL A 164 ? O VAL A 268 N GLY A 149 ? N GLY A 253 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A EDO 401 ? 4  'binding site for residue EDO A 401'                                
AC2 Software A ACY 402 ? 9  'binding site for residue ACY A 402'                                
AC3 Software D DA  16  ? 23 'binding site for Poly-Saccharide residues DA D 16 through DG D 18' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ASN A 27  ? ASN A 131 . ? 1_555 ? 
2  AC1 4  LEU A 28  ? LEU A 132 . ? 1_555 ? 
3  AC1 4  GLN A 119 ? GLN A 223 . ? 1_555 ? 
4  AC1 4  ARG A 121 ? ARG A 225 . ? 1_555 ? 
5  AC2 9  GLY A 34  ? GLY A 138 . ? 1_555 ? 
6  AC2 9  ILE A 35  ? ILE A 139 . ? 1_555 ? 
7  AC2 9  ASN A 36  ? ASN A 140 . ? 1_555 ? 
8  AC2 9  TYR A 48  ? TYR A 152 . ? 1_555 ? 
9  AC2 9  ASN A 87  ? ASN A 191 . ? 1_555 ? 
10 AC2 9  HOH F .   ? HOH A 503 . ? 1_555 ? 
11 AC2 9  HOH F .   ? HOH A 504 . ? 1_555 ? 
12 AC2 9  HOH F .   ? HOH A 547 . ? 1_555 ? 
13 AC2 9  ORP C 17  ? ORP D 17  . ? 1_555 ? 
14 AC3 23 ASN A 36  ? ASN A 140 . ? 1_555 ? 
15 AC3 23 ASN A 53  ? ASN A 157 . ? 1_555 ? 
16 AC3 23 SER A 96  ? SER A 200 . ? 1_555 ? 
17 AC3 23 SER A 167 ? SER A 271 . ? 1_555 ? 
18 AC3 23 SER A 169 ? SER A 273 . ? 1_555 ? 
19 AC3 23 ALA A 170 ? ALA A 274 . ? 1_555 ? 
20 AC3 23 ARG A 171 ? ARG A 275 . ? 1_555 ? 
21 AC3 23 CYS A 172 ? CYS A 276 . ? 1_555 ? 
22 AC3 23 ALA A 173 ? ALA A 277 . ? 1_555 ? 
23 AC3 23 GLN A 174 ? GLN A 278 . ? 1_555 ? 
24 AC3 23 ACY E .   ? ACY A 402 . ? 1_555 ? 
25 AC3 23 HOH F .   ? HOH A 533 . ? 1_555 ? 
26 AC3 23 HOH F .   ? HOH A 572 . ? 1_555 ? 
27 AC3 23 DA  B 10  ? DA  C 10  . ? 1_555 ? 
28 AC3 23 DC  B 11  ? DC  C 11  . ? 1_555 ? 
29 AC3 23 DG  B 12  ? DG  C 12  . ? 1_555 ? 
30 AC3 23 DT  B 13  ? DT  C 13  . ? 1_555 ? 
31 AC3 23 DG  B 14  ? DG  C 14  . ? 1_555 ? 
32 AC3 23 DC  C 15  ? DC  D 15  . ? 1_555 ? 
33 AC3 23 DT  C 19  ? DT  D 19  . ? 1_555 ? 
34 AC3 23 HOH H .   ? HOH D 108 . ? 1_555 ? 
35 AC3 23 HOH H .   ? HOH D 110 . ? 1_555 ? 
36 AC3 23 HOH H .   ? HOH D 129 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4Z7Z 
_atom_sites.fract_transf_matrix[1][1]   0.011022 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001069 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018706 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012247 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . PHE A 1 7   ? 26.968  -14.614 37.746 1.00 55.69  ? 111 PHE A N     1 
ATOM   2    C CA    . PHE A 1 7   ? 25.521  -14.618 37.967 1.00 53.99  ? 111 PHE A CA    1 
ATOM   3    C C     . PHE A 1 7   ? 25.196  -15.866 38.781 1.00 53.84  ? 111 PHE A C     1 
ATOM   4    O O     . PHE A 1 7   ? 24.759  -16.887 38.232 1.00 49.83  ? 111 PHE A O     1 
ATOM   5    C CB    . PHE A 1 7   ? 24.771  -14.624 36.619 1.00 56.81  ? 111 PHE A CB    1 
ATOM   6    C CG    . PHE A 1 7   ? 24.836  -13.342 35.825 1.00 60.57  ? 111 PHE A CG    1 
ATOM   7    C CD1   . PHE A 1 7   ? 26.016  -12.948 35.200 1.00 66.19  ? 111 PHE A CD1   1 
ATOM   8    C CD2   . PHE A 1 7   ? 23.700  -12.567 35.634 1.00 64.48  ? 111 PHE A CD2   1 
ATOM   9    C CE1   . PHE A 1 7   ? 26.072  -11.768 34.452 1.00 69.83  ? 111 PHE A CE1   1 
ATOM   10   C CE2   . PHE A 1 7   ? 23.755  -11.393 34.877 1.00 70.89  ? 111 PHE A CE2   1 
ATOM   11   C CZ    . PHE A 1 7   ? 24.943  -10.995 34.307 1.00 70.78  ? 111 PHE A CZ    1 
ATOM   12   N N     . ASN A 1 8   ? 25.477  -15.797 40.104 1.00 51.17  ? 112 ASN A N     1 
ATOM   13   C CA    . ASN A 1 8   ? 25.271  -16.904 41.030 1.00 51.86  ? 112 ASN A CA    1 
ATOM   14   C C     . ASN A 1 8   ? 25.965  -18.203 40.506 1.00 59.19  ? 112 ASN A C     1 
ATOM   15   O O     . ASN A 1 8   ? 25.353  -19.266 40.410 1.00 59.73  ? 112 ASN A O     1 
ATOM   16   C CB    . ASN A 1 8   ? 23.764  -17.081 41.321 1.00 48.89  ? 112 ASN A CB    1 
ATOM   17   C CG    . ASN A 1 8   ? 23.446  -18.065 42.417 1.00 56.37  ? 112 ASN A CG    1 
ATOM   18   O OD1   . ASN A 1 8   ? 24.221  -18.278 43.357 1.00 44.14  ? 112 ASN A OD1   1 
ATOM   19   N ND2   . ASN A 1 8   ? 22.323  -18.739 42.274 1.00 51.21  ? 112 ASN A ND2   1 
ATOM   20   N N     . GLY A 1 9   ? 27.225  -18.063 40.104 1.00 58.54  ? 113 GLY A N     1 
ATOM   21   C CA    . GLY A 1 9   ? 28.018  -19.166 39.570 1.00 61.68  ? 113 GLY A CA    1 
ATOM   22   C C     . GLY A 1 9   ? 27.674  -19.627 38.159 1.00 64.57  ? 113 GLY A C     1 
ATOM   23   O O     . GLY A 1 9   ? 28.222  -20.630 37.700 1.00 68.22  ? 113 GLY A O     1 
ATOM   24   N N     . VAL A 1 10  ? 26.769  -18.920 37.449 1.00 57.02  ? 114 VAL A N     1 
ATOM   25   C CA    . VAL A 1 10  ? 26.413  -19.297 36.078 1.00 56.41  ? 114 VAL A CA    1 
ATOM   26   C C     . VAL A 1 10  ? 27.330  -18.490 35.149 1.00 60.16  ? 114 VAL A C     1 
ATOM   27   O O     . VAL A 1 10  ? 27.407  -17.265 35.293 1.00 57.50  ? 114 VAL A O     1 
ATOM   28   C CB    . VAL A 1 10  ? 24.907  -19.090 35.754 1.00 58.34  ? 114 VAL A CB    1 
ATOM   29   C CG1   . VAL A 1 10  ? 24.611  -19.349 34.273 1.00 58.64  ? 114 VAL A CG1   1 
ATOM   30   C CG2   . VAL A 1 10  ? 24.023  -19.953 36.645 1.00 59.04  ? 114 VAL A CG2   1 
ATOM   31   N N     . SER A 1 11  ? 28.054  -19.178 34.238 1.00 59.80  ? 115 SER A N     1 
ATOM   32   C CA    . SER A 1 11  ? 28.997  -18.527 33.326 1.00 61.12  ? 115 SER A CA    1 
ATOM   33   C C     . SER A 1 11  ? 28.319  -17.627 32.296 1.00 67.19  ? 115 SER A C     1 
ATOM   34   O O     . SER A 1 11  ? 27.167  -17.881 31.918 1.00 66.69  ? 115 SER A O     1 
ATOM   35   C CB    . SER A 1 11  ? 29.884  -19.560 32.628 1.00 66.62  ? 115 SER A CB    1 
ATOM   36   O OG    . SER A 1 11  ? 29.163  -20.403 31.741 1.00 74.31  ? 115 SER A OG    1 
ATOM   37   N N     . GLU A 1 12  ? 29.054  -16.584 31.826 1.00 65.77  ? 116 GLU A N     1 
ATOM   38   C CA    . GLU A 1 12  ? 28.608  -15.664 30.779 1.00 66.89  ? 116 GLU A CA    1 
ATOM   39   C C     . GLU A 1 12  ? 28.390  -16.483 29.509 1.00 70.92  ? 116 GLU A C     1 
ATOM   40   O O     . GLU A 1 12  ? 27.393  -16.276 28.818 1.00 71.75  ? 116 GLU A O     1 
ATOM   41   C CB    . GLU A 1 12  ? 29.654  -14.557 30.530 1.00 71.18  ? 116 GLU A CB    1 
ATOM   42   C CG    . GLU A 1 12  ? 29.178  -13.466 29.578 1.00 84.03  ? 116 GLU A CG    1 
ATOM   43   C CD    . GLU A 1 12  ? 30.241  -12.510 29.075 1.00 110.32 ? 116 GLU A CD    1 
ATOM   44   O OE1   . GLU A 1 12  ? 31.179  -12.971 28.385 1.00 112.43 ? 116 GLU A OE1   1 
ATOM   45   O OE2   . GLU A 1 12  ? 30.107  -11.290 29.323 1.00 106.31 ? 116 GLU A OE2   1 
ATOM   46   N N     . ALA A 1 13  ? 29.299  -17.452 29.252 1.00 67.35  ? 117 ALA A N     1 
ATOM   47   C CA    . ALA A 1 13  ? 29.275  -18.375 28.114 1.00 68.63  ? 117 ALA A CA    1 
ATOM   48   C C     . ALA A 1 13  ? 27.958  -19.150 28.046 1.00 71.62  ? 117 ALA A C     1 
ATOM   49   O O     . ALA A 1 13  ? 27.451  -19.385 26.946 1.00 71.87  ? 117 ALA A O     1 
ATOM   50   C CB    . ALA A 1 13  ? 30.446  -19.346 28.203 1.00 71.15  ? 117 ALA A CB    1 
ATOM   51   N N     . GLU A 1 14  ? 27.400  -19.526 29.219 1.00 72.61  ? 118 GLU A N     1 
ATOM   52   C CA    . GLU A 1 14  ? 26.139  -20.264 29.289 1.00 71.29  ? 118 GLU A CA    1 
ATOM   53   C C     . GLU A 1 14  ? 24.962  -19.348 28.978 1.00 70.17  ? 118 GLU A C     1 
ATOM   54   O O     . GLU A 1 14  ? 24.066  -19.743 28.230 1.00 68.94  ? 118 GLU A O     1 
ATOM   55   C CB    . GLU A 1 14  ? 25.959  -20.972 30.639 1.00 73.96  ? 118 GLU A CB    1 
ATOM   56   C CG    . GLU A 1 14  ? 25.288  -22.329 30.495 1.00 86.12  ? 118 GLU A CG    1 
ATOM   57   C CD    . GLU A 1 14  ? 24.641  -22.898 31.744 1.00 98.21  ? 118 GLU A CD    1 
ATOM   58   O OE1   . GLU A 1 14  ? 25.377  -23.365 32.645 1.00 85.73  ? 118 GLU A OE1   1 
ATOM   59   O OE2   . GLU A 1 14  ? 23.390  -22.927 31.794 1.00 83.30  ? 118 GLU A OE2   1 
ATOM   60   N N     . LEU A 1 15  ? 24.987  -18.112 29.510 1.00 63.61  ? 119 LEU A N     1 
ATOM   61   C CA    . LEU A 1 15  ? 23.939  -17.117 29.289 1.00 59.78  ? 119 LEU A CA    1 
ATOM   62   C C     . LEU A 1 15  ? 23.827  -16.684 27.829 1.00 63.65  ? 119 LEU A C     1 
ATOM   63   O O     . LEU A 1 15  ? 22.723  -16.376 27.367 1.00 60.95  ? 119 LEU A O     1 
ATOM   64   C CB    . LEU A 1 15  ? 24.151  -15.881 30.168 1.00 58.53  ? 119 LEU A CB    1 
ATOM   65   C CG    . LEU A 1 15  ? 24.212  -16.071 31.687 1.00 63.94  ? 119 LEU A CG    1 
ATOM   66   C CD1   . LEU A 1 15  ? 24.345  -14.721 32.383 1.00 63.41  ? 119 LEU A CD1   1 
ATOM   67   C CD2   . LEU A 1 15  ? 22.977  -16.797 32.219 1.00 65.66  ? 119 LEU A CD2   1 
ATOM   68   N N     . LEU A 1 16  ? 24.960  -16.647 27.104 1.00 62.59  ? 120 LEU A N     1 
ATOM   69   C CA    . LEU A 1 16  ? 24.973  -16.227 25.695 1.00 61.84  ? 120 LEU A CA    1 
ATOM   70   C C     . LEU A 1 16  ? 24.241  -17.195 24.768 1.00 65.23  ? 120 LEU A C     1 
ATOM   71   O O     . LEU A 1 16  ? 23.777  -16.770 23.704 1.00 62.85  ? 120 LEU A O     1 
ATOM   72   C CB    . LEU A 1 16  ? 26.395  -15.943 25.192 1.00 64.46  ? 120 LEU A CB    1 
ATOM   73   C CG    . LEU A 1 16  ? 27.088  -14.748 25.846 1.00 69.60  ? 120 LEU A CG    1 
ATOM   74   C CD1   . LEU A 1 16  ? 28.595  -14.875 25.757 1.00 73.53  ? 120 LEU A CD1   1 
ATOM   75   C CD2   . LEU A 1 16  ? 26.585  -13.424 25.287 1.00 69.74  ? 120 LEU A CD2   1 
ATOM   76   N N     . THR A 1 17  ? 24.092  -18.472 25.195 1.00 63.39  ? 121 THR A N     1 
ATOM   77   C CA    . THR A 1 17  ? 23.393  -19.510 24.428 1.00 64.34  ? 121 THR A CA    1 
ATOM   78   C C     . THR A 1 17  ? 21.892  -19.483 24.702 1.00 63.52  ? 121 THR A C     1 
ATOM   79   O O     . THR A 1 17  ? 21.106  -19.966 23.889 1.00 63.10  ? 121 THR A O     1 
ATOM   80   C CB    . THR A 1 17  ? 23.980  -20.897 24.715 1.00 79.84  ? 121 THR A CB    1 
ATOM   81   O OG1   . THR A 1 17  ? 23.663  -21.280 26.050 1.00 78.64  ? 121 THR A OG1   1 
ATOM   82   C CG2   . THR A 1 17  ? 25.494  -20.977 24.464 1.00 82.16  ? 121 THR A CG2   1 
ATOM   83   N N     . LYS A 1 18  ? 21.505  -18.917 25.852 1.00 56.93  ? 122 LYS A N     1 
ATOM   84   C CA    . LYS A 1 18  ? 20.117  -18.807 26.303 1.00 53.60  ? 122 LYS A CA    1 
ATOM   85   C C     . LYS A 1 18  ? 19.323  -17.769 25.521 1.00 53.60  ? 122 LYS A C     1 
ATOM   86   O O     . LYS A 1 18  ? 19.878  -16.776 25.046 1.00 51.91  ? 122 LYS A O     1 
ATOM   87   C CB    . LYS A 1 18  ? 20.046  -18.494 27.807 1.00 53.86  ? 122 LYS A CB    1 
ATOM   88   C CG    . LYS A 1 18  ? 20.451  -19.666 28.710 1.00 55.08  ? 122 LYS A CG    1 
ATOM   89   C CD    . LYS A 1 18  ? 20.312  -19.320 30.194 1.00 60.87  ? 122 LYS A CD    1 
ATOM   90   C CE    . LYS A 1 18  ? 19.019  -19.821 30.794 1.00 68.15  ? 122 LYS A CE    1 
ATOM   91   N NZ    . LYS A 1 18  ? 18.686  -19.111 32.062 1.00 68.15  ? 122 LYS A NZ    1 
ATOM   92   N N     . THR A 1 19  ? 18.009  -17.995 25.418 1.00 48.79  ? 123 THR A N     1 
ATOM   93   C CA    . THR A 1 19  ? 17.065  -17.094 24.756 1.00 46.43  ? 123 THR A CA    1 
ATOM   94   C C     . THR A 1 19  ? 15.909  -16.774 25.693 1.00 47.57  ? 123 THR A C     1 
ATOM   95   O O     . THR A 1 19  ? 15.677  -17.465 26.696 1.00 49.11  ? 123 THR A O     1 
ATOM   96   C CB    . THR A 1 19  ? 16.578  -17.665 23.414 1.00 51.75  ? 123 THR A CB    1 
ATOM   97   O OG1   . THR A 1 19  ? 15.990  -18.939 23.667 1.00 50.68  ? 123 THR A OG1   1 
ATOM   98   C CG2   . THR A 1 19  ? 17.695  -17.764 22.362 1.00 50.33  ? 123 THR A CG2   1 
ATOM   99   N N     . LEU A 1 20  ? 15.186  -15.716 25.363 1.00 41.43  ? 124 LEU A N     1 
ATOM   100  C CA    . LEU A 1 20  ? 14.084  -15.250 26.182 1.00 40.23  ? 124 LEU A CA    1 
ATOM   101  C C     . LEU A 1 20  ? 12.767  -15.483 25.425 1.00 42.59  ? 124 LEU A C     1 
ATOM   102  O O     . LEU A 1 20  ? 12.580  -14.894 24.369 1.00 41.35  ? 124 LEU A O     1 
ATOM   103  C CB    . LEU A 1 20  ? 14.330  -13.742 26.468 1.00 38.00  ? 124 LEU A CB    1 
ATOM   104  C CG    . LEU A 1 20  ? 13.371  -13.012 27.349 1.00 40.82  ? 124 LEU A CG    1 
ATOM   105  C CD1   . LEU A 1 20  ? 13.363  -13.599 28.769 1.00 40.91  ? 124 LEU A CD1   1 
ATOM   106  C CD2   . LEU A 1 20  ? 13.736  -11.533 27.403 1.00 40.91  ? 124 LEU A CD2   1 
ATOM   107  N N     . PRO A 1 21  ? 11.820  -16.284 25.951 1.00 40.33  ? 125 PRO A N     1 
ATOM   108  C CA    . PRO A 1 21  ? 10.573  -16.504 25.210 1.00 41.16  ? 125 PRO A CA    1 
ATOM   109  C C     . PRO A 1 21  ? 9.680   -15.276 25.099 1.00 42.78  ? 125 PRO A C     1 
ATOM   110  O O     . PRO A 1 21  ? 9.606   -14.462 26.017 1.00 42.72  ? 125 PRO A O     1 
ATOM   111  C CB    . PRO A 1 21  ? 9.898   -17.666 25.978 1.00 45.65  ? 125 PRO A CB    1 
ATOM   112  C CG    . PRO A 1 21  ? 11.024  -18.302 26.800 1.00 49.92  ? 125 PRO A CG    1 
ATOM   113  C CD    . PRO A 1 21  ? 11.843  -17.090 27.192 1.00 43.27  ? 125 PRO A CD    1 
ATOM   114  N N     . ASP A 1 22  ? 8.994   -15.148 23.962 1.00 37.46  ? 126 ASP A N     1 
ATOM   115  C CA    . ASP A 1 22  ? 8.061   -14.042 23.753 1.00 36.78  ? 126 ASP A CA    1 
ATOM   116  C C     . ASP A 1 22  ? 6.812   -14.266 24.604 1.00 38.85  ? 126 ASP A C     1 
ATOM   117  O O     . ASP A 1 22  ? 6.510   -15.396 24.947 1.00 37.03  ? 126 ASP A O     1 
ATOM   118  C CB    . ASP A 1 22  ? 7.620   -14.012 22.281 1.00 38.83  ? 126 ASP A CB    1 
ATOM   119  C CG    . ASP A 1 22  ? 8.697   -13.658 21.283 1.00 45.27  ? 126 ASP A CG    1 
ATOM   120  O OD1   . ASP A 1 22  ? 9.699   -12.990 21.681 1.00 44.50  ? 126 ASP A OD1   1 
ATOM   121  O OD2   . ASP A 1 22  ? 8.526   -13.997 20.108 1.00 52.17  ? 126 ASP A OD2   1 
ATOM   122  N N     . ILE A 1 23  ? 6.077   -13.201 24.912 1.00 34.86  ? 127 ILE A N     1 
ATOM   123  C CA    . ILE A 1 23  ? 4.837   -13.295 25.686 1.00 35.87  ? 127 ILE A CA    1 
ATOM   124  C C     . ILE A 1 23  ? 3.858   -12.588 24.799 1.00 39.82  ? 127 ILE A C     1 
ATOM   125  O O     . ILE A 1 23  ? 3.787   -11.349 24.807 1.00 39.55  ? 127 ILE A O     1 
ATOM   126  C CB    . ILE A 1 23  ? 4.985   -12.622 27.079 1.00 37.76  ? 127 ILE A CB    1 
ATOM   127  C CG1   . ILE A 1 23  ? 6.138   -13.288 27.881 1.00 37.79  ? 127 ILE A CG1   1 
ATOM   128  C CG2   . ILE A 1 23  ? 3.659   -12.741 27.843 1.00 40.79  ? 127 ILE A CG2   1 
ATOM   129  C CD1   . ILE A 1 23  ? 6.449   -12.602 29.181 1.00 34.21  ? 127 ILE A CD1   1 
ATOM   130  N N     . LEU A 1 24  ? 3.225   -13.346 23.926 1.00 37.42  ? 128 LEU A N     1 
ATOM   131  C CA    . LEU A 1 24  ? 2.354   -12.780 22.903 1.00 37.38  ? 128 LEU A CA    1 
ATOM   132  C C     . LEU A 1 24  ? 1.029   -13.476 22.837 1.00 44.77  ? 128 LEU A C     1 
ATOM   133  O O     . LEU A 1 24  ? 0.949   -14.687 23.023 1.00 47.22  ? 128 LEU A O     1 
ATOM   134  C CB    . LEU A 1 24  ? 3.028   -12.843 21.515 1.00 35.90  ? 128 LEU A CB    1 
ATOM   135  C CG    . LEU A 1 24  ? 4.239   -11.931 21.282 1.00 36.48  ? 128 LEU A CG    1 
ATOM   136  C CD1   . LEU A 1 24  ? 4.899   -12.280 19.963 1.00 37.03  ? 128 LEU A CD1   1 
ATOM   137  C CD2   . LEU A 1 24  ? 3.828   -10.443 21.289 1.00 35.58  ? 128 LEU A CD2   1 
ATOM   138  N N     . THR A 1 25  ? -0.024  -12.700 22.591 1.00 41.88  ? 129 THR A N     1 
ATOM   139  C CA    . THR A 1 25  ? -1.382  -13.228 22.421 1.00 45.59  ? 129 THR A CA    1 
ATOM   140  C C     . THR A 1 25  ? -2.073  -12.303 21.422 1.00 48.96  ? 129 THR A C     1 
ATOM   141  O O     . THR A 1 25  ? -1.527  -11.266 21.061 1.00 46.65  ? 129 THR A O     1 
ATOM   142  C CB    . THR A 1 25  ? -2.187  -13.306 23.761 1.00 56.65  ? 129 THR A CB    1 
ATOM   143  O OG1   . THR A 1 25  ? -2.591  -12.008 24.191 1.00 58.53  ? 129 THR A OG1   1 
ATOM   144  C CG2   . THR A 1 25  ? -1.464  -14.031 24.880 1.00 58.38  ? 129 THR A CG2   1 
ATOM   145  N N     . PHE A 1 26  ? -3.276  -12.663 21.011 1.00 49.77  ? 130 PHE A N     1 
ATOM   146  C CA    . PHE A 1 26  ? -4.106  -11.849 20.136 1.00 50.59  ? 130 PHE A CA    1 
ATOM   147  C C     . PHE A 1 26  ? -4.833  -10.824 21.014 1.00 55.03  ? 130 PHE A C     1 
ATOM   148  O O     . PHE A 1 26  ? -4.848  -10.967 22.245 1.00 55.47  ? 130 PHE A O     1 
ATOM   149  C CB    . PHE A 1 26  ? -5.130  -12.751 19.405 1.00 55.68  ? 130 PHE A CB    1 
ATOM   150  C CG    . PHE A 1 26  ? -4.470  -13.825 18.577 1.00 57.35  ? 130 PHE A CG    1 
ATOM   151  C CD1   . PHE A 1 26  ? -3.915  -13.528 17.338 1.00 58.51  ? 130 PHE A CD1   1 
ATOM   152  C CD2   . PHE A 1 26  ? -4.400  -15.136 19.038 1.00 62.95  ? 130 PHE A CD2   1 
ATOM   153  C CE1   . PHE A 1 26  ? -3.268  -14.516 16.588 1.00 60.41  ? 130 PHE A CE1   1 
ATOM   154  C CE2   . PHE A 1 26  ? -3.763  -16.127 18.283 1.00 66.38  ? 130 PHE A CE2   1 
ATOM   155  C CZ    . PHE A 1 26  ? -3.199  -15.810 17.064 1.00 63.03  ? 130 PHE A CZ    1 
ATOM   156  N N     . ASN A 1 27  ? -5.433  -9.804  20.381 1.00 50.92  ? 131 ASN A N     1 
ATOM   157  C CA    . ASN A 1 27  ? -6.231  -8.745  21.014 1.00 52.04  ? 131 ASN A CA    1 
ATOM   158  C C     . ASN A 1 27  ? -5.456  -7.928  22.084 1.00 53.40  ? 131 ASN A C     1 
ATOM   159  O O     . ASN A 1 27  ? -6.073  -7.443  23.034 1.00 55.99  ? 131 ASN A O     1 
ATOM   160  C CB    . ASN A 1 27  ? -7.568  -9.303  21.578 1.00 56.91  ? 131 ASN A CB    1 
ATOM   161  C CG    . ASN A 1 27  ? -8.316  -10.252 20.663 1.00 81.68  ? 131 ASN A CG    1 
ATOM   162  O OD1   . ASN A 1 27  ? -8.511  -10.002 19.468 1.00 72.54  ? 131 ASN A OD1   1 
ATOM   163  N ND2   . ASN A 1 27  ? -8.784  -11.361 21.222 1.00 82.14  ? 131 ASN A ND2   1 
ATOM   164  N N     . LEU A 1 28  ? -4.117  -7.784  21.932 1.00 44.83  ? 132 LEU A N     1 
ATOM   165  C CA    . LEU A 1 28  ? -3.299  -6.989  22.856 1.00 43.64  ? 132 LEU A CA    1 
ATOM   166  C C     . LEU A 1 28  ? -3.367  -5.508  22.496 1.00 47.49  ? 132 LEU A C     1 
ATOM   167  O O     . LEU A 1 28  ? -3.480  -5.159  21.323 1.00 47.85  ? 132 LEU A O     1 
ATOM   168  C CB    . LEU A 1 28  ? -1.808  -7.419  22.856 1.00 40.22  ? 132 LEU A CB    1 
ATOM   169  C CG    . LEU A 1 28  ? -1.422  -8.762  23.482 1.00 43.65  ? 132 LEU A CG    1 
ATOM   170  C CD1   . LEU A 1 28  ? 0.079   -8.981  23.393 1.00 40.34  ? 132 LEU A CD1   1 
ATOM   171  C CD2   . LEU A 1 28  ? -1.824  -8.850  24.936 1.00 45.32  ? 132 LEU A CD2   1 
ATOM   172  N N     . ASP A 1 29  ? -3.281  -4.634  23.492 1.00 43.91  ? 133 ASP A N     1 
ATOM   173  C CA    . ASP A 1 29  ? -3.257  -3.199  23.230 1.00 42.44  ? 133 ASP A CA    1 
ATOM   174  C C     . ASP A 1 29  ? -1.857  -2.800  22.820 1.00 44.69  ? 133 ASP A C     1 
ATOM   175  O O     . ASP A 1 29  ? -1.673  -1.882  22.001 1.00 44.07  ? 133 ASP A O     1 
ATOM   176  C CB    . ASP A 1 29  ? -3.586  -2.416  24.497 1.00 45.81  ? 133 ASP A CB    1 
ATOM   177  C CG    . ASP A 1 29  ? -4.991  -2.615  25.027 1.00 57.09  ? 133 ASP A CG    1 
ATOM   178  O OD1   . ASP A 1 29  ? -5.938  -2.617  24.212 1.00 58.33  ? 133 ASP A OD1   1 
ATOM   179  O OD2   . ASP A 1 29  ? -5.149  -2.699  26.263 1.00 60.72  ? 133 ASP A OD2   1 
ATOM   180  N N     . ILE A 1 30  ? -0.857  -3.440  23.456 1.00 37.96  ? 134 ILE A N     1 
ATOM   181  C CA    . ILE A 1 30  ? 0.544   -3.066  23.323 1.00 34.01  ? 134 ILE A CA    1 
ATOM   182  C C     . ILE A 1 30  ? 1.469   -4.268  23.267 1.00 37.60  ? 134 ILE A C     1 
ATOM   183  O O     . ILE A 1 30  ? 1.287   -5.224  24.008 1.00 40.12  ? 134 ILE A O     1 
ATOM   184  C CB    . ILE A 1 30  ? 0.910   -2.148  24.549 1.00 36.72  ? 134 ILE A CB    1 
ATOM   185  C CG1   . ILE A 1 30  ? 0.208   -0.759  24.478 1.00 35.98  ? 134 ILE A CG1   1 
ATOM   186  C CG2   . ILE A 1 30  ? 2.447   -1.992  24.717 1.00 37.26  ? 134 ILE A CG2   1 
ATOM   187  C CD1   . ILE A 1 30  ? 0.097   0.006   25.808 1.00 43.00  ? 134 ILE A CD1   1 
ATOM   188  N N     . VAL A 1 31  ? 2.496   -4.184  22.423 1.00 32.36  ? 135 VAL A N     1 
ATOM   189  C CA    . VAL A 1 31  ? 3.563   -5.165  22.389 1.00 31.67  ? 135 VAL A CA    1 
ATOM   190  C C     . VAL A 1 31  ? 4.827   -4.351  22.574 1.00 34.04  ? 135 VAL A C     1 
ATOM   191  O O     . VAL A 1 31  ? 5.084   -3.453  21.768 1.00 34.74  ? 135 VAL A O     1 
ATOM   192  C CB    . VAL A 1 31  ? 3.616   -6.064  21.118 1.00 35.22  ? 135 VAL A CB    1 
ATOM   193  C CG1   . VAL A 1 31  ? 4.898   -6.894  21.108 1.00 33.70  ? 135 VAL A CG1   1 
ATOM   194  C CG2   . VAL A 1 31  ? 2.414   -7.000  21.073 1.00 36.70  ? 135 VAL A CG2   1 
ATOM   195  N N     . ILE A 1 32  ? 5.559   -4.608  23.672 1.00 29.59  ? 136 ILE A N     1 
ATOM   196  C CA    . ILE A 1 32  ? 6.849   -3.966  23.977 1.00 27.15  ? 136 ILE A CA    1 
ATOM   197  C C     . ILE A 1 32  ? 7.902   -4.757  23.207 1.00 29.69  ? 136 ILE A C     1 
ATOM   198  O O     . ILE A 1 32  ? 8.065   -5.964  23.412 1.00 30.03  ? 136 ILE A O     1 
ATOM   199  C CB    . ILE A 1 32  ? 7.164   -3.921  25.495 1.00 30.99  ? 136 ILE A CB    1 
ATOM   200  C CG1   . ILE A 1 32  ? 6.028   -3.232  26.305 1.00 33.30  ? 136 ILE A CG1   1 
ATOM   201  C CG2   . ILE A 1 32  ? 8.526   -3.217  25.767 1.00 32.74  ? 136 ILE A CG2   1 
ATOM   202  C CD1   . ILE A 1 32  ? 5.835   -1.721  26.060 1.00 31.48  ? 136 ILE A CD1   1 
ATOM   203  N N     . ILE A 1 33  ? 8.625   -4.078  22.342 1.00 25.59  ? 137 ILE A N     1 
ATOM   204  C CA    . ILE A 1 33  ? 9.663   -4.711  21.519 1.00 23.96  ? 137 ILE A CA    1 
ATOM   205  C C     . ILE A 1 33  ? 10.987  -4.238  22.006 1.00 28.49  ? 137 ILE A C     1 
ATOM   206  O O     . ILE A 1 33  ? 11.295  -3.070  21.828 1.00 25.85  ? 137 ILE A O     1 
ATOM   207  C CB    . ILE A 1 33  ? 9.453   -4.349  20.033 1.00 27.11  ? 137 ILE A CB    1 
ATOM   208  C CG1   . ILE A 1 33  ? 8.058   -4.799  19.529 1.00 27.98  ? 137 ILE A CG1   1 
ATOM   209  C CG2   . ILE A 1 33  ? 10.605  -4.907  19.141 1.00 27.44  ? 137 ILE A CG2   1 
ATOM   210  C CD1   . ILE A 1 33  ? 7.578   -3.992  18.161 1.00 31.14  ? 137 ILE A CD1   1 
ATOM   211  N N     . GLY A 1 34  ? 11.735  -5.123  22.664 1.00 29.04  ? 138 GLY A N     1 
ATOM   212  C CA    . GLY A 1 34  ? 13.071  -4.805  23.160 1.00 28.78  ? 138 GLY A CA    1 
ATOM   213  C C     . GLY A 1 34  ? 14.075  -4.963  22.043 1.00 32.96  ? 138 GLY A C     1 
ATOM   214  O O     . GLY A 1 34  ? 13.701  -5.283  20.917 1.00 31.18  ? 138 GLY A O     1 
ATOM   215  N N     . ILE A 1 35  ? 15.350  -4.695  22.316 1.00 31.16  ? 139 ILE A N     1 
ATOM   216  C CA    . ILE A 1 35  ? 16.382  -4.796  21.273 1.00 31.04  ? 139 ILE A CA    1 
ATOM   217  C C     . ILE A 1 35  ? 16.773  -6.286  21.142 1.00 36.24  ? 139 ILE A C     1 
ATOM   218  O O     . ILE A 1 35  ? 16.560  -6.895  20.099 1.00 34.13  ? 139 ILE A O     1 
ATOM   219  C CB    . ILE A 1 35  ? 17.556  -3.862  21.681 1.00 34.96  ? 139 ILE A CB    1 
ATOM   220  C CG1   . ILE A 1 35  ? 17.025  -2.405  21.798 1.00 35.87  ? 139 ILE A CG1   1 
ATOM   221  C CG2   . ILE A 1 35  ? 18.758  -3.999  20.702 1.00 35.66  ? 139 ILE A CG2   1 
ATOM   222  C CD1   . ILE A 1 35  ? 17.937  -1.313  22.474 1.00 39.75  ? 139 ILE A CD1   1 
ATOM   223  N N     . ASN A 1 36  ? 17.277  -6.879  22.251 1.00 32.29  ? 140 ASN A N     1 
ATOM   224  C CA    . ASN A 1 36  ? 17.633  -8.286  22.342 1.00 32.17  ? 140 ASN A CA    1 
ATOM   225  C C     . ASN A 1 36  ? 17.827  -8.558  23.816 1.00 39.66  ? 140 ASN A C     1 
ATOM   226  O O     . ASN A 1 36  ? 18.071  -7.614  24.559 1.00 40.85  ? 140 ASN A O     1 
ATOM   227  C CB    . ASN A 1 36  ? 18.942  -8.597  21.580 1.00 33.31  ? 140 ASN A CB    1 
ATOM   228  C CG    . ASN A 1 36  ? 20.168  -8.068  22.249 1.00 48.58  ? 140 ASN A CG    1 
ATOM   229  O OD1   . ASN A 1 36  ? 20.274  -6.874  22.542 1.00 50.53  ? 140 ASN A OD1   1 
ATOM   230  N ND2   . ASN A 1 36  ? 21.134  -8.936  22.447 1.00 36.00  ? 140 ASN A ND2   1 
ATOM   231  N N     . PRO A 1 37  ? 17.804  -9.821  24.272 1.00 36.72  ? 141 PRO A N     1 
ATOM   232  C CA    . PRO A 1 37  ? 17.984  -10.059 25.706 1.00 37.58  ? 141 PRO A CA    1 
ATOM   233  C C     . PRO A 1 37  ? 19.393  -9.750  26.165 1.00 43.44  ? 141 PRO A C     1 
ATOM   234  O O     . PRO A 1 37  ? 20.365  -10.067 25.489 1.00 43.02  ? 141 PRO A O     1 
ATOM   235  C CB    . PRO A 1 37  ? 17.652  -11.552 25.863 1.00 40.00  ? 141 PRO A CB    1 
ATOM   236  C CG    . PRO A 1 37  ? 16.990  -11.950 24.581 1.00 41.99  ? 141 PRO A CG    1 
ATOM   237  C CD    . PRO A 1 37  ? 17.543  -11.077 23.541 1.00 36.90  ? 141 PRO A CD    1 
ATOM   238  N N     . GLY A 1 38  ? 19.477  -9.094  27.304 1.00 43.12  ? 142 GLY A N     1 
ATOM   239  C CA    . GLY A 1 38  ? 20.740  -8.858  27.986 1.00 45.34  ? 142 GLY A CA    1 
ATOM   240  C C     . GLY A 1 38  ? 21.046  -10.100 28.814 1.00 51.21  ? 142 GLY A C     1 
ATOM   241  O O     . GLY A 1 38  ? 20.245  -11.049 28.852 1.00 49.91  ? 142 GLY A O     1 
ATOM   242  N N     . LEU A 1 39  ? 22.205  -10.112 29.476 1.00 48.82  ? 143 LEU A N     1 
ATOM   243  C CA    . LEU A 1 39  ? 22.637  -11.239 30.299 1.00 49.32  ? 143 LEU A CA    1 
ATOM   244  C C     . LEU A 1 39  ? 21.681  -11.576 31.449 1.00 50.94  ? 143 LEU A C     1 
ATOM   245  O O     . LEU A 1 39  ? 21.366  -12.755 31.657 1.00 49.79  ? 143 LEU A O     1 
ATOM   246  C CB    . LEU A 1 39  ? 24.067  -11.013 30.800 1.00 51.70  ? 143 LEU A CB    1 
ATOM   247  C CG    . LEU A 1 39  ? 25.184  -11.069 29.743 1.00 57.53  ? 143 LEU A CG    1 
ATOM   248  C CD1   . LEU A 1 39  ? 26.529  -10.826 30.387 1.00 60.72  ? 143 LEU A CD1   1 
ATOM   249  C CD2   . LEU A 1 39  ? 25.219  -12.425 29.029 1.00 60.48  ? 143 LEU A CD2   1 
ATOM   250  N N     . MET A 1 40  ? 21.186  -10.557 32.165 1.00 47.19  ? 144 MET A N     1 
ATOM   251  C CA    . MET A 1 40  ? 20.268  -10.778 33.284 1.00 47.15  ? 144 MET A CA    1 
ATOM   252  C C     . MET A 1 40  ? 18.912  -11.323 32.814 1.00 47.52  ? 144 MET A C     1 
ATOM   253  O O     . MET A 1 40  ? 18.345  -12.177 33.492 1.00 47.11  ? 144 MET A O     1 
ATOM   254  C CB    . MET A 1 40  ? 20.105  -9.489  34.120 1.00 50.90  ? 144 MET A CB    1 
ATOM   255  C CG    . MET A 1 40  ? 19.321  -9.688  35.405 1.00 55.93  ? 144 MET A CG    1 
ATOM   256  S SD    . MET A 1 40  ? 20.104  -10.908 36.469 1.00 63.10  ? 144 MET A SD    1 
ATOM   257  C CE    . MET A 1 40  ? 21.292  -9.835  37.313 1.00 62.62  ? 144 MET A CE    1 
ATOM   258  N N     . ALA A 1 41  ? 18.384  -10.826 31.670 1.00 40.63  ? 145 ALA A N     1 
ATOM   259  C CA    . ALA A 1 41  ? 17.122  -11.321 31.098 1.00 39.66  ? 145 ALA A CA    1 
ATOM   260  C C     . ALA A 1 41  ? 17.248  -12.780 30.691 1.00 44.20  ? 145 ALA A C     1 
ATOM   261  O O     . ALA A 1 41  ? 16.370  -13.579 31.023 1.00 45.07  ? 145 ALA A O     1 
ATOM   262  C CB    . ALA A 1 41  ? 16.695  -10.479 29.910 1.00 37.92  ? 145 ALA A CB    1 
ATOM   263  N N     . ALA A 1 42  ? 18.356  -13.139 30.024 1.00 40.90  ? 146 ALA A N     1 
ATOM   264  C CA    . ALA A 1 42  ? 18.651  -14.518 29.629 1.00 41.43  ? 146 ALA A CA    1 
ATOM   265  C C     . ALA A 1 42  ? 18.713  -15.401 30.885 1.00 47.76  ? 146 ALA A C     1 
ATOM   266  O O     . ALA A 1 42  ? 18.163  -16.511 30.892 1.00 48.65  ? 146 ALA A O     1 
ATOM   267  C CB    . ALA A 1 42  ? 19.982  -14.575 28.904 1.00 42.04  ? 146 ALA A CB    1 
ATOM   268  N N     . TYR A 1 43  ? 19.381  -14.900 31.948 1.00 45.69  ? 147 TYR A N     1 
ATOM   269  C CA    . TYR A 1 43  ? 19.508  -15.606 33.221 1.00 47.29  ? 147 TYR A CA    1 
ATOM   270  C C     . TYR A 1 43  ? 18.140  -15.907 33.868 1.00 50.44  ? 147 TYR A C     1 
ATOM   271  O O     . TYR A 1 43  ? 17.861  -17.057 34.220 1.00 51.77  ? 147 TYR A O     1 
ATOM   272  C CB    . TYR A 1 43  ? 20.409  -14.816 34.208 1.00 48.18  ? 147 TYR A CB    1 
ATOM   273  C CG    . TYR A 1 43  ? 20.596  -15.512 35.541 1.00 51.42  ? 147 TYR A CG    1 
ATOM   274  C CD1   . TYR A 1 43  ? 19.710  -15.298 36.598 1.00 53.91  ? 147 TYR A CD1   1 
ATOM   275  C CD2   . TYR A 1 43  ? 21.657  -16.384 35.751 1.00 54.42  ? 147 TYR A CD2   1 
ATOM   276  C CE1   . TYR A 1 43  ? 19.853  -15.975 37.817 1.00 53.47  ? 147 TYR A CE1   1 
ATOM   277  C CE2   . TYR A 1 43  ? 21.833  -17.031 36.975 1.00 57.54  ? 147 TYR A CE2   1 
ATOM   278  C CZ    . TYR A 1 43  ? 20.927  -16.827 38.004 1.00 62.27  ? 147 TYR A CZ    1 
ATOM   279  O OH    . TYR A 1 43  ? 21.107  -17.486 39.206 1.00 68.84  ? 147 TYR A OH    1 
ATOM   280  N N     . LYS A 1 44  ? 17.339  -14.864 34.080 1.00 45.69  ? 148 LYS A N     1 
ATOM   281  C CA    . LYS A 1 44  ? 16.057  -14.943 34.791 1.00 45.60  ? 148 LYS A CA    1 
ATOM   282  C C     . LYS A 1 44  ? 14.956  -15.600 33.959 1.00 50.16  ? 148 LYS A C     1 
ATOM   283  O O     . LYS A 1 44  ? 14.062  -16.227 34.524 1.00 50.10  ? 148 LYS A O     1 
ATOM   284  C CB    . LYS A 1 44  ? 15.624  -13.537 35.245 1.00 44.90  ? 148 LYS A CB    1 
ATOM   285  C CG    . LYS A 1 44  ? 16.558  -12.876 36.264 1.00 46.08  ? 148 LYS A CG    1 
ATOM   286  C CD    . LYS A 1 44  ? 16.369  -13.455 37.674 1.00 48.47  ? 148 LYS A CD    1 
ATOM   287  C CE    . LYS A 1 44  ? 17.364  -12.920 38.674 1.00 53.42  ? 148 LYS A CE    1 
ATOM   288  N NZ    . LYS A 1 44  ? 17.085  -13.433 40.049 1.00 57.17  ? 148 LYS A NZ    1 
ATOM   289  N N     . GLY A 1 45  ? 15.005  -15.417 32.638 1.00 45.21  ? 149 GLY A N     1 
ATOM   290  C CA    . GLY A 1 45  ? 13.973  -15.936 31.744 1.00 43.62  ? 149 GLY A CA    1 
ATOM   291  C C     . GLY A 1 45  ? 12.754  -15.030 31.783 1.00 44.72  ? 149 GLY A C     1 
ATOM   292  O O     . GLY A 1 45  ? 11.644  -15.416 31.396 1.00 43.68  ? 149 GLY A O     1 
ATOM   293  N N     . HIS A 1 46  ? 12.963  -13.792 32.249 1.00 38.66  ? 150 HIS A N     1 
ATOM   294  C CA    . HIS A 1 46  ? 11.900  -12.807 32.292 1.00 37.21  ? 150 HIS A CA    1 
ATOM   295  C C     . HIS A 1 46  ? 12.373  -11.486 31.655 1.00 37.49  ? 150 HIS A C     1 
ATOM   296  O O     . HIS A 1 46  ? 13.565  -11.194 31.654 1.00 36.90  ? 150 HIS A O     1 
ATOM   297  C CB    . HIS A 1 46  ? 11.375  -12.602 33.722 1.00 38.85  ? 150 HIS A CB    1 
ATOM   298  C CG    . HIS A 1 46  ? 10.686  -13.810 34.297 1.00 44.13  ? 150 HIS A CG    1 
ATOM   299  N ND1   . HIS A 1 46  ? 9.332   -14.033 34.111 1.00 45.45  ? 150 HIS A ND1   1 
ATOM   300  C CD2   . HIS A 1 46  ? 11.181  -14.776 35.107 1.00 48.01  ? 150 HIS A CD2   1 
ATOM   301  C CE1   . HIS A 1 46  ? 9.066   -15.161 34.745 1.00 48.04  ? 150 HIS A CE1   1 
ATOM   302  N NE2   . HIS A 1 46  ? 10.150  -15.650 35.355 1.00 49.18  ? 150 HIS A NE2   1 
ATOM   303  N N     . HIS A 1 47  ? 11.428  -10.695 31.159 1.00 33.06  ? 151 HIS A N     1 
ATOM   304  C CA    . HIS A 1 47  ? 11.657  -9.412  30.492 1.00 32.30  ? 151 HIS A CA    1 
ATOM   305  C C     . HIS A 1 47  ? 12.007  -8.266  31.466 1.00 35.23  ? 151 HIS A C     1 
ATOM   306  O O     . HIS A 1 47  ? 11.299  -8.077  32.444 1.00 32.75  ? 151 HIS A O     1 
ATOM   307  C CB    . HIS A 1 47  ? 10.436  -9.067  29.624 1.00 32.65  ? 151 HIS A CB    1 
ATOM   308  C CG    . HIS A 1 47  ? 10.201  -10.091 28.539 1.00 37.45  ? 151 HIS A CG    1 
ATOM   309  N ND1   . HIS A 1 47  ? 10.614  -9.862  27.228 1.00 38.67  ? 151 HIS A ND1   1 
ATOM   310  C CD2   . HIS A 1 47  ? 9.681   -11.337 28.616 1.00 40.54  ? 151 HIS A CD2   1 
ATOM   311  C CE1   . HIS A 1 47  ? 10.314  -10.966 26.557 1.00 38.62  ? 151 HIS A CE1   1 
ATOM   312  N NE2   . HIS A 1 47  ? 9.757   -11.881 27.341 1.00 40.21  ? 151 HIS A NE2   1 
ATOM   313  N N     . TYR A 1 48  ? 13.073  -7.491  31.146 1.00 32.80  ? 152 TYR A N     1 
ATOM   314  C CA    . TYR A 1 48  ? 13.602  -6.319  31.880 1.00 33.80  ? 152 TYR A CA    1 
ATOM   315  C C     . TYR A 1 48  ? 13.846  -6.568  33.377 1.00 38.53  ? 152 TYR A C     1 
ATOM   316  O O     . TYR A 1 48  ? 13.344  -5.826  34.205 1.00 35.79  ? 152 TYR A O     1 
ATOM   317  C CB    . TYR A 1 48  ? 12.727  -5.072  31.659 1.00 33.14  ? 152 TYR A CB    1 
ATOM   318  C CG    . TYR A 1 48  ? 12.469  -4.885  30.188 1.00 30.80  ? 152 TYR A CG    1 
ATOM   319  C CD1   . TYR A 1 48  ? 13.482  -4.459  29.334 1.00 30.78  ? 152 TYR A CD1   1 
ATOM   320  C CD2   . TYR A 1 48  ? 11.238  -5.216  29.629 1.00 31.44  ? 152 TYR A CD2   1 
ATOM   321  C CE1   . TYR A 1 48  ? 13.281  -4.385  27.948 1.00 32.30  ? 152 TYR A CE1   1 
ATOM   322  C CE2   . TYR A 1 48  ? 11.024  -5.134  28.249 1.00 31.90  ? 152 TYR A CE2   1 
ATOM   323  C CZ    . TYR A 1 48  ? 12.036  -4.671  27.422 1.00 33.41  ? 152 TYR A CZ    1 
ATOM   324  O OH    . TYR A 1 48  ? 11.804  -4.493  26.083 1.00 30.37  ? 152 TYR A OH    1 
ATOM   325  N N     . PRO A 1 49  ? 14.678  -7.572  33.715 1.00 37.93  ? 153 PRO A N     1 
ATOM   326  C CA    . PRO A 1 49  ? 15.010  -7.815  35.113 1.00 39.82  ? 153 PRO A CA    1 
ATOM   327  C C     . PRO A 1 49  ? 16.170  -6.941  35.603 1.00 46.53  ? 153 PRO A C     1 
ATOM   328  O O     . PRO A 1 49  ? 16.473  -6.966  36.802 1.00 50.15  ? 153 PRO A O     1 
ATOM   329  C CB    . PRO A 1 49  ? 15.393  -9.286  35.112 1.00 41.73  ? 153 PRO A CB    1 
ATOM   330  C CG    . PRO A 1 49  ? 16.002  -9.492  33.819 1.00 45.02  ? 153 PRO A CG    1 
ATOM   331  C CD    . PRO A 1 49  ? 15.391  -8.530  32.837 1.00 39.13  ? 153 PRO A CD    1 
ATOM   332  N N     . GLY A 1 50  ? 16.809  -6.199  34.690 1.00 41.64  ? 154 GLY A N     1 
ATOM   333  C CA    . GLY A 1 50  ? 17.926  -5.308  35.018 1.00 44.99  ? 154 GLY A CA    1 
ATOM   334  C C     . GLY A 1 50  ? 17.566  -4.445  36.217 1.00 52.84  ? 154 GLY A C     1 
ATOM   335  O O     . GLY A 1 50  ? 16.550  -3.748  36.150 1.00 53.90  ? 154 GLY A O     1 
ATOM   336  N N     . PRO A 1 51  ? 18.285  -4.565  37.377 1.00 50.44  ? 155 PRO A N     1 
ATOM   337  C CA    . PRO A 1 51  ? 17.892  -3.789  38.577 1.00 52.21  ? 155 PRO A CA    1 
ATOM   338  C C     . PRO A 1 51  ? 17.851  -2.283  38.363 1.00 54.14  ? 155 PRO A C     1 
ATOM   339  O O     . PRO A 1 51  ? 17.122  -1.572  39.061 1.00 54.70  ? 155 PRO A O     1 
ATOM   340  C CB    . PRO A 1 51  ? 18.897  -4.208  39.663 1.00 57.73  ? 155 PRO A CB    1 
ATOM   341  C CG    . PRO A 1 51  ? 19.987  -4.935  38.966 1.00 62.02  ? 155 PRO A CG    1 
ATOM   342  C CD    . PRO A 1 51  ? 19.476  -5.404  37.623 1.00 54.41  ? 155 PRO A CD    1 
ATOM   343  N N     . GLY A 1 52  ? 18.586  -1.835  37.353 1.00 49.16  ? 156 GLY A N     1 
ATOM   344  C CA    . GLY A 1 52  ? 18.644  -0.439  36.948 1.00 47.97  ? 156 GLY A CA    1 
ATOM   345  C C     . GLY A 1 52  ? 17.795  -0.145  35.730 1.00 45.49  ? 156 GLY A C     1 
ATOM   346  O O     . GLY A 1 52  ? 17.606  1.020   35.400 1.00 44.41  ? 156 GLY A O     1 
ATOM   347  N N     . ASN A 1 53  ? 17.247  -1.181  35.052 1.00 42.16  ? 157 ASN A N     1 
ATOM   348  C CA    . ASN A 1 53  ? 16.408  -0.947  33.872 1.00 38.57  ? 157 ASN A CA    1 
ATOM   349  C C     . ASN A 1 53  ? 15.160  -0.195  34.320 1.00 41.58  ? 157 ASN A C     1 
ATOM   350  O O     . ASN A 1 53  ? 14.682  -0.409  35.429 1.00 44.14  ? 157 ASN A O     1 
ATOM   351  C CB    . ASN A 1 53  ? 16.069  -2.265  33.153 1.00 38.78  ? 157 ASN A CB    1 
ATOM   352  C CG    . ASN A 1 53  ? 15.594  -2.048  31.754 1.00 40.03  ? 157 ASN A CG    1 
ATOM   353  O OD1   . ASN A 1 53  ? 14.446  -1.691  31.523 1.00 36.89  ? 157 ASN A OD1   1 
ATOM   354  N ND2   . ASN A 1 53  ? 16.451  -2.303  30.787 1.00 34.21  ? 157 ASN A ND2   1 
ATOM   355  N N     . HIS A 1 54  ? 14.700  0.748   33.511 1.00 35.68  ? 158 HIS A N     1 
ATOM   356  C CA    . HIS A 1 54  ? 13.621  1.650   33.881 1.00 33.73  ? 158 HIS A CA    1 
ATOM   357  C C     . HIS A 1 54  ? 12.251  1.159   33.457 1.00 36.68  ? 158 HIS A C     1 
ATOM   358  O O     . HIS A 1 54  ? 11.258  1.784   33.847 1.00 37.63  ? 158 HIS A O     1 
ATOM   359  C CB    . HIS A 1 54  ? 13.883  3.048   33.274 1.00 31.97  ? 158 HIS A CB    1 
ATOM   360  C CG    . HIS A 1 54  ? 15.161  3.706   33.692 1.00 35.60  ? 158 HIS A CG    1 
ATOM   361  N ND1   . HIS A 1 54  ? 15.828  4.568   32.842 1.00 37.03  ? 158 HIS A ND1   1 
ATOM   362  C CD2   . HIS A 1 54  ? 15.815  3.679   34.882 1.00 39.19  ? 158 HIS A CD2   1 
ATOM   363  C CE1   . HIS A 1 54  ? 16.872  5.023   33.521 1.00 37.44  ? 158 HIS A CE1   1 
ATOM   364  N NE2   . HIS A 1 54  ? 16.927  4.483   34.742 1.00 39.96  ? 158 HIS A NE2   1 
ATOM   365  N N     . PHE A 1 55  ? 12.173  0.034   32.705 1.00 32.33  ? 159 PHE A N     1 
ATOM   366  C CA    . PHE A 1 55  ? 10.889  -0.409  32.170 1.00 30.96  ? 159 PHE A CA    1 
ATOM   367  C C     . PHE A 1 55  ? 9.771   -0.534  33.241 1.00 35.29  ? 159 PHE A C     1 
ATOM   368  O O     . PHE A 1 55  ? 8.718   0.076   33.062 1.00 34.22  ? 159 PHE A O     1 
ATOM   369  C CB    . PHE A 1 55  ? 11.005  -1.695  31.342 1.00 31.74  ? 159 PHE A CB    1 
ATOM   370  C CG    . PHE A 1 55  ? 9.651   -2.219  30.940 1.00 32.59  ? 159 PHE A CG    1 
ATOM   371  C CD1   . PHE A 1 55  ? 8.964   -1.664  29.862 1.00 33.56  ? 159 PHE A CD1   1 
ATOM   372  C CD2   . PHE A 1 55  ? 9.031   -3.234  31.677 1.00 34.01  ? 159 PHE A CD2   1 
ATOM   373  C CE1   . PHE A 1 55  ? 7.694   -2.126  29.520 1.00 33.22  ? 159 PHE A CE1   1 
ATOM   374  C CE2   . PHE A 1 55  ? 7.768   -3.701  31.323 1.00 33.84  ? 159 PHE A CE2   1 
ATOM   375  C CZ    . PHE A 1 55  ? 7.106   -3.137  30.259 1.00 31.03  ? 159 PHE A CZ    1 
ATOM   376  N N     . TRP A 1 56  ? 9.955   -1.371  34.267 1.00 33.59  ? 160 TRP A N     1 
ATOM   377  C CA    . TRP A 1 56  ? 8.895   -1.604  35.256 1.00 36.25  ? 160 TRP A CA    1 
ATOM   378  C C     . TRP A 1 56  ? 8.544   -0.352  36.070 1.00 42.23  ? 160 TRP A C     1 
ATOM   379  O O     . TRP A 1 56  ? 7.372   -0.137  36.369 1.00 43.28  ? 160 TRP A O     1 
ATOM   380  C CB    . TRP A 1 56  ? 9.203   -2.794  36.164 1.00 36.39  ? 160 TRP A CB    1 
ATOM   381  C CG    . TRP A 1 56  ? 9.329   -4.074  35.409 1.00 36.87  ? 160 TRP A CG    1 
ATOM   382  C CD1   . TRP A 1 56  ? 10.485  -4.673  35.004 1.00 38.29  ? 160 TRP A CD1   1 
ATOM   383  C CD2   . TRP A 1 56  ? 8.255   -4.838  34.835 1.00 37.36  ? 160 TRP A CD2   1 
ATOM   384  N NE1   . TRP A 1 56  ? 10.199  -5.798  34.263 1.00 36.56  ? 160 TRP A NE1   1 
ATOM   385  C CE2   . TRP A 1 56  ? 8.841   -5.913  34.125 1.00 38.34  ? 160 TRP A CE2   1 
ATOM   386  C CE3   . TRP A 1 56  ? 6.849   -4.755  34.909 1.00 40.21  ? 160 TRP A CE3   1 
ATOM   387  C CZ2   . TRP A 1 56  ? 8.078   -6.896  33.487 1.00 37.67  ? 160 TRP A CZ2   1 
ATOM   388  C CZ3   . TRP A 1 56  ? 6.091   -5.723  34.272 1.00 42.34  ? 160 TRP A CZ3   1 
ATOM   389  C CH2   . TRP A 1 56  ? 6.706   -6.780  33.563 1.00 42.07  ? 160 TRP A CH2   1 
ATOM   390  N N     . LYS A 1 57  ? 9.551   0.449   36.443 1.00 40.59  ? 161 LYS A N     1 
ATOM   391  C CA    . LYS A 1 57  ? 9.376   1.705   37.177 1.00 42.47  ? 161 LYS A CA    1 
ATOM   392  C C     . LYS A 1 57  ? 8.503   2.646   36.341 1.00 44.27  ? 161 LYS A C     1 
ATOM   393  O O     . LYS A 1 57  ? 7.515   3.185   36.858 1.00 44.10  ? 161 LYS A O     1 
ATOM   394  C CB    . LYS A 1 57  ? 10.740  2.378   37.395 1.00 47.63  ? 161 LYS A CB    1 
ATOM   395  C CG    . LYS A 1 57  ? 11.326  2.169   38.759 1.00 68.63  ? 161 LYS A CG    1 
ATOM   396  C CD    . LYS A 1 57  ? 11.573  3.524   39.443 1.00 88.26  ? 161 LYS A CD    1 
ATOM   397  C CE    . LYS A 1 57  ? 12.999  3.997   39.286 1.00 99.64  ? 161 LYS A CE    1 
ATOM   398  N NZ    . LYS A 1 57  ? 13.278  5.228   40.069 1.00 111.85 ? 161 LYS A NZ    1 
ATOM   399  N N     . CYS A 1 58  ? 8.855   2.814   35.031 1.00 38.30  ? 162 CYS A N     1 
ATOM   400  C CA    . CYS A 1 58  ? 8.095   3.646   34.107 1.00 37.39  ? 162 CYS A CA    1 
ATOM   401  C C     . CYS A 1 58  ? 6.692   3.134   33.884 1.00 41.93  ? 162 CYS A C     1 
ATOM   402  O O     . CYS A 1 58  ? 5.788   3.950   33.792 1.00 43.45  ? 162 CYS A O     1 
ATOM   403  C CB    . CYS A 1 58  ? 8.836   3.847   32.793 1.00 35.48  ? 162 CYS A CB    1 
ATOM   404  S SG    . CYS A 1 58  ? 10.281  4.920   32.916 1.00 39.64  ? 162 CYS A SG    1 
ATOM   405  N N     . LEU A 1 59  ? 6.494   1.797   33.784 1.00 36.27  ? 163 LEU A N     1 
ATOM   406  C CA    . LEU A 1 59  ? 5.150   1.199   33.618 1.00 37.05  ? 163 LEU A CA    1 
ATOM   407  C C     . LEU A 1 59  ? 4.231   1.636   34.769 1.00 44.12  ? 163 LEU A C     1 
ATOM   408  O O     . LEU A 1 59  ? 3.056   1.940   34.547 1.00 46.44  ? 163 LEU A O     1 
ATOM   409  C CB    . LEU A 1 59  ? 5.223   -0.348  33.571 1.00 36.90  ? 163 LEU A CB    1 
ATOM   410  C CG    . LEU A 1 59  ? 4.060   -1.050  32.885 1.00 42.00  ? 163 LEU A CG    1 
ATOM   411  C CD1   . LEU A 1 59  ? 4.145   -0.894  31.391 1.00 40.31  ? 163 LEU A CD1   1 
ATOM   412  C CD2   . LEU A 1 59  ? 3.997   -2.533  33.254 1.00 42.71  ? 163 LEU A CD2   1 
ATOM   413  N N     . PHE A 1 60  ? 4.773   1.673   35.995 1.00 40.81  ? 164 PHE A N     1 
ATOM   414  C CA    . PHE A 1 60  ? 4.020   2.088   37.166 1.00 43.08  ? 164 PHE A CA    1 
ATOM   415  C C     . PHE A 1 60  ? 3.873   3.613   37.250 1.00 50.12  ? 164 PHE A C     1 
ATOM   416  O O     . PHE A 1 60  ? 2.746   4.090   37.391 1.00 51.34  ? 164 PHE A O     1 
ATOM   417  C CB    . PHE A 1 60  ? 4.613   1.475   38.454 1.00 44.41  ? 164 PHE A CB    1 
ATOM   418  C CG    . PHE A 1 60  ? 4.051   2.034   39.740 1.00 48.46  ? 164 PHE A CG    1 
ATOM   419  C CD1   . PHE A 1 60  ? 2.701   1.894   40.048 1.00 53.46  ? 164 PHE A CD1   1 
ATOM   420  C CD2   . PHE A 1 60  ? 4.874   2.684   40.653 1.00 51.51  ? 164 PHE A CD2   1 
ATOM   421  C CE1   . PHE A 1 60  ? 2.183   2.381   41.264 1.00 57.56  ? 164 PHE A CE1   1 
ATOM   422  C CE2   . PHE A 1 60  ? 4.353   3.187   41.858 1.00 57.95  ? 164 PHE A CE2   1 
ATOM   423  C CZ    . PHE A 1 60  ? 3.011   3.036   42.150 1.00 57.85  ? 164 PHE A CZ    1 
ATOM   424  N N     . MET A 1 61  ? 4.994   4.370   37.164 1.00 47.22  ? 165 MET A N     1 
ATOM   425  C CA    . MET A 1 61  ? 4.998   5.842   37.241 1.00 49.44  ? 165 MET A CA    1 
ATOM   426  C C     . MET A 1 61  ? 4.052   6.487   36.186 1.00 51.88  ? 165 MET A C     1 
ATOM   427  O O     . MET A 1 61  ? 3.530   7.575   36.420 1.00 52.35  ? 165 MET A O     1 
ATOM   428  C CB    . MET A 1 61  ? 6.432   6.409   37.109 1.00 52.04  ? 165 MET A CB    1 
ATOM   429  C CG    . MET A 1 61  ? 7.357   6.156   38.305 1.00 57.50  ? 165 MET A CG    1 
ATOM   430  S SD    . MET A 1 61  ? 9.127   6.460   37.925 1.00 62.36  ? 165 MET A SD    1 
ATOM   431  C CE    . MET A 1 61  ? 9.245   8.155   38.195 1.00 62.22  ? 165 MET A CE    1 
ATOM   432  N N     . SER A 1 62  ? 3.816   5.796   35.048 1.00 45.90  ? 166 SER A N     1 
ATOM   433  C CA    . SER A 1 62  ? 2.921   6.267   33.983 1.00 45.60  ? 166 SER A CA    1 
ATOM   434  C C     . SER A 1 62  ? 1.449   5.892   34.206 1.00 51.35  ? 166 SER A C     1 
ATOM   435  O O     . SER A 1 62  ? 0.588   6.461   33.542 1.00 53.33  ? 166 SER A O     1 
ATOM   436  C CB    . SER A 1 62  ? 3.360   5.720   32.625 1.00 41.76  ? 166 SER A CB    1 
ATOM   437  O OG    . SER A 1 62  ? 3.161   4.314   32.515 1.00 41.99  ? 166 SER A OG    1 
ATOM   438  N N     . GLY A 1 63  ? 1.186   4.893   35.052 1.00 46.39  ? 167 GLY A N     1 
ATOM   439  C CA    . GLY A 1 63  ? -0.163  4.393   35.295 1.00 47.47  ? 167 GLY A CA    1 
ATOM   440  C C     . GLY A 1 63  ? -0.573  3.269   34.361 1.00 50.16  ? 167 GLY A C     1 
ATOM   441  O O     . GLY A 1 63  ? -1.748  2.894   34.326 1.00 51.78  ? 167 GLY A O     1 
ATOM   442  N N     . LEU A 1 64  ? 0.387   2.729   33.572 1.00 44.12  ? 168 LEU A N     1 
ATOM   443  C CA    . LEU A 1 64  ? 0.144   1.610   32.674 1.00 42.34  ? 168 LEU A CA    1 
ATOM   444  C C     . LEU A 1 64  ? -0.061  0.340   33.499 1.00 48.42  ? 168 LEU A C     1 
ATOM   445  O O     . LEU A 1 64  ? -0.738  -0.579  33.053 1.00 49.18  ? 168 LEU A O     1 
ATOM   446  C CB    . LEU A 1 64  ? 1.256   1.460   31.649 1.00 39.24  ? 168 LEU A CB    1 
ATOM   447  C CG    . LEU A 1 64  ? 1.165   2.380   30.437 1.00 41.99  ? 168 LEU A CG    1 
ATOM   448  C CD1   . LEU A 1 64  ? 2.495   2.426   29.720 1.00 39.13  ? 168 LEU A CD1   1 
ATOM   449  C CD2   . LEU A 1 64  ? 0.049   1.929   29.488 1.00 42.81  ? 168 LEU A CD2   1 
ATOM   450  N N     . SER A 1 65  ? 0.501   0.324   34.720 1.00 45.41  ? 169 SER A N     1 
ATOM   451  C CA    . SER A 1 65  ? 0.241   -0.643  35.784 1.00 46.67  ? 169 SER A CA    1 
ATOM   452  C C     . SER A 1 65  ? -0.193  0.211   36.998 1.00 55.13  ? 169 SER A C     1 
ATOM   453  O O     . SER A 1 65  ? 0.359   1.303   37.222 1.00 54.08  ? 169 SER A O     1 
ATOM   454  C CB    . SER A 1 65  ? 1.436   -1.556  36.082 1.00 45.94  ? 169 SER A CB    1 
ATOM   455  O OG    . SER A 1 65  ? 2.514   -0.937  36.764 1.00 51.64  ? 169 SER A OG    1 
ATOM   456  N N     . GLU A 1 66  ? -1.253  -0.224  37.705 1.00 55.71  ? 170 GLU A N     1 
ATOM   457  C CA    . GLU A 1 66  ? -1.792  0.515   38.853 1.00 59.27  ? 170 GLU A CA    1 
ATOM   458  C C     . GLU A 1 66  ? -0.984  0.280   40.143 1.00 63.42  ? 170 GLU A C     1 
ATOM   459  O O     . GLU A 1 66  ? -1.187  0.986   41.129 1.00 65.40  ? 170 GLU A O     1 
ATOM   460  C CB    . GLU A 1 66  ? -3.292  0.208   39.073 1.00 64.47  ? 170 GLU A CB    1 
ATOM   461  C CG    . GLU A 1 66  ? -4.225  0.691   37.969 1.00 75.81  ? 170 GLU A CG    1 
ATOM   462  C CD    . GLU A 1 66  ? -4.557  -0.286  36.850 1.00 91.71  ? 170 GLU A CD    1 
ATOM   463  O OE1   . GLU A 1 66  ? -5.274  0.130   35.910 1.00 84.29  ? 170 GLU A OE1   1 
ATOM   464  O OE2   . GLU A 1 66  ? -4.140  -1.467  36.923 1.00 78.05  ? 170 GLU A OE2   1 
ATOM   465  N N     . VAL A 1 67  ? -0.096  -0.736  40.135 1.00 58.05  ? 171 VAL A N     1 
ATOM   466  C CA    . VAL A 1 67  ? 0.801   -1.100  41.243 1.00 57.92  ? 171 VAL A CA    1 
ATOM   467  C C     . VAL A 1 67  ? 2.198   -1.267  40.659 1.00 57.02  ? 171 VAL A C     1 
ATOM   468  O O     . VAL A 1 67  ? 2.335   -1.399  39.439 1.00 52.78  ? 171 VAL A O     1 
ATOM   469  C CB    . VAL A 1 67  ? 0.370   -2.382  42.015 1.00 64.28  ? 171 VAL A CB    1 
ATOM   470  C CG1   . VAL A 1 67  ? -0.917  -2.160  42.806 1.00 68.66  ? 171 VAL A CG1   1 
ATOM   471  C CG2   . VAL A 1 67  ? 0.254   -3.597  41.094 1.00 62.17  ? 171 VAL A CG2   1 
ATOM   472  N N     . GLN A 1 68  ? 3.231   -1.272  41.517 1.00 54.26  ? 172 GLN A N     1 
ATOM   473  C CA    . GLN A 1 68  ? 4.598   -1.497  41.056 1.00 51.37  ? 172 GLN A CA    1 
ATOM   474  C C     . GLN A 1 68  ? 4.817   -3.000  40.790 1.00 53.98  ? 172 GLN A C     1 
ATOM   475  O O     . GLN A 1 68  ? 4.667   -3.829  41.692 1.00 56.21  ? 172 GLN A O     1 
ATOM   476  C CB    . GLN A 1 68  ? 5.619   -0.958  42.074 1.00 53.61  ? 172 GLN A CB    1 
ATOM   477  C CG    . GLN A 1 68  ? 7.074   -1.204  41.678 1.00 55.96  ? 172 GLN A CG    1 
ATOM   478  C CD    . GLN A 1 68  ? 7.465   -0.470  40.423 1.00 53.12  ? 172 GLN A CD    1 
ATOM   479  O OE1   . GLN A 1 68  ? 7.579   0.746   40.412 1.00 50.86  ? 172 GLN A OE1   1 
ATOM   480  N NE2   . GLN A 1 68  ? 7.677   -1.202  39.329 1.00 44.18  ? 172 GLN A NE2   1 
ATOM   481  N N     . LEU A 1 69  ? 5.155   -3.348  39.548 1.00 47.92  ? 173 LEU A N     1 
ATOM   482  C CA    . LEU A 1 69  ? 5.415   -4.743  39.171 1.00 46.01  ? 173 LEU A CA    1 
ATOM   483  C C     . LEU A 1 69  ? 6.909   -4.917  38.921 1.00 47.21  ? 173 LEU A C     1 
ATOM   484  O O     . LEU A 1 69  ? 7.675   -3.962  39.040 1.00 45.36  ? 173 LEU A O     1 
ATOM   485  C CB    . LEU A 1 69  ? 4.592   -5.172  37.921 1.00 44.17  ? 173 LEU A CB    1 
ATOM   486  C CG    . LEU A 1 69  ? 3.068   -4.989  37.990 1.00 50.34  ? 173 LEU A CG    1 
ATOM   487  C CD1   . LEU A 1 69  ? 2.453   -5.143  36.622 1.00 49.50  ? 173 LEU A CD1   1 
ATOM   488  C CD2   . LEU A 1 69  ? 2.423   -5.950  38.991 1.00 55.04  ? 173 LEU A CD2   1 
ATOM   489  N N     . ASN A 1 70  ? 7.327   -6.139  38.609 1.00 43.75  ? 174 ASN A N     1 
ATOM   490  C CA    . ASN A 1 70  ? 8.721   -6.447  38.309 1.00 42.18  ? 174 ASN A CA    1 
ATOM   491  C C     . ASN A 1 70  ? 8.733   -7.529  37.234 1.00 41.52  ? 174 ASN A C     1 
ATOM   492  O O     . ASN A 1 70  ? 7.657   -7.979  36.849 1.00 38.95  ? 174 ASN A O     1 
ATOM   493  C CB    . ASN A 1 70  ? 9.443   -6.872  39.598 1.00 45.19  ? 174 ASN A CB    1 
ATOM   494  C CG    . ASN A 1 70  ? 8.898   -8.136  40.216 1.00 60.54  ? 174 ASN A CG    1 
ATOM   495  O OD1   . ASN A 1 70  ? 9.191   -9.222  39.768 1.00 52.95  ? 174 ASN A OD1   1 
ATOM   496  N ND2   . ASN A 1 70  ? 8.052   -8.028  41.214 1.00 61.73  ? 174 ASN A ND2   1 
ATOM   497  N N     . HIS A 1 71  ? 9.929   -7.939  36.742 1.00 38.26  ? 175 HIS A N     1 
ATOM   498  C CA    . HIS A 1 71  ? 10.104  -8.974  35.711 1.00 37.60  ? 175 HIS A CA    1 
ATOM   499  C C     . HIS A 1 71  ? 9.297   -10.293 35.963 1.00 44.69  ? 175 HIS A C     1 
ATOM   500  O O     . HIS A 1 71  ? 8.754   -10.856 35.012 1.00 43.36  ? 175 HIS A O     1 
ATOM   501  C CB    . HIS A 1 71  ? 11.596  -9.272  35.515 1.00 38.00  ? 175 HIS A CB    1 
ATOM   502  C CG    . HIS A 1 71  ? 12.240  -9.984  36.663 1.00 43.61  ? 175 HIS A CG    1 
ATOM   503  N ND1   . HIS A 1 71  ? 12.690  -9.295  37.785 1.00 47.10  ? 175 HIS A ND1   1 
ATOM   504  C CD2   . HIS A 1 71  ? 12.489  -11.306 36.835 1.00 46.71  ? 175 HIS A CD2   1 
ATOM   505  C CE1   . HIS A 1 71  ? 13.197  -10.215 38.594 1.00 48.84  ? 175 HIS A CE1   1 
ATOM   506  N NE2   . HIS A 1 71  ? 13.117  -11.434 38.057 1.00 49.70  ? 175 HIS A NE2   1 
ATOM   507  N N     . MET A 1 72  ? 9.187   -10.759 37.235 1.00 44.54  ? 176 MET A N     1 
ATOM   508  C CA    A MET A 1 72  ? 8.463   -11.992 37.571 0.50 46.14  ? 176 MET A CA    1 
ATOM   509  C CA    B MET A 1 72  ? 8.451   -11.988 37.561 0.50 46.28  ? 176 MET A CA    1 
ATOM   510  C C     . MET A 1 72  ? 6.975   -11.934 37.162 1.00 48.71  ? 176 MET A C     1 
ATOM   511  O O     . MET A 1 72  ? 6.354   -12.980 36.963 1.00 49.06  ? 176 MET A O     1 
ATOM   512  C CB    A MET A 1 72  ? 8.649   -12.369 39.064 0.50 51.89  ? 176 MET A CB    1 
ATOM   513  C CB    B MET A 1 72  ? 8.612   -12.376 39.045 0.50 52.17  ? 176 MET A CB    1 
ATOM   514  C CG    A MET A 1 72  ? 10.115  -12.577 39.460 0.50 56.86  ? 176 MET A CG    1 
ATOM   515  C CG    B MET A 1 72  ? 9.645   -13.460 39.275 0.50 58.33  ? 176 MET A CG    1 
ATOM   516  S SD    A MET A 1 72  ? 10.430  -13.078 41.185 0.50 65.88  ? 176 MET A SD    1 
ATOM   517  S SD    B MET A 1 72  ? 9.229   -15.056 38.523 0.50 63.82  ? 176 MET A SD    1 
ATOM   518  C CE    A MET A 1 72  ? 10.123  -11.527 42.033 0.50 61.47  ? 176 MET A CE    1 
ATOM   519  C CE    B MET A 1 72  ? 8.155   -15.743 39.777 0.50 64.52  ? 176 MET A CE    1 
ATOM   520  N N     . ASP A 1 73  ? 6.432   -10.720 36.976 1.00 44.10  ? 177 ASP A N     1 
ATOM   521  C CA    . ASP A 1 73  ? 5.035   -10.458 36.603 1.00 44.27  ? 177 ASP A CA    1 
ATOM   522  C C     . ASP A 1 73  ? 4.720   -10.455 35.117 1.00 45.66  ? 177 ASP A C     1 
ATOM   523  O O     . ASP A 1 73  ? 3.549   -10.365 34.747 1.00 45.71  ? 177 ASP A O     1 
ATOM   524  C CB    . ASP A 1 73  ? 4.575   -9.104  37.206 1.00 45.85  ? 177 ASP A CB    1 
ATOM   525  C CG    . ASP A 1 73  ? 4.517   -9.078  38.717 1.00 56.38  ? 177 ASP A CG    1 
ATOM   526  O OD1   . ASP A 1 73  ? 3.800   -9.933  39.304 1.00 62.22  ? 177 ASP A OD1   1 
ATOM   527  O OD2   . ASP A 1 73  ? 5.177   -8.197  39.322 1.00 52.86  ? 177 ASP A OD2   1 
ATOM   528  N N     . ASP A 1 74  ? 5.735   -10.532 34.269 1.00 41.47  ? 178 ASP A N     1 
ATOM   529  C CA    . ASP A 1 74  ? 5.595   -10.374 32.820 1.00 38.24  ? 178 ASP A CA    1 
ATOM   530  C C     . ASP A 1 74  ? 4.576   -11.330 32.170 1.00 41.83  ? 178 ASP A C     1 
ATOM   531  O O     . ASP A 1 74  ? 3.868   -10.876 31.276 1.00 40.60  ? 178 ASP A O     1 
ATOM   532  C CB    . ASP A 1 74  ? 6.960   -10.410 32.103 1.00 36.32  ? 178 ASP A CB    1 
ATOM   533  C CG    . ASP A 1 74  ? 7.764   -11.692 32.217 1.00 42.91  ? 178 ASP A CG    1 
ATOM   534  O OD1   . ASP A 1 74  ? 7.297   -12.644 32.906 1.00 45.37  ? 178 ASP A OD1   1 
ATOM   535  O OD2   . ASP A 1 74  ? 8.871   -11.727 31.688 1.00 38.75  ? 178 ASP A OD2   1 
ATOM   536  N N     . HIS A 1 75  ? 4.432   -12.596 32.651 1.00 41.45  ? 179 HIS A N     1 
ATOM   537  C CA    . HIS A 1 75  ? 3.433   -13.532 32.101 1.00 42.85  ? 179 HIS A CA    1 
ATOM   538  C C     . HIS A 1 75  ? 1.958   -13.136 32.383 1.00 48.72  ? 179 HIS A C     1 
ATOM   539  O O     . HIS A 1 75  ? 1.047   -13.601 31.676 1.00 49.18  ? 179 HIS A O     1 
ATOM   540  C CB    . HIS A 1 75  ? 3.723   -14.976 32.560 1.00 47.26  ? 179 HIS A CB    1 
ATOM   541  C CG    . HIS A 1 75  ? 4.855   -15.541 31.773 1.00 50.06  ? 179 HIS A CG    1 
ATOM   542  N ND1   . HIS A 1 75  ? 6.170   -15.134 32.004 1.00 50.98  ? 179 HIS A ND1   1 
ATOM   543  C CD2   . HIS A 1 75  ? 4.821   -16.272 30.644 1.00 51.32  ? 179 HIS A CD2   1 
ATOM   544  C CE1   . HIS A 1 75  ? 6.888   -15.702 31.057 1.00 49.65  ? 179 HIS A CE1   1 
ATOM   545  N NE2   . HIS A 1 75  ? 6.118   -16.401 30.222 1.00 50.24  ? 179 HIS A NE2   1 
ATOM   546  N N     . THR A 1 76  ? 1.723   -12.283 33.397 1.00 45.28  ? 180 THR A N     1 
ATOM   547  C CA    . THR A 1 76  ? 0.366   -11.831 33.728 1.00 46.99  ? 180 THR A CA    1 
ATOM   548  C C     . THR A 1 76  ? -0.024  -10.590 32.894 1.00 47.94  ? 180 THR A C     1 
ATOM   549  O O     . THR A 1 76  ? -1.186  -10.179 32.916 1.00 48.29  ? 180 THR A O     1 
ATOM   550  C CB    . THR A 1 76  ? 0.238   -11.471 35.223 1.00 52.65  ? 180 THR A CB    1 
ATOM   551  O OG1   . THR A 1 76  ? 0.748   -10.161 35.406 1.00 48.43  ? 180 THR A OG1   1 
ATOM   552  C CG2   . THR A 1 76  ? 0.947   -12.452 36.154 1.00 56.01  ? 180 THR A CG2   1 
ATOM   553  N N     . LEU A 1 77  ? 0.960   -9.949  32.224 1.00 42.11  ? 181 LEU A N     1 
ATOM   554  C CA    . LEU A 1 77  ? 0.693   -8.703  31.519 1.00 40.44  ? 181 LEU A CA    1 
ATOM   555  C C     . LEU A 1 77  ? -0.289  -8.850  30.342 1.00 47.15  ? 181 LEU A C     1 
ATOM   556  O O     . LEU A 1 77  ? -1.205  -8.043  30.312 1.00 48.17  ? 181 LEU A O     1 
ATOM   557  C CB    . LEU A 1 77  ? 1.979   -7.997  31.127 1.00 37.96  ? 181 LEU A CB    1 
ATOM   558  C CG    . LEU A 1 77  ? 2.340   -6.831  32.053 1.00 42.36  ? 181 LEU A CG    1 
ATOM   559  C CD1   . LEU A 1 77  ? 2.599   -7.295  33.466 1.00 45.08  ? 181 LEU A CD1   1 
ATOM   560  C CD2   . LEU A 1 77  ? 3.528   -6.068  31.530 1.00 40.35  ? 181 LEU A CD2   1 
ATOM   561  N N     . PRO A 1 78  ? -0.288  -9.902  29.483 1.00 46.93  ? 182 PRO A N     1 
ATOM   562  C CA    . PRO A 1 78  ? -1.330  -9.983  28.443 1.00 47.90  ? 182 PRO A CA    1 
ATOM   563  C C     . PRO A 1 78  ? -2.760  -9.942  28.968 1.00 54.55  ? 182 PRO A C     1 
ATOM   564  O O     . PRO A 1 78  ? -3.526  -9.046  28.604 1.00 54.12  ? 182 PRO A O     1 
ATOM   565  C CB    . PRO A 1 78  ? -1.009  -11.304 27.738 1.00 49.54  ? 182 PRO A CB    1 
ATOM   566  C CG    . PRO A 1 78  ? 0.468   -11.373 27.828 1.00 51.78  ? 182 PRO A CG    1 
ATOM   567  C CD    . PRO A 1 78  ? 0.722   -10.960 29.271 1.00 48.28  ? 182 PRO A CD    1 
ATOM   568  N N     . GLY A 1 79  ? -3.083  -10.881 29.851 1.00 54.53  ? 183 GLY A N     1 
ATOM   569  C CA    . GLY A 1 79  ? -4.406  -11.045 30.435 1.00 57.35  ? 183 GLY A CA    1 
ATOM   570  C C     . GLY A 1 79  ? -4.883  -9.919  31.324 1.00 60.74  ? 183 GLY A C     1 
ATOM   571  O O     . GLY A 1 79  ? -6.038  -9.502  31.203 1.00 64.23  ? 183 GLY A O     1 
ATOM   572  N N     . LYS A 1 80  ? -4.023  -9.438  32.239 1.00 53.98  ? 184 LYS A N     1 
ATOM   573  C CA    . LYS A 1 80  ? -4.413  -8.373  33.160 1.00 56.16  ? 184 LYS A CA    1 
ATOM   574  C C     . LYS A 1 80  ? -4.181  -6.935  32.644 1.00 57.97  ? 184 LYS A C     1 
ATOM   575  O O     . LYS A 1 80  ? -4.951  -6.052  33.027 1.00 59.88  ? 184 LYS A O     1 
ATOM   576  C CB    . LYS A 1 80  ? -3.754  -8.561  34.539 1.00 59.83  ? 184 LYS A CB    1 
ATOM   577  N N     . TYR A 1 81  ? -3.144  -6.681  31.800 1.00 49.84  ? 185 TYR A N     1 
ATOM   578  C CA    . TYR A 1 81  ? -2.861  -5.306  31.366 1.00 47.92  ? 185 TYR A CA    1 
ATOM   579  C C     . TYR A 1 81  ? -2.949  -5.034  29.857 1.00 47.81  ? 185 TYR A C     1 
ATOM   580  O O     . TYR A 1 81  ? -2.849  -3.870  29.463 1.00 48.82  ? 185 TYR A O     1 
ATOM   581  C CB    . TYR A 1 81  ? -1.483  -4.840  31.891 1.00 46.90  ? 185 TYR A CB    1 
ATOM   582  C CG    . TYR A 1 81  ? -1.412  -4.813  33.400 1.00 49.21  ? 185 TYR A CG    1 
ATOM   583  C CD1   . TYR A 1 81  ? -1.882  -3.717  34.123 1.00 53.12  ? 185 TYR A CD1   1 
ATOM   584  C CD2   . TYR A 1 81  ? -0.908  -5.895  34.110 1.00 49.92  ? 185 TYR A CD2   1 
ATOM   585  C CE1   . TYR A 1 81  ? -1.882  -3.715  35.518 1.00 53.50  ? 185 TYR A CE1   1 
ATOM   586  C CE2   . TYR A 1 81  ? -0.897  -5.905  35.504 1.00 52.78  ? 185 TYR A CE2   1 
ATOM   587  C CZ    . TYR A 1 81  ? -1.360  -4.799  36.202 1.00 58.14  ? 185 TYR A CZ    1 
ATOM   588  O OH    . TYR A 1 81  ? -1.324  -4.801  37.571 1.00 58.71  ? 185 TYR A OH    1 
ATOM   589  N N     . GLY A 1 82  ? -3.155  -6.076  29.051 1.00 40.25  ? 186 GLY A N     1 
ATOM   590  C CA    . GLY A 1 82  ? -3.248  -5.984  27.602 1.00 37.19  ? 186 GLY A CA    1 
ATOM   591  C C     . GLY A 1 82  ? -1.901  -5.688  26.976 1.00 38.57  ? 186 GLY A C     1 
ATOM   592  O O     . GLY A 1 82  ? -1.861  -5.086  25.903 1.00 38.23  ? 186 GLY A O     1 
ATOM   593  N N     . ILE A 1 83  ? -0.785  -6.119  27.642 1.00 33.65  ? 187 ILE A N     1 
ATOM   594  C CA    . ILE A 1 83  ? 0.637   -5.879  27.202 1.00 29.85  ? 187 ILE A CA    1 
ATOM   595  C C     . ILE A 1 83  ? 1.405   -7.200  26.953 1.00 34.08  ? 187 ILE A C     1 
ATOM   596  O O     . ILE A 1 83  ? 1.374   -8.100  27.778 1.00 35.69  ? 187 ILE A O     1 
ATOM   597  C CB    . ILE A 1 83  ? 1.398   -5.014  28.258 1.00 32.20  ? 187 ILE A CB    1 
ATOM   598  C CG1   . ILE A 1 83  ? 0.695   -3.632  28.476 1.00 35.38  ? 187 ILE A CG1   1 
ATOM   599  C CG2   . ILE A 1 83  ? 2.882   -4.796  27.848 1.00 31.50  ? 187 ILE A CG2   1 
ATOM   600  C CD1   . ILE A 1 83  ? 1.191   -2.849  29.617 1.00 37.64  ? 187 ILE A CD1   1 
ATOM   601  N N     . GLY A 1 84  ? 2.153   -7.264  25.862 1.00 29.55  ? 188 GLY A N     1 
ATOM   602  C CA    . GLY A 1 84  ? 2.965   -8.423  25.545 1.00 28.26  ? 188 GLY A CA    1 
ATOM   603  C C     . GLY A 1 84  ? 4.380   -7.991  25.269 1.00 31.56  ? 188 GLY A C     1 
ATOM   604  O O     . GLY A 1 84  ? 4.660   -6.789  25.258 1.00 30.33  ? 188 GLY A O     1 
ATOM   605  N N     . PHE A 1 85  ? 5.264   -8.959  25.004 1.00 26.63  ? 189 PHE A N     1 
ATOM   606  C CA    . PHE A 1 85  ? 6.689   -8.695  24.830 1.00 23.90  ? 189 PHE A CA    1 
ATOM   607  C C     . PHE A 1 85  ? 7.301   -9.534  23.773 1.00 31.53  ? 189 PHE A C     1 
ATOM   608  O O     . PHE A 1 85  ? 7.035   -10.734 23.684 1.00 31.29  ? 189 PHE A O     1 
ATOM   609  C CB    . PHE A 1 85  ? 7.425   -9.120  26.122 1.00 26.22  ? 189 PHE A CB    1 
ATOM   610  C CG    . PHE A 1 85  ? 7.085   -8.329  27.342 1.00 28.08  ? 189 PHE A CG    1 
ATOM   611  C CD1   . PHE A 1 85  ? 7.777   -7.158  27.641 1.00 30.40  ? 189 PHE A CD1   1 
ATOM   612  C CD2   . PHE A 1 85  ? 6.108   -8.780  28.234 1.00 31.25  ? 189 PHE A CD2   1 
ATOM   613  C CE1   . PHE A 1 85  ? 7.468   -6.423  28.793 1.00 32.81  ? 189 PHE A CE1   1 
ATOM   614  C CE2   . PHE A 1 85  ? 5.809   -8.053  29.386 1.00 34.17  ? 189 PHE A CE2   1 
ATOM   615  C CZ    . PHE A 1 85  ? 6.494   -6.883  29.655 1.00 33.36  ? 189 PHE A CZ    1 
ATOM   616  N N     . THR A 1 86  ? 8.242   -8.927  23.039 1.00 30.34  ? 190 THR A N     1 
ATOM   617  C CA    . THR A 1 86  ? 9.076   -9.618  22.083 1.00 29.60  ? 190 THR A CA    1 
ATOM   618  C C     . THR A 1 86  ? 10.351  -8.796  21.950 1.00 29.15  ? 190 THR A C     1 
ATOM   619  O O     . THR A 1 86  ? 10.508  -7.816  22.683 1.00 28.26  ? 190 THR A O     1 
ATOM   620  C CB    . THR A 1 86  ? 8.335   -10.006 20.784 1.00 35.57  ? 190 THR A CB    1 
ATOM   621  O OG1   . THR A 1 86  ? 9.230   -10.834 20.037 1.00 33.37  ? 190 THR A OG1   1 
ATOM   622  C CG2   . THR A 1 86  ? 7.880   -8.794  19.956 1.00 35.58  ? 190 THR A CG2   1 
ATOM   623  N N     . ASN A 1 87  ? 11.300  -9.251  21.148 1.00 39.70  ? 191 ASN A N     1 
ATOM   624  C CA    . ASN A 1 87  ? 12.540  -8.508  20.896 1.00 38.07  ? 191 ASN A CA    1 
ATOM   625  C C     . ASN A 1 87  ? 12.818  -8.466  19.423 1.00 39.52  ? 191 ASN A C     1 
ATOM   626  O O     . ASN A 1 87  ? 12.409  -9.378  18.690 1.00 40.68  ? 191 ASN A O     1 
ATOM   627  C CB    . ASN A 1 87  ? 13.736  -9.140  21.615 1.00 41.32  ? 191 ASN A CB    1 
ATOM   628  C CG    . ASN A 1 87  ? 13.664  -8.963  23.092 1.00 49.60  ? 191 ASN A CG    1 
ATOM   629  O OD1   . ASN A 1 87  ? 13.562  -7.849  23.604 1.00 44.52  ? 191 ASN A OD1   1 
ATOM   630  N ND2   . ASN A 1 87  ? 13.597  -10.051 23.795 1.00 42.91  ? 191 ASN A ND2   1 
ATOM   631  N N     . MET A 1 88  ? 13.544  -7.436  18.981 1.00 33.68  ? 192 MET A N     1 
ATOM   632  C CA    . MET A 1 88  ? 13.913  -7.293  17.562 1.00 33.70  ? 192 MET A CA    1 
ATOM   633  C C     . MET A 1 88  ? 14.823  -8.463  17.187 1.00 40.61  ? 192 MET A C     1 
ATOM   634  O O     . MET A 1 88  ? 14.620  -9.088  16.133 1.00 40.59  ? 192 MET A O     1 
ATOM   635  C CB    . MET A 1 88  ? 14.622  -5.925  17.332 1.00 36.17  ? 192 MET A CB    1 
ATOM   636  C CG    . MET A 1 88  ? 15.108  -5.724  15.921 1.00 41.22  ? 192 MET A CG    1 
ATOM   637  S SD    . MET A 1 88  ? 13.788  -5.057  14.890 1.00 46.70  ? 192 MET A SD    1 
ATOM   638  C CE    . MET A 1 88  ? 14.732  -4.423  13.543 1.00 45.30  ? 192 MET A CE    1 
ATOM   639  N N     . VAL A 1 89  ? 15.775  -8.801  18.095 1.00 39.08  ? 193 VAL A N     1 
ATOM   640  C CA    . VAL A 1 89  ? 16.751  -9.889  17.911 1.00 39.60  ? 193 VAL A CA    1 
ATOM   641  C C     . VAL A 1 89  ? 16.680  -10.859 19.092 1.00 43.74  ? 193 VAL A C     1 
ATOM   642  O O     . VAL A 1 89  ? 16.724  -10.448 20.251 1.00 41.16  ? 193 VAL A O     1 
ATOM   643  C CB    . VAL A 1 89  ? 18.197  -9.372  17.629 1.00 43.68  ? 193 VAL A CB    1 
ATOM   644  C CG1   . VAL A 1 89  ? 19.195  -10.531 17.500 1.00 44.25  ? 193 VAL A CG1   1 
ATOM   645  C CG2   . VAL A 1 89  ? 18.237  -8.490  16.371 1.00 44.14  ? 193 VAL A CG2   1 
ATOM   646  N N     . GLU A 1 90  ? 16.615  -12.159 18.775 1.00 41.73  ? 194 GLU A N     1 
ATOM   647  C CA    . GLU A 1 90  ? 16.512  -13.254 19.733 1.00 41.94  ? 194 GLU A CA    1 
ATOM   648  C C     . GLU A 1 90  ? 17.811  -13.526 20.511 1.00 47.00  ? 194 GLU A C     1 
ATOM   649  O O     . GLU A 1 90  ? 17.749  -13.829 21.701 1.00 47.28  ? 194 GLU A O     1 
ATOM   650  C CB    . GLU A 1 90  ? 16.036  -14.508 18.981 1.00 45.18  ? 194 GLU A CB    1 
ATOM   651  C CG    . GLU A 1 90  ? 15.717  -15.720 19.842 1.00 60.88  ? 194 GLU A CG    1 
ATOM   652  C CD    . GLU A 1 90  ? 15.365  -16.975 19.062 1.00 84.12  ? 194 GLU A CD    1 
ATOM   653  O OE1   . GLU A 1 90  ? 16.159  -17.380 18.181 1.00 71.98  ? 194 GLU A OE1   1 
ATOM   654  O OE2   . GLU A 1 90  ? 14.305  -17.571 19.355 1.00 85.22  ? 194 GLU A OE2   1 
ATOM   655  N N     . ARG A 1 91  ? 18.971  -13.448 19.843 1.00 45.46  ? 195 ARG A N     1 
ATOM   656  C CA    . ARG A 1 91  ? 20.273  -13.753 20.445 1.00 46.10  ? 195 ARG A CA    1 
ATOM   657  C C     . ARG A 1 91  ? 20.649  -12.859 21.629 1.00 48.36  ? 195 ARG A C     1 
ATOM   658  O O     . ARG A 1 91  ? 20.535  -11.635 21.542 1.00 46.98  ? 195 ARG A O     1 
ATOM   659  C CB    . ARG A 1 91  ? 21.374  -13.720 19.365 1.00 45.30  ? 195 ARG A CB    1 
ATOM   660  C CG    . ARG A 1 91  ? 22.738  -14.229 19.833 1.00 55.59  ? 195 ARG A CG    1 
ATOM   661  C CD    . ARG A 1 91  ? 23.723  -14.378 18.680 1.00 62.39  ? 195 ARG A CD    1 
ATOM   662  N NE    . ARG A 1 91  ? 24.255  -13.084 18.244 1.00 72.75  ? 195 ARG A NE    1 
ATOM   663  C CZ    . ARG A 1 91  ? 25.429  -12.581 18.618 1.00 87.12  ? 195 ARG A CZ    1 
ATOM   664  N NH1   . ARG A 1 91  ? 26.224  -13.264 19.433 1.00 72.54  ? 195 ARG A NH1   1 
ATOM   665  N NH2   . ARG A 1 91  ? 25.822  -11.396 18.170 1.00 74.88  ? 195 ARG A NH2   1 
ATOM   666  N N     . THR A 1 92  ? 21.123  -13.487 22.726 1.00 47.44  ? 196 THR A N     1 
ATOM   667  C CA    . THR A 1 92  ? 21.594  -12.789 23.923 1.00 48.55  ? 196 THR A CA    1 
ATOM   668  C C     . THR A 1 92  ? 23.024  -12.293 23.683 1.00 55.29  ? 196 THR A C     1 
ATOM   669  O O     . THR A 1 92  ? 23.864  -13.061 23.231 1.00 55.08  ? 196 THR A O     1 
ATOM   670  C CB    . THR A 1 92  ? 21.564  -13.716 25.166 1.00 49.07  ? 196 THR A CB    1 
ATOM   671  O OG1   . THR A 1 92  ? 20.226  -14.138 25.421 1.00 44.98  ? 196 THR A OG1   1 
ATOM   672  C CG2   . THR A 1 92  ? 22.152  -13.056 26.428 1.00 49.27  ? 196 THR A CG2   1 
ATOM   673  N N     . THR A 1 93  ? 23.301  -11.029 24.051 1.00 55.91  ? 197 THR A N     1 
ATOM   674  C CA    . THR A 1 93  ? 24.639  -10.419 23.985 1.00 59.57  ? 197 THR A CA    1 
ATOM   675  C C     . THR A 1 93  ? 24.854  -9.544  25.229 1.00 66.92  ? 197 THR A C     1 
ATOM   676  O O     . THR A 1 93  ? 23.865  -9.033  25.762 1.00 64.94  ? 197 THR A O     1 
ATOM   677  C CB    . THR A 1 93  ? 24.826  -9.554  22.721 1.00 59.88  ? 197 THR A CB    1 
ATOM   678  O OG1   . THR A 1 93  ? 23.868  -8.501  22.720 1.00 65.23  ? 197 THR A OG1   1 
ATOM   679  C CG2   . THR A 1 93  ? 24.759  -10.336 21.453 1.00 52.93  ? 197 THR A CG2   1 
ATOM   680  N N     . PRO A 1 94  ? 26.113  -9.255  25.654 1.00 69.39  ? 198 PRO A N     1 
ATOM   681  C CA    . PRO A 1 94  ? 26.294  -8.352  26.805 1.00 73.17  ? 198 PRO A CA    1 
ATOM   682  C C     . PRO A 1 94  ? 25.791  -6.933  26.528 1.00 79.03  ? 198 PRO A C     1 
ATOM   683  O O     . PRO A 1 94  ? 25.304  -6.274  27.451 1.00 80.45  ? 198 PRO A O     1 
ATOM   684  C CB    . PRO A 1 94  ? 27.805  -8.390  27.066 1.00 79.34  ? 198 PRO A CB    1 
ATOM   685  C CG    . PRO A 1 94  ? 28.316  -9.585  26.304 1.00 82.36  ? 198 PRO A CG    1 
ATOM   686  C CD    . PRO A 1 94  ? 27.415  -9.724  25.131 1.00 73.35  ? 198 PRO A CD    1 
ATOM   687  N N     . GLY A 1 95  ? 25.874  -6.504  25.259 1.00 75.13  ? 199 GLY A N     1 
ATOM   688  C CA    . GLY A 1 95  ? 25.423  -5.192  24.805 1.00 75.56  ? 199 GLY A CA    1 
ATOM   689  C C     . GLY A 1 95  ? 24.794  -5.203  23.424 1.00 77.22  ? 199 GLY A C     1 
ATOM   690  O O     . GLY A 1 95  ? 25.034  -6.118  22.629 1.00 75.07  ? 199 GLY A O     1 
ATOM   691  N N     . SER A 1 96  ? 23.999  -4.161  23.127 1.00 73.27  ? 200 SER A N     1 
ATOM   692  C CA    . SER A 1 96  ? 23.295  -3.978  21.853 1.00 71.32  ? 200 SER A CA    1 
ATOM   693  C C     . SER A 1 96  ? 24.228  -3.853  20.632 1.00 75.56  ? 200 SER A C     1 
ATOM   694  O O     . SER A 1 96  ? 23.840  -4.273  19.539 1.00 74.07  ? 200 SER A O     1 
ATOM   695  C CB    . SER A 1 96  ? 22.377  -2.763  21.929 1.00 75.84  ? 200 SER A CB    1 
ATOM   696  O OG    . SER A 1 96  ? 23.118  -1.600  22.260 1.00 89.20  ? 200 SER A OG    1 
ATOM   697  N N     . LYS A 1 97  ? 25.441  -3.276  20.812 1.00 70.92  ? 201 LYS A N     1 
ATOM   698  C CA    . LYS A 1 97  ? 26.413  -3.077  19.722 1.00 70.11  ? 201 LYS A CA    1 
ATOM   699  C C     . LYS A 1 97  ? 27.133  -4.361  19.300 1.00 73.47  ? 201 LYS A C     1 
ATOM   700  O O     . LYS A 1 97  ? 27.774  -4.374  18.256 1.00 73.62  ? 201 LYS A O     1 
ATOM   701  C CB    . LYS A 1 97  ? 27.410  -1.962  20.054 1.00 75.43  ? 201 LYS A CB    1 
ATOM   702  N N     . ASP A 1 98  ? 26.987  -5.453  20.071 1.00 70.34  ? 202 ASP A N     1 
ATOM   703  C CA    . ASP A 1 98  ? 27.570  -6.759  19.740 1.00 70.75  ? 202 ASP A CA    1 
ATOM   704  C C     . ASP A 1 98  ? 26.816  -7.460  18.589 1.00 69.34  ? 202 ASP A C     1 
ATOM   705  O O     . ASP A 1 98  ? 27.254  -8.519  18.137 1.00 70.22  ? 202 ASP A O     1 
ATOM   706  C CB    . ASP A 1 98  ? 27.570  -7.674  20.979 1.00 75.28  ? 202 ASP A CB    1 
ATOM   707  C CG    . ASP A 1 98  ? 28.603  -7.343  22.033 1.00 95.27  ? 202 ASP A CG    1 
ATOM   708  O OD1   . ASP A 1 98  ? 28.556  -6.218  22.577 1.00 98.80  ? 202 ASP A OD1   1 
ATOM   709  O OD2   . ASP A 1 98  ? 29.407  -8.239  22.376 1.00 104.10 ? 202 ASP A OD2   1 
ATOM   710  N N     . LEU A 1 99  ? 25.666  -6.896  18.151 1.00 60.95  ? 203 LEU A N     1 
ATOM   711  C CA    . LEU A 1 99  ? 24.824  -7.459  17.094 1.00 57.65  ? 203 LEU A CA    1 
ATOM   712  C C     . LEU A 1 99  ? 25.142  -6.860  15.723 1.00 60.49  ? 203 LEU A C     1 
ATOM   713  O O     . LEU A 1 99  ? 25.408  -5.658  15.602 1.00 60.57  ? 203 LEU A O     1 
ATOM   714  C CB    . LEU A 1 99  ? 23.325  -7.266  17.392 1.00 55.09  ? 203 LEU A CB    1 
ATOM   715  C CG    . LEU A 1 99  ? 22.765  -7.803  18.709 1.00 60.77  ? 203 LEU A CG    1 
ATOM   716  C CD1   . LEU A 1 99  ? 21.438  -7.137  19.026 1.00 59.33  ? 203 LEU A CD1   1 
ATOM   717  C CD2   . LEU A 1 99  ? 22.609  -9.314  18.668 1.00 62.88  ? 203 LEU A CD2   1 
ATOM   718  N N     . SER A 1 100 ? 25.046  -7.699  14.689 1.00 57.26  ? 204 SER A N     1 
ATOM   719  C CA    . SER A 1 100 ? 25.307  -7.323  13.291 1.00 56.89  ? 204 SER A CA    1 
ATOM   720  C C     . SER A 1 100 ? 24.079  -6.734  12.577 1.00 56.90  ? 204 SER A C     1 
ATOM   721  O O     . SER A 1 100 ? 22.935  -7.003  12.968 1.00 53.27  ? 204 SER A O     1 
ATOM   722  C CB    . SER A 1 100 ? 25.854  -8.521  12.513 1.00 62.33  ? 204 SER A CB    1 
ATOM   723  O OG    . SER A 1 100 ? 24.855  -9.404  12.025 1.00 66.95  ? 204 SER A OG    1 
ATOM   724  N N     . SER A 1 101 ? 24.326  -5.961  11.501 1.00 53.29  ? 205 SER A N     1 
ATOM   725  C CA    . SER A 1 101 ? 23.289  -5.351  10.665 1.00 52.36  ? 205 SER A CA    1 
ATOM   726  C C     . SER A 1 101 ? 22.338  -6.432  10.109 1.00 53.93  ? 205 SER A C     1 
ATOM   727  O O     . SER A 1 101 ? 21.119  -6.255  10.175 1.00 51.19  ? 205 SER A O     1 
ATOM   728  C CB    . SER A 1 101 ? 23.923  -4.560  9.519  1.00 57.46  ? 205 SER A CB    1 
ATOM   729  O OG    . SER A 1 101 ? 22.954  -3.942  8.687  1.00 65.97  ? 205 SER A OG    1 
ATOM   730  N N     . LYS A 1 102 ? 22.897  -7.561  9.620  1.00 52.39  ? 206 LYS A N     1 
ATOM   731  C CA    . LYS A 1 102 ? 22.141  -8.695  9.070  1.00 52.73  ? 206 LYS A CA    1 
ATOM   732  C C     . LYS A 1 102 ? 21.255  -9.350  10.140 1.00 53.07  ? 206 LYS A C     1 
ATOM   733  O O     . LYS A 1 102 ? 20.141  -9.780  9.822  1.00 51.40  ? 206 LYS A O     1 
ATOM   734  C CB    . LYS A 1 102 ? 23.086  -9.728  8.439  1.00 59.27  ? 206 LYS A CB    1 
ATOM   735  N N     . GLU A 1 103 ? 21.749  -9.422  11.400 1.00 48.64  ? 207 GLU A N     1 
ATOM   736  C CA    . GLU A 1 103 ? 20.988  -9.944  12.532 1.00 46.87  ? 207 GLU A CA    1 
ATOM   737  C C     . GLU A 1 103 ? 19.756  -9.088  12.796 1.00 47.54  ? 207 GLU A C     1 
ATOM   738  O O     . GLU A 1 103 ? 18.680  -9.629  13.053 1.00 46.08  ? 207 GLU A O     1 
ATOM   739  C CB    . GLU A 1 103 ? 21.848  -10.052 13.802 1.00 49.07  ? 207 GLU A CB    1 
ATOM   740  C CG    . GLU A 1 103 ? 22.700  -11.304 13.812 1.00 64.56  ? 207 GLU A CG    1 
ATOM   741  C CD    . GLU A 1 103 ? 23.443  -11.570 15.103 1.00 86.13  ? 207 GLU A CD    1 
ATOM   742  O OE1   . GLU A 1 103 ? 24.352  -10.779 15.448 1.00 73.74  ? 207 GLU A OE1   1 
ATOM   743  O OE2   . GLU A 1 103 ? 23.141  -12.601 15.746 1.00 82.89  ? 207 GLU A OE2   1 
ATOM   744  N N     . PHE A 1 104 ? 19.914  -7.756  12.728 1.00 44.45  ? 208 PHE A N     1 
ATOM   745  C CA    . PHE A 1 104 ? 18.819  -6.803  12.954 1.00 43.68  ? 208 PHE A CA    1 
ATOM   746  C C     . PHE A 1 104 ? 17.769  -6.877  11.846 1.00 45.46  ? 208 PHE A C     1 
ATOM   747  O O     . PHE A 1 104 ? 16.574  -6.802  12.130 1.00 43.63  ? 208 PHE A O     1 
ATOM   748  C CB    . PHE A 1 104 ? 19.351  -5.370  13.042 1.00 45.60  ? 208 PHE A CB    1 
ATOM   749  C CG    . PHE A 1 104 ? 19.893  -4.978  14.392 1.00 46.81  ? 208 PHE A CG    1 
ATOM   750  C CD1   . PHE A 1 104 ? 19.043  -4.839  15.490 1.00 48.67  ? 208 PHE A CD1   1 
ATOM   751  C CD2   . PHE A 1 104 ? 21.242  -4.697  14.559 1.00 49.83  ? 208 PHE A CD2   1 
ATOM   752  C CE1   . PHE A 1 104 ? 19.543  -4.443  16.736 1.00 50.56  ? 208 PHE A CE1   1 
ATOM   753  C CE2   . PHE A 1 104 ? 21.743  -4.304  15.808 1.00 53.66  ? 208 PHE A CE2   1 
ATOM   754  C CZ    . PHE A 1 104 ? 20.887  -4.161  16.879 1.00 50.88  ? 208 PHE A CZ    1 
ATOM   755  N N     . ARG A 1 105 ? 18.218  -7.032  10.596 1.00 44.52  ? 209 ARG A N     1 
ATOM   756  C CA    . ARG A 1 105 ? 17.340  -7.102  9.426  1.00 43.11  ? 209 ARG A CA    1 
ATOM   757  C C     . ARG A 1 105 ? 16.655  -8.468  9.365  1.00 45.15  ? 209 ARG A C     1 
ATOM   758  O O     . ARG A 1 105 ? 15.468  -8.536  9.077  1.00 43.19  ? 209 ARG A O     1 
ATOM   759  C CB    . ARG A 1 105 ? 18.080  -6.688  8.158  1.00 44.38  ? 209 ARG A CB    1 
ATOM   760  C CG    . ARG A 1 105 ? 18.352  -5.176  8.165  1.00 50.06  ? 209 ARG A CG    1 
ATOM   761  C CD    . ARG A 1 105 ? 19.130  -4.679  6.965  1.00 64.74  ? 209 ARG A CD    1 
ATOM   762  N NE    . ARG A 1 105 ? 20.523  -5.123  7.006  1.00 71.72  ? 209 ARG A NE    1 
ATOM   763  C CZ    . ARG A 1 105 ? 21.177  -5.646  5.975  1.00 74.74  ? 209 ARG A CZ    1 
ATOM   764  N NH1   . ARG A 1 105 ? 20.575  -5.791  4.801  1.00 65.98  ? 209 ARG A NH1   1 
ATOM   765  N NH2   . ARG A 1 105 ? 22.437  -6.028  6.108  1.00 52.80  ? 209 ARG A NH2   1 
ATOM   766  N N     . GLU A 1 106 ? 17.336  -9.531  9.807  1.00 43.94  ? 210 GLU A N     1 
ATOM   767  C CA    . GLU A 1 106 ? 16.700  -10.853 9.949  1.00 44.12  ? 210 GLU A CA    1 
ATOM   768  C C     . GLU A 1 106 ? 15.580  -10.703 11.005 1.00 44.19  ? 210 GLU A C     1 
ATOM   769  O O     . GLU A 1 106 ? 14.441  -11.141 10.791 1.00 43.56  ? 210 GLU A O     1 
ATOM   770  C CB    . GLU A 1 106 ? 17.734  -11.891 10.423 1.00 46.51  ? 210 GLU A CB    1 
ATOM   771  C CG    . GLU A 1 106 ? 17.150  -13.216 10.896 1.00 51.48  ? 210 GLU A CG    1 
ATOM   772  C CD    . GLU A 1 106 ? 18.187  -14.284 11.176 1.00 66.62  ? 210 GLU A CD    1 
ATOM   773  O OE1   . GLU A 1 106 ? 19.114  -14.023 11.976 1.00 59.32  ? 210 GLU A OE1   1 
ATOM   774  O OE2   . GLU A 1 106 ? 18.053  -15.398 10.621 1.00 72.56  ? 210 GLU A OE2   1 
ATOM   775  N N     . GLY A 1 107 ? 15.926  -10.013 12.093 1.00 39.19  ? 211 GLY A N     1 
ATOM   776  C CA    . GLY A 1 107 ? 15.041  -9.768  13.217 1.00 36.77  ? 211 GLY A CA    1 
ATOM   777  C C     . GLY A 1 107 ? 13.812  -8.986  12.820 1.00 38.81  ? 211 GLY A C     1 
ATOM   778  O O     . GLY A 1 107 ? 12.702  -9.354  13.209 1.00 37.70  ? 211 GLY A O     1 
ATOM   779  N N     . GLY A 1 108 ? 14.016  -7.934  12.031 1.00 36.07  ? 212 GLY A N     1 
ATOM   780  C CA    . GLY A 1 108 ? 12.949  -7.073  11.532 1.00 36.61  ? 212 GLY A CA    1 
ATOM   781  C C     . GLY A 1 108 ? 11.916  -7.848  10.739 1.00 40.90  ? 212 GLY A C     1 
ATOM   782  O O     . GLY A 1 108 ? 10.709  -7.695  10.964 1.00 42.12  ? 212 GLY A O     1 
ATOM   783  N N     . ARG A 1 109 ? 12.386  -8.727  9.850  1.00 38.03  ? 213 ARG A N     1 
ATOM   784  C CA    . ARG A 1 109 ? 11.531  -9.558  9.004  1.00 39.68  ? 213 ARG A CA    1 
ATOM   785  C C     . ARG A 1 109 ? 10.689  -10.477 9.870  1.00 42.24  ? 213 ARG A C     1 
ATOM   786  O O     . ARG A 1 109 ? 9.479   -10.601 9.659  1.00 40.95  ? 213 ARG A O     1 
ATOM   787  C CB    . ARG A 1 109 ? 12.379  -10.377 8.023  1.00 41.13  ? 213 ARG A CB    1 
ATOM   788  C CG    . ARG A 1 109 ? 11.560  -11.359 7.190  1.00 46.44  ? 213 ARG A CG    1 
ATOM   789  C CD    . ARG A 1 109 ? 12.384  -12.122 6.170  1.00 51.10  ? 213 ARG A CD    1 
ATOM   790  N NE    . ARG A 1 109 ? 13.553  -12.807 6.725  1.00 51.49  ? 213 ARG A NE    1 
ATOM   791  C CZ    . ARG A 1 109 ? 13.523  -13.972 7.366  1.00 63.63  ? 213 ARG A CZ    1 
ATOM   792  N NH1   . ARG A 1 109 ? 12.369  -14.600 7.566  1.00 52.50  ? 213 ARG A NH1   1 
ATOM   793  N NH2   . ARG A 1 109 ? 14.643  -14.514 7.816  1.00 49.35  ? 213 ARG A NH2   1 
ATOM   794  N N     . ILE A 1 110 ? 11.348  -11.136 10.830 1.00 40.09  ? 214 ILE A N     1 
ATOM   795  C CA    . ILE A 1 110 ? 10.706  -12.036 11.771 1.00 41.18  ? 214 ILE A CA    1 
ATOM   796  C C     . ILE A 1 110 ? 9.695   -11.251 12.621 1.00 43.18  ? 214 ILE A C     1 
ATOM   797  O O     . ILE A 1 110 ? 8.591   -11.748 12.867 1.00 45.54  ? 214 ILE A O     1 
ATOM   798  C CB    . ILE A 1 110 ? 11.771  -12.835 12.598 1.00 45.05  ? 214 ILE A CB    1 
ATOM   799  C CG1   . ILE A 1 110 ? 12.377  -13.972 11.724 1.00 48.47  ? 214 ILE A CG1   1 
ATOM   800  C CG2   . ILE A 1 110 ? 11.174  -13.408 13.893 1.00 46.29  ? 214 ILE A CG2   1 
ATOM   801  C CD1   . ILE A 1 110 ? 13.712  -14.518 12.210 1.00 52.62  ? 214 ILE A CD1   1 
ATOM   802  N N     . LEU A 1 111 ? 10.056  -10.019 13.035 1.00 36.78  ? 215 LEU A N     1 
ATOM   803  C CA    . LEU A 1 111 ? 9.201   -9.178  13.871 1.00 34.79  ? 215 LEU A CA    1 
ATOM   804  C C     . LEU A 1 111 ? 7.926   -8.779  13.125 1.00 40.18  ? 215 LEU A C     1 
ATOM   805  O O     . LEU A 1 111 ? 6.823   -8.899  13.693 1.00 39.91  ? 215 LEU A O     1 
ATOM   806  C CB    . LEU A 1 111 ? 9.961   -7.929  14.383 1.00 33.36  ? 215 LEU A CB    1 
ATOM   807  C CG    . LEU A 1 111 ? 9.201   -6.948  15.276 1.00 37.47  ? 215 LEU A CG    1 
ATOM   808  C CD1   . LEU A 1 111 ? 8.748   -7.596  16.599 1.00 36.70  ? 215 LEU A CD1   1 
ATOM   809  C CD2   . LEU A 1 111 ? 10.051  -5.714  15.570 1.00 34.74  ? 215 LEU A CD2   1 
ATOM   810  N N     . VAL A 1 112 ? 8.069   -8.330  11.859 1.00 38.59  ? 216 VAL A N     1 
ATOM   811  C CA    A VAL A 1 112 ? 6.903   -7.893  11.094 0.50 40.59  ? 216 VAL A CA    1 
ATOM   812  C CA    B VAL A 1 112 ? 6.935   -7.947  10.991 0.50 40.41  ? 216 VAL A CA    1 
ATOM   813  C C     . VAL A 1 112 ? 5.911   -9.077  10.951 1.00 44.79  ? 216 VAL A C     1 
ATOM   814  O O     . VAL A 1 112 ? 4.715   -8.852  11.151 1.00 46.62  ? 216 VAL A O     1 
ATOM   815  C CB    A VAL A 1 112 ? 7.224   -7.127  9.766  0.50 45.42  ? 216 VAL A CB    1 
ATOM   816  C CB    B VAL A 1 112 ? 7.391   -7.540  9.555  0.50 44.89  ? 216 VAL A CB    1 
ATOM   817  C CG1   A VAL A 1 112 ? 7.678   -8.046  8.633  0.50 46.44  ? 216 VAL A CG1   1 
ATOM   818  C CG1   B VAL A 1 112 ? 6.223   -7.480  8.568  0.50 46.78  ? 216 VAL A CG1   1 
ATOM   819  C CG2   A VAL A 1 112 ? 6.052   -6.252  9.327  0.50 46.83  ? 216 VAL A CG2   1 
ATOM   820  C CG2   B VAL A 1 112 ? 8.103   -6.211  9.579  0.50 44.24  ? 216 VAL A CG2   1 
ATOM   821  N N     . GLN A 1 113 ? 6.395   -10.311 10.708 1.00 43.63  ? 217 GLN A N     1 
ATOM   822  C CA    . GLN A 1 113 ? 5.518   -11.479 10.617 1.00 44.52  ? 217 GLN A CA    1 
ATOM   823  C C     . GLN A 1 113 ? 4.779   -11.714 11.944 1.00 43.99  ? 217 GLN A C     1 
ATOM   824  O O     . GLN A 1 113 ? 3.580   -11.940 11.914 1.00 43.23  ? 217 GLN A O     1 
ATOM   825  C CB    . GLN A 1 113 ? 6.288   -12.735 10.185 1.00 47.83  ? 217 GLN A CB    1 
ATOM   826  C CG    . GLN A 1 113 ? 6.927   -12.644 8.806  1.00 67.84  ? 217 GLN A CG    1 
ATOM   827  C CD    . GLN A 1 113 ? 7.551   -13.951 8.380  1.00 97.23  ? 217 GLN A CD    1 
ATOM   828  O OE1   . GLN A 1 113 ? 6.952   -15.028 8.506  1.00 98.26  ? 217 GLN A OE1   1 
ATOM   829  N NE2   . GLN A 1 113 ? 8.751   -13.879 7.815  1.00 89.19  ? 217 GLN A NE2   1 
ATOM   830  N N     . LYS A 1 114 ? 5.475   -11.599 13.103 1.00 38.43  ? 218 LYS A N     1 
ATOM   831  C CA    . LYS A 1 114 ? 4.853   -11.762 14.420 1.00 37.28  ? 218 LYS A CA    1 
ATOM   832  C C     . LYS A 1 114 ? 3.794   -10.676 14.633 1.00 40.68  ? 218 LYS A C     1 
ATOM   833  O O     . LYS A 1 114 ? 2.695   -10.986 15.089 1.00 41.39  ? 218 LYS A O     1 
ATOM   834  C CB    . LYS A 1 114 ? 5.899   -11.661 15.545 1.00 39.03  ? 218 LYS A CB    1 
ATOM   835  C CG    . LYS A 1 114 ? 6.710   -12.911 15.707 1.00 43.09  ? 218 LYS A CG    1 
ATOM   836  C CD    . LYS A 1 114 ? 7.684   -12.754 16.829 1.00 40.86  ? 218 LYS A CD    1 
ATOM   837  C CE    . LYS A 1 114 ? 8.595   -13.951 16.910 1.00 44.09  ? 218 LYS A CE    1 
ATOM   838  N NZ    . LYS A 1 114 ? 9.786   -13.657 17.761 1.00 40.02  ? 218 LYS A NZ    1 
ATOM   839  N N     . LEU A 1 115 ? 4.095   -9.413  14.242 1.00 35.65  ? 219 LEU A N     1 
ATOM   840  C CA    . LEU A 1 115 ? 3.113   -8.339  14.386 1.00 35.20  ? 219 LEU A CA    1 
ATOM   841  C C     . LEU A 1 115 ? 1.899   -8.503  13.463 1.00 41.89  ? 219 LEU A C     1 
ATOM   842  O O     . LEU A 1 115 ? 0.792   -8.138  13.850 1.00 42.47  ? 219 LEU A O     1 
ATOM   843  C CB    . LEU A 1 115 ? 3.755   -6.953  14.233 1.00 33.42  ? 219 LEU A CB    1 
ATOM   844  C CG    . LEU A 1 115 ? 4.771   -6.593  15.322 1.00 36.56  ? 219 LEU A CG    1 
ATOM   845  C CD1   . LEU A 1 115 ? 5.523   -5.328  14.946 1.00 36.22  ? 219 LEU A CD1   1 
ATOM   846  C CD2   . LEU A 1 115 ? 4.089   -6.406  16.684 1.00 40.11  ? 219 LEU A CD2   1 
ATOM   847  N N     . GLN A 1 116 ? 2.093   -9.084  12.278 1.00 40.96  ? 220 GLN A N     1 
ATOM   848  C CA    . GLN A 1 116 ? 1.004   -9.313  11.308 1.00 43.43  ? 220 GLN A CA    1 
ATOM   849  C C     . GLN A 1 116 ? 0.101   -10.447 11.744 1.00 49.00  ? 220 GLN A C     1 
ATOM   850  O O     . GLN A 1 116 ? -1.075  -10.479 11.384 1.00 51.39  ? 220 GLN A O     1 
ATOM   851  C CB    . GLN A 1 116 ? 1.555   -9.529  9.891  1.00 46.53  ? 220 GLN A CB    1 
ATOM   852  C CG    . GLN A 1 116 ? 2.118   -8.240  9.271  1.00 45.54  ? 220 GLN A CG    1 
ATOM   853  C CD    . GLN A 1 116 ? 2.882   -8.528  7.991  1.00 60.64  ? 220 GLN A CD    1 
ATOM   854  O OE1   . GLN A 1 116 ? 3.401   -9.627  7.762  1.00 51.55  ? 220 GLN A OE1   1 
ATOM   855  N NE2   . GLN A 1 116 ? 2.983   -7.540  7.130  1.00 55.01  ? 220 GLN A NE2   1 
ATOM   856  N N     . LYS A 1 117 ? 0.631   -11.355 12.568 1.00 45.05  ? 221 LYS A N     1 
ATOM   857  C CA    . LYS A 1 117 ? -0.136  -12.452 13.130 1.00 45.64  ? 221 LYS A CA    1 
ATOM   858  C C     . LYS A 1 117 ? -0.965  -11.947 14.317 1.00 50.27  ? 221 LYS A C     1 
ATOM   859  O O     . LYS A 1 117 ? -2.192  -12.033 14.277 1.00 51.84  ? 221 LYS A O     1 
ATOM   860  C CB    . LYS A 1 117 ? 0.800   -13.592 13.562 1.00 46.31  ? 221 LYS A CB    1 
ATOM   861  C CG    . LYS A 1 117 ? 0.084   -14.784 14.204 1.00 56.23  ? 221 LYS A CG    1 
ATOM   862  C CD    . LYS A 1 117 ? 1.073   -15.799 14.728 1.00 56.76  ? 221 LYS A CD    1 
ATOM   863  C CE    . LYS A 1 117 ? 0.401   -16.893 15.514 1.00 70.37  ? 221 LYS A CE    1 
ATOM   864  N NZ    . LYS A 1 117 ? 1.368   -17.961 15.856 1.00 80.95  ? 221 LYS A NZ    1 
ATOM   865  N N     . TYR A 1 118 ? -0.293  -11.442 15.375 1.00 44.17  ? 222 TYR A N     1 
ATOM   866  C CA    . TYR A 1 118 ? -0.921  -11.039 16.629 1.00 44.39  ? 222 TYR A CA    1 
ATOM   867  C C     . TYR A 1 118 ? -1.684  -9.725  16.547 1.00 47.48  ? 222 TYR A C     1 
ATOM   868  O O     . TYR A 1 118 ? -2.665  -9.542  17.285 1.00 47.64  ? 222 TYR A O     1 
ATOM   869  C CB    . TYR A 1 118 ? 0.108   -11.031 17.775 1.00 44.27  ? 222 TYR A CB    1 
ATOM   870  C CG    . TYR A 1 118 ? 0.598   -12.434 18.083 1.00 46.25  ? 222 TYR A CG    1 
ATOM   871  C CD1   . TYR A 1 118 ? -0.263  -13.396 18.609 1.00 50.12  ? 222 TYR A CD1   1 
ATOM   872  C CD2   . TYR A 1 118 ? 1.897   -12.824 17.768 1.00 45.44  ? 222 TYR A CD2   1 
ATOM   873  C CE1   . TYR A 1 118 ? 0.169   -14.699 18.857 1.00 52.54  ? 222 TYR A CE1   1 
ATOM   874  C CE2   . TYR A 1 118 ? 2.346   -14.121 18.029 1.00 46.92  ? 222 TYR A CE2   1 
ATOM   875  C CZ    . TYR A 1 118 ? 1.477   -15.055 18.570 1.00 55.69  ? 222 TYR A CZ    1 
ATOM   876  O OH    . TYR A 1 118 ? 1.901   -16.339 18.803 1.00 55.34  ? 222 TYR A OH    1 
ATOM   877  N N     . GLN A 1 119 ? -1.266  -8.835  15.619 1.00 41.07  ? 223 GLN A N     1 
ATOM   878  C CA    . GLN A 1 119 ? -1.913  -7.554  15.338 1.00 39.98  ? 223 GLN A CA    1 
ATOM   879  C C     . GLN A 1 119 ? -2.309  -6.770  16.607 1.00 43.38  ? 223 GLN A C     1 
ATOM   880  O O     . GLN A 1 119 ? -3.508  -6.539  16.831 1.00 44.26  ? 223 GLN A O     1 
ATOM   881  C CB    . GLN A 1 119 ? -3.114  -7.769  14.384 1.00 42.95  ? 223 GLN A CB    1 
ATOM   882  C CG    . GLN A 1 119 ? -2.661  -8.113  12.987 1.00 52.62  ? 223 GLN A CG    1 
ATOM   883  C CD    . GLN A 1 119 ? -3.787  -8.242  11.992 1.00 71.45  ? 223 GLN A CD    1 
ATOM   884  O OE1   . GLN A 1 119 ? -4.804  -7.546  12.057 1.00 71.13  ? 223 GLN A OE1   1 
ATOM   885  N NE2   . GLN A 1 119 ? -3.583  -9.080  10.992 1.00 62.26  ? 223 GLN A NE2   1 
ATOM   886  N N     . PRO A 1 120 ? -1.334  -6.390  17.482 1.00 38.00  ? 224 PRO A N     1 
ATOM   887  C CA    . PRO A 1 120 ? -1.699  -5.585  18.665 1.00 38.72  ? 224 PRO A CA    1 
ATOM   888  C C     . PRO A 1 120 ? -2.105  -4.174  18.231 1.00 43.10  ? 224 PRO A C     1 
ATOM   889  O O     . PRO A 1 120 ? -1.745  -3.776  17.128 1.00 45.18  ? 224 PRO A O     1 
ATOM   890  C CB    . PRO A 1 120 ? -0.387  -5.531  19.462 1.00 38.61  ? 224 PRO A CB    1 
ATOM   891  C CG    . PRO A 1 120 ? 0.681   -5.594  18.419 1.00 41.02  ? 224 PRO A CG    1 
ATOM   892  C CD    . PRO A 1 120 ? 0.137   -6.543  17.370 1.00 37.72  ? 224 PRO A CD    1 
ATOM   893  N N     . ARG A 1 121 ? -2.843  -3.420  19.058 1.00 39.70  ? 225 ARG A N     1 
ATOM   894  C CA    A ARG A 1 121 ? -3.245  -2.052  18.704 0.50 39.53  ? 225 ARG A CA    1 
ATOM   895  C CA    B ARG A 1 121 ? -3.245  -2.056  18.703 0.50 39.76  ? 225 ARG A CA    1 
ATOM   896  C C     . ARG A 1 121 ? -2.016  -1.170  18.428 1.00 41.06  ? 225 ARG A C     1 
ATOM   897  O O     . ARG A 1 121 ? -2.063  -0.299  17.558 1.00 40.56  ? 225 ARG A O     1 
ATOM   898  C CB    A ARG A 1 121 ? -4.091  -1.397  19.822 0.50 39.34  ? 225 ARG A CB    1 
ATOM   899  C CB    B ARG A 1 121 ? -4.109  -1.420  19.817 0.50 40.63  ? 225 ARG A CB    1 
ATOM   900  C CG    A ARG A 1 121 ? -5.426  -2.071  20.122 0.50 49.74  ? 225 ARG A CG    1 
ATOM   901  C CG    B ARG A 1 121 ? -5.446  -2.117  20.068 0.50 54.46  ? 225 ARG A CG    1 
ATOM   902  C CD    A ARG A 1 121 ? -6.239  -1.245  21.105 0.50 55.52  ? 225 ARG A CD    1 
ATOM   903  C CD    B ARG A 1 121 ? -6.293  -1.351  21.069 0.50 65.64  ? 225 ARG A CD    1 
ATOM   904  N NE    A ARG A 1 121 ? -7.424  -1.962  21.580 0.50 61.47  ? 225 ARG A NE    1 
ATOM   905  N NE    B ARG A 1 121 ? -7.723  -1.468  20.777 0.50 77.75  ? 225 ARG A NE    1 
ATOM   906  C CZ    A ARG A 1 121 ? -8.646  -1.819  21.075 0.50 77.37  ? 225 ARG A CZ    1 
ATOM   907  C CZ    B ARG A 1 121 ? -8.605  -2.102  21.544 0.50 94.07  ? 225 ARG A CZ    1 
ATOM   908  N NH1   A ARG A 1 121 ? -8.864  -0.978  20.070 0.50 61.33  ? 225 ARG A NH1   1 
ATOM   909  N NH1   B ARG A 1 121 ? -8.219  -2.688  22.670 0.50 79.31  ? 225 ARG A NH1   1 
ATOM   910  N NH2   A ARG A 1 121 ? -9.660  -2.511  21.574 0.50 69.68  ? 225 ARG A NH2   1 
ATOM   911  N NH2   B ARG A 1 121 ? -9.883  -2.149  21.194 0.50 85.61  ? 225 ARG A NH2   1 
ATOM   912  N N     . ILE A 1 122 ? -0.922  -1.372  19.195 1.00 37.47  ? 226 ILE A N     1 
ATOM   913  C CA    . ILE A 1 122 ? 0.307   -0.558  19.111 1.00 35.35  ? 226 ILE A CA    1 
ATOM   914  C C     . ILE A 1 122 ? 1.596   -1.389  19.272 1.00 38.98  ? 226 ILE A C     1 
ATOM   915  O O     . ILE A 1 122 ? 1.754   -2.087  20.276 1.00 39.10  ? 226 ILE A O     1 
ATOM   916  C CB    . ILE A 1 122 ? 0.256   0.571   20.225 1.00 36.88  ? 226 ILE A CB    1 
ATOM   917  C CG1   . ILE A 1 122 ? -1.051  1.378   20.191 1.00 37.76  ? 226 ILE A CG1   1 
ATOM   918  C CG2   . ILE A 1 122 ? 1.465   1.518   20.153 1.00 34.03  ? 226 ILE A CG2   1 
ATOM   919  C CD1   . ILE A 1 122 ? -1.346  2.206   21.505 1.00 34.29  ? 226 ILE A CD1   1 
ATOM   920  N N     . ALA A 1 123 ? 2.533   -1.266  18.314 1.00 34.55  ? 227 ALA A N     1 
ATOM   921  C CA    . ALA A 1 123 ? 3.848   -1.911  18.392 1.00 32.82  ? 227 ALA A CA    1 
ATOM   922  C C     . ALA A 1 123 ? 4.771   -0.861  19.002 1.00 35.22  ? 227 ALA A C     1 
ATOM   923  O O     . ALA A 1 123 ? 4.980   0.200   18.412 1.00 33.76  ? 227 ALA A O     1 
ATOM   924  C CB    . ALA A 1 123 ? 4.338   -2.320  17.008 1.00 33.06  ? 227 ALA A CB    1 
ATOM   925  N N     . VAL A 1 124 ? 5.276   -1.128  20.204 1.00 31.16  ? 228 VAL A N     1 
ATOM   926  C CA    . VAL A 1 124 ? 6.109   -0.159  20.926 1.00 28.64  ? 228 VAL A CA    1 
ATOM   927  C C     . VAL A 1 124 ? 7.551   -0.548  20.819 1.00 31.66  ? 228 VAL A C     1 
ATOM   928  O O     . VAL A 1 124 ? 7.944   -1.577  21.335 1.00 31.93  ? 228 VAL A O     1 
ATOM   929  C CB    . VAL A 1 124 ? 5.663   0.002   22.393 1.00 32.04  ? 228 VAL A CB    1 
ATOM   930  C CG1   . VAL A 1 124 ? 6.583   0.962   23.177 1.00 30.83  ? 228 VAL A CG1   1 
ATOM   931  C CG2   . VAL A 1 124 ? 4.215   0.443   22.467 1.00 33.38  ? 228 VAL A CG2   1 
ATOM   932  N N     . PHE A 1 125 ? 8.346   0.292   20.179 1.00 28.30  ? 229 PHE A N     1 
ATOM   933  C CA    . PHE A 1 125 ? 9.761   0.044   19.995 1.00 26.09  ? 229 PHE A CA    1 
ATOM   934  C C     . PHE A 1 125 ? 10.473  0.591   21.205 1.00 27.33  ? 229 PHE A C     1 
ATOM   935  O O     . PHE A 1 125 ? 10.473  1.809   21.436 1.00 27.60  ? 229 PHE A O     1 
ATOM   936  C CB    . PHE A 1 125 ? 10.261  0.689   18.686 1.00 27.48  ? 229 PHE A CB    1 
ATOM   937  C CG    . PHE A 1 125 ? 9.781   -0.068  17.480 1.00 29.61  ? 229 PHE A CG    1 
ATOM   938  C CD1   . PHE A 1 125 ? 8.470   0.078   17.020 1.00 31.84  ? 229 PHE A CD1   1 
ATOM   939  C CD2   . PHE A 1 125 ? 10.589  -1.023  16.879 1.00 30.30  ? 229 PHE A CD2   1 
ATOM   940  C CE1   . PHE A 1 125 ? 8.002   -0.704  15.968 1.00 33.73  ? 229 PHE A CE1   1 
ATOM   941  C CE2   . PHE A 1 125 ? 10.132  -1.771  15.800 1.00 33.95  ? 229 PHE A CE2   1 
ATOM   942  C CZ    . PHE A 1 125 ? 8.838   -1.625  15.369 1.00 33.12  ? 229 PHE A CZ    1 
ATOM   943  N N     . ASN A 1 126 ? 10.991  -0.311  22.039 1.00 26.23  ? 230 ASN A N     1 
ATOM   944  C CA    . ASN A 1 126 ? 11.669  0.086   23.246 1.00 27.09  ? 230 ASN A CA    1 
ATOM   945  C C     . ASN A 1 126 ? 13.128  0.387   22.859 1.00 31.19  ? 230 ASN A C     1 
ATOM   946  O O     . ASN A 1 126 ? 14.013  -0.439  23.062 1.00 27.95  ? 230 ASN A O     1 
ATOM   947  C CB    . ASN A 1 126 ? 11.537  -0.977  24.335 1.00 30.44  ? 230 ASN A CB    1 
ATOM   948  C CG    . ASN A 1 126 ? 12.181  -0.594  25.644 1.00 32.32  ? 230 ASN A CG    1 
ATOM   949  O OD1   . ASN A 1 126 ? 12.542  0.567   25.894 1.00 27.03  ? 230 ASN A OD1   1 
ATOM   950  N ND2   . ASN A 1 126 ? 12.329  -1.561  26.519 1.00 27.31  ? 230 ASN A ND2   1 
ATOM   951  N N     . GLY A 1 127 ? 13.326  1.555   22.255 1.00 29.16  ? 231 GLY A N     1 
ATOM   952  C CA    . GLY A 1 127 ? 14.629  1.961   21.761 1.00 28.81  ? 231 GLY A CA    1 
ATOM   953  C C     . GLY A 1 127 ? 14.516  2.546   20.363 1.00 31.76  ? 231 GLY A C     1 
ATOM   954  O O     . GLY A 1 127 ? 13.930  1.940   19.468 1.00 30.60  ? 231 GLY A O     1 
ATOM   955  N N     . LYS A 1 128 ? 15.073  3.746   20.182 1.00 29.14  ? 232 LYS A N     1 
ATOM   956  C CA    . LYS A 1 128 ? 15.088  4.437   18.901 1.00 30.35  ? 232 LYS A CA    1 
ATOM   957  C C     . LYS A 1 128 ? 15.907  3.680   17.844 1.00 35.00  ? 232 LYS A C     1 
ATOM   958  O O     . LYS A 1 128 ? 15.465  3.632   16.722 1.00 32.96  ? 232 LYS A O     1 
ATOM   959  C CB    . LYS A 1 128 ? 15.601  5.868   19.063 1.00 31.79  ? 232 LYS A CB    1 
ATOM   960  C CG    . LYS A 1 128 ? 15.160  6.769   17.943 1.00 36.73  ? 232 LYS A CG    1 
ATOM   961  C CD    . LYS A 1 128 ? 15.775  8.130   18.091 1.00 42.05  ? 232 LYS A CD    1 
ATOM   962  C CE    . LYS A 1 128 ? 14.705  9.161   18.233 1.00 33.37  ? 232 LYS A CE    1 
ATOM   963  N NZ    . LYS A 1 128 ? 15.254  10.541  18.481 1.00 38.26  ? 232 LYS A NZ    1 
ATOM   964  N N     . CYS A 1 129 ? 17.086  3.114   18.207 1.00 35.04  ? 233 CYS A N     1 
ATOM   965  C CA    . CYS A 1 129 ? 18.008  2.388   17.325 1.00 36.65  ? 233 CYS A CA    1 
ATOM   966  C C     . CYS A 1 129 ? 17.313  1.265   16.545 1.00 40.67  ? 233 CYS A C     1 
ATOM   967  O O     . CYS A 1 129 ? 17.596  1.085   15.358 1.00 42.51  ? 233 CYS A O     1 
ATOM   968  C CB    . CYS A 1 129 ? 19.191  1.840   18.118 1.00 37.92  ? 233 CYS A CB    1 
ATOM   969  S SG    . CYS A 1 129 ? 18.734  0.638   19.414 1.00 41.45  ? 233 CYS A SG    1 
ATOM   970  N N     . ILE A 1 130 ? 16.412  0.525   17.204 1.00 34.69  ? 234 ILE A N     1 
ATOM   971  C CA    . ILE A 1 130 ? 15.705  -0.597  16.571 1.00 35.59  ? 234 ILE A CA    1 
ATOM   972  C C     . ILE A 1 130 ? 14.627  -0.078  15.659 1.00 39.17  ? 234 ILE A C     1 
ATOM   973  O O     . ILE A 1 130 ? 14.348  -0.721  14.661 1.00 37.47  ? 234 ILE A O     1 
ATOM   974  C CB    . ILE A 1 130 ? 15.196  -1.684  17.556 1.00 39.98  ? 234 ILE A CB    1 
ATOM   975  C CG1   . ILE A 1 130 ? 14.399  -1.079  18.733 1.00 39.94  ? 234 ILE A CG1   1 
ATOM   976  C CG2   . ILE A 1 130 ? 16.380  -2.536  18.069 1.00 44.89  ? 234 ILE A CG2   1 
ATOM   977  C CD1   . ILE A 1 130 ? 13.380  -2.027  19.362 1.00 43.32  ? 234 ILE A CD1   1 
ATOM   978  N N     . TYR A 1 131 ? 14.004  1.086   15.979 1.00 35.97  ? 235 TYR A N     1 
ATOM   979  C CA    . TYR A 1 131 ? 13.023  1.554   15.012 1.00 34.75  ? 235 TYR A CA    1 
ATOM   980  C C     . TYR A 1 131 ? 13.725  2.124   13.766 1.00 37.99  ? 235 TYR A C     1 
ATOM   981  O O     . TYR A 1 131 ? 13.221  1.954   12.643 1.00 35.80  ? 235 TYR A O     1 
ATOM   982  C CB    . TYR A 1 131 ? 12.040  2.538   15.610 1.00 35.28  ? 235 TYR A CB    1 
ATOM   983  C CG    . TYR A 1 131 ? 10.977  2.904   14.607 1.00 35.41  ? 235 TYR A CG    1 
ATOM   984  C CD1   . TYR A 1 131 ? 9.920   2.046   14.349 1.00 36.96  ? 235 TYR A CD1   1 
ATOM   985  C CD2   . TYR A 1 131 ? 11.058  4.089   13.867 1.00 35.81  ? 235 TYR A CD2   1 
ATOM   986  C CE1   . TYR A 1 131 ? 8.970   2.341   13.373 1.00 37.67  ? 235 TYR A CE1   1 
ATOM   987  C CE2   . TYR A 1 131 ? 10.110  4.392   12.878 1.00 37.01  ? 235 TYR A CE2   1 
ATOM   988  C CZ    . TYR A 1 131 ? 9.064   3.507   12.645 1.00 39.20  ? 235 TYR A CZ    1 
ATOM   989  O OH    . TYR A 1 131 ? 8.076   3.737   11.725 1.00 41.52  ? 235 TYR A OH    1 
ATOM   990  N N     . GLU A 1 132 ? 14.890  2.770   13.950 1.00 37.03  ? 236 GLU A N     1 
ATOM   991  C CA    . GLU A 1 132 ? 15.683  3.286   12.816 1.00 39.00  ? 236 GLU A CA    1 
ATOM   992  C C     . GLU A 1 132 ? 15.874  2.141   11.766 1.00 42.11  ? 236 GLU A C     1 
ATOM   993  O O     . GLU A 1 132 ? 15.549  2.318   10.588 1.00 41.67  ? 236 GLU A O     1 
ATOM   994  C CB    . GLU A 1 132 ? 17.046  3.816   13.299 1.00 41.74  ? 236 GLU A CB    1 
ATOM   995  C CG    . GLU A 1 132 ? 16.982  5.140   14.035 1.00 55.52  ? 236 GLU A CG    1 
ATOM   996  C CD    . GLU A 1 132 ? 18.186  5.614   14.844 1.00 82.18  ? 236 GLU A CD    1 
ATOM   997  O OE1   . GLU A 1 132 ? 19.211  4.892   14.924 1.00 68.96  ? 236 GLU A OE1   1 
ATOM   998  O OE2   . GLU A 1 132 ? 18.088  6.728   15.410 1.00 73.60  ? 236 GLU A OE2   1 
ATOM   999  N N     . ILE A 1 133 ? 16.302  0.956   12.225 1.00 38.08  ? 237 ILE A N     1 
ATOM   1000 C CA    . ILE A 1 133 ? 16.494  -0.230  11.366 1.00 38.77  ? 237 ILE A CA    1 
ATOM   1001 C C     . ILE A 1 133 ? 15.159  -0.708  10.778 1.00 40.39  ? 237 ILE A C     1 
ATOM   1002 O O     . ILE A 1 133 ? 15.062  -0.927  9.586  1.00 39.33  ? 237 ILE A O     1 
ATOM   1003 C CB    . ILE A 1 133 ? 17.199  -1.358  12.169 1.00 41.83  ? 237 ILE A CB    1 
ATOM   1004 C CG1   . ILE A 1 133 ? 18.570  -0.854  12.705 1.00 42.77  ? 237 ILE A CG1   1 
ATOM   1005 C CG2   . ILE A 1 133 ? 17.357  -2.627  11.281 1.00 42.99  ? 237 ILE A CG2   1 
ATOM   1006 C CD1   . ILE A 1 133 ? 19.142  -1.613  13.820 1.00 51.21  ? 237 ILE A CD1   1 
ATOM   1007 N N     . PHE A 1 134 ? 14.145  -0.878  11.630 1.00 37.49  ? 238 PHE A N     1 
ATOM   1008 C CA    . PHE A 1 134 ? 12.822  -1.347  11.247 1.00 36.82  ? 238 PHE A CA    1 
ATOM   1009 C C     . PHE A 1 134 ? 12.207  -0.493  10.135 1.00 42.90  ? 238 PHE A C     1 
ATOM   1010 O O     . PHE A 1 134 ? 11.719  -1.048  9.154  1.00 42.92  ? 238 PHE A O     1 
ATOM   1011 C CB    . PHE A 1 134 ? 11.897  -1.371  12.485 1.00 36.44  ? 238 PHE A CB    1 
ATOM   1012 C CG    . PHE A 1 134 ? 10.592  -2.090  12.229 1.00 38.23  ? 238 PHE A CG    1 
ATOM   1013 C CD1   . PHE A 1 134 ? 10.502  -3.471  12.368 1.00 42.44  ? 238 PHE A CD1   1 
ATOM   1014 C CD2   . PHE A 1 134 ? 9.473   -1.397  11.770 1.00 39.84  ? 238 PHE A CD2   1 
ATOM   1015 C CE1   . PHE A 1 134 ? 9.302   -4.141  12.117 1.00 43.72  ? 238 PHE A CE1   1 
ATOM   1016 C CE2   . PHE A 1 134 ? 8.278   -2.068  11.495 1.00 43.41  ? 238 PHE A CE2   1 
ATOM   1017 C CZ    . PHE A 1 134 ? 8.200   -3.437  11.673 1.00 42.41  ? 238 PHE A CZ    1 
ATOM   1018 N N     . SER A 1 135 ? 12.185  0.841   10.312 1.00 41.23  ? 239 SER A N     1 
ATOM   1019 C CA    . SER A 1 135 ? 11.618  1.797   9.361  1.00 42.93  ? 239 SER A CA    1 
ATOM   1020 C C     . SER A 1 135 ? 12.246  1.655   7.969  1.00 48.06  ? 239 SER A C     1 
ATOM   1021 O O     . SER A 1 135 ? 11.533  1.587   6.954  1.00 47.82  ? 239 SER A O     1 
ATOM   1022 C CB    . SER A 1 135 ? 11.813  3.220   9.885  1.00 47.92  ? 239 SER A CB    1 
ATOM   1023 O OG    . SER A 1 135 ? 11.219  4.176   9.017  1.00 59.82  ? 239 SER A OG    1 
ATOM   1024 N N     . LYS A 1 136 ? 13.585  1.607   7.935  1.00 45.36  ? 240 LYS A N     1 
ATOM   1025 C CA    . LYS A 1 136 ? 14.397  1.490   6.730  1.00 47.91  ? 240 LYS A CA    1 
ATOM   1026 C C     . LYS A 1 136 ? 14.063  0.205   5.971  1.00 50.07  ? 240 LYS A C     1 
ATOM   1027 O O     . LYS A 1 136 ? 13.893  0.208   4.748  1.00 49.95  ? 240 LYS A O     1 
ATOM   1028 C CB    . LYS A 1 136 ? 15.874  1.473   7.158  1.00 52.16  ? 240 LYS A CB    1 
ATOM   1029 C CG    . LYS A 1 136 ? 16.824  2.193   6.224  1.00 65.32  ? 240 LYS A CG    1 
ATOM   1030 C CD    . LYS A 1 136 ? 18.257  2.230   6.772  1.00 79.81  ? 240 LYS A CD    1 
ATOM   1031 C CE    . LYS A 1 136 ? 18.440  3.066   8.026  1.00 98.36  ? 240 LYS A CE    1 
ATOM   1032 N NZ    . LYS A 1 136 ? 19.855  3.493   8.218  1.00 113.88 ? 240 LYS A NZ    1 
ATOM   1033 N N     . GLU A 1 137 ? 13.922  -0.884  6.715  1.00 45.33  ? 241 GLU A N     1 
ATOM   1034 C CA    . GLU A 1 137 ? 13.669  -2.206  6.168  1.00 43.61  ? 241 GLU A CA    1 
ATOM   1035 C C     . GLU A 1 137 ? 12.218  -2.440  5.749  1.00 47.44  ? 241 GLU A C     1 
ATOM   1036 O O     . GLU A 1 137 ? 11.970  -3.041  4.703  1.00 48.93  ? 241 GLU A O     1 
ATOM   1037 C CB    . GLU A 1 137 ? 14.131  -3.260  7.190  1.00 43.44  ? 241 GLU A CB    1 
ATOM   1038 C CG    . GLU A 1 137 ? 14.026  -4.706  6.728  1.00 46.97  ? 241 GLU A CG    1 
ATOM   1039 C CD    . GLU A 1 137 ? 14.190  -5.730  7.836  1.00 56.89  ? 241 GLU A CD    1 
ATOM   1040 O OE1   . GLU A 1 137 ? 14.264  -5.338  9.024  1.00 44.68  ? 241 GLU A OE1   1 
ATOM   1041 O OE2   . GLU A 1 137 ? 14.239  -6.937  7.514  1.00 47.95  ? 241 GLU A OE2   1 
ATOM   1042 N N     . VAL A 1 138 ? 11.275  -1.966  6.541  1.00 42.44  ? 242 VAL A N     1 
ATOM   1043 C CA    . VAL A 1 138 ? 9.844   -2.242  6.376  1.00 43.27  ? 242 VAL A CA    1 
ATOM   1044 C C     . VAL A 1 138 ? 9.091   -1.148  5.598  1.00 50.26  ? 242 VAL A C     1 
ATOM   1045 O O     . VAL A 1 138 ? 8.230   -1.464  4.792  1.00 51.73  ? 242 VAL A O     1 
ATOM   1046 C CB    . VAL A 1 138 ? 9.211   -2.532  7.773  1.00 44.21  ? 242 VAL A CB    1 
ATOM   1047 C CG1   . VAL A 1 138 ? 7.726   -2.839  7.688  1.00 43.83  ? 242 VAL A CG1   1 
ATOM   1048 C CG2   . VAL A 1 138 ? 9.949   -3.670  8.477  1.00 43.61  ? 242 VAL A CG2   1 
ATOM   1049 N N     . PHE A 1 139 ? 9.390   0.117   5.854  1.00 48.73  ? 243 PHE A N     1 
ATOM   1050 C CA    . PHE A 1 139 ? 8.702   1.206   5.175  1.00 50.62  ? 243 PHE A CA    1 
ATOM   1051 C C     . PHE A 1 139 ? 9.559   1.866   4.099  1.00 58.95  ? 243 PHE A C     1 
ATOM   1052 O O     . PHE A 1 139 ? 9.043   2.690   3.346  1.00 60.96  ? 243 PHE A O     1 
ATOM   1053 C CB    . PHE A 1 139 ? 8.245   2.243   6.216  1.00 51.05  ? 243 PHE A CB    1 
ATOM   1054 C CG    . PHE A 1 139 ? 7.424   1.644   7.320  1.00 50.17  ? 243 PHE A CG    1 
ATOM   1055 C CD1   . PHE A 1 139 ? 6.176   1.086   7.059  1.00 52.59  ? 243 PHE A CD1   1 
ATOM   1056 C CD2   . PHE A 1 139 ? 7.905   1.608   8.626  1.00 49.67  ? 243 PHE A CD2   1 
ATOM   1057 C CE1   . PHE A 1 139 ? 5.436   0.496   8.083  1.00 51.62  ? 243 PHE A CE1   1 
ATOM   1058 C CE2   . PHE A 1 139 ? 7.161   1.017   9.642  1.00 50.58  ? 243 PHE A CE2   1 
ATOM   1059 C CZ    . PHE A 1 139 ? 5.927   0.482   9.367  1.00 49.19  ? 243 PHE A CZ    1 
ATOM   1060 N N     . GLY A 1 140 ? 10.849  1.506   4.043  1.00 57.69  ? 244 GLY A N     1 
ATOM   1061 C CA    . GLY A 1 140 ? 11.815  2.072   3.098  1.00 60.74  ? 244 GLY A CA    1 
ATOM   1062 C C     . GLY A 1 140 ? 12.035  3.552   3.337  1.00 64.47  ? 244 GLY A C     1 
ATOM   1063 O O     . GLY A 1 140 ? 12.341  4.305   2.408  1.00 64.12  ? 244 GLY A O     1 
ATOM   1064 N N     . VAL A 1 141 ? 11.875  3.967   4.605  1.00 59.94  ? 245 VAL A N     1 
ATOM   1065 C CA    . VAL A 1 141 ? 11.930  5.349   5.061  1.00 61.14  ? 245 VAL A CA    1 
ATOM   1066 C C     . VAL A 1 141 ? 13.146  5.566   5.940  1.00 65.06  ? 245 VAL A C     1 
ATOM   1067 O O     . VAL A 1 141 ? 13.374  4.814   6.899  1.00 61.88  ? 245 VAL A O     1 
ATOM   1068 C CB    . VAL A 1 141 ? 10.607  5.730   5.815  1.00 65.71  ? 245 VAL A CB    1 
ATOM   1069 C CG1   . VAL A 1 141 ? 10.647  7.155   6.366  1.00 66.93  ? 245 VAL A CG1   1 
ATOM   1070 C CG2   . VAL A 1 141 ? 9.376   5.548   4.929  1.00 67.13  ? 245 VAL A CG2   1 
ATOM   1071 N N     . LYS A 1 142 ? 13.894  6.626   5.635  1.00 64.96  ? 246 LYS A N     1 
ATOM   1072 C CA    . LYS A 1 142 ? 15.025  7.074   6.425  1.00 66.52  ? 246 LYS A CA    1 
ATOM   1073 C C     . LYS A 1 142 ? 14.888  8.573   6.565  1.00 74.89  ? 246 LYS A C     1 
ATOM   1074 O O     . LYS A 1 142 ? 15.230  9.323   5.635  1.00 77.00  ? 246 LYS A O     1 
ATOM   1075 C CB    . LYS A 1 142 ? 16.378  6.696   5.794  1.00 71.10  ? 246 LYS A CB    1 
ATOM   1076 C CG    . LYS A 1 142 ? 17.454  6.337   6.826  1.00 85.56  ? 246 LYS A CG    1 
ATOM   1077 C CD    . LYS A 1 142 ? 18.063  7.529   7.566  1.00 93.93  ? 246 LYS A CD    1 
ATOM   1078 C CE    . LYS A 1 142 ? 18.909  7.088   8.731  1.00 103.71 ? 246 LYS A CE    1 
ATOM   1079 N NZ    . LYS A 1 142 ? 19.396  8.247   9.520  1.00 116.00 ? 246 LYS A NZ    1 
ATOM   1080 N N     . VAL A 1 143 ? 14.321  9.018   7.708  1.00 71.09  ? 247 VAL A N     1 
ATOM   1081 C CA    . VAL A 1 143 ? 14.189  10.462  7.935  1.00 72.67  ? 247 VAL A CA    1 
ATOM   1082 C C     . VAL A 1 143 ? 15.477  10.907  8.630  1.00 77.15  ? 247 VAL A C     1 
ATOM   1083 O O     . VAL A 1 143 ? 16.182  10.086  9.222  1.00 75.85  ? 247 VAL A O     1 
ATOM   1084 C CB    . VAL A 1 143 ? 12.886  10.900  8.683  1.00 75.96  ? 247 VAL A CB    1 
ATOM   1085 C CG1   . VAL A 1 143 ? 12.752  12.422  8.730  1.00 79.18  ? 247 VAL A CG1   1 
ATOM   1086 C CG2   . VAL A 1 143 ? 11.645  10.302  8.036  1.00 75.22  ? 247 VAL A CG2   1 
ATOM   1087 N N     . LYS A 1 144 ? 15.825  12.178  8.480  1.00 67.77  ? 248 LYS A N     1 
ATOM   1088 C CA    . LYS A 1 144 ? 17.000  12.761  9.112  1.00 67.92  ? 248 LYS A CA    1 
ATOM   1089 C C     . LYS A 1 144 ? 16.613  13.039  10.560 1.00 64.99  ? 248 LYS A C     1 
ATOM   1090 O O     . LYS A 1 144 ? 17.441  12.913  11.456 1.00 64.35  ? 248 LYS A O     1 
ATOM   1091 C CB    . LYS A 1 144 ? 17.376  14.082  8.400  1.00 74.44  ? 248 LYS A CB    1 
ATOM   1092 N N     . ASN A 1 145 ? 15.357  13.455  10.768 1.00 58.20  ? 249 ASN A N     1 
ATOM   1093 C CA    . ASN A 1 145 ? 14.842  13.800  12.079 1.00 56.45  ? 249 ASN A CA    1 
ATOM   1094 C C     . ASN A 1 145 ? 13.862  12.740  12.602 1.00 52.61  ? 249 ASN A C     1 
ATOM   1095 O O     . ASN A 1 145 ? 12.672  13.015  12.772 1.00 51.10  ? 249 ASN A O     1 
ATOM   1096 C CB    . ASN A 1 145 ? 14.258  15.228  12.097 1.00 60.71  ? 249 ASN A CB    1 
ATOM   1097 N N     . LEU A 1 146 ? 14.366  11.508  12.838 1.00 45.47  ? 250 LEU A N     1 
ATOM   1098 C CA    . LEU A 1 146 ? 13.503  10.488  13.431 1.00 40.61  ? 250 LEU A CA    1 
ATOM   1099 C C     . LEU A 1 146 ? 13.323  10.896  14.895 1.00 35.51  ? 250 LEU A C     1 
ATOM   1100 O O     . LEU A 1 146 ? 14.304  11.105  15.603 1.00 34.73  ? 250 LEU A O     1 
ATOM   1101 C CB    . LEU A 1 146 ? 14.055  9.055   13.328 1.00 40.62  ? 250 LEU A CB    1 
ATOM   1102 C CG    . LEU A 1 146 ? 13.249  8.026   14.166 1.00 45.73  ? 250 LEU A CG    1 
ATOM   1103 C CD1   . LEU A 1 146 ? 11.835  7.863   13.648 1.00 47.16  ? 250 LEU A CD1   1 
ATOM   1104 C CD2   . LEU A 1 146 ? 13.975  6.716   14.300 1.00 48.73  ? 250 LEU A CD2   1 
ATOM   1105 N N     . GLU A 1 147 ? 12.082  11.000  15.314 1.00 27.03  ? 251 GLU A N     1 
ATOM   1106 C CA    . GLU A 1 147 ? 11.580  11.408  16.627 1.00 28.62  ? 251 GLU A CA    1 
ATOM   1107 C C     . GLU A 1 147 ? 10.861  10.236  17.430 1.00 33.98  ? 251 GLU A C     1 
ATOM   1108 O O     . GLU A 1 147 ? 10.531  9.192   16.856 1.00 35.27  ? 251 GLU A O     1 
ATOM   1109 C CB    . GLU A 1 147 ? 10.553  12.541  16.400 1.00 29.53  ? 251 GLU A CB    1 
ATOM   1110 C CG    . GLU A 1 147 ? 11.247  13.732  15.739 1.00 32.56  ? 251 GLU A CG    1 
ATOM   1111 C CD    . GLU A 1 147 ? 10.498  15.035  15.770 1.00 53.21  ? 251 GLU A CD    1 
ATOM   1112 O OE1   . GLU A 1 147 ? 9.252   14.994  15.808 1.00 39.04  ? 251 GLU A OE1   1 
ATOM   1113 O OE2   . GLU A 1 147 ? 11.157  16.097  15.842 1.00 51.08  ? 251 GLU A OE2   1 
ATOM   1114 N N     . PHE A 1 148 ? 10.657  10.411  18.754 1.00 27.11  ? 252 PHE A N     1 
ATOM   1115 C CA    . PHE A 1 148 ? 10.088  9.362   19.614 1.00 28.71  ? 252 PHE A CA    1 
ATOM   1116 C C     . PHE A 1 148 ? 8.675   9.545   19.408 1.00 29.90  ? 252 PHE A C     1 
ATOM   1117 O O     . PHE A 1 148 ? 8.414   10.453  18.662 1.00 28.00  ? 252 PHE A O     1 
ATOM   1118 C CB    . PHE A 1 148 ? 10.463  9.636   21.077 1.00 31.53  ? 252 PHE A CB    1 
ATOM   1119 C CG    . PHE A 1 148 ? 11.922  9.329   21.291 1.00 32.89  ? 252 PHE A CG    1 
ATOM   1120 C CD1   . PHE A 1 148 ? 12.362  8.022   21.352 1.00 33.83  ? 252 PHE A CD1   1 
ATOM   1121 C CD2   . PHE A 1 148 ? 12.840  10.350  21.486 1.00 34.69  ? 252 PHE A CD2   1 
ATOM   1122 C CE1   . PHE A 1 148 ? 13.718  7.730   21.509 1.00 34.82  ? 252 PHE A CE1   1 
ATOM   1123 C CE2   . PHE A 1 148 ? 14.203  10.062  21.675 1.00 37.92  ? 252 PHE A CE2   1 
ATOM   1124 C CZ    . PHE A 1 148 ? 14.618  8.750   21.727 1.00 37.60  ? 252 PHE A CZ    1 
ATOM   1125 N N     . GLY A 1 149 ? 7.803   8.780   20.044 1.00 30.63  ? 253 GLY A N     1 
ATOM   1126 C CA    . GLY A 1 149 ? 6.363   9.038   19.902 1.00 31.70  ? 253 GLY A CA    1 
ATOM   1127 C C     . GLY A 1 149 ? 5.745   8.292   18.749 1.00 32.90  ? 253 GLY A C     1 
ATOM   1128 O O     . GLY A 1 149 ? 6.377   7.449   18.142 1.00 31.09  ? 253 GLY A O     1 
ATOM   1129 N N     . LEU A 1 150 ? 4.492   8.607   18.399 1.00 31.74  ? 254 LEU A N     1 
ATOM   1130 C CA    . LEU A 1 150 ? 3.873   7.912   17.326 1.00 32.78  ? 254 LEU A CA    1 
ATOM   1131 C C     . LEU A 1 150 ? 4.480   8.176   15.955 1.00 42.21  ? 254 LEU A C     1 
ATOM   1132 O O     . LEU A 1 150 ? 4.757   9.332   15.576 1.00 42.22  ? 254 LEU A O     1 
ATOM   1133 C CB    . LEU A 1 150 ? 2.399   8.340   17.282 1.00 34.13  ? 254 LEU A CB    1 
ATOM   1134 C CG    . LEU A 1 150 ? 1.574   7.571   16.335 1.00 41.00  ? 254 LEU A CG    1 
ATOM   1135 C CD1   . LEU A 1 150 ? 1.425   6.124   16.758 1.00 42.87  ? 254 LEU A CD1   1 
ATOM   1136 C CD2   . LEU A 1 150 ? 0.250   8.254   16.172 1.00 37.68  ? 254 LEU A CD2   1 
ATOM   1137 N N     . GLN A 1 151 ? 4.657   7.072   15.208 1.00 40.34  ? 255 GLN A N     1 
ATOM   1138 C CA    . GLN A 1 151 ? 5.240   7.050   13.883 1.00 39.75  ? 255 GLN A CA    1 
ATOM   1139 C C     . GLN A 1 151 ? 4.149   7.083   12.851 1.00 43.89  ? 255 GLN A C     1 
ATOM   1140 O O     . GLN A 1 151 ? 3.027   6.660   13.124 1.00 44.92  ? 255 GLN A O     1 
ATOM   1141 C CB    . GLN A 1 151 ? 6.199   5.893   13.726 1.00 40.33  ? 255 GLN A CB    1 
ATOM   1142 C CG    . GLN A 1 151 ? 7.226   5.876   14.838 1.00 37.04  ? 255 GLN A CG    1 
ATOM   1143 C CD    . GLN A 1 151 ? 8.164   7.069   14.892 1.00 50.71  ? 255 GLN A CD    1 
ATOM   1144 O OE1   . GLN A 1 151 ? 8.716   7.494   13.859 1.00 37.59  ? 255 GLN A OE1   1 
ATOM   1145 N NE2   . GLN A 1 151 ? 8.450   7.574   16.130 1.00 24.38  ? 255 GLN A NE2   1 
ATOM   1146 N N     . PRO A 1 152 ? 4.392   7.737   11.709 1.00 40.96  ? 256 PRO A N     1 
ATOM   1147 C CA    . PRO A 1 152 ? 3.287   7.938   10.760 1.00 41.81  ? 256 PRO A CA    1 
ATOM   1148 C C     . PRO A 1 152 ? 2.942   6.734   9.873  1.00 48.14  ? 256 PRO A C     1 
ATOM   1149 O O     . PRO A 1 152 ? 2.196   6.897   8.925  1.00 48.45  ? 256 PRO A O     1 
ATOM   1150 C CB    . PRO A 1 152 ? 3.725   9.169   9.953  1.00 44.75  ? 256 PRO A CB    1 
ATOM   1151 C CG    . PRO A 1 152 ? 5.208   9.307   10.159 1.00 47.91  ? 256 PRO A CG    1 
ATOM   1152 C CD    . PRO A 1 152 ? 5.648   8.376   11.251 1.00 42.34  ? 256 PRO A CD    1 
ATOM   1153 N N     . HIS A 1 153 ? 3.448   5.525   10.191 1.00 46.53  ? 257 HIS A N     1 
ATOM   1154 C CA    . HIS A 1 153 ? 3.192   4.327   9.382  1.00 49.72  ? 257 HIS A CA    1 
ATOM   1155 C C     . HIS A 1 153 ? 2.670   3.165   10.206 1.00 53.24  ? 257 HIS A C     1 
ATOM   1156 O O     . HIS A 1 153 ? 3.248   2.854   11.247 1.00 51.26  ? 257 HIS A O     1 
ATOM   1157 C CB    . HIS A 1 153 ? 4.492   3.888   8.692  1.00 51.22  ? 257 HIS A CB    1 
ATOM   1158 C CG    . HIS A 1 153 ? 5.089   4.930   7.806  1.00 54.88  ? 257 HIS A CG    1 
ATOM   1159 N ND1   . HIS A 1 153 ? 6.232   5.625   8.180  1.00 54.39  ? 257 HIS A ND1   1 
ATOM   1160 C CD2   . HIS A 1 153 ? 4.667   5.387   6.605  1.00 57.67  ? 257 HIS A CD2   1 
ATOM   1161 C CE1   . HIS A 1 153 ? 6.483   6.450   7.176  1.00 54.68  ? 257 HIS A CE1   1 
ATOM   1162 N NE2   . HIS A 1 153 ? 5.560   6.347   6.213  1.00 57.27  ? 257 HIS A NE2   1 
ATOM   1163 N N     . LYS A 1 154 ? 1.627   2.488   9.706  1.00 45.05  ? 258 LYS A N     1 
ATOM   1164 C CA    . LYS A 1 154 ? 1.058   1.303   10.350 1.00 44.10  ? 258 LYS A CA    1 
ATOM   1165 C C     . LYS A 1 154 ? 1.848   0.072   9.866  1.00 45.01  ? 258 LYS A C     1 
ATOM   1166 O O     . LYS A 1 154 ? 2.417   0.109   8.775  1.00 45.43  ? 258 LYS A O     1 
ATOM   1167 C CB    . LYS A 1 154 ? -0.427  1.141   9.961  1.00 48.01  ? 258 LYS A CB    1 
ATOM   1168 C CG    . LYS A 1 154 ? -1.325  2.275   10.423 1.00 53.90  ? 258 LYS A CG    1 
ATOM   1169 C CD    . LYS A 1 154 ? -2.723  2.135   9.848  1.00 63.66  ? 258 LYS A CD    1 
ATOM   1170 C CE    . LYS A 1 154 ? -3.586  3.322   10.197 1.00 72.66  ? 258 LYS A CE    1 
ATOM   1171 N NZ    . LYS A 1 154 ? -4.825  3.377   9.376  1.00 87.68  ? 258 LYS A NZ    1 
ATOM   1172 N N     . ILE A 1 155 ? 1.887   -1.005  10.654 1.00 40.13  ? 259 ILE A N     1 
ATOM   1173 C CA    . ILE A 1 155 ? 2.550   -2.254  10.253 1.00 40.08  ? 259 ILE A CA    1 
ATOM   1174 C C     . ILE A 1 155 ? 1.856   -2.719  8.921  1.00 48.05  ? 259 ILE A C     1 
ATOM   1175 O O     . ILE A 1 155 ? 0.621   -2.664  8.853  1.00 49.62  ? 259 ILE A O     1 
ATOM   1176 C CB    . ILE A 1 155 ? 2.469   -3.307  11.403 1.00 42.72  ? 259 ILE A CB    1 
ATOM   1177 C CG1   . ILE A 1 155 ? 3.261   -2.854  12.661 1.00 40.53  ? 259 ILE A CG1   1 
ATOM   1178 C CG2   . ILE A 1 155 ? 2.860   -4.738  10.949 1.00 45.74  ? 259 ILE A CG2   1 
ATOM   1179 C CD1   . ILE A 1 155 ? 4.779   -2.761  12.537 1.00 43.35  ? 259 ILE A CD1   1 
ATOM   1180 N N     . PRO A 1 156 ? 2.604   -3.023  7.824  1.00 46.40  ? 260 PRO A N     1 
ATOM   1181 C CA    . PRO A 1 156 ? 1.935   -3.404  6.551  1.00 48.77  ? 260 PRO A CA    1 
ATOM   1182 C C     . PRO A 1 156 ? 0.885   -4.501  6.710  1.00 55.87  ? 260 PRO A C     1 
ATOM   1183 O O     . PRO A 1 156 ? 1.110   -5.459  7.442  1.00 55.26  ? 260 PRO A O     1 
ATOM   1184 C CB    . PRO A 1 156 ? 3.087   -3.868  5.647  1.00 51.15  ? 260 PRO A CB    1 
ATOM   1185 C CG    . PRO A 1 156 ? 4.296   -3.237  6.226  1.00 53.91  ? 260 PRO A CG    1 
ATOM   1186 C CD    . PRO A 1 156 ? 4.073   -3.097  7.702  1.00 47.91  ? 260 PRO A CD    1 
ATOM   1187 N N     . ASP A 1 157 ? -0.273  -4.326  6.046  1.00 56.48  ? 261 ASP A N     1 
ATOM   1188 C CA    . ASP A 1 157 ? -1.432  -5.230  6.059  1.00 58.38  ? 261 ASP A CA    1 
ATOM   1189 C C     . ASP A 1 157 ? -2.127  -5.309  7.440  1.00 60.92  ? 261 ASP A C     1 
ATOM   1190 O O     . ASP A 1 157 ? -2.807  -6.296  7.726  1.00 63.97  ? 261 ASP A O     1 
ATOM   1191 C CB    . ASP A 1 157 ? -1.075  -6.640  5.516  1.00 62.25  ? 261 ASP A CB    1 
ATOM   1192 C CG    . ASP A 1 157 ? -0.405  -6.637  4.154  1.00 79.96  ? 261 ASP A CG    1 
ATOM   1193 O OD1   . ASP A 1 157 ? -1.023  -6.130  3.187  1.00 82.48  ? 261 ASP A OD1   1 
ATOM   1194 O OD2   . ASP A 1 157 ? 0.738   -7.139  4.053  1.00 88.54  ? 261 ASP A OD2   1 
ATOM   1195 N N     . THR A 1 158 ? -1.945  -4.290  8.294  1.00 53.48  ? 262 THR A N     1 
ATOM   1196 C CA    . THR A 1 158 ? -2.564  -4.214  9.632  1.00 51.78  ? 262 THR A CA    1 
ATOM   1197 C C     . THR A 1 158 ? -2.938  -2.763  9.962  1.00 55.14  ? 262 THR A C     1 
ATOM   1198 O O     . THR A 1 158 ? -2.537  -1.825  9.245  1.00 54.92  ? 262 THR A O     1 
ATOM   1199 C CB    . THR A 1 158 ? -1.593  -4.658  10.772 1.00 53.01  ? 262 THR A CB    1 
ATOM   1200 O OG1   . THR A 1 158 ? -0.742  -3.565  11.110 1.00 50.99  ? 262 THR A OG1   1 
ATOM   1201 C CG2   . THR A 1 158 ? -0.795  -5.928  10.476 1.00 47.68  ? 262 THR A CG2   1 
ATOM   1202 N N     . GLU A 1 159 ? -3.612  -2.583  11.120 1.00 50.58  ? 263 GLU A N     1 
ATOM   1203 C CA    . GLU A 1 159 ? -3.962  -1.285  11.699 1.00 49.40  ? 263 GLU A CA    1 
ATOM   1204 C C     . GLU A 1 159 ? -3.020  -0.994  12.892 1.00 49.58  ? 263 GLU A C     1 
ATOM   1205 O O     . GLU A 1 159 ? -3.208  0.006   13.593 1.00 50.59  ? 263 GLU A O     1 
ATOM   1206 C CB    . GLU A 1 159 ? -5.442  -1.253  12.142 1.00 53.01  ? 263 GLU A CB    1 
ATOM   1207 C CG    . GLU A 1 159 ? -6.432  -1.124  10.988 1.00 65.28  ? 263 GLU A CG    1 
ATOM   1208 C CD    . GLU A 1 159 ? -6.185  0.009   10.006 1.00 84.09  ? 263 GLU A CD    1 
ATOM   1209 O OE1   . GLU A 1 159 ? -5.965  -0.282  8.808  1.00 73.11  ? 263 GLU A OE1   1 
ATOM   1210 O OE2   . GLU A 1 159 ? -6.208  1.186   10.435 1.00 79.14  ? 263 GLU A OE2   1 
ATOM   1211 N N     . THR A 1 160 ? -2.003  -1.863  13.110 1.00 42.64  ? 264 THR A N     1 
ATOM   1212 C CA    . THR A 1 160 ? -1.045  -1.723  14.245 1.00 40.55  ? 264 THR A CA    1 
ATOM   1213 C C     . THR A 1 160 ? -0.182  -0.500  14.085 1.00 41.58  ? 264 THR A C     1 
ATOM   1214 O O     . THR A 1 160 ? 0.520   -0.371  13.078 1.00 41.66  ? 264 THR A O     1 
ATOM   1215 C CB    . THR A 1 160 ? -0.172  -2.988  14.400 1.00 44.06  ? 264 THR A CB    1 
ATOM   1216 O OG1   . THR A 1 160 ? -1.027  -4.118  14.524 1.00 46.40  ? 264 THR A OG1   1 
ATOM   1217 C CG2   . THR A 1 160 ? 0.788   -2.902  15.603 1.00 41.05  ? 264 THR A CG2   1 
ATOM   1218 N N     . LEU A 1 161 ? -0.221  0.394   15.084 1.00 36.74  ? 265 LEU A N     1 
ATOM   1219 C CA    . LEU A 1 161 ? 0.564   1.617   15.059 1.00 35.73  ? 265 LEU A CA    1 
ATOM   1220 C C     . LEU A 1 161 ? 1.984   1.329   15.563 1.00 40.30  ? 265 LEU A C     1 
ATOM   1221 O O     . LEU A 1 161 ? 2.220   0.304   16.206 1.00 39.62  ? 265 LEU A O     1 
ATOM   1222 C CB    . LEU A 1 161 ? -0.092  2.711   15.924 1.00 37.11  ? 265 LEU A CB    1 
ATOM   1223 C CG    . LEU A 1 161 ? -1.545  3.127   15.581 1.00 44.92  ? 265 LEU A CG    1 
ATOM   1224 C CD1   . LEU A 1 161 ? -2.055  4.121   16.602 1.00 46.88  ? 265 LEU A CD1   1 
ATOM   1225 C CD2   . LEU A 1 161 ? -1.644  3.735   14.215 1.00 46.00  ? 265 LEU A CD2   1 
ATOM   1226 N N     . CYS A 1 162 ? 2.930   2.211   15.224 1.00 34.60  ? 266 CYS A N     1 
ATOM   1227 C CA    . CYS A 1 162 ? 4.311   2.117   15.654 1.00 33.77  ? 266 CYS A CA    1 
ATOM   1228 C C     . CYS A 1 162 ? 4.544   3.307   16.551 1.00 34.80  ? 266 CYS A C     1 
ATOM   1229 O O     . CYS A 1 162 ? 4.269   4.448   16.163 1.00 36.18  ? 266 CYS A O     1 
ATOM   1230 C CB    . CYS A 1 162 ? 5.266   2.116   14.464 1.00 34.42  ? 266 CYS A CB    1 
ATOM   1231 S SG    . CYS A 1 162 ? 5.116   0.657   13.419 1.00 40.03  ? 266 CYS A SG    1 
ATOM   1232 N N     . TYR A 1 163 ? 5.030   3.039   17.755 1.00 30.58  ? 267 TYR A N     1 
ATOM   1233 C CA    . TYR A 1 163 ? 5.290   4.066   18.761 1.00 28.68  ? 267 TYR A CA    1 
ATOM   1234 C C     . TYR A 1 163 ? 6.689   3.847   19.287 1.00 32.49  ? 267 TYR A C     1 
ATOM   1235 O O     . TYR A 1 163 ? 7.031   2.711   19.590 1.00 34.48  ? 267 TYR A O     1 
ATOM   1236 C CB    . TYR A 1 163 ? 4.227   3.954   19.858 1.00 29.74  ? 267 TYR A CB    1 
ATOM   1237 C CG    . TYR A 1 163 ? 4.315   5.045   20.882 1.00 29.76  ? 267 TYR A CG    1 
ATOM   1238 C CD1   . TYR A 1 163 ? 3.693   6.276   20.672 1.00 31.48  ? 267 TYR A CD1   1 
ATOM   1239 C CD2   . TYR A 1 163 ? 5.074   4.881   22.033 1.00 31.08  ? 267 TYR A CD2   1 
ATOM   1240 C CE1   . TYR A 1 163 ? 3.787   7.297   21.606 1.00 31.42  ? 267 TYR A CE1   1 
ATOM   1241 C CE2   . TYR A 1 163 ? 5.165   5.893   22.982 1.00 32.11  ? 267 TYR A CE2   1 
ATOM   1242 C CZ    . TYR A 1 163 ? 4.529   7.101   22.759 1.00 37.87  ? 267 TYR A CZ    1 
ATOM   1243 O OH    . TYR A 1 163 ? 4.657   8.093   23.682 1.00 36.52  ? 267 TYR A OH    1 
ATOM   1244 N N     . VAL A 1 164 ? 7.533   4.900   19.325 1.00 26.72  ? 268 VAL A N     1 
ATOM   1245 C CA    . VAL A 1 164 ? 8.953   4.731   19.709 1.00 23.97  ? 268 VAL A CA    1 
ATOM   1246 C C     . VAL A 1 164 ? 9.267   5.406   21.028 1.00 29.07  ? 268 VAL A C     1 
ATOM   1247 O O     . VAL A 1 164 ? 8.915   6.557   21.238 1.00 28.50  ? 268 VAL A O     1 
ATOM   1248 C CB    . VAL A 1 164 ? 9.929   5.207   18.576 1.00 25.03  ? 268 VAL A CB    1 
ATOM   1249 C CG1   . VAL A 1 164 ? 11.381  4.913   18.927 1.00 24.57  ? 268 VAL A CG1   1 
ATOM   1250 C CG2   . VAL A 1 164 ? 9.598   4.534   17.251 1.00 23.78  ? 268 VAL A CG2   1 
ATOM   1251 N N     . MET A 1 165 ? 10.004  4.719   21.891 1.00 27.67  ? 269 MET A N     1 
ATOM   1252 C CA    . MET A 1 165 ? 10.396  5.332   23.159 1.00 29.47  ? 269 MET A CA    1 
ATOM   1253 C C     . MET A 1 165 ? 11.917  5.244   23.325 1.00 30.54  ? 269 MET A C     1 
ATOM   1254 O O     . MET A 1 165 ? 12.506  4.344   22.747 1.00 29.46  ? 269 MET A O     1 
ATOM   1255 C CB    . MET A 1 165 ? 9.712   4.604   24.341 1.00 32.01  ? 269 MET A CB    1 
ATOM   1256 C CG    . MET A 1 165 ? 8.211   4.616   24.246 1.00 35.70  ? 269 MET A CG    1 
ATOM   1257 S SD    . MET A 1 165 ? 7.340   4.265   25.773 1.00 39.29  ? 269 MET A SD    1 
ATOM   1258 C CE    . MET A 1 165 ? 8.111   2.620   26.223 1.00 34.09  ? 269 MET A CE    1 
ATOM   1259 N N     . PRO A 1 166 ? 12.546  6.130   24.128 1.00 27.93  ? 270 PRO A N     1 
ATOM   1260 C CA    . PRO A 1 166 ? 13.966  5.928   24.477 1.00 28.81  ? 270 PRO A CA    1 
ATOM   1261 C C     . PRO A 1 166 ? 14.073  4.583   25.199 1.00 31.53  ? 270 PRO A C     1 
ATOM   1262 O O     . PRO A 1 166 ? 13.164  4.245   25.973 1.00 29.42  ? 270 PRO A O     1 
ATOM   1263 C CB    . PRO A 1 166 ? 14.258  7.057   25.497 1.00 32.27  ? 270 PRO A CB    1 
ATOM   1264 C CG    . PRO A 1 166 ? 13.129  8.029   25.369 1.00 36.39  ? 270 PRO A CG    1 
ATOM   1265 C CD    . PRO A 1 166 ? 11.940  7.211   24.923 1.00 30.71  ? 270 PRO A CD    1 
ATOM   1266 N N     . SER A 1 167 ? 15.136  3.791   24.909 1.00 29.14  ? 271 SER A N     1 
ATOM   1267 C CA    . SER A 1 167 ? 15.351  2.478   25.513 1.00 29.34  ? 271 SER A CA    1 
ATOM   1268 C C     . SER A 1 167 ? 15.235  2.588   27.029 1.00 33.85  ? 271 SER A C     1 
ATOM   1269 O O     . SER A 1 167 ? 15.822  3.493   27.628 1.00 28.94  ? 271 SER A O     1 
ATOM   1270 C CB    . SER A 1 167 ? 16.734  1.928   25.173 1.00 31.69  ? 271 SER A CB    1 
ATOM   1271 O OG    . SER A 1 167 ? 16.973  0.716   25.884 1.00 33.34  ? 271 SER A OG    1 
ATOM   1272 N N     . SER A 1 168 ? 14.539  1.605   27.650 1.00 32.75  ? 272 SER A N     1 
ATOM   1273 C CA    . SER A 1 168 ? 14.348  1.563   29.109 1.00 31.59  ? 272 SER A CA    1 
ATOM   1274 C C     . SER A 1 168 ? 15.704  1.263   29.764 1.00 33.34  ? 272 SER A C     1 
ATOM   1275 O O     . SER A 1 168 ? 15.874  1.462   30.968 1.00 32.68  ? 272 SER A O     1 
ATOM   1276 C CB    . SER A 1 168 ? 13.293  0.522   29.461 1.00 33.89  ? 272 SER A CB    1 
ATOM   1277 O OG    . SER A 1 168 ? 13.707  -0.772  29.059 1.00 32.91  ? 272 SER A OG    1 
ATOM   1278 N N     . SER A 1 169 ? 16.705  0.830   28.944 1.00 30.44  ? 273 SER A N     1 
ATOM   1279 C CA    . SER A 1 169 ? 18.061  0.593   29.448 1.00 30.73  ? 273 SER A CA    1 
ATOM   1280 C C     . SER A 1 169 ? 18.571  1.866   30.131 1.00 34.96  ? 273 SER A C     1 
ATOM   1281 O O     . SER A 1 169 ? 18.384  2.968   29.618 1.00 33.60  ? 273 SER A O     1 
ATOM   1282 C CB    . SER A 1 169 ? 19.020  0.230   28.330 1.00 31.09  ? 273 SER A CB    1 
ATOM   1283 O OG    . SER A 1 169 ? 20.321  0.157   28.890 1.00 38.08  ? 273 SER A OG    1 
ATOM   1284 N N     . ALA A 1 170 ? 19.242  1.724   31.277 1.00 33.10  ? 274 ALA A N     1 
ATOM   1285 C CA    . ALA A 1 170 ? 19.763  2.934   31.919 1.00 33.19  ? 274 ALA A CA    1 
ATOM   1286 C C     . ALA A 1 170 ? 21.089  3.382   31.258 1.00 36.03  ? 274 ALA A C     1 
ATOM   1287 O O     . ALA A 1 170 ? 21.729  4.318   31.748 1.00 37.08  ? 274 ALA A O     1 
ATOM   1288 C CB    . ALA A 1 170 ? 19.956  2.693   33.399 1.00 34.65  ? 274 ALA A CB    1 
ATOM   1289 N N     . ARG A 1 171 ? 21.475  2.747   30.140 1.00 32.44  ? 275 ARG A N     1 
ATOM   1290 C CA    A ARG A 1 171 ? 22.719  3.082   29.447 0.60 34.11  ? 275 ARG A CA    1 
ATOM   1291 C CA    B ARG A 1 171 ? 22.720  3.074   29.435 0.40 33.69  ? 275 ARG A CA    1 
ATOM   1292 C C     . ARG A 1 171 ? 22.742  4.526   28.872 1.00 38.89  ? 275 ARG A C     1 
ATOM   1293 O O     . ARG A 1 171 ? 23.743  5.227   29.059 1.00 40.03  ? 275 ARG A O     1 
ATOM   1294 C CB    A ARG A 1 171 ? 23.065  2.039   28.368 0.60 34.16  ? 275 ARG A CB    1 
ATOM   1295 C CB    B ARG A 1 171 ? 23.039  2.009   28.350 0.40 32.96  ? 275 ARG A CB    1 
ATOM   1296 C CG    A ARG A 1 171 ? 24.371  2.342   27.619 0.60 44.26  ? 275 ARG A CG    1 
ATOM   1297 C CG    B ARG A 1 171 ? 24.075  2.368   27.256 0.40 40.00  ? 275 ARG A CG    1 
ATOM   1298 C CD    A ARG A 1 171 ? 24.774  1.277   26.622 0.60 47.13  ? 275 ARG A CD    1 
ATOM   1299 C CD    B ARG A 1 171 ? 25.520  2.417   27.736 0.40 50.39  ? 275 ARG A CD    1 
ATOM   1300 N NE    A ARG A 1 171 ? 24.902  -0.054  27.219 0.60 48.42  ? 275 ARG A NE    1 
ATOM   1301 N NE    B ARG A 1 171 ? 25.860  3.762   28.200 0.40 52.87  ? 275 ARG A NE    1 
ATOM   1302 C CZ    A ARG A 1 171 ? 25.965  -0.484  27.888 0.60 57.93  ? 275 ARG A CZ    1 
ATOM   1303 C CZ    B ARG A 1 171 ? 27.061  4.318   28.121 0.40 58.96  ? 275 ARG A CZ    1 
ATOM   1304 N NH1   A ARG A 1 171 ? 27.009  0.315   28.081 0.60 42.52  ? 275 ARG A NH1   1 
ATOM   1305 N NH1   B ARG A 1 171 ? 27.251  5.556   28.552 0.40 48.26  ? 275 ARG A NH1   1 
ATOM   1306 N NH2   A ARG A 1 171 ? 25.989  -1.710  28.380 0.60 41.88  ? 275 ARG A NH2   1 
ATOM   1307 N NH2   B ARG A 1 171 ? 28.079  3.647   27.597 0.40 41.75  ? 275 ARG A NH2   1 
ATOM   1308 N N     . CYS A 1 172 ? 21.662  4.987   28.210 1.00 37.06  ? 276 CYS A N     1 
ATOM   1309 C CA    . CYS A 1 172 ? 21.706  6.355   27.625 1.00 37.28  ? 276 CYS A CA    1 
ATOM   1310 C C     . CYS A 1 172 ? 21.654  7.481   28.637 1.00 39.62  ? 276 CYS A C     1 
ATOM   1311 O O     . CYS A 1 172 ? 20.759  7.552   29.476 1.00 39.71  ? 276 CYS A O     1 
ATOM   1312 C CB    . CYS A 1 172 ? 20.676  6.571   26.520 1.00 37.59  ? 276 CYS A CB    1 
ATOM   1313 S SG    . CYS A 1 172 ? 18.959  6.559   27.087 1.00 41.20  ? 276 CYS A SG    1 
ATOM   1314 N N     . ALA A 1 173 ? 22.629  8.381   28.512 1.00 37.12  ? 277 ALA A N     1 
ATOM   1315 C CA    . ALA A 1 173 ? 22.789  9.551   29.375 1.00 37.84  ? 277 ALA A CA    1 
ATOM   1316 C C     . ALA A 1 173 ? 21.817  10.651  29.047 1.00 39.59  ? 277 ALA A C     1 
ATOM   1317 O O     . ALA A 1 173 ? 21.637  11.502  29.886 1.00 39.92  ? 277 ALA A O     1 
ATOM   1318 C CB    . ALA A 1 173 ? 24.222  10.080  29.305 1.00 39.81  ? 277 ALA A CB    1 
ATOM   1319 N N     . GLN A 1 174 ? 21.148  10.630  27.870 1.00 35.94  ? 278 GLN A N     1 
ATOM   1320 C CA    . GLN A 1 174 ? 20.236  11.726  27.485 1.00 35.76  ? 278 GLN A CA    1 
ATOM   1321 C C     . GLN A 1 174 ? 18.941  11.735  28.278 1.00 37.25  ? 278 GLN A C     1 
ATOM   1322 O O     . GLN A 1 174 ? 18.305  12.777  28.365 1.00 36.34  ? 278 GLN A O     1 
ATOM   1323 C CB    . GLN A 1 174 ? 19.960  11.736  25.965 1.00 37.50  ? 278 GLN A CB    1 
ATOM   1324 C CG    . GLN A 1 174 ? 21.190  12.150  25.129 1.00 41.14  ? 278 GLN A CG    1 
ATOM   1325 C CD    . GLN A 1 174 ? 22.057  10.975  24.717 1.00 52.21  ? 278 GLN A CD    1 
ATOM   1326 O OE1   . GLN A 1 174 ? 21.879  9.823   25.148 1.00 42.60  ? 278 GLN A OE1   1 
ATOM   1327 N NE2   . GLN A 1 174 ? 23.041  11.242  23.874 1.00 41.37  ? 278 GLN A NE2   1 
ATOM   1328 N N     . PHE A 1 175 ? 18.530  10.556  28.812 1.00 33.72  ? 279 PHE A N     1 
ATOM   1329 C CA    . PHE A 1 175 ? 17.337  10.367  29.646 1.00 33.67  ? 279 PHE A CA    1 
ATOM   1330 C C     . PHE A 1 175 ? 17.903  9.626   30.861 1.00 36.97  ? 279 PHE A C     1 
ATOM   1331 O O     . PHE A 1 175 ? 17.808  8.394   30.921 1.00 36.52  ? 279 PHE A O     1 
ATOM   1332 C CB    . PHE A 1 175 ? 16.300  9.526   28.881 1.00 33.90  ? 279 PHE A CB    1 
ATOM   1333 C CG    . PHE A 1 175 ? 15.913  10.113  27.539 1.00 35.30  ? 279 PHE A CG    1 
ATOM   1334 C CD1   . PHE A 1 175 ? 14.874  11.031  27.438 1.00 38.06  ? 279 PHE A CD1   1 
ATOM   1335 C CD2   . PHE A 1 175 ? 16.611  9.766   26.373 1.00 35.76  ? 279 PHE A CD2   1 
ATOM   1336 C CE1   . PHE A 1 175 ? 14.533  11.593  26.206 1.00 37.61  ? 279 PHE A CE1   1 
ATOM   1337 C CE2   . PHE A 1 175 ? 16.269  10.338  25.145 1.00 38.75  ? 279 PHE A CE2   1 
ATOM   1338 C CZ    . PHE A 1 175 ? 15.241  11.255  25.076 1.00 36.35  ? 279 PHE A CZ    1 
ATOM   1339 N N     . PRO A 1 176 ? 18.679  10.334  31.724 1.00 34.55  ? 280 PRO A N     1 
ATOM   1340 C CA    . PRO A 1 176 ? 19.428  9.631   32.781 1.00 35.37  ? 280 PRO A CA    1 
ATOM   1341 C C     . PRO A 1 176 ? 18.625  8.813   33.788 1.00 39.17  ? 280 PRO A C     1 
ATOM   1342 O O     . PRO A 1 176 ? 19.168  7.854   34.346 1.00 39.35  ? 280 PRO A O     1 
ATOM   1343 C CB    . PRO A 1 176 ? 20.216  10.750  33.466 1.00 39.12  ? 280 PRO A CB    1 
ATOM   1344 C CG    . PRO A 1 176 ? 19.547  12.027  33.087 1.00 43.26  ? 280 PRO A CG    1 
ATOM   1345 C CD    . PRO A 1 176 ? 18.970  11.793  31.740 1.00 36.96  ? 280 PRO A CD    1 
ATOM   1346 N N     . ARG A 1 177 ? 17.349  9.146   33.991 1.00 31.63  ? 281 ARG A N     1 
ATOM   1347 C CA    . ARG A 1 177 ? 16.500  8.512   35.009 1.00 33.15  ? 281 ARG A CA    1 
ATOM   1348 C C     . ARG A 1 177 ? 15.197  7.976   34.438 1.00 37.20  ? 281 ARG A C     1 
ATOM   1349 O O     . ARG A 1 177 ? 14.764  8.426   33.386 1.00 36.68  ? 281 ARG A O     1 
ATOM   1350 C CB    . ARG A 1 177 ? 16.121  9.567   36.084 1.00 33.54  ? 281 ARG A CB    1 
ATOM   1351 C CG    . ARG A 1 177 ? 17.281  10.273  36.807 1.00 41.94  ? 281 ARG A CG    1 
ATOM   1352 C CD    . ARG A 1 177 ? 16.817  11.533  37.545 1.00 50.20  ? 281 ARG A CD    1 
ATOM   1353 N NE    . ARG A 1 177 ? 16.173  12.476  36.626 1.00 54.96  ? 281 ARG A NE    1 
ATOM   1354 C CZ    . ARG A 1 177 ? 15.300  13.410  36.985 1.00 70.61  ? 281 ARG A CZ    1 
ATOM   1355 N NH1   . ARG A 1 177 ? 14.966  13.565  38.263 1.00 55.38  ? 281 ARG A NH1   1 
ATOM   1356 N NH2   . ARG A 1 177 ? 14.763  14.206  36.074 1.00 59.90  ? 281 ARG A NH2   1 
ATOM   1357 N N     . ALA A 1 178 ? 14.512  7.088   35.202 1.00 36.36  ? 282 ALA A N     1 
ATOM   1358 C CA    . ALA A 1 178 ? 13.185  6.566   34.844 1.00 35.96  ? 282 ALA A CA    1 
ATOM   1359 C C     . ALA A 1 178 ? 12.234  7.748   34.655 1.00 39.43  ? 282 ALA A C     1 
ATOM   1360 O O     . ALA A 1 178 ? 11.467  7.752   33.714 1.00 37.75  ? 282 ALA A O     1 
ATOM   1361 C CB    . ALA A 1 178 ? 12.653  5.635   35.946 1.00 37.46  ? 282 ALA A CB    1 
ATOM   1362 N N     . GLN A 1 179 ? 12.350  8.778   35.501 1.00 39.61  ? 283 GLN A N     1 
ATOM   1363 C CA    . GLN A 1 179 ? 11.543  10.004  35.429 1.00 39.84  ? 283 GLN A CA    1 
ATOM   1364 C C     . GLN A 1 179 ? 11.670  10.717  34.079 1.00 40.56  ? 283 GLN A C     1 
ATOM   1365 O O     . GLN A 1 179 ? 10.717  11.374  33.645 1.00 42.10  ? 283 GLN A O     1 
ATOM   1366 C CB    . GLN A 1 179 ? 11.947  10.968  36.577 1.00 42.54  ? 283 GLN A CB    1 
ATOM   1367 C CG    . GLN A 1 179 ? 11.196  12.293  36.646 1.00 58.11  ? 283 GLN A CG    1 
ATOM   1368 C CD    . GLN A 1 179 ? 9.692   12.148  36.745 1.00 81.32  ? 283 GLN A CD    1 
ATOM   1369 O OE1   . GLN A 1 179 ? 9.166   11.355  37.532 1.00 74.94  ? 283 GLN A OE1   1 
ATOM   1370 N NE2   . GLN A 1 179 ? 8.967   12.915  35.936 1.00 76.39  ? 283 GLN A NE2   1 
ATOM   1371 N N     . ASP A 1 180 ? 12.853  10.662  33.453 1.00 35.97  ? 284 ASP A N     1 
ATOM   1372 C CA    . ASP A 1 180 ? 13.074  11.341  32.168 1.00 36.52  ? 284 ASP A CA    1 
ATOM   1373 C C     . ASP A 1 180 ? 12.451  10.617  30.985 1.00 40.32  ? 284 ASP A C     1 
ATOM   1374 O O     . ASP A 1 180 ? 12.314  11.209  29.923 1.00 39.17  ? 284 ASP A O     1 
ATOM   1375 C CB    . ASP A 1 180 ? 14.567  11.623  31.919 1.00 37.46  ? 284 ASP A CB    1 
ATOM   1376 C CG    . ASP A 1 180 ? 15.173  12.443  33.051 1.00 41.70  ? 284 ASP A CG    1 
ATOM   1377 O OD1   . ASP A 1 180 ? 14.611  13.516  33.382 1.00 46.33  ? 284 ASP A OD1   1 
ATOM   1378 O OD2   . ASP A 1 180 ? 16.191  12.013  33.607 1.00 44.72  ? 284 ASP A OD2   1 
ATOM   1379 N N     . LYS A 1 181 ? 12.015  9.361   31.192 1.00 36.88  ? 285 LYS A N     1 
ATOM   1380 C CA    . LYS A 1 181 ? 11.401  8.579   30.131 1.00 35.62  ? 285 LYS A CA    1 
ATOM   1381 C C     . LYS A 1 181 ? 9.907   8.454   30.350 1.00 39.29  ? 285 LYS A C     1 
ATOM   1382 O O     . LYS A 1 181 ? 9.192   8.119   29.408 1.00 38.64  ? 285 LYS A O     1 
ATOM   1383 C CB    . LYS A 1 181 ? 12.053  7.170   30.076 1.00 35.07  ? 285 LYS A CB    1 
ATOM   1384 C CG    . LYS A 1 181 ? 13.537  7.241   29.749 1.00 34.68  ? 285 LYS A CG    1 
ATOM   1385 C CD    . LYS A 1 181 ? 14.228  5.923   29.861 1.00 32.87  ? 285 LYS A CD    1 
ATOM   1386 C CE    . LYS A 1 181 ? 15.713  6.109   29.703 1.00 35.90  ? 285 LYS A CE    1 
ATOM   1387 N NZ    . LYS A 1 181 ? 16.472  4.894   30.115 1.00 33.82  ? 285 LYS A NZ    1 
ATOM   1388 N N     . VAL A 1 182 ? 9.439   8.677   31.596 1.00 35.18  ? 286 VAL A N     1 
ATOM   1389 C CA    . VAL A 1 182 ? 8.037   8.489   31.951 1.00 36.53  ? 286 VAL A CA    1 
ATOM   1390 C C     . VAL A 1 182 ? 7.053   9.224   30.995 1.00 36.42  ? 286 VAL A C     1 
ATOM   1391 O O     . VAL A 1 182 ? 5.988   8.686   30.703 1.00 33.63  ? 286 VAL A O     1 
ATOM   1392 C CB    . VAL A 1 182 ? 7.774   8.813   33.450 1.00 44.74  ? 286 VAL A CB    1 
ATOM   1393 C CG1   . VAL A 1 182 ? 7.493   10.285  33.695 1.00 47.59  ? 286 VAL A CG1   1 
ATOM   1394 C CG2   . VAL A 1 182 ? 6.642   7.962   33.987 1.00 46.31  ? 286 VAL A CG2   1 
ATOM   1395 N N     . HIS A 1 183 ? 7.408   10.427  30.505 1.00 35.30  ? 287 HIS A N     1 
ATOM   1396 C CA    . HIS A 1 183 ? 6.554   11.204  29.604 1.00 36.55  ? 287 HIS A CA    1 
ATOM   1397 C C     . HIS A 1 183 ? 6.084   10.318  28.412 1.00 36.96  ? 287 HIS A C     1 
ATOM   1398 O O     . HIS A 1 183 ? 4.895   10.305  28.097 1.00 36.87  ? 287 HIS A O     1 
ATOM   1399 C CB    . HIS A 1 183 ? 7.315   12.466  29.122 1.00 38.50  ? 287 HIS A CB    1 
ATOM   1400 C CG    . HIS A 1 183 ? 6.826   13.008  27.830 1.00 43.98  ? 287 HIS A CG    1 
ATOM   1401 N ND1   . HIS A 1 183 ? 5.678   13.788  27.763 1.00 49.05  ? 287 HIS A ND1   1 
ATOM   1402 C CD2   . HIS A 1 183 ? 7.326   12.851  26.580 1.00 44.53  ? 287 HIS A CD2   1 
ATOM   1403 C CE1   . HIS A 1 183 ? 5.505   14.057  26.474 1.00 48.15  ? 287 HIS A CE1   1 
ATOM   1404 N NE2   . HIS A 1 183 ? 6.462   13.500  25.726 1.00 46.11  ? 287 HIS A NE2   1 
ATOM   1405 N N     . TYR A 1 184 ? 6.999   9.524   27.812 1.00 32.18  ? 288 TYR A N     1 
ATOM   1406 C CA    . TYR A 1 184 ? 6.651   8.665   26.668 1.00 31.62  ? 288 TYR A CA    1 
ATOM   1407 C C     . TYR A 1 184 ? 5.672   7.530   27.004 1.00 37.79  ? 288 TYR A C     1 
ATOM   1408 O O     . TYR A 1 184 ? 4.869   7.138   26.162 1.00 38.43  ? 288 TYR A O     1 
ATOM   1409 C CB    . TYR A 1 184 ? 7.930   8.126   26.009 1.00 30.11  ? 288 TYR A CB    1 
ATOM   1410 C CG    . TYR A 1 184 ? 8.683   9.270   25.369 1.00 32.38  ? 288 TYR A CG    1 
ATOM   1411 C CD1   . TYR A 1 184 ? 8.213   9.875   24.209 1.00 33.66  ? 288 TYR A CD1   1 
ATOM   1412 C CD2   . TYR A 1 184 ? 9.841   9.782   25.945 1.00 34.85  ? 288 TYR A CD2   1 
ATOM   1413 C CE1   . TYR A 1 184 ? 8.855   10.980  23.661 1.00 33.41  ? 288 TYR A CE1   1 
ATOM   1414 C CE2   . TYR A 1 184 ? 10.536  10.849  25.358 1.00 35.42  ? 288 TYR A CE2   1 
ATOM   1415 C CZ    . TYR A 1 184 ? 10.041  11.437  24.211 1.00 40.38  ? 288 TYR A CZ    1 
ATOM   1416 O OH    . TYR A 1 184 ? 10.689  12.512  23.630 1.00 42.38  ? 288 TYR A OH    1 
ATOM   1417 N N     . TYR A 1 185 ? 5.748   7.013   28.218 1.00 33.83  ? 289 TYR A N     1 
ATOM   1418 C CA    . TYR A 1 185 ? 4.880   5.938   28.718 1.00 33.63  ? 289 TYR A CA    1 
ATOM   1419 C C     . TYR A 1 185 ? 3.493   6.524   28.972 1.00 37.88  ? 289 TYR A C     1 
ATOM   1420 O O     . TYR A 1 185 ? 2.505   5.848   28.722 1.00 37.10  ? 289 TYR A O     1 
ATOM   1421 C CB    . TYR A 1 185 ? 5.454   5.351   30.015 1.00 33.73  ? 289 TYR A CB    1 
ATOM   1422 C CG    . TYR A 1 185 ? 6.617   4.402   29.825 1.00 33.51  ? 289 TYR A CG    1 
ATOM   1423 C CD1   . TYR A 1 185 ? 7.887   4.877   29.489 1.00 34.44  ? 289 TYR A CD1   1 
ATOM   1424 C CD2   . TYR A 1 185 ? 6.465   3.034   30.023 1.00 33.09  ? 289 TYR A CD2   1 
ATOM   1425 C CE1   . TYR A 1 185 ? 8.981   4.009   29.387 1.00 32.24  ? 289 TYR A CE1   1 
ATOM   1426 C CE2   . TYR A 1 185 ? 7.541   2.154   29.894 1.00 32.68  ? 289 TYR A CE2   1 
ATOM   1427 C CZ    . TYR A 1 185 ? 8.794   2.644   29.561 1.00 36.44  ? 289 TYR A CZ    1 
ATOM   1428 O OH    . TYR A 1 185 ? 9.844   1.762   29.410 1.00 34.63  ? 289 TYR A OH    1 
ATOM   1429 N N     . ILE A 1 186 ? 3.422   7.784   29.446 1.00 36.72  ? 290 ILE A N     1 
ATOM   1430 C CA    . ILE A 1 186 ? 2.149   8.477   29.671 1.00 38.82  ? 290 ILE A CA    1 
ATOM   1431 C C     . ILE A 1 186 ? 1.469   8.734   28.319 1.00 41.98  ? 290 ILE A C     1 
ATOM   1432 O O     . ILE A 1 186 ? 0.265   8.498   28.179 1.00 42.05  ? 290 ILE A O     1 
ATOM   1433 C CB    . ILE A 1 186 ? 2.288   9.770   30.518 1.00 44.50  ? 290 ILE A CB    1 
ATOM   1434 C CG1   . ILE A 1 186 ? 2.695   9.441   31.967 1.00 45.62  ? 290 ILE A CG1   1 
ATOM   1435 C CG2   . ILE A 1 186 ? 0.979   10.569  30.498 1.00 48.05  ? 290 ILE A CG2   1 
ATOM   1436 C CD1   . ILE A 1 186 ? 3.205   10.668  32.822 1.00 56.54  ? 290 ILE A CD1   1 
ATOM   1437 N N     . LYS A 1 187 ? 2.241   9.191   27.322 1.00 37.01  ? 291 LYS A N     1 
ATOM   1438 C CA    . LYS A 1 187 ? 1.705   9.421   25.977 1.00 36.82  ? 291 LYS A CA    1 
ATOM   1439 C C     . LYS A 1 187 ? 1.253   8.096   25.315 1.00 39.73  ? 291 LYS A C     1 
ATOM   1440 O O     . LYS A 1 187 ? 0.239   8.074   24.597 1.00 41.59  ? 291 LYS A O     1 
ATOM   1441 C CB    . LYS A 1 187 ? 2.676   10.241  25.106 1.00 36.63  ? 291 LYS A CB    1 
ATOM   1442 C CG    . LYS A 1 187 ? 2.524   11.754  25.344 1.00 56.30  ? 291 LYS A CG    1 
ATOM   1443 C CD    . LYS A 1 187 ? 1.306   12.331  24.632 1.00 71.04  ? 291 LYS A CD    1 
ATOM   1444 C CE    . LYS A 1 187 ? 1.242   13.831  24.717 1.00 90.04  ? 291 LYS A CE    1 
ATOM   1445 N NZ    . LYS A 1 187 ? 0.088   14.362  23.948 1.00 103.74 ? 291 LYS A NZ    1 
ATOM   1446 N N     . LEU A 1 188 ? 1.949   6.988   25.640 1.00 34.32  ? 292 LEU A N     1 
ATOM   1447 C CA    . LEU A 1 188 ? 1.586   5.651   25.156 1.00 33.35  ? 292 LEU A CA    1 
ATOM   1448 C C     . LEU A 1 188 ? 0.216   5.258   25.732 1.00 39.45  ? 292 LEU A C     1 
ATOM   1449 O O     . LEU A 1 188 ? -0.660  4.804   24.994 1.00 41.37  ? 292 LEU A O     1 
ATOM   1450 C CB    . LEU A 1 188 ? 2.659   4.610   25.533 1.00 31.59  ? 292 LEU A CB    1 
ATOM   1451 C CG    . LEU A 1 188 ? 2.352   3.153   25.185 1.00 34.32  ? 292 LEU A CG    1 
ATOM   1452 C CD1   . LEU A 1 188 ? 1.972   2.972   23.700 1.00 34.82  ? 292 LEU A CD1   1 
ATOM   1453 C CD2   . LEU A 1 188 ? 3.487   2.232   25.612 1.00 31.96  ? 292 LEU A CD2   1 
ATOM   1454 N N     . LYS A 1 189 ? 0.032   5.481   27.026 1.00 37.95  ? 293 LYS A N     1 
ATOM   1455 C CA    . LYS A 1 189 ? -1.209  5.196   27.749 1.00 40.40  ? 293 LYS A CA    1 
ATOM   1456 C C     . LYS A 1 189 ? -2.361  5.994   27.127 1.00 47.86  ? 293 LYS A C     1 
ATOM   1457 O O     . LYS A 1 189 ? -3.421  5.426   26.861 1.00 50.80  ? 293 LYS A O     1 
ATOM   1458 C CB    . LYS A 1 189 ? -1.049  5.545   29.235 1.00 40.93  ? 293 LYS A CB    1 
ATOM   1459 C CG    . LYS A 1 189 ? -2.234  5.121   30.111 1.00 42.14  ? 293 LYS A CG    1 
ATOM   1460 C CD    . LYS A 1 189 ? -2.014  5.536   31.551 1.00 42.95  ? 293 LYS A CD    1 
ATOM   1461 C CE    . LYS A 1 189 ? -2.481  6.966   31.776 1.00 59.05  ? 293 LYS A CE    1 
ATOM   1462 N NZ    . LYS A 1 189 ? -1.837  7.628   32.949 1.00 62.85  ? 293 LYS A NZ    1 
ATOM   1463 N N     . ASP A 1 190 ? -2.133  7.288   26.870 1.00 44.64  ? 294 ASP A N     1 
ATOM   1464 C CA    . ASP A 1 190 ? -3.119  8.196   26.289 1.00 45.99  ? 294 ASP A CA    1 
ATOM   1465 C C     . ASP A 1 190 ? -3.529  7.749   24.891 1.00 49.13  ? 294 ASP A C     1 
ATOM   1466 O O     . ASP A 1 190 ? -4.718  7.696   24.608 1.00 50.68  ? 294 ASP A O     1 
ATOM   1467 C CB    . ASP A 1 190 ? -2.604  9.651   26.315 1.00 48.57  ? 294 ASP A CB    1 
ATOM   1468 C CG    . ASP A 1 190 ? -2.413  10.261  27.706 1.00 58.28  ? 294 ASP A CG    1 
ATOM   1469 O OD1   . ASP A 1 190 ? -3.033  9.749   28.685 1.00 60.42  ? 294 ASP A OD1   1 
ATOM   1470 O OD2   . ASP A 1 190 ? -1.655  11.258  27.819 1.00 57.18  ? 294 ASP A OD2   1 
ATOM   1471 N N     . LEU A 1 191 ? -2.553  7.366   24.041 1.00 44.48  ? 295 LEU A N     1 
ATOM   1472 C CA    . LEU A 1 191 ? -2.799  6.853   22.693 1.00 43.59  ? 295 LEU A CA    1 
ATOM   1473 C C     . LEU A 1 191 ? -3.660  5.570   22.759 1.00 49.41  ? 295 LEU A C     1 
ATOM   1474 O O     . LEU A 1 191 ? -4.582  5.417   21.963 1.00 51.43  ? 295 LEU A O     1 
ATOM   1475 C CB    . LEU A 1 191 ? -1.452  6.566   22.000 1.00 41.76  ? 295 LEU A CB    1 
ATOM   1476 C CG    . LEU A 1 191 ? -1.506  5.947   20.608 1.00 45.73  ? 295 LEU A CG    1 
ATOM   1477 C CD1   . LEU A 1 191 ? -2.208  6.907   19.593 1.00 47.30  ? 295 LEU A CD1   1 
ATOM   1478 C CD2   . LEU A 1 191 ? -0.132  5.590   20.144 1.00 42.14  ? 295 LEU A CD2   1 
ATOM   1479 N N     . ARG A 1 192 ? -3.380  4.667   23.723 1.00 46.45  ? 296 ARG A N     1 
ATOM   1480 C CA    . ARG A 1 192 ? -4.154  3.428   23.903 1.00 46.93  ? 296 ARG A CA    1 
ATOM   1481 C C     . ARG A 1 192 ? -5.595  3.773   24.265 1.00 53.80  ? 296 ARG A C     1 
ATOM   1482 O O     . ARG A 1 192 ? -6.526  3.194   23.695 1.00 54.55  ? 296 ARG A O     1 
ATOM   1483 C CB    . ARG A 1 192 ? -3.534  2.551   24.998 1.00 46.45  ? 296 ARG A CB    1 
ATOM   1484 C CG    . ARG A 1 192 ? -4.326  1.274   25.235 1.00 52.32  ? 296 ARG A CG    1 
ATOM   1485 C CD    . ARG A 1 192 ? -4.188  0.764   26.640 1.00 46.90  ? 296 ARG A CD    1 
ATOM   1486 N NE    . ARG A 1 192 ? -4.697  1.685   27.657 1.00 51.27  ? 296 ARG A NE    1 
ATOM   1487 C CZ    . ARG A 1 192 ? -4.352  1.630   28.939 1.00 66.46  ? 296 ARG A CZ    1 
ATOM   1488 N NH1   . ARG A 1 192 ? -3.510  0.696   29.367 1.00 54.53  ? 296 ARG A NH1   1 
ATOM   1489 N NH2   . ARG A 1 192 ? -4.856  2.497   29.806 1.00 54.56  ? 296 ARG A NH2   1 
ATOM   1490 N N     . ASP A 1 193 ? -5.768  4.740   25.199 1.00 49.95  ? 297 ASP A N     1 
ATOM   1491 C CA    . ASP A 1 193 ? -7.068  5.215   25.634 1.00 52.29  ? 297 ASP A CA    1 
ATOM   1492 C C     . ASP A 1 193 ? -7.829  5.870   24.477 1.00 58.33  ? 297 ASP A C     1 
ATOM   1493 O O     . ASP A 1 193 ? -9.033  5.647   24.346 1.00 61.00  ? 297 ASP A O     1 
ATOM   1494 C CB    . ASP A 1 193 ? -6.927  6.160   26.846 1.00 54.83  ? 297 ASP A CB    1 
ATOM   1495 C CG    . ASP A 1 193 ? -6.358  5.517   28.110 1.00 58.97  ? 297 ASP A CG    1 
ATOM   1496 O OD1   . ASP A 1 193 ? -6.105  4.285   28.094 1.00 57.08  ? 297 ASP A OD1   1 
ATOM   1497 O OD2   . ASP A 1 193 ? -6.130  6.254   29.103 1.00 60.74  ? 297 ASP A OD2   1 
ATOM   1498 N N     . GLN A 1 194 ? -7.134  6.635   23.619 1.00 53.25  ? 298 GLN A N     1 
ATOM   1499 C CA    . GLN A 1 194 ? -7.782  7.273   22.464 1.00 54.46  ? 298 GLN A CA    1 
ATOM   1500 C C     . GLN A 1 194 ? -8.294  6.201   21.481 1.00 57.39  ? 298 GLN A C     1 
ATOM   1501 O O     . GLN A 1 194 ? -9.445  6.270   21.051 1.00 58.66  ? 298 GLN A O     1 
ATOM   1502 C CB    . GLN A 1 194 ? -6.825  8.252   21.763 1.00 54.76  ? 298 GLN A CB    1 
ATOM   1503 C CG    . GLN A 1 194 ? -7.520  9.259   20.835 1.00 70.76  ? 298 GLN A CG    1 
ATOM   1504 C CD    . GLN A 1 194 ? -6.651  9.751   19.688 1.00 87.36  ? 298 GLN A CD    1 
ATOM   1505 O OE1   . GLN A 1 194 ? -5.413  9.629   19.680 1.00 70.12  ? 298 GLN A OE1   1 
ATOM   1506 N NE2   . GLN A 1 194 ? -7.294  10.331  18.682 1.00 89.47  ? 298 GLN A NE2   1 
ATOM   1507 N N     . LEU A 1 195 ? -7.458  5.189   21.183 1.00 52.05  ? 299 LEU A N     1 
ATOM   1508 C CA    . LEU A 1 195 ? -7.799  4.090   20.268 1.00 52.85  ? 299 LEU A CA    1 
ATOM   1509 C C     . LEU A 1 195 ? -8.988  3.243   20.750 1.00 62.26  ? 299 LEU A C     1 
ATOM   1510 O O     . LEU A 1 195 ? -9.816  2.822   19.929 1.00 63.97  ? 299 LEU A O     1 
ATOM   1511 C CB    . LEU A 1 195 ? -6.579  3.187   19.995 1.00 49.64  ? 299 LEU A CB    1 
ATOM   1512 C CG    . LEU A 1 195 ? -5.417  3.807   19.235 1.00 52.17  ? 299 LEU A CG    1 
ATOM   1513 C CD1   . LEU A 1 195 ? -4.234  2.893   19.263 1.00 50.16  ? 299 LEU A CD1   1 
ATOM   1514 C CD2   . LEU A 1 195 ? -5.789  4.135   17.780 1.00 56.73  ? 299 LEU A CD2   1 
ATOM   1515 N N     . LYS A 1 196 ? -9.060  2.984   22.068 1.00 60.33  ? 300 LYS A N     1 
ATOM   1516 C CA    . LYS A 1 196 ? -10.160 2.222   22.672 1.00 64.28  ? 300 LYS A CA    1 
ATOM   1517 C C     . LYS A 1 196 ? -11.461 3.057   22.649 1.00 75.86  ? 300 LYS A C     1 
ATOM   1518 O O     . LYS A 1 196 ? -12.543 2.498   22.459 1.00 78.88  ? 300 LYS A O     1 
ATOM   1519 C CB    . LYS A 1 196 ? -9.809  1.777   24.101 1.00 65.95  ? 300 LYS A CB    1 
ATOM   1520 C CG    . LYS A 1 196 ? -8.855  0.592   24.158 1.00 69.48  ? 300 LYS A CG    1 
ATOM   1521 C CD    . LYS A 1 196 ? -8.178  0.485   25.523 1.00 75.44  ? 300 LYS A CD    1 
ATOM   1522 C CE    . LYS A 1 196 ? -8.780  -0.572  26.422 1.00 86.33  ? 300 LYS A CE    1 
ATOM   1523 N NZ    . LYS A 1 196 ? -8.312  -1.939  26.070 1.00 93.05  ? 300 LYS A NZ    1 
ATOM   1524 N N     . GLY A 1 197 ? -11.324 4.378   22.812 1.00 74.66  ? 301 GLY A N     1 
ATOM   1525 C CA    . GLY A 1 197 ? -12.418 5.343   22.763 1.00 78.66  ? 301 GLY A CA    1 
ATOM   1526 C C     . GLY A 1 197 ? -12.989 5.478   21.364 1.00 87.20  ? 301 GLY A C     1 
ATOM   1527 O O     . GLY A 1 197 ? -14.203 5.652   21.206 1.00 89.07  ? 301 GLY A O     1 
ATOM   1528 N N     . ILE A 1 198 ? -12.103 5.376   20.334 1.00 84.84  ? 302 ILE A N     1 
ATOM   1529 C CA    . ILE A 1 198 ? -12.457 5.420   18.909 1.00 86.98  ? 302 ILE A CA    1 
ATOM   1530 C C     . ILE A 1 198 ? -13.303 4.195   18.555 1.00 96.45  ? 302 ILE A C     1 
ATOM   1531 O O     . ILE A 1 198 ? -14.325 4.332   17.877 1.00 98.62  ? 302 ILE A O     1 
ATOM   1532 C CB    . ILE A 1 198 ? -11.201 5.524   18.019 1.00 87.38  ? 302 ILE A CB    1 
ATOM   1533 N N     . GLU A 1 199 ? -12.895 3.008   19.064 1.00 94.96  ? 303 GLU A N     1 
ATOM   1534 C CA    . GLU A 1 199 ? -13.586 1.726   18.902 1.00 98.06  ? 303 GLU A CA    1 
ATOM   1535 C C     . GLU A 1 199 ? -14.995 1.777   19.515 1.00 110.03 ? 303 GLU A C     1 
ATOM   1536 O O     . GLU A 1 199 ? -15.950 1.320   18.882 1.00 112.07 ? 303 GLU A O     1 
ATOM   1537 C CB    . GLU A 1 199 ? -12.776 0.601   19.567 1.00 97.80  ? 303 GLU A CB    1 
ATOM   1538 C CG    . GLU A 1 199 ? -11.917 -0.202  18.608 1.00 104.93 ? 303 GLU A CG    1 
ATOM   1539 C CD    . GLU A 1 199 ? -12.242 -1.683  18.567 1.00 123.40 ? 303 GLU A CD    1 
ATOM   1540 O OE1   . GLU A 1 199 ? -12.188 -2.342  19.631 1.00 107.21 ? 303 GLU A OE1   1 
ATOM   1541 O OE2   . GLU A 1 199 ? -12.549 -2.186  17.462 1.00 122.50 ? 303 GLU A OE2   1 
ATOM   1542 N N     . ARG A 1 200 ? -15.110 2.351   20.740 1.00 69.59  ? 304 ARG A N     1 
ATOM   1543 C CA    . ARG A 1 200 ? -16.349 2.502   21.519 1.00 71.37  ? 304 ARG A CA    1 
ATOM   1544 C C     . ARG A 1 200 ? -17.411 3.338   20.760 1.00 77.75  ? 304 ARG A C     1 
ATOM   1545 O O     . ARG A 1 200 ? -18.530 2.857   20.557 1.00 77.68  ? 304 ARG A O     1 
ATOM   1546 C CB    . ARG A 1 200 ? -16.031 3.109   22.912 1.00 72.54  ? 304 ARG A CB    1 
ATOM   1547 C CG    . ARG A 1 200 ? -16.939 2.653   24.063 1.00 81.80  ? 304 ARG A CG    1 
ATOM   1548 C CD    . ARG A 1 200 ? -16.751 1.193   24.487 1.00 92.85  ? 304 ARG A CD    1 
ATOM   1549 N NE    . ARG A 1 200 ? -15.373 0.865   24.868 1.00 100.04 ? 304 ARG A NE    1 
ATOM   1550 C CZ    . ARG A 1 200 ? -14.898 0.914   26.109 1.00 113.42 ? 304 ARG A CZ    1 
ATOM   1551 N NH1   . ARG A 1 200 ? -13.634 0.597   26.355 1.00 98.35  ? 304 ARG A NH1   1 
ATOM   1552 N NH2   . ARG A 1 200 ? -15.683 1.284   27.115 1.00 101.42 ? 304 ARG A NH2   1 
ATOM   1553 N N     . ASN A 1 201 ? -17.033 4.562   20.312 1.00 75.12  ? 305 ASN A N     1 
ATOM   1554 C CA    . ASN A 1 201 ? -17.871 5.501   19.558 1.00 107.40 ? 305 ASN A CA    1 
ATOM   1555 C C     . ASN A 1 201 ? -17.746 5.264   18.052 1.00 121.79 ? 305 ASN A C     1 
ATOM   1556 O O     . ASN A 1 201 ? -18.137 4.210   17.554 1.00 80.36  ? 305 ASN A O     1 
ATOM   1557 C CB    . ASN A 1 201 ? -17.484 6.943   19.893 1.00 109.09 ? 305 ASN A CB    1 
ATOM   1558 C CG    . ASN A 1 201 ? -17.825 7.344   21.305 1.00 135.68 ? 305 ASN A CG    1 
ATOM   1559 O OD1   . ASN A 1 201 ? -18.936 7.804   21.591 1.00 133.25 ? 305 ASN A OD1   1 
ATOM   1560 N ND2   . ASN A 1 201 ? -16.883 7.169   22.222 1.00 125.82 ? 305 ASN A ND2   1 
ATOM   1561 O "O5'" . DC  B 2 1   ? 31.525  23.456  -1.295 1.00 69.14  ? 1   DC  C "O5'" 1 
ATOM   1562 C "C5'" . DC  B 2 1   ? 31.096  24.606  -2.042 1.00 71.59  ? 1   DC  C "C5'" 1 
ATOM   1563 C "C4'" . DC  B 2 1   ? 29.643  24.462  -2.510 1.00 72.70  ? 1   DC  C "C4'" 1 
ATOM   1564 O "O4'" . DC  B 2 1   ? 29.539  23.452  -3.556 1.00 70.58  ? 1   DC  C "O4'" 1 
ATOM   1565 C "C3'" . DC  B 2 1   ? 28.625  24.071  -1.434 1.00 73.27  ? 1   DC  C "C3'" 1 
ATOM   1566 O "O3'" . DC  B 2 1   ? 27.378  24.751  -1.670 1.00 77.69  ? 1   DC  C "O3'" 1 
ATOM   1567 C "C2'" . DC  B 2 1   ? 28.485  22.562  -1.617 1.00 70.54  ? 1   DC  C "C2'" 1 
ATOM   1568 C "C1'" . DC  B 2 1   ? 28.703  22.384  -3.124 1.00 70.67  ? 1   DC  C "C1'" 1 
ATOM   1569 N N1    . DC  B 2 1   ? 29.364  21.085  -3.500 1.00 69.57  ? 1   DC  C N1    1 
ATOM   1570 C C2    . DC  B 2 1   ? 28.644  20.109  -4.229 1.00 70.30  ? 1   DC  C C2    1 
ATOM   1571 O O2    . DC  B 2 1   ? 27.452  20.297  -4.485 1.00 71.87  ? 1   DC  C O2    1 
ATOM   1572 N N3    . DC  B 2 1   ? 29.291  18.972  -4.632 1.00 69.54  ? 1   DC  C N3    1 
ATOM   1573 C C4    . DC  B 2 1   ? 30.594  18.808  -4.358 1.00 68.73  ? 1   DC  C C4    1 
ATOM   1574 N N4    . DC  B 2 1   ? 31.176  17.667  -4.741 1.00 67.91  ? 1   DC  C N4    1 
ATOM   1575 C C5    . DC  B 2 1   ? 31.332  19.769  -3.580 1.00 68.53  ? 1   DC  C C5    1 
ATOM   1576 C C6    . DC  B 2 1   ? 30.689  20.880  -3.185 1.00 69.02  ? 1   DC  C C6    1 
ATOM   1577 P P     . DA  B 2 2   ? 26.303  24.984  -0.490 1.00 82.04  ? 2   DA  C P     1 
ATOM   1578 O OP1   . DA  B 2 2   ? 25.477  26.162  -0.864 1.00 85.10  ? 2   DA  C OP1   1 
ATOM   1579 O OP2   . DA  B 2 2   ? 27.009  24.958  0.818  1.00 82.37  ? 2   DA  C OP2   1 
ATOM   1580 O "O5'" . DA  B 2 2   ? 25.395  23.672  -0.556 1.00 80.89  ? 2   DA  C "O5'" 1 
ATOM   1581 C "C5'" . DA  B 2 2   ? 24.717  23.318  -1.759 1.00 81.46  ? 2   DA  C "C5'" 1 
ATOM   1582 C "C4'" . DA  B 2 2   ? 24.074  21.948  -1.624 1.00 81.34  ? 2   DA  C "C4'" 1 
ATOM   1583 O "O4'" . DA  B 2 2   ? 25.053  20.910  -1.895 1.00 78.12  ? 2   DA  C "O4'" 1 
ATOM   1584 C "C3'" . DA  B 2 2   ? 23.483  21.628  -0.250 1.00 82.85  ? 2   DA  C "C3'" 1 
ATOM   1585 O "O3'" . DA  B 2 2   ? 22.185  21.074  -0.423 1.00 86.40  ? 2   DA  C "O3'" 1 
ATOM   1586 C "C2'" . DA  B 2 2   ? 24.474  20.608  0.343  1.00 79.34  ? 2   DA  C "C2'" 1 
ATOM   1587 C "C1'" . DA  B 2 2   ? 24.969  19.906  -0.910 1.00 76.40  ? 2   DA  C "C1'" 1 
ATOM   1588 N N9    . DA  B 2 2   ? 26.290  19.281  -0.796 1.00 72.08  ? 2   DA  C N9    1 
ATOM   1589 C C8    . DA  B 2 2   ? 27.392  19.766  -0.136 1.00 70.41  ? 2   DA  C C8    1 
ATOM   1590 N N7    . DA  B 2 2   ? 28.488  19.070  -0.338 1.00 67.91  ? 2   DA  C N7    1 
ATOM   1591 C C5    . DA  B 2 2   ? 28.081  18.046  -1.180 1.00 67.05  ? 2   DA  C C5    1 
ATOM   1592 C C6    . DA  B 2 2   ? 28.762  16.931  -1.742 1.00 64.53  ? 2   DA  C C6    1 
ATOM   1593 N N6    . DA  B 2 2   ? 30.066  16.685  -1.560 1.00 61.83  ? 2   DA  C N6    1 
ATOM   1594 N N1    . DA  B 2 2   ? 28.051  16.106  -2.548 1.00 65.67  ? 2   DA  C N1    1 
ATOM   1595 C C2    . DA  B 2 2   ? 26.742  16.348  -2.742 1.00 68.11  ? 2   DA  C C2    1 
ATOM   1596 N N3    . DA  B 2 2   ? 25.999  17.362  -2.289 1.00 69.62  ? 2   DA  C N3    1 
ATOM   1597 C C4    . DA  B 2 2   ? 26.730  18.176  -1.491 1.00 69.46  ? 2   DA  C C4    1 
ATOM   1598 P P     . DG  B 2 3   ? 21.069  21.176  0.727  1.00 90.08  ? 3   DG  C P     1 
ATOM   1599 O OP1   . DG  B 2 3   ? 20.225  22.361  0.444  1.00 92.81  ? 3   DG  C OP1   1 
ATOM   1600 O OP2   . DG  B 2 3   ? 21.731  21.042  2.052  1.00 88.99  ? 3   DG  C OP2   1 
ATOM   1601 O "O5'" . DG  B 2 3   ? 20.220  19.852  0.448  1.00 91.75  ? 3   DG  C "O5'" 1 
ATOM   1602 C "C5'" . DG  B 2 3   ? 20.088  18.898  1.449  1.00 93.19  ? 3   DG  C "C5'" 1 
ATOM   1603 C "C4'" . DG  B 2 3   ? 20.623  17.547  1.022  1.00 92.30  ? 3   DG  C "C4'" 1 
ATOM   1604 O "O4'" . DG  B 2 3   ? 22.050  17.621  0.734  1.00 88.74  ? 3   DG  C "O4'" 1 
ATOM   1605 C "C3'" . DG  B 2 3   ? 20.477  16.499  2.118  1.00 93.89  ? 3   DG  C "C3'" 1 
ATOM   1606 O "O3'" . DG  B 2 3   ? 19.554  15.494  1.745  1.00 97.73  ? 3   DG  C "O3'" 1 
ATOM   1607 C "C2'" . DG  B 2 3   ? 21.882  15.947  2.346  1.00 90.10  ? 3   DG  C "C2'" 1 
ATOM   1608 C "C1'" . DG  B 2 3   ? 22.630  16.384  1.108  1.00 87.06  ? 3   DG  C "C1'" 1 
ATOM   1609 N N9    . DG  B 2 3   ? 24.088  16.529  1.324  1.00 82.27  ? 3   DG  C N9    1 
ATOM   1610 C C8    . DG  B 2 3   ? 24.737  17.499  2.061  1.00 80.86  ? 3   DG  C C8    1 
ATOM   1611 N N7    . DG  B 2 3   ? 26.039  17.355  2.090  1.00 77.65  ? 3   DG  C N7    1 
ATOM   1612 C C5    . DG  B 2 3   ? 26.269  16.180  1.382  1.00 75.51  ? 3   DG  C C5    1 
ATOM   1613 C C6    . DG  B 2 3   ? 27.492  15.505  1.088  1.00 72.28  ? 3   DG  C C6    1 
ATOM   1614 O O6    . DG  B 2 3   ? 28.648  15.840  1.390  1.00 70.34  ? 3   DG  C O6    1 
ATOM   1615 N N1    . DG  B 2 3   ? 27.279  14.338  0.345  1.00 72.30  ? 3   DG  C N1    1 
ATOM   1616 C C2    . DG  B 2 3   ? 26.043  13.880  -0.065 1.00 75.02  ? 3   DG  C C2    1 
ATOM   1617 N N2    . DG  B 2 3   ? 26.029  12.721  -0.734 1.00 75.59  ? 3   DG  C N2    1 
ATOM   1618 N N3    . DG  B 2 3   ? 24.892  14.497  0.205  1.00 77.78  ? 3   DG  C N3    1 
ATOM   1619 C C4    . DG  B 2 3   ? 25.078  15.641  0.927  1.00 78.27  ? 3   DG  C C4    1 
ATOM   1620 P P     . DC  B 2 4   ? 18.580  14.863  2.853  1.00 102.53 ? 4   DC  C P     1 
ATOM   1621 O OP1   . DC  B 2 4   ? 17.186  15.002  2.364  1.00 106.27 ? 4   DC  C OP1   1 
ATOM   1622 O OP2   . DC  B 2 4   ? 18.954  15.416  4.187  1.00 102.58 ? 4   DC  C OP2   1 
ATOM   1623 O "O5'" . DC  B 2 4   ? 18.982  13.309  2.832  1.00 101.77 ? 4   DC  C "O5'" 1 
ATOM   1624 C "C5'" . DC  B 2 4   ? 20.141  12.855  3.521  1.00 98.12  ? 4   DC  C "C5'" 1 
ATOM   1625 C "C4'" . DC  B 2 4   ? 20.913  11.865  2.672  1.00 94.83  ? 4   DC  C "C4'" 1 
ATOM   1626 O "O4'" . DC  B 2 4   ? 22.006  12.552  2.015  1.00 90.11  ? 4   DC  C "O4'" 1 
ATOM   1627 C "C3'" . DC  B 2 4   ? 21.528  10.713  3.455  1.00 94.62  ? 4   DC  C "C3'" 1 
ATOM   1628 O "O3'" . DC  B 2 4   ? 20.671  9.561   3.355  1.00 98.45  ? 4   DC  C "O3'" 1 
ATOM   1629 C "C2'" . DC  B 2 4   ? 22.866  10.470  2.759  1.00 90.38  ? 4   DC  C "C2'" 1 
ATOM   1630 C "C1'" . DC  B 2 4   ? 23.212  11.830  2.177  1.00 86.89  ? 4   DC  C "C1'" 1 
ATOM   1631 N N1    . DC  B 2 4   ? 24.228  12.656  2.987  1.00 82.13  ? 4   DC  C N1    1 
ATOM   1632 C C2    . DC  B 2 4   ? 25.604  12.347  2.909  1.00 77.57  ? 4   DC  C C2    1 
ATOM   1633 O O2    . DC  B 2 4   ? 25.966  11.347  2.280  1.00 76.76  ? 4   DC  C O2    1 
ATOM   1634 N N3    . DC  B 2 4   ? 26.500  13.158  3.547  1.00 74.79  ? 4   DC  C N3    1 
ATOM   1635 C C4    . DC  B 2 4   ? 26.077  14.234  4.228  1.00 76.01  ? 4   DC  C C4    1 
ATOM   1636 N N4    . DC  B 2 4   ? 26.995  14.985  4.853  1.00 74.50  ? 4   DC  C N4    1 
ATOM   1637 C C5    . DC  B 2 4   ? 24.687  14.557  4.336  1.00 79.64  ? 4   DC  C C5    1 
ATOM   1638 C C6    . DC  B 2 4   ? 23.810  13.753  3.708  1.00 82.01  ? 4   DC  C C6    1 
ATOM   1639 P P     . DT  B 2 5   ? 20.570  8.481   4.542  1.00 92.40  ? 5   DT  C P     1 
ATOM   1640 O OP1   . DT  B 2 5   ? 19.509  7.510   4.172  1.00 95.87  ? 5   DT  C OP1   1 
ATOM   1641 O OP2   . DT  B 2 5   ? 20.491  9.208   5.837  1.00 89.86  ? 5   DT  C OP2   1 
ATOM   1642 O "O5'" . DT  B 2 5   ? 21.982  7.743   4.486  1.00 88.78  ? 5   DT  C "O5'" 1 
ATOM   1643 C "C5'" . DT  B 2 5   ? 22.377  7.009   3.324  1.00 89.94  ? 5   DT  C "C5'" 1 
ATOM   1644 C "C4'" . DT  B 2 5   ? 23.814  6.546   3.473  1.00 87.23  ? 5   DT  C "C4'" 1 
ATOM   1645 O "O4'" . DT  B 2 5   ? 24.683  7.700   3.661  1.00 84.29  ? 5   DT  C "O4'" 1 
ATOM   1646 C "C3'" . DT  B 2 5   ? 24.059  5.620   4.665  1.00 84.99  ? 5   DT  C "C3'" 1 
ATOM   1647 O "O3'" . DT  B 2 5   ? 24.818  4.484   4.255  1.00 87.35  ? 5   DT  C "O3'" 1 
ATOM   1648 C "C2'" . DT  B 2 5   ? 24.805  6.497   5.679  1.00 80.66  ? 5   DT  C "C2'" 1 
ATOM   1649 C "C1'" . DT  B 2 5   ? 25.527  7.493   4.775  1.00 80.02  ? 5   DT  C "C1'" 1 
ATOM   1650 N N1    . DT  B 2 5   ? 25.822  8.844   5.428  1.00 75.20  ? 5   DT  C N1    1 
ATOM   1651 C C2    . DT  B 2 5   ? 27.134  9.211   5.660  1.00 71.80  ? 5   DT  C C2    1 
ATOM   1652 O O2    . DT  B 2 5   ? 28.084  8.510   5.385  1.00 72.30  ? 5   DT  C O2    1 
ATOM   1653 N N3    . DT  B 2 5   ? 27.293  10.458  6.203  1.00 69.97  ? 5   DT  C N3    1 
ATOM   1654 C C4    . DT  B 2 5   ? 26.303  11.354  6.561  1.00 70.45  ? 5   DT  C C4    1 
ATOM   1655 O O4    . DT  B 2 5   ? 26.622  12.430  7.053  1.00 70.28  ? 5   DT  C O4    1 
ATOM   1656 C C5    . DT  B 2 5   ? 24.943  10.889  6.363  1.00 72.44  ? 5   DT  C C5    1 
ATOM   1657 C C7    . DT  B 2 5   ? 23.778  11.755  6.744  1.00 73.53  ? 5   DT  C C7    1 
ATOM   1658 C C6    . DT  B 2 5   ? 24.768  9.677   5.805  1.00 74.32  ? 5   DT  C C6    1 
ATOM   1659 P P     . DC  B 2 6   ? 24.988  3.217   5.225  1.00 88.39  ? 6   DC  C P     1 
ATOM   1660 O OP1   . DC  B 2 6   ? 25.104  2.003   4.382  1.00 91.91  ? 6   DC  C OP1   1 
ATOM   1661 O OP2   . DC  B 2 6   ? 23.949  3.282   6.288  1.00 88.13  ? 6   DC  C OP2   1 
ATOM   1662 O "O5'" . DC  B 2 6   ? 26.399  3.503   5.917  1.00 86.68  ? 6   DC  C "O5'" 1 
ATOM   1663 C "C5'" . DC  B 2 6   ? 27.563  3.705   5.118  1.00 87.71  ? 6   DC  C "C5'" 1 
ATOM   1664 C "C4'" . DC  B 2 6   ? 28.732  4.135   5.977  1.00 85.92  ? 6   DC  C "C4'" 1 
ATOM   1665 O "O4'" . DC  B 2 6   ? 28.544  5.507   6.405  1.00 82.25  ? 6   DC  C "O4'" 1 
ATOM   1666 C "C3'" . DC  B 2 6   ? 28.936  3.304   7.246  1.00 86.49  ? 6   DC  C "C3'" 1 
ATOM   1667 O "O3'" . DC  B 2 6   ? 30.268  2.792   7.271  1.00 90.11  ? 6   DC  C "O3'" 1 
ATOM   1668 C "C2'" . DC  B 2 6   ? 28.650  4.285   8.402  1.00 82.12  ? 6   DC  C "C2'" 1 
ATOM   1669 C "C1'" . DC  B 2 6   ? 28.938  5.634   7.758  1.00 79.94  ? 6   DC  C "C1'" 1 
ATOM   1670 N N1    . DC  B 2 6   ? 28.195  6.821   8.374  1.00 75.45  ? 6   DC  C N1    1 
ATOM   1671 C C2    . DC  B 2 6   ? 28.919  7.955   8.795  1.00 71.97  ? 6   DC  C C2    1 
ATOM   1672 O O2    . DC  B 2 6   ? 30.147  7.929   8.773  1.00 71.73  ? 6   DC  C O2    1 
ATOM   1673 N N3    . DC  B 2 6   ? 28.235  9.044   9.244  1.00 70.25  ? 6   DC  C N3    1 
ATOM   1674 C C4    . DC  B 2 6   ? 26.898  9.037   9.284  1.00 70.46  ? 6   DC  C C4    1 
ATOM   1675 N N4    . DC  B 2 6   ? 26.282  10.129  9.737  1.00 69.71  ? 6   DC  C N4    1 
ATOM   1676 C C5    . DC  B 2 6   ? 26.137  7.913   8.840  1.00 72.77  ? 6   DC  C C5    1 
ATOM   1677 C C6    . DC  B 2 6   ? 26.816  6.840   8.394  1.00 75.00  ? 6   DC  C C6    1 
ATOM   1678 P P     . DT  B 2 7   ? 30.728  1.718   8.374  1.00 93.39  ? 7   DT  C P     1 
ATOM   1679 O OP1   . DT  B 2 7   ? 31.729  0.820   7.743  1.00 98.66  ? 7   DT  C OP1   1 
ATOM   1680 O OP2   . DT  B 2 7   ? 29.519  1.139   9.021  1.00 93.56  ? 7   DT  C OP2   1 
ATOM   1681 O "O5'" . DT  B 2 7   ? 31.468  2.643   9.453  1.00 90.92  ? 7   DT  C "O5'" 1 
ATOM   1682 C "C5'" . DT  B 2 7   ? 32.585  3.447   9.047  1.00 89.93  ? 7   DT  C "C5'" 1 
ATOM   1683 C "C4'" . DT  B 2 7   ? 33.096  4.300   10.193 1.00 86.60  ? 7   DT  C "C4'" 1 
ATOM   1684 O "O4'" . DT  B 2 7   ? 32.211  5.426   10.398 1.00 81.32  ? 7   DT  C "O4'" 1 
ATOM   1685 C "C3'" . DT  B 2 7   ? 33.226  3.589   11.542 1.00 87.92  ? 7   DT  C "C3'" 1 
ATOM   1686 O "O3'" . DT  B 2 7   ? 34.543  3.787   12.051 1.00 90.76  ? 7   DT  C "O3'" 1 
ATOM   1687 C "C2'" . DT  B 2 7   ? 32.161  4.264   12.419 1.00 83.21  ? 7   DT  C "C2'" 1 
ATOM   1688 C "C1'" . DT  B 2 7   ? 32.038  5.636   11.771 1.00 78.95  ? 7   DT  C "C1'" 1 
ATOM   1689 N N1    . DT  B 2 7   ? 30.709  6.298   11.980 1.00 73.98  ? 7   DT  C N1    1 
ATOM   1690 C C2    . DT  B 2 7   ? 30.671  7.610   12.410 1.00 70.23  ? 7   DT  C C2    1 
ATOM   1691 O O2    . DT  B 2 7   ? 31.670  8.271   12.650 1.00 69.93  ? 7   DT  C O2    1 
ATOM   1692 N N3    . DT  B 2 7   ? 29.407  8.125   12.557 1.00 67.83  ? 7   DT  C N3    1 
ATOM   1693 C C4    . DT  B 2 7   ? 28.202  7.482   12.330 1.00 68.26  ? 7   DT  C C4    1 
ATOM   1694 O O4    . DT  B 2 7   ? 27.155  8.093   12.520 1.00 67.17  ? 7   DT  C O4    1 
ATOM   1695 C C5    . DT  B 2 7   ? 28.308  6.094   11.905 1.00 71.25  ? 7   DT  C C5    1 
ATOM   1696 C C7    . DT  B 2 7   ? 27.074  5.274   11.652 1.00 72.56  ? 7   DT  C C7    1 
ATOM   1697 C C6    . DT  B 2 7   ? 29.539  5.580   11.745 1.00 73.66  ? 7   DT  C C6    1 
ATOM   1698 P P     . DG  B 2 8   ? 35.121  2.927   13.285 1.00 95.04  ? 8   DG  C P     1 
ATOM   1699 O OP1   . DG  B 2 8   ? 36.395  2.312   12.843 1.00 100.51 ? 8   DG  C OP1   1 
ATOM   1700 O OP2   . DG  B 2 8   ? 34.038  2.071   13.838 1.00 95.54  ? 8   DG  C OP2   1 
ATOM   1701 O "O5'" . DG  B 2 8   ? 35.450  4.060   14.374 1.00 92.54  ? 8   DG  C "O5'" 1 
ATOM   1702 C "C5'" . DG  B 2 8   ? 36.073  5.299   13.972 1.00 89.71  ? 8   DG  C "C5'" 1 
ATOM   1703 C "C4'" . DG  B 2 8   ? 35.830  6.408   14.992 1.00 86.00  ? 8   DG  C "C4'" 1 
ATOM   1704 O "O4'" . DG  B 2 8   ? 34.481  6.932   14.863 1.00 81.63  ? 8   DG  C "O4'" 1 
ATOM   1705 C "C3'" . DG  B 2 8   ? 36.005  6.015   16.462 1.00 88.06  ? 8   DG  C "C3'" 1 
ATOM   1706 O "O3'" . DG  B 2 8   ? 36.789  7.000   17.115 1.00 88.05  ? 8   DG  C "O3'" 1 
ATOM   1707 C "C2'" . DG  B 2 8   ? 34.572  5.974   17.000 1.00 85.63  ? 8   DG  C "C2'" 1 
ATOM   1708 C "C1'" . DG  B 2 8   ? 33.889  7.027   16.143 1.00 81.17  ? 8   DG  C "C1'" 1 
ATOM   1709 N N9    . DG  B 2 8   ? 32.447  6.832   16.000 1.00 79.26  ? 8   DG  C N9    1 
ATOM   1710 C C8    . DG  B 2 8   ? 31.799  5.685   15.609 1.00 80.69  ? 8   DG  C C8    1 
ATOM   1711 N N7    . DG  B 2 8   ? 30.511  5.827   15.496 1.00 79.00  ? 8   DG  C N7    1 
ATOM   1712 C C5    . DG  B 2 8   ? 30.284  7.141   15.856 1.00 76.17  ? 8   DG  C C5    1 
ATOM   1713 C C6    . DG  B 2 8   ? 29.072  7.863   15.942 1.00 74.41  ? 8   DG  C C6    1 
ATOM   1714 O O6    . DG  B 2 8   ? 27.925  7.459   15.711 1.00 74.18  ? 8   DG  C O6    1 
ATOM   1715 N N1    . DG  B 2 8   ? 29.283  9.174   16.385 1.00 73.81  ? 8   DG  C N1    1 
ATOM   1716 C C2    . DG  B 2 8   ? 30.518  9.725   16.669 1.00 73.65  ? 8   DG  C C2    1 
ATOM   1717 N N2    . DG  B 2 8   ? 30.536  11.017  17.028 1.00 72.22  ? 8   DG  C N2    1 
ATOM   1718 N N3    . DG  B 2 8   ? 31.659  9.057   16.582 1.00 75.23  ? 8   DG  C N3    1 
ATOM   1719 C C4    . DG  B 2 8   ? 31.468  7.773   16.179 1.00 76.41  ? 8   DG  C C4    1 
ATOM   1720 P P     . DT  B 2 9   ? 37.416  6.755   18.567 1.00 98.43  ? 9   DT  C P     1 
ATOM   1721 O OP1   . DT  B 2 9   ? 38.861  7.088   18.497 1.00 104.67 ? 9   DT  C OP1   1 
ATOM   1722 O OP2   . DT  B 2 9   ? 36.984  5.424   19.070 1.00 95.00  ? 9   DT  C OP2   1 
ATOM   1723 O "O5'" . DT  B 2 9   ? 36.675  7.863   19.436 1.00 93.87  ? 9   DT  C "O5'" 1 
ATOM   1724 C "C5'" . DT  B 2 9   ? 36.662  9.212   18.987 1.00 95.70  ? 9   DT  C "C5'" 1 
ATOM   1725 C "C4'" . DT  B 2 9   ? 35.568  9.994   19.672 1.00 90.84  ? 9   DT  C "C4'" 1 
ATOM   1726 O "O4'" . DT  B 2 9   ? 34.274  9.499   19.270 1.00 86.16  ? 9   DT  C "O4'" 1 
ATOM   1727 C "C3'" . DT  B 2 9   ? 35.591  9.947   21.203 1.00 87.45  ? 9   DT  C "C3'" 1 
ATOM   1728 O "O3'" . DT  B 2 9   ? 35.757  11.272  21.682 1.00 90.11  ? 9   DT  C "O3'" 1 
ATOM   1729 C "C2'" . DT  B 2 9   ? 34.221  9.346   21.587 1.00 80.79  ? 9   DT  C "C2'" 1 
ATOM   1730 C "C1'" . DT  B 2 9   ? 33.390  9.643   20.347 1.00 80.50  ? 9   DT  C "C1'" 1 
ATOM   1731 N N1    . DT  B 2 9   ? 32.201  8.734   20.118 1.00 75.16  ? 9   DT  C N1    1 
ATOM   1732 C C2    . DT  B 2 9   ? 30.928  9.296   20.022 1.00 72.89  ? 9   DT  C C2    1 
ATOM   1733 O O2    . DT  B 2 9   ? 30.693  10.494  20.188 1.00 74.71  ? 9   DT  C O2    1 
ATOM   1734 N N3    . DT  B 2 9   ? 29.935  8.407   19.686 1.00 68.72  ? 9   DT  C N3    1 
ATOM   1735 C C4    . DT  B 2 9   ? 30.061  7.053   19.422 1.00 67.18  ? 9   DT  C C4    1 
ATOM   1736 O O4    . DT  B 2 9   ? 29.055  6.401   19.124 1.00 63.84  ? 9   DT  C O4    1 
ATOM   1737 C C5    . DT  B 2 9   ? 31.412  6.521   19.541 1.00 70.50  ? 9   DT  C C5    1 
ATOM   1738 C C7    . DT  B 2 9   ? 31.677  5.056   19.323 1.00 70.83  ? 9   DT  C C7    1 
ATOM   1739 C C6    . DT  B 2 9   ? 32.409  7.382   19.849 1.00 73.70  ? 9   DT  C C6    1 
ATOM   1740 P P     . DA  B 2 10  ? 36.169  11.581  23.196 1.00 89.86  ? 10  DA  C P     1 
ATOM   1741 O OP1   . DA  B 2 10  ? 37.058  12.775  23.175 1.00 95.27  ? 10  DA  C OP1   1 
ATOM   1742 O OP2   . DA  B 2 10  ? 36.619  10.318  23.845 1.00 88.28  ? 10  DA  C OP2   1 
ATOM   1743 O "O5'" . DA  B 2 10  ? 34.770  11.970  23.849 1.00 83.59  ? 10  DA  C "O5'" 1 
ATOM   1744 C "C5'" . DA  B 2 10  ? 33.983  13.026  23.307 1.00 83.01  ? 10  DA  C "C5'" 1 
ATOM   1745 C "C4'" . DA  B 2 10  ? 32.670  13.132  24.055 1.00 77.66  ? 10  DA  C "C4'" 1 
ATOM   1746 O "O4'" . DA  B 2 10  ? 31.739  12.142  23.543 1.00 73.03  ? 10  DA  C "O4'" 1 
ATOM   1747 C "C3'" . DA  B 2 10  ? 32.767  12.899  25.569 1.00 74.74  ? 10  DA  C "C3'" 1 
ATOM   1748 O "O3'" . DA  B 2 10  ? 32.066  13.929  26.252 1.00 75.19  ? 10  DA  C "O3'" 1 
ATOM   1749 C "C2'" . DA  B 2 10  ? 32.121  11.518  25.775 1.00 69.27  ? 10  DA  C "C2'" 1 
ATOM   1750 C "C1'" . DA  B 2 10  ? 31.133  11.452  24.617 1.00 67.65  ? 10  DA  C "C1'" 1 
ATOM   1751 N N9    . DA  B 2 10  ? 30.822  10.092  24.164 1.00 63.80  ? 10  DA  C N9    1 
ATOM   1752 C C8    . DA  B 2 10  ? 31.696  9.049   24.017 1.00 64.40  ? 10  DA  C C8    1 
ATOM   1753 N N7    . DA  B 2 10  ? 31.164  7.976   23.476 1.00 62.32  ? 10  DA  C N7    1 
ATOM   1754 C C5    . DA  B 2 10  ? 29.847  8.333   23.253 1.00 59.51  ? 10  DA  C C5    1 
ATOM   1755 C C6    . DA  B 2 10  ? 28.743  7.629   22.710 1.00 57.03  ? 10  DA  C C6    1 
ATOM   1756 N N6    . DA  B 2 10  ? 28.804  6.354   22.317 1.00 56.97  ? 10  DA  C N6    1 
ATOM   1757 N N1    . DA  B 2 10  ? 27.572  8.292   22.593 1.00 54.97  ? 10  DA  C N1    1 
ATOM   1758 C C2    . DA  B 2 10  ? 27.490  9.558   23.034 1.00 55.80  ? 10  DA  C C2    1 
ATOM   1759 N N3    . DA  B 2 10  ? 28.451  10.331  23.545 1.00 58.34  ? 10  DA  C N3    1 
ATOM   1760 C C4    . DA  B 2 10  ? 29.618  9.643   23.652 1.00 60.34  ? 10  DA  C C4    1 
ATOM   1761 P P     . DC  B 2 11  ? 32.305  14.228  27.815 1.00 75.12  ? 11  DC  C P     1 
ATOM   1762 O OP1   . DC  B 2 11  ? 32.848  15.598  27.930 1.00 80.59  ? 11  DC  C OP1   1 
ATOM   1763 O OP2   . DC  B 2 11  ? 33.032  13.083  28.442 1.00 73.35  ? 11  DC  C OP2   1 
ATOM   1764 O "O5'" . DC  B 2 11  ? 30.823  14.216  28.416 1.00 71.55  ? 11  DC  C "O5'" 1 
ATOM   1765 C "C5'" . DC  B 2 11  ? 29.697  14.581  27.616 1.00 69.62  ? 11  DC  C "C5'" 1 
ATOM   1766 C "C4'" . DC  B 2 11  ? 28.506  13.699  27.946 1.00 64.19  ? 11  DC  C "C4'" 1 
ATOM   1767 O "O4'" . DC  B 2 11  ? 28.567  12.502  27.160 1.00 61.46  ? 11  DC  C "O4'" 1 
ATOM   1768 C "C3'" . DC  B 2 11  ? 28.438  13.203  29.386 1.00 61.86  ? 11  DC  C "C3'" 1 
ATOM   1769 O "O3'" . DC  B 2 11  ? 27.648  14.079  30.146 1.00 63.01  ? 11  DC  C "O3'" 1 
ATOM   1770 C "C2'" . DC  B 2 11  ? 27.790  11.813  29.281 1.00 57.55  ? 11  DC  C "C2'" 1 
ATOM   1771 C "C1'" . DC  B 2 11  ? 27.749  11.547  27.776 1.00 57.21  ? 11  DC  C "C1'" 1 
ATOM   1772 N N1    . DC  B 2 11  ? 28.218  10.198  27.375 1.00 54.80  ? 11  DC  C N1    1 
ATOM   1773 C C2    . DC  B 2 11  ? 27.386  9.404   26.564 1.00 52.08  ? 11  DC  C C2    1 
ATOM   1774 O O2    . DC  B 2 11  ? 26.269  9.838   26.226 1.00 51.03  ? 11  DC  C O2    1 
ATOM   1775 N N3    . DC  B 2 11  ? 27.847  8.199   26.138 1.00 52.06  ? 11  DC  C N3    1 
ATOM   1776 C C4    . DC  B 2 11  ? 29.046  7.746   26.539 1.00 53.74  ? 11  DC  C C4    1 
ATOM   1777 N N4    . DC  B 2 11  ? 29.430  6.533   26.103 1.00 54.53  ? 11  DC  C N4    1 
ATOM   1778 C C5    . DC  B 2 11  ? 29.927  8.545   27.351 1.00 55.36  ? 11  DC  C C5    1 
ATOM   1779 C C6    . DC  B 2 11  ? 29.472  9.751   27.753 1.00 56.02  ? 11  DC  C C6    1 
ATOM   1780 P P     . DG  B 2 12  ? 27.810  14.166  31.735 1.00 63.01  ? 12  DG  C P     1 
ATOM   1781 O OP1   . DG  B 2 12  ? 27.918  15.605  32.093 1.00 68.08  ? 12  DG  C OP1   1 
ATOM   1782 O OP2   . DG  B 2 12  ? 28.862  13.214  32.181 1.00 61.59  ? 12  DG  C OP2   1 
ATOM   1783 O "O5'" . DG  B 2 12  ? 26.423  13.592  32.258 1.00 58.90  ? 12  DG  C "O5'" 1 
ATOM   1784 C "C5'" . DG  B 2 12  ? 25.178  14.145  31.842 1.00 57.70  ? 12  DG  C "C5'" 1 
ATOM   1785 C "C4'" . DG  B 2 12  ? 24.045  13.583  32.701 1.00 54.65  ? 12  DG  C "C4'" 1 
ATOM   1786 O "O4'" . DG  B 2 12  ? 23.801  12.184  32.381 1.00 50.44  ? 12  DG  C "O4'" 1 
ATOM   1787 C "C3'" . DG  B 2 12  ? 24.258  13.633  34.214 1.00 55.05  ? 12  DG  C "C3'" 1 
ATOM   1788 O "O3'" . DG  B 2 12  ? 22.986  13.889  34.837 1.00 55.98  ? 12  DG  C "O3'" 1 
ATOM   1789 C "C2'" . DG  B 2 12  ? 24.787  12.220  34.528 1.00 52.42  ? 12  DG  C "C2'" 1 
ATOM   1790 C "C1'" . DG  B 2 12  ? 24.023  11.364  33.515 1.00 49.65  ? 12  DG  C "C1'" 1 
ATOM   1791 N N9    . DG  B 2 12  ? 24.742  10.167  33.057 1.00 48.09  ? 12  DG  C N9    1 
ATOM   1792 C C8    . DG  B 2 12  ? 26.022  10.118  32.545 1.00 48.92  ? 12  DG  C C8    1 
ATOM   1793 N N7    . DG  B 2 12  ? 26.350  8.949   32.066 1.00 47.10  ? 12  DG  C N7    1 
ATOM   1794 C C5    . DG  B 2 12  ? 25.209  8.170   32.240 1.00 44.35  ? 12  DG  C C5    1 
ATOM   1795 C C6    . DG  B 2 12  ? 24.957  6.805   31.883 1.00 41.36  ? 12  DG  C C6    1 
ATOM   1796 O O6    . DG  B 2 12  ? 25.717  6.015   31.319 1.00 39.71  ? 12  DG  C O6    1 
ATOM   1797 N N1    . DG  B 2 12  ? 23.641  6.417   32.184 1.00 40.55  ? 12  DG  C N1    1 
ATOM   1798 C C2    . DG  B 2 12  ? 22.692  7.251   32.755 1.00 40.85  ? 12  DG  C C2    1 
ATOM   1799 N N2    . DG  B 2 12  ? 21.488  6.713   32.984 1.00 41.31  ? 12  DG  C N2    1 
ATOM   1800 N N3    . DG  B 2 12  ? 22.924  8.511   33.119 1.00 42.57  ? 12  DG  C N3    1 
ATOM   1801 C C4    . DG  B 2 12  ? 24.209  8.899   32.859 1.00 44.90  ? 12  DG  C C4    1 
ATOM   1802 P P     . DT  B 2 13  ? 22.835  14.205  36.394 1.00 59.09  ? 13  DT  C P     1 
ATOM   1803 O OP1   . DT  B 2 13  ? 22.082  15.471  36.538 1.00 64.04  ? 13  DT  C OP1   1 
ATOM   1804 O OP2   . DT  B 2 13  ? 24.163  14.060  37.055 1.00 58.76  ? 13  DT  C OP2   1 
ATOM   1805 O "O5'" . DT  B 2 13  ? 21.905  13.019  36.879 1.00 56.00  ? 13  DT  C "O5'" 1 
ATOM   1806 C "C5'" . DT  B 2 13  ? 22.425  11.765  36.955 1.00 51.72  ? 13  DT  C "C5'" 1 
ATOM   1807 C "C4'" . DT  B 2 13  ? 21.337  10.765  37.165 1.00 47.80  ? 13  DT  C "C4'" 1 
ATOM   1808 O "O4'" . DT  B 2 13  ? 21.597  9.615   36.345 1.00 42.83  ? 13  DT  C "O4'" 1 
ATOM   1809 C "C3'" . DT  B 2 13  ? 21.235  10.258  38.593 1.00 46.95  ? 13  DT  C "C3'" 1 
ATOM   1810 O "O3'" . DT  B 2 13  ? 19.888  10.002  38.896 1.00 46.71  ? 13  DT  C "O3'" 1 
ATOM   1811 C "C2'" . DT  B 2 13  ? 22.061  8.977   38.569 1.00 44.69  ? 13  DT  C "C2'" 1 
ATOM   1812 C "C1'" . DT  B 2 13  ? 21.902  8.491   37.132 1.00 43.13  ? 13  DT  C "C1'" 1 
ATOM   1813 N N1    . DT  B 2 13  ? 23.130  7.889   36.573 1.00 43.46  ? 13  DT  C N1    1 
ATOM   1814 C C2    . DT  B 2 13  ? 23.091  6.594   36.066 1.00 42.62  ? 13  DT  C C2    1 
ATOM   1815 O O2    . DT  B 2 13  ? 22.072  5.886   36.065 1.00 42.93  ? 13  DT  C O2    1 
ATOM   1816 N N3    . DT  B 2 13  ? 24.280  6.168   35.519 1.00 41.81  ? 13  DT  C N3    1 
ATOM   1817 C C4    . DT  B 2 13  ? 25.472  6.882   35.434 1.00 44.28  ? 13  DT  C C4    1 
ATOM   1818 O O4    . DT  B 2 13  ? 26.444  6.361   34.911 1.00 46.17  ? 13  DT  C O4    1 
ATOM   1819 C C5    . DT  B 2 13  ? 25.453  8.214   36.011 1.00 45.74  ? 13  DT  C C5    1 
ATOM   1820 C C7    . DT  B 2 13  ? 26.692  9.070   36.016 1.00 48.07  ? 13  DT  C C7    1 
ATOM   1821 C C6    . DT  B 2 13  ? 24.291  8.662   36.508 1.00 45.24  ? 13  DT  C C6    1 
ATOM   1822 P P     . DG  B 2 14  ? 19.408  9.790   40.397 1.00 47.56  ? 14  DG  C P     1 
ATOM   1823 O OP1   . DG  B 2 14  ? 17.968  10.121  40.457 1.00 48.02  ? 14  DG  C OP1   1 
ATOM   1824 O OP2   . DG  B 2 14  ? 20.365  10.496  41.293 1.00 50.41  ? 14  DG  C OP2   1 
ATOM   1825 O "O5'" . DG  B 2 14  ? 19.604  8.213   40.618 1.00 47.70  ? 14  DG  C "O5'" 1 
ATOM   1826 C "C5'" . DG  B 2 14  ? 18.786  7.276   39.923 1.00 48.41  ? 14  DG  C "C5'" 1 
ATOM   1827 C "C4'" . DG  B 2 14  ? 19.292  5.844   40.117 1.00 49.42  ? 14  DG  C "C4'" 1 
ATOM   1828 O "O4'" . DG  B 2 14  ? 20.595  5.665   39.495 1.00 47.06  ? 14  DG  C "O4'" 1 
ATOM   1829 C "C3'" . DG  B 2 14  ? 19.457  5.364   41.574 1.00 53.14  ? 14  DG  C "C3'" 1 
ATOM   1830 O "O3'" . DG  B 2 14  ? 19.114  4.000   41.619 1.00 55.92  ? 14  DG  C "O3'" 1 
ATOM   1831 C "C2'" . DG  B 2 14  ? 20.958  5.529   41.816 1.00 51.44  ? 14  DG  C "C2'" 1 
ATOM   1832 C "C1'" . DG  B 2 14  ? 21.469  5.073   40.452 1.00 48.87  ? 14  DG  C "C1'" 1 
ATOM   1833 N N9    . DG  B 2 14  ? 22.838  5.443   40.129 1.00 48.11  ? 14  DG  C N9    1 
ATOM   1834 C C8    . DG  B 2 14  ? 23.501  6.619   40.435 1.00 49.19  ? 14  DG  C C8    1 
ATOM   1835 N N7    . DG  B 2 14  ? 24.679  6.709   39.876 1.00 48.80  ? 14  DG  C N7    1 
ATOM   1836 C C5    . DG  B 2 14  ? 24.782  5.539   39.128 1.00 47.06  ? 14  DG  C C5    1 
ATOM   1837 C C6    . DG  B 2 14  ? 25.843  5.056   38.335 1.00 46.06  ? 14  DG  C C6    1 
ATOM   1838 O O6    . DG  B 2 14  ? 26.920  5.611   38.099 1.00 48.19  ? 14  DG  C O6    1 
ATOM   1839 N N1    . DG  B 2 14  ? 25.555  3.801   37.780 1.00 44.27  ? 14  DG  C N1    1 
ATOM   1840 C C2    . DG  B 2 14  ? 24.385  3.099   38.002 1.00 45.19  ? 14  DG  C C2    1 
ATOM   1841 N N2    . DG  B 2 14  ? 24.267  1.893   37.418 1.00 44.11  ? 14  DG  C N2    1 
ATOM   1842 N N3    . DG  B 2 14  ? 23.407  3.533   38.786 1.00 46.15  ? 14  DG  C N3    1 
ATOM   1843 C C4    . DG  B 2 14  ? 23.659  4.756   39.288 1.00 46.45  ? 14  DG  C C4    1 
ATOM   1844 P P     . DA  B 2 15  ? 18.399  3.364   42.883 1.00 62.20  ? 15  DA  C P     1 
ATOM   1845 O OP1   . DA  B 2 15  ? 16.946  3.572   42.714 1.00 66.06  ? 15  DA  C OP1   1 
ATOM   1846 O OP2   . DA  B 2 15  ? 19.087  3.826   44.112 1.00 64.10  ? 15  DA  C OP2   1 
ATOM   1847 O "O5'" . DA  B 2 15  ? 18.721  1.820   42.704 1.00 61.46  ? 15  DA  C "O5'" 1 
ATOM   1848 C "C5'" . DA  B 2 15  ? 18.585  1.204   41.412 1.00 58.87  ? 15  DA  C "C5'" 1 
ATOM   1849 C "C4'" . DA  B 2 15  ? 19.494  -0.010  41.295 1.00 59.07  ? 15  DA  C "C4'" 1 
ATOM   1850 O "O4'" . DA  B 2 15  ? 20.810  0.410   40.843 1.00 56.73  ? 15  DA  C "O4'" 1 
ATOM   1851 C "C3'" . DA  B 2 15  ? 19.702  -0.807  42.588 1.00 63.09  ? 15  DA  C "C3'" 1 
ATOM   1852 O "O3'" . DA  B 2 15  ? 19.537  -2.212  42.331 1.00 65.35  ? 15  DA  C "O3'" 1 
ATOM   1853 C "C2'" . DA  B 2 15  ? 21.128  -0.443  43.033 1.00 62.19  ? 15  DA  C "C2'" 1 
ATOM   1854 C "C1'" . DA  B 2 15  ? 21.815  -0.089  41.712 1.00 57.94  ? 15  DA  C "C1'" 1 
ATOM   1855 N N9    . DA  B 2 15  ? 22.849  0.946   41.845 1.00 55.99  ? 15  DA  C N9    1 
ATOM   1856 C C8    . DA  B 2 15  ? 22.729  2.144   42.500 1.00 56.68  ? 15  DA  C C8    1 
ATOM   1857 N N7    . DA  B 2 15  ? 23.755  2.946   42.348 1.00 55.43  ? 15  DA  C N7    1 
ATOM   1858 C C5    . DA  B 2 15  ? 24.623  2.224   41.555 1.00 53.43  ? 15  DA  C C5    1 
ATOM   1859 C C6    . DA  B 2 15  ? 25.904  2.519   41.056 1.00 51.88  ? 15  DA  C C6    1 
ATOM   1860 N N6    . DA  B 2 15  ? 26.572  3.639   41.381 1.00 52.69  ? 15  DA  C N6    1 
ATOM   1861 N N1    . DA  B 2 15  ? 26.536  1.554   40.352 1.00 51.28  ? 15  DA  C N1    1 
ATOM   1862 C C2    . DA  B 2 15  ? 25.876  0.417   40.055 1.00 51.63  ? 15  DA  C C2    1 
ATOM   1863 N N3    . DA  B 2 15  ? 24.656  0.033   40.456 1.00 52.47  ? 15  DA  C N3    1 
ATOM   1864 C C4    . DA  B 2 15  ? 24.081  0.988   41.220 1.00 53.65  ? 15  DA  C C4    1 
ATOM   1865 P P     . DG  B 2 16  ? 19.640  -3.308  43.508 1.00 69.23  ? 16  DG  C P     1 
ATOM   1866 O OP1   . DG  B 2 16  ? 18.822  -4.482  43.115 1.00 71.78  ? 16  DG  C OP1   1 
ATOM   1867 O OP2   . DG  B 2 16  ? 19.394  -2.651  44.820 1.00 71.54  ? 16  DG  C OP2   1 
ATOM   1868 O "O5'" . DG  B 2 16  ? 21.176  -3.722  43.455 1.00 68.96  ? 16  DG  C "O5'" 1 
ATOM   1869 C "C5'" . DG  B 2 16  ? 21.757  -4.224  42.226 1.00 67.49  ? 16  DG  C "C5'" 1 
ATOM   1870 C "C4'" . DG  B 2 16  ? 23.256  -4.453  42.386 1.00 67.84  ? 16  DG  C "C4'" 1 
ATOM   1871 O "O4'" . DG  B 2 16  ? 23.957  -3.178  42.365 1.00 64.89  ? 16  DG  C "O4'" 1 
ATOM   1872 C "C3'" . DG  B 2 16  ? 23.683  -5.137  43.688 1.00 72.66  ? 16  DG  C "C3'" 1 
ATOM   1873 O "O3'" . DG  B 2 16  ? 24.762  -5.986  43.416 1.00 76.23  ? 16  DG  C "O3'" 1 
ATOM   1874 C "C2'" . DG  B 2 16  ? 24.149  -3.960  44.542 1.00 70.86  ? 16  DG  C "C2'" 1 
ATOM   1875 C "C1'" . DG  B 2 16  ? 24.821  -3.124  43.469 1.00 66.46  ? 16  DG  C "C1'" 1 
ATOM   1876 N N9    . DG  B 2 16  ? 25.082  -1.730  43.827 1.00 63.65  ? 16  DG  C N9    1 
ATOM   1877 C C8    . DG  B 2 16  ? 24.314  -0.892  44.613 1.00 63.69  ? 16  DG  C C8    1 
ATOM   1878 N N7    . DG  B 2 16  ? 24.843  0.292   44.788 1.00 62.60  ? 16  DG  C N7    1 
ATOM   1879 C C5    . DG  B 2 16  ? 26.031  0.238   44.057 1.00 61.75  ? 16  DG  C C5    1 
ATOM   1880 C C6    . DG  B 2 16  ? 27.054  1.220   43.872 1.00 61.30  ? 16  DG  C C6    1 
ATOM   1881 O O6    . DG  B 2 16  ? 27.099  2.385   44.317 1.00 62.13  ? 16  DG  C O6    1 
ATOM   1882 N N1    . DG  B 2 16  ? 28.131  0.708   43.137 1.00 60.61  ? 16  DG  C N1    1 
ATOM   1883 C C2    . DG  B 2 16  ? 28.195  -0.575  42.617 1.00 60.60  ? 16  DG  C C2    1 
ATOM   1884 N N2    . DG  B 2 16  ? 29.290  -0.889  41.926 1.00 61.17  ? 16  DG  C N2    1 
ATOM   1885 N N3    . DG  B 2 16  ? 27.242  -1.482  42.758 1.00 60.72  ? 16  DG  C N3    1 
ATOM   1886 C C4    . DG  B 2 16  ? 26.193  -1.011  43.480 1.00 61.58  ? 16  DG  C C4    1 
ATOM   1887 P P     . DC  B 2 17  ? 24.583  -7.569  43.378 1.00 80.66  ? 17  DC  C P     1 
ATOM   1888 O OP1   . DC  B 2 17  ? 23.886  -7.908  42.113 1.00 79.04  ? 17  DC  C OP1   1 
ATOM   1889 O OP2   . DC  B 2 17  ? 24.028  -8.011  44.686 1.00 85.01  ? 17  DC  C OP2   1 
ATOM   1890 O "O5'" . DC  B 2 17  ? 26.096  -8.054  43.293 1.00 81.42  ? 17  DC  C "O5'" 1 
ATOM   1891 C "C5'" . DC  B 2 17  ? 26.999  -7.622  44.276 1.00 82.06  ? 17  DC  C "C5'" 1 
ATOM   1892 C "C4'" . DC  B 2 17  ? 28.329  -7.240  43.673 1.00 80.27  ? 17  DC  C "C4'" 1 
ATOM   1893 O "O4'" . DC  B 2 17  ? 28.303  -5.844  43.291 1.00 75.26  ? 17  DC  C "O4'" 1 
ATOM   1894 C "C3'" . DC  B 2 17  ? 29.489  -7.408  44.634 1.00 84.83  ? 17  DC  C "C3'" 1 
ATOM   1895 O "O3'" . DC  B 2 17  ? 30.140  -8.620  44.326 1.00 89.74  ? 17  DC  C "O3'" 1 
ATOM   1896 C "C2'" . DC  B 2 17  ? 30.386  -6.201  44.365 1.00 81.47  ? 17  DC  C "C2'" 1 
ATOM   1897 C "C1'" . DC  B 2 17  ? 29.425  -5.166  43.825 1.00 75.56  ? 17  DC  C "C1'" 1 
ATOM   1898 N N1    . DC  B 2 17  ? 28.969  -4.079  44.810 1.00 73.22  ? 17  DC  C N1    1 
ATOM   1899 C C2    . DC  B 2 17  ? 29.693  -2.874  44.884 1.00 71.24  ? 17  DC  C C2    1 
ATOM   1900 O O2    . DC  B 2 17  ? 30.776  -2.785  44.296 1.00 71.96  ? 17  DC  C O2    1 
ATOM   1901 N N3    . DC  B 2 17  ? 29.173  -1.832  45.600 1.00 69.16  ? 17  DC  C N3    1 
ATOM   1902 C C4    . DC  B 2 17  ? 28.006  -1.965  46.239 1.00 69.22  ? 17  DC  C C4    1 
ATOM   1903 N N4    . DC  B 2 17  ? 27.569  -0.934  46.954 1.00 68.50  ? 17  DC  C N4    1 
ATOM   1904 C C5    . DC  B 2 17  ? 27.262  -3.183  46.202 1.00 71.15  ? 17  DC  C C5    1 
ATOM   1905 C C6    . DC  B 2 17  ? 27.747  -4.184  45.444 1.00 72.81  ? 17  DC  C C6    1 
ATOM   1906 P P     . DG  B 2 18  ? 30.798  -9.513  45.456 1.00 79.82  ? 18  DG  C P     1 
ATOM   1907 O OP1   . DG  B 2 18  ? 30.982  -10.873 44.884 1.00 83.37  ? 18  DG  C OP1   1 
ATOM   1908 O OP2   . DG  B 2 18  ? 30.045  -9.333  46.736 1.00 76.51  ? 18  DG  C OP2   1 
ATOM   1909 O "O5'" . DG  B 2 18  ? 32.220  -8.823  45.658 1.00 76.65  ? 18  DG  C "O5'" 1 
ATOM   1910 C "C5'" . DG  B 2 18  ? 33.126  -8.593  44.561 1.00 76.62  ? 18  DG  C "C5'" 1 
ATOM   1911 C "C4'" . DG  B 2 18  ? 34.244  -7.660  45.027 1.00 73.34  ? 18  DG  C "C4'" 1 
ATOM   1912 O "O4'" . DG  B 2 18  ? 33.679  -6.353  45.325 1.00 70.15  ? 18  DG  C "O4'" 1 
ATOM   1913 C "C3'" . DG  B 2 18  ? 34.964  -8.095  46.309 1.00 69.83  ? 18  DG  C "C3'" 1 
ATOM   1914 O "O3'" . DG  B 2 18  ? 36.334  -7.722  46.246 1.00 72.24  ? 18  DG  C "O3'" 1 
ATOM   1915 C "C2'" . DG  B 2 18  ? 34.219  -7.333  47.401 1.00 64.82  ? 18  DG  C "C2'" 1 
ATOM   1916 C "C1'" . DG  B 2 18  ? 33.871  -6.031  46.684 1.00 65.00  ? 18  DG  C "C1'" 1 
ATOM   1917 N N9    . DG  B 2 18  ? 32.657  -5.386  47.189 1.00 60.13  ? 18  DG  C N9    1 
ATOM   1918 C C8    . DG  B 2 18  ? 31.458  -5.994  47.491 1.00 58.18  ? 18  DG  C C8    1 
ATOM   1919 N N7    . DG  B 2 18  ? 30.552  -5.176  47.939 1.00 56.23  ? 18  DG  C N7    1 
ATOM   1920 C C5    . DG  B 2 18  ? 31.206  -3.953  48.002 1.00 56.08  ? 18  DG  C C5    1 
ATOM   1921 C C6    . DG  B 2 18  ? 30.751  -2.708  48.486 1.00 54.28  ? 18  DG  C C6    1 
ATOM   1922 O O6    . DG  B 2 18  ? 29.626  -2.426  48.930 1.00 52.95  ? 18  DG  C O6    1 
ATOM   1923 N N1    . DG  B 2 18  ? 31.758  -1.737  48.443 1.00 55.32  ? 18  DG  C N1    1 
ATOM   1924 C C2    . DG  B 2 18  ? 33.040  -1.945  47.986 1.00 55.82  ? 18  DG  C C2    1 
ATOM   1925 N N2    . DG  B 2 18  ? 33.850  -0.878  47.972 1.00 56.99  ? 18  DG  C N2    1 
ATOM   1926 N N3    . DG  B 2 18  ? 33.469  -3.096  47.498 1.00 56.50  ? 18  DG  C N3    1 
ATOM   1927 C C4    . DG  B 2 18  ? 32.509  -4.064  47.557 1.00 57.54  ? 18  DG  C C4    1 
ATOM   1928 P P     . DA  B 2 19  ? 37.379  -8.175  47.386 1.00 73.11  ? 19  DA  C P     1 
ATOM   1929 O OP1   . DA  B 2 19  ? 38.624  -8.591  46.694 1.00 79.19  ? 19  DA  C OP1   1 
ATOM   1930 O OP2   . DA  B 2 19  ? 36.710  -9.099  48.336 1.00 70.24  ? 19  DA  C OP2   1 
ATOM   1931 O "O5'" . DA  B 2 19  ? 37.654  -6.815  48.169 1.00 70.03  ? 19  DA  C "O5'" 1 
ATOM   1932 C "C5'" . DA  B 2 19  ? 38.061  -5.645  47.457 1.00 70.91  ? 19  DA  C "C5'" 1 
ATOM   1933 C "C4'" . DA  B 2 19  ? 38.147  -4.449  48.393 1.00 68.48  ? 19  DA  C "C4'" 1 
ATOM   1934 O "O4'" . DA  B 2 19  ? 36.815  -3.981  48.737 1.00 64.12  ? 19  DA  C "O4'" 1 
ATOM   1935 C "C3'" . DA  B 2 19  ? 38.879  -4.684  49.706 1.00 67.39  ? 19  DA  C "C3'" 1 
ATOM   1936 O "O3'" . DA  B 2 19  ? 39.810  -3.620  49.906 1.00 71.45  ? 19  DA  C "O3'" 1 
ATOM   1937 C "C2'" . DA  B 2 19  ? 37.751  -4.698  50.758 1.00 61.98  ? 19  DA  C "C2'" 1 
ATOM   1938 C "C1'" . DA  B 2 19  ? 36.703  -3.792  50.123 1.00 60.41  ? 19  DA  C "C1'" 1 
ATOM   1939 N N9    . DA  B 2 19  ? 35.322  -4.106  50.491 1.00 55.58  ? 19  DA  C N9    1 
ATOM   1940 C C8    . DA  B 2 19  ? 34.679  -5.302  50.307 1.00 54.27  ? 19  DA  C C8    1 
ATOM   1941 N N7    . DA  B 2 19  ? 33.416  -5.289  50.659 1.00 52.45  ? 19  DA  C N7    1 
ATOM   1942 C C5    . DA  B 2 19  ? 33.178  -3.964  51.017 1.00 51.32  ? 19  DA  C C5    1 
ATOM   1943 C C6    . DA  B 2 19  ? 32.022  -3.289  51.511 1.00 49.85  ? 19  DA  C C6    1 
ATOM   1944 N N6    . DA  B 2 19  ? 30.819  -3.876  51.641 1.00 48.89  ? 19  DA  C N6    1 
ATOM   1945 N N1    . DA  B 2 19  ? 32.131  -1.957  51.769 1.00 49.76  ? 19  DA  C N1    1 
ATOM   1946 C C2    . DA  B 2 19  ? 33.337  -1.375  51.665 1.00 51.59  ? 19  DA  C C2    1 
ATOM   1947 N N3    . DA  B 2 19  ? 34.498  -1.913  51.257 1.00 53.05  ? 19  DA  C N3    1 
ATOM   1948 C C4    . DA  B 2 19  ? 34.345  -3.217  50.920 1.00 52.87  ? 19  DA  C C4    1 
ATOM   1949 P P     . DT  B 2 20  ? 40.871  -3.639  51.114 1.00 73.92  ? 20  DT  C P     1 
ATOM   1950 O OP1   . DT  B 2 20  ? 42.106  -2.969  50.634 1.00 79.85  ? 20  DT  C OP1   1 
ATOM   1951 O OP2   . DT  B 2 20  ? 40.938  -5.009  51.685 1.00 72.37  ? 20  DT  C OP2   1 
ATOM   1952 O "O5'" . DT  B 2 20  ? 40.168  -2.705  52.196 1.00 70.86  ? 20  DT  C "O5'" 1 
ATOM   1953 C "C5'" . DT  B 2 20  ? 39.713  -1.409  51.826 1.00 71.25  ? 20  DT  C "C5'" 1 
ATOM   1954 C "C4'" . DT  B 2 20  ? 38.907  -0.789  52.943 1.00 68.07  ? 20  DT  C "C4'" 1 
ATOM   1955 O "O4'" . DT  B 2 20  ? 37.568  -1.330  52.941 1.00 62.91  ? 20  DT  C "O4'" 1 
ATOM   1956 C "C3'" . DT  B 2 20  ? 39.459  -1.036  54.353 1.00 68.00  ? 20  DT  C "C3'" 1 
ATOM   1957 O "O3'" . DT  B 2 20  ? 39.702  0.199   54.983 1.00 72.13  ? 20  DT  C "O3'" 1 
ATOM   1958 C "C2'" . DT  B 2 20  ? 38.345  -1.814  55.060 1.00 61.91  ? 20  DT  C "C2'" 1 
ATOM   1959 C "C1'" . DT  B 2 20  ? 37.127  -1.380  54.269 1.00 59.63  ? 20  DT  C "C1'" 1 
ATOM   1960 N N1    . DT  B 2 20  ? 35.954  -2.314  54.354 1.00 54.78  ? 20  DT  C N1    1 
ATOM   1961 C C2    . DT  B 2 20  ? 34.721  -1.818  54.763 1.00 51.96  ? 20  DT  C C2    1 
ATOM   1962 O O2    . DT  B 2 20  ? 34.520  -0.649  55.051 1.00 52.45  ? 20  DT  C O2    1 
ATOM   1963 N N3    . DT  B 2 20  ? 33.717  -2.745  54.786 1.00 49.41  ? 20  DT  C N3    1 
ATOM   1964 C C4    . DT  B 2 20  ? 33.798  -4.084  54.451 1.00 48.77  ? 20  DT  C C4    1 
ATOM   1965 O O4    . DT  B 2 20  ? 32.783  -4.776  54.508 1.00 46.96  ? 20  DT  C O4    1 
ATOM   1966 C C5    . DT  B 2 20  ? 35.129  -4.556  54.080 1.00 51.17  ? 20  DT  C C5    1 
ATOM   1967 C C7    . DT  B 2 20  ? 35.366  -6.008  53.735 1.00 51.37  ? 20  DT  C C7    1 
ATOM   1968 C C6    . DT  B 2 20  ? 36.124  -3.659  54.046 1.00 53.27  ? 20  DT  C C6    1 
ATOM   1969 P P     . DG  B 2 21  ? 40.791  0.331   56.151 1.00 76.05  ? 21  DG  C P     1 
ATOM   1970 O OP1   . DG  B 2 21  ? 41.861  1.228   55.640 1.00 81.90  ? 21  DG  C OP1   1 
ATOM   1971 O OP2   . DG  B 2 21  ? 41.133  -1.024  56.668 1.00 73.73  ? 21  DG  C OP2   1 
ATOM   1972 O "O5'" . DG  B 2 21  ? 39.981  1.081   57.307 1.00 74.80  ? 21  DG  C "O5'" 1 
ATOM   1973 C "C5'" . DG  B 2 21  ? 38.799  1.828   57.002 1.00 72.95  ? 21  DG  C "C5'" 1 
ATOM   1974 C "C4'" . DG  B 2 21  ? 37.716  1.606   58.054 1.00 69.73  ? 21  DG  C "C4'" 1 
ATOM   1975 O "O4'" . DG  B 2 21  ? 36.842  0.535   57.635 1.00 65.36  ? 21  DG  C "O4'" 1 
ATOM   1976 C "C3'" . DG  B 2 21  ? 38.188  1.229   59.479 1.00 69.84  ? 21  DG  C "C3'" 1 
ATOM   1977 O "O3'" . DG  B 2 21  ? 37.359  1.887   60.421 1.00 70.85  ? 21  DG  C "O3'" 1 
ATOM   1978 C "C2'" . DG  B 2 21  ? 37.916  -0.267  59.519 1.00 65.07  ? 21  DG  C "C2'" 1 
ATOM   1979 C "C1'" . DG  B 2 21  ? 36.615  -0.284  58.741 1.00 62.03  ? 21  DG  C "C1'" 1 
ATOM   1980 N N9    . DG  B 2 21  ? 36.164  -1.593  58.299 1.00 57.54  ? 21  DG  C N9    1 
ATOM   1981 C C8    . DG  B 2 21  ? 36.940  -2.678  57.947 1.00 57.61  ? 21  DG  C C8    1 
ATOM   1982 N N7    . DG  B 2 21  ? 36.246  -3.747  57.684 1.00 54.75  ? 21  DG  C N7    1 
ATOM   1983 C C5    . DG  B 2 21  ? 34.938  -3.361  57.946 1.00 51.93  ? 21  DG  C C5    1 
ATOM   1984 C C6    . DG  B 2 21  ? 33.749  -4.100  57.862 1.00 48.98  ? 21  DG  C C6    1 
ATOM   1985 O O6    . DG  B 2 21  ? 33.626  -5.292  57.567 1.00 49.83  ? 21  DG  C O6    1 
ATOM   1986 N N1    . DG  B 2 21  ? 32.638  -3.342  58.258 1.00 46.95  ? 21  DG  C N1    1 
ATOM   1987 C C2    . DG  B 2 21  ? 32.687  -2.031  58.669 1.00 48.73  ? 21  DG  C C2    1 
ATOM   1988 N N2    . DG  B 2 21  ? 31.532  -1.467  59.035 1.00 49.32  ? 21  DG  C N2    1 
ATOM   1989 N N3    . DG  B 2 21  ? 33.795  -1.325  58.728 1.00 51.41  ? 21  DG  C N3    1 
ATOM   1990 C C4    . DG  B 2 21  ? 34.879  -2.050  58.349 1.00 52.74  ? 21  DG  C C4    1 
ATOM   1991 P P     . DG  B 2 22  ? 37.965  2.821   61.568 1.00 75.28  ? 22  DG  C P     1 
ATOM   1992 O OP1   . DG  B 2 22  ? 38.613  3.988   60.920 1.00 80.85  ? 22  DG  C OP1   1 
ATOM   1993 O OP2   . DG  B 2 22  ? 38.731  1.968   62.512 1.00 75.85  ? 22  DG  C OP2   1 
ATOM   1994 O "O5'" . DG  B 2 22  ? 36.658  3.320   62.332 1.00 74.12  ? 22  DG  C "O5'" 1 
ATOM   1995 C "C5'" . DG  B 2 22  ? 35.540  3.847   61.614 1.00 73.27  ? 22  DG  C "C5'" 1 
ATOM   1996 C "C4'" . DG  B 2 22  ? 34.245  3.345   62.233 1.00 71.08  ? 22  DG  C "C4'" 1 
ATOM   1997 O "O4'" . DG  B 2 22  ? 33.951  1.991   61.758 1.00 66.71  ? 22  DG  C "O4'" 1 
ATOM   1998 C "C3'" . DG  B 2 22  ? 34.250  3.281   63.763 1.00 72.62  ? 22  DG  C "C3'" 1 
ATOM   1999 O "O3'" . DG  B 2 22  ? 33.078  3.927   64.257 1.00 75.82  ? 22  DG  C "O3'" 1 
ATOM   2000 C "C2'" . DG  B 2 22  ? 34.302  1.772   64.084 1.00 67.27  ? 22  DG  C "C2'" 1 
ATOM   2001 C "C1'" . DG  B 2 22  ? 33.659  1.144   62.852 1.00 63.86  ? 22  DG  C "C1'" 1 
ATOM   2002 N N9    . DG  B 2 22  ? 34.148  -0.204  62.527 1.00 59.07  ? 22  DG  C N9    1 
ATOM   2003 C C8    . DG  B 2 22  ? 35.449  -0.572  62.229 1.00 59.16  ? 22  DG  C C8    1 
ATOM   2004 N N7    . DG  B 2 22  ? 35.566  -1.813  61.832 1.00 55.94  ? 22  DG  C N7    1 
ATOM   2005 C C5    . DG  B 2 22  ? 34.264  -2.297  61.849 1.00 52.28  ? 22  DG  C C5    1 
ATOM   2006 C C6    . DG  B 2 22  ? 33.771  -3.587  61.531 1.00 48.62  ? 22  DG  C C6    1 
ATOM   2007 O O6    . DG  B 2 22  ? 34.406  -4.566  61.126 1.00 48.24  ? 22  DG  C O6    1 
ATOM   2008 N N1    . DG  B 2 22  ? 32.386  -3.664  61.675 1.00 47.44  ? 22  DG  C N1    1 
ATOM   2009 C C2    . DG  B 2 22  ? 31.580  -2.637  62.133 1.00 50.02  ? 22  DG  C C2    1 
ATOM   2010 N N2    . DG  B 2 22  ? 30.267  -2.904  62.212 1.00 51.05  ? 22  DG  C N2    1 
ATOM   2011 N N3    . DG  B 2 22  ? 32.024  -1.411  62.415 1.00 51.43  ? 22  DG  C N3    1 
ATOM   2012 C C4    . DG  B 2 22  ? 33.377  -1.324  62.285 1.00 53.57  ? 22  DG  C C4    1 
ATOM   2013 P P     . DA  B 2 23  ? 32.770  4.073   65.821 1.00 79.21  ? 23  DA  C P     1 
ATOM   2014 O OP1   . DA  B 2 23  ? 32.023  5.345   66.016 1.00 83.96  ? 23  DA  C OP1   1 
ATOM   2015 O OP2   . DA  B 2 23  ? 34.020  3.830   66.608 1.00 80.65  ? 23  DA  C OP2   1 
ATOM   2016 O "O5'" . DA  B 2 23  ? 31.781  2.842   66.092 1.00 74.02  ? 23  DA  C "O5'" 1 
ATOM   2017 C "C5'" . DA  B 2 23  ? 30.514  2.787   65.425 1.00 71.70  ? 23  DA  C "C5'" 1 
ATOM   2018 C "C4'" . DA  B 2 23  ? 29.689  1.604   65.904 1.00 67.71  ? 23  DA  C "C4'" 1 
ATOM   2019 O "O4'" . DA  B 2 23  ? 30.223  0.361   65.365 1.00 61.44  ? 23  DA  C "O4'" 1 
ATOM   2020 C "C3'" . DA  B 2 23  ? 29.597  1.427   67.420 1.00 69.25  ? 23  DA  C "C3'" 1 
ATOM   2021 O "O3'" . DA  B 2 23  ? 28.252  1.160   67.758 1.00 72.49  ? 23  DA  C "O3'" 1 
ATOM   2022 C "C2'" . DA  B 2 23  ? 30.517  0.232   67.705 1.00 63.95  ? 23  DA  C "C2'" 1 
ATOM   2023 C "C1'" . DA  B 2 23  ? 30.427  -0.570  66.403 1.00 59.25  ? 23  DA  C "C1'" 1 
ATOM   2024 N N9    . DA  B 2 23  ? 31.631  -1.334  66.081 1.00 55.12  ? 23  DA  C N9    1 
ATOM   2025 C C8    . DA  B 2 23  ? 32.919  -0.872  66.042 1.00 55.93  ? 23  DA  C C8    1 
ATOM   2026 N N7    . DA  B 2 23  ? 33.802  -1.764  65.666 1.00 53.57  ? 23  DA  C N7    1 
ATOM   2027 C C5    . DA  B 2 23  ? 33.038  -2.887  65.384 1.00 50.07  ? 23  DA  C C5    1 
ATOM   2028 C C6    . DA  B 2 23  ? 33.375  -4.188  64.935 1.00 46.82  ? 23  DA  C C6    1 
ATOM   2029 N N6    . DA  B 2 23  ? 34.621  -4.570  64.652 1.00 46.47  ? 23  DA  C N6    1 
ATOM   2030 N N1    . DA  B 2 23  ? 32.365  -5.073  64.760 1.00 45.20  ? 23  DA  C N1    1 
ATOM   2031 C C2    . DA  B 2 23  ? 31.104  -4.697  65.042 1.00 46.12  ? 23  DA  C C2    1 
ATOM   2032 N N3    . DA  B 2 23  ? 30.662  -3.514  65.493 1.00 48.73  ? 23  DA  C N3    1 
ATOM   2033 C C4    . DA  B 2 23  ? 31.690  -2.640  65.634 1.00 51.03  ? 23  DA  C C4    1 
ATOM   2034 P P     . DC  B 2 24  ? 27.735  1.193   69.269 1.00 78.75  ? 24  DC  C P     1 
ATOM   2035 O OP1   . DC  B 2 24  ? 26.326  1.656   69.231 1.00 83.62  ? 24  DC  C OP1   1 
ATOM   2036 O OP2   . DC  B 2 24  ? 28.732  1.894   70.129 1.00 80.95  ? 24  DC  C OP2   1 
ATOM   2037 O "O5'" . DC  B 2 24  ? 27.764  -0.344  69.681 1.00 73.55  ? 24  DC  C "O5'" 1 
ATOM   2038 C "C5'" . DC  B 2 24  ? 27.142  -1.307  68.852 1.00 69.75  ? 24  DC  C "C5'" 1 
ATOM   2039 C "C4'" . DC  B 2 24  ? 27.649  -2.688  69.187 1.00 64.95  ? 24  DC  C "C4'" 1 
ATOM   2040 O "O4'" . DC  B 2 24  ? 28.964  -2.863  68.637 1.00 59.95  ? 24  DC  C "O4'" 1 
ATOM   2041 C "C3'" . DC  B 2 24  ? 27.771  -2.996  70.690 1.00 67.67  ? 24  DC  C "C3'" 1 
ATOM   2042 O "O3'" . DC  B 2 24  ? 26.846  -4.005  71.001 1.00 69.83  ? 24  DC  C "O3'" 1 
ATOM   2043 C "C2'" . DC  B 2 24  ? 29.230  -3.485  70.853 1.00 63.87  ? 24  DC  C "C2'" 1 
ATOM   2044 C "C1'" . DC  B 2 24  ? 29.608  -3.817  69.406 1.00 58.80  ? 24  DC  C "C1'" 1 
ATOM   2045 N N1    . DC  B 2 24  ? 31.088  -3.805  69.087 1.00 56.23  ? 24  DC  C N1    1 
ATOM   2046 C C2    . DC  B 2 24  ? 31.665  -4.942  68.483 1.00 51.67  ? 24  DC  C C2    1 
ATOM   2047 O O2    . DC  B 2 24  ? 30.947  -5.912  68.213 1.00 49.20  ? 24  DC  C O2    1 
ATOM   2048 N N3    . DC  B 2 24  ? 32.999  -4.941  68.206 1.00 50.96  ? 24  DC  C N3    1 
ATOM   2049 C C4    . DC  B 2 24  ? 33.754  -3.875  68.519 1.00 54.34  ? 24  DC  C C4    1 
ATOM   2050 N N4    . DC  B 2 24  ? 35.056  -3.919  68.198 1.00 54.53  ? 24  DC  C N4    1 
ATOM   2051 C C5    . DC  B 2 24  ? 33.186  -2.690  69.109 1.00 58.05  ? 24  DC  C C5    1 
ATOM   2052 C C6    . DC  B 2 24  ? 31.864  -2.702  69.381 1.00 58.68  ? 24  DC  C C6    1 
ATOM   2053 P P     . DA  B 2 25  ? 26.236  -4.210  72.475 1.00 74.93  ? 25  DA  C P     1 
ATOM   2054 O OP1   . DA  B 2 25  ? 24.812  -3.798  72.434 1.00 79.52  ? 25  DA  C OP1   1 
ATOM   2055 O OP2   . DA  B 2 25  ? 27.152  -3.620  73.495 1.00 76.76  ? 25  DA  C OP2   1 
ATOM   2056 O "O5'" . DA  B 2 25  ? 26.304  -5.795  72.622 1.00 71.46  ? 25  DA  C "O5'" 1 
ATOM   2057 C "C5'" . DA  B 2 25  ? 26.214  -6.628  71.470 1.00 66.14  ? 25  DA  C "C5'" 1 
ATOM   2058 C "C4'" . DA  B 2 25  ? 27.058  -7.871  71.642 1.00 62.09  ? 25  DA  C "C4'" 1 
ATOM   2059 O "O4'" . DA  B 2 25  ? 28.425  -7.610  71.227 1.00 58.35  ? 25  DA  C "O4'" 1 
ATOM   2060 C "C3'" . DA  B 2 25  ? 27.144  -8.412  73.079 1.00 64.35  ? 25  DA  C "C3'" 1 
ATOM   2061 O "O3'" . DA  B 2 25  ? 27.017  -9.821  73.044 1.00 64.32  ? 25  DA  C "O3'" 1 
ATOM   2062 C "C2'" . DA  B 2 25  ? 28.541  -7.993  73.525 1.00 62.46  ? 25  DA  C "C2'" 1 
ATOM   2063 C "C1'" . DA  B 2 25  ? 29.309  -8.102  72.219 1.00 58.36  ? 25  DA  C "C1'" 1 
ATOM   2064 N N9    . DA  B 2 25  ? 30.518  -7.297  72.190 1.00 57.29  ? 25  DA  C N9    1 
ATOM   2065 C C8    . DA  B 2 25  ? 30.665  -6.024  72.669 1.00 60.14  ? 25  DA  C C8    1 
ATOM   2066 N N7    . DA  B 2 25  ? 31.828  -5.486  72.406 1.00 59.72  ? 25  DA  C N7    1 
ATOM   2067 C C5    . DA  B 2 25  ? 32.497  -6.478  71.710 1.00 55.63  ? 25  DA  C C5    1 
ATOM   2068 C C6    . DA  B 2 25  ? 33.789  -6.533  71.160 1.00 53.60  ? 25  DA  C C6    1 
ATOM   2069 N N6    . DA  B 2 25  ? 34.681  -5.542  71.307 1.00 55.60  ? 25  DA  C N6    1 
ATOM   2070 N N1    . DA  B 2 25  ? 34.173  -7.696  70.574 1.00 50.61  ? 25  DA  C N1    1 
ATOM   2071 C C2    . DA  B 2 25  ? 33.279  -8.692  70.448 1.00 49.39  ? 25  DA  C C2    1 
ATOM   2072 N N3    . DA  B 2 25  ? 32.033  -8.755  70.931 1.00 50.64  ? 25  DA  C N3    1 
ATOM   2073 C C4    . DA  B 2 25  ? 31.701  -7.601  71.557 1.00 54.05  ? 25  DA  C C4    1 
ATOM   2074 P P     . DG  B 2 26  ? 26.527  -10.645 74.317 1.00 67.51  ? 26  DG  C P     1 
ATOM   2075 O OP1   . DG  B 2 26  ? 25.072  -10.868 74.173 1.00 71.34  ? 26  DG  C OP1   1 
ATOM   2076 O OP2   . DG  B 2 26  ? 27.059  -10.005 75.557 1.00 69.71  ? 26  DG  C OP2   1 
ATOM   2077 O "O5'" . DG  B 2 26  ? 27.283  -12.038 74.121 1.00 64.03  ? 26  DG  C "O5'" 1 
ATOM   2078 C "C5'" . DG  B 2 26  ? 27.864  -12.407 72.843 1.00 58.07  ? 26  DG  C "C5'" 1 
ATOM   2079 C "C4'" . DG  B 2 26  ? 29.165  -13.193 73.030 1.00 55.41  ? 26  DG  C "C4'" 1 
ATOM   2080 O "O4'" . DG  B 2 26  ? 30.295  -12.291 72.917 1.00 53.10  ? 26  DG  C "O4'" 1 
ATOM   2081 C "C3'" . DG  B 2 26  ? 29.340  -13.927 74.386 1.00 57.59  ? 26  DG  C "C3'" 1 
ATOM   2082 O "O3'" . DG  B 2 26  ? 29.906  -15.224 74.148 1.00 58.82  ? 26  DG  C "O3'" 1 
ATOM   2083 C "C2'" . DG  B 2 26  ? 30.303  -13.018 75.162 1.00 56.97  ? 26  DG  C "C2'" 1 
ATOM   2084 C "C1'" . DG  B 2 26  ? 31.162  -12.451 74.042 1.00 54.74  ? 26  DG  C "C1'" 1 
ATOM   2085 N N9    . DG  B 2 26  ? 31.763  -11.139 74.325 1.00 55.40  ? 26  DG  C N9    1 
ATOM   2086 C C8    . DG  B 2 26  ? 31.119  -10.020 74.797 1.00 56.90  ? 26  DG  C C8    1 
ATOM   2087 N N7    . DG  B 2 26  ? 31.871  -8.959  74.835 1.00 57.53  ? 26  DG  C N7    1 
ATOM   2088 C C5    . DG  B 2 26  ? 33.062  -9.371  74.254 1.00 55.41  ? 26  DG  C C5    1 
ATOM   2089 C C6    . DG  B 2 26  ? 34.265  -8.649  74.035 1.00 56.02  ? 26  DG  C C6    1 
ATOM   2090 O O6    . DG  B 2 26  ? 34.496  -7.451  74.289 1.00 58.10  ? 26  DG  C O6    1 
ATOM   2091 N N1    . DG  B 2 26  ? 35.264  -9.455  73.481 1.00 54.26  ? 26  DG  C N1    1 
ATOM   2092 C C2    . DG  B 2 26  ? 35.127  -10.798 73.211 1.00 54.29  ? 26  DG  C C2    1 
ATOM   2093 N N2    . DG  B 2 26  ? 36.187  -11.407 72.669 1.00 56.03  ? 26  DG  C N2    1 
ATOM   2094 N N3    . DG  B 2 26  ? 34.006  -11.492 73.418 1.00 53.08  ? 26  DG  C N3    1 
ATOM   2095 C C4    . DG  B 2 26  ? 33.010  -10.706 73.922 1.00 53.90  ? 26  DG  C C4    1 
ATOM   2096 P P     . DC  B 2 27  ? 29.837  -16.414 75.228 1.00 63.21  ? 27  DC  C P     1 
ATOM   2097 O OP1   . DC  B 2 27  ? 29.542  -17.663 74.495 1.00 64.69  ? 27  DC  C OP1   1 
ATOM   2098 O OP2   . DC  B 2 27  ? 28.966  -16.011 76.364 1.00 65.90  ? 27  DC  C OP2   1 
ATOM   2099 O "O5'" . DC  B 2 27  ? 31.341  -16.480 75.763 1.00 64.49  ? 27  DC  C "O5'" 1 
ATOM   2100 C "C5'" . DC  B 2 27  ? 32.390  -16.458 74.804 1.00 62.82  ? 27  DC  C "C5'" 1 
ATOM   2101 C "C4'" . DC  B 2 27  ? 33.708  -16.002 75.388 1.00 63.21  ? 27  DC  C "C4'" 1 
ATOM   2102 O "O4'" . DC  B 2 27  ? 33.789  -14.576 75.346 1.00 60.69  ? 27  DC  C "O4'" 1 
ATOM   2103 C "C3'" . DC  B 2 27  ? 33.985  -16.412 76.822 1.00 68.16  ? 27  DC  C "C3'" 1 
ATOM   2104 O "O3'" . DC  B 2 27  ? 35.027  -17.340 76.832 1.00 72.71  ? 27  DC  C "O3'" 1 
ATOM   2105 C "C2'" . DC  B 2 27  ? 34.402  -15.110 77.511 1.00 67.12  ? 27  DC  C "C2'" 1 
ATOM   2106 C "C1'" . DC  B 2 27  ? 34.668  -14.176 76.344 1.00 63.17  ? 27  DC  C "C1'" 1 
ATOM   2107 N N1    . DC  B 2 27  ? 34.431  -12.735 76.658 1.00 61.98  ? 27  DC  C N1    1 
ATOM   2108 C C2    . DC  B 2 27  ? 35.496  -11.819 76.538 1.00 63.07  ? 27  DC  C C2    1 
ATOM   2109 O O2    . DC  B 2 27  ? 36.585  -12.214 76.082 1.00 65.24  ? 27  DC  C O2    1 
ATOM   2110 N N3    . DC  B 2 27  ? 35.284  -10.508 76.883 1.00 61.63  ? 27  DC  C N3    1 
ATOM   2111 C C4    . DC  B 2 27  ? 34.090  -10.129 77.380 1.00 61.57  ? 27  DC  C C4    1 
ATOM   2112 N N4    . DC  B 2 27  ? 33.929  -8.844  77.734 1.00 62.75  ? 27  DC  C N4    1 
ATOM   2113 C C5    . DC  B 2 27  ? 33.019  -11.063 77.568 1.00 61.67  ? 27  DC  C C5    1 
ATOM   2114 C C6    . DC  B 2 27  ? 33.229  -12.338 77.199 1.00 61.57  ? 27  DC  C C6    1 
ATOM   2115 P P     . DT  B 2 28  ? 35.307  -18.254 78.095 1.00 80.16  ? 28  DT  C P     1 
ATOM   2116 O OP1   . DT  B 2 28  ? 35.729  -19.583 77.579 1.00 82.18  ? 28  DT  C OP1   1 
ATOM   2117 O OP2   . DT  B 2 28  ? 34.164  -18.159 79.037 1.00 83.83  ? 28  DT  C OP2   1 
ATOM   2118 O "O5'" . DT  B 2 28  ? 36.562  -17.508 78.780 1.00 78.04  ? 28  DT  C "O5'" 1 
ATOM   2119 C "C5'" . DT  B 2 28  ? 37.849  -17.626 78.180 1.00 77.21  ? 28  DT  C "C5'" 1 
ATOM   2120 C "C4'" . DT  B 2 28  ? 38.742  -16.451 78.501 1.00 77.73  ? 28  DT  C "C4'" 1 
ATOM   2121 O "O4'" . DT  B 2 28  ? 38.044  -15.217 78.252 1.00 74.98  ? 28  DT  C "O4'" 1 
ATOM   2122 C "C3'" . DT  B 2 28  ? 39.183  -16.347 79.953 1.00 81.27  ? 28  DT  C "C3'" 1 
ATOM   2123 O "O3'" . DT  B 2 28  ? 40.338  -17.142 80.172 1.00 84.14  ? 28  DT  C "O3'" 1 
ATOM   2124 C "C2'" . DT  B 2 28  ? 39.519  -14.867 80.080 1.00 82.24  ? 28  DT  C "C2'" 1 
ATOM   2125 C "C1'" . DT  B 2 28  ? 38.657  -14.202 79.015 1.00 77.47  ? 28  DT  C "C1'" 1 
ATOM   2126 N N1    . DT  B 2 28  ? 37.622  -13.237 79.546 1.00 76.74  ? 28  DT  C N1    1 
ATOM   2127 C C2    . DT  B 2 28  ? 37.959  -11.899 79.633 1.00 77.03  ? 28  DT  C C2    1 
ATOM   2128 O O2    . DT  B 2 28  ? 39.079  -11.471 79.381 1.00 79.16  ? 28  DT  C O2    1 
ATOM   2129 N N3    . DT  B 2 28  ? 36.926  -11.069 80.006 1.00 75.36  ? 28  DT  C N3    1 
ATOM   2130 C C4    . DT  B 2 28  ? 35.644  -11.430 80.386 1.00 73.80  ? 28  DT  C C4    1 
ATOM   2131 O O4    . DT  B 2 28  ? 34.836  -10.553 80.694 1.00 73.41  ? 28  DT  C O4    1 
ATOM   2132 C C5    . DT  B 2 28  ? 35.360  -12.852 80.336 1.00 74.19  ? 28  DT  C C5    1 
ATOM   2133 C C7    . DT  B 2 28  ? 33.985  -13.351 80.679 1.00 73.93  ? 28  DT  C C7    1 
ATOM   2134 C C6    . DT  B 2 28  ? 36.355  -13.688 79.933 1.00 75.35  ? 28  DT  C C6    1 
ATOM   2135 O "O5'" . DA  C 3 1   ? 40.157  -2.614  83.716 1.00 120.38 ? 1   DA  D "O5'" 1 
ATOM   2136 C "C5'" . DA  C 3 1   ? 40.571  -1.944  82.529 1.00 117.89 ? 1   DA  D "C5'" 1 
ATOM   2137 C "C4'" . DA  C 3 1   ? 41.586  -2.790  81.772 1.00 115.74 ? 1   DA  D "C4'" 1 
ATOM   2138 O "O4'" . DA  C 3 1   ? 41.040  -4.102  81.497 1.00 110.91 ? 1   DA  D "O4'" 1 
ATOM   2139 C "C3'" . DA  C 3 1   ? 42.048  -2.254  80.430 1.00 113.35 ? 1   DA  D "C3'" 1 
ATOM   2140 O "O3'" . DA  C 3 1   ? 43.418  -2.676  80.215 1.00 116.19 ? 1   DA  D "O3'" 1 
ATOM   2141 C "C2'" . DA  C 3 1   ? 41.063  -2.911  79.444 1.00 105.92 ? 1   DA  D "C2'" 1 
ATOM   2142 C "C1'" . DA  C 3 1   ? 40.788  -4.263  80.114 1.00 104.57 ? 1   DA  D "C1'" 1 
ATOM   2143 N N9    . DA  C 3 1   ? 39.417  -4.764  79.979 1.00 98.69  ? 1   DA  D N9    1 
ATOM   2144 C C8    . DA  C 3 1   ? 38.252  -4.038  80.023 1.00 96.89  ? 1   DA  D C8    1 
ATOM   2145 N N7    . DA  C 3 1   ? 37.163  -4.774  79.986 1.00 93.38  ? 1   DA  D N7    1 
ATOM   2146 C C5    . DA  C 3 1   ? 37.641  -6.072  79.972 1.00 92.32  ? 1   DA  D C5    1 
ATOM   2147 C C6    . DA  C 3 1   ? 36.995  -7.330  79.985 1.00 89.18  ? 1   DA  D C6    1 
ATOM   2148 N N6    . DA  C 3 1   ? 35.669  -7.479  79.983 1.00 86.72  ? 1   DA  D N6    1 
ATOM   2149 N N1    . DA  C 3 1   ? 37.774  -8.433  79.982 1.00 89.53  ? 1   DA  D N1    1 
ATOM   2150 C C2    . DA  C 3 1   ? 39.110  -8.294  79.994 1.00 92.07  ? 1   DA  D C2    1 
ATOM   2151 N N3    . DA  C 3 1   ? 39.831  -7.174  80.005 1.00 94.94  ? 1   DA  D N3    1 
ATOM   2152 C C4    . DA  C 3 1   ? 39.029  -6.085  80.015 1.00 95.42  ? 1   DA  D C4    1 
ATOM   2153 P P     . DG  C 3 2   ? 44.276  -2.177  78.942 1.00 115.87 ? 2   DG  D P     1 
ATOM   2154 O OP1   . DG  C 3 2   ? 45.693  -2.064  79.382 1.00 122.32 ? 2   DG  D OP1   1 
ATOM   2155 O OP2   . DG  C 3 2   ? 43.597  -1.010  78.327 1.00 113.25 ? 2   DG  D OP2   1 
ATOM   2156 O "O5'" . DG  C 3 2   ? 44.135  -3.413  77.922 1.00 110.18 ? 2   DG  D "O5'" 1 
ATOM   2157 C "C5'" . DG  C 3 2   ? 44.631  -4.705  78.299 1.00 110.43 ? 2   DG  D "C5'" 1 
ATOM   2158 C "C4'" . DG  C 3 2   ? 44.125  -5.790  77.374 1.00 103.32 ? 2   DG  D "C4'" 1 
ATOM   2159 O "O4'" . DG  C 3 2   ? 42.708  -5.977  77.547 1.00 98.74  ? 2   DG  D "O4'" 1 
ATOM   2160 C "C3'" . DG  C 3 2   ? 44.346  -5.552  75.873 1.00 99.50  ? 2   DG  D "C3'" 1 
ATOM   2161 O "O3'" . DG  C 3 2   ? 45.245  -6.556  75.392 1.00 100.74 ? 2   DG  D "O3'" 1 
ATOM   2162 C "C2'" . DG  C 3 2   ? 42.929  -5.674  75.257 1.00 92.52  ? 2   DG  D "C2'" 1 
ATOM   2163 C "C1'" . DG  C 3 2   ? 42.190  -6.453  76.332 1.00 92.30  ? 2   DG  D "C1'" 1 
ATOM   2164 N N9    . DG  C 3 2   ? 40.730  -6.299  76.349 1.00 87.77  ? 2   DG  D N9    1 
ATOM   2165 C C8    . DG  C 3 2   ? 40.015  -5.135  76.516 1.00 87.31  ? 2   DG  D C8    1 
ATOM   2166 N N7    . DG  C 3 2   ? 38.727  -5.320  76.626 1.00 84.32  ? 2   DG  D N7    1 
ATOM   2167 C C5    . DG  C 3 2   ? 38.576  -6.701  76.591 1.00 82.66  ? 2   DG  D C5    1 
ATOM   2168 C C6    . DG  C 3 2   ? 37.399  -7.503  76.676 1.00 79.65  ? 2   DG  D C6    1 
ATOM   2169 O O6    . DG  C 3 2   ? 36.232  -7.131  76.852 1.00 78.14  ? 2   DG  D O6    1 
ATOM   2170 N N1    . DG  C 3 2   ? 37.692  -8.877  76.606 1.00 79.33  ? 2   DG  D N1    1 
ATOM   2171 C C2    . DG  C 3 2   ? 38.956  -9.403  76.423 1.00 81.04  ? 2   DG  D C2    1 
ATOM   2172 N N2    . DG  C 3 2   ? 39.048  -10.739 76.368 1.00 80.20  ? 2   DG  D N2    1 
ATOM   2173 N N3    . DG  C 3 2   ? 40.062  -8.664  76.343 1.00 84.35  ? 2   DG  D N3    1 
ATOM   2174 C C4    . DG  C 3 2   ? 39.799  -7.321  76.427 1.00 84.85  ? 2   DG  D C4    1 
ATOM   2175 P P     . DC  C 3 3   ? 45.829  -6.553  73.891 1.00 99.89  ? 3   DC  D P     1 
ATOM   2176 O OP1   . DC  C 3 3   ? 47.224  -7.053  73.966 1.00 105.20 ? 3   DC  D OP1   1 
ATOM   2177 O OP2   . DC  C 3 3   ? 45.539  -5.244  73.246 1.00 98.31  ? 3   DC  D OP2   1 
ATOM   2178 O "O5'" . DC  C 3 3   ? 44.929  -7.655  73.171 1.00 94.14  ? 3   DC  D "O5'" 1 
ATOM   2179 C "C5'" . DC  C 3 3   ? 44.693  -8.913  73.818 1.00 94.11  ? 3   DC  D "C5'" 1 
ATOM   2180 C "C4'" . DC  C 3 3   ? 43.592  -9.688  73.118 1.00 87.85  ? 3   DC  D "C4'" 1 
ATOM   2181 O "O4'" . DC  C 3 3   ? 42.302  -9.232  73.568 1.00 84.38  ? 3   DC  D "O4'" 1 
ATOM   2182 C "C3'" . DC  C 3 3   ? 43.585  -9.578  71.601 1.00 85.08  ? 3   DC  D "C3'" 1 
ATOM   2183 O "O3'" . DC  C 3 3   ? 43.807  -10.856 71.063 1.00 85.82  ? 3   DC  D "O3'" 1 
ATOM   2184 C "C2'" . DC  C 3 3   ? 42.185  -9.030  71.263 1.00 79.84  ? 3   DC  D "C2'" 1 
ATOM   2185 C "C1'" . DC  C 3 3   ? 41.392  -9.359  72.525 1.00 79.49  ? 3   DC  D "C1'" 1 
ATOM   2186 N N1    . DC  C 3 3   ? 40.210  -8.436  72.796 1.00 76.53  ? 3   DC  D N1    1 
ATOM   2187 C C2    . DC  C 3 3   ? 38.906  -8.979  72.955 1.00 73.21  ? 3   DC  D C2    1 
ATOM   2188 O O2    . DC  C 3 3   ? 38.735  -10.206 72.880 1.00 71.97  ? 3   DC  D O2    1 
ATOM   2189 N N3    . DC  C 3 3   ? 37.865  -8.127  73.188 1.00 71.61  ? 3   DC  D N3    1 
ATOM   2190 C C4    . DC  C 3 3   ? 38.084  -6.804  73.302 1.00 72.14  ? 3   DC  D C4    1 
ATOM   2191 N N4    . DC  C 3 3   ? 37.042  -6.024  73.604 1.00 71.12  ? 3   DC  D N4    1 
ATOM   2192 C C5    . DC  C 3 3   ? 39.390  -6.234  73.147 1.00 75.03  ? 3   DC  D C5    1 
ATOM   2193 C C6    . DC  C 3 3   ? 40.411  -7.073  72.896 1.00 76.74  ? 3   DC  D C6    1 
ATOM   2194 P P     . DT  C 3 4   ? 44.125  -11.076 69.506 1.00 85.35  ? 4   DT  D P     1 
ATOM   2195 O OP1   . DT  C 3 4   ? 45.079  -12.215 69.431 1.00 89.37  ? 4   DT  D OP1   1 
ATOM   2196 O OP2   . DT  C 3 4   ? 44.453  -9.775  68.866 1.00 84.46  ? 4   DT  D OP2   1 
ATOM   2197 O "O5'" . DT  C 3 4   ? 42.716  -11.535 68.918 1.00 79.57  ? 4   DT  D "O5'" 1 
ATOM   2198 C "C5'" . DT  C 3 4   ? 41.918  -12.501 69.613 1.00 78.35  ? 4   DT  D "C5'" 1 
ATOM   2199 C "C4'" . DT  C 3 4   ? 40.517  -12.529 69.043 1.00 73.12  ? 4   DT  D "C4'" 1 
ATOM   2200 O "O4'" . DT  C 3 4   ? 39.714  -11.501 69.687 1.00 71.26  ? 4   DT  D "O4'" 1 
ATOM   2201 C "C3'" . DT  C 3 4   ? 40.448  -12.243 67.531 1.00 71.00  ? 4   DT  D "C3'" 1 
ATOM   2202 O "O3'" . DT  C 3 4   ? 39.706  -13.222 66.879 1.00 70.97  ? 4   DT  D "O3'" 1 
ATOM   2203 C "C2'" . DT  C 3 4   ? 39.771  -10.882 67.448 1.00 67.67  ? 4   DT  D "C2'" 1 
ATOM   2204 C "C1'" . DT  C 3 4   ? 38.913  -10.897 68.699 1.00 67.38  ? 4   DT  D "C1'" 1 
ATOM   2205 N N1    . DT  C 3 4   ? 38.478  -9.534  69.149 1.00 66.43  ? 4   DT  D N1    1 
ATOM   2206 C C2    . DT  C 3 4   ? 37.155  -9.333  69.500 1.00 64.26  ? 4   DT  D C2    1 
ATOM   2207 O O2    . DT  C 3 4   ? 36.334  -10.239 69.578 1.00 62.95  ? 4   DT  D O2    1 
ATOM   2208 N N3    . DT  C 3 4   ? 36.845  -8.038  69.846 1.00 64.43  ? 4   DT  D N3    1 
ATOM   2209 C C4    . DT  C 3 4   ? 37.673  -6.928  69.777 1.00 66.20  ? 4   DT  D C4    1 
ATOM   2210 O O4    . DT  C 3 4   ? 37.223  -5.828  70.067 1.00 67.44  ? 4   DT  D O4    1 
ATOM   2211 C C5    . DT  C 3 4   ? 39.035  -7.192  69.345 1.00 67.83  ? 4   DT  D C5    1 
ATOM   2212 C C7    . DT  C 3 4   ? 40.038  -6.077  69.249 1.00 70.39  ? 4   DT  D C7    1 
ATOM   2213 C C6    . DT  C 3 4   ? 39.369  -8.466  69.062 1.00 68.17  ? 4   DT  D C6    1 
ATOM   2214 P P     . DG  C 3 5   ? 40.007  -13.598 65.335 1.00 72.09  ? 5   DG  D P     1 
ATOM   2215 O OP1   . DG  C 3 5   ? 40.903  -14.782 65.357 1.00 74.84  ? 5   DG  D OP1   1 
ATOM   2216 O OP2   . DG  C 3 5   ? 40.396  -12.368 64.584 1.00 70.80  ? 5   DG  D OP2   1 
ATOM   2217 O "O5'" . DG  C 3 5   ? 38.565  -14.040 64.789 1.00 67.04  ? 5   DG  D "O5'" 1 
ATOM   2218 C "C5'" . DG  C 3 5   ? 37.653  -14.734 65.658 1.00 64.42  ? 5   DG  D "C5'" 1 
ATOM   2219 C "C4'" . DG  C 3 5   ? 36.249  -14.195 65.484 1.00 58.75  ? 5   DG  D "C4'" 1 
ATOM   2220 O "O4'" . DG  C 3 5   ? 36.098  -12.967 66.238 1.00 57.45  ? 5   DG  D "O4'" 1 
ATOM   2221 C "C3'" . DG  C 3 5   ? 35.871  -13.882 64.045 1.00 54.69  ? 5   DG  D "C3'" 1 
ATOM   2222 O "O3'" . DG  C 3 5   ? 34.786  -14.672 63.652 1.00 51.42  ? 5   DG  D "O3'" 1 
ATOM   2223 C "C2'" . DG  C 3 5   ? 35.534  -12.405 64.039 1.00 53.86  ? 5   DG  D "C2'" 1 
ATOM   2224 C "C1'" . DG  C 3 5   ? 35.330  -12.049 65.495 1.00 55.30  ? 5   DG  D "C1'" 1 
ATOM   2225 N N9    . DG  C 3 5   ? 35.798  -10.679 65.797 1.00 54.99  ? 5   DG  D N9    1 
ATOM   2226 C C8    . DG  C 3 5   ? 37.081  -10.188 65.633 1.00 55.46  ? 5   DG  D C8    1 
ATOM   2227 N N7    . DG  C 3 5   ? 37.204  -8.928  65.941 1.00 54.48  ? 5   DG  D N7    1 
ATOM   2228 C C5    . DG  C 3 5   ? 35.916  -8.533  66.287 1.00 51.74  ? 5   DG  D C5    1 
ATOM   2229 C C6    . DG  C 3 5   ? 35.447  -7.291  66.767 1.00 49.68  ? 5   DG  D C6    1 
ATOM   2230 O O6    . DG  C 3 5   ? 36.095  -6.262  66.973 1.00 52.96  ? 5   DG  D O6    1 
ATOM   2231 N N1    . DG  C 3 5   ? 34.083  -7.323  67.053 1.00 47.06  ? 5   DG  D N1    1 
ATOM   2232 C C2    . DG  C 3 5   ? 33.283  -8.434  66.936 1.00 47.57  ? 5   DG  D C2    1 
ATOM   2233 N N2    . DG  C 3 5   ? 31.999  -8.281  67.274 1.00 48.30  ? 5   DG  D N2    1 
ATOM   2234 N N3    . DG  C 3 5   ? 33.708  -9.612  66.504 1.00 48.63  ? 5   DG  D N3    1 
ATOM   2235 C C4    . DG  C 3 5   ? 35.031  -9.592  66.185 1.00 51.86  ? 5   DG  D C4    1 
ATOM   2236 P P     . DT  C 3 6   ? 34.093  -14.532 62.214 1.00 46.26  ? 6   DT  D P     1 
ATOM   2237 O OP1   . DT  C 3 6   ? 33.678  -15.884 61.773 1.00 46.87  ? 6   DT  D OP1   1 
ATOM   2238 O OP2   . DT  C 3 6   ? 34.945  -13.710 61.315 1.00 48.30  ? 6   DT  D OP2   1 
ATOM   2239 O "O5'" . DT  C 3 6   ? 32.804  -13.672 62.553 1.00 41.91  ? 6   DT  D "O5'" 1 
ATOM   2240 C "C5'" . DT  C 3 6   ? 31.874  -14.123 63.517 1.00 41.17  ? 6   DT  D "C5'" 1 
ATOM   2241 C "C4'" . DT  C 3 6   ? 30.675  -13.203 63.587 1.00 39.11  ? 6   DT  D "C4'" 1 
ATOM   2242 O "O4'" . DT  C 3 6   ? 31.093  -11.934 64.104 1.00 41.44  ? 6   DT  D "O4'" 1 
ATOM   2243 C "C3'" . DT  C 3 6   ? 29.950  -12.923 62.255 1.00 39.40  ? 6   DT  D "C3'" 1 
ATOM   2244 O "O3'" . DT  C 3 6   ? 28.566  -12.977 62.506 1.00 39.35  ? 6   DT  D "O3'" 1 
ATOM   2245 C "C2'" . DT  C 3 6   ? 30.411  -11.505 61.882 1.00 39.41  ? 6   DT  D "C2'" 1 
ATOM   2246 C "C1'" . DT  C 3 6   ? 30.675  -10.875 63.247 1.00 40.71  ? 6   DT  D "C1'" 1 
ATOM   2247 N N1    . DT  C 3 6   ? 31.769  -9.834  63.235 1.00 42.40  ? 6   DT  D N1    1 
ATOM   2248 C C2    . DT  C 3 6   ? 31.542  -8.556  63.766 1.00 43.17  ? 6   DT  D C2    1 
ATOM   2249 O O2    . DT  C 3 6   ? 30.456  -8.157  64.183 1.00 44.08  ? 6   DT  D O2    1 
ATOM   2250 N N3    . DT  C 3 6   ? 32.650  -7.743  63.769 1.00 42.63  ? 6   DT  D N3    1 
ATOM   2251 C C4    . DT  C 3 6   ? 33.914  -8.024  63.254 1.00 42.75  ? 6   DT  D C4    1 
ATOM   2252 O O4    . DT  C 3 6   ? 34.816  -7.204  63.396 1.00 43.94  ? 6   DT  D O4    1 
ATOM   2253 C C5    . DT  C 3 6   ? 34.087  -9.358  62.726 1.00 43.73  ? 6   DT  D C5    1 
ATOM   2254 C C7    . DT  C 3 6   ? 35.408  -9.768  62.147 1.00 45.08  ? 6   DT  D C7    1 
ATOM   2255 C C6    . DT  C 3 6   ? 33.019  -10.182 62.721 1.00 43.45  ? 6   DT  D C6    1 
ATOM   2256 P P     . DC  C 3 7   ? 27.463  -12.919 61.374 1.00 40.23  ? 7   DC  D P     1 
ATOM   2257 O OP1   . DC  C 3 7   ? 26.292  -13.684 61.923 1.00 39.79  ? 7   DC  D OP1   1 
ATOM   2258 O OP2   . DC  C 3 7   ? 28.073  -13.279 60.070 1.00 40.90  ? 7   DC  D OP2   1 
ATOM   2259 O "O5'" . DC  C 3 7   ? 27.107  -11.379 61.327 1.00 39.92  ? 7   DC  D "O5'" 1 
ATOM   2260 C "C5'" . DC  C 3 7   ? 26.633  -10.759 62.512 1.00 42.81  ? 7   DC  D "C5'" 1 
ATOM   2261 C "C4'" . DC  C 3 7   ? 26.455  -9.276  62.314 1.00 44.88  ? 7   DC  D "C4'" 1 
ATOM   2262 O "O4'" . DC  C 3 7   ? 27.737  -8.636  62.310 1.00 44.54  ? 7   DC  D "O4'" 1 
ATOM   2263 C "C3'" . DC  C 3 7   ? 25.743  -8.856  61.043 1.00 46.19  ? 7   DC  D "C3'" 1 
ATOM   2264 O "O3'" . DC  C 3 7   ? 24.687  -8.008  61.410 1.00 50.02  ? 7   DC  D "O3'" 1 
ATOM   2265 C "C2'" . DC  C 3 7   ? 26.829  -8.132  60.226 1.00 43.72  ? 7   DC  D "C2'" 1 
ATOM   2266 C "C1'" . DC  C 3 7   ? 27.772  -7.653  61.331 1.00 43.97  ? 7   DC  D "C1'" 1 
ATOM   2267 N N1    . DC  C 3 7   ? 29.217  -7.489  60.941 1.00 42.76  ? 7   DC  D N1    1 
ATOM   2268 C C2    . DC  C 3 7   ? 29.911  -6.344  61.366 1.00 42.47  ? 7   DC  D C2    1 
ATOM   2269 O O2    . DC  C 3 7   ? 29.324  -5.511  62.065 1.00 44.73  ? 7   DC  D O2    1 
ATOM   2270 N N3    . DC  C 3 7   ? 31.239  -6.237  61.085 1.00 42.08  ? 7   DC  D N3    1 
ATOM   2271 C C4    . DC  C 3 7   ? 31.870  -7.213  60.422 1.00 42.73  ? 7   DC  D C4    1 
ATOM   2272 N N4    . DC  C 3 7   ? 33.177  -7.045  60.155 1.00 44.50  ? 7   DC  D N4    1 
ATOM   2273 C C5    . DC  C 3 7   ? 31.187  -8.395  59.983 1.00 41.75  ? 7   DC  D C5    1 
ATOM   2274 C C6    . DC  C 3 7   ? 29.883  -8.506  60.294 1.00 41.55  ? 7   DC  D C6    1 
ATOM   2275 P P     . DC  C 3 8   ? 23.510  -7.632  60.395 1.00 54.25  ? 8   DC  D P     1 
ATOM   2276 O OP1   . DC  C 3 8   ? 22.268  -7.511  61.205 1.00 58.32  ? 8   DC  D OP1   1 
ATOM   2277 O OP2   . DC  C 3 8   ? 23.553  -8.523  59.207 1.00 53.19  ? 8   DC  D OP2   1 
ATOM   2278 O "O5'" . DC  C 3 8   ? 23.939  -6.170  59.904 1.00 53.15  ? 8   DC  D "O5'" 1 
ATOM   2279 C "C5'" . DC  C 3 8   ? 24.212  -5.145  60.860 1.00 52.69  ? 8   DC  D "C5'" 1 
ATOM   2280 C "C4'" . DC  C 3 8   ? 24.917  -3.993  60.201 1.00 52.83  ? 8   DC  D "C4'" 1 
ATOM   2281 O "O4'" . DC  C 3 8   ? 26.330  -4.295  60.025 1.00 50.72  ? 8   DC  D "O4'" 1 
ATOM   2282 C "C3'" . DC  C 3 8   ? 24.391  -3.623  58.812 1.00 54.06  ? 8   DC  D "C3'" 1 
ATOM   2283 O "O3'" . DC  C 3 8   ? 24.395  -2.245  58.708 1.00 57.72  ? 8   DC  D "O3'" 1 
ATOM   2284 C "C2'" . DC  C 3 8   ? 25.448  -4.230  57.884 1.00 50.69  ? 8   DC  D "C2'" 1 
ATOM   2285 C "C1'" . DC  C 3 8   ? 26.696  -3.962  58.710 1.00 48.69  ? 8   DC  D "C1'" 1 
ATOM   2286 N N1    . DC  C 3 8   ? 27.922  -4.742  58.297 1.00 45.95  ? 8   DC  D N1    1 
ATOM   2287 C C2    . DC  C 3 8   ? 29.199  -4.159  58.427 1.00 44.22  ? 8   DC  D C2    1 
ATOM   2288 O O2    . DC  C 3 8   ? 29.305  -3.029  58.904 1.00 45.12  ? 8   DC  D O2    1 
ATOM   2289 N N3    . DC  C 3 8   ? 30.288  -4.853  57.989 1.00 42.45  ? 8   DC  D N3    1 
ATOM   2290 C C4    . DC  C 3 8   ? 30.154  -6.056  57.474 1.00 43.13  ? 8   DC  D C4    1 
ATOM   2291 N N4    . DC  C 3 8   ? 31.270  -6.704  57.101 1.00 44.01  ? 8   DC  D N4    1 
ATOM   2292 C C5    . DC  C 3 8   ? 28.869  -6.669  57.316 1.00 44.62  ? 8   DC  D C5    1 
ATOM   2293 C C6    . DC  C 3 8   ? 27.791  -5.972  57.718 1.00 45.29  ? 8   DC  D C6    1 
ATOM   2294 P P     . DA  C 3 9   ? 23.097  -1.408  58.306 1.00 59.60  ? 9   DA  D P     1 
ATOM   2295 O OP1   . DA  C 3 9   ? 22.103  -1.515  59.396 1.00 62.76  ? 9   DA  D OP1   1 
ATOM   2296 O OP2   . DA  C 3 9   ? 22.725  -1.769  56.913 1.00 60.16  ? 9   DA  D OP2   1 
ATOM   2297 O "O5'" . DA  C 3 9   ? 23.692  0.065   58.310 1.00 59.01  ? 9   DA  D "O5'" 1 
ATOM   2298 C "C5'" . DA  C 3 9   ? 24.549  0.491   59.388 1.00 57.09  ? 9   DA  D "C5'" 1 
ATOM   2299 C "C4'" . DA  C 3 9   ? 25.690  1.360   58.869 1.00 54.06  ? 9   DA  D "C4'" 1 
ATOM   2300 O "O4'" . DA  C 3 9   ? 26.800  0.530   58.428 1.00 50.20  ? 9   DA  D "O4'" 1 
ATOM   2301 C "C3'" . DA  C 3 9   ? 25.338  2.276   57.701 1.00 52.53  ? 9   DA  D "C3'" 1 
ATOM   2302 O "O3'" . DA  C 3 9   ? 25.805  3.588   58.001 1.00 54.78  ? 9   DA  D "O3'" 1 
ATOM   2303 C "C2'" . DA  C 3 9   ? 26.044  1.644   56.484 1.00 48.46  ? 9   DA  D "C2'" 1 
ATOM   2304 C "C1'" . DA  C 3 9   ? 27.222  0.924   57.123 1.00 47.39  ? 9   DA  D "C1'" 1 
ATOM   2305 N N9    . DA  C 3 9   ? 27.657  -0.286  56.418 1.00 42.66  ? 9   DA  D N9    1 
ATOM   2306 C C8    . DA  C 3 9   ? 26.880  -1.370  56.080 1.00 42.25  ? 9   DA  D C8    1 
ATOM   2307 N N7    . DA  C 3 9   ? 27.552  -2.372  55.563 1.00 40.23  ? 9   DA  D N7    1 
ATOM   2308 C C5    . DA  C 3 9   ? 28.870  -1.966  55.662 1.00 38.81  ? 9   DA  D C5    1 
ATOM   2309 C C6    . DA  C 3 9   ? 30.086  -2.590  55.304 1.00 36.97  ? 9   DA  D C6    1 
ATOM   2310 N N6    . DA  C 3 9   ? 30.153  -3.807  54.763 1.00 37.33  ? 9   DA  D N6    1 
ATOM   2311 N N1    . DA  C 3 9   ? 31.224  -1.889  55.466 1.00 37.47  ? 9   DA  D N1    1 
ATOM   2312 C C2    . DA  C 3 9   ? 31.162  -0.643  55.971 1.00 38.93  ? 9   DA  D C2    1 
ATOM   2313 N N3    . DA  C 3 9   ? 30.079  0.058   56.327 1.00 40.85  ? 9   DA  D N3    1 
ATOM   2314 C C4    . DA  C 3 9   ? 28.954  -0.673  56.164 1.00 40.50  ? 9   DA  D C4    1 
ATOM   2315 P P     . DT  C 3 10  ? 25.499  4.850   57.064 1.00 55.34  ? 10  DT  D P     1 
ATOM   2316 O OP1   . DT  C 3 10  ? 25.601  6.043   57.920 1.00 58.64  ? 10  DT  D OP1   1 
ATOM   2317 O OP2   . DT  C 3 10  ? 24.271  4.606   56.265 1.00 55.60  ? 10  DT  D OP2   1 
ATOM   2318 O "O5'" . DT  C 3 10  ? 26.741  4.827   56.046 1.00 50.60  ? 10  DT  D "O5'" 1 
ATOM   2319 C "C5'" . DT  C 3 10  ? 28.058  4.942   56.536 1.00 48.69  ? 10  DT  D "C5'" 1 
ATOM   2320 C "C4'" . DT  C 3 10  ? 29.055  4.629   55.458 1.00 47.74  ? 10  DT  D "C4'" 1 
ATOM   2321 O "O4'" . DT  C 3 10  ? 29.041  3.212   55.175 1.00 45.53  ? 10  DT  D "O4'" 1 
ATOM   2322 C "C3'" . DT  C 3 10  ? 28.815  5.304   54.116 1.00 49.71  ? 10  DT  D "C3'" 1 
ATOM   2323 O "O3'" . DT  C 3 10  ? 29.696  6.439   54.006 1.00 53.55  ? 10  DT  D "O3'" 1 
ATOM   2324 C "C2'" . DT  C 3 10  ? 29.113  4.191   53.080 1.00 46.85  ? 10  DT  D "C2'" 1 
ATOM   2325 C "C1'" . DT  C 3 10  ? 29.643  3.043   53.936 1.00 44.38  ? 10  DT  D "C1'" 1 
ATOM   2326 N N1    . DT  C 3 10  ? 29.311  1.657   53.413 1.00 41.96  ? 10  DT  D N1    1 
ATOM   2327 C C2    . DT  C 3 10  ? 30.344  0.831   53.054 1.00 40.36  ? 10  DT  D C2    1 
ATOM   2328 O O2    . DT  C 3 10  ? 31.518  1.160   53.131 1.00 40.63  ? 10  DT  D O2    1 
ATOM   2329 N N3    . DT  C 3 10  ? 29.956  -0.416  52.623 1.00 39.41  ? 10  DT  D N3    1 
ATOM   2330 C C4    . DT  C 3 10  ? 28.662  -0.900  52.504 1.00 39.40  ? 10  DT  D C4    1 
ATOM   2331 O O4    . DT  C 3 10  ? 28.492  -2.031  52.102 1.00 39.74  ? 10  DT  D O4    1 
ATOM   2332 C C5    . DT  C 3 10  ? 27.611  0.041   52.847 1.00 42.15  ? 10  DT  D C5    1 
ATOM   2333 C C7    . DT  C 3 10  ? 26.156  -0.336  52.695 1.00 43.70  ? 10  DT  D C7    1 
ATOM   2334 C C6    . DT  C 3 10  ? 27.983  1.253   53.299 1.00 42.11  ? 10  DT  D C6    1 
ATOM   2335 P P     A DC  C 3 11  ? 29.607  7.438   52.743 0.50 55.20  ? 11  DC  D P     1 
ATOM   2336 P P     B DC  C 3 11  ? 29.915  7.266   52.653 0.50 56.30  ? 11  DC  D P     1 
ATOM   2337 O OP1   A DC  C 3 11  ? 29.890  8.801   53.220 0.50 59.72  ? 11  DC  D OP1   1 
ATOM   2338 O OP1   B DC  C 3 11  ? 30.161  8.656   53.049 0.50 60.08  ? 11  DC  D OP1   1 
ATOM   2339 O OP2   A DC  C 3 11  ? 28.350  7.169   51.997 0.50 53.14  ? 11  DC  D OP2   1 
ATOM   2340 O OP2   B DC  C 3 11  ? 28.816  6.967   51.698 0.50 54.50  ? 11  DC  D OP2   1 
ATOM   2341 O "O5'" A DC  C 3 11  ? 30.828  6.959   51.826 0.50 53.97  ? 11  DC  D "O5'" 1 
ATOM   2342 O "O5'" B DC  C 3 11  ? 31.290  6.631   52.085 0.50 56.04  ? 11  DC  D "O5'" 1 
ATOM   2343 C "C5'" A DC  C 3 11  ? 32.110  6.693   52.411 0.50 53.58  ? 11  DC  D "C5'" 1 
ATOM   2344 C "C5'" B DC  C 3 11  ? 32.458  6.574   52.942 0.50 57.23  ? 11  DC  D "C5'" 1 
ATOM   2345 C "C4'" A DC  C 3 11  ? 32.962  5.865   51.473 0.50 51.58  ? 11  DC  D "C4'" 1 
ATOM   2346 C "C4'" B DC  C 3 11  ? 33.553  5.667   52.382 0.50 56.30  ? 11  DC  D "C4'" 1 
ATOM   2347 O "O4'" A DC  C 3 11  ? 32.465  4.512   51.450 0.50 48.43  ? 11  DC  D "O4'" 1 
ATOM   2348 O "O4'" B DC  C 3 11  ? 33.031  4.346   52.094 0.50 53.16  ? 11  DC  D "O4'" 1 
ATOM   2349 C "C3'" A DC  C 3 11  ? 32.952  6.349   50.032 0.50 52.04  ? 11  DC  D "C3'" 1 
ATOM   2350 C "C3'" B DC  C 3 11  ? 34.248  6.153   51.104 0.50 58.09  ? 11  DC  D "C3'" 1 
ATOM   2351 O "O3'" A DC  C 3 11  ? 34.164  7.024   49.735 0.50 54.88  ? 11  DC  D "O3'" 1 
ATOM   2352 O "O3'" B DC  C 3 11  ? 35.674  5.993   51.250 0.50 60.20  ? 11  DC  D "O3'" 1 
ATOM   2353 C "C2'" A DC  C 3 11  ? 32.766  5.097   49.176 0.50 49.40  ? 11  DC  D "C2'" 1 
ATOM   2354 C "C2'" B DC  C 3 11  ? 33.672  5.237   50.014 0.50 55.77  ? 11  DC  D "C2'" 1 
ATOM   2355 C "C1'" A DC  C 3 11  ? 32.673  3.949   50.168 0.50 47.01  ? 11  DC  D "C1'" 1 
ATOM   2356 C "C1'" B DC  C 3 11  ? 33.433  3.946   50.793 0.50 53.22  ? 11  DC  D "C1'" 1 
ATOM   2357 N N1    A DC  C 3 11  ? 31.543  2.981   49.884 0.50 43.86  ? 11  DC  D N1    1 
ATOM   2358 N N1    B DC  C 3 11  ? 32.354  3.052   50.219 0.50 51.26  ? 11  DC  D N1    1 
ATOM   2359 C C2    A DC  C 3 11  ? 31.828  1.622   49.624 0.50 41.09  ? 11  DC  D C2    1 
ATOM   2360 C C2    B DC  C 3 11  ? 32.691  1.830   49.584 0.50 49.41  ? 11  DC  D C2    1 
ATOM   2361 O O2    A DC  C 3 11  ? 33.007  1.243   49.552 0.50 41.46  ? 11  DC  D O2    1 
ATOM   2362 O O2    B DC  C 3 11  ? 33.884  1.526   49.416 0.50 49.54  ? 11  DC  D O2    1 
ATOM   2363 N N3    A DC  C 3 11  ? 30.794  0.751   49.507 0.50 38.69  ? 11  DC  D N3    1 
ATOM   2364 N N3    B DC  C 3 11  ? 31.683  1.018   49.163 0.50 47.82  ? 11  DC  D N3    1 
ATOM   2365 C C4    A DC  C 3 11  ? 29.534  1.179   49.598 0.50 38.84  ? 11  DC  D C4    1 
ATOM   2366 C C4    B DC  C 3 11  ? 30.406  1.344   49.399 0.50 47.99  ? 11  DC  D C4    1 
ATOM   2367 N N4    A DC  C 3 11  ? 28.571  0.283   49.448 0.50 37.31  ? 11  DC  D N4    1 
ATOM   2368 N N4    B DC  C 3 11  ? 29.460  0.503   48.985 0.50 47.15  ? 11  DC  D N4    1 
ATOM   2369 C C5    A DC  C 3 11  ? 29.211  2.554   49.836 0.50 41.35  ? 11  DC  D C5    1 
ATOM   2370 C C5    B DC  C 3 11  ? 30.042  2.576   50.012 0.50 50.14  ? 11  DC  D C5    1 
ATOM   2371 C C6    A DC  C 3 11  ? 30.234  3.415   49.961 0.50 43.35  ? 11  DC  D C6    1 
ATOM   2372 C C6    B DC  C 3 11  ? 31.033  3.382   50.417 0.50 51.62  ? 11  DC  D C6    1 
ATOM   2373 P P     A DG  C 3 12  ? 34.300  7.902   48.403 0.60 57.77  ? 12  DG  D P     1 
ATOM   2374 P P     B DG  C 3 12  ? 36.706  6.799   50.323 0.40 64.45  ? 12  DG  D P     1 
ATOM   2375 O OP1   A DG  C 3 12  ? 35.308  8.955   48.650 0.60 61.35  ? 12  DG  D OP1   1 
ATOM   2376 O OP1   B DG  C 3 12  ? 37.985  6.909   51.062 0.40 66.80  ? 12  DG  D OP1   1 
ATOM   2377 O OP2   A DG  C 3 12  ? 32.945  8.265   47.920 0.60 56.17  ? 12  DG  D OP2   1 
ATOM   2378 O OP2   B DG  C 3 12  ? 36.036  8.031   49.829 0.40 65.54  ? 12  DG  D OP2   1 
ATOM   2379 O "O5'" A DG  C 3 12  ? 34.914  6.851   47.368 0.60 59.28  ? 12  DG  D "O5'" 1 
ATOM   2380 O "O5'" B DG  C 3 12  ? 36.907  5.795   49.087 0.40 64.20  ? 12  DG  D "O5'" 1 
ATOM   2381 C "C5'" A DG  C 3 12  ? 36.106  6.125   47.704 0.60 61.05  ? 12  DG  D "C5'" 1 
ATOM   2382 C "C5'" B DG  C 3 12  ? 36.645  6.239   47.765 0.40 66.02  ? 12  DG  D "C5'" 1 
ATOM   2383 C "C4'" A DG  C 3 12  ? 36.351  4.997   46.717 0.60 61.34  ? 12  DG  D "C4'" 1 
ATOM   2384 C "C4'" B DG  C 3 12  ? 36.532  5.073   46.801 0.40 65.06  ? 12  DG  D "C4'" 1 
ATOM   2385 O "O4'" A DG  C 3 12  ? 35.323  3.974   46.853 0.60 57.88  ? 12  DG  D "O4'" 1 
ATOM   2386 O "O4'" B DG  C 3 12  ? 35.328  4.303   47.080 0.40 61.99  ? 12  DG  D "O4'" 1 
ATOM   2387 C "C3'" A DG  C 3 12  ? 36.348  5.414   45.255 0.60 64.85  ? 12  DG  D "C3'" 1 
ATOM   2388 C "C3'" B DG  C 3 12  ? 36.451  5.481   45.332 0.40 67.47  ? 12  DG  D "C3'" 1 
ATOM   2389 O "O3'" A DG  C 3 12  ? 37.408  4.753   44.569 0.60 68.82  ? 12  DG  D "O3'" 1 
ATOM   2390 O "O3'" B DG  C 3 12  ? 37.411  4.748   44.575 0.40 69.89  ? 12  DG  D "O3'" 1 
ATOM   2391 C "C2'" A DG  C 3 12  ? 34.965  4.978   44.760 0.60 61.31  ? 12  DG  D "C2'" 1 
ATOM   2392 C "C2'" B DG  C 3 12  ? 35.012  5.143   44.928 0.40 64.59  ? 12  DG  D "C2'" 1 
ATOM   2393 C "C1'" A DG  C 3 12  ? 34.724  3.732   45.593 0.60 56.84  ? 12  DG  D "C1'" 1 
ATOM   2394 C "C1'" B DG  C 3 12  ? 34.690  3.991   45.862 0.40 60.87  ? 12  DG  D "C1'" 1 
ATOM   2395 N N9    A DG  C 3 12  ? 33.312  3.401   45.805 0.60 52.50  ? 12  DG  D N9    1 
ATOM   2396 N N9    B DG  C 3 12  ? 33.256  3.800   46.106 0.40 57.53  ? 12  DG  D N9    1 
ATOM   2397 C C8    A DG  C 3 12  ? 32.323  4.222   46.295 0.60 51.81  ? 12  DG  D C8    1 
ATOM   2398 C C8    B DG  C 3 12  ? 32.351  4.740   46.550 0.40 57.43  ? 12  DG  D C8    1 
ATOM   2399 N N7    A DG  C 3 12  ? 31.183  3.619   46.474 0.60 49.50  ? 12  DG  D N7    1 
ATOM   2400 N N7    B DG  C 3 12  ? 31.138  4.278   46.675 0.40 55.54  ? 12  DG  D N7    1 
ATOM   2401 C C5    A DG  C 3 12  ? 31.419  2.321   46.047 0.60 47.47  ? 12  DG  D C5    1 
ATOM   2402 C C5    B DG  C 3 12  ? 31.240  2.942   46.304 0.40 53.62  ? 12  DG  D C5    1 
ATOM   2403 C C6    A DG  C 3 12  ? 30.535  1.208   45.952 0.60 44.93  ? 12  DG  D C6    1 
ATOM   2404 C C6    B DG  C 3 12  ? 30.234  1.936   46.198 0.40 51.76  ? 12  DG  D C6    1 
ATOM   2405 O O6    A DG  C 3 12  ? 29.338  1.141   46.289 0.60 43.01  ? 12  DG  D O6    1 
ATOM   2406 O O6    B DG  C 3 12  ? 29.039  2.007   46.523 0.40 50.91  ? 12  DG  D O6    1 
ATOM   2407 N N1    A DG  C 3 12  ? 31.171  0.095   45.390 0.60 44.68  ? 12  DG  D N1    1 
ATOM   2408 N N1    B DG  C 3 12  ? 30.763  0.716   45.755 0.40 51.08  ? 12  DG  D N1    1 
ATOM   2409 C C2    A DG  C 3 12  ? 32.500  0.046   45.024 0.60 46.52  ? 12  DG  D C2    1 
ATOM   2410 C C2    B DG  C 3 12  ? 32.082  0.515   45.407 0.40 51.91  ? 12  DG  D C2    1 
ATOM   2411 N N2    A DG  C 3 12  ? 32.950  -1.123  44.535 0.60 46.87  ? 12  DG  D N2    1 
ATOM   2412 N N2    B DG  C 3 12  ? 32.406  -0.710  44.983 0.40 52.05  ? 12  DG  D N2    1 
ATOM   2413 N N3    A DG  C 3 12  ? 33.329  1.078   45.108 0.60 48.11  ? 12  DG  D N3    1 
ATOM   2414 N N3    B DG  C 3 12  ? 33.022  1.455   45.471 0.40 53.36  ? 12  DG  D N3    1 
ATOM   2415 C C4    A DG  C 3 12  ? 32.723  2.179   45.618 0.60 48.95  ? 12  DG  D C4    1 
ATOM   2416 C C4    B DG  C 3 12  ? 32.534  2.639   45.928 0.40 54.46  ? 12  DG  D C4    1 
ATOM   2417 P P     . DC  C 3 13  ? 37.869  5.245   43.121 1.00 73.79  ? 13  DC  D P     1 
ATOM   2418 O OP1   . DC  C 3 13  ? 39.320  4.943   42.985 1.00 77.46  ? 13  DC  D OP1   1 
ATOM   2419 O OP2   . DC  C 3 13  ? 37.381  6.631   42.913 1.00 75.84  ? 13  DC  D OP2   1 
ATOM   2420 O "O5'" . DC  C 3 13  ? 37.046  4.276   42.150 1.00 72.10  ? 13  DC  D "O5'" 1 
ATOM   2421 C "C5'" . DC  C 3 13  ? 37.307  2.864   42.194 1.00 71.00  ? 13  DC  D "C5'" 1 
ATOM   2422 C "C4'" . DC  C 3 13  ? 36.153  2.068   41.620 1.00 69.78  ? 13  DC  D "C4'" 1 
ATOM   2423 O "O4'" . DC  C 3 13  ? 34.973  2.294   42.400 1.00 67.36  ? 13  DC  D "O4'" 1 
ATOM   2424 C "C3'" . DC  C 3 13  ? 35.760  2.420   40.189 1.00 71.77  ? 13  DC  D "C3'" 1 
ATOM   2425 O "O3'" . DC  C 3 13  ? 36.373  1.496   39.296 1.00 74.56  ? 13  DC  D "O3'" 1 
ATOM   2426 C "C2'" . DC  C 3 13  ? 34.228  2.292   40.178 1.00 69.36  ? 13  DC  D "C2'" 1 
ATOM   2427 C "C1'" . DC  C 3 13  ? 33.873  1.925   41.612 1.00 65.90  ? 13  DC  D "C1'" 1 
ATOM   2428 N N1    . DC  C 3 13  ? 32.626  2.608   42.147 1.00 62.92  ? 13  DC  D N1    1 
ATOM   2429 C C2    . DC  C 3 13  ? 31.450  1.860   42.323 1.00 59.84  ? 13  DC  D C2    1 
ATOM   2430 O O2    . DC  C 3 13  ? 31.452  0.655   42.025 1.00 58.92  ? 13  DC  D O2    1 
ATOM   2431 N N3    . DC  C 3 13  ? 30.352  2.477   42.856 1.00 58.45  ? 13  DC  D N3    1 
ATOM   2432 C C4    . DC  C 3 13  ? 30.391  3.786   43.157 1.00 59.52  ? 13  DC  D C4    1 
ATOM   2433 N N4    . DC  C 3 13  ? 29.287  4.349   43.655 1.00 59.18  ? 13  DC  D N4    1 
ATOM   2434 C C5    . DC  C 3 13  ? 31.572  4.570   42.959 1.00 61.95  ? 13  DC  D C5    1 
ATOM   2435 C C6    . DC  C 3 13  ? 32.650  3.950   42.457 1.00 63.10  ? 13  DC  D C6    1 
ATOM   2436 P P     . DT  C 3 14  ? 36.315  1.680   37.687 1.00 78.02  ? 14  DT  D P     1 
ATOM   2437 O OP1   . DT  C 3 14  ? 37.564  1.098   37.141 1.00 80.72  ? 14  DT  D OP1   1 
ATOM   2438 O OP2   . DT  C 3 14  ? 35.944  3.086   37.365 1.00 78.73  ? 14  DT  D OP2   1 
ATOM   2439 O "O5'" . DT  C 3 14  ? 35.086  0.734   37.276 1.00 76.19  ? 14  DT  D "O5'" 1 
ATOM   2440 C "C5'" . DT  C 3 14  ? 34.998  -0.604  37.831 1.00 73.24  ? 14  DT  D "C5'" 1 
ATOM   2441 C "C4'" . DT  C 3 14  ? 33.632  -1.224  37.583 1.00 70.66  ? 14  DT  D "C4'" 1 
ATOM   2442 O "O4'" . DT  C 3 14  ? 32.627  -0.564  38.397 1.00 67.40  ? 14  DT  D "O4'" 1 
ATOM   2443 C "C3'" . DT  C 3 14  ? 33.134  -1.160  36.141 1.00 72.27  ? 14  DT  D "C3'" 1 
ATOM   2444 O "O3'" . DT  C 3 14  ? 32.683  -2.438  35.753 1.00 73.37  ? 14  DT  D "O3'" 1 
ATOM   2445 C "C2'" . DT  C 3 14  ? 31.996  -0.136  36.184 1.00 70.38  ? 14  DT  D "C2'" 1 
ATOM   2446 C "C1'" . DT  C 3 14  ? 31.487  -0.301  37.609 1.00 66.19  ? 14  DT  D "C1'" 1 
ATOM   2447 N N1    . DT  C 3 14  ? 30.794  0.899   38.183 1.00 62.02  ? 14  DT  D N1    1 
ATOM   2448 C C2    . DT  C 3 14  ? 29.552  0.742   38.776 1.00 58.97  ? 14  DT  D C2    1 
ATOM   2449 O O2    . DT  C 3 14  ? 28.948  -0.313  38.813 1.00 57.28  ? 14  DT  D O2    1 
ATOM   2450 N N3    . DT  C 3 14  ? 29.049  1.876   39.351 1.00 58.77  ? 14  DT  D N3    1 
ATOM   2451 C C4    . DT  C 3 14  ? 29.639  3.122   39.418 1.00 59.30  ? 14  DT  D C4    1 
ATOM   2452 O O4    . DT  C 3 14  ? 29.039  4.033   39.969 1.00 58.97  ? 14  DT  D O4    1 
ATOM   2453 C C5    . DT  C 3 14  ? 30.938  3.231   38.775 1.00 61.37  ? 14  DT  D C5    1 
ATOM   2454 C C7    . DT  C 3 14  ? 31.662  4.551   38.731 1.00 63.44  ? 14  DT  D C7    1 
ATOM   2455 C C6    . DT  C 3 14  ? 31.447  2.126   38.200 1.00 61.92  ? 14  DT  D C6    1 
ATOM   2456 P P     . DC  C 3 15  ? 32.627  -2.841  34.207 1.00 77.95  ? 15  DC  D P     1 
ATOM   2457 O OP1   . DC  C 3 15  ? 32.884  -4.300  34.121 1.00 80.32  ? 15  DC  D OP1   1 
ATOM   2458 O OP2   . DC  C 3 15  ? 33.460  -1.894  33.439 1.00 80.26  ? 15  DC  D OP2   1 
ATOM   2459 O "O5'" . DC  C 3 15  ? 31.107  -2.564  33.833 1.00 76.37  ? 15  DC  D "O5'" 1 
ATOM   2460 C "C5'" . DC  C 3 15  ? 30.067  -3.228  34.563 1.00 71.77  ? 15  DC  D "C5'" 1 
ATOM   2461 C "C4'" . DC  C 3 15  ? 28.742  -2.542  34.344 1.00 69.45  ? 15  DC  D "C4'" 1 
ATOM   2462 O "O4'" . DC  C 3 15  ? 28.682  -1.331  35.136 1.00 66.14  ? 15  DC  D "O4'" 1 
ATOM   2463 C "C3'" . DC  C 3 15  ? 28.466  -2.117  32.898 1.00 72.55  ? 15  DC  D "C3'" 1 
ATOM   2464 O "O3'" . DC  C 3 15  ? 27.168  -2.517  32.544 1.00 74.69  ? 15  DC  D "O3'" 1 
ATOM   2465 C "C2'" . DC  C 3 15  ? 28.583  -0.592  32.947 1.00 71.06  ? 15  DC  D "C2'" 1 
ATOM   2466 C "C1'" . DC  C 3 15  ? 28.082  -0.340  34.353 1.00 66.89  ? 15  DC  D "C1'" 1 
ATOM   2467 N N1    . DC  C 3 15  ? 28.385  0.998   34.923 1.00 63.69  ? 15  DC  D N1    1 
ATOM   2468 C C2    . DC  C 3 15  ? 27.471  1.566   35.826 1.00 60.33  ? 15  DC  D C2    1 
ATOM   2469 O O2    . DC  C 3 15  ? 26.454  0.929   36.129 1.00 58.26  ? 15  DC  D O2    1 
ATOM   2470 N N3    . DC  C 3 15  ? 27.745  2.790   36.357 1.00 60.37  ? 15  DC  D N3    1 
ATOM   2471 C C4    . DC  C 3 15  ? 28.841  3.463   35.969 1.00 62.37  ? 15  DC  D C4    1 
ATOM   2472 N N4    . DC  C 3 15  ? 29.023  4.699   36.453 1.00 62.91  ? 15  DC  D N4    1 
ATOM   2473 C C5    . DC  C 3 15  ? 29.773  2.911   35.025 1.00 64.13  ? 15  DC  D C5    1 
ATOM   2474 C C6    . DC  C 3 15  ? 29.497  1.698   34.518 1.00 64.66  ? 15  DC  D C6    1 
ATOM   2475 P P     . DA  C 3 16  ? 26.945  -3.527  31.335 1.00 57.22  ? 16  DA  D P     1 
ATOM   2476 O OP1   . DA  C 3 16  ? 27.402  -4.868  31.777 1.00 63.05  ? 16  DA  D OP1   1 
ATOM   2477 O OP2   . DA  C 3 16  ? 27.533  -2.921  30.140 1.00 57.84  ? 16  DA  D OP2   1 
ATOM   2478 O "O5'" . DA  C 3 16  ? 25.355  -3.534  31.201 1.00 51.30  ? 16  DA  D "O5'" 1 
ATOM   2479 C "C5'" . DA  C 3 16  ? 24.541  -3.983  32.311 1.00 49.33  ? 16  DA  D "C5'" 1 
ATOM   2480 C "C4'" . DA  C 3 16  ? 23.276  -3.135  32.447 1.00 45.08  ? 16  DA  D "C4'" 1 
ATOM   2481 O "O4'" . DA  C 3 16  ? 23.606  -1.823  32.961 1.00 43.15  ? 16  DA  D "O4'" 1 
ATOM   2482 C "C3'" . DA  C 3 16  ? 22.490  -2.885  31.147 1.00 43.62  ? 16  DA  D "C3'" 1 
ATOM   2483 O "O3'" . DA  C 3 16  ? 21.082  -2.878  31.445 1.00 43.26  ? 16  DA  D "O3'" 1 
ATOM   2484 C "C2'" . DA  C 3 16  ? 22.972  -1.507  30.701 1.00 41.08  ? 16  DA  D "C2'" 1 
ATOM   2485 C "C1'" . DA  C 3 16  ? 23.153  -0.827  32.059 1.00 40.63  ? 16  DA  D "C1'" 1 
ATOM   2486 N N9    . DA  C 3 16  ? 24.113  0.271   32.086 1.00 41.10  ? 16  DA  D N9    1 
ATOM   2487 C C8    . DA  C 3 16  ? 25.305  0.360   31.416 1.00 44.09  ? 16  DA  D C8    1 
ATOM   2488 N N7    . DA  C 3 16  ? 25.987  1.439   31.697 1.00 45.35  ? 16  DA  D N7    1 
ATOM   2489 C C5    . DA  C 3 16  ? 25.228  2.059   32.681 1.00 42.21  ? 16  DA  D C5    1 
ATOM   2490 C C6    . DA  C 3 16  ? 25.407  3.249   33.424 1.00 42.96  ? 16  DA  D C6    1 
ATOM   2491 N N6    . DA  C 3 16  ? 26.514  3.992   33.366 1.00 45.73  ? 16  DA  D N6    1 
ATOM   2492 N N1    . DA  C 3 16  ? 24.440  3.593   34.307 1.00 41.92  ? 16  DA  D N1    1 
ATOM   2493 C C2    . DA  C 3 16  ? 23.365  2.809   34.440 1.00 38.79  ? 16  DA  D C2    1 
ATOM   2494 N N3    . DA  C 3 16  ? 23.090  1.661   33.803 1.00 38.19  ? 16  DA  D N3    1 
ATOM   2495 C C4    . DA  C 3 16  ? 24.048  1.372   32.891 1.00 39.74  ? 16  DA  D C4    1 
HETATM 2496 C C1    . ORP C 3 17  ? 19.994  -5.288  25.552 1.00 53.68  ? 17  ORP D C1    1 
HETATM 2497 O O1    . ORP C 3 17  ? 21.145  -5.607  24.751 1.00 57.44  ? 17  ORP D O1    1 
HETATM 2498 C C2    . ORP C 3 17  ? 19.393  -3.957  25.136 1.00 48.85  ? 17  ORP D C2    1 
HETATM 2499 C C3    . ORP C 3 17  ? 19.903  -2.962  26.157 1.00 44.30  ? 17  ORP D C3    1 
HETATM 2500 O O3    . ORP C 3 17  ? 20.926  -2.209  25.498 1.00 46.27  ? 17  ORP D O3    1 
HETATM 2501 C C4    . ORP C 3 17  ? 20.530  -3.789  27.276 1.00 44.17  ? 17  ORP D C4    1 
HETATM 2502 O O4    . ORP C 3 17  ? 20.367  -5.160  26.918 1.00 49.32  ? 17  ORP D O4    1 
HETATM 2503 C C5    . ORP C 3 17  ? 19.861  -3.504  28.625 1.00 42.82  ? 17  ORP D C5    1 
HETATM 2504 O O5    . ORP C 3 17  ? 20.338  -4.446  29.601 1.00 49.83  ? 17  ORP D O5    1 
HETATM 2505 P P     . ORP C 3 17  ? 20.202  -4.197  31.191 1.00 47.75  ? 17  ORP D P     1 
HETATM 2506 O O1P   . ORP C 3 17  ? 20.866  -5.347  31.895 1.00 50.81  ? 17  ORP D O1P   1 
HETATM 2507 O O2P   . ORP C 3 17  ? 18.794  -3.789  31.567 1.00 44.90  ? 17  ORP D O2P   1 
ATOM   2508 P P     . DG  C 3 18  ? 21.958  -1.070  25.826 1.00 46.12  ? 18  DG  D P     1 
ATOM   2509 O OP1   . DG  C 3 18  ? 23.066  -0.912  24.846 1.00 49.58  ? 18  DG  D OP1   1 
ATOM   2510 O OP2   . DG  C 3 18  ? 22.250  -1.046  27.286 1.00 44.86  ? 18  DG  D OP2   1 
ATOM   2511 O "O5'" . DG  C 3 18  ? 20.844  0.061   25.536 1.00 43.28  ? 18  DG  D "O5'" 1 
ATOM   2512 C "C5'" . DG  C 3 18  ? 20.695  0.619   24.255 1.00 40.65  ? 18  DG  D "C5'" 1 
ATOM   2513 C "C4'" . DG  C 3 18  ? 20.213  2.068   24.341 1.00 36.92  ? 18  DG  D "C4'" 1 
ATOM   2514 O "O4'" . DG  C 3 18  ? 21.280  2.934   24.803 1.00 35.26  ? 18  DG  D "O4'" 1 
ATOM   2515 C "C3'" . DG  C 3 18  ? 19.770  2.667   23.007 1.00 35.98  ? 18  DG  D "C3'" 1 
ATOM   2516 O "O3'" . DG  C 3 18  ? 18.764  3.649   23.253 1.00 35.02  ? 18  DG  D "O3'" 1 
ATOM   2517 C "C2'" . DG  C 3 18  ? 21.063  3.287   22.474 1.00 35.34  ? 18  DG  D "C2'" 1 
ATOM   2518 C "C1'" . DG  C 3 18  ? 21.675  3.833   23.757 1.00 36.38  ? 18  DG  D "C1'" 1 
ATOM   2519 N N9    . DG  C 3 18  ? 23.134  3.895   23.744 1.00 37.04  ? 18  DG  D N9    1 
ATOM   2520 C C8    . DG  C 3 18  ? 23.990  2.844   23.511 1.00 38.57  ? 18  DG  D C8    1 
ATOM   2521 N N7    . DG  C 3 18  ? 25.241  3.133   23.742 1.00 41.27  ? 18  DG  D N7    1 
ATOM   2522 C C5    . DG  C 3 18  ? 25.203  4.423   24.262 1.00 39.86  ? 18  DG  D C5    1 
ATOM   2523 C C6    . DG  C 3 18  ? 26.252  5.249   24.747 1.00 42.15  ? 18  DG  D C6    1 
ATOM   2524 O O6    . DG  C 3 18  ? 27.463  5.011   24.762 1.00 45.50  ? 18  DG  D O6    1 
ATOM   2525 N N1    . DG  C 3 18  ? 25.780  6.495   25.187 1.00 40.79  ? 18  DG  D N1    1 
ATOM   2526 C C2    . DG  C 3 18  ? 24.448  6.870   25.192 1.00 37.90  ? 18  DG  D C2    1 
ATOM   2527 N N2    . DG  C 3 18  ? 24.167  8.098   25.666 1.00 37.57  ? 18  DG  D N2    1 
ATOM   2528 N N3    . DG  C 3 18  ? 23.465  6.109   24.716 1.00 35.14  ? 18  DG  D N3    1 
ATOM   2529 C C4    . DG  C 3 18  ? 23.910  4.900   24.284 1.00 36.84  ? 18  DG  D C4    1 
ATOM   2530 P P     . DT  C 3 19  ? 17.927  4.322   22.077 1.00 37.07  ? 19  DT  D P     1 
ATOM   2531 O OP1   . DT  C 3 19  ? 16.546  4.512   22.538 1.00 40.45  ? 19  DT  D OP1   1 
ATOM   2532 O OP2   . DT  C 3 19  ? 18.172  3.589   20.809 1.00 37.12  ? 19  DT  D OP2   1 
ATOM   2533 O "O5'" . DT  C 3 19  ? 18.605  5.738   21.951 1.00 36.58  ? 19  DT  D "O5'" 1 
ATOM   2534 C "C5'" . DT  C 3 19  ? 18.536  6.656   23.043 1.00 35.89  ? 19  DT  D "C5'" 1 
ATOM   2535 C "C4'" . DT  C 3 19  ? 19.509  7.779   22.806 1.00 38.26  ? 19  DT  D "C4'" 1 
ATOM   2536 O "O4'" . DT  C 3 19  ? 20.845  7.253   22.760 1.00 37.38  ? 19  DT  D "O4'" 1 
ATOM   2537 C "C3'" . DT  C 3 19  ? 19.307  8.561   21.490 1.00 40.82  ? 19  DT  D "C3'" 1 
ATOM   2538 O "O3'" . DT  C 3 19  ? 18.875  9.851   21.840 1.00 45.00  ? 19  DT  D "O3'" 1 
ATOM   2539 C "C2'" . DT  C 3 19  ? 20.709  8.572   20.830 1.00 40.04  ? 19  DT  D "C2'" 1 
ATOM   2540 C "C1'" . DT  C 3 19  ? 21.618  8.137   21.991 1.00 39.86  ? 19  DT  D "C1'" 1 
ATOM   2541 N N1    . DT  C 3 19  ? 22.901  7.423   21.612 1.00 38.95  ? 19  DT  D N1    1 
ATOM   2542 C C2    . DT  C 3 19  ? 24.101  7.958   22.034 1.00 38.61  ? 19  DT  D C2    1 
ATOM   2543 O O2    . DT  C 3 19  ? 24.199  9.045   22.563 1.00 39.08  ? 19  DT  D O2    1 
ATOM   2544 N N3    . DT  C 3 19  ? 25.186  7.167   21.799 1.00 38.73  ? 19  DT  D N3    1 
ATOM   2545 C C4    . DT  C 3 19  ? 25.204  5.906   21.218 1.00 39.33  ? 19  DT  D C4    1 
ATOM   2546 O O4    . DT  C 3 19  ? 26.272  5.319   21.095 1.00 42.43  ? 19  DT  D O4    1 
ATOM   2547 C C5    . DT  C 3 19  ? 23.921  5.396   20.804 1.00 38.17  ? 19  DT  D C5    1 
ATOM   2548 C C7    . DT  C 3 19  ? 23.813  4.062   20.100 1.00 40.02  ? 19  DT  D C7    1 
ATOM   2549 C C6    . DT  C 3 19  ? 22.841  6.154   21.052 1.00 37.31  ? 19  DT  D C6    1 
ATOM   2550 P P     . DA  C 3 20  ? 18.299  10.936  20.771 1.00 49.65  ? 20  DA  D P     1 
ATOM   2551 O OP1   . DA  C 3 20  ? 17.381  11.818  21.549 1.00 51.40  ? 20  DA  D OP1   1 
ATOM   2552 O OP2   . DA  C 3 20  ? 17.822  10.256  19.551 1.00 48.87  ? 20  DA  D OP2   1 
ATOM   2553 O "O5'" . DA  C 3 20  ? 19.613  11.743  20.372 1.00 49.91  ? 20  DA  D "O5'" 1 
ATOM   2554 C "C5'" . DA  C 3 20  ? 20.235  12.581  21.338 1.00 50.62  ? 20  DA  D "C5'" 1 
ATOM   2555 C "C4'" . DA  C 3 20  ? 21.555  13.083  20.827 1.00 50.59  ? 20  DA  D "C4'" 1 
ATOM   2556 O "O4'" . DA  C 3 20  ? 22.463  11.971  20.697 1.00 47.44  ? 20  DA  D "O4'" 1 
ATOM   2557 C "C3'" . DA  C 3 20  ? 21.497  13.768  19.458 1.00 52.87  ? 20  DA  D "C3'" 1 
ATOM   2558 O "O3'" . DA  C 3 20  ? 22.063  15.034  19.582 1.00 58.38  ? 20  DA  D "O3'" 1 
ATOM   2559 C "C2'" . DA  C 3 20  ? 22.338  12.865  18.548 1.00 50.77  ? 20  DA  D "C2'" 1 
ATOM   2560 C "C1'" . DA  C 3 20  ? 23.255  12.165  19.548 1.00 48.97  ? 20  DA  D "C1'" 1 
ATOM   2561 N N9    . DA  C 3 20  ? 23.730  10.848  19.103 1.00 46.57  ? 20  DA  D N9    1 
ATOM   2562 C C8    . DA  C 3 20  ? 22.974  9.842   18.562 1.00 44.47  ? 20  DA  D C8    1 
ATOM   2563 N N7    . DA  C 3 20  ? 23.637  8.736   18.355 1.00 44.75  ? 20  DA  D N7    1 
ATOM   2564 C C5    . DA  C 3 20  ? 24.919  9.033   18.796 1.00 44.83  ? 20  DA  D C5    1 
ATOM   2565 C C6    . DA  C 3 20  ? 26.115  8.292   18.774 1.00 46.31  ? 20  DA  D C6    1 
ATOM   2566 N N6    . DA  C 3 20  ? 26.189  7.032   18.298 1.00 48.45  ? 20  DA  D N6    1 
ATOM   2567 N N1    . DA  C 3 20  ? 27.232  8.881   19.254 1.00 46.53  ? 20  DA  D N1    1 
ATOM   2568 C C2    . DA  C 3 20  ? 27.176  10.170  19.635 1.00 48.61  ? 20  DA  D C2    1 
ATOM   2569 N N3    . DA  C 3 20  ? 26.100  10.966  19.717 1.00 48.93  ? 20  DA  D N3    1 
ATOM   2570 C C4    . DA  C 3 20  ? 24.995  10.329  19.256 1.00 46.18  ? 20  DA  D C4    1 
ATOM   2571 P P     . DC  C 3 21  ? 21.768  16.218  18.548 1.00 63.47  ? 21  DC  D P     1 
ATOM   2572 O OP1   . DC  C 3 21  ? 21.125  17.299  19.328 1.00 67.18  ? 21  DC  D OP1   1 
ATOM   2573 O OP2   . DC  C 3 21  ? 21.107  15.678  17.323 1.00 61.66  ? 21  DC  D OP2   1 
ATOM   2574 O "O5'" . DC  C 3 21  ? 23.244  16.679  18.130 1.00 66.67  ? 21  DC  D "O5'" 1 
ATOM   2575 C "C5'" . DC  C 3 21  ? 24.374  16.385  18.991 1.00 66.70  ? 21  DC  D "C5'" 1 
ATOM   2576 C "C4'" . DC  C 3 21  ? 25.632  16.079  18.175 1.00 66.90  ? 21  DC  D "C4'" 1 
ATOM   2577 O "O4'" . DC  C 3 21  ? 25.844  14.643  18.101 1.00 63.09  ? 21  DC  D "O4'" 1 
ATOM   2578 C "C3'" . DC  C 3 21  ? 25.636  16.581  16.723 1.00 68.49  ? 21  DC  D "C3'" 1 
ATOM   2579 O "O3'" . DC  C 3 21  ? 26.880  17.136  16.436 1.00 72.80  ? 21  DC  D "O3'" 1 
ATOM   2580 C "C2'" . DC  C 3 21  ? 25.448  15.303  15.922 1.00 64.97  ? 21  DC  D "C2'" 1 
ATOM   2581 C "C1'" . DC  C 3 21  ? 26.233  14.339  16.796 1.00 62.11  ? 21  DC  D "C1'" 1 
ATOM   2582 N N1    . DC  C 3 21  ? 26.010  12.885  16.506 1.00 56.85  ? 21  DC  D N1    1 
ATOM   2583 C C2    . DC  C 3 21  ? 27.104  12.007  16.577 1.00 55.67  ? 21  DC  D C2    1 
ATOM   2584 O O2    . DC  C 3 21  ? 28.203  12.434  16.987 1.00 56.91  ? 21  DC  D O2    1 
ATOM   2585 N N3    . DC  C 3 21  ? 26.912  10.693  16.252 1.00 53.70  ? 21  DC  D N3    1 
ATOM   2586 C C4    . DC  C 3 21  ? 25.717  10.274  15.804 1.00 51.99  ? 21  DC  D C4    1 
ATOM   2587 N N4    . DC  C 3 21  ? 25.593  8.991   15.460 1.00 50.76  ? 21  DC  D N4    1 
ATOM   2588 C C5    . DC  C 3 21  ? 24.595  11.158  15.709 1.00 52.68  ? 21  DC  D C5    1 
ATOM   2589 C C6    . DC  C 3 21  ? 24.795  12.449  16.031 1.00 54.67  ? 21  DC  D C6    1 
ATOM   2590 P P     . DA  C 3 22  ? 27.014  18.448  15.526 1.00 76.51  ? 22  DA  D P     1 
ATOM   2591 O OP1   . DA  C 3 22  ? 26.600  19.596  16.372 1.00 81.02  ? 22  DA  D OP1   1 
ATOM   2592 O OP2   . DA  C 3 22  ? 26.359  18.200  14.219 1.00 73.65  ? 22  DA  D OP2   1 
ATOM   2593 O "O5'" . DA  C 3 22  ? 28.586  18.522  15.290 1.00 77.86  ? 22  DA  D "O5'" 1 
ATOM   2594 C "C5'" . DA  C 3 22  ? 29.480  18.241  16.381 1.00 78.43  ? 22  DA  D "C5'" 1 
ATOM   2595 C "C4'" . DA  C 3 22  ? 30.704  17.484  15.894 1.00 77.83  ? 22  DA  D "C4'" 1 
ATOM   2596 O "O4'" . DA  C 3 22  ? 30.373  16.091  15.700 1.00 72.62  ? 22  DA  D "O4'" 1 
ATOM   2597 C "C3'" . DA  C 3 22  ? 31.298  17.979  14.579 1.00 80.47  ? 22  DA  D "C3'" 1 
ATOM   2598 O "O3'" . DA  C 3 22  ? 32.703  18.054  14.689 1.00 85.77  ? 22  DA  D "O3'" 1 
ATOM   2599 C "C2'" . DA  C 3 22  ? 30.854  16.936  13.549 1.00 75.28  ? 22  DA  D "C2'" 1 
ATOM   2600 C "C1'" . DA  C 3 22  ? 30.716  15.676  14.391 1.00 71.59  ? 22  DA  D "C1'" 1 
ATOM   2601 N N9    . DA  C 3 22  ? 29.666  14.773  13.930 1.00 66.19  ? 22  DA  D N9    1 
ATOM   2602 C C8    . DA  C 3 22  ? 28.344  15.077  13.749 1.00 64.67  ? 22  DA  D C8    1 
ATOM   2603 N N7    . DA  C 3 22  ? 27.594  14.041  13.450 1.00 61.74  ? 22  DA  D N7    1 
ATOM   2604 C C5    . DA  C 3 22  ? 28.480  12.986  13.426 1.00 59.74  ? 22  DA  D C5    1 
ATOM   2605 C C6    . DA  C 3 22  ? 28.309  11.615  13.157 1.00 57.16  ? 22  DA  D C6    1 
ATOM   2606 N N6    . DA  C 3 22  ? 27.147  11.087  12.778 1.00 55.32  ? 22  DA  D N6    1 
ATOM   2607 N N1    . DA  C 3 22  ? 29.396  10.816  13.250 1.00 58.15  ? 22  DA  D N1    1 
ATOM   2608 C C2    . DA  C 3 22  ? 30.595  11.373  13.525 1.00 60.82  ? 22  DA  D C2    1 
ATOM   2609 N N3    . DA  C 3 22  ? 30.876  12.646  13.819 1.00 62.32  ? 22  DA  D N3    1 
ATOM   2610 C C4    . DA  C 3 22  ? 29.767  13.414  13.731 1.00 62.35  ? 22  DA  D C4    1 
ATOM   2611 P P     . DG  C 3 23  ? 33.554  18.955  13.682 1.00 91.72  ? 23  DG  D P     1 
ATOM   2612 O OP1   . DG  C 3 23  ? 34.652  19.578  14.465 1.00 97.69  ? 23  DG  D OP1   1 
ATOM   2613 O OP2   . DG  C 3 23  ? 32.627  19.813  12.890 1.00 91.95  ? 23  DG  D OP2   1 
ATOM   2614 O "O5'" . DG  C 3 23  ? 34.173  17.879  12.676 1.00 89.46  ? 23  DG  D "O5'" 1 
ATOM   2615 C "C5'" . DG  C 3 23  ? 34.842  16.724  13.178 1.00 87.92  ? 23  DG  D "C5'" 1 
ATOM   2616 C "C4'" . DG  C 3 23  ? 34.871  15.620  12.134 1.00 84.34  ? 23  DG  D "C4'" 1 
ATOM   2617 O "O4'" . DG  C 3 23  ? 33.578  14.968  12.070 1.00 78.24  ? 23  DG  D "O4'" 1 
ATOM   2618 C "C3'" . DG  C 3 23  ? 35.186  16.065  10.695 1.00 86.02  ? 23  DG  D "C3'" 1 
ATOM   2619 O "O3'" . DG  C 3 23  ? 36.084  15.129  10.103 1.00 89.16  ? 23  DG  D "O3'" 1 
ATOM   2620 C "C2'" . DG  C 3 23  ? 33.817  15.996  10.016 1.00 80.86  ? 23  DG  D "C2'" 1 
ATOM   2621 C "C1'" . DG  C 3 23  ? 33.265  14.778  10.722 1.00 75.98  ? 23  DG  D "C1'" 1 
ATOM   2622 N N9    . DG  C 3 23  ? 31.842  14.552  10.576 1.00 69.04  ? 23  DG  D N9    1 
ATOM   2623 C C8    . DG  C 3 23  ? 30.829  15.483  10.564 1.00 67.73  ? 23  DG  D C8    1 
ATOM   2624 N N7    . DG  C 3 23  ? 29.646  14.959  10.406 1.00 64.57  ? 23  DG  D N7    1 
ATOM   2625 C C5    . DG  C 3 23  ? 29.902  13.600  10.281 1.00 62.50  ? 23  DG  D C5    1 
ATOM   2626 C C6    . DG  C 3 23  ? 29.017  12.526  10.059 1.00 60.18  ? 23  DG  D C6    1 
ATOM   2627 O O6    . DG  C 3 23  ? 27.780  12.563  9.994  1.00 59.83  ? 23  DG  D O6    1 
ATOM   2628 N N1    . DG  C 3 23  ? 29.700  11.298  9.962  1.00 59.02  ? 23  DG  D N1    1 
ATOM   2629 C C2    . DG  C 3 23  ? 31.074  11.145  10.059 1.00 59.33  ? 23  DG  D C2    1 
ATOM   2630 N N2    . DG  C 3 23  ? 31.555  9.895   9.982  1.00 57.92  ? 23  DG  D N2    1 
ATOM   2631 N N3    . DG  C 3 23  ? 31.909  12.152  10.254 1.00 61.86  ? 23  DG  D N3    1 
ATOM   2632 C C4    . DG  C 3 23  ? 31.253  13.341  10.381 1.00 63.94  ? 23  DG  D C4    1 
ATOM   2633 P P     . DA  C 3 24  ? 37.174  15.602  9.038  1.00 93.80  ? 24  DA  D P     1 
ATOM   2634 O OP1   . DA  C 3 24  ? 38.350  16.091  9.804  1.00 99.22  ? 24  DA  D OP1   1 
ATOM   2635 O OP2   . DA  C 3 24  ? 36.514  16.482  8.034  1.00 92.83  ? 24  DA  D OP2   1 
ATOM   2636 O "O5'" . DA  C 3 24  ? 37.567  14.239  8.291  1.00 92.53  ? 24  DA  D "O5'" 1 
ATOM   2637 C "C5'" . DA  C 3 24  ? 37.692  13.007  9.015  1.00 90.72  ? 24  DA  D "C5'" 1 
ATOM   2638 C "C4'" . DA  C 3 24  ? 37.116  11.844  8.215  1.00 87.07  ? 24  DA  D "C4'" 1 
ATOM   2639 O "O4'" . DA  C 3 24  ? 35.667  11.861  8.298  1.00 81.41  ? 24  DA  D "O4'" 1 
ATOM   2640 C "C3'" . DA  C 3 24  ? 37.467  11.817  6.714  1.00 88.71  ? 24  DA  D "C3'" 1 
ATOM   2641 O "O3'" . DA  C 3 24  ? 37.893  10.498  6.354  1.00 92.25  ? 24  DA  D "O3'" 1 
ATOM   2642 C "C2'" . DA  C 3 24  ? 36.152  12.209  6.022  1.00 83.48  ? 24  DA  D "C2'" 1 
ATOM   2643 C "C1'" . DA  C 3 24  ? 35.117  11.677  7.002  1.00 79.11  ? 24  DA  D "C1'" 1 
ATOM   2644 N N9    . DA  C 3 24  ? 33.819  12.355  6.947  1.00 73.78  ? 24  DA  D N9    1 
ATOM   2645 C C8    . DA  C 3 24  ? 33.571  13.692  7.143  1.00 73.01  ? 24  DA  D C8    1 
ATOM   2646 N N7    . DA  C 3 24  ? 32.296  14.007  7.126  1.00 70.21  ? 24  DA  D N7    1 
ATOM   2647 C C5    . DA  C 3 24  ? 31.655  12.786  6.962  1.00 68.05  ? 24  DA  D C5    1 
ATOM   2648 C C6    . DA  C 3 24  ? 30.284  12.427  6.857  1.00 65.55  ? 24  DA  D C6    1 
ATOM   2649 N N6    . DA  C 3 24  ? 29.281  13.313  6.946  1.00 64.90  ? 24  DA  D N6    1 
ATOM   2650 N N1    . DA  C 3 24  ? 29.989  11.118  6.637  1.00 64.45  ? 24  DA  D N1    1 
ATOM   2651 C C2    . DA  C 3 24  ? 30.991  10.225  6.565  1.00 65.80  ? 24  DA  D C2    1 
ATOM   2652 N N3    . DA  C 3 24  ? 32.308  10.439  6.662  1.00 68.56  ? 24  DA  D N3    1 
ATOM   2653 C C4    . DA  C 3 24  ? 32.579  11.757  6.842  1.00 69.78  ? 24  DA  D C4    1 
ATOM   2654 P P     . DG  C 3 25  ? 38.576  10.173  4.935  1.00 97.23  ? 25  DG  D P     1 
ATOM   2655 O OP1   . DG  C 3 25  ? 39.585  9.111   5.171  1.00 101.85 ? 25  DG  D OP1   1 
ATOM   2656 O OP2   . DG  C 3 25  ? 38.983  11.444  4.272  1.00 99.23  ? 25  DG  D OP2   1 
ATOM   2657 O "O5'" . DG  C 3 25  ? 37.359  9.557   4.086  1.00 92.84  ? 25  DG  D "O5'" 1 
ATOM   2658 C "C5'" . DG  C 3 25  ? 36.504  8.568   4.679  1.00 88.59  ? 25  DG  D "C5'" 1 
ATOM   2659 C "C4'" . DG  C 3 25  ? 35.254  8.330   3.847  1.00 84.11  ? 25  DG  D "C4'" 1 
ATOM   2660 O "O4'" . DG  C 3 25  ? 34.237  9.312   4.167  1.00 78.94  ? 25  DG  D "O4'" 1 
ATOM   2661 C "C3'" . DG  C 3 25  ? 35.435  8.363   2.317  1.00 85.90  ? 25  DG  D "C3'" 1 
ATOM   2662 O "O3'" . DG  C 3 25  ? 34.932  7.125   1.773  1.00 88.24  ? 25  DG  D "O3'" 1 
ATOM   2663 C "C2'" . DG  C 3 25  ? 34.606  9.588   1.877  1.00 81.60  ? 25  DG  D "C2'" 1 
ATOM   2664 C "C1'" . DG  C 3 25  ? 33.557  9.646   2.976  1.00 76.81  ? 25  DG  D "C1'" 1 
ATOM   2665 N N9    . DG  C 3 25  ? 32.906  10.945  3.147  1.00 70.96  ? 25  DG  D N9    1 
ATOM   2666 C C8    . DG  C 3 25  ? 33.500  12.132  3.506  1.00 70.05  ? 25  DG  D C8    1 
ATOM   2667 N N7    . DG  C 3 25  ? 32.646  13.091  3.734  1.00 67.76  ? 25  DG  D N7    1 
ATOM   2668 C C5    . DG  C 3 25  ? 31.406  12.503  3.524  1.00 65.24  ? 25  DG  D C5    1 
ATOM   2669 C C6    . DG  C 3 25  ? 30.097  13.070  3.559  1.00 63.29  ? 25  DG  D C6    1 
ATOM   2670 O O6    . DG  C 3 25  ? 29.771  14.226  3.861  1.00 63.95  ? 25  DG  D O6    1 
ATOM   2671 N N1    . DG  C 3 25  ? 29.109  12.122  3.261  1.00 61.11  ? 25  DG  D N1    1 
ATOM   2672 C C2    . DG  C 3 25  ? 29.356  10.804  2.948  1.00 61.81  ? 25  DG  D C2    1 
ATOM   2673 N N2    . DG  C 3 25  ? 28.286  10.038  2.683  1.00 61.35  ? 25  DG  D N2    1 
ATOM   2674 N N3    . DG  C 3 25  ? 30.572  10.268  2.903  1.00 64.24  ? 25  DG  D N3    1 
ATOM   2675 C C4    . DG  C 3 25  ? 31.548  11.174  3.194  1.00 66.23  ? 25  DG  D C4    1 
ATOM   2676 P P     . DC  C 3 26  ? 35.032  6.750   0.206  1.00 92.20  ? 26  DC  D P     1 
ATOM   2677 O OP1   . DC  C 3 26  ? 35.212  5.278   0.116  1.00 95.70  ? 26  DC  D OP1   1 
ATOM   2678 O OP2   . DC  C 3 26  ? 36.006  7.657   -0.470 1.00 93.61  ? 26  DC  D OP2   1 
ATOM   2679 O "O5'" . DC  C 3 26  ? 33.569  7.121   -0.319 1.00 87.67  ? 26  DC  D "O5'" 1 
ATOM   2680 C "C5'" . DC  C 3 26  ? 32.417  6.566   0.331  1.00 83.33  ? 26  DC  D "C5'" 1 
ATOM   2681 C "C4'" . DC  C 3 26  ? 31.141  7.105   -0.283 1.00 79.94  ? 26  DC  D "C4'" 1 
ATOM   2682 O "O4'" . DC  C 3 26  ? 30.881  8.434   0.213  1.00 75.70  ? 26  DC  D "O4'" 1 
ATOM   2683 C "C3'" . DC  C 3 26  ? 31.148  7.200   -1.808 1.00 82.26  ? 26  DC  D "C3'" 1 
ATOM   2684 O "O3'" . DC  C 3 26  ? 30.095  6.397   -2.322 1.00 84.98  ? 26  DC  D "O3'" 1 
ATOM   2685 C "C2'" . DC  C 3 26  ? 30.956  8.701   -2.102 1.00 79.58  ? 26  DC  D "C2'" 1 
ATOM   2686 C "C1'" . DC  C 3 26  ? 30.324  9.213   -0.812 1.00 75.92  ? 26  DC  D "C1'" 1 
ATOM   2687 N N1    . DC  C 3 26  ? 30.593  10.678  -0.492 1.00 73.52  ? 26  DC  D N1    1 
ATOM   2688 C C2    . DC  C 3 26  ? 29.511  11.589  -0.367 1.00 72.86  ? 26  DC  D C2    1 
ATOM   2689 O O2    . DC  C 3 26  ? 28.351  11.203  -0.588 1.00 73.44  ? 26  DC  D O2    1 
ATOM   2690 N N3    . DC  C 3 26  ? 29.777  12.876  0.012  1.00 71.80  ? 26  DC  D N3    1 
ATOM   2691 C C4    . DC  C 3 26  ? 31.041  13.265  0.255  1.00 70.96  ? 26  DC  D C4    1 
ATOM   2692 N N4    . DC  C 3 26  ? 31.244  14.533  0.619  1.00 70.48  ? 26  DC  D N4    1 
ATOM   2693 C C5    . DC  C 3 26  ? 32.148  12.371  0.111  1.00 71.85  ? 26  DC  D C5    1 
ATOM   2694 C C6    . DC  C 3 26  ? 31.881  11.096  -0.230 1.00 72.99  ? 26  DC  D C6    1 
ATOM   2695 P P     . DT  C 3 27  ? 30.046  5.948   -3.870 1.00 89.72  ? 27  DT  D P     1 
ATOM   2696 O OP1   . DT  C 3 27  ? 29.460  4.588   -3.918 1.00 93.67  ? 27  DT  D OP1   1 
ATOM   2697 O OP2   . DT  C 3 27  ? 31.365  6.205   -4.514 1.00 91.12  ? 27  DT  D OP2   1 
ATOM   2698 O "O5'" . DT  C 3 27  ? 28.994  6.978   -4.485 1.00 89.11  ? 27  DT  D "O5'" 1 
ATOM   2699 C "C5'" . DT  C 3 27  ? 27.789  7.317   -3.762 1.00 85.64  ? 27  DT  D "C5'" 1 
ATOM   2700 C "C4'" . DT  C 3 27  ? 27.115  8.548   -4.367 1.00 84.65  ? 27  DT  D "C4'" 1 
ATOM   2701 O "O4'" . DT  C 3 27  ? 27.645  9.751   -3.749 1.00 80.29  ? 27  DT  D "O4'" 1 
ATOM   2702 C "C3'" . DT  C 3 27  ? 27.302  8.734   -5.877 1.00 87.79  ? 27  DT  D "C3'" 1 
ATOM   2703 O "O3'" . DT  C 3 27  ? 26.079  9.183   -6.456 1.00 91.16  ? 27  DT  D "O3'" 1 
ATOM   2704 C "C2'" . DT  C 3 27  ? 28.361  9.837   -5.946 1.00 84.81  ? 27  DT  D "C2'" 1 
ATOM   2705 C "C1'" . DT  C 3 27  ? 27.924  10.679  -4.761 1.00 79.83  ? 27  DT  D "C1'" 1 
ATOM   2706 N N1    . DT  C 3 27  ? 28.922  11.685  -4.260 1.00 75.08  ? 27  DT  D N1    1 
ATOM   2707 C C2    . DT  C 3 27  ? 28.465  12.927  -3.850 1.00 72.75  ? 27  DT  D C2    1 
ATOM   2708 O O2    . DT  C 3 27  ? 27.291  13.255  -3.890 1.00 73.63  ? 27  DT  D O2    1 
ATOM   2709 N N3    . DT  C 3 27  ? 29.444  13.792  -3.421 1.00 70.36  ? 27  DT  D N3    1 
ATOM   2710 C C4    . DT  C 3 27  ? 30.800  13.534  -3.300 1.00 70.41  ? 27  DT  D C4    1 
ATOM   2711 O O4    . DT  C 3 27  ? 31.536  14.402  -2.828 1.00 68.69  ? 27  DT  D O4    1 
ATOM   2712 C C5    . DT  C 3 27  ? 31.219  12.203  -3.731 1.00 73.23  ? 27  DT  D C5    1 
ATOM   2713 C C7    . DT  C 3 27  ? 32.670  11.800  -3.674 1.00 74.77  ? 27  DT  D C7    1 
ATOM   2714 C C6    . DT  C 3 27  ? 30.273  11.365  -4.210 1.00 74.50  ? 27  DT  D C6    1 
ATOM   2715 P P     . DG  C 3 28  ? 25.282  8.285   -7.511 1.00 95.76  ? 28  DG  D P     1 
ATOM   2716 O OP1   . DG  C 3 28  ? 24.682  7.150   -6.772 1.00 96.93  ? 28  DG  D OP1   1 
ATOM   2717 O OP2   . DG  C 3 28  ? 26.171  8.031   -8.671 1.00 98.28  ? 28  DG  D OP2   1 
ATOM   2718 O "O5'" . DG  C 3 28  ? 24.114  9.278   -7.975 1.00 98.97  ? 28  DG  D "O5'" 1 
ATOM   2719 C "C5'" . DG  C 3 28  ? 23.253  9.905   -6.988 1.00 97.59  ? 28  DG  D "C5'" 1 
ATOM   2720 C "C4'" . DG  C 3 28  ? 23.085  11.407  -7.249 1.00 97.93  ? 28  DG  D "C4'" 1 
ATOM   2721 O "O4'" . DG  C 3 28  ? 24.202  12.133  -6.675 1.00 93.41  ? 28  DG  D "O4'" 1 
ATOM   2722 C "C3'" . DG  C 3 28  ? 23.005  11.832  -8.718 1.00 102.43 ? 28  DG  D "C3'" 1 
ATOM   2723 O "O3'" . DG  C 3 28  ? 21.840  12.619  -8.942 1.00 107.09 ? 28  DG  D "O3'" 1 
ATOM   2724 C "C2'" . DG  C 3 28  ? 24.277  12.653  -8.933 1.00 99.08  ? 28  DG  D "C2'" 1 
ATOM   2725 C "C1'" . DG  C 3 28  ? 24.545  13.185  -7.539 1.00 93.06  ? 28  DG  D "C1'" 1 
ATOM   2726 N N9    . DG  C 3 28  ? 25.943  13.550  -7.304 1.00 87.46  ? 28  DG  D N9    1 
ATOM   2727 C C8    . DG  C 3 28  ? 27.047  12.764  -7.524 1.00 85.69  ? 28  DG  D C8    1 
ATOM   2728 N N7    . DG  C 3 28  ? 28.168  13.336  -7.197 1.00 82.93  ? 28  DG  D N7    1 
ATOM   2729 C C5    . DG  C 3 28  ? 27.791  14.583  -6.730 1.00 81.81  ? 28  DG  D C5    1 
ATOM   2730 C C6    . DG  C 3 28  ? 28.588  15.663  -6.269 1.00 79.62  ? 28  DG  D C6    1 
ATOM   2731 O O6    . DG  C 3 28  ? 29.814  15.724  -6.200 1.00 78.16  ? 28  DG  D O6    1 
ATOM   2732 N N1    . DG  C 3 28  ? 27.817  16.769  -5.904 1.00 80.27  ? 28  DG  D N1    1 
ATOM   2733 C C2    . DG  C 3 28  ? 26.445  16.823  -5.976 1.00 82.18  ? 28  DG  D C2    1 
ATOM   2734 N N2    . DG  C 3 28  ? 25.877  17.967  -5.575 1.00 82.69  ? 28  DG  D N2    1 
ATOM   2735 N N3    . DG  C 3 28  ? 25.680  15.809  -6.391 1.00 84.32  ? 28  DG  D N3    1 
ATOM   2736 C C4    . DG  C 3 28  ? 26.422  14.728  -6.770 1.00 84.23  ? 28  DG  D C4    1 
HETATM 2737 C C1    . EDO D 4 .   ? -8.307  -6.193  18.730 1.00 86.53  ? 401 EDO A C1    1 
HETATM 2738 O O1    . EDO D 4 .   ? -8.518  -5.585  19.996 1.00 87.45  ? 401 EDO A O1    1 
HETATM 2739 C C2    . EDO D 4 .   ? -6.934  -5.755  18.154 1.00 85.60  ? 401 EDO A C2    1 
HETATM 2740 O O2    . EDO D 4 .   ? -5.879  -6.186  19.007 1.00 83.14  ? 401 EDO A O2    1 
HETATM 2741 C C     . ACY E 5 .   ? 16.072  -4.872  25.873 1.00 41.61  ? 402 ACY A C     1 
HETATM 2742 O O     . ACY E 5 .   ? 15.913  -3.980  25.039 1.00 39.45  ? 402 ACY A O     1 
HETATM 2743 O OXT   . ACY E 5 .   ? 16.784  -4.604  27.016 1.00 41.56  ? 402 ACY A OXT   1 
HETATM 2744 C CH3   . ACY E 5 .   ? 15.593  -6.315  25.811 1.00 37.78  ? 402 ACY A CH3   1 
HETATM 2745 O O     . HOH F 6 .   ? 15.468  -14.312 22.877 1.00 38.17  ? 501 HOH A O     1 
HETATM 2746 O O     . HOH F 6 .   ? 12.203  -0.455  36.283 1.00 41.02  ? 502 HOH A O     1 
HETATM 2747 O O     . HOH F 6 .   ? 16.358  -2.134  27.798 1.00 34.15  ? 503 HOH A O     1 
HETATM 2748 O O     . HOH F 6 .   ? 15.380  -1.407  25.227 1.00 35.58  ? 504 HOH A O     1 
HETATM 2749 O O     . HOH F 6 .   ? 16.915  10.883  15.887 1.00 51.88  ? 505 HOH A O     1 
HETATM 2750 O O     . HOH F 6 .   ? 9.309   12.273  31.585 1.00 40.43  ? 506 HOH A O     1 
HETATM 2751 O O     . HOH F 6 .   ? 22.480  0.586   20.887 1.00 55.24  ? 507 HOH A O     1 
HETATM 2752 O O     . HOH F 6 .   ? -3.061  -1.853  27.735 1.00 55.63  ? 508 HOH A O     1 
HETATM 2753 O O     . HOH F 6 .   ? 10.168  -3.227  39.643 1.00 43.89  ? 509 HOH A O     1 
HETATM 2754 O O     . HOH F 6 .   ? 7.423   16.456  14.516 1.00 59.76  ? 510 HOH A O     1 
HETATM 2755 O O     . HOH F 6 .   ? 13.792  16.527  16.017 1.00 55.40  ? 511 HOH A O     1 
HETATM 2756 O O     . HOH F 6 .   ? 13.411  -18.580 24.294 1.00 46.50  ? 512 HOH A O     1 
HETATM 2757 O O     . HOH F 6 .   ? 11.297  2.723   27.366 1.00 32.17  ? 513 HOH A O     1 
HETATM 2758 O O     . HOH F 6 .   ? 19.287  7.409   17.717 1.00 48.46  ? 514 HOH A O     1 
HETATM 2759 O O     . HOH F 6 .   ? 12.982  -8.134  26.217 1.00 49.40  ? 515 HOH A O     1 
HETATM 2760 O O     . HOH F 6 .   ? 0.650   -9.415  37.993 1.00 51.39  ? 516 HOH A O     1 
HETATM 2761 O O     . HOH F 6 .   ? 18.245  3.007   37.106 1.00 42.79  ? 517 HOH A O     1 
HETATM 2762 O O     . HOH F 6 .   ? 21.279  -16.482 22.727 1.00 50.77  ? 518 HOH A O     1 
HETATM 2763 O O     . HOH F 6 .   ? -6.040  -6.548  25.581 1.00 60.48  ? 519 HOH A O     1 
HETATM 2764 O O     . HOH F 6 .   ? 14.004  -4.542  36.571 1.00 57.31  ? 520 HOH A O     1 
HETATM 2765 O O     . HOH F 6 .   ? 9.335   10.130  13.790 1.00 40.43  ? 521 HOH A O     1 
HETATM 2766 O O     . HOH F 6 .   ? 3.597   10.975  13.761 1.00 59.49  ? 522 HOH A O     1 
HETATM 2767 O O     . HOH F 6 .   ? 1.922   0.883   6.221  1.00 60.27  ? 523 HOH A O     1 
HETATM 2768 O O     . HOH F 6 .   ? 22.024  14.185  30.023 1.00 47.58  ? 524 HOH A O     1 
HETATM 2769 O O     . HOH F 6 .   ? 12.494  -10.709 15.664 1.00 39.72  ? 525 HOH A O     1 
HETATM 2770 O O     . HOH F 6 .   ? 11.589  -13.988 20.007 1.00 50.21  ? 526 HOH A O     1 
HETATM 2771 O O     . HOH F 6 .   ? -2.607  -1.223  31.191 1.00 65.29  ? 527 HOH A O     1 
HETATM 2772 O O     . HOH F 6 .   ? 19.040  3.776   27.107 1.00 32.45  ? 528 HOH A O     1 
HETATM 2773 O O     . HOH F 6 .   ? -4.432  0.137   16.294 1.00 48.99  ? 529 HOH A O     1 
HETATM 2774 O O     . HOH F 6 .   ? 5.061   -1.881  37.016 1.00 35.39  ? 530 HOH A O     1 
HETATM 2775 O O     . HOH F 6 .   ? 10.345  -6.655  25.281 1.00 26.99  ? 531 HOH A O     1 
HETATM 2776 O O     . HOH F 6 .   ? 11.487  -12.482 23.710 1.00 42.08  ? 532 HOH A O     1 
HETATM 2777 O O     . HOH F 6 .   ? 23.907  -3.365  27.754 1.00 55.64  ? 533 HOH A O     1 
HETATM 2778 O O     . HOH F 6 .   ? 18.956  5.899   30.699 1.00 30.55  ? 534 HOH A O     1 
HETATM 2779 O O     . HOH F 6 .   ? 14.384  -13.114 40.363 1.00 46.98  ? 535 HOH A O     1 
HETATM 2780 O O     . HOH F 6 .   ? 1.919   4.179   13.469 1.00 44.04  ? 536 HOH A O     1 
HETATM 2781 O O     . HOH F 6 .   ? 18.827  6.145   36.463 1.00 37.62  ? 537 HOH A O     1 
HETATM 2782 O O     . HOH F 6 .   ? 12.719  -18.533 33.887 1.00 59.66  ? 538 HOH A O     1 
HETATM 2783 O O     . HOH F 6 .   ? -5.396  -9.334  17.482 1.00 48.90  ? 539 HOH A O     1 
HETATM 2784 O O     . HOH F 6 .   ? -0.059  9.943   22.607 1.00 54.09  ? 540 HOH A O     1 
HETATM 2785 O O     . HOH F 6 .   ? 4.339   -7.333  4.749  1.00 60.95  ? 541 HOH A O     1 
HETATM 2786 O O     . HOH F 6 .   ? 20.037  2.097   14.599 1.00 55.78  ? 542 HOH A O     1 
HETATM 2787 O O     . HOH F 6 .   ? 18.359  -12.182 14.033 1.00 48.76  ? 543 HOH A O     1 
HETATM 2788 O O     . HOH F 6 .   ? 20.546  -13.510 15.917 1.00 63.41  ? 544 HOH A O     1 
HETATM 2789 O O     . HOH F 6 .   ? 16.226  13.909  29.791 1.00 55.21  ? 545 HOH A O     1 
HETATM 2790 O O     . HOH F 6 .   ? 9.390   18.205  16.111 1.00 40.00  ? 546 HOH A O     1 
HETATM 2791 O O     A HOH F 6 .   ? 18.076  -7.036  28.508 0.50 35.15  ? 547 HOH A O     1 
HETATM 2792 O O     B HOH F 6 .   ? 16.575  -6.591  29.156 0.50 24.47  ? 547 HOH A O     1 
HETATM 2793 O O     . HOH F 6 .   ? 17.298  -1.500  8.060  1.00 49.54  ? 548 HOH A O     1 
HETATM 2794 O O     . HOH F 6 .   ? 13.551  -16.605 37.219 1.00 45.44  ? 549 HOH A O     1 
HETATM 2795 O O     . HOH F 6 .   ? 15.770  -17.373 29.478 1.00 40.60  ? 550 HOH A O     1 
HETATM 2796 O O     . HOH F 6 .   ? -1.896  -0.848  6.711  1.00 60.04  ? 551 HOH A O     1 
HETATM 2797 O O     . HOH F 6 .   ? 13.894  12.910  19.059 1.00 34.61  ? 552 HOH A O     1 
HETATM 2798 O O     . HOH F 6 .   ? 15.133  4.794   9.365  1.00 47.83  ? 553 HOH A O     1 
HETATM 2799 O O     . HOH F 6 .   ? -2.041  -8.770  19.896 1.00 36.45  ? 554 HOH A O     1 
HETATM 2800 O O     . HOH F 6 .   ? 5.958   13.164  22.994 1.00 48.30  ? 555 HOH A O     1 
HETATM 2801 O O     . HOH F 6 .   ? -17.725 2.942   28.080 1.00 80.03  ? 556 HOH A O     1 
HETATM 2802 O O     . HOH F 6 .   ? 20.704  -2.814  35.791 1.00 53.44  ? 557 HOH A O     1 
HETATM 2803 O O     . HOH F 6 .   ? -4.039  1.564   32.328 1.00 64.20  ? 558 HOH A O     1 
HETATM 2804 O O     . HOH F 6 .   ? 17.265  -20.448 26.601 1.00 52.20  ? 559 HOH A O     1 
HETATM 2805 O O     . HOH F 6 .   ? 15.650  -16.492 9.601  1.00 58.76  ? 560 HOH A O     1 
HETATM 2806 O O     . HOH F 6 .   ? -0.901  -7.320  38.796 1.00 54.05  ? 561 HOH A O     1 
HETATM 2807 O O     . HOH F 6 .   ? -13.922 -0.901  23.192 1.00 89.23  ? 562 HOH A O     1 
HETATM 2808 O O     . HOH F 6 .   ? 6.668   -15.971 19.272 1.00 52.13  ? 563 HOH A O     1 
HETATM 2809 O O     . HOH F 6 .   ? 21.754  -20.232 39.516 1.00 54.05  ? 564 HOH A O     1 
HETATM 2810 O O     . HOH F 6 .   ? 9.606   -16.901 21.807 1.00 45.76  ? 565 HOH A O     1 
HETATM 2811 O O     . HOH F 6 .   ? -1.687  -13.229 30.971 1.00 49.20  ? 566 HOH A O     1 
HETATM 2812 O O     . HOH F 6 .   ? 12.313  -6.469  37.799 1.00 40.37  ? 567 HOH A O     1 
HETATM 2813 O O     . HOH F 6 .   ? 8.948   7.082   11.024 1.00 42.30  ? 568 HOH A O     1 
HETATM 2814 O O     . HOH F 6 .   ? 7.784   -14.507 12.704 1.00 48.28  ? 569 HOH A O     1 
HETATM 2815 O O     . HOH F 6 .   ? 14.333  -7.961  28.589 1.00 36.64  ? 570 HOH A O     1 
HETATM 2816 O O     . HOH F 6 .   ? 7.546   -4.128  3.898  1.00 48.73  ? 571 HOH A O     1 
HETATM 2817 O O     . HOH F 6 .   ? 19.481  -0.730  32.800 1.00 31.90  ? 572 HOH A O     1 
HETATM 2818 O O     . HOH F 6 .   ? 7.468   13.091  14.504 1.00 45.10  ? 573 HOH A O     1 
HETATM 2819 O O     A HOH F 6 .   ? 7.139   -5.212  42.388 0.50 32.50  ? 574 HOH A O     1 
HETATM 2820 O O     B HOH F 6 .   ? 9.020   -5.314  42.913 0.50 46.87  ? 574 HOH A O     1 
HETATM 2821 O O     . HOH F 6 .   ? 0.877   5.263   39.306 1.00 67.08  ? 575 HOH A O     1 
HETATM 2822 O O     . HOH F 6 .   ? 20.213  1.865   10.619 1.00 60.90  ? 576 HOH A O     1 
HETATM 2823 O O     . HOH F 6 .   ? 25.853  -13.237 41.501 1.00 52.58  ? 577 HOH A O     1 
HETATM 2824 O O     . HOH F 6 .   ? 10.347  -10.788 17.126 1.00 37.45  ? 578 HOH A O     1 
HETATM 2825 O O     . HOH F 6 .   ? 19.259  -12.216 41.638 1.00 65.18  ? 579 HOH A O     1 
HETATM 2826 O O     . HOH F 6 .   ? 16.521  -12.934 15.917 1.00 35.32  ? 580 HOH A O     1 
HETATM 2827 O O     . HOH F 6 .   ? 23.334  14.190  23.464 1.00 48.76  ? 581 HOH A O     1 
HETATM 2828 O O     . HOH F 6 .   ? 18.794  -7.958  30.924 1.00 48.60  ? 582 HOH A O     1 
HETATM 2829 O O     . HOH F 6 .   ? 21.126  -20.665 44.233 1.00 32.36  ? 583 HOH A O     1 
HETATM 2830 O O     . HOH F 6 .   ? 2.875   -0.148  44.277 1.00 64.11  ? 584 HOH A O     1 
HETATM 2831 O O     . HOH F 6 .   ? 7.353   10.837  15.849 1.00 30.59  ? 585 HOH A O     1 
HETATM 2832 O O     . HOH F 6 .   ? 0.300   3.397   7.118  1.00 48.86  ? 586 HOH A O     1 
HETATM 2833 O O     . HOH F 6 .   ? 13.373  -12.244 19.145 1.00 66.42  ? 587 HOH A O     1 
HETATM 2834 O O     . HOH F 6 .   ? 9.494   -15.064 29.234 1.00 52.52  ? 588 HOH A O     1 
HETATM 2835 O O     . HOH F 6 .   ? 12.241  -16.420 21.722 1.00 46.40  ? 589 HOH A O     1 
HETATM 2836 O O     . HOH F 6 .   ? 4.313   14.422  30.492 1.00 67.41  ? 590 HOH A O     1 
HETATM 2837 O O     . HOH F 6 .   ? 13.618  -12.544 21.907 1.00 53.96  ? 591 HOH A O     1 
HETATM 2838 O O     . HOH F 6 .   ? -6.769  -0.147  17.900 1.00 56.18  ? 592 HOH A O     1 
HETATM 2839 O O     . HOH F 6 .   ? 17.071  -18.832 36.718 1.00 53.30  ? 593 HOH A O     1 
HETATM 2840 O O     A HOH F 6 .   ? 6.234   -10.263 6.437  0.50 71.69  ? 594 HOH A O     1 
HETATM 2841 O O     B HOH F 6 .   ? 7.859   -9.937  7.018  0.50 41.84  ? 594 HOH A O     1 
HETATM 2842 O O     . HOH F 6 .   ? 27.121  -4.543  10.761 1.00 64.90  ? 595 HOH A O     1 
HETATM 2843 O O     . HOH F 6 .   ? -4.821  -4.048  15.223 1.00 61.85  ? 596 HOH A O     1 
HETATM 2844 O O     . HOH F 6 .   ? 4.600   -16.662 22.567 1.00 57.07  ? 597 HOH A O     1 
HETATM 2845 O O     . HOH F 6 .   ? 12.292  -15.630 16.675 1.00 57.12  ? 598 HOH A O     1 
HETATM 2846 O O     . HOH F 6 .   ? -0.617  7.954   36.352 1.00 61.04  ? 599 HOH A O     1 
HETATM 2847 O O     . HOH F 6 .   ? 21.756  4.340   17.186 1.00 47.79  ? 600 HOH A O     1 
HETATM 2848 O O     . HOH F 6 .   ? 24.541  -2.821  13.086 1.00 65.49  ? 601 HOH A O     1 
HETATM 2849 O O     . HOH F 6 .   ? 5.185   -15.113 13.177 1.00 59.21  ? 602 HOH A O     1 
HETATM 2850 O O     . HOH F 6 .   ? -4.819  -2.323  33.360 1.00 69.25  ? 603 HOH A O     1 
HETATM 2851 O O     . HOH F 6 .   ? -1.743  3.950   38.480 1.00 72.23  ? 604 HOH A O     1 
HETATM 2852 O O     . HOH F 6 .   ? 10.108  -1.340  1.621  1.00 65.57  ? 605 HOH A O     1 
HETATM 2853 O O     . HOH F 6 .   ? 11.168  15.415  34.352 1.00 62.13  ? 606 HOH A O     1 
HETATM 2854 O O     A HOH F 6 .   ? -0.681  6.808   12.695 0.50 39.36  ? 607 HOH A O     1 
HETATM 2855 O O     B HOH F 6 .   ? -0.787  6.250   10.990 0.50 34.83  ? 607 HOH A O     1 
HETATM 2856 O O     . HOH F 6 .   ? 2.631   -16.460 25.943 1.00 70.88  ? 608 HOH A O     1 
HETATM 2857 O O     . HOH F 6 .   ? 16.106  3.086   38.678 1.00 50.35  ? 609 HOH A O     1 
HETATM 2858 O O     . HOH F 6 .   ? 13.945  -12.980 15.960 1.00 49.60  ? 610 HOH A O     1 
HETATM 2859 O O     . HOH F 6 .   ? -4.304  7.718   16.393 1.00 65.75  ? 611 HOH A O     1 
HETATM 2860 O O     . HOH F 6 .   ? 13.880  -19.336 29.835 1.00 58.01  ? 612 HOH A O     1 
HETATM 2861 O O     . HOH F 6 .   ? 2.785   6.369   40.917 1.00 63.72  ? 613 HOH A O     1 
HETATM 2862 O O     . HOH F 6 .   ? 19.827  -1.100  8.909  1.00 54.24  ? 614 HOH A O     1 
HETATM 2863 O O     . HOH F 6 .   ? -1.432  -12.780 38.569 1.00 65.40  ? 615 HOH A O     1 
HETATM 2864 O O     . HOH F 6 .   ? 5.222   1.002   45.079 1.00 61.53  ? 616 HOH A O     1 
HETATM 2865 O O     . HOH G 6 .   ? 28.566  -17.481 72.044 1.00 51.20  ? 101 HOH C O     1 
HETATM 2866 O O     . HOH G 6 .   ? 26.346  12.617  37.546 1.00 64.37  ? 102 HOH C O     1 
HETATM 2867 O O     . HOH G 6 .   ? 35.388  8.035   24.485 1.00 65.14  ? 103 HOH C O     1 
HETATM 2868 O O     . HOH G 6 .   ? 39.280  -6.215  53.437 1.00 67.10  ? 104 HOH C O     1 
HETATM 2869 O O     . HOH G 6 .   ? 21.866  9.071   43.035 1.00 49.28  ? 105 HOH C O     1 
HETATM 2870 O O     . HOH G 6 .   ? 28.833  7.197   33.943 1.00 58.96  ? 106 HOH C O     1 
HETATM 2871 O O     . HOH G 6 .   ? 23.707  20.143  3.688  1.00 65.99  ? 107 HOH C O     1 
HETATM 2872 O O     . HOH G 6 .   ? 25.260  -1.237  48.446 1.00 55.93  ? 108 HOH C O     1 
HETATM 2873 O O     . HOH G 6 .   ? 30.685  -11.062 70.178 1.00 66.46  ? 109 HOH C O     1 
HETATM 2874 O O     . HOH G 6 .   ? 33.436  1.429   58.548 1.00 61.65  ? 110 HOH C O     1 
HETATM 2875 O O     . HOH G 6 .   ? 36.529  -1.429  65.201 1.00 68.03  ? 111 HOH C O     1 
HETATM 2876 O O     . HOH G 6 .   ? 36.703  -1.755  68.839 1.00 56.10  ? 112 HOH C O     1 
HETATM 2877 O O     . HOH G 6 .   ? 31.746  -7.514  50.949 1.00 57.50  ? 113 HOH C O     1 
HETATM 2878 O O     . HOH G 6 .   ? 23.234  -2.033  39.202 1.00 62.61  ? 114 HOH C O     1 
HETATM 2879 O O     . HOH G 6 .   ? 27.707  13.020  23.905 1.00 53.00  ? 115 HOH C O     1 
HETATM 2880 O O     . HOH G 6 .   ? 22.252  8.274   7.826  1.00 65.83  ? 116 HOH C O     1 
HETATM 2881 O O     . HOH G 6 .   ? 23.831  2.399   46.375 1.00 67.00  ? 117 HOH C O     1 
HETATM 2882 O O     . HOH G 6 .   ? 27.788  8.025   39.286 1.00 64.37  ? 118 HOH C O     1 
HETATM 2883 O O     . HOH G 6 .   ? 28.047  -5.523  49.232 1.00 43.26  ? 119 HOH C O     1 
HETATM 2884 O O     . HOH G 6 .   ? 28.365  -7.059  67.900 1.00 56.55  ? 120 HOH C O     1 
HETATM 2885 O O     . HOH G 6 .   ? 31.770  -19.419 78.134 1.00 61.71  ? 121 HOH C O     1 
HETATM 2886 O O     . HOH G 6 .   ? 20.803  3.484   36.992 1.00 50.76  ? 122 HOH C O     1 
HETATM 2887 O O     . HOH G 6 .   ? 31.186  0.687   71.014 1.00 74.71  ? 123 HOH C O     1 
HETATM 2888 O O     . HOH G 6 .   ? 27.784  24.818  -5.395 1.00 53.93  ? 124 HOH C O     1 
HETATM 2889 O O     . HOH G 6 .   ? 38.639  -13.790 74.713 1.00 69.85  ? 125 HOH C O     1 
HETATM 2890 O O     . HOH G 6 .   ? 37.967  -3.480  61.451 1.00 66.57  ? 126 HOH C O     1 
HETATM 2891 O O     . HOH G 6 .   ? 27.736  -3.504  65.888 1.00 54.34  ? 127 HOH C O     1 
HETATM 2892 O O     . HOH G 6 .   ? 21.697  0.530   37.960 1.00 53.80  ? 128 HOH C O     1 
HETATM 2893 O O     . HOH G 6 .   ? 33.400  -13.841 71.663 1.00 56.70  ? 129 HOH C O     1 
HETATM 2894 O O     . HOH G 6 .   ? 35.574  -8.414  51.050 1.00 51.49  ? 130 HOH C O     1 
HETATM 2895 O O     . HOH G 6 .   ? 16.314  12.622  40.842 1.00 54.77  ? 131 HOH C O     1 
HETATM 2896 O O     . HOH G 6 .   ? 34.134  10.689  15.733 1.00 78.62  ? 132 HOH C O     1 
HETATM 2897 O O     . HOH G 6 .   ? 29.279  -6.576  51.416 1.00 57.70  ? 133 HOH C O     1 
HETATM 2898 O O     . HOH G 6 .   ? 26.738  -3.731  40.546 1.00 71.24  ? 134 HOH C O     1 
HETATM 2899 O O     . HOH G 6 .   ? 36.016  -14.542 72.058 1.00 57.13  ? 135 HOH C O     1 
HETATM 2900 O O     . HOH G 6 .   ? 17.898  6.673   45.075 1.00 60.74  ? 136 HOH C O     1 
HETATM 2901 O O     . HOH G 6 .   ? 30.977  -14.294 78.548 1.00 62.95  ? 137 HOH C O     1 
HETATM 2902 O O     . HOH G 6 .   ? 31.611  -16.246 80.320 1.00 55.43  ? 138 HOH C O     1 
HETATM 2903 O O     . HOH G 6 .   ? 25.495  13.547  25.739 1.00 63.78  ? 139 HOH C O     1 
HETATM 2904 O O     . HOH G 6 .   ? 38.652  -20.143 81.020 0.50 57.20  ? 140 HOH C O     1 
HETATM 2905 O O     . HOH G 6 .   ? 36.173  2.257   52.928 1.00 54.12  ? 141 HOH C O     1 
HETATM 2906 O O     . HOH G 6 .   ? 34.959  18.267  -5.531 1.00 54.05  ? 142 HOH C O     1 
HETATM 2907 O O     . HOH G 6 .   ? 28.533  -15.352 70.224 1.00 48.87  ? 143 HOH C O     1 
HETATM 2908 O O     . HOH H 6 .   ? 34.118  14.932  -2.398 1.00 60.80  ? 101 HOH D O     1 
HETATM 2909 O O     . HOH H 6 .   ? 27.902  -1.239  60.329 1.00 64.92  ? 102 HOH D O     1 
HETATM 2910 O O     . HOH H 6 .   ? 40.359  -16.603 63.456 1.00 57.66  ? 103 HOH D O     1 
HETATM 2911 O O     . HOH H 6 .   ? 33.769  2.172   54.214 1.00 53.36  ? 104 HOH D O     1 
HETATM 2912 O O     . HOH H 6 .   ? 31.425  8.981   55.441 1.00 50.55  ? 105 HOH D O     1 
HETATM 2913 O O     . HOH H 6 .   ? 27.082  -3.112  50.060 1.00 48.24  ? 106 HOH D O     1 
HETATM 2914 O O     . HOH H 6 .   ? 30.266  16.891  3.763  1.00 62.84  ? 107 HOH D O     1 
HETATM 2915 O O     . HOH H 6 .   ? 16.885  -5.703  31.837 1.00 48.72  ? 108 HOH D O     1 
HETATM 2916 O O     . HOH H 6 .   ? 32.527  0.581   32.811 1.00 61.96  ? 109 HOH D O     1 
HETATM 2917 O O     . HOH H 6 .   ? 21.359  -5.266  34.575 1.00 52.87  ? 110 HOH D O     1 
HETATM 2918 O O     . HOH H 6 .   ? 22.857  6.415   54.795 1.00 50.98  ? 111 HOH D O     1 
HETATM 2919 O O     . HOH H 6 .   ? 29.397  -11.337 58.672 1.00 49.87  ? 112 HOH D O     1 
HETATM 2920 O O     . HOH H 6 .   ? 35.938  0.466   50.879 1.00 61.19  ? 113 HOH D O     1 
HETATM 2921 O O     . HOH H 6 .   ? 36.059  -17.184 61.242 1.00 53.92  ? 114 HOH D O     1 
HETATM 2922 O O     . HOH H 6 .   ? 26.031  1.378   49.396 1.00 42.75  ? 115 HOH D O     1 
HETATM 2923 O O     . HOH H 6 .   ? 33.743  -11.818 59.693 1.00 38.11  ? 116 HOH D O     1 
HETATM 2924 O O     . HOH H 6 .   ? 38.535  -5.665  65.809 1.00 60.31  ? 117 HOH D O     1 
HETATM 2925 O O     . HOH H 6 .   ? 24.728  3.469   53.781 1.00 56.61  ? 118 HOH D O     1 
HETATM 2926 O O     . HOH H 6 .   ? 28.621  5.185   47.420 1.00 49.59  ? 119 HOH D O     1 
HETATM 2927 O O     . HOH H 6 .   ? 37.651  -3.323  73.370 1.00 60.30  ? 120 HOH D O     1 
HETATM 2928 O O     . HOH H 6 .   ? 36.048  0.491   45.460 1.00 61.34  ? 121 HOH D O     1 
HETATM 2929 O O     . HOH H 6 .   ? 36.861  -3.222  76.678 1.00 59.63  ? 122 HOH D O     1 
HETATM 2930 O O     . HOH H 6 .   ? 23.679  6.209   17.125 1.00 49.01  ? 123 HOH D O     1 
HETATM 2931 O O     . HOH H 6 .   ? 32.545  -15.991 59.199 1.00 36.29  ? 124 HOH D O     1 
HETATM 2932 O O     . HOH H 6 .   ? 24.906  12.664  12.014 1.00 58.21  ? 125 HOH D O     1 
HETATM 2933 O O     . HOH H 6 .   ? 30.914  2.274   57.906 1.00 51.08  ? 126 HOH D O     1 
HETATM 2934 O O     . HOH H 6 .   ? 27.957  7.298   59.011 1.00 56.63  ? 127 HOH D O     1 
HETATM 2935 O O     . HOH H 6 .   ? 27.065  5.306   50.118 1.00 47.86  ? 128 HOH D O     1 
HETATM 2936 O O     . HOH H 6 .   ? 21.244  -0.325  34.847 1.00 47.97  ? 129 HOH D O     1 
HETATM 2937 O O     . HOH H 6 .   ? 36.858  10.901  47.136 1.00 66.74  ? 130 HOH D O     1 
HETATM 2938 O O     . HOH H 6 .   ? 26.514  13.379  21.300 1.00 58.42  ? 131 HOH D O     1 
HETATM 2939 O O     . HOH H 6 .   ? 25.994  -4.555  54.395 1.00 59.38  ? 132 HOH D O     1 
HETATM 2940 O O     . HOH H 6 .   ? 28.267  -5.902  53.819 1.00 58.75  ? 133 HOH D O     1 
HETATM 2941 O O     . HOH H 6 .   ? 34.413  -9.367  58.759 1.00 61.79  ? 134 HOH D O     1 
HETATM 2942 O O     . HOH H 6 .   ? 29.489  6.786   41.012 1.00 48.61  ? 135 HOH D O     1 
HETATM 2943 O O     . HOH H 6 .   ? 20.119  5.108   19.140 1.00 37.51  ? 136 HOH D O     1 
HETATM 2944 O O     . HOH H 6 .   ? 42.439  -10.354 77.054 1.00 61.09  ? 137 HOH D O     1 
HETATM 2945 O O     . HOH H 6 .   ? 37.869  -13.104 60.777 1.00 59.98  ? 138 HOH D O     1 
HETATM 2946 O O     . HOH H 6 .   ? 17.941  13.899  23.721 1.00 53.46  ? 139 HOH D O     1 
HETATM 2947 O O     . HOH H 6 .   ? 38.188  -15.833 62.114 1.00 50.56  ? 140 HOH D O     1 
HETATM 2948 O O     . HOH H 6 .   ? 24.885  -2.067  36.295 1.00 65.57  ? 141 HOH D O     1 
HETATM 2949 O O     . HOH H 6 .   ? 25.325  -3.876  51.906 1.00 59.65  ? 142 HOH D O     1 
HETATM 2950 O O     . HOH H 6 .   ? 23.167  -12.412 59.565 1.00 53.36  ? 143 HOH D O     1 
HETATM 2951 O O     . HOH H 6 .   ? 23.185  1.340   54.364 1.00 66.36  ? 144 HOH D O     1 
HETATM 2952 O O     . HOH H 6 .   ? 34.768  11.183  45.402 1.00 58.00  ? 145 HOH D O     1 
HETATM 2953 O O     . HOH H 6 .   ? 36.302  -16.284 68.817 1.00 57.84  ? 146 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . PHE A 7   ? 0.7521 0.8569 0.5069 0.0675  0.0467  0.1848  111 PHE A N     
2    C CA    . PHE A 7   ? 0.7460 0.8253 0.4801 0.0739  0.0439  0.1985  111 PHE A CA    
3    C C     . PHE A 7   ? 0.7515 0.8328 0.4614 0.0728  0.0198  0.1979  111 PHE A C     
4    O O     . PHE A 7   ? 0.7158 0.7793 0.3983 0.0751  0.0160  0.2036  111 PHE A O     
5    C CB    . PHE A 7   ? 0.7859 0.8654 0.5071 0.0925  0.0520  0.2177  111 PHE A CB    
6    C CG    . PHE A 7   ? 0.8443 0.8956 0.5614 0.1073  0.0832  0.2345  111 PHE A CG    
7    C CD1   . PHE A 7   ? 0.9189 0.9532 0.6429 0.0931  0.1022  0.2321  111 PHE A CD1   
8    C CD2   . PHE A 7   ? 0.9045 0.9465 0.5989 0.1412  0.0986  0.2547  111 PHE A CD2   
9    C CE1   . PHE A 7   ? 0.9942 0.9689 0.6902 0.1013  0.1435  0.2534  111 PHE A CE1   
10   C CE2   . PHE A 7   ? 1.0157 0.9975 0.6802 0.1708  0.1370  0.2829  111 PHE A CE2   
11   C CZ    . PHE A 7   ? 1.0326 0.9646 0.6921 0.1451  0.1628  0.2840  111 PHE A CZ    
12   N N     . ASN A 8   ? 0.7119 0.8104 0.4219 0.0642  0.0109  0.1883  112 ASN A N     
13   C CA    . ASN A 8   ? 0.7399 0.8232 0.4072 0.0678  -0.0054 0.1971  112 ASN A CA    
14   C C     . ASN A 8   ? 0.8580 0.9006 0.4903 0.0992  -0.0104 0.2119  112 ASN A C     
15   O O     . ASN A 8   ? 0.9084 0.8772 0.4838 0.0950  -0.0027 0.2221  112 ASN A O     
16   C CB    . ASN A 8   ? 0.7188 0.7819 0.3568 0.0422  -0.0009 0.1966  112 ASN A CB    
17   C CG    . ASN A 8   ? 0.8449 0.8744 0.4226 0.0298  -0.0063 0.2054  112 ASN A CG    
18   O OD1   . ASN A 8   ? 0.6919 0.7313 0.2541 0.0482  -0.0178 0.2157  112 ASN A OD1   
19   N ND2   . ASN A 8   ? 0.8053 0.8024 0.3380 -0.0030 0.0065  0.2004  112 ASN A ND2   
20   N N     . GLY A 9   ? 0.8239 0.9136 0.4867 0.1255  -0.0148 0.2056  113 GLY A N     
21   C CA    . GLY A 9   ? 0.8811 0.9453 0.5170 0.1707  -0.0174 0.2148  113 GLY A CA    
22   C C     . GLY A 9   ? 0.9370 0.9484 0.5678 0.1628  -0.0017 0.2116  113 GLY A C     
23   O O     . GLY A 9   ? 1.0068 0.9771 0.6082 0.1991  0.0036  0.2139  113 GLY A O     
24   N N     . VAL A 10  ? 0.8303 0.8514 0.4847 0.1234  0.0085  0.2051  114 VAL A N     
25   C CA    . VAL A 10  ? 0.8266 0.8383 0.4783 0.1130  0.0227  0.1978  114 VAL A CA    
26   C C     . VAL A 10  ? 0.8366 0.9111 0.5380 0.1216  0.0243  0.1932  114 VAL A C     
27   O O     . VAL A 10  ? 0.7830 0.8890 0.5127 0.1099  0.0282  0.1963  114 VAL A O     
28   C CB    . VAL A 10  ? 0.8500 0.8765 0.4900 0.0771  0.0327  0.1933  114 VAL A CB    
29   C CG1   . VAL A 10  ? 0.8396 0.9055 0.4828 0.0661  0.0465  0.1804  114 VAL A CG1   
30   C CG2   . VAL A 10  ? 0.8964 0.8671 0.4798 0.0494  0.0396  0.1873  114 VAL A CG2   
31   N N     . SER A 11  ? 0.8295 0.9103 0.5324 0.1381  0.0288  0.1823  115 SER A N     
32   C CA    . SER A 11  ? 0.8104 0.9585 0.5536 0.1383  0.0337  0.1733  115 SER A CA    
33   C C     . SER A 11  ? 0.8777 1.0471 0.6280 0.1136  0.0491  0.1852  115 SER A C     
34   O O     . SER A 11  ? 0.8802 1.0445 0.6093 0.1058  0.0526  0.1914  115 SER A O     
35   C CB    . SER A 11  ? 0.8768 1.0363 0.6182 0.1674  0.0351  0.1543  115 SER A CB    
36   O OG    . SER A 11  ? 0.9966 1.1160 0.7109 0.1555  0.0501  0.1459  115 SER A OG    
37   N N     . GLU A 12  ? 0.8422 1.0438 0.6128 0.1015  0.0635  0.1868  116 GLU A N     
38   C CA    . GLU A 12  ? 0.8600 1.0645 0.6169 0.0930  0.0860  0.2105  116 GLU A CA    
39   C C     . GLU A 12  ? 0.8958 1.1501 0.6487 0.0984  0.0843  0.2054  116 GLU A C     
40   O O     . GLU A 12  ? 0.9043 1.1859 0.6359 0.1056  0.0904  0.2256  116 GLU A O     
41   C CB    . GLU A 12  ? 0.9141 1.1162 0.6741 0.0662  0.1151  0.2074  116 GLU A CB    
42   C CG    . GLU A 12  ? 1.1051 1.2655 0.8222 0.0673  0.1500  0.2470  116 GLU A CG    
43   C CD    . GLU A 12  ? 1.4523 1.5889 1.1506 0.0253  0.1936  0.2418  116 GLU A CD    
44   O OE1   . GLU A 12  ? 1.4464 1.6584 1.1670 0.0046  0.1915  0.2154  116 GLU A OE1   
45   O OE2   . GLU A 12  ? 1.4505 1.4853 1.1034 0.0103  0.2375  0.2611  116 GLU A OE2   
46   N N     . ALA A 13  ? 0.8359 1.1161 0.6071 0.1006  0.0771  0.1738  117 ALA A N     
47   C CA    . ALA A 13  ? 0.8386 1.1609 0.6083 0.0993  0.0816  0.1529  117 ALA A CA    
48   C C     . ALA A 13  ? 0.8893 1.2005 0.6313 0.0898  0.0828  0.1459  117 ALA A C     
49   O O     . ALA A 13  ? 0.8717 1.2519 0.6069 0.0742  0.0937  0.1346  117 ALA A O     
50   C CB    . ALA A 13  ? 0.8638 1.1896 0.6498 0.1196  0.0767  0.1176  117 ALA A CB    
51   N N     . GLU A 14  ? 1.0750 0.9607 0.7231 0.2704  -0.0124 0.1877  118 GLU A N     
52   C CA    . GLU A 14  ? 1.1032 0.8937 0.7119 0.2612  -0.0082 0.1660  118 GLU A CA    
53   C C     . GLU A 14  ? 1.0942 0.8696 0.7022 0.2199  -0.0036 0.1426  118 GLU A C     
54   O O     . GLU A 14  ? 1.1022 0.8239 0.6933 0.2206  0.0037  0.1204  118 GLU A O     
55   C CB    . GLU A 14  ? 1.1598 0.9063 0.7441 0.2534  -0.0186 0.1812  118 GLU A CB    
56   C CG    . GLU A 14  ? 1.3561 1.0093 0.9069 0.2702  -0.0157 0.1724  118 GLU A CG    
57   C CD    . GLU A 14  ? 1.5357 1.1353 1.0606 0.2485  -0.0226 0.1860  118 GLU A CD    
58   O OE1   . GLU A 14  ? 1.3764 0.9853 0.8956 0.2639  -0.0321 0.2124  118 GLU A OE1   
59   O OE2   . GLU A 14  ? 1.3677 0.9182 0.8789 0.2174  -0.0182 0.1731  118 GLU A OE2   
60   N N     . LEU A 15  ? 0.9898 0.8113 0.6159 0.1854  -0.0103 0.1474  119 LEU A N     
61   C CA    . LEU A 15  ? 0.9437 0.7561 0.5714 0.1490  -0.0068 0.1272  119 LEU A CA    
62   C C     . LEU A 15  ? 0.9807 0.8126 0.6253 0.1567  0.0030  0.1127  119 LEU A C     
63   O O     . LEU A 15  ? 0.9590 0.7598 0.5971 0.1377  0.0085  0.0920  119 LEU A O     
64   C CB    . LEU A 15  ? 0.9110 0.7632 0.5496 0.1166  -0.0196 0.1349  119 LEU A CB    
65   C CG    . LEU A 15  ? 0.9927 0.8301 0.6066 0.1051  -0.0313 0.1473  119 LEU A CG    
66   C CD1   . LEU A 15  ? 0.9745 0.8428 0.5918 0.0738  -0.0469 0.1470  119 LEU A CD1   
67   C CD2   . LEU A 15  ? 1.0487 0.8178 0.6281 0.0967  -0.0210 0.1378  119 LEU A CD2   
68   N N     . LEU A 16  ? 0.9407 0.8294 0.6080 0.1854  0.0057  0.1262  120 LEU A N     
69   C CA    . LEU A 16  ? 0.9177 0.8340 0.5979 0.1968  0.0167  0.1171  120 LEU A CA    
70   C C     . LEU A 16  ? 0.9928 0.8458 0.6399 0.2210  0.0265  0.0923  120 LEU A C     
71   O O     . LEU A 16  ? 0.9620 0.8179 0.6083 0.2194  0.0331  0.0773  120 LEU A O     
72   C CB    . LEU A 16  ? 0.9101 0.9139 0.6250 0.2226  0.0198  0.1434  120 LEU A CB    
73   C CG    . LEU A 16  ? 0.9390 1.0111 0.6943 0.1906  0.0050  0.1681  120 LEU A CG    
74   C CD1   . LEU A 16  ? 0.9483 1.1049 0.7406 0.2187  0.0043  0.2025  120 LEU A CD1   
75   C CD2   . LEU A 16  ? 0.9291 1.0186 0.7022 0.1558  0.0035  0.1614  120 LEU A CD2   
76   N N     . THR A 17  ? 1.0001 0.7906 0.6179 0.2406  0.0241  0.0883  121 THR A N     
77   C CA    . THR A 17  ? 1.0493 0.7640 0.6312 0.2611  0.0263  0.0640  121 THR A CA    
78   C C     . THR A 17  ? 1.0636 0.7160 0.6338 0.2202  0.0206  0.0463  121 THR A C     
79   O O     . THR A 17  ? 1.0831 0.6823 0.6321 0.2233  0.0186  0.0239  121 THR A O     
80   C CB    . THR A 17  ? 1.2682 0.9396 0.8257 0.3024  0.0234  0.0703  121 THR A CB    
81   O OG1   . THR A 17  ? 1.2660 0.9024 0.8194 0.2795  0.0139  0.0835  121 THR A OG1   
82   C CG2   . THR A 17  ? 1.2686 1.0105 0.8425 0.3489  0.0310  0.0910  121 THR A CG2   
83   N N     . LYS A 18  ? 0.9726 0.6347 0.5560 0.1832  0.0171  0.0572  122 LYS A N     
84   C CA    . LYS A 18  ? 0.9460 0.5655 0.5250 0.1450  0.0154  0.0472  122 LYS A CA    
85   C C     . LYS A 18  ? 0.9345 0.5732 0.5288 0.1227  0.0189  0.0304  122 LYS A C     
86   O O     . LYS A 18  ? 0.8879 0.5834 0.5010 0.1242  0.0217  0.0327  122 LYS A O     
87   C CB    . LYS A 18  ? 0.9449 0.5751 0.5264 0.1202  0.0136  0.0649  122 LYS A CB    
88   C CG    . LYS A 18  ? 0.9789 0.5735 0.5404 0.1352  0.0087  0.0830  122 LYS A CG    
89   C CD    . LYS A 18  ? 1.0501 0.6565 0.6062 0.1110  0.0073  0.1003  122 LYS A CD    
90   C CE    . LYS A 18  ? 1.1639 0.7190 0.7065 0.0861  0.0115  0.1017  122 LYS A CE    
91   N NZ    . LYS A 18  ? 1.1586 0.7372 0.6935 0.0616  0.0153  0.1123  122 LYS A NZ    
92   N N     . THR A 19  ? 0.8902 0.4837 0.4799 0.1002  0.0173  0.0171  123 THR A N     
93   C CA    . THR A 19  ? 0.8509 0.4572 0.4562 0.0779  0.0190  0.0023  123 THR A CA    
94   C C     . THR A 19  ? 0.8652 0.4612 0.4810 0.0431  0.0218  0.0053  123 THR A C     
95   O O     . THR A 19  ? 0.8970 0.4655 0.5034 0.0355  0.0224  0.0176  123 THR A O     
96   C CB    . THR A 19  ? 0.9349 0.5049 0.5265 0.0901  0.0128  -0.0181 123 THR A CB    
97   O OG1   . THR A 19  ? 0.9504 0.4511 0.5241 0.0877  0.0040  -0.0208 123 THR A OG1   
98   C CG2   . THR A 19  ? 0.9139 0.5065 0.4918 0.1296  0.0149  -0.0224 123 THR A CG2   
99   N N     . LEU A 20  ? 0.7728 0.3936 0.4077 0.0243  0.0248  -0.0035 124 LEU A N     
100  C CA    . LEU A 20  ? 0.7533 0.3753 0.4001 -0.0029 0.0310  -0.0011 124 LEU A CA    
101  C C     . LEU A 20  ? 0.7856 0.3859 0.4467 -0.0177 0.0280  -0.0124 124 LEU A C     
102  O O     . LEU A 20  ? 0.7617 0.3767 0.4328 -0.0158 0.0240  -0.0252 124 LEU A O     
103  C CB    . LEU A 20  ? 0.7060 0.3735 0.3643 -0.0099 0.0347  -0.0020 124 LEU A CB    
104  C CG    . LEU A 20  ? 0.7372 0.4122 0.4017 -0.0293 0.0431  -0.0021 124 LEU A CG    
105  C CD1   . LEU A 20  ? 0.7493 0.4114 0.3936 -0.0327 0.0495  0.0124  124 LEU A CD1   
106  C CD2   . LEU A 20  ? 0.7258 0.4322 0.3965 -0.0320 0.0408  -0.0074 124 LEU A CD2   
107  N N     . PRO A 21  ? 0.7657 0.3358 0.4309 -0.0348 0.0285  -0.0047 125 PRO A N     
108  C CA    . PRO A 21  ? 0.7745 0.3294 0.4600 -0.0524 0.0212  -0.0126 125 PRO A CA    
109  C C     . PRO A 21  ? 0.7711 0.3685 0.4858 -0.0666 0.0290  -0.0170 125 PRO A C     
110  O O     . PRO A 21  ? 0.7585 0.3864 0.4783 -0.0703 0.0433  -0.0100 125 PRO A O     
111  C CB    . PRO A 21  ? 0.8427 0.3608 0.5309 -0.0702 0.0198  0.0049  125 PRO A CB    
112  C CG    . PRO A 21  ? 0.9130 0.4121 0.5715 -0.0529 0.0223  0.0175  125 PRO A CG    
113  C CD    . PRO A 21  ? 0.8136 0.3632 0.4672 -0.0403 0.0336  0.0152  125 PRO A CD    
114  N N     . ASP A 22  ? 0.6989 0.2950 0.4294 -0.0724 0.0177  -0.0295 126 ASP A N     
115  C CA    . ASP A 22  ? 0.6670 0.3018 0.4287 -0.0837 0.0229  -0.0324 126 ASP A CA    
116  C C     . ASP A 22  ? 0.6799 0.3251 0.4710 -0.1062 0.0324  -0.0167 126 ASP A C     
117  O O     . ASP A 22  ? 0.6663 0.2825 0.4580 -0.1187 0.0278  -0.0048 126 ASP A O     
118  C CB    . ASP A 22  ? 0.6923 0.3215 0.4616 -0.0841 0.0049  -0.0473 126 ASP A CB    
119  C CG    . ASP A 22  ? 0.7819 0.4130 0.5252 -0.0606 -0.0013 -0.0602 126 ASP A CG    
120  O OD1   . ASP A 22  ? 0.7680 0.4214 0.5013 -0.0474 0.0095  -0.0560 126 ASP A OD1   
121  O OD2   . ASP A 22  ? 0.8782 0.4924 0.6116 -0.0559 -0.0174 -0.0728 126 ASP A OD2   
122  N N     . ILE A 23  ? 0.6071 0.2939 0.4235 -0.1102 0.0454  -0.0147 127 ILE A N     
123  C CA    . ILE A 23  ? 0.6008 0.3123 0.4499 -0.1271 0.0591  0.0030  127 ILE A CA    
124  C C     . ILE A 23  ? 0.6283 0.3692 0.5154 -0.1324 0.0528  -0.0035 127 ILE A C     
125  O O     . ILE A 23  ? 0.6136 0.3834 0.5059 -0.1197 0.0622  -0.0111 127 ILE A O     
126  C CB    . ILE A 23  ? 0.6214 0.3574 0.4561 -0.1173 0.0847  0.0112  127 ILE A CB    
127  C CG1   . ILE A 23  ? 0.6458 0.3521 0.4379 -0.1100 0.0862  0.0171  127 ILE A CG1   
128  C CG2   . ILE A 23  ? 0.6367 0.4076 0.5056 -0.1304 0.1034  0.0325  127 ILE A CG2   
129  C CD1   . ILE A 23  ? 0.6033 0.3274 0.3692 -0.0986 0.1053  0.0211  127 ILE A CD1   
130  N N     . LEU A 24  ? 0.5954 0.3222 0.5040 -0.1493 0.0321  -0.0029 128 LEU A N     
131  C CA    . LEU A 24  ? 0.5750 0.3273 0.5178 -0.1547 0.0192  -0.0092 128 LEU A CA    
132  C C     . LEU A 24  ? 0.6474 0.4145 0.6391 -0.1829 0.0095  0.0084  128 LEU A C     
133  O O     . LEU A 24  ? 0.6901 0.4236 0.6806 -0.2019 -0.0018 0.0189  128 LEU A O     
134  C CB    . LEU A 24  ? 0.5761 0.2974 0.4906 -0.1449 -0.0057 -0.0311 128 LEU A CB    
135  C CG    . LEU A 24  ? 0.5947 0.3171 0.4742 -0.1190 0.0013  -0.0446 128 LEU A CG    
136  C CD1   . LEU A 24  ? 0.6215 0.3155 0.4701 -0.1085 -0.0202 -0.0609 128 LEU A CD1   
137  C CD2   . LEU A 24  ? 0.5612 0.3268 0.4639 -0.1112 0.0123  -0.0446 128 LEU A CD2   
138  N N     . THR A 25  ? 0.5782 0.3967 0.6164 -0.1864 0.0127  0.0144  129 THR A N     
139  C CA    . THR A 25  ? 0.5955 0.4435 0.6933 -0.2151 0.0010  0.0350  129 THR A CA    
140  C C     . THR A 25  ? 0.6151 0.5003 0.7449 -0.2100 -0.0118 0.0271  129 THR A C     
141  O O     . THR A 25  ? 0.5932 0.4806 0.6988 -0.1846 -0.0065 0.0095  129 THR A O     
142  C CB    . THR A 25  ? 0.7055 0.6037 0.8431 -0.2240 0.0319  0.0671  129 THR A CB    
143  O OG1   . THR A 25  ? 0.7048 0.6594 0.8597 -0.2001 0.0594  0.0679  129 THR A OG1   
144  C CG2   . THR A 25  ? 0.7500 0.6173 0.8510 -0.2242 0.0488  0.0774  129 THR A CG2   
145  N N     . PHE A 26  ? 0.5959 0.5122 0.7828 -0.2354 -0.0297 0.0433  130 PHE A N     
146  C CA    . PHE A 26  ? 0.5782 0.5388 0.8052 -0.2327 -0.0433 0.0420  130 PHE A CA    
147  C C     . PHE A 26  ? 0.5955 0.6289 0.8666 -0.2155 -0.0072 0.0601  130 PHE A C     
148  O O     . PHE A 26  ? 0.5946 0.6448 0.8683 -0.2125 0.0242  0.0759  130 PHE A O     
149  C CB    . PHE A 26  ? 0.6249 0.5915 0.8993 -0.2703 -0.0813 0.0552  130 PHE A CB    
150  C CG    . PHE A 26  ? 0.6902 0.5751 0.9136 -0.2844 -0.1191 0.0341  130 PHE A CG    
151  C CD1   . PHE A 26  ? 0.7318 0.5823 0.9090 -0.2685 -0.1439 0.0048  130 PHE A CD1   
152  C CD2   . PHE A 26  ? 0.7779 0.6180 0.9959 -0.3107 -0.1296 0.0445  130 PHE A CD2   
153  C CE1   . PHE A 26  ? 0.8005 0.5735 0.9213 -0.2737 -0.1759 -0.0176 130 PHE A CE1   
154  C CE2   . PHE A 26  ? 0.8677 0.6229 1.0314 -0.3176 -0.1649 0.0216  130 PHE A CE2   
155  C CZ    . PHE A 26  ? 0.8528 0.5756 0.9663 -0.2968 -0.1869 -0.0109 130 PHE A CZ    
156  N N     . ASN A 27  ? 0.5193 0.5941 0.8212 -0.2013 -0.0117 0.0579  131 ASN A N     
157  C CA    . ASN A 27  ? 0.4962 0.6395 0.8417 -0.1786 0.0187  0.0725  131 ASN A CA    
158  C C     . ASN A 27  ? 0.5336 0.6634 0.8319 -0.1445 0.0564  0.0611  131 ASN A C     
159  O O     . ASN A 27  ? 0.5417 0.7202 0.8655 -0.1272 0.0887  0.0756  131 ASN A O     
160  C CB    . ASN A 27  ? 0.5079 0.7223 0.9320 -0.2008 0.0281  0.1099  131 ASN A CB    
161  C CG    . ASN A 27  ? 0.8030 1.0255 1.2749 -0.2423 -0.0141 0.1237  131 ASN A CG    
162  O OD1   . ASN A 27  ? 0.6866 0.9043 1.1653 -0.2455 -0.0478 0.1119  131 ASN A OD1   
163  N ND2   . ASN A 27  ? 0.7934 1.0280 1.2995 -0.2765 -0.0152 0.1512  131 ASN A ND2   
164  N N     . LEU A 28  ? 0.4693 0.5353 0.6988 -0.1342 0.0513  0.0360  132 LEU A N     
165  C CA    . LEU A 28  ? 0.4764 0.5230 0.6587 -0.1060 0.0782  0.0235  132 LEU A CA    
166  C C     . LEU A 28  ? 0.5221 0.5776 0.7046 -0.0767 0.0802  0.0112  132 LEU A C     
167  O O     . LEU A 28  ? 0.5227 0.5773 0.7180 -0.0783 0.0559  0.0062  132 LEU A O     
168  C CB    . LEU A 28  ? 0.4768 0.4584 0.5929 -0.1083 0.0699  0.0059  132 LEU A CB    
169  C CG    . LEU A 28  ? 0.5344 0.4916 0.6326 -0.1282 0.0722  0.0151  132 LEU A CG    
170  C CD1   . LEU A 28  ? 0.5320 0.4324 0.5684 -0.1225 0.0640  -0.0026 132 LEU A CD1   
171  C CD2   . LEU A 28  ? 0.5440 0.5298 0.6480 -0.1232 0.1054  0.0326  132 LEU A CD2   
172  N N     . ASP A 29  ? 0.4823 0.5407 0.6454 -0.0490 0.1071  0.0060  133 ASP A N     
173  C CA    . ASP A 29  ? 0.4682 0.5199 0.6242 -0.0199 0.1068  -0.0072 133 ASP A CA    
174  C C     . ASP A 29  ? 0.5357 0.5263 0.6360 -0.0195 0.0898  -0.0267 133 ASP A C     
175  O O     . ASP A 29  ? 0.5329 0.5098 0.6318 -0.0099 0.0737  -0.0337 133 ASP A O     
176  C CB    . ASP A 29  ? 0.5106 0.5752 0.6549 0.0123  0.1393  -0.0098 133 ASP A CB    
177  C CG    . ASP A 29  ? 0.6102 0.7477 0.8113 0.0206  0.1640  0.0130  133 ASP A CG    
178  O OD1   . ASP A 29  ? 0.5902 0.7735 0.8525 0.0147  0.1526  0.0277  133 ASP A OD1   
179  O OD2   . ASP A 29  ? 0.6567 0.8094 0.8409 0.0353  0.1951  0.0175  133 ASP A OD2   
180  N N     . ILE A 30  ? 0.4762 0.4338 0.5323 -0.0289 0.0944  -0.0322 134 ILE A N     
181  C CA    . ILE A 30  ? 0.4593 0.3678 0.4651 -0.0274 0.0825  -0.0467 134 ILE A CA    
182  C C     . ILE A 30  ? 0.5211 0.4070 0.5007 -0.0473 0.0746  -0.0459 134 ILE A C     
183  O O     . ILE A 30  ? 0.5512 0.4431 0.5299 -0.0565 0.0868  -0.0377 134 ILE A O     
184  C CB    . ILE A 30  ? 0.5131 0.4002 0.4821 -0.0051 0.0993  -0.0581 134 ILE A CB    
185  C CG1   . ILE A 30  ? 0.4971 0.3889 0.4810 0.0213  0.1021  -0.0642 134 ILE A CG1   
186  C CG2   . ILE A 30  ? 0.5522 0.3928 0.4706 -0.0102 0.0870  -0.0686 134 ILE A CG2   
187  C CD1   . ILE A 30  ? 0.6019 0.4787 0.5531 0.0494  0.1229  -0.0763 134 ILE A CD1   
188  N N     . VAL A 31  ? 0.4707 0.3311 0.4277 -0.0513 0.0556  -0.0523 135 VAL A N     
189  C CA    . VAL A 31  ? 0.4802 0.3167 0.4064 -0.0617 0.0495  -0.0533 135 VAL A CA    
190  C C     . VAL A 31  ? 0.5290 0.3430 0.4213 -0.0533 0.0459  -0.0597 135 VAL A C     
191  O O     . VAL A 31  ? 0.5373 0.3499 0.4329 -0.0489 0.0338  -0.0610 135 VAL A O     
192  C CB    . VAL A 31  ? 0.5250 0.3574 0.4558 -0.0732 0.0298  -0.0527 135 VAL A CB    
193  C CG1   . VAL A 31  ? 0.5279 0.3324 0.4202 -0.0744 0.0255  -0.0557 135 VAL A CG1   
194  C CG2   . VAL A 31  ? 0.5271 0.3758 0.4917 -0.0881 0.0281  -0.0449 135 VAL A CG2   
195  N N     . ILE A 32  ? 0.4878 0.2862 0.3502 -0.0524 0.0549  -0.0609 136 ILE A N     
196  C CA    . ILE A 32  ? 0.4736 0.2524 0.3056 -0.0490 0.0476  -0.0644 136 ILE A CA    
197  C C     . ILE A 32  ? 0.5099 0.2864 0.3317 -0.0548 0.0365  -0.0591 136 ILE A C     
198  O O     . ILE A 32  ? 0.5186 0.2908 0.3315 -0.0583 0.0402  -0.0561 136 ILE A O     
199  C CB    . ILE A 32  ? 0.5371 0.3019 0.3384 -0.0446 0.0587  -0.0680 136 ILE A CB    
200  C CG1   . ILE A 32  ? 0.5635 0.3331 0.3686 -0.0316 0.0746  -0.0745 136 ILE A CG1   
201  C CG2   . ILE A 32  ? 0.5751 0.3200 0.3488 -0.0455 0.0441  -0.0706 136 ILE A CG2   
202  C CD1   . ILE A 32  ? 0.5440 0.3002 0.3518 -0.0198 0.0662  -0.0846 136 ILE A CD1   
203  N N     . ILE A 33  ? 0.4567 0.2362 0.2793 -0.0540 0.0236  -0.0561 137 ILE A N     
204  C CA    . ILE A 33  ? 0.4374 0.2232 0.2498 -0.0533 0.0161  -0.0494 137 ILE A CA    
205  C C     . ILE A 33  ? 0.4994 0.2854 0.2976 -0.0543 0.0111  -0.0421 137 ILE A C     
206  O O     . ILE A 33  ? 0.4630 0.2507 0.2685 -0.0579 0.0019  -0.0375 137 ILE A O     
207  C CB    . ILE A 33  ? 0.4679 0.2681 0.2939 -0.0509 0.0063  -0.0460 137 ILE A CB    
208  C CG1   . ILE A 33  ? 0.4724 0.2746 0.3160 -0.0526 0.0058  -0.0528 137 ILE A CG1   
209  C CG2   . ILE A 33  ? 0.4735 0.2856 0.2833 -0.0439 0.0018  -0.0383 137 ILE A CG2   
210  C CD1   . ILE A 33  ? 0.5019 0.3196 0.3617 -0.0499 -0.0066 -0.0489 137 ILE A CD1   
211  N N     . GLY A 34  ? 0.5135 0.2963 0.2936 -0.0526 0.0147  -0.0394 138 GLY A N     
212  C CA    . GLY A 34  ? 0.5112 0.3009 0.2814 -0.0547 0.0073  -0.0295 138 GLY A CA    
213  C C     . GLY A 34  ? 0.5525 0.3701 0.3299 -0.0490 0.0022  -0.0154 138 GLY A C     
214  O O     . GLY A 34  ? 0.5258 0.3512 0.3077 -0.0416 0.0045  -0.0166 138 GLY A O     
215  N N     . ILE A 35  ? 0.5229 0.3596 0.3015 -0.0517 -0.0054 -0.0004 139 ILE A N     
216  C CA    . ILE A 35  ? 0.5047 0.3806 0.2942 -0.0436 -0.0067 0.0185  139 ILE A CA    
217  C C     . ILE A 35  ? 0.5750 0.4548 0.3472 -0.0228 0.0038  0.0169  139 ILE A C     
218  O O     . ILE A 35  ? 0.5497 0.4329 0.3142 -0.0072 0.0100  0.0128  139 ILE A O     
219  C CB    . ILE A 35  ? 0.5406 0.4409 0.3467 -0.0579 -0.0211 0.0394  139 ILE A CB    
220  C CG1   . ILE A 35  ? 0.5557 0.4343 0.3729 -0.0773 -0.0347 0.0368  139 ILE A CG1   
221  C CG2   . ILE A 35  ? 0.5251 0.4812 0.3488 -0.0486 -0.0191 0.0666  139 ILE A CG2   
222  C CD1   . ILE A 35  ? 0.6005 0.4801 0.4296 -0.0994 -0.0576 0.0515  139 ILE A CD1   
223  N N     . ASN A 36  ? 0.5313 0.4032 0.2925 -0.0216 0.0036  0.0184  140 ASN A N     
224  C CA    . ASN A 36  ? 0.5380 0.4032 0.2813 -0.0014 0.0113  0.0173  140 ASN A CA    
225  C C     . ASN A 36  ? 0.6421 0.4906 0.3741 -0.0085 0.0082  0.0183  140 ASN A C     
226  O O     . ASN A 36  ? 0.6533 0.5076 0.3912 -0.0252 -0.0017 0.0228  140 ASN A O     
227  C CB    . ASN A 36  ? 0.5352 0.4454 0.2850 0.0196  0.0138  0.0361  140 ASN A CB    
228  C CG    . ASN A 36  ? 0.7090 0.6586 0.4780 0.0122  0.0050  0.0592  140 ASN A CG    
229  O OD1   . ASN A 36  ? 0.7239 0.6846 0.5115 -0.0117 -0.0072 0.0670  140 ASN A OD1   
230  N ND2   . ASN A 36  ? 0.5436 0.5144 0.3097 0.0330  0.0083  0.0714  140 ASN A ND2   
231  N N     . PRO A 37  ? 0.6190 0.4445 0.3316 0.0043  0.0139  0.0156  141 PRO A N     
232  C CA    . PRO A 37  ? 0.6393 0.4510 0.3375 -0.0023 0.0109  0.0198  141 PRO A CA    
233  C C     . PRO A 37  ? 0.6985 0.5474 0.4047 -0.0004 -0.0003 0.0391  141 PRO A C     
234  O O     . PRO A 37  ? 0.6774 0.5606 0.3966 0.0167  -0.0001 0.0531  141 PRO A O     
235  C CB    . PRO A 37  ? 0.6880 0.4653 0.3666 0.0118  0.0186  0.0167  141 PRO A CB    
236  C CG    . PRO A 37  ? 0.7171 0.4801 0.3982 0.0199  0.0231  0.0042  141 PRO A CG    
237  C CD    . PRO A 37  ? 0.6336 0.4366 0.3319 0.0244  0.0208  0.0080  141 PRO A CD    
238  N N     . GLY A 38  ? 0.6987 0.5427 0.3968 -0.0173 -0.0109 0.0400  142 GLY A N     
239  C CA    . GLY A 38  ? 0.7153 0.5894 0.4181 -0.0203 -0.0274 0.0583  142 GLY A CA    
240  C C     . GLY A 38  ? 0.8011 0.6630 0.4816 -0.0049 -0.0242 0.0655  142 GLY A C     
241  O O     . GLY A 38  ? 0.8026 0.6288 0.4648 0.0046  -0.0100 0.0565  142 GLY A O     
242  N N     . LEU A 39  ? 0.7596 0.6512 0.4439 -0.0038 -0.0398 0.0843  143 LEU A N     
243  C CA    . LEU A 39  ? 0.7751 0.6592 0.4395 0.0123  -0.0401 0.0958  143 LEU A CA    
244  C C     . LEU A 39  ? 0.8260 0.6605 0.4490 0.0047  -0.0352 0.0846  143 LEU A C     
245  O O     . LEU A 39  ? 0.8260 0.6333 0.4323 0.0192  -0.0238 0.0879  143 LEU A O     
246  C CB    . LEU A 39  ? 0.7833 0.7166 0.4645 0.0121  -0.0619 0.1203  143 LEU A CB    
247  C CG    . LEU A 39  ? 0.8212 0.8174 0.5472 0.0287  -0.0617 0.1419  143 LEU A CG    
248  C CD1   . LEU A 39  ? 0.8360 0.8866 0.5845 0.0240  -0.0861 0.1698  143 LEU A CD1   
249  C CD2   . LEU A 39  ? 0.8625 0.8513 0.5843 0.0669  -0.0408 0.1435  143 LEU A CD2   
250  N N     . MET A 40  ? 0.7891 0.6098 0.3941 -0.0165 -0.0429 0.0722  144 MET A N     
251  C CA    . MET A 40  ? 0.8152 0.5979 0.3784 -0.0209 -0.0347 0.0633  144 MET A CA    
252  C C     . MET A 40  ? 0.8297 0.5828 0.3933 -0.0183 -0.0096 0.0521  144 MET A C     
253  O O     . MET A 40  ? 0.8399 0.5694 0.3805 -0.0147 0.0020  0.0576  144 MET A O     
254  C CB    . MET A 40  ? 0.8742 0.6478 0.4122 -0.0382 -0.0494 0.0495  144 MET A CB    
255  C CG    . MET A 40  ? 0.9651 0.7081 0.4517 -0.0373 -0.0403 0.0432  144 MET A CG    
256  S SD    . MET A 40  ? 1.0644 0.8111 0.5221 -0.0255 -0.0467 0.0687  144 MET A SD    
257  C CE    . MET A 40  ? 1.0600 0.8228 0.4966 -0.0377 -0.0865 0.0686  144 MET A CE    
258  N N     . ALA A 41  ? 0.7449 0.4249 0.3741 0.0655  -0.0453 0.0548  145 ALA A N     
259  C CA    . ALA A 41  ? 0.7347 0.4017 0.3704 0.0547  -0.0187 0.0458  145 ALA A CA    
260  C C     . ALA A 41  ? 0.8019 0.4462 0.4313 0.0632  -0.0053 0.0512  145 ALA A C     
261  O O     . ALA A 41  ? 0.8319 0.4402 0.4403 0.0575  0.0160  0.0498  145 ALA A O     
262  C CB    . ALA A 41  ? 0.6846 0.3908 0.3654 0.0436  -0.0183 0.0347  145 ALA A CB    
263  N N     . ALA A 42  ? 0.7483 0.4106 0.3949 0.0776  -0.0161 0.0586  146 ALA A N     
264  C CA    . ALA A 42  ? 0.7675 0.4034 0.4031 0.0902  -0.0034 0.0648  146 ALA A CA    
265  C C     . ALA A 42  ? 0.8795 0.4682 0.4672 0.1005  0.0045  0.0771  146 ALA A C     
266  O O     . ALA A 42  ? 0.9116 0.4580 0.4790 0.0999  0.0267  0.0771  146 ALA A O     
267  C CB    . ALA A 42  ? 0.7573 0.4231 0.4170 0.1091  -0.0169 0.0752  146 ALA A CB    
268  N N     . TYR A 43  ? 0.8582 0.4520 0.4259 0.1098  -0.0142 0.0874  147 TYR A N     
269  C CA    . TYR A 43  ? 0.9098 0.4610 0.4259 0.1234  -0.0097 0.1008  147 TYR A CA    
270  C C     . TYR A 43  ? 0.9750 0.4814 0.4598 0.1101  0.0170  0.0952  147 TYR A C     
271  O O     . TYR A 43  ? 1.0172 0.4775 0.4725 0.1171  0.0389  0.1035  147 TYR A O     
272  C CB    . TYR A 43  ? 0.9202 0.4902 0.4201 0.1333  -0.0404 0.1093  147 TYR A CB    
273  C CG    . TYR A 43  ? 0.9955 0.5228 0.4356 0.1512  -0.0387 0.1242  147 TYR A CG    
274  C CD1   . TYR A 43  ? 1.0551 0.5447 0.4487 0.1452  -0.0276 0.1209  147 TYR A CD1   
275  C CD2   . TYR A 43  ? 1.0387 0.5626 0.4665 0.1773  -0.0464 0.1438  147 TYR A CD2   
276  C CE1   . TYR A 43  ? 1.0844 0.5305 0.4168 0.1647  -0.0232 0.1362  147 TYR A CE1   
277  C CE2   . TYR A 43  ? 1.1109 0.5951 0.4801 0.1970  -0.0446 0.1594  147 TYR A CE2   
278  C CZ    . TYR A 43  ? 1.2008 0.6449 0.5205 0.1906  -0.0331 0.1553  147 TYR A CZ    
279  O OH    . TYR A 43  ? 1.3193 0.7210 0.5754 0.2132  -0.0296 0.1724  147 TYR A OH    
280  N N     . LYS A 44  ? 0.9088 0.4275 0.3998 0.0928  0.0166  0.0834  148 LYS A N     
281  C CA    . LYS A 44  ? 0.9280 0.4114 0.3932 0.0816  0.0420  0.0807  148 LYS A CA    
282  C C     . LYS A 44  ? 0.9790 0.4542 0.4728 0.0638  0.0689  0.0719  148 LYS A C     
283  O O     . LYS A 44  ? 0.9977 0.4345 0.4715 0.0580  0.0955  0.0758  148 LYS A O     
284  C CB    . LYS A 44  ? 0.9140 0.4149 0.3771 0.0721  0.0329  0.0720  148 LYS A CB    
285  C CG    . LYS A 44  ? 0.9422 0.4412 0.3675 0.0860  0.0057  0.0778  148 LYS A CG    
286  C CD    . LYS A 44  ? 1.0132 0.4582 0.3701 0.1004  0.0179  0.0901  148 LYS A CD    
287  C CE    . LYS A 44  ? 1.0913 0.5332 0.4051 0.1154  -0.0137 0.0950  148 LYS A CE    
288  N NZ    . LYS A 44  ? 1.1823 0.5683 0.4216 0.1318  -0.0002 0.1068  148 LYS A NZ    
289  N N     . GLY A 45  ? 0.8887 0.4002 0.4290 0.0547  0.0615  0.0604  149 GLY A N     
290  C CA    . GLY A 45  ? 0.8594 0.3691 0.4288 0.0356  0.0802  0.0487  149 GLY A CA    
291  C C     . GLY A 45  ? 0.8587 0.3901 0.4502 0.0164  0.0883  0.0393  149 GLY A C     
292  O O     . GLY A 45  ? 0.8391 0.3678 0.4528 -0.0020 0.1063  0.0320  149 GLY A O     
293  N N     . HIS A 46  ? 0.7761 0.3299 0.3631 0.0206  0.0744  0.0397  150 HIS A N     
294  C CA    . HIS A 46  ? 0.7444 0.3192 0.3502 0.0072  0.0825  0.0326  150 HIS A CA    
295  C C     . HIS A 46  ? 0.7239 0.3446 0.3558 0.0082  0.0598  0.0252  150 HIS A C     
296  O O     . HIS A 46  ? 0.7159 0.3454 0.3409 0.0200  0.0378  0.0285  150 HIS A O     
297  C CB    . HIS A 46  ? 0.7910 0.3309 0.3542 0.0112  0.0986  0.0415  150 HIS A CB    
298  C CG    . HIS A 46  ? 0.8786 0.3750 0.4230 0.0081  0.1276  0.0504  150 HIS A CG    
299  N ND1   . HIS A 46  ? 0.8843 0.3840 0.4585 -0.0102 0.1534  0.0481  150 HIS A ND1   
300  C CD2   . HIS A 46  ? 0.9583 0.4079 0.4581 0.0216  0.1350  0.0634  150 HIS A CD2   
301  C CE1   . HIS A 46  ? 0.9404 0.3940 0.4907 -0.0097 0.1765  0.0589  150 HIS A CE1   
302  N NE2   . HIS A 46  ? 0.9821 0.4020 0.4844 0.0106  0.1674  0.0687  150 HIS A NE2   
303  N N     . HIS A 47  ? 0.6477 0.2975 0.3110 -0.0035 0.0665  0.0171  151 HIS A N     
304  C CA    . HIS A 47  ? 0.6154 0.3063 0.3058 -0.0033 0.0511  0.0108  151 HIS A CA    
305  C C     . HIS A 47  ? 0.6653 0.3462 0.3270 0.0032  0.0428  0.0134  151 HIS A C     
306  O O     . HIS A 47  ? 0.6522 0.3067 0.2854 0.0029  0.0586  0.0162  151 HIS A O     
307  C CB    . HIS A 47  ? 0.5948 0.3188 0.3269 -0.0160 0.0630  0.0030  151 HIS A CB    
308  C CG    . HIS A 47  ? 0.6430 0.3781 0.4017 -0.0239 0.0642  -0.0034 151 HIS A CG    
309  N ND1   . HIS A 47  ? 0.6377 0.4072 0.4244 -0.0216 0.0495  -0.0104 151 HIS A ND1   
310  C CD2   . HIS A 47  ? 0.6918 0.4016 0.4471 -0.0332 0.0780  -0.0040 151 HIS A CD2   
311  C CE1   . HIS A 47  ? 0.6363 0.3992 0.4317 -0.0292 0.0533  -0.0169 151 HIS A CE1   
312  N NE2   . HIS A 47  ? 0.6739 0.4008 0.4531 -0.0379 0.0698  -0.0139 151 HIS A NE2   
313  N N     . TYR A 48  ? 0.6247 0.3261 0.2954 0.0086  0.0191  0.0122  152 TYR A N     
314  C CA    . TYR A 48  ? 0.6471 0.3413 0.2959 0.0117  0.0045  0.0115  152 TYR A CA    
315  C C     . TYR A 48  ? 0.7424 0.3901 0.3313 0.0187  0.0022  0.0164  152 TYR A C     
316  O O     . TYR A 48  ? 0.7263 0.3503 0.2832 0.0187  0.0091  0.0137  152 TYR A O     
317  C CB    . TYR A 48  ? 0.6291 0.3371 0.2929 0.0059  0.0150  0.0051  152 TYR A CB    
318  C CG    . TYR A 48  ? 0.5661 0.3198 0.2841 0.0019  0.0167  0.0017  152 TYR A CG    
319  C CD1   . TYR A 48  ? 0.5469 0.3295 0.2931 0.0047  -0.0021 0.0018  152 TYR A CD1   
320  C CD2   . TYR A 48  ? 0.5612 0.3305 0.3029 -0.0038 0.0366  -0.0005 152 TYR A CD2   
321  C CE1   . TYR A 48  ? 0.5391 0.3602 0.3279 0.0046  0.0003  -0.0002 152 TYR A CE1   
322  C CE2   . TYR A 48  ? 0.5384 0.3493 0.3242 -0.0058 0.0348  -0.0043 152 TYR A CE2   
323  C CZ    . TYR A 48  ? 0.5432 0.3776 0.3484 -0.0001 0.0175  -0.0041 152 TYR A CZ    
324  O OH    . TYR A 48  ? 0.4801 0.3523 0.3214 0.0012  0.0173  -0.0070 152 TYR A OH    
325  N N     . PRO A 49  ? 0.7459 0.3794 0.3159 0.0275  -0.0080 0.0244  153 PRO A N     
326  C CA    . PRO A 49  ? 0.8042 0.3953 0.3134 0.0374  -0.0135 0.0304  153 PRO A CA    
327  C C     . PRO A 49  ? 0.8927 0.4886 0.3865 0.0405  -0.0475 0.0284  153 PRO A C     
328  O O     . PRO A 49  ? 0.9689 0.5300 0.4066 0.0488  -0.0573 0.0311  153 PRO A O     
329  C CB    . PRO A 49  ? 0.8352 0.4132 0.3370 0.0468  -0.0090 0.0413  153 PRO A CB    
330  C CG    . PRO A 49  ? 0.8457 0.4645 0.4004 0.0450  -0.0191 0.0404  153 PRO A CG    
331  C CD    . PRO A 49  ? 0.7447 0.3981 0.3438 0.0318  -0.0147 0.0293  153 PRO A CD    
332  N N     . GLY A 50  ? 0.8006 0.4383 0.3430 0.0337  -0.0654 0.0241  154 GLY A N     
333  C CA    . GLY A 50  ? 0.8397 0.4884 0.3815 0.0316  -0.0987 0.0217  154 GLY A CA    
334  C C     . GLY A 50  ? 0.9721 0.5792 0.4565 0.0292  -0.1025 0.0129  154 GLY A C     
335  O O     . GLY A 50  ? 0.9907 0.5859 0.4713 0.0233  -0.0816 0.0051  154 GLY A O     
336  N N     . PRO A 51  ? 0.9681 0.5481 0.4004 0.0365  -0.1261 0.0148  155 PRO A N     
337  C CA    . PRO A 51  ? 1.0296 0.5602 0.3938 0.0365  -0.1286 0.0048  155 PRO A CA    
338  C C     . PRO A 51  ? 1.0491 0.5820 0.4261 0.0217  -0.1375 -0.0098 155 PRO A C     
339  O O     . PRO A 51  ? 1.0871 0.5768 0.4145 0.0218  -0.1253 -0.0193 155 PRO A O     
340  C CB    . PRO A 51  ? 1.1227 0.6343 0.4364 0.0470  -0.1607 0.0095  155 PRO A CB    
341  C CG    . PRO A 51  ? 1.1422 0.7034 0.5108 0.0499  -0.1805 0.0217  155 PRO A CG    
342  C CD    . PRO A 51  ? 1.0143 0.6076 0.4454 0.0471  -0.1516 0.0267  155 PRO A CD    
343  N N     . GLY A 52  ? 0.9476 0.5286 0.3915 0.0108  -0.1542 -0.0100 156 GLY A N     
344  C CA    . GLY A 52  ? 0.9223 0.5100 0.3905 -0.0040 -0.1608 -0.0214 156 GLY A CA    
345  C C     . GLY A 52  ? 0.8647 0.4791 0.3846 -0.0069 -0.1301 -0.0204 156 GLY A C     
346  O O     . GLY A 52  ? 0.8465 0.4598 0.3810 -0.0160 -0.1271 -0.0284 156 GLY A O     
347  N N     . ASN A 53  ? 0.8065 0.4429 0.3524 0.0009  -0.1072 -0.0110 157 ASN A N     
348  C CA    . ASN A 53  ? 0.7358 0.4007 0.3290 -0.0012 -0.0813 -0.0105 157 ASN A CA    
349  C C     . ASN A 53  ? 0.7955 0.4278 0.3566 -0.0009 -0.0560 -0.0176 157 ASN A C     
350  O O     . ASN A 53  ? 0.8617 0.4504 0.3649 0.0050  -0.0474 -0.0191 157 ASN A O     
351  C CB    . ASN A 53  ? 0.7217 0.4103 0.3415 0.0052  -0.0656 -0.0018 157 ASN A CB    
352  C CG    . ASN A 53  ? 0.7057 0.4344 0.3810 0.0028  -0.0510 -0.0015 157 ASN A CG    
353  O OD1   . ASN A 53  ? 0.6649 0.3928 0.3438 0.0017  -0.0282 -0.0047 157 ASN A OD1   
354  N ND2   . ASN A 53  ? 0.6051 0.3709 0.3241 0.0040  -0.0631 0.0038  157 ASN A ND2   
355  N N     . HIS A 54  ? 0.7031 0.3542 0.2985 -0.0047 -0.0439 -0.0205 158 HIS A N     
356  C CA    . HIS A 54  ? 0.6966 0.3191 0.2658 -0.0022 -0.0202 -0.0257 158 HIS A CA    
357  C C     . HIS A 54  ? 0.7231 0.3612 0.3095 0.0043  0.0134  -0.0196 158 HIS A C     
358  O O     . HIS A 54  ? 0.7498 0.3657 0.3145 0.0096  0.0372  -0.0206 158 HIS A O     
359  C CB    . HIS A 54  ? 0.6627 0.2938 0.2584 -0.0083 -0.0245 -0.0306 158 HIS A CB    
360  C CG    . HIS A 54  ? 0.7176 0.3327 0.3023 -0.0192 -0.0573 -0.0377 158 HIS A CG    
361  N ND1   . HIS A 54  ? 0.7116 0.3519 0.3435 -0.0279 -0.0675 -0.0377 158 HIS A ND1   
362  C CD2   . HIS A 54  ? 0.7939 0.3697 0.3256 -0.0229 -0.0811 -0.0451 158 HIS A CD2   
363  C CE1   . HIS A 54  ? 0.7304 0.3488 0.3434 -0.0397 -0.0979 -0.0451 158 HIS A CE1   
364  N NE2   . HIS A 54  ? 0.7948 0.3763 0.3473 -0.0369 -0.1096 -0.0503 158 HIS A NE2   
365  N N     . PHE A 55  ? 0.6435 0.3175 0.2674 0.0040  0.0159  -0.0132 159 PHE A N     
366  C CA    . PHE A 55  ? 0.6101 0.3061 0.2603 0.0060  0.0435  -0.0087 159 PHE A CA    
367  C C     . PHE A 55  ? 0.6908 0.3502 0.2998 0.0114  0.0707  -0.0058 159 PHE A C     
368  O O     . PHE A 55  ? 0.6700 0.3381 0.2920 0.0151  0.0940  -0.0037 159 PHE A O     
369  C CB    . PHE A 55  ? 0.5972 0.3256 0.2832 0.0029  0.0401  -0.0050 159 PHE A CB    
370  C CG    . PHE A 55  ? 0.5934 0.3408 0.3040 0.0011  0.0653  -0.0021 159 PHE A CG    
371  C CD1   . PHE A 55  ? 0.5767 0.3661 0.3323 0.0009  0.0733  -0.0025 159 PHE A CD1   
372  C CD2   . PHE A 55  ? 0.6262 0.3501 0.3159 -0.0002 0.0815  0.0022  159 PHE A CD2   
373  C CE1   . PHE A 55  ? 0.5556 0.3680 0.3385 -0.0023 0.0931  0.0003  159 PHE A CE1   
374  C CE2   . PHE A 55  ? 0.6070 0.3518 0.3271 -0.0053 0.1040  0.0054  159 PHE A CE2   
375  C CZ    . PHE A 55  ? 0.5400 0.3310 0.3078 -0.0070 0.1080  0.0039  159 PHE A CZ    
376  N N     . TRP A 56  ? 0.6964 0.3193 0.2606 0.0140  0.0703  -0.0032 160 TRP A N     
377  C CA    . TRP A 56  ? 0.7545 0.3425 0.2805 0.0211  0.1003  0.0026  160 TRP A CA    
378  C C     . TRP A 56  ? 0.8590 0.4074 0.3381 0.0298  0.1115  -0.0012 160 TRP A C     
379  O O     . TRP A 56  ? 0.8767 0.4169 0.3507 0.0369  0.1440  0.0051  160 TRP A O     
380  C CB    . TRP A 56  ? 0.7814 0.3355 0.2656 0.0246  0.0996  0.0083  160 TRP A CB    
381  C CG    . TRP A 56  ? 0.7637 0.3475 0.2897 0.0174  0.0967  0.0127  160 TRP A CG    
382  C CD1   . TRP A 56  ? 0.7744 0.3700 0.3104 0.0154  0.0697  0.0114  160 TRP A CD1   
383  C CD2   . TRP A 56  ? 0.7473 0.3558 0.3163 0.0104  0.1210  0.0182  160 TRP A CD2   
384  N NE1   . TRP A 56  ? 0.7328 0.3502 0.3061 0.0094  0.0777  0.0150  160 TRP A NE1   
385  C CE2   . TRP A 56  ? 0.7452 0.3713 0.3405 0.0041  0.1070  0.0178  160 TRP A CE2   
386  C CE3   . TRP A 56  ? 0.7748 0.3909 0.3622 0.0089  0.1538  0.0242  160 TRP A CE3   
387  C CZ2   . TRP A 56  ? 0.7170 0.3626 0.3519 -0.0061 0.1223  0.0202  160 TRP A CZ2   
388  C CZ3   . TRP A 56  ? 0.7769 0.4203 0.4116 -0.0025 0.1676  0.0281  160 TRP A CZ3   
389  C CH2   . TRP A 56  ? 0.7622 0.4178 0.4184 -0.0111 0.1508  0.0246  160 TRP A CH2   
390  N N     . LYS A 57  ? 0.8580 0.3808 0.3033 0.0291  0.0853  -0.0111 161 LYS A N     
391  C CA    . LYS A 57  ? 0.9140 0.3910 0.3087 0.0358  0.0917  -0.0184 161 LYS A CA    
392  C C     . LYS A 57  ? 0.9132 0.4177 0.3511 0.0380  0.1142  -0.0165 161 LYS A C     
393  O O     . LYS A 57  ? 0.9291 0.4069 0.3397 0.0499  0.1449  -0.0130 161 LYS A O     
394  C CB    . LYS A 57  ? 0.9936 0.4515 0.3648 0.0279  0.0527  -0.0311 161 LYS A CB    
395  C CG    . LYS A 57  ? 1.3052 0.7062 0.5964 0.0326  0.0359  -0.0366 161 LYS A CG    
396  C CD    . LYS A 57  ? 1.5904 0.9379 0.8253 0.0324  0.0263  -0.0516 161 LYS A CD    
397  C CE    . LYS A 57  ? 1.7283 1.0834 0.9742 0.0163  -0.0197 -0.0630 161 LYS A CE    
398  N NZ    . LYS A 57  ? 1.9236 1.2184 1.1079 0.0129  -0.0325 -0.0801 161 LYS A NZ    
399  N N     . CYS A 58  ? 0.7972 0.3560 0.3020 0.0293  0.1009  -0.0168 162 CYS A N     
400  C CA    . CYS A 58  ? 0.7598 0.3515 0.3093 0.0333  0.1195  -0.0131 162 CYS A CA    
401  C C     . CYS A 58  ? 0.7981 0.4184 0.3766 0.0402  0.1520  -0.0013 162 CYS A C     
402  O O     . CYS A 58  ? 0.8145 0.4372 0.3992 0.0507  0.1770  0.0037  162 CYS A O     
403  C CB    . CYS A 58  ? 0.7000 0.3404 0.3077 0.0250  0.0980  -0.0145 162 CYS A CB    
404  S SG    . CYS A 58  ? 0.7681 0.3807 0.3575 0.0164  0.0673  -0.0256 162 CYS A SG    
405  N N     . LEU A 59  ? 0.6625 0.3446 0.3709 -0.0245 0.1258  -0.0269 163 LEU A N     
406  C CA    . LEU A 59  ? 0.6506 0.3566 0.4005 -0.0122 0.1485  -0.0223 163 LEU A CA    
407  C C     . LEU A 59  ? 0.7573 0.4363 0.4829 0.0031  0.1766  -0.0299 163 LEU A C     
408  O O     . LEU A 59  ? 0.7693 0.4651 0.5301 0.0178  0.1934  -0.0330 163 LEU A O     
409  C CB    . LEU A 59  ? 0.6344 0.3673 0.4004 -0.0192 0.1514  -0.0143 163 LEU A CB    
410  C CG    . LEU A 59  ? 0.6679 0.4386 0.4895 -0.0177 0.1658  -0.0090 163 LEU A CG    
411  C CD1   . LEU A 59  ? 0.6209 0.4235 0.4871 -0.0214 0.1455  -0.0057 163 LEU A CD1   
412  C CD2   . LEU A 59  ? 0.6782 0.4515 0.4931 -0.0264 0.1756  -0.0025 163 LEU A CD2   
413  N N     . PHE A 60  ? 0.7482 0.3889 0.4136 0.0009  0.1809  -0.0349 164 PHE A N     
414  C CA    . PHE A 60  ? 0.7984 0.4091 0.4294 0.0138  0.2092  -0.0440 164 PHE A CA    
415  C C     . PHE A 60  ? 0.9065 0.4808 0.5171 0.0273  0.2072  -0.0563 164 PHE A C     
416  O O     . PHE A 60  ? 0.9148 0.4926 0.5435 0.0478  0.2299  -0.0643 164 PHE A O     
417  C CB    . PHE A 60  ? 0.8485 0.4254 0.4135 0.0065  0.2141  -0.0438 164 PHE A CB    
418  C CG    . PHE A 60  ? 0.9307 0.4671 0.4434 0.0170  0.2417  -0.0552 164 PHE A CG    
419  C CD1   . PHE A 60  ? 0.9804 0.5351 0.5158 0.0274  0.2800  -0.0593 164 PHE A CD1   
420  C CD2   . PHE A 60  ? 1.0107 0.4949 0.4514 0.0152  0.2301  -0.0641 164 PHE A CD2   
421  C CE1   . PHE A 60  ? 1.0607 0.5809 0.5452 0.0375  0.3096  -0.0722 164 PHE A CE1   
422  C CE2   . PHE A 60  ? 1.1247 0.5671 0.5099 0.0253  0.2568  -0.0762 164 PHE A CE2   
423  C CZ    . PHE A 60  ? 1.1103 0.5706 0.5171 0.0374  0.2977  -0.0804 164 PHE A CZ    
424  N N     . MET A 61  ? 0.8938 0.4337 0.4665 0.0158  0.1803  -0.0596 165 MET A N     
425  C CA    . MET A 61  ? 0.9508 0.4386 0.4890 0.0237  0.1746  -0.0710 165 MET A CA    
426  C C     . MET A 61  ? 0.9628 0.4606 0.5477 0.0430  0.1752  -0.0700 165 MET A C     
427  O O     . MET A 61  ? 0.9916 0.4452 0.5523 0.0636  0.1810  -0.0811 165 MET A O     
428  C CB    . MET A 61  ? 1.0072 0.4658 0.5045 -0.0024 0.1433  -0.0730 165 MET A CB    
429  C CG    . MET A 61  ? 1.1029 0.5400 0.5420 -0.0157 0.1375  -0.0796 165 MET A CG    
430  S SD    . MET A 61  ? 1.1692 0.6114 0.5889 -0.0522 0.0979  -0.0823 165 MET A SD    
431  C CE    . MET A 61  ? 1.2141 0.5774 0.5726 -0.0602 0.0923  -0.0967 165 MET A CE    
432  N N     . SER A 62  ? 0.8479 0.4004 0.4955 0.0391  0.1677  -0.0579 166 SER A N     
433  C CA    . SER A 62  ? 0.8236 0.3919 0.5172 0.0581  0.1634  -0.0557 166 SER A CA    
434  C C     . SER A 62  ? 0.8650 0.4773 0.6090 0.0853  0.1913  -0.0612 166 SER A C     
435  O O     . SER A 62  ? 0.8751 0.4979 0.6532 0.1098  0.1879  -0.0643 166 SER A O     
436  C CB    . SER A 62  ? 0.7488 0.3557 0.4822 0.0395  0.1410  -0.0416 166 SER A CB    
437  O OG    . SER A 62  ? 0.7171 0.3834 0.4947 0.0313  0.1504  -0.0346 166 SER A OG    
438  N N     . GLY A 63  ? 0.7906 0.4317 0.5403 0.0789  0.2168  -0.0621 167 GLY A N     
439  C CA    . GLY A 63  ? 0.7701 0.4636 0.5702 0.0947  0.2477  -0.0682 167 GLY A CA    
440  C C     . GLY A 63  ? 0.7590 0.5198 0.6270 0.0817  0.2450  -0.0572 167 GLY A C     
441  O O     . GLY A 63  ? 0.7433 0.5588 0.6654 0.0912  0.2668  -0.0630 167 GLY A O     
442  N N     . LEU A 64  ? 0.6827 0.4438 0.5498 0.0589  0.2185  -0.0434 168 LEU A N     
443  C CA    . LEU A 64  ? 0.6246 0.4389 0.5451 0.0442  0.2135  -0.0336 168 LEU A CA    
444  C C     . LEU A 64  ? 0.6986 0.5274 0.6137 0.0271  0.2394  -0.0310 168 LEU A C     
445  O O     . LEU A 64  ? 0.6773 0.5520 0.6392 0.0168  0.2481  -0.0276 168 LEU A O     
446  C CB    . LEU A 64  ? 0.5898 0.3967 0.5043 0.0276  0.1804  -0.0228 168 LEU A CB    
447  C CG    . LEU A 64  ? 0.6184 0.4247 0.5523 0.0377  0.1558  -0.0211 168 LEU A CG    
448  C CD1   . LEU A 64  ? 0.5973 0.3846 0.5047 0.0165  0.1290  -0.0132 168 LEU A CD1   
449  C CD2   . LEU A 64  ? 0.5864 0.4509 0.5893 0.0452  0.1550  -0.0196 168 LEU A CD2   
450  N N     . SER A 65  ? 0.6969 0.4803 0.5483 0.0228  0.2510  -0.0329 169 SER A N     
451  C CA    . SER A 65  ? 0.7245 0.5009 0.5477 0.0097  0.2796  -0.0313 169 SER A CA    
452  C C     . SER A 65  ? 0.8544 0.6025 0.6379 0.0253  0.3062  -0.0450 169 SER A C     
453  O O     . SER A 65  ? 0.8666 0.5745 0.6136 0.0388  0.2922  -0.0517 169 SER A O     
454  C CB    . SER A 65  ? 0.7441 0.4851 0.5165 -0.0079 0.2632  -0.0200 169 SER A CB    
455  O OG    . SER A 65  ? 0.8537 0.5454 0.5630 -0.0038 0.2476  -0.0229 169 SER A OG    
456  N N     . GLU A 66  ? 0.8506 0.6223 0.6439 0.0225  0.3459  -0.0511 170 GLU A N     
457  C CA    . GLU A 66  ? 0.9135 0.6661 0.6722 0.0381  0.3774  -0.0669 170 GLU A CA    
458  C C     . GLU A 66  ? 1.0214 0.7051 0.6832 0.0266  0.3840  -0.0639 170 GLU A C     
459  O O     . GLU A 66  ? 1.0718 0.7250 0.6880 0.0393  0.4048  -0.0774 170 GLU A O     
460  C CB    . GLU A 66  ? 0.9398 0.7570 0.7526 0.0385  0.4210  -0.0781 170 GLU A CB    
461  C CG    . GLU A 66  ? 1.0278 0.9172 0.9354 0.0595  0.4145  -0.0874 170 GLU A CG    
462  C CD    . GLU A 66  ? 1.1869 1.1344 1.1632 0.0392  0.4024  -0.0765 170 GLU A CD    
463  O OE1   . GLU A 66  ? 1.0492 1.0541 1.0994 0.0578  0.3909  -0.0838 170 GLU A OE1   
464  O OE2   . GLU A 66  ? 1.0265 0.9593 0.9796 0.0065  0.4033  -0.0618 170 GLU A OE2   
465  N N     . VAL A 67  ? 0.9730 0.6313 0.6013 0.0050  0.3652  -0.0473 171 VAL A N     
466  C CA    . VAL A 67  ? 1.0244 0.6168 0.5593 -0.0042 0.3611  -0.0418 171 VAL A CA    
467  C C     . VAL A 67  ? 1.0230 0.5975 0.5458 -0.0070 0.3132  -0.0321 171 VAL A C     
468  O O     . VAL A 67  ? 0.9360 0.5494 0.5201 -0.0081 0.2920  -0.0270 171 VAL A O     
469  C CB    . VAL A 67  ? 1.1236 0.6997 0.6190 -0.0267 0.3912  -0.0320 171 VAL A CB    
470  C CG1   . VAL A 67  ? 1.1729 0.7671 0.6687 -0.0279 0.4441  -0.0448 171 VAL A CG1   
471  C CG2   . VAL A 67  ? 1.0719 0.6776 0.6128 -0.0451 0.3826  -0.0173 171 VAL A CG2   
472  N N     . GLN A 68  ? 1.0319 0.5526 0.4771 -0.0082 0.2961  -0.0310 172 GLN A N     
473  C CA    . GLN A 68  ? 1.0003 0.5149 0.4368 -0.0103 0.2517  -0.0251 172 GLN A CA    
474  C C     . GLN A 68  ? 1.0322 0.5494 0.4693 -0.0200 0.2441  -0.0097 172 GLN A C     
475  O O     . GLN A 68  ? 1.0937 0.5703 0.4719 -0.0261 0.2592  -0.0023 172 GLN A O     
476  C CB    . GLN A 68  ? 1.0718 0.5358 0.4293 -0.0070 0.2326  -0.0322 172 GLN A CB    
477  C CG    . GLN A 68  ? 1.1009 0.5713 0.4539 -0.0090 0.1864  -0.0298 172 GLN A CG    
478  C CD    . GLN A 68  ? 1.0286 0.5428 0.4469 -0.0115 0.1653  -0.0345 172 GLN A CD    
479  O OE1   . GLN A 68  ? 1.0045 0.5092 0.4188 -0.0117 0.1615  -0.0456 172 GLN A OE1   
480  N NE2   . GLN A 68  ? 0.8832 0.4396 0.3557 -0.0146 0.1514  -0.0263 172 GLN A NE2   
481  N N     . LEU A 69  ? 0.9222 0.4798 0.4187 -0.0216 0.2215  -0.0050 173 LEU A N     
482  C CA    . LEU A 69  ? 0.8982 0.4543 0.3956 -0.0276 0.2110  0.0073  173 LEU A CA    
483  C C     . LEU A 69  ? 0.9190 0.4735 0.4012 -0.0190 0.1677  0.0064  173 LEU A C     
484  O O     . LEU A 69  ? 0.8962 0.4561 0.3712 -0.0142 0.1486  -0.0035 173 LEU A O     
485  C CB    . LEU A 69  ? 0.8319 0.4381 0.4083 -0.0359 0.2200  0.0111  173 LEU A CB    
486  C CG    . LEU A 69  ? 0.8902 0.5205 0.5020 -0.0441 0.2604  0.0085  173 LEU A CG    
487  C CD1   . LEU A 69  ? 0.8322 0.5208 0.5278 -0.0490 0.2577  0.0090  173 LEU A CD1   
488  C CD2   . LEU A 69  ? 0.9793 0.5719 0.5398 -0.0597 0.2925  0.0157  173 LEU A CD2   
489  N N     . ASN A 70  ? 0.8799 0.4268 0.3555 -0.0172 0.1525  0.0147  174 ASN A N     
490  C CA    . ASN A 70  ? 0.8587 0.4154 0.3285 -0.0044 0.1117  0.0112  174 ASN A CA    
491  C C     . ASN A 70  ? 0.8305 0.4075 0.3396 -0.0036 0.1032  0.0167  174 ASN A C     
492  O O     . ASN A 70  ? 0.7898 0.3672 0.3230 -0.0163 0.1282  0.0239  174 ASN A O     
493  C CB    . ASN A 70  ? 0.9449 0.4448 0.3274 0.0077  0.0962  0.0129  174 ASN A CB    
494  C CG    . ASN A 70  ? 1.1801 0.6167 0.5036 0.0066  0.1112  0.0277  174 ASN A CG    
495  O OD1   . ASN A 70  ? 1.0884 0.5135 0.4098 0.0139  0.0963  0.0338  174 ASN A OD1   
496  N ND2   . ASN A 70  ? 1.2275 0.6187 0.4992 -0.0046 0.1434  0.0330  174 ASN A ND2   
497  N N     . HIS A 71  ? 0.7796 0.3775 0.2968 0.0109  0.0684  0.0111  175 HIS A N     
498  C CA    . HIS A 71  ? 0.7554 0.3696 0.3036 0.0162  0.0569  0.0128  175 HIS A CA    
499  C C     . HIS A 71  ? 0.8778 0.4323 0.3878 0.0120  0.0735  0.0266  175 HIS A C     
500  O O     . HIS A 71  ? 0.8432 0.4123 0.3921 0.0025  0.0814  0.0292  175 HIS A O     
501  C CB    . HIS A 71  ? 0.7534 0.3915 0.2990 0.0391  0.0176  0.0017  175 HIS A CB    
502  C CG    . HIS A 71  ? 0.8689 0.4506 0.3373 0.0613  -0.0022 0.0042  175 HIS A CG    
503  N ND1   . HIS A 71  ? 0.9334 0.4993 0.3570 0.0652  -0.0111 0.0003  175 HIS A ND1   
504  C CD2   . HIS A 71  ? 0.9400 0.4717 0.3632 0.0817  -0.0168 0.0100  175 HIS A CD2   
505  C CE1   . HIS A 71  ? 0.9970 0.5078 0.3511 0.0885  -0.0321 0.0045  175 HIS A CE1   
506  N NE2   . HIS A 71  ? 1.0173 0.5036 0.3675 0.1007  -0.0370 0.0106  175 HIS A NE2   
507  N N     . MET A 72  ? 0.9267 0.4100 0.3555 0.0151  0.0796  0.0355  176 MET A N     
508  C CA    A MET A 72  ? 0.9872 0.4012 0.3647 0.0052  0.0967  0.0497  176 MET A CA    
509  C CA    B MET A 72  ? 0.9886 0.4030 0.3669 0.0050  0.0971  0.0497  176 MET A CA    
510  C C     . MET A 72  ? 0.9994 0.4315 0.4200 -0.0272 0.1379  0.0547  176 MET A C     
511  O O     . MET A 72  ? 1.0214 0.4169 0.4257 -0.0428 0.1510  0.0635  176 MET A O     
512  C CB    A MET A 72  ? 1.1236 0.4527 0.3954 0.0122  0.0962  0.0591  176 MET A CB    
513  C CB    B MET A 72  ? 1.1267 0.4560 0.3996 0.0113  0.0974  0.0593  176 MET A CB    
514  C CG    A MET A 72  ? 1.2064 0.5189 0.4351 0.0483  0.0497  0.0533  176 MET A CG    
515  C CG    B MET A 72  ? 1.2450 0.5172 0.4540 0.0410  0.0594  0.0625  176 MET A CG    
516  S SD    A MET A 72  ? 1.4023 0.6063 0.4944 0.0616  0.0400  0.0651  176 MET A SD    
517  S SD    B MET A 72  ? 1.3368 0.5563 0.5316 0.0366  0.0600  0.0723  176 MET A SD    
518  C CE    A MET A 72  ? 1.3366 0.5693 0.4298 0.0463  0.0616  0.0577  176 MET A CE    
519  C CE    B MET A 72  ? 1.4168 0.5267 0.5079 0.0053  0.0979  0.0937  176 MET A CE    
520  N N     . ASP A 73  ? 0.9030 0.3928 0.3799 -0.0364 0.1555  0.0474  177 ASP A N     
521  C CA    . ASP A 73  ? 0.8762 0.4005 0.4054 -0.0608 0.1913  0.0478  177 ASP A CA    
522  C C     . ASP A 73  ? 0.8452 0.4313 0.4585 -0.0666 0.1850  0.0432  177 ASP A C     
523  O O     . ASP A 73  ? 0.8195 0.4380 0.4791 -0.0856 0.2102  0.0427  177 ASP A O     
524  C CB    . ASP A 73  ? 0.8839 0.4331 0.4250 -0.0608 0.2118  0.0405  177 ASP A CB    
525  C CG    . ASP A 73  ? 1.0654 0.5544 0.5225 -0.0618 0.2291  0.0443  177 ASP A CG    
526  O OD1   . ASP A 73  ? 1.1681 0.6142 0.5818 -0.0807 0.2560  0.0536  177 ASP A OD1   
527  O OD2   . ASP A 73  ? 1.0323 0.5141 0.4621 -0.0468 0.2165  0.0376  177 ASP A OD2   
528  N N     . ASP A 74  ? 0.7782 0.3853 0.4123 -0.0506 0.1518  0.0382  178 ASP A N     
529  C CA    . ASP A 74  ? 0.6934 0.3589 0.4007 -0.0543 0.1426  0.0326  178 ASP A CA    
530  C C     . ASP A 74  ? 0.7310 0.3963 0.4622 -0.0756 0.1575  0.0370  178 ASP A C     
531  O O     . ASP A 74  ? 0.6763 0.3950 0.4715 -0.0855 0.1633  0.0330  178 ASP A O     
532  C CB    . ASP A 74  ? 0.6597 0.3452 0.3753 -0.0350 0.1073  0.0250  178 ASP A CB    
533  C CG    . ASP A 74  ? 0.7737 0.4143 0.4423 -0.0199 0.0875  0.0262  178 ASP A CG    
534  O OD1   . ASP A 74  ? 0.8439 0.4205 0.4594 -0.0260 0.0993  0.0359  178 ASP A OD1   
535  O OD2   . ASP A 74  ? 0.7089 0.3748 0.3885 -0.0016 0.0608  0.0168  178 ASP A OD2   
536  N N     . HIS A 75  ? 0.7656 0.3676 0.4417 -0.0847 0.1637  0.0450  179 HIS A N     
537  C CA    . HIS A 75  ? 0.7799 0.3757 0.4724 -0.1122 0.1793  0.0483  179 HIS A CA    
538  C C     . HIS A 75  ? 0.8305 0.4608 0.5597 -0.1407 0.2169  0.0486  179 HIS A C     
539  O O     . HIS A 75  ? 0.8137 0.4706 0.5844 -0.1654 0.2275  0.0467  179 HIS A O     
540  C CB    . HIS A 75  ? 0.8928 0.3979 0.5048 -0.1162 0.1749  0.0571  179 HIS A CB    
541  C CG    . HIS A 75  ? 0.9346 0.4278 0.5395 -0.0900 0.1387  0.0515  179 HIS A CG    
542  N ND1   . HIS A 75  ? 0.9500 0.4481 0.5386 -0.0544 0.1110  0.0461  179 HIS A ND1   
543  C CD2   . HIS A 75  ? 0.9417 0.4388 0.5693 -0.0947 0.1270  0.0464  179 HIS A CD2   
544  C CE1   . HIS A 75  ? 0.9273 0.4316 0.5276 -0.0374 0.0857  0.0379  179 HIS A CE1   
545  N NE2   . HIS A 75  ? 0.9301 0.4290 0.5499 -0.0598 0.0944  0.0381  179 HIS A NE2   
546  N N     . THR A 76  ? 0.7901 0.4243 0.5059 -0.1369 0.2365  0.0485  180 THR A N     
547  C CA    . THR A 76  ? 0.7851 0.4612 0.5392 -0.1580 0.2739  0.0448  180 THR A CA    
548  C C     . THR A 76  ? 0.7400 0.5006 0.5809 -0.1445 0.2681  0.0336  180 THR A C     
549  O O     . THR A 76  ? 0.7106 0.5227 0.6014 -0.1557 0.2934  0.0269  180 THR A O     
550  C CB    . THR A 76  ? 0.8888 0.5280 0.5838 -0.1581 0.3006  0.0474  180 THR A CB    
551  O OG1   . THR A 76  ? 0.8229 0.4865 0.5308 -0.1298 0.2893  0.0401  180 THR A OG1   
552  C CG2   . THR A 76  ? 0.9987 0.5404 0.5892 -0.1604 0.2965  0.0599  180 THR A CG2   
553  N N     . LEU A 77  ? 0.6575 0.4307 0.5119 -0.1196 0.2354  0.0309  181 LEU A N     
554  C CA    . LEU A 77  ? 0.5953 0.4288 0.5124 -0.1057 0.2277  0.0227  181 LEU A CA    
555  C C     . LEU A 77  ? 0.6360 0.5288 0.6265 -0.1179 0.2271  0.0183  181 LEU A C     
556  O O     . LEU A 77  ? 0.6176 0.5576 0.6551 -0.1133 0.2403  0.0113  181 LEU A O     
557  C CB    . LEU A 77  ? 0.5697 0.3973 0.4752 -0.0842 0.1961  0.0213  181 LEU A CB    
558  C CG    . LEU A 77  ? 0.6401 0.4524 0.5169 -0.0685 0.2002  0.0177  181 LEU A CG    
559  C CD1   . LEU A 77  ? 0.7166 0.4735 0.5226 -0.0703 0.2148  0.0217  181 LEU A CD1   
560  C CD2   . LEU A 77  ? 0.6146 0.4303 0.4882 -0.0552 0.1700  0.0147  181 LEU A CD2   
561  N N     . PRO A 78  ? 0.6301 0.5222 0.6308 -0.1338 0.2152  0.0206  182 PRO A N     
562  C CA    . PRO A 78  ? 0.5991 0.5515 0.6695 -0.1473 0.2146  0.0147  182 PRO A CA    
563  C C     . PRO A 78  ? 0.6561 0.6512 0.7652 -0.1648 0.2479  0.0088  182 PRO A C     
564  O O     . PRO A 78  ? 0.6096 0.6673 0.7793 -0.1532 0.2489  0.0002  182 PRO A O     
565  C CB    . PRO A 78  ? 0.6350 0.5592 0.6880 -0.1650 0.2004  0.0177  182 PRO A CB    
566  C CG    . PRO A 78  ? 0.6978 0.5726 0.6969 -0.1442 0.1787  0.0219  182 PRO A CG    
567  C CD    . PRO A 78  ? 0.6806 0.5206 0.6331 -0.1351 0.1963  0.0260  182 PRO A CD    
568  N N     . GLY A 79  ? 0.6809 0.6401 0.7507 -0.1913 0.2750  0.0129  183 GLY A N     
569  C CA    . GLY A 79  ? 0.6929 0.6927 0.7934 -0.2171 0.3130  0.0063  183 GLY A CA    
570  C C     . GLY A 79  ? 0.7200 0.7521 0.8357 -0.1984 0.3376  -0.0015 183 GLY A C     
571  O O     . GLY A 79  ? 0.7152 0.8250 0.9004 -0.2017 0.3553  -0.0144 183 GLY A O     
572  N N     . LYS A 80  ? 0.6748 0.6500 0.7262 -0.1777 0.3384  0.0040  184 LYS A N     
573  C CA    . LYS A 80  ? 0.6957 0.6892 0.7489 -0.1589 0.3625  -0.0049 184 LYS A CA    
574  C C     . LYS A 80  ? 0.6966 0.7198 0.7863 -0.1187 0.3387  -0.0125 184 LYS A C     
575  O O     . LYS A 80  ? 0.6964 0.7604 0.8185 -0.1022 0.3581  -0.0252 184 LYS A O     
576  C CB    . LYS A 80  ? 0.8003 0.7144 0.7585 -0.1611 0.3795  0.0031  184 LYS A CB    
577  N N     . TYR A 81  ? 0.6041 0.6046 0.6849 -0.1032 0.2989  -0.0060 185 TYR A N     
578  C CA    . TYR A 81  ? 0.5697 0.5820 0.6689 -0.0706 0.2775  -0.0112 185 TYR A CA    
579  C C     . TYR A 81  ? 0.5369 0.5890 0.6907 -0.0628 0.2455  -0.0117 185 TYR A C     
580  O O     . TYR A 81  ? 0.5441 0.6012 0.7096 -0.0374 0.2288  -0.0153 185 TYR A O     
581  C CB    . TYR A 81  ? 0.6023 0.5486 0.6309 -0.0579 0.2616  -0.0054 185 TYR A CB    
582  C CG    . TYR A 81  ? 0.6655 0.5698 0.6347 -0.0589 0.2891  -0.0066 185 TYR A CG    
583  C CD1   . TYR A 81  ? 0.7146 0.6226 0.6811 -0.0397 0.3074  -0.0177 185 TYR A CD1   
584  C CD2   . TYR A 81  ? 0.7106 0.5660 0.6201 -0.0774 0.2963  0.0027  185 TYR A CD2   
585  C CE1   . TYR A 81  ? 0.7520 0.6213 0.6595 -0.0422 0.3353  -0.0202 185 TYR A CE1   
586  C CE2   . TYR A 81  ? 0.7821 0.5945 0.6289 -0.0798 0.3216  0.0025  185 TYR A CE2   
587  C CZ    . TYR A 81  ? 0.8477 0.6683 0.6932 -0.0633 0.3415  -0.0092 185 TYR A CZ    
588  O OH    . TYR A 81  ? 0.8928 0.6681 0.6698 -0.0662 0.3667  -0.0103 185 TYR A OH    
589  N N     . GLY A 82  ? 0.4258 0.4985 0.6051 -0.0850 0.2373  -0.0082 186 GLY A N     
590  C CA    . GLY A 82  ? 0.3608 0.4678 0.5842 -0.0817 0.2071  -0.0085 186 GLY A CA    
591  C C     . GLY A 82  ? 0.4051 0.4706 0.5897 -0.0724 0.1762  -0.0008 186 GLY A C     
592  O O     . GLY A 82  ? 0.3870 0.4708 0.5947 -0.0615 0.1513  -0.0010 186 GLY A O     
593  N N     . ILE A 83  ? 0.3810 0.3924 0.5049 -0.0772 0.1774  0.0052  187 ILE A N     
594  C CA    . ILE A 83  ? 0.3556 0.3357 0.4430 -0.0702 0.1512  0.0094  187 ILE A CA    
595  C C     . ILE A 83  ? 0.4256 0.3826 0.4866 -0.0838 0.1424  0.0131  187 ILE A C     
596  O O     . ILE A 83  ? 0.4657 0.3934 0.4967 -0.0931 0.1576  0.0158  187 ILE A O     
597  C CB    . ILE A 83  ? 0.4138 0.3559 0.4537 -0.0569 0.1550  0.0090  187 ILE A CB    
598  C CG1   . ILE A 83  ? 0.4445 0.3977 0.5020 -0.0391 0.1619  0.0035  187 ILE A CG1   
599  C CG2   . ILE A 83  ? 0.4222 0.3442 0.4305 -0.0548 0.1296  0.0105  187 ILE A CG2   
600  C CD1   . ILE A 83  ? 0.5025 0.4156 0.5120 -0.0287 0.1702  0.0007  187 ILE A CD1   
601  N N     . GLY A 84  ? 0.3650 0.3288 0.4291 -0.0828 0.1180  0.0128  188 GLY A N     
602  C CA    . GLY A 84  ? 0.3637 0.3069 0.4031 -0.0886 0.1074  0.0128  188 GLY A CA    
603  C C     . GLY A 84  ? 0.4150 0.3532 0.4310 -0.0777 0.0881  0.0101  188 GLY A C     
604  O O     . GLY A 84  ? 0.3958 0.3431 0.4134 -0.0717 0.0833  0.0096  188 GLY A O     
605  N N     . PHE A 85  ? 0.3642 0.2891 0.3586 -0.0756 0.0767  0.0068  189 PHE A N     
606  C CA    . PHE A 85  ? 0.3336 0.2647 0.3097 -0.0653 0.0602  0.0005  189 PHE A CA    
607  C C     . PHE A 85  ? 0.4249 0.3684 0.4047 -0.0642 0.0461  -0.0070 189 PHE A C     
608  O O     . PHE A 85  ? 0.4328 0.3532 0.4028 -0.0644 0.0470  -0.0076 189 PHE A O     
609  C CB    . PHE A 85  ? 0.3894 0.2856 0.3212 -0.0525 0.0608  0.0001  189 PHE A CB    
610  C CG    . PHE A 85  ? 0.4253 0.3026 0.3391 -0.0514 0.0742  0.0050  189 PHE A CG    
611  C CD1   . PHE A 85  ? 0.4533 0.3415 0.3601 -0.0480 0.0677  0.0012  189 PHE A CD1   
612  C CD2   . PHE A 85  ? 0.4813 0.3267 0.3793 -0.0562 0.0949  0.0120  189 PHE A CD2   
613  C CE1   . PHE A 85  ? 0.4995 0.3639 0.3833 -0.0460 0.0800  0.0037  189 PHE A CE1   
614  C CE2   . PHE A 85  ? 0.5314 0.3588 0.4080 -0.0541 0.1097  0.0144  189 PHE A CE2   
615  C CZ    . PHE A 85  ? 0.5213 0.3563 0.3899 -0.0471 0.1012  0.0099  189 PHE A CZ    
616  N N     . THR A 86  ? 0.3968 0.3724 0.3835 -0.0633 0.0339  -0.0142 190 THR A N     
617  C CA    . THR A 86  ? 0.3808 0.3758 0.3682 -0.0591 0.0221  -0.0254 190 THR A CA    
618  C C     . THR A 86  ? 0.3637 0.3942 0.3498 -0.0581 0.0142  -0.0344 190 THR A C     
619  O O     . THR A 86  ? 0.3550 0.3841 0.3346 -0.0615 0.0168  -0.0306 190 THR A O     
620  C CB    . THR A 86  ? 0.4464 0.4512 0.4540 -0.0711 0.0201  -0.0257 190 THR A CB    
621  O OG1   . THR A 86  ? 0.4174 0.4335 0.4169 -0.0628 0.0107  -0.0394 190 THR A OG1   
622  C CG2   . THR A 86  ? 0.4311 0.4613 0.4594 -0.0858 0.0183  -0.0203 190 THR A CG2   
623  N N     . ASN A 87  ? 0.7140 0.4055 0.3890 0.0508  0.0722  0.0542  191 ASN A N     
624  C CA    . ASN A 87  ? 0.7143 0.3975 0.3347 0.0407  0.0689  0.0382  191 ASN A CA    
625  C C     . ASN A 87  ? 0.7271 0.4298 0.3446 0.0313  0.0484  0.0303  191 ASN A C     
626  O O     . ASN A 87  ? 0.7279 0.4469 0.3709 0.0306  0.0318  0.0244  191 ASN A O     
627  C CB    . ASN A 87  ? 0.7608 0.4501 0.3588 0.0378  0.0712  0.0274  191 ASN A CB    
628  C CG    . ASN A 87  ? 0.8783 0.5495 0.4569 0.0482  0.0898  0.0339  191 ASN A CG    
629  O OD1   . ASN A 87  ? 0.8368 0.4765 0.3783 0.0496  0.0991  0.0329  191 ASN A OD1   
630  N ND2   . ASN A 87  ? 0.7816 0.4663 0.3824 0.0592  0.0976  0.0417  191 ASN A ND2   
631  N N     . MET A 88  ? 0.6655 0.3647 0.2495 0.0239  0.0487  0.0301  192 MET A N     
632  C CA    . MET A 88  ? 0.6611 0.3847 0.2347 0.0206  0.0345  0.0288  192 MET A CA    
633  C C     . MET A 88  ? 0.7447 0.4895 0.3087 0.0222  0.0267  0.0122  192 MET A C     
634  O O     . MET A 88  ? 0.7413 0.4994 0.3015 0.0281  0.0120  0.0023  192 MET A O     
635  C CB    . MET A 88  ? 0.7034 0.4188 0.2521 0.0118  0.0420  0.0405  192 MET A CB    
636  C CG    . MET A 88  ? 0.7606 0.5084 0.2972 0.0133  0.0339  0.0479  192 MET A CG    
637  S SD    . MET A 88  ? 0.8231 0.5792 0.3720 0.0247  0.0271  0.0675  192 MET A SD    
638  C CE    . MET A 88  ? 0.8031 0.5927 0.3256 0.0272  0.0279  0.0852  192 MET A CE    
639  N N     . VAL A 89  ? 0.7274 0.4729 0.2845 0.0196  0.0363  0.0092  193 VAL A N     
640  C CA    . VAL A 89  ? 0.7292 0.4950 0.2806 0.0272  0.0368  0.0004  193 VAL A CA    
641  C C     . VAL A 89  ? 0.7776 0.5345 0.3496 0.0326  0.0444  -0.0012 193 VAL A C     
642  O O     . VAL A 89  ? 0.7474 0.4982 0.3182 0.0279  0.0523  0.0072  193 VAL A O     
643  C CB    . VAL A 89  ? 0.7767 0.5741 0.3088 0.0225  0.0422  0.0117  193 VAL A CB    
644  C CG1   . VAL A 89  ? 0.7761 0.5988 0.3065 0.0388  0.0494  0.0096  193 VAL A CG1   
645  C CG2   . VAL A 89  ? 0.7834 0.5936 0.3001 0.0215  0.0390  0.0210  193 VAL A CG2   
646  N N     . GLU A 90  ? 0.7493 0.5017 0.3344 0.0445  0.0426  -0.0122 194 GLU A N     
647  C CA    . GLU A 90  ? 0.7458 0.4887 0.3590 0.0531  0.0522  -0.0087 194 GLU A CA    
648  C C     . GLU A 90  ? 0.8039 0.5739 0.4082 0.0610  0.0662  0.0039  194 GLU A C     
649  O O     . GLU A 90  ? 0.8015 0.5743 0.4205 0.0651  0.0760  0.0174  194 GLU A O     
650  C CB    . GLU A 90  ? 0.7898 0.5068 0.4200 0.0603  0.0432  -0.0266 194 GLU A CB    
651  C CG    . GLU A 90  ? 0.9807 0.6785 0.6541 0.0676  0.0531  -0.0192 194 GLU A CG    
652  C CD    . GLU A 90  ? 1.2838 0.9409 0.9715 0.0704  0.0415  -0.0417 194 GLU A CD    
653  O OE1   . GLU A 90  ? 1.1473 0.7929 0.7948 0.0836  0.0412  -0.0624 194 GLU A OE1   
654  O OE2   . GLU A 90  ? 1.2881 0.9221 1.0277 0.0602  0.0336  -0.0373 194 GLU A OE2   
655  N N     . ARG A 91  ? 0.7821 0.5797 0.3653 0.0659  0.0681  0.0050  195 ARG A N     
656  C CA    . ARG A 91  ? 0.7761 0.6144 0.3611 0.0742  0.0794  0.0242  195 ARG A CA    
657  C C     . ARG A 91  ? 0.7984 0.6606 0.3784 0.0553  0.0741  0.0398  195 ARG A C     
658  O O     . ARG A 91  ? 0.7887 0.6448 0.3515 0.0338  0.0632  0.0367  195 ARG A O     
659  C CB    . ARG A 91  ? 0.7601 0.6312 0.3297 0.0850  0.0850  0.0296  195 ARG A CB    
660  C CG    . ARG A 91  ? 0.8682 0.7919 0.4520 0.1004  0.0996  0.0569  195 ARG A CG    
661  C CD    . ARG A 91  ? 0.9475 0.9035 0.5198 0.1220  0.1138  0.0672  195 ARG A CD    
662  N NE    . ARG A 91  ? 1.0660 1.0627 0.6357 0.0998  0.1052  0.0842  195 ARG A NE    
663  C CZ    . ARG A 91  ? 1.2167 1.2813 0.8120 0.0877  0.1048  0.1201  195 ARG A CZ    
664  N NH1   . ARG A 91  ? 1.0087 1.1169 0.6305 0.0987  0.1122  0.1442  195 ARG A NH1   
665  N NH2   . ARG A 91  ? 1.0505 1.1434 0.6514 0.0631  0.0959  0.1366  195 ARG A NH2   
666  N N     . THR A 92  ? 0.7752 0.6612 0.3660 0.0646  0.0812  0.0565  196 THR A N     
667  C CA    . THR A 92  ? 0.7863 0.6975 0.3608 0.0484  0.0712  0.0685  196 THR A CA    
668  C C     . THR A 92  ? 0.8515 0.8213 0.4278 0.0334  0.0603  0.0859  196 THR A C     
669  O O     . THR A 92  ? 0.8272 0.8386 0.4268 0.0521  0.0717  0.1041  196 THR A O     
670  C CB    . THR A 92  ? 0.7850 0.7100 0.3693 0.0679  0.0821  0.0856  196 THR A CB    
671  O OG1   . THR A 92  ? 0.7457 0.6229 0.3403 0.0800  0.0941  0.0780  196 THR A OG1   
672  C CG2   . THR A 92  ? 0.7874 0.7441 0.3407 0.0531  0.0668  0.0961  196 THR A CG2   
673  N N     . THR A 93  ? 0.8660 0.8375 0.4210 0.0004  0.0392  0.0831  197 THR A N     
674  C CA    . THR A 93  ? 0.8881 0.9194 0.4560 -0.0246 0.0218  0.1047  197 THR A CA    
675  C C     . THR A 93  ? 0.9933 1.0197 0.5297 -0.0574 -0.0065 0.0986  197 THR A C     
676  O O     . THR A 93  ? 1.0042 0.9640 0.4993 -0.0606 -0.0079 0.0722  197 THR A O     
677  C CB    . THR A 93  ? 0.8897 0.9181 0.4675 -0.0404 0.0205  0.1061  197 THR A CB    
678  O OG1   . THR A 93  ? 0.9902 0.9497 0.5385 -0.0590 0.0128  0.0810  197 THR A OG1   
679  C CG2   . THR A 93  ? 0.7939 0.8305 0.3865 -0.0073 0.0447  0.1101  197 THR A CG2   
680  N N     . PRO A 94  ? 0.9972 1.0899 0.5494 -0.0834 -0.0312 0.1220  198 PRO A N     
681  C CA    . PRO A 94  ? 1.0649 1.1410 0.5741 -0.1200 -0.0665 0.1075  198 PRO A CA    
682  C C     . PRO A 94  ? 1.1759 1.1726 0.6540 -0.1535 -0.0796 0.0781  198 PRO A C     
683  O O     . PRO A 94  ? 1.2353 1.1694 0.6522 -0.1670 -0.0949 0.0484  198 PRO A O     
684  C CB    . PRO A 94  ? 1.0961 1.2725 0.6459 -0.1450 -0.0943 0.1448  198 PRO A CB    
685  C CG    . PRO A 94  ? 1.0909 1.3380 0.7006 -0.1056 -0.0625 0.1827  198 PRO A CG    
686  C CD    . PRO A 94  ? 0.9973 1.1836 0.6061 -0.0803 -0.0293 0.1640  198 PRO A CD    
687  N N     . GLY A 95  ? 1.1145 1.1102 0.6298 -0.1604 -0.0693 0.0879  199 GLY A N     
688  C CA    . GLY A 95  ? 1.1492 1.0735 0.6481 -0.1873 -0.0752 0.0699  199 GLY A CA    
689  C C     . GLY A 95  ? 1.1680 1.0761 0.6900 -0.1640 -0.0458 0.0753  199 GLY A C     
690  O O     . GLY A 95  ? 1.1118 1.0734 0.6669 -0.1356 -0.0264 0.0952  199 GLY A O     
691  N N     . SER A 96  ? 1.1509 0.9826 0.6504 -0.1740 -0.0426 0.0578  200 SER A N     
692  C CA    . SER A 96  ? 1.1273 0.9411 0.6416 -0.1542 -0.0195 0.0637  200 SER A CA    
693  C C     . SER A 96  ? 1.1428 1.0217 0.7065 -0.1607 -0.0153 0.1004  200 SER A C     
694  O O     . SER A 96  ? 1.1161 1.0103 0.6878 -0.1306 0.0055  0.1084  200 SER A O     
695  C CB    . SER A 96  ? 1.2251 0.9480 0.7087 -0.1644 -0.0174 0.0452  200 SER A CB    
696  O OG    . SER A 96  ? 1.4034 1.0996 0.8863 -0.2101 -0.0402 0.0471  200 SER A OG    
697  N N     . LYS A 97  ? 0.9428 1.1757 0.5762 -0.2318 0.0339  0.0477  201 LYS A N     
698  C CA    . LYS A 97  ? 0.9175 1.1609 0.5855 -0.2133 0.0387  0.0742  201 LYS A CA    
699  C C     . LYS A 97  ? 0.9432 1.2210 0.6274 -0.1727 0.0364  0.1196  201 LYS A C     
700  O O     . LYS A 97  ? 0.9358 1.2170 0.6444 -0.1484 0.0471  0.1382  201 LYS A O     
701  C CB    . LYS A 97  ? 0.9602 1.2522 0.6535 -0.2567 0.0320  0.0699  201 LYS A CB    
702  N N     . ASP A 98  ? 0.8991 1.2001 0.5733 -0.1639 0.0252  0.1377  202 ASP A N     
703  C CA    . ASP A 98  ? 0.8878 1.2112 0.5893 -0.1219 0.0244  0.1796  202 ASP A CA    
704  C C     . ASP A 98  ? 0.8978 1.1446 0.5924 -0.0756 0.0424  0.1695  202 ASP A C     
705  O O     . ASP A 98  ? 0.8985 1.1499 0.6197 -0.0371 0.0476  0.1940  202 ASP A O     
706  C CB    . ASP A 98  ? 0.9306 1.2995 0.6302 -0.1305 0.0046  0.2080  202 ASP A CB    
707  C CG    . ASP A 98  ? 1.1459 1.6146 0.8594 -0.1692 -0.0180 0.2335  202 ASP A CG    
708  O OD1   . ASP A 98  ? 1.1929 1.6795 0.8817 -0.2171 -0.0234 0.2017  202 ASP A OD1   
709  O OD2   . ASP A 98  ? 1.2249 1.7546 0.9760 -0.1536 -0.0317 0.2846  202 ASP A OD2   
710  N N     . LEU A 99  ? 0.8247 1.0033 0.4876 -0.0802 0.0511  0.1324  203 LEU A N     
711  C CA    . LEU A 99  ? 0.8102 0.9207 0.4595 -0.0451 0.0636  0.1186  203 LEU A CA    
712  C C     . LEU A 99  ? 0.8498 0.9466 0.5019 -0.0306 0.0789  0.1136  203 LEU A C     
713  O O     . LEU A 99  ? 0.8453 0.9540 0.5022 -0.0556 0.0804  0.1089  203 LEU A O     
714  C CB    . LEU A 99  ? 0.8068 0.8608 0.4256 -0.0578 0.0616  0.0878  203 LEU A CB    
715  C CG    . LEU A 99  ? 0.8785 0.9443 0.4861 -0.0756 0.0503  0.0901  203 LEU A CG    
716  C CD1   . LEU A 99  ? 0.8815 0.9070 0.4660 -0.0968 0.0537  0.0540  203 LEU A CD1   
717  C CD2   . LEU A 99  ? 0.9067 0.9577 0.5246 -0.0448 0.0474  0.1129  203 LEU A CD2   
718  N N     . SER A 100 ? 0.8190 0.8893 0.4674 0.0074  0.0908  0.1130  204 SER A N     
719  C CA    . SER A 100 ? 0.8185 0.8835 0.4598 0.0234  0.1074  0.1098  204 SER A CA    
720  C C     . SER A 100 ? 0.8487 0.8569 0.4564 0.0179  0.1070  0.0867  204 SER A C     
721  O O     . SER A 100 ? 0.8228 0.7866 0.4145 0.0144  0.0976  0.0686  204 SER A O     
722  C CB    . SER A 100 ? 0.8818 0.9534 0.5330 0.0653  0.1232  0.1138  204 SER A CB    
723  O OG    . SER A 100 ? 0.9688 0.9806 0.5946 0.0863  0.1247  0.0891  204 SER A OG    
724  N N     . SER A 101 ? 0.8025 0.8186 0.4037 0.0175  0.1170  0.0927  205 SER A N     
725  C CA    . SER A 101 ? 0.8128 0.7878 0.3889 0.0138  0.1148  0.0827  205 SER A CA    
726  C C     . SER A 101 ? 0.8573 0.7908 0.4010 0.0381  0.1131  0.0607  205 SER A C     
727  O O     . SER A 101 ? 0.8402 0.7320 0.3726 0.0303  0.1012  0.0468  205 SER A O     
728  C CB    . SER A 101 ? 0.8676 0.8731 0.4425 0.0122  0.1268  0.1042  205 SER A CB    
729  O OG    . SER A 101 ? 0.9924 0.9669 0.5472 0.0075  0.1213  0.1049  205 SER A OG    
730  N N     . LYS A 102 ? 0.8362 0.7818 0.3728 0.0667  0.1257  0.0554  206 LYS A N     
731  C CA    . LYS A 102 ? 0.8625 0.7680 0.3729 0.0883  0.1258  0.0286  206 LYS A CA    
732  C C     . LYS A 102 ? 0.8769 0.7413 0.3983 0.0834  0.1102  0.0177  206 LYS A C     
733  O O     . LYS A 102 ? 0.8767 0.6984 0.3778 0.0850  0.1014  -0.0032 206 LYS A O     
734  C CB    . LYS A 102 ? 0.9372 0.8641 0.4509 0.1201  0.1477  0.0208  206 LYS A CB    
735  N N     . GLU A 103 ? 0.8034 0.6881 0.3566 0.0744  0.1057  0.0345  207 GLU A N     
736  C CA    . GLU A 103 ? 0.7862 0.6460 0.3487 0.0644  0.0921  0.0321  207 GLU A CA    
737  C C     . GLU A 103 ? 0.8082 0.6415 0.3566 0.0394  0.0812  0.0191  207 GLU A C     
738  O O     . GLU A 103 ? 0.8032 0.6009 0.3468 0.0378  0.0732  0.0063  207 GLU A O     
739  C CB    . GLU A 103 ? 0.7891 0.6931 0.3821 0.0545  0.0879  0.0581  207 GLU A CB    
740  C CG    . GLU A 103 ? 0.9705 0.8882 0.5942 0.0841  0.0944  0.0742  207 GLU A CG    
741  C CD    . GLU A 103 ? 1.2161 1.1826 0.8739 0.0745  0.0843  0.1090  207 GLU A CD    
742  O OE1   . GLU A 103 ? 1.0364 1.0601 0.7054 0.0582  0.0827  0.1261  207 GLU A OE1   
743  O OE2   . GLU A 103 ? 1.1739 1.1252 0.8502 0.0819  0.0766  0.1224  207 GLU A OE2   
744  N N     . PHE A 104 ? 0.7627 0.6131 0.3130 0.0204  0.0821  0.0234  208 PHE A N     
745  C CA    . PHE A 104 ? 0.7606 0.5866 0.3124 -0.0003 0.0755  0.0113  208 PHE A CA    
746  C C     . PHE A 104 ? 0.8004 0.5914 0.3354 0.0108  0.0703  0.0010  208 PHE A C     
747  O O     . PHE A 104 ? 0.7844 0.5485 0.3249 0.0031  0.0624  -0.0114 208 PHE A O     
748  C CB    . PHE A 104 ? 0.7719 0.6189 0.3418 -0.0215 0.0792  0.0192  208 PHE A CB    
749  C CG    . PHE A 104 ? 0.7718 0.6483 0.3584 -0.0470 0.0789  0.0177  208 PHE A CG    
750  C CD1   . PHE A 104 ? 0.7983 0.6633 0.3876 -0.0663 0.0761  -0.0024 208 PHE A CD1   
751  C CD2   . PHE A 104 ? 0.7903 0.7134 0.3894 -0.0550 0.0820  0.0350  208 PHE A CD2   
752  C CE1   . PHE A 104 ? 0.8084 0.7088 0.4037 -0.0951 0.0758  -0.0087 208 PHE A CE1   
753  C CE2   . PHE A 104 ? 0.8233 0.7814 0.4341 -0.0844 0.0779  0.0318  208 PHE A CE2   
754  C CZ    . PHE A 104 ? 0.7940 0.7404 0.3986 -0.1054 0.0748  0.0080  208 PHE A CZ    
755  N N     . ARG A 105 ? 0.7926 0.5919 0.3071 0.0272  0.0749  0.0066  209 ARG A N     
756  C CA    . ARG A 105 ? 0.7894 0.5693 0.2794 0.0343  0.0673  -0.0008 209 ARG A CA    
757  C C     . ARG A 105 ? 0.8303 0.5799 0.3051 0.0465  0.0613  -0.0243 209 ARG A C     
758  O O     . ARG A 105 ? 0.8151 0.5412 0.2848 0.0413  0.0476  -0.0347 209 ARG A O     
759  C CB    . ARG A 105 ? 0.8029 0.6133 0.2702 0.0414  0.0755  0.0140  209 ARG A CB    
760  C CG    . ARG A 105 ? 0.8604 0.6886 0.3531 0.0232  0.0759  0.0415  209 ARG A CG    
761  C CD    . ARG A 105 ? 1.0396 0.9063 0.5138 0.0259  0.0850  0.0660  209 ARG A CD    
762  N NE    . ARG A 105 ? 1.1159 1.0204 0.5887 0.0361  0.1045  0.0691  209 ARG A NE    
763  C CZ    . ARG A 105 ? 1.1541 1.0912 0.5946 0.0525  0.1197  0.0686  209 ARG A CZ    
764  N NH1   . ARG A 105 ? 1.0573 0.9960 0.4535 0.0569  0.1159  0.0634  209 ARG A NH1   
765  N NH2   . ARG A 105 ? 0.8594 0.8340 0.3126 0.0638  0.1394  0.0723  209 ARG A NH2   
766  N N     . GLU A 106 ? 0.8135 0.5627 0.2935 0.0600  0.0699  -0.0296 210 GLU A N     
767  C CA    . GLU A 106 ? 0.8279 0.5403 0.3081 0.0687  0.0645  -0.0493 210 GLU A CA    
768  C C     . GLU A 106 ? 0.8281 0.5220 0.3290 0.0489  0.0517  -0.0478 210 GLU A C     
769  O O     . GLU A 106 ? 0.8306 0.4955 0.3291 0.0444  0.0401  -0.0626 210 GLU A O     
770  C CB    . GLU A 106 ? 0.8497 0.5669 0.3506 0.0872  0.0766  -0.0446 210 GLU A CB    
771  C CG    . GLU A 106 ? 0.9203 0.5961 0.4398 0.0926  0.0706  -0.0548 210 GLU A CG    
772  C CD    . GLU A 106 ? 1.1011 0.7778 0.6524 0.1164  0.0829  -0.0463 210 GLU A CD    
773  O OE1   . GLU A 106 ? 0.9873 0.7038 0.5629 0.1167  0.0869  -0.0162 210 GLU A OE1   
774  O OE2   . GLU A 106 ? 1.1870 0.8251 0.7447 0.1339  0.0876  -0.0699 210 GLU A OE2   
775  N N     . GLY A 107 ? 0.7505 0.4677 0.2708 0.0346  0.0549  -0.0319 211 GLY A N     
776  C CA    . GLY A 107 ? 0.7154 0.4281 0.2534 0.0143  0.0498  -0.0328 211 GLY A CA    
777  C C     . GLY A 107 ? 0.7448 0.4423 0.2876 0.0046  0.0424  -0.0436 211 GLY A C     
778  O O     . GLY A 107 ? 0.7321 0.4131 0.2871 -0.0032 0.0362  -0.0519 211 GLY A O     
779  N N     . GLY A 108 ? 0.7080 0.4145 0.2479 0.0052  0.0429  -0.0384 212 GLY A N     
780  C CA    . GLY A 108 ? 0.7129 0.4098 0.2685 -0.0008 0.0342  -0.0392 212 GLY A CA    
781  C C     . GLY A 108 ? 0.7772 0.4555 0.3214 0.0051  0.0187  -0.0483 212 GLY A C     
782  O O     . GLY A 108 ? 0.7868 0.4563 0.3572 -0.0029 0.0104  -0.0529 212 GLY A O     
783  N N     . ARG A 109 ? 0.7539 0.4287 0.2623 0.0179  0.0161  -0.0545 213 ARG A N     
784  C CA    . ARG A 109 ? 0.7864 0.4446 0.2766 0.0199  0.0003  -0.0705 213 ARG A CA    
785  C C     . ARG A 109 ? 0.8193 0.4527 0.3329 0.0124  -0.0043 -0.0830 213 ARG A C     
786  O O     . ARG A 109 ? 0.8011 0.4268 0.3282 0.0029  -0.0201 -0.0891 213 ARG A O     
787  C CB    . ARG A 109 ? 0.8190 0.4778 0.2661 0.0346  0.0058  -0.0848 213 ARG A CB    
788  C CG    . ARG A 109 ? 0.9005 0.5391 0.3248 0.0326  -0.0096 -0.1123 213 ARG A CG    
789  C CD    . ARG A 109 ? 0.9740 0.6137 0.3540 0.0467  0.0007  -0.1369 213 ARG A CD    
790  N NE    . ARG A 109 ? 0.9783 0.6072 0.3708 0.0650  0.0239  -0.1415 213 ARG A NE    
791  C CZ    . ARG A 109 ? 1.1360 0.7270 0.5548 0.0710  0.0274  -0.1558 213 ARG A CZ    
792  N NH1   . ARG A 109 ? 1.0012 0.5590 0.4347 0.0572  0.0102  -0.1695 213 ARG A NH1   
793  N NH2   . ARG A 109 ? 0.9493 0.5382 0.3876 0.0902  0.0471  -0.1514 213 ARG A NH2   
794  N N     . ILE A 110 ? 0.7916 0.4181 0.3134 0.0155  0.0082  -0.0815 214 ILE A N     
795  C CA    . ILE A 110 ? 0.8035 0.4116 0.3495 0.0066  0.0061  -0.0836 214 ILE A CA    
796  C C     . ILE A 110 ? 0.8138 0.4365 0.3905 -0.0113 0.0056  -0.0775 214 ILE A C     
797  O O     . ILE A 110 ? 0.8399 0.4523 0.4380 -0.0222 -0.0024 -0.0822 214 ILE A O     
798  C CB    . ILE A 110 ? 0.8509 0.4582 0.4025 0.0145  0.0183  -0.0719 214 ILE A CB    
799  C CG1   . ILE A 110 ? 0.9077 0.4874 0.4467 0.0346  0.0196  -0.0865 214 ILE A CG1   
800  C CG2   . ILE A 110 ? 0.8578 0.4630 0.4379 -0.0011 0.0179  -0.0593 214 ILE A CG2   
801  C CD1   . ILE A 110 ? 0.9534 0.5415 0.5045 0.0513  0.0334  -0.0705 214 ILE A CD1   
802  N N     . LEU A 111 ? 0.7222 0.3691 0.3061 -0.0152 0.0160  -0.0700 215 LEU A N     
803  C CA    . LEU A 111 ? 0.6811 0.3420 0.2987 -0.0300 0.0224  -0.0720 215 LEU A CA    
804  C C     . LEU A 111 ? 0.7424 0.3984 0.3857 -0.0305 0.0090  -0.0755 215 LEU A C     
805  O O     . LEU A 111 ? 0.7265 0.3870 0.4031 -0.0409 0.0096  -0.0801 215 LEU A O     
806  C CB    . LEU A 111 ? 0.6545 0.3356 0.2775 -0.0349 0.0373  -0.0704 215 LEU A CB    
807  C CG    . LEU A 111 ? 0.6897 0.3832 0.3506 -0.0495 0.0505  -0.0827 215 LEU A CG    
808  C CD1   . LEU A 111 ? 0.6734 0.3837 0.3374 -0.0657 0.0611  -0.0895 215 LEU A CD1   
809  C CD2   . LEU A 111 ? 0.6495 0.3539 0.3165 -0.0555 0.0633  -0.0868 215 LEU A CD2   
810  N N     . VAL A 112 ? 0.7271 0.3819 0.3571 -0.0206 -0.0035 -0.0692 216 VAL A N     
811  C CA    A VAL A 112 ? 0.7415 0.4018 0.3990 -0.0217 -0.0211 -0.0639 216 VAL A CA    
812  C CA    B VAL A 112 ? 0.7407 0.4005 0.3944 -0.0211 -0.0226 -0.0638 216 VAL A CA    
813  C C     . VAL A 112 ? 0.7968 0.4479 0.4570 -0.0292 -0.0373 -0.0745 216 VAL A C     
814  O O     . VAL A 112 ? 0.8009 0.4632 0.5072 -0.0367 -0.0438 -0.0724 216 VAL A O     
815  C CB    A VAL A 112 ? 0.8043 0.4757 0.4459 -0.0133 -0.0342 -0.0460 216 VAL A CB    
816  C CB    B VAL A 112 ? 0.8049 0.4733 0.4272 -0.0123 -0.0368 -0.0500 216 VAL A CB    
817  C CG1   A VAL A 112 ? 0.8377 0.5071 0.4198 -0.0086 -0.0473 -0.0524 216 VAL A CG1   
818  C CG1   B VAL A 112 ? 0.8200 0.5018 0.4556 -0.0159 -0.0643 -0.0413 216 VAL A CG1   
819  C CG2   A VAL A 112 ? 0.7999 0.4866 0.4929 -0.0149 -0.0497 -0.0286 216 VAL A CG2   
820  C CG2   B VAL A 112 ? 0.7882 0.4669 0.4257 -0.0086 -0.0248 -0.0318 216 VAL A CG2   
821  N N     . GLN A 113 ? 0.7747 0.4473 0.4355 -0.0587 -0.0431 -0.1241 217 GLN A N     
822  C CA    . GLN A 113 ? 0.7873 0.4414 0.4628 -0.0690 -0.0563 -0.1390 217 GLN A CA    
823  C C     . GLN A 113 ? 0.7555 0.4262 0.4898 -0.0726 -0.0590 -0.1243 217 GLN A C     
824  O O     . GLN A 113 ? 0.7373 0.4125 0.4928 -0.0850 -0.0788 -0.1255 217 GLN A O     
825  C CB    . GLN A 113 ? 0.8460 0.4671 0.5043 -0.0649 -0.0420 -0.1612 217 GLN A CB    
826  C CG    . GLN A 113 ? 1.1254 0.7308 0.7213 -0.0623 -0.0372 -0.1804 217 GLN A CG    
827  C CD    . GLN A 113 ? 1.5138 1.0845 1.0962 -0.0568 -0.0236 -0.2079 217 GLN A CD    
828  O OE1   . GLN A 113 ? 1.5288 1.0742 1.1305 -0.0643 -0.0351 -0.2221 217 GLN A OE1   
829  N NE2   . GLN A 113 ? 1.4234 0.9916 0.9737 -0.0440 0.0010  -0.2170 217 GLN A NE2   
830  N N     . LYS A 114 ? 0.6722 0.3557 0.4323 -0.0628 -0.0395 -0.1090 218 LYS A N     
831  C CA    . LYS A 114 ? 0.6354 0.3376 0.4433 -0.0660 -0.0383 -0.0933 218 LYS A CA    
832  C C     . LYS A 114 ? 0.6626 0.3957 0.4871 -0.0698 -0.0524 -0.0832 218 LYS A C     
833  O O     . LYS A 114 ? 0.6553 0.4020 0.5153 -0.0794 -0.0613 -0.0791 218 LYS A O     
834  C CB    . LYS A 114 ? 0.6502 0.3617 0.4710 -0.0542 -0.0171 -0.0786 218 LYS A CB    
835  C CG    . LYS A 114 ? 0.7087 0.3940 0.5343 -0.0500 -0.0048 -0.0833 218 LYS A CG    
836  C CD    . LYS A 114 ? 0.6713 0.3695 0.5117 -0.0391 0.0111  -0.0661 218 LYS A CD    
837  C CE    . LYS A 114 ? 0.7184 0.3903 0.5667 -0.0317 0.0220  -0.0697 218 LYS A CE    
838  N NZ    . LYS A 114 ? 0.6588 0.3455 0.5164 -0.0191 0.0353  -0.0539 218 LYS A NZ    
839  N N     . LEU A 115 ? 0.6030 0.3469 0.4048 -0.0625 -0.0549 -0.0793 219 LEU A N     
840  C CA    . LEU A 115 ? 0.5824 0.3521 0.4029 -0.0630 -0.0695 -0.0710 219 LEU A CA    
841  C C     . LEU A 115 ? 0.6662 0.4356 0.4899 -0.0747 -0.0960 -0.0786 219 LEU A C     
842  O O     . LEU A 115 ? 0.6524 0.4470 0.5144 -0.0775 -0.1074 -0.0725 219 LEU A O     
843  C CB    . LEU A 115 ? 0.5649 0.3406 0.3642 -0.0529 -0.0678 -0.0631 219 LEU A CB    
844  C CG    . LEU A 115 ? 0.5998 0.3832 0.4061 -0.0429 -0.0468 -0.0541 219 LEU A CG    
845  C CD1   . LEU A 115 ? 0.6037 0.3862 0.3864 -0.0365 -0.0470 -0.0476 219 LEU A CD1   
846  C CD2   . LEU A 115 ? 0.6228 0.4313 0.4699 -0.0404 -0.0425 -0.0467 219 LEU A CD2   
847  N N     . GLN A 116 ? 0.6760 0.4189 0.4614 -0.0815 -0.1055 -0.0931 220 GLN A N     
848  C CA    . GLN A 116 ? 0.7098 0.4493 0.4911 -0.0946 -0.1348 -0.1023 220 GLN A CA    
849  C C     . GLN A 116 ? 0.7655 0.5063 0.5899 -0.1078 -0.1413 -0.1074 220 GLN A C     
850  O O     . GLN A 116 ? 0.7839 0.5372 0.6314 -0.1194 -0.1665 -0.1087 220 GLN A O     
851  C CB    . GLN A 116 ? 0.7804 0.4901 0.4973 -0.0981 -0.1424 -0.1182 220 GLN A CB    
852  C CG    . GLN A 116 ? 0.7799 0.4939 0.4564 -0.0902 -0.1437 -0.1079 220 GLN A CG    
853  C CD    . GLN A 116 ? 1.0032 0.6903 0.6105 -0.0927 -0.1414 -0.1227 220 GLN A CD    
854  O OE1   . GLN A 116 ? 0.9020 0.5658 0.4910 -0.0939 -0.1286 -0.1422 220 GLN A OE1   
855  N NE2   . GLN A 116 ? 0.9446 0.6340 0.5113 -0.0931 -0.1529 -0.1135 220 GLN A NE2   
856  N N     . LYS A 117 ? 0.7138 0.4436 0.5542 -0.1068 -0.1199 -0.1073 221 LYS A N     
857  C CA    . LYS A 117 ? 0.7065 0.4361 0.5914 -0.1206 -0.1230 -0.1070 221 LYS A CA    
858  C C     . LYS A 117 ? 0.7321 0.5053 0.6725 -0.1207 -0.1178 -0.0871 221 LYS A C     
859  O O     . LYS A 117 ? 0.7320 0.5268 0.7110 -0.1329 -0.1353 -0.0848 221 LYS A O     
860  C CB    . LYS A 117 ? 0.7268 0.4254 0.6074 -0.1185 -0.1028 -0.1112 221 LYS A CB    
861  C CG    . LYS A 117 ? 0.8384 0.5318 0.7663 -0.1344 -0.1052 -0.1067 221 LYS A CG    
862  C CD    . LYS A 117 ? 0.8556 0.5181 0.7828 -0.1293 -0.0858 -0.1058 221 LYS A CD    
863  C CE    . LYS A 117 ? 1.0131 0.6710 0.9896 -0.1457 -0.0869 -0.0943 221 LYS A CE    
864  N NZ    . LYS A 117 ? 1.1606 0.7797 1.1354 -0.1403 -0.0731 -0.0945 221 LYS A NZ    
865  N N     . TYR A 118 ? 0.6485 0.4362 0.5933 -0.1072 -0.0938 -0.0737 222 TYR A N     
866  C CA    . TYR A 118 ? 0.6233 0.4505 0.6130 -0.1055 -0.0825 -0.0573 222 TYR A CA    
867  C C     . TYR A 118 ? 0.6457 0.5066 0.6518 -0.0982 -0.0931 -0.0543 222 TYR A C     
868  O O     . TYR A 118 ? 0.6196 0.5174 0.6733 -0.1006 -0.0902 -0.0459 222 TYR A O     
869  C CB    . TYR A 118 ? 0.6244 0.4516 0.6061 -0.0946 -0.0557 -0.0464 222 TYR A CB    
870  C CG    . TYR A 118 ? 0.6580 0.4576 0.6416 -0.1025 -0.0466 -0.0441 222 TYR A CG    
871  C CD1   . TYR A 118 ? 0.6913 0.4976 0.7154 -0.1189 -0.0472 -0.0353 222 TYR A CD1   
872  C CD2   . TYR A 118 ? 0.6705 0.4364 0.6195 -0.0939 -0.0388 -0.0504 222 TYR A CD2   
873  C CE1   . TYR A 118 ? 0.7308 0.5060 0.7594 -0.1266 -0.0417 -0.0315 222 TYR A CE1   
874  C CE2   . TYR A 118 ? 0.6964 0.4338 0.6523 -0.0987 -0.0322 -0.0486 222 TYR A CE2   
875  C CZ    . TYR A 118 ? 0.7941 0.5332 0.7888 -0.1151 -0.0349 -0.0387 222 TYR A CZ    
876  O OH    . TYR A 118 ? 0.7976 0.5033 0.8016 -0.1203 -0.0309 -0.0352 222 TYR A OH    
877  N N     . GLN A 119 ? 0.5808 0.4296 0.5500 -0.0895 -0.1052 -0.0604 223 GLN A N     
878  C CA    . GLN A 119 ? 0.5553 0.4271 0.5367 -0.0814 -0.1204 -0.0571 223 GLN A CA    
879  C C     . GLN A 119 ? 0.5727 0.4811 0.5943 -0.0698 -0.1047 -0.0480 223 GLN A C     
880  O O     . GLN A 119 ? 0.5566 0.4984 0.6268 -0.0712 -0.1129 -0.0453 223 GLN A O     
881  C CB    . GLN A 119 ? 0.5837 0.4631 0.5850 -0.0941 -0.1516 -0.0617 223 GLN A CB    
882  C CG    . GLN A 119 ? 0.7367 0.5794 0.6834 -0.1016 -0.1701 -0.0732 223 GLN A CG    
883  C CD    . GLN A 119 ? 0.9693 0.8178 0.9276 -0.1147 -0.2057 -0.0781 223 GLN A CD    
884  O OE1   . GLN A 119 ? 0.9405 0.8213 0.9406 -0.1122 -0.2227 -0.0699 223 GLN A OE1   
885  N NE2   . GLN A 119 ? 0.8769 0.6932 0.7956 -0.1278 -0.2194 -0.0929 223 GLN A NE2   
886  N N     . PRO A 120 ? 0.5117 0.4166 0.5155 -0.0585 -0.0818 -0.0444 224 PRO A N     
887  C CA    . PRO A 120 ? 0.5000 0.4372 0.5341 -0.0469 -0.0674 -0.0400 224 PRO A CA    
888  C C     . PRO A 120 ? 0.5497 0.4955 0.5925 -0.0338 -0.0832 -0.0421 224 PRO A C     
889  O O     . PRO A 120 ? 0.5939 0.5158 0.6068 -0.0336 -0.1015 -0.0429 224 PRO A O     
890  C CB    . PRO A 120 ? 0.5143 0.4369 0.5159 -0.0399 -0.0460 -0.0375 224 PRO A CB    
891  C CG    . PRO A 120 ? 0.5721 0.4582 0.5283 -0.0409 -0.0541 -0.0405 224 PRO A CG    
892  C CD    . PRO A 120 ? 0.5346 0.4080 0.4907 -0.0547 -0.0702 -0.0454 224 PRO A CD    
893  N N     . ARG A 121 ? 0.4826 0.4609 0.5650 -0.0225 -0.0762 -0.0427 225 ARG A N     
894  C CA    A ARG A 121 ? 0.4738 0.4571 0.5710 -0.0074 -0.0920 -0.0449 225 ARG A CA    
895  C CA    B ARG A 121 ? 0.4766 0.4600 0.5739 -0.0074 -0.0920 -0.0449 225 ARG A CA    
896  C C     . ARG A 121 ? 0.5203 0.4691 0.5706 0.0009  -0.0939 -0.0445 225 ARG A C     
897  O O     . ARG A 121 ? 0.5211 0.4555 0.5646 0.0061  -0.1155 -0.0416 225 ARG A O     
898  C CB    A ARG A 121 ? 0.4418 0.4645 0.5885 0.0069  -0.0774 -0.0498 225 ARG A CB    
899  C CB    B ARG A 121 ? 0.4578 0.4810 0.6051 0.0066  -0.0775 -0.0497 225 ARG A CB    
900  C CG    A ARG A 121 ? 0.5395 0.6061 0.7443 -0.0002 -0.0740 -0.0482 225 ARG A CG    
901  C CG    B ARG A 121 ? 0.5993 0.6656 0.8043 -0.0011 -0.0751 -0.0479 225 ARG A CG    
902  C CD    A ARG A 121 ? 0.5828 0.6903 0.8363 0.0178  -0.0584 -0.0553 225 ARG A CD    
903  C CD    B ARG A 121 ? 0.7099 0.8188 0.9653 0.0160  -0.0590 -0.0545 225 ARG A CD    
904  N NE    A ARG A 121 ? 0.6227 0.7793 0.9335 0.0095  -0.0471 -0.0520 225 ARG A NE    
905  N NE    B ARG A 121 ? 0.8267 0.9774 1.1499 0.0143  -0.0706 -0.0524 225 ARG A NE    
906  C CZ    A ARG A 121 ? 0.7929 0.9823 1.1646 0.0106  -0.0644 -0.0506 225 ARG A CZ    
907  C CZ    B ARG A 121 ? 1.0017 1.1994 1.3732 0.0079  -0.0508 -0.0502 225 ARG A CZ    
908  N NH1   A ARG A 121 ? 0.5914 0.7674 0.9716 0.0207  -0.0959 -0.0515 225 ARG A NH1   
909  N NH1   B ARG A 121 ? 0.8175 1.0245 1.1715 0.0025  -0.0180 -0.0487 225 ARG A NH1   
910  N NH2   A ARG A 121 ? 0.6610 0.8985 1.0879 0.0007  -0.0512 -0.0461 225 ARG A NH2   
911  N NH2   B ARG A 121 ? 0.8586 1.0967 1.2977 0.0060  -0.0641 -0.0474 225 ARG A NH2   
912  N N     . ILE A 122 ? 0.4885 0.4255 0.5094 0.0012  -0.0725 -0.0453 226 ILE A N     
913  C CA    . ILE A 122 ? 0.4835 0.3929 0.4669 0.0072  -0.0717 -0.0442 226 ILE A CA    
914  C C     . ILE A 122 ? 0.5483 0.4393 0.4936 -0.0011 -0.0569 -0.0412 226 ILE A C     
915  O O     . ILE A 122 ? 0.5444 0.4473 0.4940 -0.0032 -0.0386 -0.0415 226 ILE A O     
916  C CB    . ILE A 122 ? 0.4933 0.4138 0.4940 0.0231  -0.0622 -0.0515 226 ILE A CB    
917  C CG1   . ILE A 122 ? 0.4819 0.4234 0.5294 0.0355  -0.0738 -0.0566 226 ILE A CG1   
918  C CG2   . ILE A 122 ? 0.4776 0.3688 0.4464 0.0274  -0.0652 -0.0503 226 ILE A CG2   
919  C CD1   . ILE A 122 ? 0.4240 0.3839 0.4951 0.0524  -0.0578 -0.0700 226 ILE A CD1   
920  N N     . ALA A 123 ? 0.5131 0.3772 0.4226 -0.0050 -0.0644 -0.0371 227 ALA A N     
921  C CA    . ALA A 123 ? 0.5065 0.3551 0.3854 -0.0098 -0.0504 -0.0346 227 ALA A CA    
922  C C     . ALA A 123 ? 0.5416 0.3850 0.4117 -0.0024 -0.0453 -0.0326 227 ALA A C     
923  O O     . ALA A 123 ? 0.5299 0.3608 0.3919 0.0003  -0.0574 -0.0293 227 ALA A O     
924  C CB    . ALA A 123 ? 0.5275 0.3544 0.3743 -0.0176 -0.0582 -0.0330 227 ALA A CB    
925  N N     . VAL A 124 ? 0.4863 0.3388 0.3590 -0.0002 -0.0298 -0.0336 228 VAL A N     
926  C CA    . VAL A 124 ? 0.4578 0.3066 0.3237 0.0054  -0.0273 -0.0341 228 VAL A CA    
927  C C     . VAL A 124 ? 0.5069 0.3448 0.3514 0.0004  -0.0203 -0.0271 228 VAL A C     
928  O O     . VAL A 124 ? 0.5088 0.3526 0.3516 -0.0021 -0.0089 -0.0245 228 VAL A O     
929  C CB    . VAL A 124 ? 0.4893 0.3582 0.3698 0.0118  -0.0174 -0.0415 228 VAL A CB    
930  C CG1   . VAL A 124 ? 0.4801 0.3421 0.3492 0.0161  -0.0174 -0.0452 228 VAL A CG1   
931  C CG2   . VAL A 124 ? 0.4914 0.3763 0.4006 0.0189  -0.0217 -0.0496 228 VAL A CG2   
932  N N     . PHE A 125 ? 0.4733 0.2966 0.3054 -0.0010 -0.0272 -0.0224 229 PHE A N     
933  C CA    . PHE A 125 ? 0.4517 0.2696 0.2699 -0.0055 -0.0198 -0.0149 229 PHE A CA    
934  C C     . PHE A 125 ? 0.4636 0.2873 0.2874 -0.0034 -0.0183 -0.0155 229 PHE A C     
935  O O     . PHE A 125 ? 0.4682 0.2850 0.2956 -0.0018 -0.0281 -0.0183 229 PHE A O     
936  C CB    . PHE A 125 ? 0.4794 0.2827 0.2821 -0.0106 -0.0264 -0.0070 229 PHE A CB    
937  C CG    . PHE A 125 ? 0.5134 0.3110 0.3006 -0.0141 -0.0269 -0.0075 229 PHE A CG    
938  C CD1   . PHE A 125 ? 0.5411 0.3368 0.3320 -0.0132 -0.0405 -0.0113 229 PHE A CD1   
939  C CD2   . PHE A 125 ? 0.5279 0.3237 0.2996 -0.0174 -0.0140 -0.0066 229 PHE A CD2   
940  C CE1   . PHE A 125 ? 0.5722 0.3625 0.3469 -0.0181 -0.0438 -0.0139 229 PHE A CE1   
941  C CE2   . PHE A 125 ? 0.5831 0.3709 0.3360 -0.0207 -0.0149 -0.0117 229 PHE A CE2   
942  C CZ    . PHE A 125 ? 0.5737 0.3582 0.3265 -0.0221 -0.0310 -0.0154 229 PHE A CZ    
943  N N     . ASN A 126 ? 0.4456 0.2804 0.2707 -0.0034 -0.0082 -0.0136 230 ASN A N     
944  C CA    . ASN A 126 ? 0.4536 0.2958 0.2798 -0.0026 -0.0091 -0.0141 230 ASN A CA    
945  C C     . ASN A 126 ? 0.5069 0.3454 0.3329 -0.0078 -0.0107 -0.0047 230 ASN A C     
946  O O     . ASN A 126 ? 0.4617 0.3088 0.2915 -0.0087 -0.0037 0.0029  230 ASN A O     
947  C CB    . ASN A 126 ? 0.4911 0.3479 0.3175 -0.0012 -0.0002 -0.0123 230 ASN A CB    
948  C CG    . ASN A 126 ? 0.5140 0.3796 0.3345 -0.0012 -0.0036 -0.0128 230 ASN A CG    
949  O OD1   . ASN A 126 ? 0.4498 0.3098 0.2675 -0.0016 -0.0134 -0.0193 230 ASN A OD1   
950  N ND2   . ASN A 126 ? 0.4477 0.3252 0.2648 -0.0016 0.0025  -0.0056 230 ASN A ND2   
951  N N     . GLY A 127 ? 0.4851 0.3117 0.3110 -0.0113 -0.0200 -0.0039 231 GLY A N     
952  C CA    . GLY A 127 ? 0.4797 0.3054 0.3095 -0.0187 -0.0207 0.0071  231 GLY A CA    
953  C C     . GLY A 127 ? 0.5240 0.3363 0.3466 -0.0236 -0.0231 0.0140  231 GLY A C     
954  O O     . GLY A 127 ? 0.5141 0.3234 0.3251 -0.0220 -0.0175 0.0139  231 GLY A O     
955  N N     . LYS A 128 ? 0.4922 0.2948 0.3201 -0.0311 -0.0331 0.0208  232 LYS A N     
956  C CA    . LYS A 128 ? 0.5149 0.3040 0.3342 -0.0383 -0.0369 0.0328  232 LYS A CA    
957  C C     . LYS A 128 ? 0.5732 0.3744 0.3824 -0.0435 -0.0196 0.0441  232 LYS A C     
958  O O     . LYS A 128 ? 0.5567 0.3500 0.3456 -0.0454 -0.0180 0.0488  232 LYS A O     
959  C CB    . LYS A 128 ? 0.5339 0.3085 0.3655 -0.0472 -0.0517 0.0400  232 LYS A CB    
960  C CG    . LYS A 128 ? 0.6067 0.3600 0.4291 -0.0526 -0.0620 0.0523  232 LYS A CG    
961  C CD    . LYS A 128 ? 0.6746 0.4102 0.5130 -0.0634 -0.0769 0.0618  232 LYS A CD    
962  C CE    . LYS A 128 ? 0.5726 0.2790 0.4163 -0.0566 -0.0976 0.0548  232 LYS A CE    
963  N NZ    . LYS A 128 ? 0.6367 0.3179 0.4993 -0.0668 -0.1154 0.0611  232 LYS A NZ    
964  N N     . CYS A 129 ? 0.5621 0.3833 0.3859 -0.0451 -0.0074 0.0479  233 CYS A N     
965  C CA    . CYS A 129 ? 0.5780 0.4152 0.3995 -0.0474 0.0127  0.0561  233 CYS A CA    
966  C C     . CYS A 129 ? 0.6381 0.4714 0.4356 -0.0398 0.0242  0.0468  233 CYS A C     
967  O O     . CYS A 129 ? 0.6673 0.5021 0.4457 -0.0433 0.0365  0.0515  233 CYS A O     
968  C CB    . CYS A 129 ? 0.5765 0.4375 0.4269 -0.0456 0.0207  0.0586  233 CYS A CB    
969  S SG    . CYS A 129 ? 0.6172 0.4827 0.4749 -0.0320 0.0195  0.0451  233 CYS A SG    
970  N N     . ILE A 130 ? 0.6041 0.4492 0.2650 -0.0306 0.0444  0.0096  234 ILE A N     
971  C CA    . ILE A 130 ? 0.6232 0.4473 0.2819 -0.0175 0.0445  0.0146  234 ILE A CA    
972  C C     . ILE A 130 ? 0.6839 0.4753 0.3292 -0.0187 0.0450  0.0089  234 ILE A C     
973  O O     . ILE A 130 ? 0.6688 0.4450 0.3100 -0.0111 0.0463  0.0088  234 ILE A O     
974  C CB    . ILE A 130 ? 0.6756 0.5046 0.3388 -0.0107 0.0393  0.0238  234 ILE A CB    
975  C CG1   . ILE A 130 ? 0.6754 0.5117 0.3303 -0.0209 0.0369  0.0205  234 ILE A CG1   
976  C CG2   . ILE A 130 ? 0.7236 0.5796 0.4023 -0.0025 0.0354  0.0350  234 ILE A CG2   
977  C CD1   . ILE A 130 ? 0.7209 0.5514 0.3737 -0.0189 0.0359  0.0287  234 ILE A CD1   
978  N N     . TYR A 131 ? 0.6481 0.4295 0.2889 -0.0273 0.0425  0.0023  235 TYR A N     
979  C CA    . TYR A 131 ? 0.6461 0.3966 0.2775 -0.0250 0.0392  -0.0005 235 TYR A CA    
980  C C     . TYR A 131 ? 0.6957 0.4343 0.3135 -0.0296 0.0426  0.0045  235 TYR A C     
981  O O     . TYR A 131 ? 0.6790 0.3989 0.2825 -0.0248 0.0400  0.0069  235 TYR A O     
982  C CB    . TYR A 131 ? 0.6544 0.3945 0.2914 -0.0284 0.0343  -0.0099 235 TYR A CB    
983  C CG    . TYR A 131 ? 0.6675 0.3782 0.2996 -0.0219 0.0267  -0.0108 235 TYR A CG    
984  C CD1   . TYR A 131 ? 0.6871 0.3949 0.3224 -0.0129 0.0224  -0.0135 235 TYR A CD1   
985  C CD2   . TYR A 131 ? 0.6834 0.3692 0.3081 -0.0255 0.0222  -0.0072 235 TYR A CD2   
986  C CE1   . TYR A 131 ? 0.7043 0.3911 0.3360 -0.0060 0.0120  -0.0147 235 TYR A CE1   
987  C CE2   . TYR A 131 ? 0.7095 0.3694 0.3273 -0.0176 0.0110  -0.0038 235 TYR A CE2   
988  C CZ    . TYR A 131 ? 0.7346 0.3984 0.3564 -0.0071 0.0051  -0.0088 235 TYR A CZ    
989  O OH    . TYR A 131 ? 0.7713 0.4171 0.3892 0.0017  -0.0091 -0.0074 235 TYR A OH    
990  N N     . GLU A 132 ? 0.6777 0.4306 0.2988 -0.0409 0.0486  0.0057  236 GLU A N     
991  C CA    . GLU A 132 ? 0.7091 0.4560 0.3169 -0.0500 0.0558  0.0121  236 GLU A CA    
992  C C     . GLU A 132 ? 0.7497 0.5031 0.3472 -0.0407 0.0611  0.0134  236 GLU A C     
993  O O     . GLU A 132 ? 0.7581 0.4930 0.3321 -0.0419 0.0612  0.0178  236 GLU A O     
994  C CB    . GLU A 132 ? 0.7301 0.5041 0.3518 -0.0644 0.0639  0.0102  236 GLU A CB    
995  C CG    . GLU A 132 ? 0.9055 0.6687 0.5354 -0.0781 0.0605  0.0052  236 GLU A CG    
996  C CD    . GLU A 132 ? 1.2256 1.0216 0.8752 -0.0932 0.0654  -0.0025 236 GLU A CD    
997  O OE1   . GLU A 132 ? 1.0415 0.8762 0.7024 -0.0921 0.0706  -0.0027 236 GLU A OE1   
998  O OE2   . GLU A 132 ? 1.1183 0.9024 0.7759 -0.1058 0.0628  -0.0109 236 GLU A OE2   
999  N N     . ILE A 133 ? 0.6847 0.4626 0.2997 -0.0304 0.0636  0.0090  237 ILE A N     
1000 C CA    . ILE A 133 ? 0.6917 0.4756 0.3059 -0.0195 0.0690  0.0043  237 ILE A CA    
1001 C C     . ILE A 133 ? 0.7259 0.4828 0.3259 -0.0114 0.0613  0.0014  237 ILE A C     
1002 O O     . ILE A 133 ? 0.7207 0.4717 0.3020 -0.0108 0.0643  -0.0029 237 ILE A O     
1003 C CB    . ILE A 133 ? 0.7117 0.5218 0.3558 -0.0080 0.0700  0.0019  237 ILE A CB    
1004 C CG1   . ILE A 133 ? 0.7060 0.5514 0.3678 -0.0159 0.0752  0.0028  237 ILE A CG1   
1005 C CG2   . ILE A 133 ? 0.7237 0.5353 0.3745 0.0054  0.0757  -0.0077 237 ILE A CG2   
1006 C CD1   . ILE A 133 ? 0.7948 0.6663 0.4848 -0.0056 0.0689  0.0057  237 ILE A CD1   
1007 N N     . PHE A 134 ? 0.6899 0.4355 0.2991 -0.0069 0.0517  0.0019  238 PHE A N     
1008 C CA    . PHE A 134 ? 0.6895 0.4155 0.2939 -0.0006 0.0436  -0.0030 238 PHE A CA    
1009 C C     . PHE A 134 ? 0.7812 0.4887 0.3600 -0.0042 0.0372  -0.0020 238 PHE A C     
1010 O O     . PHE A 134 ? 0.7877 0.4892 0.3540 0.0002  0.0339  -0.0083 238 PHE A O     
1011 C CB    . PHE A 134 ? 0.6802 0.4040 0.3004 0.0000  0.0374  -0.0024 238 PHE A CB    
1012 C CG    . PHE A 134 ? 0.7053 0.4165 0.3305 0.0052  0.0311  -0.0094 238 PHE A CG    
1013 C CD1   . PHE A 134 ? 0.7539 0.4652 0.3933 0.0103  0.0338  -0.0119 238 PHE A CD1   
1014 C CD2   . PHE A 134 ? 0.7320 0.4307 0.3511 0.0052  0.0213  -0.0141 238 PHE A CD2   
1015 C CE1   . PHE A 134 ? 0.7710 0.4715 0.4187 0.0116  0.0288  -0.0205 238 PHE A CE1   
1016 C CE2   . PHE A 134 ? 0.7758 0.4695 0.4042 0.0088  0.0147  -0.0233 238 PHE A CE2   
1017 C CZ    . PHE A 134 ? 0.7580 0.4532 0.4003 0.0102  0.0195  -0.0274 238 PHE A CZ    
1018 N N     . SER A 135 ? 0.7658 0.4632 0.3377 -0.0119 0.0335  0.0059  239 SER A N     
1019 C CA    . SER A 135 ? 0.8026 0.4771 0.3515 -0.0146 0.0239  0.0132  239 SER A CA    
1020 C C     . SER A 135 ? 0.8774 0.5543 0.3943 -0.0196 0.0298  0.0181  239 SER A C     
1021 O O     . SER A 135 ? 0.8855 0.5521 0.3791 -0.0163 0.0199  0.0192  239 SER A O     
1022 C CB    . SER A 135 ? 0.8690 0.5294 0.4223 -0.0233 0.0219  0.0213  239 SER A CB    
1023 O OG    . SER A 135 ? 1.0357 0.6673 0.5698 -0.0240 0.0097  0.0327  239 SER A OG    
1024 N N     . LYS A 136 ? 0.8371 0.5331 0.3533 -0.0282 0.0461  0.0193  240 LYS A N     
1025 C CA    . LYS A 136 ? 0.8745 0.5828 0.3632 -0.0364 0.0580  0.0208  240 LYS A CA    
1026 C C     . LYS A 136 ? 0.9006 0.6197 0.3821 -0.0260 0.0587  0.0045  240 LYS A C     
1027 O O     . LYS A 136 ? 0.9111 0.6297 0.3572 -0.0300 0.0582  0.0045  240 LYS A O     
1028 C CB    . LYS A 136 ? 0.9127 0.6497 0.4196 -0.0449 0.0763  0.0184  240 LYS A CB    
1029 C CG    . LYS A 136 ? 1.0850 0.8308 0.5659 -0.0639 0.0906  0.0278  240 LYS A CG    
1030 C CD    . LYS A 136 ? 1.2475 1.0283 0.7567 -0.0729 0.1078  0.0225  240 LYS A CD    
1031 C CE    . LYS A 136 ? 1.4754 1.2509 1.0110 -0.0792 0.1022  0.0279  240 LYS A CE    
1032 N NZ    . LYS A 136 ? 1.6550 1.4632 1.2086 -0.0962 0.1184  0.0263  240 LYS A NZ    
1033 N N     . GLU A 137 ? 0.8270 0.5542 0.3409 -0.0138 0.0590  -0.0091 241 GLU A N     
1034 C CA    . GLU A 137 ? 0.8016 0.5356 0.3199 -0.0040 0.0607  -0.0282 241 GLU A CA    
1035 C C     . GLU A 137 ? 0.8595 0.5756 0.3675 0.0009  0.0439  -0.0338 241 GLU A C     
1036 O O     . GLU A 137 ? 0.8826 0.6038 0.3726 0.0021  0.0434  -0.0484 241 GLU A O     
1037 C CB    . GLU A 137 ? 0.7820 0.5260 0.3427 0.0065  0.0664  -0.0361 241 GLU A CB    
1038 C CG    . GLU A 137 ? 0.8210 0.5671 0.3967 0.0173  0.0698  -0.0574 241 GLU A CG    
1039 C CD    . GLU A 137 ? 0.9333 0.6767 0.5515 0.0286  0.0696  -0.0579 241 GLU A CD    
1040 O OE1   . GLU A 137 ? 0.7743 0.5177 0.4058 0.0275  0.0653  -0.0413 241 GLU A OE1   
1041 O OE2   . GLU A 137 ? 0.8147 0.5549 0.4523 0.0381  0.0730  -0.0751 241 GLU A OE2   
1042 N N     . VAL A 138 ? 0.7970 0.4974 0.3180 0.0031  0.0306  -0.0255 242 VAL A N     
1043 C CA    . VAL A 138 ? 0.8098 0.4996 0.3346 0.0085  0.0142  -0.0330 242 VAL A CA    
1044 C C     . VAL A 138 ? 0.9118 0.5899 0.4079 0.0065  -0.0028 -0.0223 242 VAL A C     
1045 O O     . VAL A 138 ? 0.9340 0.6129 0.4184 0.0098  -0.0161 -0.0312 242 VAL A O     
1046 C CB    . VAL A 138 ? 0.8102 0.4964 0.3732 0.0123  0.0119  -0.0336 242 VAL A CB    
1047 C CG1   . VAL A 138 ? 0.8028 0.4844 0.3781 0.0158  -0.0025 -0.0439 242 VAL A CG1   
1048 C CG2   . VAL A 138 ? 0.7918 0.4859 0.3794 0.0150  0.0251  -0.0384 242 VAL A CG2   
1049 N N     . PHE A 139 ? 0.8991 0.5656 0.3868 0.0016  -0.0044 -0.0034 243 PHE A N     
1050 C CA    . PHE A 139 ? 0.9368 0.5853 0.4012 0.0018  -0.0230 0.0115  243 PHE A CA    
1051 C C     . PHE A 139 ? 1.0590 0.7033 0.4774 -0.0098 -0.0180 0.0292  243 PHE A C     
1052 O O     . PHE A 139 ? 1.0993 0.7265 0.4902 -0.0103 -0.0351 0.0464  243 PHE A O     
1053 C CB    . PHE A 139 ? 0.9386 0.5700 0.4310 0.0049  -0.0305 0.0195  243 PHE A CB    
1054 C CG    . PHE A 139 ? 0.9103 0.5514 0.4446 0.0127  -0.0317 0.0026  243 PHE A CG    
1055 C CD1   . PHE A 139 ? 0.9346 0.5821 0.4815 0.0211  -0.0459 -0.0102 243 PHE A CD1   
1056 C CD2   . PHE A 139 ? 0.8929 0.5412 0.4530 0.0094  -0.0182 -0.0009 243 PHE A CD2   
1057 C CE1   . PHE A 139 ? 0.9054 0.5648 0.4910 0.0241  -0.0434 -0.0251 243 PHE A CE1   
1058 C CE2   . PHE A 139 ? 0.8898 0.5498 0.4823 0.0132  -0.0171 -0.0140 243 PHE A CE2   
1059 C CZ    . PHE A 139 ? 0.8663 0.5308 0.4719 0.0197  -0.0284 -0.0254 243 PHE A CZ    
1060 N N     . GLY A 140 ? 1.0396 0.7010 0.4515 -0.0193 0.0048  0.0261  244 GLY A N     
1061 C CA    . GLY A 140 ? 1.0907 0.7557 0.4614 -0.0348 0.0161  0.0410  244 GLY A CA    
1062 C C     . GLY A 140 ? 1.1491 0.7865 0.5140 -0.0450 0.0123  0.0680  244 GLY A C     
1063 O O     . GLY A 140 ? 1.1621 0.7885 0.4857 -0.0582 0.0121  0.0898  244 GLY A O     
1064 N N     . VAL A 141 ? 1.0819 0.7075 0.4881 -0.0402 0.0096  0.0660  245 VAL A N     
1065 C CA    . VAL A 141 ? 1.1045 0.6999 0.5185 -0.0473 0.0042  0.0842  245 VAL A CA    
1066 C C     . VAL A 141 ? 1.1418 0.7508 0.5793 -0.0600 0.0244  0.0799  245 VAL A C     
1067 O O     . VAL A 141 ? 1.0830 0.7161 0.5522 -0.0536 0.0319  0.0612  245 VAL A O     
1068 C CB    . VAL A 141 ? 1.1587 0.7333 0.6046 -0.0308 -0.0172 0.0790  245 VAL A CB    
1069 C CG1   . VAL A 141 ? 1.1798 0.7210 0.6422 -0.0363 -0.0223 0.0914  245 VAL A CG1   
1070 C CG2   . VAL A 141 ? 1.1852 0.7518 0.6135 -0.0176 -0.0404 0.0823  245 VAL A CG2   
1071 N N     . LYS A 142 ? 1.1508 0.7437 0.5736 -0.0789 0.0315  0.0988  246 LYS A N     
1072 C CA    . LYS A 142 ? 1.1587 0.7631 0.6057 -0.0945 0.0481  0.0953  246 LYS A CA    
1073 C C     . LYS A 142 ? 1.2784 0.8386 0.7284 -0.1059 0.0400  0.1132  246 LYS A C     
1074 O O     . LYS A 142 ? 1.3232 0.8607 0.7416 -0.1229 0.0426  0.1380  246 LYS A O     
1075 C CB    . LYS A 142 ? 1.2105 0.8497 0.6415 -0.1117 0.0722  0.0957  246 LYS A CB    
1076 C CG    . LYS A 142 ? 1.3674 1.0452 0.8384 -0.1159 0.0876  0.0774  246 LYS A CG    
1077 C CD    . LYS A 142 ? 1.4697 1.1362 0.9629 -0.1348 0.0913  0.0820  246 LYS A CD    
1078 C CE    . LYS A 142 ? 1.5658 1.2745 1.1003 -0.1342 0.0992  0.0614  246 LYS A CE    
1079 N NZ    . LYS A 142 ? 1.7167 1.4161 1.2747 -0.1529 0.1002  0.0603  246 LYS A NZ    
1080 N N     . VAL A 143 ? 1.2227 0.7683 0.7101 -0.0967 0.0297  0.1006  247 VAL A N     
1081 C CA    . VAL A 143 ? 1.2538 0.7537 0.7534 -0.1060 0.0218  0.1120  247 VAL A CA    
1082 C C     . VAL A 143 ? 1.2980 0.8142 0.8189 -0.1290 0.0406  0.1036  247 VAL A C     
1083 O O     . VAL A 143 ? 1.2610 0.8249 0.7963 -0.1299 0.0533  0.0853  247 VAL A O     
1084 C CB    . VAL A 143 ? 1.2936 0.7678 0.8246 -0.0855 0.0015  0.0996  247 VAL A CB    
1085 C CG1   . VAL A 143 ? 1.3476 0.7674 0.8935 -0.0934 -0.0075 0.1114  247 VAL A CG1   
1086 C CG2   . VAL A 143 ? 1.2905 0.7610 0.8067 -0.0629 -0.0170 0.1038  247 VAL A CG2   
1087 N N     . LYS A 144 ? 0.7643 0.9061 0.9044 0.1294  0.1023  0.2656  248 LYS A N     
1088 C CA    . LYS A 144 ? 0.7386 0.9088 0.9331 0.1017  0.1193  0.2902  248 LYS A CA    
1089 C C     . LYS A 144 ? 0.6811 0.8573 0.9311 0.0647  0.1062  0.2442  248 LYS A C     
1090 O O     . LYS A 144 ? 0.6496 0.8651 0.9304 0.0414  0.1165  0.2411  248 LYS A O     
1091 C CB    . LYS A 144 ? 0.8096 0.9718 1.0470 0.1035  0.1267  0.3376  248 LYS A CB    
1092 N N     . ASN A 145 ? 0.6017 0.7472 0.8626 0.0644  0.0841  0.2122  249 ASN A N     
1093 C CA    . ASN A 145 ? 0.5620 0.7137 0.8693 0.0420  0.0685  0.1708  249 ASN A CA    
1094 C C     . ASN A 145 ? 0.5164 0.6811 0.8012 0.0534  0.0540  0.1363  249 ASN A C     
1095 O O     . ASN A 145 ? 0.5029 0.6487 0.7901 0.0602  0.0332  0.1174  249 ASN A O     
1096 C CB    . ASN A 145 ? 0.6172 0.7274 0.9620 0.0347  0.0566  0.1678  249 ASN A CB    
1097 N N     . LEU A 146 ? 0.4212 0.6204 0.6862 0.0574  0.0672  0.1345  250 LEU A N     
1098 C CA    . LEU A 146 ? 0.3546 0.5708 0.6174 0.0659  0.0554  0.1069  250 LEU A CA    
1099 C C     . LEU A 146 ? 0.2547 0.5139 0.5805 0.0544  0.0481  0.0813  250 LEU A C     
1100 O O     . LEU A 146 ? 0.2200 0.5211 0.5783 0.0403  0.0639  0.0805  250 LEU A O     
1101 C CB    . LEU A 146 ? 0.3586 0.5955 0.5893 0.0760  0.0754  0.1125  250 LEU A CB    
1102 C CG    . LEU A 146 ? 0.4060 0.6706 0.6610 0.0813  0.0670  0.0886  250 LEU A CG    
1103 C CD1   . LEU A 146 ? 0.4423 0.6679 0.6817 0.0894  0.0340  0.0762  250 LEU A CD1   
1104 C CD2   . LEU A 146 ? 0.4416 0.7309 0.6792 0.0898  0.0958  0.0962  250 LEU A CD2   
1105 N N     . GLU A 147 ? 0.1438 0.3995 0.4839 0.0640  0.0235  0.0630  251 GLU A N     
1106 C CA    . GLU A 147 ? 0.1339 0.4291 0.5246 0.0680  0.0095  0.0395  251 GLU A CA    
1107 C C     . GLU A 147 ? 0.1742 0.5266 0.5904 0.0867  0.0039  0.0320  251 GLU A C     
1108 O O     . GLU A 147 ? 0.2017 0.5434 0.5950 0.0913  0.0047  0.0420  251 GLU A O     
1109 C CB    . GLU A 147 ? 0.1639 0.4105 0.5476 0.0746  -0.0146 0.0365  251 GLU A CB    
1110 C CG    . GLU A 147 ? 0.2211 0.4169 0.5991 0.0580  -0.0058 0.0476  251 GLU A CG    
1111 C CD    . GLU A 147 ? 0.4967 0.6458 0.8792 0.0637  -0.0207 0.0432  251 GLU A CD    
1112 O OE1   . GLU A 147 ? 0.3246 0.4688 0.6898 0.0845  -0.0379 0.0427  251 GLU A OE1   
1113 O OE2   . GLU A 147 ? 0.4715 0.5912 0.8783 0.0474  -0.0154 0.0417  251 GLU A OE2   
1114 N N     . PHE A 148 ? 0.0617 0.4586 0.5096 0.0953  -0.0015 0.0156  252 PHE A N     
1115 C CA    . PHE A 148 ? 0.0666 0.5027 0.5214 0.1101  -0.0016 0.0177  252 PHE A CA    
1116 C C     . PHE A 148 ? 0.0785 0.5095 0.5480 0.1284  -0.0312 0.0248  252 PHE A C     
1117 O O     . PHE A 148 ? 0.0814 0.4583 0.5243 0.1224  -0.0438 0.0249  252 PHE A O     
1118 C CB    . PHE A 148 ? 0.0689 0.5722 0.5570 0.1227  0.0028  0.0001  252 PHE A CB    
1119 C CG    . PHE A 148 ? 0.0644 0.6165 0.5686 0.1110  0.0337  -0.0018 252 PHE A CG    
1120 C CD1   . PHE A 148 ? 0.0684 0.6504 0.5665 0.1139  0.0597  0.0167  252 PHE A CD1   
1121 C CD2   . PHE A 148 ? 0.0604 0.6499 0.6078 0.0998  0.0387  -0.0198 252 PHE A CD2   
1122 C CE1   . PHE A 148 ? 0.0719 0.6890 0.5621 0.1032  0.0900  0.0227  252 PHE A CE1   
1123 C CE2   . PHE A 148 ? 0.0689 0.7281 0.6436 0.0866  0.0719  -0.0156 252 PHE A CE2   
1124 C CZ    . PHE A 148 ? 0.0703 0.7466 0.6117 0.0918  0.0991  0.0069  252 PHE A CZ    
1125 N N     . GLY A 149 ? 0.0841 0.5297 0.5502 0.1383  -0.0374 0.0351  253 GLY A N     
1126 C CA    . GLY A 149 ? 0.1003 0.5372 0.5671 0.1526  -0.0666 0.0489  253 GLY A CA    
1127 C C     . GLY A 149 ? 0.1084 0.5446 0.5968 0.1534  -0.0863 0.0666  253 GLY A C     
1128 O O     . GLY A 149 ? 0.0961 0.5127 0.5727 0.1374  -0.0711 0.0638  253 GLY A O     
1129 N N     . LEU A 150 ? 0.1219 0.5162 0.5678 0.1497  -0.1074 0.0800  254 LEU A N     
1130 C CA    . LEU A 150 ? 0.1381 0.5215 0.5857 0.1442  -0.1313 0.0926  254 LEU A CA    
1131 C C     . LEU A 150 ? 0.2982 0.6179 0.6879 0.1282  -0.1266 0.0804  254 LEU A C     
1132 O O     . LEU A 150 ? 0.3219 0.6070 0.6754 0.1286  -0.1197 0.0772  254 LEU A O     
1133 C CB    . LEU A 150 ? 0.1587 0.5447 0.5935 0.1529  -0.1589 0.1160  254 LEU A CB    
1134 C CG    . LEU A 150 ? 0.2427 0.6310 0.6840 0.1459  -0.1936 0.1312  254 LEU A CG    
1135 C CD1   . LEU A 150 ? 0.2322 0.6581 0.7385 0.1397  -0.2007 0.1395  254 LEU A CD1   
1136 C CD2   . LEU A 150 ? 0.2080 0.6007 0.6228 0.1542  -0.2155 0.1576  254 LEU A CD2   
1137 N N     . GLN A 151 ? 0.2887 0.5831 0.6610 0.1139  -0.1268 0.0746  255 GLN A N     
1138 C CA    . GLN A 151 ? 0.3248 0.5574 0.6281 0.1034  -0.1191 0.0633  255 GLN A CA    
1139 C C     . GLN A 151 ? 0.3990 0.6062 0.6626 0.1010  -0.1500 0.0672  255 GLN A C     
1140 O O     . GLN A 151 ? 0.3930 0.6269 0.6870 0.0990  -0.1785 0.0778  255 GLN A O     
1141 C CB    . GLN A 151 ? 0.3386 0.5584 0.6355 0.0976  -0.0984 0.0521  255 GLN A CB    
1142 C CG    . GLN A 151 ? 0.2670 0.5324 0.6080 0.1017  -0.0651 0.0532  255 GLN A CG    
1143 C CD    . GLN A 151 ? 0.4466 0.7087 0.7713 0.1008  -0.0441 0.0530  255 GLN A CD    
1144 O OE1   . GLN A 151 ? 0.3141 0.5303 0.5840 0.0976  -0.0362 0.0555  255 GLN A OE1   
1145 N NE2   . GLN A 151 ? 0.0773 0.3942 0.4549 0.1058  -0.0341 0.0510  255 GLN A NE2   
1146 N N     . PRO A 152 ? 0.3954 0.5641 0.5970 0.1045  -0.1445 0.0654  256 PRO A N     
1147 C CA    . PRO A 152 ? 0.4206 0.5830 0.5848 0.1071  -0.1714 0.0713  256 PRO A CA    
1148 C C     . PRO A 152 ? 0.5170 0.6601 0.6519 0.0984  -0.1968 0.0526  256 PRO A C     
1149 O O     . PRO A 152 ? 0.5348 0.6767 0.6295 0.1018  -0.2176 0.0525  256 PRO A O     
1150 C CB    . PRO A 152 ? 0.4796 0.6210 0.5995 0.1214  -0.1498 0.0810  256 PRO A CB    
1151 C CG    . PRO A 152 ? 0.5239 0.6479 0.6486 0.1210  -0.1166 0.0767  256 PRO A CG    
1152 C CD    . PRO A 152 ? 0.4321 0.5743 0.6022 0.1095  -0.1128 0.0649  256 PRO A CD    
1153 N N     . HIS A 153 ? 0.4944 0.6241 0.6496 0.0886  -0.1952 0.0361  257 HIS A N     
1154 C CA    . HIS A 153 ? 0.5553 0.6517 0.6822 0.0800  -0.2208 0.0114  257 HIS A CA    
1155 C C     . HIS A 153 ? 0.5721 0.6814 0.7696 0.0611  -0.2394 0.0107  257 HIS A C     
1156 O O     . HIS A 153 ? 0.5226 0.6518 0.7732 0.0624  -0.2138 0.0198  257 HIS A O     
1157 C CB    . HIS A 153 ? 0.6098 0.6590 0.6774 0.0937  -0.1953 -0.0078 257 HIS A CB    
1158 C CG    . HIS A 153 ? 0.6786 0.7212 0.6856 0.1169  -0.1758 0.0007  257 HIS A CG    
1159 N ND1   . HIS A 153 ? 0.6688 0.7173 0.6806 0.1262  -0.1358 0.0189  257 HIS A ND1   
1160 C CD2   . HIS A 153 ? 0.7332 0.7737 0.6842 0.1333  -0.1905 -0.0021 257 HIS A CD2   
1161 C CE1   . HIS A 153 ? 0.6900 0.7342 0.6534 0.1477  -0.1274 0.0301  257 HIS A CE1   
1162 N NE2   . HIS A 153 ? 0.7358 0.7791 0.6611 0.1561  -0.1571 0.0186  257 HIS A NE2   
1163 N N     . LYS A 154 ? 0.7284 0.5013 0.4819 -0.0743 -0.1182 -0.0019 258 LYS A N     
1164 C CA    . LYS A 154 ? 0.6975 0.4917 0.4865 -0.0738 -0.1169 -0.0102 258 LYS A CA    
1165 C C     . LYS A 154 ? 0.7173 0.5057 0.4871 -0.0821 -0.1109 -0.0228 258 LYS A C     
1166 O O     . LYS A 154 ? 0.7361 0.5167 0.4731 -0.0891 -0.1123 -0.0270 258 LYS A O     
1167 C CB    . LYS A 154 ? 0.7328 0.5463 0.5451 -0.0722 -0.1372 -0.0104 258 LYS A CB    
1168 C CG    . LYS A 154 ? 0.7936 0.6202 0.6341 -0.0560 -0.1468 -0.0045 258 LYS A CG    
1169 C CD    . LYS A 154 ? 0.8970 0.7568 0.7649 -0.0508 -0.1718 -0.0108 258 LYS A CD    
1170 C CE    . LYS A 154 ? 0.9953 0.8712 0.8944 -0.0256 -0.1859 -0.0098 258 LYS A CE    
1171 N NZ    . LYS A 154 ? 1.1661 1.0774 1.0877 -0.0128 -0.2193 -0.0174 258 LYS A NZ    
1172 N N     . ILE A 155 ? 0.6517 0.4378 0.4352 -0.0814 -0.1043 -0.0299 259 ILE A N     
1173 C CA    . ILE A 155 ? 0.6628 0.4331 0.4271 -0.0825 -0.1020 -0.0442 259 ILE A CA    
1174 C C     . ILE A 155 ? 0.7695 0.5382 0.5182 -0.0954 -0.1150 -0.0497 259 ILE A C     
1175 O O     . ILE A 155 ? 0.7798 0.5604 0.5451 -0.1034 -0.1264 -0.0448 259 ILE A O     
1176 C CB    . ILE A 155 ? 0.7021 0.4501 0.4711 -0.0793 -0.0978 -0.0463 259 ILE A CB    
1177 C CG1   . ILE A 155 ? 0.6713 0.4212 0.4474 -0.0657 -0.0887 -0.0419 259 ILE A CG1   
1178 C CG2   . ILE A 155 ? 0.7600 0.4746 0.5034 -0.0779 -0.1007 -0.0613 259 ILE A CG2   
1179 C CD1   . ILE A 155 ? 0.7062 0.4663 0.4745 -0.0501 -0.0844 -0.0545 259 ILE A CD1   
1180 N N     . PRO A 156 ? 0.7602 0.5234 0.4794 -0.0988 -0.1137 -0.0623 260 PRO A N     
1181 C CA    . PRO A 156 ? 0.7981 0.5592 0.4959 -0.1136 -0.1271 -0.0679 260 PRO A CA    
1182 C C     . PRO A 156 ? 0.8867 0.6399 0.5964 -0.1239 -0.1353 -0.0737 260 PRO A C     
1183 O O     . PRO A 156 ? 0.8866 0.6149 0.5981 -0.1215 -0.1267 -0.0808 260 PRO A O     
1184 C CB    . PRO A 156 ? 0.8413 0.5955 0.5067 -0.1158 -0.1168 -0.0879 260 PRO A CB    
1185 C CG    . PRO A 156 ? 0.8697 0.6366 0.5419 -0.1047 -0.1003 -0.0899 260 PRO A CG    
1186 C CD    . PRO A 156 ? 0.7827 0.5488 0.4888 -0.0909 -0.0994 -0.0773 260 PRO A CD    
1187 N N     . ASP A 157 ? 0.8863 0.6589 0.6006 -0.1364 -0.1533 -0.0713 261 ASP A N     
1188 C CA    . ASP A 157 ? 0.9033 0.6827 0.6322 -0.1552 -0.1614 -0.0809 261 ASP A CA    
1189 C C     . ASP A 157 ? 0.9190 0.7091 0.6867 -0.1586 -0.1530 -0.0764 261 ASP A C     
1190 O O     . ASP A 157 ? 0.9591 0.7414 0.7301 -0.1811 -0.1493 -0.0873 261 ASP A O     
1191 C CB    . ASP A 157 ? 0.9760 0.7178 0.6713 -0.1691 -0.1559 -0.1008 261 ASP A CB    
1192 C CG    . ASP A 157 ? 1.2155 0.9514 0.8712 -0.1700 -0.1599 -0.1110 261 ASP A CG    
1193 O OD1   . ASP A 157 ? 1.2428 1.0029 0.8881 -0.1794 -0.1784 -0.1085 261 ASP A OD1   
1194 O OD2   . ASP A 157 ? 1.3406 1.0494 0.9742 -0.1605 -0.1455 -0.1236 261 ASP A OD2   
1195 N N     . THR A 158 ? 0.8123 0.6165 0.6031 -0.1414 -0.1473 -0.0624 262 THR A N     
1196 C CA    . THR A 158 ? 0.7749 0.5931 0.5996 -0.1455 -0.1363 -0.0596 262 THR A CA    
1197 C C     . THR A 158 ? 0.7933 0.6495 0.6521 -0.1270 -0.1421 -0.0496 262 THR A C     
1198 O O     . THR A 158 ? 0.7954 0.6505 0.6406 -0.1104 -0.1539 -0.0409 262 THR A O     
1199 C CB    . THR A 158 ? 0.8113 0.5860 0.6170 -0.1396 -0.1169 -0.0545 262 THR A CB    
1200 O OG1   . THR A 158 ? 0.7822 0.5631 0.5920 -0.1168 -0.1132 -0.0435 262 THR A OG1   
1201 C CG2   . THR A 158 ? 0.7761 0.4967 0.5389 -0.1417 -0.1140 -0.0631 262 THR A CG2   
1202 N N     . GLU A 159 ? 0.7157 0.5956 0.6102 -0.1313 -0.1310 -0.0517 263 GLU A N     
1203 C CA    . GLU A 159 ? 0.6789 0.5897 0.6082 -0.1119 -0.1320 -0.0468 263 GLU A CA    
1204 C C     . GLU A 159 ? 0.6953 0.5767 0.6119 -0.1052 -0.1106 -0.0372 263 GLU A C     
1205 O O     . GLU A 159 ? 0.6943 0.5929 0.6349 -0.0923 -0.1057 -0.0349 263 GLU A O     
1206 C CB    . GLU A 159 ? 0.6854 0.6581 0.6706 -0.1220 -0.1330 -0.0639 263 GLU A CB    
1207 C CG    . GLU A 159 ? 0.8169 0.8367 0.8269 -0.1180 -0.1622 -0.0755 263 GLU A CG    
1208 C CD    . GLU A 159 ? 1.0638 1.0732 1.0579 -0.0846 -0.1908 -0.0624 263 GLU A CD    
1209 O OE1   . GLU A 159 ? 0.9428 0.9341 0.9008 -0.0875 -0.2092 -0.0586 263 GLU A OE1   
1210 O OE2   . GLU A 159 ? 0.9953 1.0066 1.0050 -0.0575 -0.1941 -0.0560 263 GLU A OE2   
1211 N N     . THR A 160 ? 0.6346 0.4721 0.5132 -0.1113 -0.1003 -0.0339 264 THR A N     
1212 C CA    . THR A 160 ? 0.6217 0.4340 0.4851 -0.1038 -0.0850 -0.0269 264 THR A CA    
1213 C C     . THR A 160 ? 0.6346 0.4497 0.4955 -0.0841 -0.0862 -0.0197 264 THR A C     
1214 O O     . THR A 160 ? 0.6455 0.4517 0.4857 -0.0785 -0.0935 -0.0191 264 THR A O     
1215 C CB    . THR A 160 ? 0.6957 0.4601 0.5185 -0.1068 -0.0818 -0.0281 264 THR A CB    
1216 O OG1   . THR A 160 ? 0.7342 0.4812 0.5476 -0.1314 -0.0794 -0.0342 264 THR A OG1   
1217 C CG2   . THR A 160 ? 0.6706 0.4128 0.4764 -0.0954 -0.0727 -0.0222 264 THR A CG2   
1218 N N     . LEU A 161 ? 0.5646 0.3898 0.4416 -0.0782 -0.0764 -0.0165 265 LEU A N     
1219 C CA    . LEU A 161 ? 0.5556 0.3766 0.4254 -0.0655 -0.0746 -0.0111 265 LEU A CA    
1220 C C     . LEU A 161 ? 0.6268 0.4322 0.4724 -0.0638 -0.0652 -0.0121 265 LEU A C     
1221 O O     . LEU A 161 ? 0.6255 0.4188 0.4613 -0.0662 -0.0623 -0.0144 265 LEU A O     
1222 C CB    . LEU A 161 ? 0.5591 0.3951 0.4558 -0.0591 -0.0680 -0.0114 265 LEU A CB    
1223 C CG    . LEU A 161 ? 0.6361 0.5012 0.5695 -0.0521 -0.0797 -0.0170 265 LEU A CG    
1224 C CD1   . LEU A 161 ? 0.6462 0.5268 0.6083 -0.0424 -0.0695 -0.0235 265 LEU A CD1   
1225 C CD2   . LEU A 161 ? 0.6582 0.5121 0.5776 -0.0393 -0.1022 -0.0107 265 LEU A CD2   
1226 N N     . CYS A 162 ? 0.5594 0.3636 0.3915 -0.0605 -0.0624 -0.0121 266 CYS A N     
1227 C CA    . CYS A 162 ? 0.5519 0.3598 0.3713 -0.0585 -0.0545 -0.0196 266 CYS A CA    
1228 C C     . CYS A 162 ? 0.5623 0.3741 0.3860 -0.0603 -0.0439 -0.0182 266 CYS A C     
1229 O O     . CYS A 162 ? 0.5843 0.3864 0.4039 -0.0637 -0.0423 -0.0136 266 CYS A O     
1230 C CB    . CYS A 162 ? 0.5646 0.3778 0.3654 -0.0621 -0.0549 -0.0283 266 CYS A CB    
1231 S SG    . CYS A 162 ? 0.6409 0.4472 0.4327 -0.0597 -0.0657 -0.0354 266 CYS A SG    
1232 N N     . TYR A 163 ? 0.5061 0.3245 0.3313 -0.0575 -0.0386 -0.0222 267 TYR A N     
1233 C CA    . TYR A 163 ? 0.4797 0.3030 0.3068 -0.0615 -0.0276 -0.0241 267 TYR A CA    
1234 C C     . TYR A 163 ? 0.5241 0.3675 0.3429 -0.0593 -0.0268 -0.0362 267 TYR A C     
1235 O O     . TYR A 163 ? 0.5509 0.3949 0.3644 -0.0476 -0.0369 -0.0388 267 TYR A O     
1236 C CB    . TYR A 163 ? 0.4916 0.3091 0.3294 -0.0622 -0.0229 -0.0192 267 TYR A CB    
1237 C CG    . TYR A 163 ? 0.4905 0.3106 0.3296 -0.0668 -0.0100 -0.0234 267 TYR A CG    
1238 C CD1   . TYR A 163 ? 0.5116 0.3231 0.3613 -0.0664 -0.0043 -0.0238 267 TYR A CD1   
1239 C CD2   . TYR A 163 ? 0.5099 0.3364 0.3348 -0.0695 -0.0063 -0.0285 267 TYR A CD2   
1240 C CE1   . TYR A 163 ? 0.5130 0.3202 0.3605 -0.0707 0.0088  -0.0308 267 TYR A CE1   
1241 C CE2   . TYR A 163 ? 0.5228 0.3517 0.3456 -0.0769 0.0064  -0.0350 267 TYR A CE2   
1242 C CZ    . TYR A 163 ? 0.5953 0.4136 0.4301 -0.0786 0.0158  -0.0370 267 TYR A CZ    
1243 O OH    . TYR A 163 ? 0.5813 0.3958 0.4105 -0.0860 0.0294  -0.0463 267 TYR A OH    
1244 N N     . VAL A 164 ? 0.4414 0.2229 0.3510 0.0429  -0.0274 -0.0251 268 VAL A N     
1245 C CA    . VAL A 164 ? 0.4149 0.1971 0.2987 0.0392  -0.0232 -0.0157 268 VAL A CA    
1246 C C     . VAL A 164 ? 0.4782 0.2668 0.3593 0.0364  -0.0161 -0.0225 268 VAL A C     
1247 O O     . VAL A 164 ? 0.4693 0.2529 0.3606 0.0390  -0.0223 -0.0319 268 VAL A O     
1248 C CB    . VAL A 164 ? 0.4353 0.2102 0.3055 0.0384  -0.0343 -0.0051 268 VAL A CB    
1249 C CG1   . VAL A 164 ? 0.4323 0.2203 0.2809 0.0354  -0.0295 0.0029  268 VAL A CG1   
1250 C CG2   . VAL A 164 ? 0.4220 0.1900 0.2914 0.0433  -0.0416 0.0003  268 VAL A CG2   
1251 N N     . MET A 165 ? 0.4644 0.2593 0.3278 0.0327  -0.0068 -0.0186 269 MET A N     
1252 C CA    . MET A 165 ? 0.4884 0.2865 0.3450 0.0301  -0.0011 -0.0245 269 MET A CA    
1253 C C     . MET A 165 ? 0.5093 0.3072 0.3439 0.0273  -0.0031 -0.0149 269 MET A C     
1254 O O     . MET A 165 ? 0.4981 0.2994 0.3219 0.0292  -0.0047 -0.0068 269 MET A O     
1255 C CB    . MET A 165 ? 0.5174 0.3263 0.3724 0.0260  0.0130  -0.0310 269 MET A CB    
1256 C CG    . MET A 165 ? 0.5510 0.3742 0.4314 0.0268  0.0171  -0.0415 269 MET A CG    
1257 S SD    . MET A 165 ? 0.5870 0.4373 0.4684 0.0183  0.0355  -0.0524 269 MET A SD    
1258 C CE    . MET A 165 ? 0.5391 0.3733 0.3829 0.0031  0.0390  -0.0343 269 MET A CE    
1259 N N     . PRO A 166 ? 0.4794 0.2751 0.3069 0.0242  -0.0047 -0.0173 270 PRO A N     
1260 C CA    . PRO A 166 ? 0.4946 0.2965 0.3036 0.0207  -0.0057 -0.0094 270 PRO A CA    
1261 C C     . PRO A 166 ? 0.5336 0.3369 0.3277 0.0232  0.0029  -0.0098 270 PRO A C     
1262 O O     . PRO A 166 ? 0.5085 0.3069 0.3025 0.0215  0.0114  -0.0163 270 PRO A O     
1263 C CB    . PRO A 166 ? 0.5428 0.3361 0.3471 0.0167  -0.0090 -0.0148 270 PRO A CB    
1264 C CG    . PRO A 166 ? 0.5942 0.3749 0.4135 0.0205  -0.0146 -0.0253 270 PRO A CG    
1265 C CD    . PRO A 166 ? 0.5146 0.3032 0.3492 0.0260  -0.0060 -0.0299 270 PRO A CD    
1266 N N     . SER A 167 ? 0.5053 0.3165 0.2853 0.0272  -0.0012 -0.0036 271 SER A N     
1267 C CA    . SER A 167 ? 0.5178 0.3203 0.2766 0.0313  -0.0008 -0.0041 271 SER A CA    
1268 C C     . SER A 167 ? 0.5832 0.3741 0.3288 0.0245  0.0058  -0.0087 271 SER A C     
1269 O O     . SER A 167 ? 0.5199 0.3145 0.2653 0.0218  0.0058  -0.0106 271 SER A O     
1270 C CB    . SER A 167 ? 0.5473 0.3638 0.2931 0.0411  -0.0099 -0.0018 271 SER A CB    
1271 O OG    . SER A 167 ? 0.5828 0.3813 0.3028 0.0469  -0.0152 -0.0042 271 SER A OG    
1272 N N     . SER A 168 ? 0.5796 0.3550 0.3095 0.0198  0.0096  -0.0092 272 SER A N     
1273 C CA    . SER A 168 ? 0.5746 0.3399 0.2858 0.0105  0.0170  -0.0127 272 SER A CA    
1274 C C     . SER A 168 ? 0.6086 0.3636 0.2944 0.0150  0.0079  -0.0114 272 SER A C     
1275 O O     . SER A 168 ? 0.6092 0.3548 0.2776 0.0092  0.0116  -0.0144 272 SER A O     
1276 C CB    . SER A 168 ? 0.6122 0.3661 0.3096 -0.0012 0.0212  -0.0100 272 SER A CB    
1277 O OG    . SER A 168 ? 0.6150 0.3465 0.2889 0.0019  0.0064  -0.0030 272 SER A OG    
1278 N N     . SER A 169 ? 0.5704 0.3314 0.2550 0.0273  -0.0046 -0.0088 273 SER A N     
1279 C CA    . SER A 169 ? 0.5801 0.3406 0.2468 0.0351  -0.0153 -0.0105 273 SER A CA    
1280 C C     . SER A 169 ? 0.6271 0.3987 0.3026 0.0292  -0.0106 -0.0123 273 SER A C     
1281 O O     . SER A 169 ? 0.5964 0.3843 0.2960 0.0252  -0.0063 -0.0113 273 SER A O     
1282 C CB    . SER A 169 ? 0.5745 0.3583 0.2485 0.0511  -0.0268 -0.0110 273 SER A CB    
1283 O OG    . SER A 169 ? 0.6637 0.4567 0.3264 0.0589  -0.0366 -0.0151 273 SER A OG    
1284 N N     . ALA A 170 ? 0.6159 0.3735 0.2684 0.0285  -0.0154 -0.0149 274 ALA A N     
1285 C CA    . ALA A 170 ? 0.6128 0.3769 0.2714 0.0232  -0.0144 -0.0165 274 ALA A CA    
1286 C C     . ALA A 170 ? 0.6327 0.4289 0.3074 0.0276  -0.0248 -0.0138 274 ALA A C     
1287 O O     . ALA A 170 ? 0.6433 0.4446 0.3210 0.0212  -0.0288 -0.0132 274 ALA A O     
1288 C CB    . ALA A 170 ? 0.6508 0.3877 0.2780 0.0197  -0.0159 -0.0200 274 ALA A CB    
1289 N N     . ARG A 171 ? 0.5759 0.3964 0.2602 0.0375  -0.0296 -0.0125 275 ARG A N     
1290 C CA    A ARG A 171 ? 0.5768 0.4417 0.2773 0.0404  -0.0371 -0.0108 275 ARG A CA    
1291 C CA    B ARG A 171 ? 0.5714 0.4366 0.2720 0.0405  -0.0371 -0.0108 275 ARG A CA    
1292 C C     . ARG A 171 ? 0.6232 0.5084 0.3463 0.0234  -0.0343 -0.0024 275 ARG A C     
1293 O O     . ARG A 171 ? 0.6279 0.5361 0.3568 0.0145  -0.0411 0.0011  275 ARG A O     
1294 C CB    A ARG A 171 ? 0.5681 0.4588 0.2711 0.0580  -0.0426 -0.0144 275 ARG A CB    
1295 C CB    B ARG A 171 ? 0.5532 0.4433 0.2559 0.0583  -0.0425 -0.0145 275 ARG A CB    
1296 C CG    A ARG A 171 ? 0.6695 0.6216 0.3906 0.0613  -0.0480 -0.0147 275 ARG A CG    
1297 C CG    B ARG A 171 ? 0.6144 0.5666 0.3390 0.0602  -0.0452 -0.0129 275 ARG A CG    
1298 C CD    A ARG A 171 ? 0.6956 0.6784 0.4166 0.0844  -0.0544 -0.0230 275 ARG A CD    
1299 C CD    B ARG A 171 ? 0.7328 0.7224 0.4596 0.0645  -0.0548 -0.0179 275 ARG A CD    
1300 N NE    A ARG A 171 ? 0.7311 0.6832 0.4253 0.1071  -0.0683 -0.0351 275 ARG A NE    
1301 N NE    B ARG A 171 ? 0.7581 0.7550 0.4956 0.0404  -0.0532 -0.0085 275 ARG A NE    
1302 C CZ    A ARG A 171 ? 0.8511 0.8145 0.5355 0.1211  -0.0822 -0.0455 275 ARG A CZ    
1303 C CZ    B ARG A 171 ? 0.8135 0.8613 0.5652 0.0316  -0.0590 -0.0058 275 ARG A CZ    
1304 N NH1   A ARG A 171 ? 0.6336 0.6450 0.3371 0.1134  -0.0818 -0.0449 275 ARG A NH1   
1305 N NH1   B ARG A 171 ? 0.6782 0.7208 0.4347 0.0069  -0.0613 0.0046  275 ARG A NH1   
1306 N NH2   A ARG A 171 ? 0.6711 0.5951 0.3250 0.1416  -0.0997 -0.0561 275 ARG A NH2   
1307 N NH2   B ARG A 171 ? 0.5729 0.6795 0.3338 0.0475  -0.0643 -0.0145 275 ARG A NH2   
1308 N N     . CYS A 172 ? 0.6003 0.4740 0.3339 0.0174  -0.0276 0.0012  276 CYS A N     
1309 C CA    . CYS A 172 ? 0.5950 0.4782 0.3432 0.0007  -0.0312 0.0096  276 CYS A CA    
1310 C C     . CYS A 172 ? 0.6360 0.4919 0.3776 -0.0104 -0.0368 0.0093  276 CYS A C     
1311 O O     . CYS A 172 ? 0.6511 0.4738 0.3840 -0.0059 -0.0319 0.0014  276 CYS A O     
1312 C CB    . CYS A 172 ? 0.5971 0.4743 0.3567 -0.0009 -0.0276 0.0126  276 CYS A CB    
1313 S SG    . CYS A 172 ? 0.6575 0.4918 0.4161 0.0048  -0.0194 0.0034  276 CYS A SG    
1314 N N     . ALA A 173 ? 0.5973 0.4708 0.3424 -0.0261 -0.0483 0.0181  277 ALA A N     
1315 C CA    . ALA A 173 ? 0.6188 0.4644 0.3546 -0.0382 -0.0602 0.0193  277 ALA A CA    
1316 C C     . ALA A 173 ? 0.6522 0.4639 0.3882 -0.0449 -0.0679 0.0200  277 ALA A C     
1317 O O     . ALA A 173 ? 0.6717 0.4494 0.3959 -0.0469 -0.0783 0.0154  277 ALA A O     
1318 C CB    . ALA A 173 ? 0.6322 0.5098 0.3706 -0.0563 -0.0733 0.0304  277 ALA A CB    
1319 N N     . GLN A 174 ? 0.6005 0.4173 0.3476 -0.0453 -0.0651 0.0234  278 GLN A N     
1320 C CA    . GLN A 174 ? 0.6106 0.3916 0.3567 -0.0500 -0.0777 0.0227  278 GLN A CA    
1321 C C     . GLN A 174 ? 0.6405 0.3897 0.3851 -0.0309 -0.0715 0.0043  278 GLN A C     
1322 O O     . GLN A 174 ? 0.6417 0.3574 0.3817 -0.0296 -0.0865 -0.0021 278 GLN A O     
1323 C CB    . GLN A 174 ? 0.6248 0.4194 0.3808 -0.0571 -0.0790 0.0322  278 GLN A CB    
1324 C CG    . GLN A 174 ? 0.6607 0.4879 0.4144 -0.0829 -0.0892 0.0516  278 GLN A CG    
1325 C CD    . GLN A 174 ? 0.7779 0.6644 0.5413 -0.0783 -0.0733 0.0544  278 GLN A CD    
1326 O OE1   . GLN A 174 ? 0.6519 0.5473 0.4195 -0.0561 -0.0584 0.0428  278 GLN A OE1   
1327 N NE2   . GLN A 174 ? 0.6259 0.5553 0.3906 -0.0995 -0.0783 0.0692  278 GLN A NE2   
1328 N N     . PHE A 175 ? 0.5910 0.3524 0.3379 -0.0163 -0.0513 -0.0046 279 PHE A N     
1329 C CA    . PHE A 175 ? 0.5959 0.3420 0.3414 -0.0017 -0.0404 -0.0214 279 PHE A CA    
1330 C C     . PHE A 175 ? 0.6422 0.3916 0.3708 0.0007  -0.0309 -0.0241 279 PHE A C     
1331 O O     . PHE A 175 ? 0.6329 0.3953 0.3594 0.0046  -0.0175 -0.0235 279 PHE A O     
1332 C CB    . PHE A 175 ? 0.5891 0.3483 0.3506 0.0058  -0.0271 -0.0241 279 PHE A CB    
1333 C CG    . PHE A 175 ? 0.6032 0.3591 0.3790 0.0027  -0.0380 -0.0191 279 PHE A CG    
1334 C CD1   . PHE A 175 ? 0.6427 0.3777 0.4257 0.0098  -0.0477 -0.0308 279 PHE A CD1   
1335 C CD2   . PHE A 175 ? 0.6016 0.3759 0.3813 -0.0061 -0.0405 -0.0042 279 PHE A CD2   
1336 C CE1   . PHE A 175 ? 0.6376 0.3621 0.4292 0.0065  -0.0618 -0.0260 279 PHE A CE1   
1337 C CE2   . PHE A 175 ? 0.6391 0.4069 0.4264 -0.0115 -0.0517 0.0017  279 PHE A CE2   
1338 C CZ    . PHE A 175 ? 0.6168 0.3556 0.4087 -0.0061 -0.0635 -0.0083 279 PHE A CZ    
1339 N N     . PRO A 176 ? 0.6216 0.3561 0.3349 -0.0038 -0.0424 -0.0244 280 PRO A N     
1340 C CA    . PRO A 176 ? 0.6376 0.3735 0.3329 -0.0029 -0.0374 -0.0249 280 PRO A CA    
1341 C C     . PRO A 176 ? 0.6930 0.4216 0.3735 0.0058  -0.0207 -0.0362 280 PRO A C     
1342 O O     . PRO A 176 ? 0.7003 0.4299 0.3648 0.0056  -0.0164 -0.0337 280 PRO A O     
1343 C CB    . PRO A 176 ? 0.6961 0.4121 0.3784 -0.0097 -0.0559 -0.0241 280 PRO A CB    
1344 C CG    . PRO A 176 ? 0.7545 0.4481 0.4413 -0.0101 -0.0699 -0.0284 280 PRO A CG    
1345 C CD    . PRO A 176 ? 0.6619 0.3724 0.3701 -0.0111 -0.0649 -0.0231 280 PRO A CD    
1346 N N     . ARG A 177 ? 0.6496 0.3463 0.2059 -0.0185 -0.0299 -0.0335 281 ARG A N     
1347 C CA    . ARG A 177 ? 0.6724 0.3711 0.2159 -0.0099 -0.0141 -0.0355 281 ARG A CA    
1348 C C     . ARG A 177 ? 0.7161 0.4124 0.2850 0.0000  -0.0002 -0.0330 281 ARG A C     
1349 O O     . ARG A 177 ? 0.7046 0.3920 0.2971 0.0020  -0.0024 -0.0358 281 ARG A O     
1350 C CB    . ARG A 177 ? 0.6897 0.3760 0.2087 -0.0110 -0.0107 -0.0574 281 ARG A CB    
1351 C CG    . ARG A 177 ? 0.8052 0.4920 0.2964 -0.0228 -0.0250 -0.0660 281 ARG A CG    
1352 C CD    . ARG A 177 ? 0.9215 0.5884 0.3976 -0.0225 -0.0247 -0.0959 281 ARG A CD    
1353 N NE    . ARG A 177 ? 0.9829 0.6182 0.4872 -0.0183 -0.0287 -0.1058 281 ARG A NE    
1354 C CZ    . ARG A 177 ? 1.1874 0.8009 0.6947 -0.0090 -0.0252 -0.1325 281 ARG A CZ    
1355 N NH1   . ARG A 177 ? 0.9992 0.6245 0.4805 -0.0038 -0.0154 -0.1565 281 ARG A NH1   
1356 N NH2   . ARG A 177 ? 1.0520 0.6350 0.5888 -0.0042 -0.0325 -0.1362 281 ARG A NH2   
1357 N N     . ALA A 178 ? 0.7042 0.4105 0.2668 0.0041  0.0136  -0.0268 282 ALA A N     
1358 C CA    . ALA A 178 ? 0.6907 0.3990 0.2768 0.0105  0.0280  -0.0249 282 ALA A CA    
1359 C C     . ALA A 178 ? 0.7349 0.4330 0.3302 0.0166  0.0335  -0.0454 282 ALA A C     
1360 O O     . ALA A 178 ? 0.7047 0.4005 0.3292 0.0219  0.0358  -0.0457 282 ALA A O     
1361 C CB    . ALA A 178 ? 0.7091 0.4331 0.2811 0.0085  0.0414  -0.0137 282 ALA A CB    
1362 N N     . GLN A 179 ? 0.7469 0.4385 0.3195 0.0168  0.0328  -0.0639 283 GLN A N     
1363 C CA    . GLN A 179 ? 0.7513 0.4277 0.3346 0.0260  0.0344  -0.0878 283 GLN A CA    
1364 C C     . GLN A 179 ? 0.7593 0.4119 0.3698 0.0265  0.0189  -0.0851 283 GLN A C     
1365 O O     . GLN A 179 ? 0.7746 0.4166 0.4085 0.0370  0.0201  -0.0958 283 GLN A O     
1366 C CB    . GLN A 179 ? 0.7980 0.4677 0.3507 0.0249  0.0312  -0.1118 283 GLN A CB    
1367 C CG    . GLN A 179 ? 0.9979 0.6469 0.5630 0.0375  0.0300  -0.1426 283 GLN A CG    
1368 C CD    . GLN A 179 ? 1.2781 0.9475 0.8641 0.0533  0.0494  -0.1539 283 GLN A CD    
1369 O OE1   . GLN A 179 ? 1.1893 0.8957 0.7623 0.0531  0.0685  -0.1520 283 GLN A OE1   
1370 N NE2   . GLN A 179 ? 1.2111 0.8600 0.8315 0.0662  0.0438  -0.1637 283 GLN A NE2   
1371 N N     . ASP A 180 ? 0.7037 0.3520 0.3111 0.0148  0.0033  -0.0707 284 ASP A N     
1372 C CA    . ASP A 180 ? 0.7083 0.3420 0.3374 0.0104  -0.0123 -0.0633 284 ASP A CA    
1373 C C     . ASP A 180 ? 0.7414 0.3912 0.3993 0.0146  -0.0083 -0.0498 284 ASP A C     
1374 O O     . ASP A 180 ? 0.7226 0.3656 0.3999 0.0128  -0.0192 -0.0435 284 ASP A O     
1375 C CB    . ASP A 180 ? 0.7245 0.3583 0.3406 -0.0064 -0.0297 -0.0534 284 ASP A CB    
1376 C CG    . ASP A 180 ? 0.7928 0.4097 0.3819 -0.0128 -0.0365 -0.0692 284 ASP A CG    
1377 O OD1   . ASP A 180 ? 0.8604 0.4480 0.4518 -0.0079 -0.0401 -0.0879 284 ASP A OD1   
1378 O OD2   . ASP A 180 ? 0.8326 0.4662 0.4003 -0.0215 -0.0395 -0.0648 284 ASP A OD2   
1379 N N     . LYS A 181 ? 0.6897 0.3604 0.3512 0.0192  0.0059  -0.0451 285 LYS A N     
1380 C CA    . LYS A 181 ? 0.6592 0.3458 0.3484 0.0223  0.0092  -0.0364 285 LYS A CA    
1381 C C     . LYS A 181 ? 0.6984 0.3895 0.4049 0.0328  0.0239  -0.0440 285 LYS A C     
1382 O O     . LYS A 181 ? 0.6774 0.3800 0.4108 0.0357  0.0247  -0.0403 285 LYS A O     
1383 C CB    . LYS A 181 ? 0.6469 0.3514 0.3344 0.0186  0.0107  -0.0258 285 LYS A CB    
1384 C CG    . LYS A 181 ? 0.6434 0.3547 0.3197 0.0104  -0.0036 -0.0199 285 LYS A CG    
1385 C CD    . LYS A 181 ? 0.6152 0.3417 0.2919 0.0116  -0.0040 -0.0132 285 LYS A CD    
1386 C CE    . LYS A 181 ? 0.6525 0.3930 0.3186 0.0051  -0.0175 -0.0101 285 LYS A CE    
1387 N NZ    . LYS A 181 ? 0.6224 0.3745 0.2878 0.0101  -0.0199 -0.0048 285 LYS A NZ    
1388 N N     . VAL A 182 ? 0.6519 0.3415 0.3434 0.0376  0.0360  -0.0558 286 VAL A N     
1389 C CA    . VAL A 182 ? 0.6583 0.3639 0.3659 0.0464  0.0527  -0.0639 286 VAL A CA    
1390 C C     . VAL A 182 ? 0.6461 0.3499 0.3878 0.0574  0.0485  -0.0706 286 VAL A C     
1391 O O     . VAL A 182 ? 0.5953 0.3208 0.3616 0.0613  0.0586  -0.0695 286 VAL A O     
1392 C CB    . VAL A 182 ? 0.7679 0.4811 0.4510 0.0500  0.0661  -0.0795 286 VAL A CB    
1393 C CG1   . VAL A 182 ? 0.8091 0.5051 0.4940 0.0625  0.0612  -0.1048 286 VAL A CG1   
1394 C CG2   . VAL A 182 ? 0.7736 0.5201 0.4660 0.0504  0.0869  -0.0772 286 VAL A CG2   
1395 N N     . HIS A 183 ? 0.6394 0.3178 0.3842 0.0607  0.0319  -0.0750 287 HIS A N     
1396 C CA    . HIS A 183 ? 0.6463 0.3191 0.4234 0.0716  0.0231  -0.0770 287 HIS A CA    
1397 C C     . HIS A 183 ? 0.6345 0.3333 0.4365 0.0678  0.0231  -0.0613 287 HIS A C     
1398 O O     . HIS A 183 ? 0.6181 0.3340 0.4488 0.0780  0.0284  -0.0655 287 HIS A O     
1399 C CB    . HIS A 183 ? 0.6839 0.3210 0.4579 0.0683  -0.0003 -0.0736 287 HIS A CB    
1400 C CG    . HIS A 183 ? 0.7444 0.3781 0.5485 0.0718  -0.0160 -0.0608 287 HIS A CG    
1401 N ND1   . HIS A 183 ? 0.8015 0.4271 0.6350 0.0910  -0.0190 -0.0718 287 HIS A ND1   
1402 C CD2   . HIS A 183 ? 0.7465 0.3898 0.5556 0.0587  -0.0297 -0.0379 287 HIS A CD2   
1403 C CE1   . HIS A 183 ? 0.7823 0.4101 0.6370 0.0883  -0.0357 -0.0517 287 HIS A CE1   
1404 N NE2   . HIS A 183 ? 0.7571 0.3984 0.5964 0.0679  -0.0416 -0.0311 287 HIS A NE2   
1405 N N     . TYR A 184 ? 0.5747 0.2811 0.3670 0.0539  0.0177  -0.0468 288 TYR A N     
1406 C CA    . TYR A 184 ? 0.5516 0.2839 0.3658 0.0500  0.0162  -0.0376 288 TYR A CA    
1407 C C     . TYR A 184 ? 0.6173 0.3717 0.4470 0.0515  0.0333  -0.0416 288 TYR A C     
1408 O O     . TYR A 184 ? 0.6093 0.3849 0.4661 0.0523  0.0328  -0.0402 288 TYR A O     
1409 C CB    . TYR A 184 ? 0.5347 0.2737 0.3357 0.0373  0.0064  -0.0275 288 TYR A CB    
1410 C CG    . TYR A 184 ? 0.5694 0.2977 0.3631 0.0314  -0.0119 -0.0186 288 TYR A CG    
1411 C CD1   . TYR A 184 ? 0.5759 0.3139 0.3890 0.0313  -0.0244 -0.0093 288 TYR A CD1   
1412 C CD2   . TYR A 184 ? 0.6154 0.3253 0.3834 0.0238  -0.0182 -0.0170 288 TYR A CD2   
1413 C CE1   . TYR A 184 ? 0.5788 0.3048 0.3860 0.0225  -0.0430 0.0045  288 TYR A CE1   
1414 C CE2   . TYR A 184 ? 0.6276 0.3274 0.3909 0.0138  -0.0364 -0.0056 288 TYR A CE2   
1415 C CZ    . TYR A 184 ? 0.6815 0.3886 0.4643 0.0122  -0.0488 0.0067  288 TYR A CZ    
1416 O OH    . TYR A 184 ? 0.7117 0.4079 0.4908 -0.0012 -0.0687 0.0237  288 TYR A OH    
1417 N N     . TYR A 185 ? 0.5737 0.3256 0.3862 0.0495  0.0471  -0.0446 289 TYR A N     
1418 C CA    . TYR A 185 ? 0.5605 0.3324 0.3850 0.0461  0.0633  -0.0434 289 TYR A CA    
1419 C C     . TYR A 185 ? 0.6007 0.3915 0.4471 0.0568  0.0740  -0.0545 289 TYR A C     
1420 O O     . TYR A 185 ? 0.5735 0.3899 0.4462 0.0540  0.0820  -0.0530 289 TYR A O     
1421 C CB    . TYR A 185 ? 0.5735 0.3393 0.3686 0.0389  0.0727  -0.0384 289 TYR A CB    
1422 C CG    . TYR A 185 ? 0.5786 0.3327 0.3619 0.0299  0.0634  -0.0265 289 TYR A CG    
1423 C CD1   . TYR A 185 ? 0.6008 0.3407 0.3669 0.0302  0.0492  -0.0263 289 TYR A CD1   
1424 C CD2   . TYR A 185 ? 0.5691 0.3271 0.3610 0.0211  0.0677  -0.0155 289 TYR A CD2   
1425 C CE1   . TYR A 185 ? 0.5771 0.3127 0.3353 0.0253  0.0409  -0.0183 289 TYR A CE1   
1426 C CE2   . TYR A 185 ? 0.5704 0.3152 0.3560 0.0171  0.0571  -0.0070 289 TYR A CE2   
1427 C CZ    . TYR A 185 ? 0.6261 0.3628 0.3957 0.0210  0.0443  -0.0101 289 TYR A CZ    
1428 O OH    . TYR A 185 ? 0.6056 0.3362 0.3740 0.0203  0.0337  -0.0047 289 TYR A OH    
1429 N N     . ILE A 186 ? 0.5923 0.3717 0.4313 0.0697  0.0728  -0.0676 290 ILE A N     
1430 C CA    . ILE A 186 ? 0.6040 0.4026 0.4682 0.0855  0.0809  -0.0831 290 ILE A CA    
1431 C C     . ILE A 186 ? 0.6288 0.4363 0.5299 0.0921  0.0683  -0.0789 290 ILE A C     
1432 O O     . ILE A 186 ? 0.6081 0.4491 0.5404 0.0976  0.0770  -0.0833 290 ILE A O     
1433 C CB    . ILE A 186 ? 0.6871 0.4667 0.5371 0.1005  0.0799  -0.1036 290 ILE A CB    
1434 C CG1   . ILE A 186 ? 0.7108 0.4975 0.5249 0.0939  0.0957  -0.1106 290 ILE A CG1   
1435 C CG2   . ILE A 186 ? 0.7138 0.5125 0.5994 0.1225  0.0836  -0.1227 290 ILE A CG2   
1436 C CD1   . ILE A 186 ? 0.8649 0.6274 0.6558 0.1049  0.0911  -0.1340 290 ILE A CD1   
1437 N N     . LYS A 187 ? 0.5748 0.3591 0.4723 0.0894  0.0475  -0.0685 291 LYS A N     
1438 C CA    . LYS A 187 ? 0.5582 0.3552 0.4857 0.0928  0.0330  -0.0602 291 LYS A CA    
1439 C C     . LYS A 187 ? 0.5781 0.4091 0.5224 0.0808  0.0386  -0.0539 291 LYS A C     
1440 O O     . LYS A 187 ? 0.5815 0.4405 0.5584 0.0857  0.0356  -0.0540 291 LYS A O     
1441 C CB    . LYS A 187 ? 0.5683 0.3389 0.4846 0.0887  0.0095  -0.0470 291 LYS A CB    
1442 C CG    . LYS A 187 ? 0.8255 0.5649 0.7486 0.1043  -0.0031 -0.0525 291 LYS A CG    
1443 C CD    . LYS A 187 ? 0.9936 0.7478 0.9576 0.1208  -0.0129 -0.0514 291 LYS A CD    
1444 C CE    . LYS A 187 ? 1.2436 0.9585 1.2190 0.1372  -0.0313 -0.0546 291 LYS A CE    
1445 N NZ    . LYS A 187 ? 1.3977 1.1276 1.4164 0.1550  -0.0444 -0.0501 291 LYS A NZ    
1446 N N     . LEU A 188 ? 0.5170 0.3452 0.4418 0.0661  0.0460  -0.0502 292 LEU A N     
1447 C CA    . LEU A 188 ? 0.4914 0.3428 0.4328 0.0539  0.0501  -0.0474 292 LEU A CA    
1448 C C     . LEU A 188 ? 0.5506 0.4305 0.5177 0.0548  0.0667  -0.0528 292 LEU A C     
1449 O O     . LEU A 188 ? 0.5549 0.4636 0.5532 0.0514  0.0651  -0.0537 292 LEU A O     
1450 C CB    . LEU A 188 ? 0.4827 0.3170 0.4004 0.0413  0.0521  -0.0427 292 LEU A CB    
1451 C CG    . LEU A 188 ? 0.5068 0.3540 0.4433 0.0288  0.0544  -0.0419 292 LEU A CG    
1452 C CD1   . LEU A 188 ? 0.4964 0.3679 0.4588 0.0273  0.0417  -0.0470 292 LEU A CD1   
1453 C CD2   . LEU A 188 ? 0.4914 0.3153 0.4075 0.0210  0.0526  -0.0371 292 LEU A CD2   
1454 N N     . LYS A 189 ? 0.5365 0.4149 0.4906 0.0586  0.0823  -0.0573 293 LYS A N     
1455 C CA    . LYS A 189 ? 0.5485 0.4631 0.5234 0.0583  0.1011  -0.0624 293 LYS A CA    
1456 C C     . LYS A 189 ? 0.6206 0.5646 0.6335 0.0747  0.0976  -0.0723 293 LYS A C     
1457 O O     . LYS A 189 ? 0.6339 0.6168 0.6795 0.0691  0.1040  -0.0724 293 LYS A O     
1458 C CB    . LYS A 189 ? 0.5648 0.4779 0.5124 0.0618  0.1172  -0.0684 293 LYS A CB    
1459 C CG    . LYS A 189 ? 0.5585 0.5200 0.5226 0.0570  0.1398  -0.0716 293 LYS A CG    
1460 C CD    . LYS A 189 ? 0.5771 0.5450 0.5096 0.0608  0.1553  -0.0802 293 LYS A CD    
1461 C CE    . LYS A 189 ? 0.7748 0.7519 0.7170 0.0886  0.1565  -0.1074 293 LYS A CE    
1462 N NZ    . LYS A 189 ? 0.8396 0.8050 0.7434 0.0956  0.1630  -0.1220 293 LYS A NZ    
1463 N N     . ASP A 190 ? 0.5869 0.5111 0.5980 0.0940  0.0850  -0.0792 294 ASP A N     
1464 C CA    . ASP A 190 ? 0.5851 0.5292 0.6330 0.1141  0.0766  -0.0869 294 ASP A CA    
1465 C C     . ASP A 190 ? 0.6087 0.5743 0.6837 0.1070  0.0623  -0.0759 294 ASP A C     
1466 O O     . ASP A 190 ? 0.6018 0.6090 0.7149 0.1133  0.0648  -0.0805 294 ASP A O     
1467 C CB    . ASP A 190 ? 0.6342 0.5389 0.6725 0.1337  0.0612  -0.0928 294 ASP A CB    
1468 C CG    . ASP A 190 ? 0.7687 0.6590 0.7868 0.1451  0.0742  -0.1121 294 ASP A CG    
1469 O OD1   . ASP A 190 ? 0.7835 0.7095 0.8028 0.1435  0.0977  -0.1233 294 ASP A OD1   
1470 O OD2   . ASP A 190 ? 0.7750 0.6215 0.7760 0.1538  0.0604  -0.1162 294 ASP A OD2   
1471 N N     . LEU A 191 ? 0.5633 0.5078 0.6188 0.0932  0.0481  -0.0636 295 LEU A N     
1472 C CA    . LEU A 191 ? 0.5375 0.5066 0.6123 0.0840  0.0344  -0.0563 295 LEU A CA    
1473 C C     . LEU A 191 ? 0.5910 0.5966 0.6895 0.0694  0.0475  -0.0610 295 LEU A C     
1474 O O     . LEU A 191 ? 0.5930 0.6365 0.7248 0.0690  0.0410  -0.0622 295 LEU A O     
1475 C CB    . LEU A 191 ? 0.5322 0.4777 0.5767 0.0712  0.0213  -0.0474 295 LEU A CB    
1476 C CG    . LEU A 191 ? 0.5686 0.5434 0.6254 0.0600  0.0076  -0.0444 295 LEU A CG    
1477 C CD1   . LEU A 191 ? 0.5723 0.5723 0.6527 0.0709  -0.0107 -0.0361 295 LEU A CD1   
1478 C CD2   . LEU A 191 ? 0.5388 0.4974 0.5651 0.0489  -0.0003 -0.0411 295 LEU A CD2   
1479 N N     . ARG A 192 ? 0.5624 0.5572 0.6453 0.0559  0.0641  -0.0617 296 ARG A N     
1480 C CA    . ARG A 192 ? 0.5517 0.5744 0.6572 0.0376  0.0755  -0.0621 296 ARG A CA    
1481 C C     . ARG A 192 ? 0.6107 0.6813 0.7522 0.0453  0.0872  -0.0681 296 ARG A C     
1482 O O     . ARG A 192 ? 0.5955 0.7048 0.7721 0.0354  0.0858  -0.0695 296 ARG A O     
1483 C CB    . ARG A 192 ? 0.5626 0.5601 0.6424 0.0224  0.0889  -0.0556 296 ARG A CB    
1484 C CG    . ARG A 192 ? 0.6208 0.6416 0.7255 -0.0004 0.0983  -0.0510 296 ARG A CG    
1485 C CD    . ARG A 192 ? 0.5614 0.5738 0.6467 -0.0125 0.1159  -0.0400 296 ARG A CD    
1486 N NE    . ARG A 192 ? 0.6102 0.6485 0.6892 0.0007  0.1333  -0.0445 296 ARG A NE    
1487 C CZ    . ARG A 192 ? 0.8143 0.8471 0.8640 -0.0039 0.1480  -0.0375 296 ARG A CZ    
1488 N NH1   . ARG A 192 ? 0.6823 0.6817 0.7079 -0.0213 0.1459  -0.0211 296 ARG A NH1   
1489 N NH2   . ARG A 192 ? 0.6547 0.7183 0.7001 0.0099  0.1638  -0.0481 296 ARG A NH2   
1490 N N     . ASP A 193 ? 0.5638 0.6354 0.6985 0.0638  0.0981  -0.0746 297 ASP A N     
1491 C CA    . ASP A 193 ? 0.5651 0.6872 0.7346 0.0771  0.1104  -0.0853 297 ASP A CA    
1492 C C     . ASP A 193 ? 0.6200 0.7684 0.8280 0.0935  0.0925  -0.0886 297 ASP A C     
1493 O O     . ASP A 193 ? 0.6217 0.8253 0.8708 0.0932  0.0982  -0.0933 297 ASP A O     
1494 C CB    . ASP A 193 ? 0.6061 0.7202 0.7571 0.0968  0.1235  -0.0978 297 ASP A CB    
1495 C CG    . ASP A 193 ? 0.6746 0.7776 0.7886 0.0799  0.1426  -0.0935 297 ASP A CG    
1496 O OD1   . ASP A 193 ? 0.6549 0.7529 0.7609 0.0528  0.1454  -0.0777 297 ASP A OD1   
1497 O OD2   . ASP A 193 ? 0.7059 0.8030 0.7988 0.0941  0.1525  -0.1059 297 ASP A OD2   
1498 N N     . GLN A 194 ? 0.5713 0.6848 0.7670 0.1052  0.0699  -0.0834 298 GLN A N     
1499 C CA    . GLN A 194 ? 0.5675 0.7049 0.7968 0.1193  0.0490  -0.0806 298 GLN A CA    
1500 C C     . GLN A 194 ? 0.5843 0.7605 0.8357 0.0979  0.0429  -0.0760 298 GLN A C     
1501 O O     . GLN A 194 ? 0.5692 0.7965 0.8631 0.1040  0.0392  -0.0792 298 GLN A O     
1502 C CB    . GLN A 194 ? 0.5941 0.6857 0.8007 0.1299  0.0251  -0.0697 298 GLN A CB    
1503 C CG    . GLN A 194 ? 0.7792 0.8892 1.0201 0.1508  0.0018  -0.0632 298 GLN A CG    
1504 C CD    . GLN A 194 ? 1.0050 1.0884 1.2258 0.1461  -0.0254 -0.0426 298 GLN A CD    
1505 O OE1   . GLN A 194 ? 0.8130 0.8580 0.9930 0.1325  -0.0273 -0.0355 298 GLN A OE1   
1506 N NE2   . GLN A 194 ? 1.0130 1.1229 1.2635 0.1568  -0.0479 -0.0307 298 GLN A NE2   
1507 N N     . LEU A 195 ? 0.5327 0.6868 0.7582 0.0738  0.0417  -0.0714 299 LEU A N     
1508 C CA    . LEU A 195 ? 0.5270 0.7106 0.7707 0.0521  0.0344  -0.0726 299 LEU A CA    
1509 C C     . LEU A 195 ? 0.6189 0.8477 0.8991 0.0379  0.0503  -0.0785 299 LEU A C     
1510 O O     . LEU A 195 ? 0.6143 0.8876 0.9285 0.0290  0.0413  -0.0820 299 LEU A O     
1511 C CB    . LEU A 195 ? 0.5101 0.6559 0.7201 0.0332  0.0303  -0.0718 299 LEU A CB    
1512 C CG    . LEU A 195 ? 0.5620 0.6799 0.7402 0.0402  0.0129  -0.0658 299 LEU A CG    
1513 C CD1   . LEU A 195 ? 0.5576 0.6423 0.7058 0.0253  0.0139  -0.0690 299 LEU A CD1   
1514 C CD2   . LEU A 195 ? 0.6014 0.7577 0.7965 0.0421  -0.0093 -0.0633 299 LEU A CD2   
1515 N N     . LYS A 196 ? 0.5993 0.8214 0.8717 0.0330  0.0731  -0.0786 300 LYS A N     
1516 C CA    . LYS A 196 ? 0.6227 0.8920 0.9275 0.0157  0.0906  -0.0799 300 LYS A CA    
1517 C C     . LYS A 196 ? 0.7338 1.0663 1.0824 0.0362  0.0936  -0.0878 300 LYS A C     
1518 O O     . LYS A 196 ? 0.7397 1.1283 1.1291 0.0221  0.0972  -0.0898 300 LYS A O     
1519 C CB    . LYS A 196 ? 0.6588 0.9089 0.9381 0.0040  0.1135  -0.0738 300 LYS A CB    
1520 C CG    . LYS A 196 ? 0.7288 0.9300 0.9813 -0.0218 0.1103  -0.0640 300 LYS A CG    
1521 C CD    . LYS A 196 ? 0.8264 0.9980 1.0421 -0.0261 0.1273  -0.0543 300 LYS A CD    
1522 C CE    . LYS A 196 ? 0.9521 1.1480 1.1802 -0.0558 0.1442  -0.0409 300 LYS A CE    
1523 N NZ    . LYS A 196 ? 1.0495 1.2078 1.2783 -0.0840 0.1326  -0.0303 300 LYS A NZ    
1524 N N     . GLY A 197 ? 0.7242 1.0457 1.0668 0.0691  0.0900  -0.0928 301 GLY A N     
1525 C CA    . GLY A 197 ? 0.7437 1.1160 1.1289 0.0971  0.0885  -0.1026 301 GLY A CA    
1526 C C     . GLY A 197 ? 0.8305 1.2336 1.2492 0.1012  0.0636  -0.0990 301 GLY A C     
1527 O O     . GLY A 197 ? 0.8162 1.2841 1.2838 0.1107  0.0638  -0.1053 301 GLY A O     
1528 N N     . ILE A 198 ? 0.8224 1.1863 1.2148 0.0933  0.0418  -0.0889 302 ILE A N     
1529 C CA    . ILE A 198 ? 0.8326 1.2258 1.2465 0.0925  0.0160  -0.0833 302 ILE A CA    
1530 C C     . ILE A 198 ? 0.9242 1.3709 1.3695 0.0641  0.0197  -0.0891 302 ILE A C     
1531 O O     . ILE A 198 ? 0.9178 1.4237 1.4056 0.0687  0.0081  -0.0907 302 ILE A O     
1532 C CB    . ILE A 198 ? 0.8678 1.2128 1.2395 0.0870  -0.0040 -0.0727 302 ILE A CB    
1533 N N     . GLU A 199 ? 0.9186 1.3436 1.3458 0.0345  0.0347  -0.0915 303 GLU A N     
1534 C CA    . GLU A 199 ? 0.9362 1.3981 1.3916 0.0019  0.0388  -0.0965 303 GLU A CA    
1535 C C     . GLU A 199 ? 1.0479 1.5802 1.5526 0.0025  0.0544  -0.0998 303 GLU A C     
1536 O O     . GLU A 199 ? 1.0406 1.6305 1.5870 -0.0114 0.0465  -0.1041 303 GLU A O     
1537 C CB    . GLU A 199 ? 0.9597 1.3709 1.3851 -0.0254 0.0513  -0.0944 303 GLU A CB    
1538 C CG    . GLU A 199 ? 1.0687 1.4445 1.4737 -0.0423 0.0332  -0.0997 303 GLU A CG    
1539 C CD    . GLU A 199 ? 1.2942 1.6742 1.7202 -0.0785 0.0337  -0.1056 303 GLU A CD    
1540 O OE1   . GLU A 199 ? 1.0982 1.4552 1.5201 -0.0959 0.0505  -0.0974 303 GLU A OE1   
1541 O OE2   . GLU A 199 ? 1.2673 1.6732 1.7139 -0.0908 0.0154  -0.1180 303 GLU A OE2   
1561 O "O5'" . DC  B 1   ? 1.2913 0.8894 0.4465 0.0268  0.2424  0.1211  1   DC  C "O5'" 
1562 C "C5'" . DC  B 1   ? 1.3117 0.8875 0.5209 0.0459  0.2560  0.1355  1   DC  C "C5'" 
1563 C "C4'" . DC  B 1   ? 1.3139 0.9000 0.5483 0.0639  0.2454  0.1523  1   DC  C "C4'" 
1564 O "O4'" . DC  B 1   ? 1.2991 0.8914 0.4911 0.0782  0.2111  0.1796  1   DC  C "O4'" 
1565 C "C3'" . DC  B 1   ? 1.3075 0.9200 0.5566 0.0506  0.2504  0.1291  1   DC  C "C3'" 
1566 O "O3'" . DC  B 1   ? 1.3415 0.9587 0.6517 0.0678  0.2600  0.1383  1   DC  C "O3'" 
1567 C "C2'" . DC  B 1   ? 1.2827 0.9128 0.4846 0.0452  0.2189  0.1400  1   DC  C "C2'" 
1568 C "C1'" . DC  B 1   ? 1.2958 0.9117 0.4777 0.0676  0.1931  0.1707  1   DC  C "C1'" 
1569 N N1    . DC  B 1   ? 1.3037 0.9172 0.4224 0.0634  0.1665  0.1766  1   DC  C N1    
1570 C C2    . DC  B 1   ? 1.3138 0.9362 0.4212 0.0708  0.1340  0.1857  1   DC  C C2    
1571 O O2    . DC  B 1   ? 1.3129 0.9535 0.4642 0.0783  0.1254  0.1897  1   DC  C O2    
1572 N N3    . DC  B 1   ? 1.3261 0.9378 0.3785 0.0693  0.1128  0.1875  1   DC  C N3    
1573 C C4    . DC  B 1   ? 1.3347 0.9320 0.3449 0.0639  0.1237  0.1871  1   DC  C C4    
1574 N N4    . DC  B 1   ? 1.3447 0.9302 0.3052 0.0656  0.1058  0.1900  1   DC  C N4    
1575 C C5    . DC  B 1   ? 1.3277 0.9248 0.3513 0.0545  0.1536  0.1798  1   DC  C C5    
1576 C C6    . DC  B 1   ? 1.3141 0.9170 0.3913 0.0535  0.1735  0.1717  1   DC  C C6    
1577 P P     . DA  B 2   ? 1.3749 1.0145 0.7275 0.0603  0.2841  0.1134  2   DA  C P     
1578 O OP1   . DA  B 2   ? 1.3932 1.0232 0.8172 0.0832  0.3047  0.1241  2   DA  C OP1   
1579 O OP2   . DA  B 2   ? 1.3872 1.0318 0.7109 0.0368  0.3033  0.0745  2   DA  C OP2   
1580 O "O5'" . DA  B 2   ? 1.3523 1.0264 0.6949 0.0568  0.2568  0.1280  2   DA  C "O5'" 
1581 C "C5'" . DA  B 2   ? 1.3513 1.0348 0.7088 0.0740  0.2258  0.1585  2   DA  C "C5'" 
1582 C "C4'" . DA  B 2   ? 1.3429 1.0550 0.6929 0.0605  0.2004  0.1616  2   DA  C "C4'" 
1583 O "O4'" . DA  B 2   ? 1.3292 1.0262 0.6127 0.0494  0.1775  0.1614  2   DA  C "O4'" 
1584 C "C3'" . DA  B 2   ? 1.3460 1.0841 0.7179 0.0433  0.2250  0.1458  2   DA  C "C3'" 
1585 O "O3'" . DA  B 2   ? 1.3621 1.1339 0.7867 0.0438  0.2107  0.1601  2   DA  C "O3'" 
1586 C "C2'" . DA  B 2   ? 1.3250 1.0572 0.6324 0.0229  0.2209  0.1369  2   DA  C "C2'" 
1587 C "C1'" . DA  B 2   ? 1.3062 1.0186 0.5782 0.0276  0.1820  0.1522  2   DA  C "C1'" 
1588 N N9    . DA  B 2   ? 1.2805 0.9730 0.4853 0.0183  0.1770  0.1484  2   DA  C N9    
1589 C C8    . DA  B 2   ? 1.2735 0.9572 0.4445 0.0124  0.1982  0.1346  2   DA  C C8    
1590 N N7    . DA  B 2   ? 1.2644 0.9347 0.3812 0.0083  0.1859  0.1392  2   DA  C N7    
1591 C C5    . DA  B 2   ? 1.2576 0.9210 0.3689 0.0122  0.1564  0.1540  2   DA  C C5    
1592 C C6    . DA  B 2   ? 1.2472 0.8923 0.3123 0.0126  0.1345  0.1623  2   DA  C C6    
1593 N N6    . DA  B 2   ? 1.2333 0.8674 0.2484 0.0111  0.1400  0.1640  2   DA  C N6    
1594 N N1    . DA  B 2   ? 1.2596 0.8996 0.3361 0.0156  0.1059  0.1666  2   DA  C N1    
1595 C C2    . DA  B 2   ? 1.2649 0.9248 0.3983 0.0165  0.0975  0.1660  2   DA  C C2    
1596 N N3    . DA  B 2   ? 1.2605 0.9422 0.4424 0.0188  0.1170  0.1648  2   DA  C N3    
1597 C C4    . DA  B 2   ? 1.2649 0.9435 0.4310 0.0168  0.1481  0.1576  2   DA  C C4    
1598 P P     . DG  B 3   ? 1.3767 1.1860 0.8600 0.0394  0.2430  0.1562  3   DG  C P     
1599 O OP1   . DG  B 3   ? 1.3869 1.2052 0.9342 0.0623  0.2588  0.1621  3   DG  C OP1   
1600 O OP2   . DG  B 3   ? 1.3772 1.1864 0.8178 0.0253  0.2741  0.1358  3   DG  C OP2   
1601 O "O5'" . DG  B 3   ? 1.3765 1.2162 0.8933 0.0265  0.2131  0.1738  3   DG  C "O5'" 
1602 C "C5'" . DG  B 3   ? 1.3884 1.2466 0.9058 0.0072  0.2276  0.1752  3   DG  C "C5'" 
1603 C "C4'" . DG  B 3   ? 1.3944 1.2360 0.8764 -0.0098 0.1956  0.1807  3   DG  C "C4'" 
1604 O "O4'" . DG  B 3   ? 1.3904 1.1917 0.7894 -0.0076 0.1882  0.1700  3   DG  C "O4'" 
1605 C "C3'" . DG  B 3   ? 1.4056 1.2662 0.8957 -0.0281 0.2166  0.1907  3   DG  C "C3'" 
1606 O "O3'" . DG  B 3   ? 1.4263 1.3046 0.9824 -0.0419 0.1948  0.2055  3   DG  C "O3'" 
1607 C "C2'" . DG  B 3   ? 1.3961 1.2254 0.8021 -0.0344 0.2154  0.1859  3   DG  C "C2'" 
1608 C "C1'" . DG  B 3   ? 1.3840 1.1762 0.7478 -0.0239 0.1838  0.1748  3   DG  C "C1'" 
1609 N N9    . DG  B 3   ? 1.3583 1.1244 0.6432 -0.0223 0.1911  0.1657  3   DG  C N9    
1610 C C8    . DG  B 3   ? 1.3494 1.1182 0.6046 -0.0177 0.2194  0.1504  3   DG  C C8    
1611 N N7    . DG  B 3   ? 1.3358 1.0861 0.5284 -0.0197 0.2164  0.1454  3   DG  C N7    
1612 C C5    . DG  B 3   ? 1.3206 1.0519 0.4965 -0.0235 0.1887  0.1603  3   DG  C C5    
1613 C C6    . DG  B 3   ? 1.3072 1.0148 0.4243 -0.0240 0.1764  0.1650  3   DG  C C6    
1614 O O6    . DG  B 3   ? 1.2992 1.0037 0.3696 -0.0224 0.1856  0.1593  3   DG  C O6    
1615 N N1    . DG  B 3   ? 1.3127 1.0003 0.4342 -0.0267 0.1504  0.1754  3   DG  C N1    
1616 C C2    . DG  B 3   ? 1.3257 1.0192 0.5054 -0.0321 0.1343  0.1780  3   DG  C C2    
1617 N N2    . DG  B 3   ? 1.3408 1.0106 0.5206 -0.0372 0.1089  0.1800  3   DG  C N2    
1618 N N3    . DG  B 3   ? 1.3309 1.0538 0.5704 -0.0330 0.1434  0.1769  3   DG  C N3    
1619 C C4    . DG  B 3   ? 1.3344 1.0732 0.5662 -0.0268 0.1724  0.1695  3   DG  C C4    
1620 P P     . DC  B 4   ? 1.4497 1.3709 1.0749 -0.0542 0.2276  0.2273  4   DC  C P     
1621 O OP1   . DC  B 4   ? 1.4512 1.4098 1.1767 -0.0548 0.2143  0.2359  4   DC  C OP1   
1622 O OP2   . DC  B 4   ? 1.4589 1.3955 1.0432 -0.0448 0.2775  0.2263  4   DC  C OP2   
1623 O "O5'" . DC  B 4   ? 1.4492 1.3490 1.0685 -0.0756 0.2127  0.2394  4   DC  C "O5'" 
1624 C "C5'" . DC  B 4   ? 1.4348 1.3140 0.9791 -0.0765 0.2321  0.2443  4   DC  C "C5'" 
1625 C "C4'" . DC  B 4   ? 1.4203 1.2523 0.9307 -0.0859 0.1969  0.2396  4   DC  C "C4'" 
1626 O "O4'" . DC  B 4   ? 1.3988 1.1987 0.8262 -0.0719 0.1791  0.2180  4   DC  C "O4'" 
1627 C "C3'" . DC  B 4   ? 1.4276 1.2496 0.9179 -0.0944 0.2187  0.2630  4   DC  C "C3'" 
1628 O "O3'" . DC  B 4   ? 1.4467 1.2693 1.0248 -0.1142 0.2133  0.2807  4   DC  C "O3'" 
1629 C "C2'" . DC  B 4   ? 1.4178 1.1910 0.8250 -0.0889 0.1944  0.2486  4   DC  C "C2'" 
1630 C "C1'" . DC  B 4   ? 1.3899 1.1599 0.7518 -0.0732 0.1808  0.2227  4   DC  C "C1'" 
1631 N N1    . DC  B 4   ? 1.3503 1.1299 0.6405 -0.0611 0.2081  0.2179  4   DC  C N1    
1632 C C2    . DC  B 4   ? 1.3254 1.0796 0.5422 -0.0569 0.2033  0.2173  4   DC  C C2    
1633 O O2    . DC  B 4   ? 1.3290 1.0502 0.5374 -0.0608 0.1831  0.2236  4   DC  C O2    
1634 N N3    . DC  B 4   ? 1.3038 1.0724 0.4653 -0.0488 0.2216  0.2075  4   DC  C N3    
1635 C C4    . DC  B 4   ? 1.3049 1.1047 0.4783 -0.0449 0.2443  0.1937  4   DC  C C4    
1636 N N4    . DC  B 4   ? 1.2984 1.1116 0.4208 -0.0401 0.2591  0.1767  4   DC  C N4    
1637 C C5    . DC  B 4   ? 1.3206 1.1418 0.5636 -0.0457 0.2536  0.1949  4   DC  C C5    
1638 C C6    . DC  B 4   ? 1.3339 1.1474 0.6348 -0.0539 0.2348  0.2096  4   DC  C C6    
1639 P P     . DT  B 5   ? 1.3116 1.3997 0.7996 -0.1152 -0.1081 0.0719  5   DT  C P     
1640 O OP1   . DT  B 5   ? 1.3232 1.4318 0.8876 -0.1204 -0.1296 0.0476  5   DT  C OP1   
1641 O OP2   . DT  B 5   ? 1.2571 1.3667 0.7904 -0.0996 -0.0804 0.0860  5   DT  C OP2   
1642 O "O5'" . DT  B 5   ? 1.2900 1.3690 0.7144 -0.1275 -0.0661 0.0697  5   DT  C "O5'" 
1643 C "C5'" . DT  B 5   ? 1.3271 1.3921 0.6983 -0.1434 -0.0765 0.0453  5   DT  C "C5'" 
1644 C "C4'" . DT  B 5   ? 1.3023 1.3745 0.6377 -0.1465 -0.0330 0.0342  5   DT  C "C4'" 
1645 O "O4'" . DT  B 5   ? 1.2868 1.3569 0.5591 -0.1515 -0.0173 0.0546  5   DT  C "O4'" 
1646 C "C3'" . DT  B 5   ? 1.2450 1.3278 0.6562 -0.1316 -0.0026 0.0355  5   DT  C "C3'" 
1647 O "O3'" . DT  B 5   ? 1.2749 1.3554 0.6887 -0.1306 0.0073  0.0008  5   DT  C "O3'" 
1648 C "C2'" . DT  B 5   ? 1.1926 1.2833 0.5890 -0.1230 0.0234  0.0626  5   DT  C "C2'" 
1649 C "C1'" . DT  B 5   ? 1.2143 1.3036 0.5224 -0.1379 0.0204  0.0602  5   DT  C "C1'" 
1650 N N1    . DT  B 5   ? 1.1644 1.2488 0.4439 -0.1368 0.0261  0.0909  5   DT  C N1    
1651 C C2    . DT  B 5   ? 1.1283 1.2269 0.3730 -0.1440 0.0538  0.0895  5   DT  C C2    
1652 O O2    . DT  B 5   ? 1.1254 1.2496 0.3719 -0.1474 0.0753  0.0607  5   DT  C O2    
1653 N N3    . DT  B 5   ? 1.1185 1.2038 0.3361 -0.1461 0.0526  0.1162  5   DT  C N3    
1654 C C4    . DT  B 5   ? 1.1303 1.1891 0.3572 -0.1362 0.0264  0.1390  5   DT  C C4    
1655 O O4    . DT  B 5   ? 1.1417 1.1847 0.3439 -0.1373 0.0259  0.1562  5   DT  C O4    
1656 C C5    . DT  B 5   ? 1.1383 1.1954 0.4186 -0.1236 0.0003  0.1333  5   DT  C C5    
1657 C C7    . DT  B 5   ? 1.1417 1.1877 0.4642 -0.1060 -0.0299 0.1421  5   DT  C C7    
1658 C C6    . DT  B 5   ? 1.1508 1.2207 0.4522 -0.1275 0.0015  0.1122  5   DT  C C6    
1659 P P     . DC  B 6   ? 1.2705 1.3329 0.7552 -0.1171 0.0168  -0.0010 6   DC  C P     
1660 O OP1   . DC  B 6   ? 1.3143 1.3616 0.8160 -0.1168 0.0028  -0.0467 6   DC  C OP1   
1661 O OP2   . DC  B 6   ? 1.2543 1.3088 0.7855 -0.1225 0.0178  0.0357  6   DC  C OP2   
1662 O "O5'" . DC  B 6   ? 1.2497 1.3235 0.7201 -0.1015 0.0410  0.0030  6   DC  C "O5'" 
1663 C "C5'" . DC  B 6   ? 1.2642 1.3693 0.6992 -0.1010 0.0547  -0.0345 6   DC  C "C5'" 
1664 C "C4'" . DC  B 6   ? 1.2328 1.3581 0.6735 -0.0877 0.0737  -0.0261 6   DC  C "C4'" 
1665 O "O4'" . DC  B 6   ? 1.1990 1.3302 0.5960 -0.0995 0.0819  0.0147  6   DC  C "O4'" 
1666 C "C3'" . DC  B 6   ? 1.2328 1.3240 0.7296 -0.0640 0.0620  -0.0095 6   DC  C "C3'" 
1667 O "O3'" . DC  B 6   ? 1.2595 1.3713 0.7930 -0.0411 0.0617  -0.0496 6   DC  C "O3'" 
1668 C "C2'" . DC  B 6   ? 1.1878 1.2718 0.6607 -0.0690 0.0702  0.0437  6   DC  C "C2'" 
1669 C "C1'" . DC  B 6   ? 1.1646 1.2878 0.5850 -0.0842 0.0865  0.0417  6   DC  C "C1'" 
1670 N N1    . DC  B 6   ? 1.1199 1.2346 0.5122 -0.0928 0.0888  0.0836  6   DC  C N1    
1671 C C2    . DC  B 6   ? 1.0821 1.2108 0.4417 -0.0958 0.1001  0.0966  6   DC  C C2    
1672 O O2    . DC  B 6   ? 1.0701 1.2243 0.4310 -0.0936 0.1100  0.0770  6   DC  C O2    
1673 N N3    . DC  B 6   ? 1.0713 1.1879 0.4100 -0.1000 0.0978  0.1243  6   DC  C N3    
1674 C C4    . DC  B 6   ? 1.0707 1.1751 0.4312 -0.0992 0.0871  0.1342  6   DC  C C4    
1675 N N4    . DC  B 6   ? 1.0644 1.1640 0.4204 -0.0969 0.0832  0.1495  6   DC  C N4    
1676 C C5    . DC  B 6   ? 1.0888 1.1891 0.4871 -0.1004 0.0779  0.1217  6   DC  C C5    
1677 C C6    . DC  B 6   ? 1.1144 1.2138 0.5213 -0.0983 0.0781  0.0991  6   DC  C C6    
1678 P P     . DT  B 7   ? 1.2996 1.3592 0.8896 -0.0108 0.0300  -0.0431 7   DT  C P     
1679 O OP1   . DT  B 7   ? 1.3380 1.4190 0.9915 0.0174  0.0178  -0.1135 7   DT  C OP1   
1680 O OP2   . DT  B 7   ? 1.3281 1.3155 0.9111 -0.0241 0.0125  0.0031  7   DT  C OP2   
1681 O "O5'" . DT  B 7   ? 1.2686 1.3447 0.8411 -0.0053 0.0357  -0.0114 7   DT  C "O5'" 
1682 C "C5'" . DT  B 7   ? 1.2298 1.3807 0.8064 -0.0042 0.0580  -0.0451 7   DT  C "C5'" 
1683 C "C4'" . DT  B 7   ? 1.1930 1.3464 0.7511 -0.0024 0.0564  -0.0090 7   DT  C "C4'" 
1684 O "O4'" . DT  B 7   ? 1.1514 1.2967 0.6417 -0.0302 0.0768  0.0371  7   DT  C "O4'" 
1685 C "C3'" . DT  B 7   ? 1.2273 1.3129 0.8003 0.0205  0.0153  0.0227  7   DT  C "C3'" 
1686 O "O3'" . DT  B 7   ? 1.2397 1.3579 0.8509 0.0428  -0.0020 0.0019  7   DT  C "O3'" 
1687 C "C2'" . DT  B 7   ? 1.2049 1.2501 0.7065 -0.0051 0.0272  0.0864  7   DT  C "C2'" 
1688 C "C1'" . DT  B 7   ? 1.1421 1.2464 0.6112 -0.0264 0.0643  0.0820  7   DT  C "C1'" 
1689 N N1    . DT  B 7   ? 1.1007 1.1855 0.5247 -0.0486 0.0807  0.1194  7   DT  C N1    
1690 C C2    . DT  B 7   ? 1.0612 1.1606 0.4466 -0.0591 0.0953  0.1382  7   DT  C C2    
1691 O O2    . DT  B 7   ? 1.0518 1.1753 0.4298 -0.0567 0.0965  0.1312  7   DT  C O2    
1692 N N3    . DT  B 7   ? 1.0410 1.1285 0.4077 -0.0719 0.1061  0.1594  7   DT  C N3    
1693 C C4    . DT  B 7   ? 1.0447 1.1172 0.4316 -0.0793 0.1064  0.1638  7   DT  C C4    
1694 O O4    . DT  B 7   ? 1.0290 1.1073 0.4158 -0.0881 0.1162  0.1737  7   DT  C O4    
1695 C C5    . DT  B 7   ? 1.0787 1.1313 0.4972 -0.0745 0.0917  0.1497  7   DT  C C5    
1696 C C7    . DT  B 7   ? 1.0927 1.1259 0.5385 -0.0881 0.0890  0.1522  7   DT  C C7    
1697 C C6    . DT  B 7   ? 1.1034 1.1586 0.5369 -0.0573 0.0783  0.1279  7   DT  C C6    
1698 P P     . DG  B 8   ? 1.3085 1.3568 0.9456 0.0756  -0.0647 0.0184  8   DG  C P     
1699 O OP1   . DG  B 8   ? 1.3258 1.4232 1.0700 0.1156  -0.0920 -0.0530 8   DG  C OP1   
1700 O OP2   . DG  B 8   ? 1.3654 1.3081 0.9564 0.0650  -0.0876 0.0682  8   DG  C OP2   
1701 O "O5'" . DG  B 8   ? 1.2928 1.3476 0.8758 0.0637  -0.0628 0.0572  8   DG  C "O5'" 
1702 C "C5'" . DG  B 8   ? 1.2246 1.3697 0.8143 0.0499  -0.0261 0.0328  8   DG  C "C5'" 
1703 C "C4'" . DG  B 8   ? 1.2099 1.3353 0.7223 0.0289  -0.0182 0.0813  8   DG  C "C4'" 
1704 O "O4'" . DG  B 8   ? 1.1856 1.2863 0.6297 -0.0003 0.0177  0.1172  8   DG  C "O4'" 
1705 C "C3'" . DG  B 8   ? 1.2733 1.3231 0.7494 0.0419  -0.0684 0.1197  8   DG  C "C3'" 
1706 O "O3'" . DG  B 8   ? 1.2671 1.3484 0.7302 0.0390  -0.0742 0.1192  8   DG  C "O3'" 
1707 C "C2'" . DG  B 8   ? 1.2951 1.2754 0.6829 0.0139  -0.0493 0.1739  8   DG  C "C2'" 
1708 C "C1'" . DG  B 8   ? 1.2229 1.2605 0.6007 -0.0093 0.0072  0.1654  8   DG  C "C1'" 
1709 N N9    . DG  B 8   ? 1.2194 1.2269 0.5654 -0.0299 0.0323  0.1897  8   DG  C N9    
1710 C C8    . DG  B 8   ? 1.2427 1.2144 0.6087 -0.0306 0.0246  0.1919  8   DG  C C8    
1711 N N7    . DG  B 8   ? 1.2298 1.1962 0.5757 -0.0542 0.0528  0.2083  8   DG  C N7    
1712 C C5    . DG  B 8   ? 1.1949 1.1921 0.5073 -0.0646 0.0786  0.2155  8   DG  C C5    
1713 C C6    . DG  B 8   ? 1.1724 1.1848 0.4702 -0.0831 0.1097  0.2235  8   DG  C C6    
1714 O O6    . DG  B 8   ? 1.1639 1.1746 0.4800 -0.0976 0.1236  0.2262  8   DG  C O6    
1715 N N1    . DG  B 8   ? 1.1670 1.2007 0.4369 -0.0828 0.1214  0.2223  8   DG  C N1    
1716 C C2    . DG  B 8   ? 1.1676 1.2087 0.4220 -0.0724 0.1067  0.2171  8   DG  C C2    
1717 N N2    . DG  B 8   ? 1.1536 1.2080 0.3822 -0.0764 0.1177  0.2145  8   DG  C N2    
1718 N N3    . DG  B 8   ? 1.1817 1.2202 0.4566 -0.0578 0.0796  0.2085  8   DG  C N3    
1719 C C4    . DG  B 8   ? 1.1940 1.2099 0.4993 -0.0517 0.0660  0.2068  8   DG  C C4    
1720 P P     . DT  B 9   ? 1.0689 1.8642 0.8069 0.1411  0.1427  0.1841  9   DT  C P     
1721 O OP1   . DT  B 9   ? 1.0796 2.0158 0.8814 0.1151  0.1763  0.2089  9   DT  C OP1   
1722 O OP2   . DT  B 9   ? 1.0369 1.7974 0.7750 0.1964  0.1116  0.1419  9   DT  C OP2   
1723 O "O5'" . DT  B 9   ? 1.0445 1.7398 0.7821 0.0789  0.1198  0.1986  9   DT  C "O5'" 
1724 C "C5'" . DT  B 9   ? 1.0841 1.7529 0.7991 0.0256  0.1413  0.2376  9   DT  C "C5'" 
1725 C "C4'" . DT  B 9   ? 1.0743 1.6131 0.7642 -0.0050 0.1142  0.2385  9   DT  C "C4'" 
1726 O "O4'" . DT  B 9   ? 1.0621 1.5178 0.6937 0.0435  0.0934  0.2180  9   DT  C "O4'" 
1727 C "C3'" . DT  B 9   ? 1.0195 1.5415 0.7617 -0.0316 0.0841  0.2186  9   DT  C "C3'" 
1728 O "O3'" . DT  B 9   ? 1.0643 1.5452 0.8143 -0.1000 0.0884  0.2418  9   DT  C "O3'" 
1729 C "C2'" . DT  B 9   ? 0.9787 1.4040 0.6871 0.0074  0.0512  0.1887  9   DT  C "C2'" 
1730 C "C1'" . DT  B 9   ? 1.0163 1.3871 0.6554 0.0317  0.0611  0.2012  9   DT  C "C1'" 
1731 N N1    . DT  B 9   ? 0.9777 1.2967 0.5815 0.0838  0.0359  0.1711  9   DT  C N1    
1732 C C2    . DT  B 9   ? 0.9928 1.2205 0.5561 0.0860  0.0202  0.1741  9   DT  C C2    
1733 O O2    . DT  B 9   ? 1.0384 1.2114 0.5888 0.0534  0.0255  0.1990  9   DT  C O2    
1734 N N3    . DT  B 9   ? 0.9570 1.1594 0.4948 0.1292  -0.0022 0.1465  9   DT  C N3    
1735 C C4    . DT  B 9   ? 0.9247 1.1635 0.4642 0.1674  -0.0101 0.1153  9   DT  C C4    
1736 O O4    . DT  B 9   ? 0.9030 1.1059 0.4166 0.1954  -0.0327 0.0910  9   DT  C O4    
1737 C C5    . DT  B 9   ? 0.9280 1.2478 0.5031 0.1705  0.0087  0.1136  9   DT  C C5    
1738 C C7    . DT  B 9   ? 0.9219 1.2719 0.4973 0.2178  0.0027  0.0797  9   DT  C C7    
1739 C C6    . DT  B 9   ? 0.9422 1.3076 0.5505 0.1304  0.0309  0.1424  9   DT  C C6    
1740 P P     . DA  B 10  ? 1.0421 1.5269 0.8454 -0.1485 0.0650  0.2281  10  DA  C P     
1741 O OP1   . DA  B 10  ? 1.0948 1.6042 0.9208 -0.2238 0.0856  0.2577  10  DA  C OP1   
1742 O OP2   . DA  B 10  ? 0.9784 1.5466 0.8292 -0.1115 0.0463  0.2009  10  DA  C OP2   
1743 O "O5'" . DA  B 10  ? 1.0256 1.3674 0.7829 -0.1441 0.0392  0.2121  10  DA  C "O5'" 
1744 C "C5'" . DA  B 10  ? 1.0729 1.3078 0.7734 -0.1569 0.0488  0.2327  10  DA  C "C5'" 
1745 C "C4'" . DA  B 10  ? 1.0508 1.1777 0.7224 -0.1384 0.0227  0.2101  10  DA  C "C4'" 
1746 O "O4'" . DA  B 10  ? 1.0010 1.1232 0.6505 -0.0746 0.0119  0.1946  10  DA  C "O4'" 
1747 C "C3'" . DA  B 10  ? 1.0015 1.1305 0.7078 -0.1569 -0.0020 0.1807  10  DA  C "C3'" 
1748 O "O3'" . DA  B 10  ? 1.0540 1.0729 0.7299 -0.1822 -0.0095 0.1760  10  DA  C "O3'" 
1749 C "C2'" . DA  B 10  ? 0.9233 1.0732 0.6354 -0.0989 -0.0208 0.1545  10  DA  C "C2'" 
1750 C "C1'" . DA  B 10  ? 0.9330 1.0379 0.5996 -0.0575 -0.0142 0.1627  10  DA  C "C1'" 
1751 N N9    . DA  B 10  ? 0.8703 1.0155 0.5384 -0.0054 -0.0229 0.1449  10  DA  C N9    
1752 C C8    . DA  B 10  ? 0.8393 1.0707 0.5368 0.0140  -0.0203 0.1365  10  DA  C C8    
1753 N N7    . DA  B 10  ? 0.8182 1.0506 0.4991 0.0616  -0.0285 0.1186  10  DA  C N7    
1754 C C5    . DA  B 10  ? 0.8204 0.9755 0.4652 0.0706  -0.0390 0.1161  10  DA  C C5    
1755 C C6    . DA  B 10  ? 0.8081 0.9328 0.4258 0.1080  -0.0543 0.0982  10  DA  C C6    
1756 N N6    . DA  B 10  ? 0.7990 0.9508 0.4147 0.1420  -0.0616 0.0759  10  DA  C N6    
1757 N N1    . DA  B 10  ? 0.8102 0.8750 0.4036 0.1092  -0.0631 0.1025  10  DA  C N1    
1758 C C2    . DA  B 10  ? 0.8360 0.8580 0.4259 0.0802  -0.0556 0.1220  10  DA  C C2    
1759 N N3    . DA  B 10  ? 0.8613 0.8888 0.4666 0.0407  -0.0409 0.1378  10  DA  C N3    
1760 C C4    . DA  B 10  ? 0.8512 0.9537 0.4878 0.0347  -0.0344 0.1337  10  DA  C C4    
1761 P P     . DC  B 11  ? 1.0533 1.0539 0.7469 -0.2218 -0.0295 0.1503  11  DC  C P     
1762 O OP1   . DC  B 11  ? 1.1444 1.0918 0.8259 -0.2870 -0.0193 0.1635  11  DC  C OP1   
1763 O OP2   . DC  B 11  ? 0.9783 1.0873 0.7213 -0.2125 -0.0450 0.1340  11  DC  C OP2   
1764 O "O5'" . DC  B 11  ? 1.0523 0.9575 0.7087 -0.1850 -0.0432 0.1284  11  DC  C "O5'" 
1765 C "C5'" . DC  B 11  ? 1.0664 0.8968 0.6819 -0.1492 -0.0349 0.1400  11  DC  C "C5'" 
1766 C "C4'" . DC  B 11  ? 1.0000 0.8248 0.6140 -0.0977 -0.0497 0.1183  11  DC  C "C4'" 
1767 O "O4'" . DC  B 11  ? 0.9345 0.8340 0.5667 -0.0628 -0.0517 0.1204  11  DC  C "O4'" 
1768 C "C3'" . DC  B 11  ? 0.9612 0.7972 0.5921 -0.1045 -0.0660 0.0893  11  DC  C "C3'" 
1769 O "O3'" . DC  B 11  ? 1.0154 0.7633 0.6156 -0.1091 -0.0664 0.0760  11  DC  C "O3'" 
1770 C "C2'" . DC  B 11  ? 0.8862 0.7668 0.5337 -0.0589 -0.0762 0.0787  11  DC  C "C2'" 
1771 C "C1'" . DC  B 11  ? 0.8754 0.7806 0.5180 -0.0329 -0.0677 0.0971  11  DC  C "C1'" 
1772 N N1    . DC  B 11  ? 0.8112 0.7928 0.4781 -0.0102 -0.0729 0.0920  11  DC  C N1    
1773 C C2    . DC  B 11  ? 0.7791 0.7636 0.4363 0.0304  -0.0786 0.0863  11  DC  C C2    
1774 O O2    . DC  B 11  ? 0.7884 0.7264 0.4242 0.0464  -0.0810 0.0874  11  DC  C O2    
1775 N N3    . DC  B 11  ? 0.7564 0.7950 0.4269 0.0526  -0.0824 0.0783  11  DC  C N3    
1776 C C4    . DC  B 11  ? 0.7498 0.8449 0.4472 0.0428  -0.0804 0.0785  11  DC  C C4    
1777 N N4    . DC  B 11  ? 0.7426 0.8807 0.4484 0.0742  -0.0833 0.0690  11  DC  C N4    
1778 C C5    . DC  B 11  ? 0.7589 0.8701 0.4746 0.0015  -0.0764 0.0871  11  DC  C C5    
1779 C C6    . DC  B 11  ? 0.7940 0.8432 0.4915 -0.0273 -0.0735 0.0918  11  DC  C C6    
1780 P P     . DG  B 12  ? 1.0205 0.7562 0.6173 -0.1346 -0.0782 0.0477  12  DG  C P     
1781 O OP1   . DG  B 12  ? 1.1279 0.7710 0.6879 -0.1700 -0.0719 0.0424  12  DG  C OP1   
1782 O OP2   . DG  B 12  ? 0.9586 0.7897 0.5920 -0.1506 -0.0912 0.0443  12  DG  C OP2   
1783 O "O5'" . DG  B 12  ? 0.9766 0.6954 0.5660 -0.0896 -0.0813 0.0312  12  DG  C "O5'" 
1784 C "C5'" . DG  B 12  ? 0.9896 0.6456 0.5571 -0.0557 -0.0720 0.0329  12  DG  C "C5'" 
1785 C "C4'" . DG  B 12  ? 0.9483 0.6095 0.5187 -0.0266 -0.0739 0.0129  12  DG  C "C4'" 
1786 O "O4'" . DG  B 12  ? 0.8592 0.5934 0.4640 -0.0063 -0.0821 0.0168  12  DG  C "O4'" 
1787 C "C3'" . DG  B 12  ? 0.9624 0.6134 0.5158 -0.0491 -0.0769 -0.0112 12  DG  C "C3'" 
1788 O "O3'" . DG  B 12  ? 0.9918 0.6071 0.5281 -0.0195 -0.0666 -0.0273 12  DG  C "O3'" 
1789 C "C2'" . DG  B 12  ? 0.8910 0.6258 0.4750 -0.0535 -0.0899 -0.0088 12  DG  C "C2'" 
1790 C "C1'" . DG  B 12  ? 0.8355 0.6033 0.4476 -0.0176 -0.0891 0.0040  12  DG  C "C1'" 
1791 N N9    . DG  B 12  ? 0.7851 0.6169 0.4253 -0.0168 -0.0998 0.0139  12  DG  C N9    
1792 C C8    . DG  B 12  ? 0.7797 0.6473 0.4316 -0.0340 -0.1038 0.0248  12  DG  C C8    
1793 N N7    . DG  B 12  ? 0.7322 0.6507 0.4066 -0.0173 -0.1106 0.0303  12  DG  C N7    
1794 C C5    . DG  B 12  ? 0.7000 0.6084 0.3768 0.0063  -0.1129 0.0232  12  DG  C C5    
1795 C C6    . DG  B 12  ? 0.6487 0.5816 0.3412 0.0277  -0.1207 0.0226  12  DG  C C6    
1796 O O6    . DG  B 12  ? 0.6134 0.5787 0.3167 0.0382  -0.1263 0.0265  12  DG  C O6    
1797 N N1    . DG  B 12  ? 0.6438 0.5581 0.3389 0.0376  -0.1200 0.0154  12  DG  C N1    
1798 C C2    . DG  B 12  ? 0.6594 0.5466 0.3459 0.0349  -0.1105 0.0097  12  DG  C C2    
1799 N N2    . DG  B 12  ? 0.6597 0.5504 0.3596 0.0440  -0.1085 0.0046  12  DG  C N2    
1800 N N3    . DG  B 12  ? 0.6978 0.5558 0.3640 0.0234  -0.1024 0.0077  12  DG  C N3    
1801 C C4    . DG  B 12  ? 0.7267 0.5919 0.3874 0.0057  -0.1055 0.0145  12  DG  C C4    
1802 P P     . DT  B 13  ? 1.0533 0.6388 0.5531 -0.0308 -0.0625 -0.0562 13  DT  C P     
1803 O OP1   . DT  B 13  ? 1.1582 0.6551 0.6200 -0.0112 -0.0470 -0.0708 13  DT  C OP1   
1804 O OP2   . DT  B 13  ? 1.0449 0.6522 0.5356 -0.0764 -0.0782 -0.0624 13  DT  C OP2   
1805 O "O5'" . DT  B 13  ? 0.9859 0.6327 0.5092 -0.0046 -0.0588 -0.0570 13  DT  C "O5'" 
1806 C "C5'" . DT  B 13  ? 0.9012 0.6137 0.4502 -0.0159 -0.0715 -0.0460 13  DT  C "C5'" 
1807 C "C4'" . DT  B 13  ? 0.8303 0.5832 0.4027 0.0077  -0.0644 -0.0423 13  DT  C "C4'" 
1808 O "O4'" . DT  B 13  ? 0.7392 0.5391 0.3492 0.0098  -0.0770 -0.0246 13  DT  C "O4'" 
1809 C "C3'" . DT  B 13  ? 0.8228 0.5903 0.3709 -0.0016 -0.0600 -0.0510 13  DT  C "C3'" 
1810 O "O3'" . DT  B 13  ? 0.8110 0.5936 0.3702 0.0209  -0.0408 -0.0535 13  DT  C "O3'" 
1811 C "C2'" . DT  B 13  ? 0.7730 0.5858 0.3392 -0.0146 -0.0778 -0.0337 13  DT  C "C2'" 
1812 C "C1'" . DT  B 13  ? 0.7323 0.5639 0.3427 -0.0003 -0.0835 -0.0199 13  DT  C "C1'" 
1813 N N1    . DT  B 13  ? 0.7232 0.5806 0.3474 -0.0093 -0.1013 -0.0081 13  DT  C N1    
1814 C C2    . DT  B 13  ? 0.6950 0.5795 0.3447 0.0021  -0.1091 0.0033  13  DT  C C2    
1815 O O2    . DT  B 13  ? 0.6936 0.5807 0.3568 0.0114  -0.1038 0.0049  13  DT  C O2    
1816 N N3    . DT  B 13  ? 0.6731 0.5822 0.3335 0.0014  -0.1224 0.0114  13  DT  C N3    
1817 C C4    . DT  B 13  ? 0.7007 0.6242 0.3577 -0.0142 -0.1280 0.0120  13  DT  C C4    
1818 O O4    . DT  B 13  ? 0.7063 0.6669 0.3810 -0.0097 -0.1370 0.0204  13  DT  C O4    
1819 C C5    . DT  B 13  ? 0.7380 0.6299 0.3699 -0.0356 -0.1217 0.0006  13  DT  C C5    
1820 C C7    . DT  B 13  ? 0.7650 0.6676 0.3936 -0.0650 -0.1285 -0.0007 13  DT  C C7    
1821 C C6    . DT  B 13  ? 0.7508 0.6043 0.3639 -0.0291 -0.1088 -0.0101 13  DT  C C6    
1822 P P     . DG  B 14  ? 0.8306 0.6217 0.3548 0.0184  -0.0239 -0.0633 14  DG  C P     
1823 O OP1   . DG  B 14  ? 0.8272 0.6299 0.3673 0.0473  0.0023  -0.0707 14  DG  C OP1   
1824 O OP2   . DG  B 14  ? 0.8988 0.6520 0.3644 -0.0020 -0.0313 -0.0812 14  DG  C OP2   
1825 O "O5'" . DG  B 14  ? 0.8107 0.6479 0.3538 0.0048  -0.0333 -0.0399 14  DG  C "O5'" 
1826 C "C5'" . DG  B 14  ? 0.7911 0.6629 0.3853 0.0124  -0.0303 -0.0244 14  DG  C "C5'" 
1827 C "C4'" . DG  B 14  ? 0.7975 0.6847 0.3956 -0.0033 -0.0436 -0.0031 14  DG  C "C4'" 
1828 O "O4'" . DG  B 14  ? 0.7700 0.6489 0.3692 -0.0073 -0.0691 0.0018  14  DG  C "O4'" 
1829 C "C3'" . DG  B 14  ? 0.8600 0.7478 0.4111 -0.0158 -0.0360 0.0055  14  DG  C "C3'" 
1830 O "O3'" . DG  B 14  ? 0.8857 0.7847 0.4543 -0.0240 -0.0353 0.0292  14  DG  C "O3'" 
1831 C "C2'" . DG  B 14  ? 0.8537 0.7286 0.3722 -0.0239 -0.0612 0.0047  14  DG  C "C2'" 
1832 C "C1'" . DG  B 14  ? 0.8039 0.6841 0.3688 -0.0182 -0.0798 0.0125  14  DG  C "C1'" 
1833 N N9    . DG  B 14  ? 0.7944 0.6783 0.3552 -0.0226 -0.1014 0.0095  14  DG  C N9    
1834 C C8    . DG  B 14  ? 0.8193 0.6942 0.3554 -0.0352 -0.1062 -0.0073 14  DG  C C8    
1835 N N7    . DG  B 14  ? 0.8029 0.6965 0.3548 -0.0420 -0.1249 -0.0042 14  DG  C N7    
1836 C C5    . DG  B 14  ? 0.7633 0.6764 0.3483 -0.0256 -0.1313 0.0136  14  DG  C C5    
1837 C C6    . DG  B 14  ? 0.7312 0.6753 0.3436 -0.0183 -0.1469 0.0232  14  DG  C C6    
1838 O O6    . DG  B 14  ? 0.7459 0.7182 0.3671 -0.0293 -0.1572 0.0207  14  DG  C O6    
1839 N N1    . DG  B 14  ? 0.7030 0.6449 0.3342 0.0028  -0.1484 0.0354  14  DG  C N1    
1840 C C2    . DG  B 14  ? 0.7251 0.6391 0.3529 0.0068  -0.1379 0.0397  14  DG  C C2    
1841 N N2    . DG  B 14  ? 0.7100 0.6128 0.3531 0.0215  -0.1431 0.0486  14  DG  C N2    
1842 N N3    . DG  B 14  ? 0.7482 0.6473 0.3578 -0.0043 -0.1220 0.0347  14  DG  C N3    
1843 C C4    . DG  B 14  ? 0.7592 0.6588 0.3470 -0.0160 -0.1188 0.0208  14  DG  C C4    
1844 P P     . DA  B 15  ? 0.9718 0.8808 0.5109 -0.0359 -0.0114 0.0460  15  DA  C P     
1845 O OP1   . DA  B 15  ? 0.9961 0.9385 0.5754 -0.0343 0.0167  0.0403  15  DA  C OP1   
1846 O OP2   . DA  B 15  ? 1.0225 0.9212 0.4918 -0.0372 -0.0117 0.0420  15  DA  C OP2   
1847 O "O5'" . DA  B 15  ? 0.9652 0.8572 0.5129 -0.0471 -0.0260 0.0760  15  DA  C "O5'" 
1848 C "C5'" . DA  B 15  ? 0.9165 0.8026 0.5174 -0.0466 -0.0399 0.0763  15  DA  C "C5'" 
1849 C "C4'" . DA  B 15  ? 0.9361 0.7852 0.5229 -0.0456 -0.0623 0.0971  15  DA  C "C4'" 
1850 O "O4'" . DA  B 15  ? 0.9091 0.7579 0.4886 -0.0268 -0.0867 0.0873  15  DA  C "O4'" 
1851 C "C3'" . DA  B 15  ? 1.0123 0.8386 0.5463 -0.0541 -0.0566 0.1276  15  DA  C "C3'" 
1852 O "O3'" . DA  B 15  ? 1.0529 0.8355 0.5946 -0.0630 -0.0615 0.1508  15  DA  C "O3'" 
1853 C "C2'" . DA  B 15  ? 1.0141 0.8419 0.5071 -0.0360 -0.0797 0.1274  15  DA  C "C2'" 
1854 C "C1'" . DA  B 15  ? 0.9433 0.7799 0.4784 -0.0207 -0.1002 0.1067  15  DA  C "C1'" 
1855 N N9    . DA  B 15  ? 0.9141 0.7779 0.4353 -0.0136 -0.1143 0.0911  15  DA  C N9    
1856 C C8    . DA  B 15  ? 0.9259 0.8053 0.4225 -0.0231 -0.1048 0.0730  15  DA  C C8    
1857 N N7    . DA  B 15  ? 0.9049 0.8020 0.3991 -0.0227 -0.1222 0.0585  15  DA  C N7    
1858 C C5    . DA  B 15  ? 0.8669 0.7734 0.3897 -0.0088 -0.1422 0.0697  15  DA  C C5    
1859 C C6    . DA  B 15  ? 0.8304 0.7697 0.3711 -0.0033 -0.1634 0.0651  15  DA  C C6    
1860 N N6    . DA  B 15  ? 0.8360 0.8000 0.3660 -0.0202 -0.1714 0.0488  15  DA  C N6    
1861 N N1    . DA  B 15  ? 0.8116 0.7592 0.3777 0.0189  -0.1762 0.0785  15  DA  C N1    
1862 C C2    . DA  B 15  ? 0.8276 0.7361 0.3980 0.0316  -0.1700 0.0916  15  DA  C C2    
1863 N N3    . DA  B 15  ? 0.8551 0.7264 0.4122 0.0198  -0.1524 0.0978  15  DA  C N3    
1864 C C4    . DA  B 15  ? 0.8742 0.7542 0.4102 0.0006  -0.1379 0.0877  15  DA  C C4    
1865 P P     . DG  B 16  ? 1.1351 0.8741 0.6212 -0.0726 -0.0550 0.1926  16  DG  C P     
1866 O OP1   . DG  B 16  ? 1.1739 0.8686 0.6847 -0.0977 -0.0470 0.2088  16  DG  C OP1   
1867 O OP2   . DG  B 16  ? 1.1695 0.9404 0.6082 -0.0793 -0.0334 0.1999  16  DG  C OP2   
1868 O "O5'" . DG  B 16  ? 1.1512 0.8622 0.6070 -0.0396 -0.0886 0.2024  16  DG  C "O5'" 
1869 C "C5'" . DG  B 16  ? 1.1295 0.8156 0.6192 -0.0198 -0.1111 0.1905  16  DG  C "C5'" 
1870 C "C4'" . DG  B 16  ? 1.1431 0.8284 0.6062 0.0173  -0.1388 0.2005  16  DG  C "C4'" 
1871 O "O4'" . DG  B 16  ? 1.0799 0.8336 0.5522 0.0249  -0.1476 0.1769  16  DG  C "O4'" 
1872 C "C3'" . DG  B 16  ? 1.2349 0.8920 0.6337 0.0263  -0.1435 0.2407  16  DG  C "C3'" 
1873 O "O3'" . DG  B 16  ? 1.2933 0.9201 0.6830 0.0654  -0.1691 0.2552  16  DG  C "O3'" 
1874 C "C2'" . DG  B 16  ? 1.1979 0.9234 0.5712 0.0254  -0.1471 0.2310  16  DG  C "C2'" 
1875 C "C1'" . DG  B 16  ? 1.1091 0.8821 0.5341 0.0372  -0.1617 0.1952  16  DG  C "C1'" 
1876 N N9    . DG  B 16  ? 1.0551 0.8869 0.4762 0.0254  -0.1626 0.1706  16  DG  C N9    
1877 C C8    . DG  B 16  ? 1.0608 0.9043 0.4548 0.0016  -0.1420 0.1599  16  DG  C C8    
1878 N N7    . DG  B 16  ? 1.0357 0.9188 0.4242 -0.0040 -0.1505 0.1344  16  DG  C N7    
1879 C C5    . DG  B 16  ? 1.0048 0.9150 0.4263 0.0125  -0.1774 0.1309  16  DG  C C5    
1880 C C6    . DG  B 16  ? 0.9777 0.9377 0.4139 0.0075  -0.1965 0.1094  16  DG  C C6    
1881 O O6    . DG  B 16  ? 0.9891 0.9652 0.4064 -0.0144 -0.1956 0.0856  16  DG  C O6    
1882 N N1    . DG  B 16  ? 0.9459 0.9369 0.4200 0.0302  -0.2178 0.1175  16  DG  C N1    
1883 C C2    . DG  B 16  ? 0.9498 0.9138 0.4388 0.0602  -0.2206 0.1391  16  DG  C C2    
1884 N N2    . DG  B 16  ? 0.9320 0.9358 0.4565 0.0864  -0.2385 0.1412  16  DG  C N2    
1885 N N3    . DG  B 16  ? 0.9787 0.8797 0.4488 0.0627  -0.2052 0.1564  16  DG  C N3    
1886 C C4    . DG  B 16  ? 1.0057 0.8881 0.4461 0.0353  -0.1839 0.1528  16  DG  C C4    
1887 P P     . DC  B 17  ? 1.3930 0.9147 0.7570 0.0756  -0.1702 0.2877  17  DC  C P     
1888 O OP1   . DC  B 17  ? 1.3694 0.8530 0.7806 0.0606  -0.1631 0.2613  17  DC  C OP1   
1889 O OP2   . DC  B 17  ? 1.4804 0.9648 0.7847 0.0542  -0.1545 0.3296  17  DC  C OP2   
1890 O "O5'" . DC  B 17  ? 1.4064 0.9299 0.7572 0.1350  -0.2020 0.2990  17  DC  C "O5'" 
1891 C "C5'" . DC  B 17  ? 1.4049 0.9894 0.7234 0.1555  -0.2194 0.3158  17  DC  C "C5'" 
1892 C "C4'" . DC  B 17  ? 1.3446 1.0040 0.7011 0.1963  -0.2455 0.2961  17  DC  C "C4'" 
1893 O "O4'" . DC  B 17  ? 1.2385 0.9835 0.6375 0.1682  -0.2402 0.2577  17  DC  C "O4'" 
1894 C "C3'" . DC  B 17  ? 1.3994 1.1033 0.7203 0.2346  -0.2744 0.3249  17  DC  C "C3'" 
1895 O "O3'" . DC  B 17  ? 1.4822 1.1320 0.7956 0.2902  -0.2896 0.3475  17  DC  C "O3'" 
1896 C "C2'" . DC  B 17  ? 1.3003 1.1271 0.6682 0.2334  -0.2901 0.2930  17  DC  C "C2'" 
1897 C "C1'" . DC  B 17  ? 1.2124 1.0476 0.6109 0.1818  -0.2639 0.2563  17  DC  C "C1'" 
1898 N N1    . DC  B 17  ? 1.1810 1.0523 0.5485 0.1399  -0.2564 0.2475  17  DC  C N1    
1899 C C2    . DC  B 17  ? 1.1199 1.0791 0.5078 0.1264  -0.2706 0.2212  17  DC  C C2    
1900 O O2    . DC  B 17  ? 1.0945 1.1140 0.5259 0.1484  -0.2905 0.2135  17  DC  C O2    
1901 N N3    . DC  B 17  ? 1.0983 1.0725 0.4570 0.0882  -0.2605 0.2035  17  DC  C N3    
1902 C C4    . DC  B 17  ? 1.1317 1.0521 0.4463 0.0687  -0.2348 0.2129  17  DC  C C4    
1903 N N4    . DC  B 17  ? 1.1276 1.0655 0.4095 0.0393  -0.2239 0.1924  17  DC  C N4    
1904 C C5    . DC  B 17  ? 1.1860 1.0316 0.4858 0.0778  -0.2184 0.2440  17  DC  C C5    
1905 C C6    . DC  B 17  ? 1.2076 1.0240 0.5348 0.1103  -0.2306 0.2584  17  DC  C C6    
1906 P P     . DG  B 18  ? 1.6388 0.7466 0.6473 0.1210  -0.2699 -0.0208 18  DG  C P     
1907 O OP1   . DG  B 18  ? 1.7474 0.7625 0.6578 0.1276  -0.2760 -0.0331 18  DG  C OP1   
1908 O OP2   . DG  B 18  ? 1.5275 0.7283 0.6512 0.1097  -0.2936 -0.0111 18  DG  C OP2   
1909 O "O5'" . DG  B 18  ? 1.5728 0.7267 0.6128 0.1381  -0.2046 -0.0256 18  DG  C "O5'" 
1910 C "C5'" . DG  B 18  ? 1.6186 0.7187 0.5740 0.1500  -0.1624 -0.0293 18  DG  C "C5'" 
1911 C "C4'" . DG  B 18  ? 1.5267 0.7095 0.5505 0.1482  -0.1118 -0.0239 18  DG  C "C4'" 
1912 O "O4'" . DG  B 18  ? 1.4693 0.6704 0.5256 0.1252  -0.1307 -0.0124 18  DG  C "O4'" 
1913 C "C3'" . DG  B 18  ? 1.4136 0.6958 0.5438 0.1570  -0.0935 -0.0264 18  DG  C "C3'" 
1914 O "O3'" . DG  B 18  ? 1.4150 0.7572 0.5724 0.1612  -0.0387 -0.0209 18  DG  C "O3'" 
1915 C "C2'" . DG  B 18  ? 1.3067 0.6394 0.5167 0.1347  -0.1251 -0.0196 18  DG  C "C2'" 
1916 C "C1'" . DG  B 18  ? 1.3399 0.6288 0.5011 0.1176  -0.1282 -0.0101 18  DG  C "C1'" 
1917 N N9    . DG  B 18  ? 1.2696 0.5580 0.4570 0.1108  -0.1690 -0.0030 18  DG  C N9    
1918 C C8    . DG  B 18  ? 1.2363 0.5285 0.4459 0.1162  -0.2127 -0.0014 18  DG  C C8    
1919 N N7    . DG  B 18  ? 1.1956 0.5044 0.4363 0.1171  -0.2353 0.0094  18  DG  C N7    
1920 C C5    . DG  B 18  ? 1.2027 0.4995 0.4288 0.1113  -0.2072 0.0121  18  DG  C C5    
1921 C C6    . DG  B 18  ? 1.1814 0.4689 0.4119 0.1155  -0.2119 0.0212  18  DG  C C6    
1922 O O6    . DG  B 18  ? 1.1504 0.4525 0.4091 0.1344  -0.2379 0.0302  18  DG  C O6    
1923 N N1    . DG  B 18  ? 1.2165 0.4745 0.4107 0.0960  -0.1803 0.0216  18  DG  C N1    
1924 C C2    . DG  B 18  ? 1.2265 0.4910 0.4033 0.0744  -0.1457 0.0177  18  DG  C C2    
1925 N N2    . DG  B 18  ? 1.2602 0.5009 0.4042 0.0462  -0.1215 0.0243  18  DG  C N2    
1926 N N3    . DG  B 18  ? 1.2266 0.5127 0.4076 0.0810  -0.1349 0.0104  18  DG  C N3    
1927 C C4    . DG  B 18  ? 1.2325 0.5229 0.4309 0.1004  -0.1681 0.0060  18  DG  C C4    
1928 P P     . DA  B 19  ? 1.3532 0.8083 0.6162 0.1739  -0.0154 -0.0186 19  DA  C P     
1929 O OP1   . DA  B 19  ? 1.4270 0.9099 0.6718 0.2039  0.0413  -0.0150 19  DA  C OP1   
1930 O OP2   . DA  B 19  ? 1.3060 0.7601 0.6026 0.1848  -0.0539 -0.0274 19  DA  C OP2   
1931 O "O5'" . DA  B 19  ? 1.2662 0.7925 0.6022 0.1315  -0.0156 -0.0055 19  DA  C "O5'" 
1932 C "C5'" . DA  B 19  ? 1.2934 0.8075 0.5935 0.1021  0.0085  0.0063  19  DA  C "C5'" 
1933 C "C4'" . DA  B 19  ? 1.2335 0.7850 0.5832 0.0585  -0.0044 0.0165  19  DA  C "C4'" 
1934 O "O4'" . DA  B 19  ? 1.2095 0.6935 0.5334 0.0550  -0.0477 0.0107  19  DA  C "O4'" 
1935 C "C3'" . DA  B 19  ? 1.1514 0.8064 0.6026 0.0501  -0.0059 0.0210  19  DA  C "C3'" 
1936 O "O3'" . DA  B 19  ? 1.1782 0.8831 0.6533 0.0016  0.0115  0.0390  19  DA  C "O3'" 
1937 C "C2'" . DA  B 19  ? 1.0882 0.7120 0.5549 0.0520  -0.0511 0.0110  19  DA  C "C2'" 
1938 C "C1'" . DA  B 19  ? 1.1261 0.6536 0.5156 0.0437  -0.0675 0.0104  19  DA  C "C1'" 
1939 N N9    . DA  B 19  ? 1.0789 0.5682 0.4648 0.0648  -0.1045 0.0024  19  DA  C N9    
1940 C C8    . DA  B 19  ? 1.0645 0.5461 0.4516 0.0917  -0.1216 -0.0058 19  DA  C C8    
1941 N N7    . DA  B 19  ? 1.0465 0.5082 0.4381 0.0986  -0.1547 -0.0056 19  DA  C N7    
1942 C C5    . DA  B 19  ? 1.0407 0.4851 0.4239 0.0865  -0.1558 0.0013  19  DA  C C5    
1943 C C6    . DA  B 19  ? 1.0281 0.4534 0.4125 0.0972  -0.1778 0.0069  19  DA  C C6    
1944 N N6    . DA  B 19  ? 1.0021 0.4433 0.4121 0.1159  -0.2051 0.0101  19  DA  C N6    
1945 N N1    . DA  B 19  ? 1.0522 0.4367 0.4019 0.0885  -0.1700 0.0119  19  DA  C N1    
1946 C C2    . DA  B 19  ? 1.0872 0.4608 0.4124 0.0571  -0.1465 0.0128  19  DA  C C2    
1947 N N3    . DA  B 19  ? 1.0860 0.5015 0.4281 0.0388  -0.1242 0.0118  19  DA  C N3    
1948 C C4    . DA  B 19  ? 1.0635 0.5118 0.4333 0.0617  -0.1277 0.0051  19  DA  C C4    
1949 P P     . DT  B 20  ? 1.1354 0.9606 0.7125 -0.0232 0.0099  0.0521  20  DT  C P     
1950 O OP1   . DT  B 20  ? 1.1791 1.0779 0.7770 -0.0654 0.0453  0.0767  20  DT  C OP1   
1951 O OP2   . DT  B 20  ? 1.0787 0.9566 0.7143 0.0259  0.0030  0.0432  20  DT  C OP2   
1952 O "O5'" . DT  B 20  ? 1.1222 0.8891 0.6811 -0.0589 -0.0313 0.0483  20  DT  C "O5'" 
1953 C "C5'" . DT  B 20  ? 1.1870 0.8574 0.6626 -0.0933 -0.0368 0.0513  20  DT  C "C5'" 
1954 C "C4'" . DT  B 20  ? 1.1768 0.7819 0.6277 -0.1032 -0.0724 0.0437  20  DT  C "C4'" 
1955 O "O4'" . DT  B 20  ? 1.1336 0.6880 0.5686 -0.0522 -0.0897 0.0274  20  DT  C "O4'" 
1956 C "C3'" . DT  B 20  ? 1.1308 0.8044 0.6485 -0.1217 -0.0906 0.0463  20  DT  C "C3'" 
1957 O "O3'" . DT  B 20  ? 1.2178 0.8371 0.6855 -0.1771 -0.1059 0.0546  20  DT  C "O3'" 
1958 C "C2'" . DT  B 20  ? 1.0567 0.7079 0.5878 -0.0734 -0.1114 0.0287  20  DT  C "C2'" 
1959 C "C1'" . DT  B 20  ? 1.0840 0.6385 0.5430 -0.0481 -0.1129 0.0212  20  DT  C "C1'" 
1960 N N1    . DT  B 20  ? 1.0184 0.5677 0.4952 0.0008  -0.1266 0.0095  20  DT  C N1    
1961 C C2    . DT  B 20  ? 1.0140 0.5027 0.4576 0.0196  -0.1427 0.0061  20  DT  C C2    
1962 O O2    . DT  B 20  ? 1.0612 0.4831 0.4484 0.0073  -0.1448 0.0091  20  DT  C O2    
1963 N N3    . DT  B 20  ? 0.9658 0.4723 0.4390 0.0544  -0.1553 0.0012  20  DT  C N3    
1964 C C4    . DT  B 20  ? 0.9299 0.4816 0.4415 0.0686  -0.1574 -0.0031 20  DT  C C4    
1965 O O4    . DT  B 20  ? 0.9016 0.4557 0.4270 0.0888  -0.1742 -0.0044 20  DT  C O4    
1966 C C5    . DT  B 20  ? 0.9398 0.5343 0.4702 0.0577  -0.1383 -0.0028 20  DT  C C5    
1967 C C7    . DT  B 20  ? 0.9254 0.5491 0.4773 0.0820  -0.1359 -0.0084 20  DT  C C7    
1968 C C6    . DT  B 20  ? 0.9661 0.5700 0.4881 0.0264  -0.1223 0.0048  20  DT  C C6    
1969 P P     . DG  B 21  ? 1.2262 0.9188 0.7446 -0.2300 -0.1249 0.0684  21  DG  C P     
1970 O OP1   . DG  B 21  ? 1.2977 1.0131 0.8009 -0.3011 -0.1143 0.0925  21  DG  C OP1   
1971 O OP2   . DG  B 21  ? 1.1242 0.9315 0.7456 -0.1929 -0.1276 0.0664  21  DG  C OP2   
1972 O "O5'" . DG  B 21  ? 1.2779 0.8493 0.7149 -0.2386 -0.1554 0.0566  21  DG  C "O5'" 
1973 C "C5'" . DG  B 21  ? 1.3335 0.7683 0.6699 -0.2128 -0.1539 0.0447  21  DG  C "C5'" 
1974 C "C4'" . DG  B 21  ? 1.3163 0.6990 0.6340 -0.1685 -0.1682 0.0284  21  DG  C "C4'" 
1975 O "O4'" . DG  B 21  ? 1.2264 0.6557 0.6013 -0.1052 -0.1590 0.0185  21  DG  C "O4'" 
1976 C "C3'" . DG  B 21  ? 1.2946 0.7149 0.6443 -0.1888 -0.1899 0.0280  21  DG  C "C3'" 
1977 O "O3'" . DG  B 21  ? 1.3771 0.6792 0.6356 -0.1763 -0.1993 0.0178  21  DG  C "O3'" 
1978 C "C2'" . DG  B 21  ? 1.1667 0.6887 0.6169 -0.1383 -0.1850 0.0213  21  DG  C "C2'" 
1979 C "C1'" . DG  B 21  ? 1.1548 0.6251 0.5770 -0.0859 -0.1705 0.0117  21  DG  C "C1'" 
1980 N N9    . DG  B 21  ? 1.0514 0.5911 0.5439 -0.0419 -0.1649 0.0064  21  DG  C N9    
1981 C C8    . DG  B 21  ? 0.9973 0.6296 0.5620 -0.0377 -0.1599 0.0092  21  DG  C C8    
1982 N N7    . DG  B 21  ? 0.9457 0.5961 0.5383 0.0026  -0.1599 0.0020  21  DG  C N7    
1983 C C5    . DG  B 21  ? 0.9428 0.5322 0.4982 0.0218  -0.1662 -0.0028 21  DG  C C5    
1984 C C6    . DG  B 21  ? 0.9003 0.4906 0.4702 0.0556  -0.1724 -0.0063 21  DG  C C6    
1985 O O6    . DG  B 21  ? 0.8884 0.5134 0.4916 0.0703  -0.1772 -0.0085 21  DG  C O6    
1986 N N1    . DG  B 21  ? 0.9012 0.4447 0.4382 0.0713  -0.1735 -0.0047 21  DG  C N1    
1987 C C2    . DG  B 21  ? 0.9659 0.4435 0.4422 0.0619  -0.1680 -0.0036 21  DG  C C2    
1988 N N2    . DG  B 21  ? 0.9972 0.4335 0.4430 0.0935  -0.1642 -0.0013 21  DG  C N2    
1989 N N3    . DG  B 21  ? 1.0193 0.4715 0.4625 0.0237  -0.1666 -0.0026 21  DG  C N3    
1990 C C4    . DG  B 21  ? 0.9956 0.5180 0.4904 0.0022  -0.1664 -0.0007 21  DG  C C4    
1991 P P     . DG  B 22  ? 1.4931 0.7068 0.6603 -0.2369 -0.2250 0.0217  22  DG  C P     
1992 O OP1   . DG  B 22  ? 1.6127 0.7570 0.7023 -0.2982 -0.2286 0.0342  22  DG  C OP1   
1993 O OP2   . DG  B 22  ? 1.4420 0.7537 0.6862 -0.2590 -0.2469 0.0264  22  DG  C OP2   
1994 O "O5'" . DG  B 22  ? 1.5581 0.6361 0.6220 -0.1854 -0.2180 0.0060  22  DG  C "O5'" 
1995 C "C5'" . DG  B 22  ? 1.5899 0.5927 0.6012 -0.1302 -0.1958 0.0007  22  DG  C "C5'" 
1996 C "C4'" . DG  B 22  ? 1.5570 0.5608 0.5831 -0.0559 -0.1803 -0.0092 22  DG  C "C4'" 
1997 O "O4'" . DG  B 22  ? 1.4081 0.5560 0.5706 -0.0254 -0.1744 -0.0085 22  DG  C "O4'" 
1998 C "C3'" . DG  B 22  ? 1.6067 0.5659 0.5868 -0.0614 -0.1876 -0.0158 22  DG  C "C3'" 
1999 O "O3'" . DG  B 22  ? 1.7152 0.5646 0.6010 -0.0019 -0.1654 -0.0223 22  DG  C "O3'" 
2000 C "C2'" . DG  B 22  ? 1.4457 0.5512 0.5590 -0.0501 -0.1906 -0.0158 22  DG  C "C2'" 
2001 C "C1'" . DG  B 22  ? 1.3437 0.5358 0.5470 -0.0087 -0.1755 -0.0131 22  DG  C "C1'" 
2002 N N9    . DG  B 22  ? 1.1997 0.5233 0.5216 -0.0160 -0.1832 -0.0105 22  DG  C N9    
2003 C C8    . DG  B 22  ? 1.1611 0.5532 0.5334 -0.0599 -0.1970 -0.0045 22  DG  C C8    
2004 N N7    . DG  B 22  ? 1.0571 0.5478 0.5207 -0.0420 -0.1961 -0.0037 22  DG  C N7    
2005 C C5    . DG  B 22  ? 1.0089 0.4950 0.4826 0.0050  -0.1861 -0.0088 22  DG  C C5    
2006 C C6    . DG  B 22  ? 0.9181 0.4702 0.4589 0.0328  -0.1856 -0.0095 22  DG  C C6    
2007 O O6    . DG  B 22  ? 0.8752 0.4888 0.4688 0.0307  -0.1908 -0.0087 22  DG  C O6    
2008 N N1    . DG  B 22  ? 0.9096 0.4471 0.4457 0.0667  -0.1775 -0.0090 22  DG  C N1    
2009 C C2    . DG  B 22  ? 0.9830 0.4565 0.4612 0.0854  -0.1651 -0.0081 22  DG  C C2    
2010 N N2    . DG  B 22  ? 0.9814 0.4767 0.4816 0.1220  -0.1551 -0.0019 22  DG  C N2    
2011 N N3    . DG  B 22  ? 1.0548 0.4458 0.4536 0.0698  -0.1625 -0.0106 22  DG  C N3    
2012 C C4    . DG  B 22  ? 1.0792 0.4782 0.4781 0.0231  -0.1764 -0.0111 22  DG  C C4    
2013 P P     . DA  B 23  ? 1.8172 0.5789 0.6135 0.0113  -0.1598 -0.0306 23  DA  C P     
2014 O OP1   . DA  B 23  ? 1.9870 0.5764 0.6269 0.0552  -0.1387 -0.0352 23  DA  C OP1   
2015 O OP2   . DA  B 23  ? 1.8362 0.6040 0.6242 -0.0651 -0.1948 -0.0303 23  DA  C OP2   
2016 O "O5'" . DA  B 23  ? 1.6698 0.5583 0.5841 0.0696  -0.1373 -0.0295 23  DA  C "O5'" 
2017 C "C5'" . DA  B 23  ? 1.6108 0.5418 0.5715 0.1400  -0.1095 -0.0237 23  DA  C "C5'" 
2018 C "C4'" . DA  B 23  ? 1.4878 0.5350 0.5500 0.1744  -0.0932 -0.0188 23  DA  C "C4'" 
2019 O "O4'" . DA  B 23  ? 1.3232 0.5005 0.5109 0.1397  -0.1155 -0.0160 23  DA  C "O4'" 
2020 C "C3'" . DA  B 23  ? 1.5421 0.5431 0.5461 0.1768  -0.0809 -0.0238 23  DA  C "C3'" 
2021 O "O3'" . DA  B 23  ? 1.5577 0.6039 0.5928 0.2417  -0.0429 -0.0148 23  DA  C "O3'" 
2022 C "C2'" . DA  B 23  ? 1.4182 0.5080 0.5036 0.1220  -0.1109 -0.0248 23  DA  C "C2'" 
2023 C "C1'" . DA  B 23  ? 1.2728 0.4896 0.4886 0.1234  -0.1200 -0.0177 23  DA  C "C1'" 
2024 N N9    . DA  B 23  ? 1.1780 0.4594 0.4569 0.0730  -0.1514 -0.0188 23  DA  C N9    
2025 C C8    . DA  B 23  ? 1.2096 0.4596 0.4559 0.0217  -0.1761 -0.0210 23  DA  C C8    
2026 N N7    . DA  B 23  ? 1.1207 0.4632 0.4514 -0.0050 -0.1960 -0.0174 23  DA  C N7    
2027 C C5    . DA  B 23  ? 1.0252 0.4436 0.4335 0.0294  -0.1860 -0.0156 23  DA  C C5    
2028 C C6    . DA  B 23  ? 0.9247 0.4340 0.4203 0.0292  -0.1968 -0.0129 23  DA  C C6    
2029 N N6    . DA  B 23  ? 0.8914 0.4487 0.4254 0.0034  -0.2148 -0.0104 23  DA  C N6    
2030 N N1    . DA  B 23  ? 0.8776 0.4249 0.4150 0.0579  -0.1877 -0.0105 23  DA  C N1    
2031 C C2    . DA  B 23  ? 0.9040 0.4286 0.4198 0.0857  -0.1671 -0.0073 23  DA  C C2    
2032 N N3    . DA  B 23  ? 0.9842 0.4379 0.4294 0.1008  -0.1494 -0.0085 23  DA  C N3    
2033 C C4    . DA  B 23  ? 1.0553 0.4447 0.4387 0.0711  -0.1609 -0.0148 23  DA  C C4    
2034 P P     . DC  B 24  ? 1.6840 0.6693 0.6387 0.2700  -0.0096 -0.0165 24  DC  C P     
2035 O OP1   . DC  B 24  ? 1.7424 0.7398 0.6950 0.3542  0.0389  -0.0039 24  DC  C OP1   
2036 O OP2   . DC  B 24  ? 1.8135 0.6430 0.6193 0.2280  -0.0276 -0.0317 24  DC  C OP2   
2037 O "O5'" . DC  B 24  ? 1.5376 0.6514 0.6056 0.2410  -0.0191 -0.0101 24  DC  C "O5'" 
2038 C "C5'" . DC  B 24  ? 1.3920 0.6546 0.6036 0.2494  -0.0207 0.0040  24  DC  C "C5'" 
2039 C "C4'" . DC  B 24  ? 1.2841 0.6194 0.5642 0.2032  -0.0450 0.0048  24  DC  C "C4'" 
2040 O "O4'" . DC  B 24  ? 1.2175 0.5487 0.5117 0.1543  -0.0876 -0.0053 24  DC  C "O4'" 
2041 C "C3'" . DC  B 24  ? 1.3599 0.6414 0.5700 0.1924  -0.0340 0.0020  24  DC  C "C3'" 
2042 O "O3'" . DC  B 24  ? 1.3334 0.7062 0.6138 0.2039  -0.0128 0.0179  24  DC  C "O3'" 
2043 C "C2'" . DC  B 24  ? 1.3196 0.5832 0.5241 0.1328  -0.0828 -0.0084 24  DC  C "C2'" 
2044 C "C1'" . DC  B 24  ? 1.1948 0.5409 0.4985 0.1201  -0.1076 -0.0071 24  DC  C "C1'" 
2045 N N1    . DC  B 24  ? 1.1646 0.5020 0.4698 0.0743  -0.1484 -0.0146 24  DC  C N1    
2046 C C2    . DC  B 24  ? 1.0476 0.4722 0.4434 0.0568  -0.1728 -0.0116 24  DC  C C2    
2047 O O2    . DC  B 24  ? 0.9754 0.4616 0.4323 0.0722  -0.1656 -0.0050 24  DC  C O2    
2048 N N3    . DC  B 24  ? 1.0296 0.4674 0.4392 0.0234  -0.2033 -0.0137 24  DC  C N3    
2049 C C4    . DC  B 24  ? 1.1170 0.4896 0.4582 -0.0055 -0.2159 -0.0168 24  DC  C C4    
2050 N N4    . DC  B 24  ? 1.0947 0.5081 0.4692 -0.0423 -0.2455 -0.0127 24  DC  C N4    
2051 C C5    . DC  B 24  ? 1.2380 0.4986 0.4689 0.0032  -0.1972 -0.0221 24  DC  C C5    
2052 C C6    . DC  B 24  ? 1.2567 0.5013 0.4714 0.0497  -0.1609 -0.0218 24  DC  C C6    
2053 P P     . DA  B 25  ? 1.4316 0.7694 0.6461 0.2191  0.0265  0.0247  25  DA  C P     
2054 O OP1   . DA  B 25  ? 1.4633 0.8543 0.7038 0.2792  0.0813  0.0429  25  DA  C OP1   
2055 O OP2   . DA  B 25  ? 1.5491 0.7436 0.6236 0.2002  0.0155  0.0072  25  DA  C OP2   
2056 O "O5'" . DA  B 25  ? 1.3330 0.7552 0.6270 0.1776  0.0046  0.0349  25  DA  C "O5'" 
2057 C "C5'" . DA  B 25  ? 1.1929 0.7176 0.6024 0.1597  -0.0224 0.0429  25  DA  C "C5'" 
2058 C "C4'" . DA  B 25  ? 1.1356 0.6633 0.5603 0.1137  -0.0629 0.0394  25  DA  C "C4'" 
2059 O "O4'" . DA  B 25  ? 1.1080 0.5936 0.5153 0.0952  -0.1026 0.0218  25  DA  C "O4'" 
2060 C "C3'" . DA  B 25  ? 1.2052 0.6803 0.5596 0.0978  -0.0549 0.0424  25  DA  C "C3'" 
2061 O "O3'" . DA  B 25  ? 1.1738 0.6952 0.5750 0.0689  -0.0735 0.0540  25  DA  C "O3'" 
2062 C "C2'" . DA  B 25  ? 1.2367 0.6214 0.5153 0.0794  -0.0898 0.0238  25  DA  C "C2'" 
2063 C "C1'" . DA  B 25  ? 1.1439 0.5767 0.4970 0.0690  -0.1263 0.0169  25  DA  C "C1'" 
2064 N N9    . DA  B 25  ? 1.1623 0.5419 0.4725 0.0543  -0.1538 0.0036  25  DA  C N9    
2065 C C8    . DA  B 25  ? 1.2577 0.5506 0.4768 0.0578  -0.1435 -0.0046 25  DA  C C8    
2066 N N7    . DA  B 25  ? 1.2662 0.5338 0.4690 0.0302  -0.1778 -0.0119 25  DA  C N7    
2067 C C5    . DA  B 25  ? 1.1539 0.5083 0.4515 0.0166  -0.2072 -0.0079 25  DA  C C5    
2068 C C6    . DA  B 25  ? 1.1012 0.4942 0.4412 -0.0087 -0.2442 -0.0080 25  DA  C C6    
2069 N N6    . DA  B 25  ? 1.1564 0.5073 0.4490 -0.0397 -0.2652 -0.0103 25  DA  C N6    
2070 N N1    . DA  B 25  ? 1.0091 0.4811 0.4327 -0.0034 -0.2599 -0.0031 25  DA  C N1    
2071 C C2    . DA  B 25  ? 0.9752 0.4720 0.4292 0.0171  -0.2445 0.0004  25  DA  C C2    
2072 N N3    . DA  B 25  ? 1.0076 0.4819 0.4346 0.0300  -0.2144 0.0036  25  DA  C N3    
2073 C C4    . DA  B 25  ? 1.0963 0.5068 0.4505 0.0333  -0.1937 -0.0004 25  DA  C C4    
2074 P P     . DG  B 26  ? 1.2375 0.7372 0.5904 0.0517  -0.0539 0.0688  26  DG  C P     
2075 O OP1   . DG  B 26  ? 1.2354 0.8256 0.6496 0.0582  -0.0128 0.0939  26  DG  C OP1   
2076 O OP2   . DG  B 26  ? 1.3394 0.7336 0.5754 0.0575  -0.0448 0.0579  26  DG  C OP2   
2077 O "O5'" . DG  B 26  ? 1.1914 0.6829 0.5584 0.0158  -0.1043 0.0687  26  DG  C "O5'" 
2078 C "C5'" . DG  B 26  ? 1.0831 0.6089 0.5144 0.0122  -0.1420 0.0610  26  DG  C "C5'" 
2079 C "C4'" . DG  B 26  ? 1.0766 0.5515 0.4771 0.0004  -0.1884 0.0519  26  DG  C "C4'" 
2080 O "O4'" . DG  B 26  ? 1.0567 0.5133 0.4477 0.0120  -0.2064 0.0359  26  DG  C "O4'" 
2081 C "C3'" . DG  B 26  ? 1.1536 0.5603 0.4742 -0.0167 -0.1959 0.0593  26  DG  C "C3'" 
2082 O "O3'" . DG  B 26  ? 1.1766 0.5624 0.4958 -0.0265 -0.2344 0.0622  26  DG  C "O3'" 
2083 C "C2'" . DG  B 26  ? 1.1843 0.5359 0.4444 -0.0099 -0.2081 0.0468  26  DG  C "C2'" 
2084 C "C1'" . DG  B 26  ? 1.1215 0.5151 0.4434 0.0020  -0.2305 0.0341  26  DG  C "C1'" 
2085 N N9    . DG  B 26  ? 1.1520 0.5155 0.4374 0.0029  -0.2324 0.0235  26  DG  C N9    
2086 C C8    . DG  B 26  ? 1.2033 0.5256 0.4329 0.0105  -0.1966 0.0199  26  DG  C C8    
2087 N N7    . DG  B 26  ? 1.2369 0.5202 0.4287 0.0041  -0.2111 0.0098  26  DG  C N7    
2088 C C5    . DG  B 26  ? 1.1759 0.5044 0.4252 -0.0095 -0.2563 0.0092  26  DG  C C5    
2089 C C6    . DG  B 26  ? 1.1828 0.5125 0.4333 -0.0294 -0.2899 0.0052  26  DG  C C6    
2090 O O6    . DG  B 26  ? 1.2498 0.5213 0.4363 -0.0454 -0.2906 -0.0007 26  DG  C O6    
2091 N N1    . DG  B 26  ? 1.1100 0.5132 0.4385 -0.0313 -0.3251 0.0111  26  DG  C N1    
2092 C C2    . DG  B 26  ? 1.0819 0.5234 0.4576 -0.0120 -0.3292 0.0167  26  DG  C C2    
2093 N N2    . DG  B 26  ? 1.0626 0.5654 0.5010 -0.0039 -0.3592 0.0221  26  DG  C N2    
2094 N N3    . DG  B 26  ? 1.0790 0.4994 0.4383 -0.0015 -0.3036 0.0191  26  DG  C N3    
2095 C C4    . DG  B 26  ? 1.1219 0.4983 0.4277 -0.0031 -0.2671 0.0165  26  DG  C C4    
2096 P P     . DC  B 27  ? 1.2827 0.5958 0.5230 -0.0483 -0.2470 0.0759  27  DC  C P     
2097 O OP1   . DC  B 27  ? 1.2977 0.6071 0.5531 -0.0621 -0.2648 0.0843  27  DC  C OP1   
2098 O OP2   . DC  B 27  ? 1.3416 0.6343 0.5280 -0.0618 -0.2057 0.0866  27  DC  C OP2   
2099 O "O5'" . DC  B 27  ? 1.3301 0.5922 0.5281 -0.0333 -0.2919 0.0668  27  DC  C "O5'" 
2100 C "C5'" . DC  B 27  ? 1.2768 0.5770 0.5331 -0.0095 -0.3223 0.0565  27  DC  C "C5'" 
2101 C "C4'" . DC  B 27  ? 1.2908 0.5811 0.5300 0.0003  -0.3569 0.0526  27  DC  C "C4'" 
2102 O "O4'" . DC  B 27  ? 1.2442 0.5624 0.4995 -0.0051 -0.3413 0.0433  27  DC  C "O4'" 
2103 C "C3'" . DC  B 27  ? 1.4115 0.6220 0.5563 -0.0115 -0.3795 0.0618  27  DC  C "C3'" 
2104 O "O3'" . DC  B 27  ? 1.4727 0.6727 0.6170 0.0095  -0.4262 0.0682  27  DC  C "O3'" 
2105 C "C2'" . DC  B 27  ? 1.4126 0.6122 0.5254 -0.0241 -0.3826 0.0558  27  DC  C "C2'" 
2106 C "C1'" . DC  B 27  ? 1.3065 0.5862 0.5074 -0.0154 -0.3725 0.0449  27  DC  C "C1'" 
2107 N N1    . DC  B 27  ? 1.3108 0.5686 0.4755 -0.0302 -0.3507 0.0363  27  DC  C N1    
2108 C C2    . DC  B 27  ? 1.3144 0.5906 0.4914 -0.0422 -0.3805 0.0324  27  DC  C C2    
2109 O O2    . DC  B 27  ? 1.2995 0.6382 0.5413 -0.0369 -0.4187 0.0384  27  DC  C O2    
2110 N N3    . DC  B 27  ? 1.3339 0.5587 0.4490 -0.0587 -0.3641 0.0241  27  DC  C N3    
2111 C C4    . DC  B 27  ? 1.3775 0.5393 0.4227 -0.0515 -0.3157 0.0197  27  DC  C C4    
2112 N N4    . DC  B 27  ? 1.4427 0.5338 0.4076 -0.0590 -0.2991 0.0107  27  DC  C N4    
2113 C C5    . DC  B 27  ? 1.3769 0.5421 0.4243 -0.0371 -0.2819 0.0269  27  DC  C C5    
2114 C C6    . DC  B 27  ? 1.3414 0.5514 0.4465 -0.0331 -0.3036 0.0351  27  DC  C C6    
2115 P P     . DT  B 28  ? 1.6320 0.7383 0.6755 0.0055  -0.4593 0.0821  28  DT  C P     
2116 O OP1   . DT  B 28  ? 1.6622 0.7499 0.7104 0.0367  -0.4854 0.0887  28  DT  C OP1   
2117 O OP2   . DT  B 28  ? 1.7300 0.7671 0.6878 -0.0282 -0.4241 0.0864  28  DT  C OP2   
2118 O "O5'" . DT  B 28  ? 1.6019 0.7238 0.6396 0.0062  -0.5040 0.0844  28  DT  C "O5'" 
2119 C "C5'" . DT  B 28  ? 1.5382 0.7390 0.6565 0.0372  -0.5437 0.0888  28  DT  C "C5'" 
2120 C "C4'" . DT  B 28  ? 1.5200 0.7709 0.6626 0.0169  -0.5717 0.0903  28  DT  C "C4'" 
2121 O "O4'" . DT  B 28  ? 1.4834 0.7382 0.6273 -0.0124 -0.5301 0.0753  28  DT  C "O4'" 
2122 C "C3'" . DT  B 28  ? 1.6224 0.7993 0.6661 -0.0074 -0.6164 0.1017  28  DT  C "C3'" 
2123 O "O3'" . DT  B 28  ? 1.6398 0.8492 0.7078 0.0219  -0.6757 0.1212  28  DT  C "O3'" 
2124 C "C2'" . DT  B 28  ? 1.6260 0.8264 0.6725 -0.0466 -0.6223 0.0959  28  DT  C "C2'" 
2125 C "C1'" . DT  B 28  ? 1.5356 0.7720 0.6359 -0.0460 -0.5601 0.0776  28  DT  C "C1'" 
2126 N N1    . DT  B 28  ? 1.5855 0.7361 0.5943 -0.0736 -0.5171 0.0642  28  DT  C N1    
2127 C C2    . DT  B 28  ? 1.6009 0.7405 0.5853 -0.1037 -0.5240 0.0578  28  DT  C C2    
2128 O O2    . DT  B 28  ? 1.5904 0.7918 0.6257 -0.1208 -0.5683 0.0654  28  DT  C O2    
2129 N N3    . DT  B 28  ? 1.6380 0.6917 0.5335 -0.1130 -0.4755 0.0446  28  DT  C N3    
2130 C C4    . DT  B 28  ? 1.6554 0.6530 0.4958 -0.0972 -0.4213 0.0411  28  DT  C C4    
2131 O O4    . DT  B 28  ? 1.6965 0.6295 0.4634 -0.0980 -0.3765 0.0316  28  DT  C O4    
2132 C C5    . DT  B 28  ? 1.6410 0.6626 0.5153 -0.0793 -0.4206 0.0514  28  DT  C C5    
2133 C C7    . DT  B 28  ? 1.6657 0.6473 0.4958 -0.0729 -0.3641 0.0541  28  DT  C C7    
2134 C C6    . DT  B 28  ? 1.6115 0.6943 0.5573 -0.0680 -0.4700 0.0608  28  DT  C C6    
2135 O "O5'" . DA  C 1   ? 2.7130 1.2328 0.6280 -0.5444 -0.6133 -0.0111 1   DA  D "O5'" 
2136 C "C5'" . DA  C 1   ? 2.6282 1.2025 0.6485 -0.5520 -0.6130 -0.0172 1   DA  D "C5'" 
2137 C "C4'" . DA  C 1   ? 2.4906 1.2263 0.6808 -0.5482 -0.6592 0.0192  1   DA  D "C4'" 
2138 O "O4'" . DA  C 1   ? 2.3779 1.1813 0.6547 -0.4891 -0.6318 0.0395  1   DA  D "O4'" 
2139 C "C3'" . DA  C 1   ? 2.3929 1.2050 0.7091 -0.5508 -0.6561 0.0187  1   DA  D "C3'" 
2140 O "O3'" . DA  C 1   ? 2.3535 1.2900 0.7713 -0.5772 -0.7230 0.0526  1   DA  D "O3'" 
2141 C "C2'" . DA  C 1   ? 2.2495 1.1072 0.6678 -0.4809 -0.5915 0.0183  1   DA  D "C2'" 
2142 C "C1'" . DA  C 1   ? 2.2247 1.1064 0.6421 -0.4499 -0.5960 0.0401  1   DA  D "C1'" 
2143 N N9    . DA  C 1   ? 2.1624 1.0106 0.5766 -0.3970 -0.5295 0.0314  1   DA  D N9    
2144 C C8    . DA  C 1   ? 2.1966 0.9500 0.5348 -0.3818 -0.4687 0.0034  1   DA  D C8    
2145 N N7    . DA  C 1   ? 2.1471 0.8994 0.5015 -0.3365 -0.4205 0.0074  1   DA  D N7    
2146 C C5    . DA  C 1   ? 2.0790 0.9161 0.5125 -0.3234 -0.4527 0.0375  1   DA  D C5    
2147 C C6    . DA  C 1   ? 2.0138 0.8824 0.4921 -0.2849 -0.4316 0.0565  1   DA  D C6    
2148 N N6    . DA  C 1   ? 2.0019 0.8321 0.4609 -0.2543 -0.3712 0.0493  1   DA  D N6    
2149 N N1    . DA  C 1   ? 1.9709 0.9133 0.5174 -0.2793 -0.4750 0.0857  1   DA  D N1    
2150 C C2    . DA  C 1   ? 1.9763 0.9703 0.5515 -0.3079 -0.5351 0.0980  1   DA  D C2    
2151 N N3    . DA  C 1   ? 2.0268 1.0092 0.5715 -0.3494 -0.5626 0.0849  1   DA  D N3    
2152 C C4    . DA  C 1   ? 2.0879 0.9826 0.5549 -0.3571 -0.5192 0.0530  1   DA  D C4    
2153 P P     . DG  C 2   ? 2.2703 1.3091 0.8232 -0.5930 -0.7369 0.0626  2   DG  D P     
2154 O OP1   . DG  C 2   ? 2.3233 1.4304 0.8938 -0.6523 -0.8173 0.0903  2   DG  D OP1   
2155 O OP2   . DG  C 2   ? 2.2783 1.2325 0.7921 -0.5966 -0.6877 0.0288  2   DG  D OP2   
2156 O "O5'" . DG  C 2   ? 2.1036 1.2656 0.8170 -0.5239 -0.7094 0.0847  2   DG  D "O5'" 
2157 C "C5'" . DG  C 2   ? 2.0599 1.3054 0.8303 -0.5012 -0.7431 0.1189  2   DG  D "C5'" 
2158 C "C4'" . DG  C 2   ? 1.9108 1.2217 0.7932 -0.4312 -0.7005 0.1273  2   DG  D "C4'" 
2159 O "O4'" . DG  C 2   ? 1.9063 1.1247 0.7208 -0.3975 -0.6430 0.1034  2   DG  D "O4'" 
2160 C "C3'" . DG  C 2   ? 1.7937 1.1850 0.8021 -0.4111 -0.6750 0.1262  2   DG  D "C3'" 
2161 O "O3'" . DG  C 2   ? 1.7249 1.2436 0.8589 -0.3834 -0.7003 0.1610  2   DG  D "O3'" 
2162 C "C2'" . DG  C 2   ? 1.7265 1.0606 0.7280 -0.3639 -0.6042 0.0998  2   DG  D "C2'" 
2163 C "C1'" . DG  C 2   ? 1.7737 1.0418 0.6916 -0.3473 -0.5980 0.1006  2   DG  D "C1'" 
2164 N N9    . DG  C 2   ? 1.7666 0.9460 0.6225 -0.3223 -0.5375 0.0747  2   DG  D N9    
2165 C C8    . DG  C 2   ? 1.8230 0.9064 0.5880 -0.3397 -0.5052 0.0456  2   DG  D C8    
2166 N N7    . DG  C 2   ? 1.8171 0.8433 0.5432 -0.3077 -0.4530 0.0327  2   DG  D N7    
2167 C C5    . DG  C 2   ? 1.7578 0.8382 0.5448 -0.2737 -0.4543 0.0539  2   DG  D C5    
2168 C C6    . DG  C 2   ? 1.7278 0.7867 0.5118 -0.2364 -0.4121 0.0554  2   DG  D C6    
2169 O O6    . DG  C 2   ? 1.7485 0.7435 0.4771 -0.2241 -0.3633 0.0401  2   DG  D O6    
2170 N N1    . DG  C 2   ? 1.6814 0.8005 0.5325 -0.2134 -0.4319 0.0806  2   DG  D N1    
2171 C C2    . DG  C 2   ? 1.6548 0.8507 0.5738 -0.2174 -0.4819 0.1023  2   DG  D C2    
2172 N N2    . DG  C 2   ? 1.6132 0.8484 0.5856 -0.1873 -0.4912 0.1250  2   DG  D N2    
2173 N N3    . DG  C 2   ? 1.6811 0.9113 0.6126 -0.2495 -0.5204 0.1041  2   DG  D N3    
2174 C C4    . DG  C 2   ? 1.7310 0.8992 0.5937 -0.2798 -0.5052 0.0787  2   DG  D C4    
2175 P P     . DC  C 3   ? 1.6289 1.2596 0.9068 -0.3602 -0.6849 0.1711  3   DC  D P     
2176 O OP1   . DC  C 3   ? 1.6257 1.3789 0.9925 -0.3666 -0.7378 0.2126  3   DC  D OP1   
2177 O OP2   . DC  C 3   ? 1.6297 1.2186 0.8872 -0.3886 -0.6581 0.1450  3   DC  D OP2   
2178 O "O5'" . DC  C 3   ? 1.5393 1.1719 0.8656 -0.2894 -0.6345 0.1645  3   DC  D "O5'" 
2179 C "C5'" . DC  C 3   ? 1.5464 1.1697 0.8598 -0.2562 -0.6421 0.1794  3   DC  D "C5'" 
2180 C "C4'" . DC  C 3   ? 1.4694 1.0643 0.8044 -0.2027 -0.5890 0.1644  3   DC  D "C4'" 
2181 O "O4'" . DC  C 3   ? 1.4943 0.9813 0.7304 -0.2118 -0.5544 0.1364  3   DC  D "O4'" 
2182 C "C3'" . DC  C 3   ? 1.3846 1.0350 0.8131 -0.1749 -0.5551 0.1554  3   DC  D "C3'" 
2183 O "O3'" . DC  C 3   ? 1.3513 1.0546 0.8550 -0.1240 -0.5506 0.1719  3   DC  D "O3'" 
2184 C "C2'" . DC  C 3   ? 1.3640 0.9305 0.7390 -0.1714 -0.5042 0.1218  3   DC  D "C2'" 
2185 C "C1'" . DC  C 3   ? 1.4220 0.9016 0.6966 -0.1780 -0.5043 0.1183  3   DC  D "C1'" 
2186 N N1    . DC  C 3   ? 1.4452 0.8307 0.6318 -0.1935 -0.4668 0.0900  3   DC  D N1    
2187 C C2    . DC  C 3   ? 1.4325 0.7635 0.5857 -0.1676 -0.4279 0.0811  3   DC  D C2    
2188 O O2    . DC  C 3   ? 1.3977 0.7494 0.5874 -0.1376 -0.4273 0.0946  3   DC  D O2    
2189 N N3    . DC  C 3   ? 1.4610 0.7172 0.5427 -0.1760 -0.3909 0.0595  3   DC  D N3    
2190 C C4    . DC  C 3   ? 1.4963 0.7160 0.5289 -0.2077 -0.3920 0.0445  3   DC  D C4    
2191 N N4    . DC  C 3   ? 1.5359 0.6743 0.4918 -0.2090 -0.3526 0.0248  3   DC  D N4    
2192 C C5    . DC  C 3   ? 1.5095 0.7733 0.5681 -0.2401 -0.4338 0.0513  3   DC  D C5    
2193 C C6    . DC  C 3   ? 1.4745 0.8271 0.6143 -0.2325 -0.4699 0.0753  3   DC  D C6    
2194 P P     . DT  C 4   ? 1.2850 1.0639 0.8940 -0.0864 -0.5241 0.1712  4   DT  D P     
2195 O OP1   . DT  C 4   ? 1.2874 1.1405 0.9678 -0.0486 -0.5465 0.2026  4   DT  D OP1   
2196 O OP2   . DT  C 4   ? 1.2571 1.0655 0.8863 -0.1186 -0.5177 0.1617  4   DT  D OP2   
2197 O "O5'" . DT  C 4   ? 1.2416 0.9532 0.8284 -0.0551 -0.4757 0.1448  4   DT  D "O5'" 
2198 C "C5'" . DT  C 4   ? 1.2645 0.9111 0.8013 -0.0388 -0.4712 0.1450  4   DT  D "C5'" 
2199 C "C4'" . DT  C 4   ? 1.2256 0.8137 0.7390 -0.0268 -0.4263 0.1190  4   DT  D "C4'" 
2200 O "O4'" . DT  C 4   ? 1.2487 0.7740 0.6849 -0.0615 -0.4136 0.1027  4   DT  D "O4'" 
2201 C "C3'" . DT  C 4   ? 1.1645 0.7925 0.7405 -0.0080 -0.3979 0.1044  4   DT  D "C3'" 
2202 O "O3'" . DT  C 4   ? 1.1664 0.7729 0.7572 0.0255  -0.3747 0.0966  4   DT  D "O3'" 
2203 C "C2'" . DT  C 4   ? 1.1472 0.7410 0.6830 -0.0388 -0.3768 0.0840  4   DT  D "C2'" 
2204 C "C1'" . DT  C 4   ? 1.1980 0.7141 0.6482 -0.0561 -0.3756 0.0811  4   DT  D "C1'" 
2205 N N1    . DT  C 4   ? 1.2236 0.6911 0.6092 -0.0898 -0.3642 0.0662  4   DT  D N1    
2206 C C2    . DT  C 4   ? 1.2376 0.6381 0.5657 -0.0890 -0.3316 0.0532  4   DT  D C2    
2207 O O2    . DT  C 4   ? 1.2275 0.6099 0.5545 -0.0689 -0.3161 0.0558  4   DT  D O2    
2208 N N3    . DT  C 4   ? 1.2761 0.6282 0.5439 -0.1140 -0.3183 0.0394  4   DT  D N3    
2209 C C4    . DT  C 4   ? 1.2996 0.6574 0.5581 -0.1434 -0.3348 0.0354  4   DT  D C4    
2210 O O4    . DT  C 4   ? 1.3572 0.6535 0.5515 -0.1617 -0.3173 0.0208  4   DT  D O4    
2211 C C5    . DT  C 4   ? 1.2703 0.7082 0.5987 -0.1488 -0.3706 0.0511  4   DT  D C5    
2212 C C7    . DT  C 4   ? 1.2955 0.7532 0.6257 -0.1867 -0.3935 0.0526  4   DT  D C7    
2213 C C6    . DT  C 4   ? 1.2363 0.7279 0.6259 -0.1192 -0.3820 0.0662  4   DT  D C6    
2214 P P     . DG  C 5   ? 1.1408 0.7960 0.8020 0.0609  -0.3564 0.0901  5   DG  D P     
2215 O OP1   . DG  C 5   ? 1.1536 0.8380 0.8518 0.0955  -0.3747 0.1098  5   DG  D OP1   
2216 O OP2   . DG  C 5   ? 1.0995 0.8011 0.7896 0.0450  -0.3468 0.0829  5   DG  D OP2   
2217 O "O5'" . DG  C 5   ? 1.1040 0.7018 0.7416 0.0711  -0.3259 0.0702  5   DG  D "O5'" 
2218 C "C5'" . DG  C 5   ? 1.1088 0.6422 0.6968 0.0657  -0.3258 0.0726  5   DG  D "C5'" 
2219 C "C4'" . DG  C 5   ? 1.0592 0.5554 0.6178 0.0495  -0.2973 0.0563  5   DG  D "C4'" 
2220 O "O4'" . DG  C 5   ? 1.0599 0.5442 0.5789 0.0198  -0.2947 0.0543  5   DG  D "O4'" 
2221 C "C3'" . DG  C 5   ? 0.9876 0.5079 0.5826 0.0609  -0.2749 0.0396  5   DG  D "C3'" 
2222 O "O3'" . DG  C 5   ? 0.9595 0.4461 0.5482 0.0680  -0.2614 0.0332  5   DG  D "O3'" 
2223 C "C2'" . DG  C 5   ? 0.9800 0.5058 0.5606 0.0380  -0.2600 0.0315  5   DG  D "C2'" 
2224 C "C1'" . DG  C 5   ? 1.0309 0.5162 0.5542 0.0144  -0.2670 0.0388  5   DG  D "C1'" 
2225 N N9    . DG  C 5   ? 1.0324 0.5219 0.5350 -0.0091 -0.2691 0.0356  5   DG  D N9    
2226 C C8    . DG  C 5   ? 1.0151 0.5485 0.5438 -0.0178 -0.2903 0.0411  5   DG  D C8    
2227 N N7    . DG  C 5   ? 1.0187 0.5362 0.5151 -0.0450 -0.2889 0.0360  5   DG  D N7    
2228 C C5    . DG  C 5   ? 1.0205 0.4792 0.4662 -0.0480 -0.2611 0.0256  5   DG  D C5    
2229 C C6    . DG  C 5   ? 1.0315 0.4386 0.4175 -0.0684 -0.2449 0.0162  5   DG  D C6    
2230 O O6    . DG  C 5   ? 1.0854 0.4807 0.4463 -0.0937 -0.2553 0.0132  5   DG  D O6    
2231 N N1    . DG  C 5   ? 1.0243 0.3874 0.3763 -0.0577 -0.2133 0.0114  5   DG  D N1    
2232 C C2    . DG  C 5   ? 1.0207 0.3918 0.3950 -0.0378 -0.2032 0.0168  5   DG  D C2    
2233 N N2    . DG  C 5   ? 1.0516 0.3881 0.3954 -0.0323 -0.1717 0.0159  5   DG  D N2    
2234 N N3    . DG  C 5   ? 1.0055 0.4141 0.4281 -0.0241 -0.2215 0.0237  5   DG  D N3    
2235 C C4    . DG  C 5   ? 1.0220 0.4713 0.4770 -0.0267 -0.2483 0.0270  5   DG  D C4    
2236 P P     . DT  C 6   ? 0.8814 0.3815 0.4949 0.0761  -0.2410 0.0169  6   DT  D P     
2237 O OP1   . DT  C 6   ? 0.8999 0.3681 0.5127 0.0898  -0.2442 0.0139  6   DT  D OP1   
2238 O OP2   . DT  C 6   ? 0.8792 0.4303 0.5257 0.0844  -0.2374 0.0108  6   DT  D OP2   
2239 O "O5'" . DT  C 6   ? 0.8393 0.3237 0.4296 0.0535  -0.2207 0.0152  6   DT  D "O5'" 
2240 C "C5'" . DT  C 6   ? 0.8537 0.2987 0.4120 0.0404  -0.2166 0.0243  6   DT  D "C5'" 
2241 C "C4'" . DT  C 6   ? 0.8310 0.2756 0.3794 0.0277  -0.1905 0.0237  6   DT  D "C4'" 
2242 O "O4'" . DT  C 6   ? 0.8677 0.3131 0.3937 0.0201  -0.1841 0.0219  6   DT  D "O4'" 
2243 C "C3'" . DT  C 6   ? 0.8136 0.2871 0.3963 0.0332  -0.1768 0.0154  6   DT  D "C3'" 
2244 O "O3'" . DT  C 6   ? 0.8162 0.2834 0.3957 0.0231  -0.1594 0.0243  6   DT  D "O3'" 
2245 C "C2'" . DT  C 6   ? 0.8043 0.3016 0.3917 0.0353  -0.1667 0.0088  6   DT  D "C2'" 
2246 C "C1'" . DT  C 6   ? 0.8451 0.3128 0.3886 0.0228  -0.1646 0.0143  6   DT  D "C1'" 
2247 N N1    . DT  C 6   ? 0.8657 0.3426 0.4028 0.0178  -0.1714 0.0091  6   DT  D N1    
2248 C C2    . DT  C 6   ? 0.8967 0.3476 0.3960 0.0066  -0.1552 0.0073  6   DT  D C2    
2249 O O2    . DT  C 6   ? 0.9255 0.3503 0.3991 0.0071  -0.1304 0.0096  6   DT  D O2    
2250 N N3    . DT  C 6   ? 0.8904 0.3462 0.3831 -0.0050 -0.1680 0.0039  6   DT  D N3    
2251 C C4    . DT  C 6   ? 0.8654 0.3635 0.3954 -0.0046 -0.1918 0.0053  6   DT  D C4    
2252 O O4    . DT  C 6   ? 0.8811 0.3847 0.4037 -0.0214 -0.2028 0.0059  6   DT  D O4    
2253 C C5    . DT  C 6   ? 0.8547 0.3821 0.4247 0.0148  -0.2030 0.0078  6   DT  D C5    
2254 C C7    . DT  C 6   ? 0.8412 0.4174 0.4544 0.0247  -0.2225 0.0116  6   DT  D C7    
2255 C C6    . DT  C 6   ? 0.8582 0.3673 0.4255 0.0241  -0.1931 0.0078  6   DT  D C6    
2256 P P     . DC  C 7   ? 0.8057 0.3036 0.4193 0.0228  -0.1489 0.0240  7   DC  D P     
2257 O OP1   . DC  C 7   ? 0.8038 0.2911 0.4168 0.0075  -0.1436 0.0396  7   DC  D OP1   
2258 O OP2   . DC  C 7   ? 0.8018 0.3155 0.4368 0.0334  -0.1643 0.0099  7   DC  D OP2   
2259 O "O5'" . DC  C 7   ? 0.7950 0.3127 0.4090 0.0278  -0.1238 0.0256  7   DC  D "O5'" 
2260 C "C5'" . DC  C 7   ? 0.8491 0.3455 0.4321 0.0240  -0.1024 0.0355  7   DC  D "C5'" 
2261 C "C4'" . DC  C 7   ? 0.8752 0.3776 0.4524 0.0337  -0.0790 0.0338  7   DC  D "C4'" 
2262 O "O4'" . DC  C 7   ? 0.8827 0.3698 0.4398 0.0332  -0.0904 0.0211  7   DC  D "O4'" 
2263 C "C3'" . DC  C 7   ? 0.8630 0.4090 0.4831 0.0436  -0.0703 0.0369  7   DC  D "C3'" 
2264 O "O3'" . DC  C 7   ? 0.9114 0.4608 0.5283 0.0529  -0.0382 0.0504  7   DC  D "O3'" 
2265 C "C2'" . DC  C 7   ? 0.8296 0.3803 0.4512 0.0494  -0.0795 0.0232  7   DC  D "C2'" 
2266 C "C1'" . DC  C 7   ? 0.8626 0.3703 0.4378 0.0420  -0.0812 0.0171  7   DC  D "C1'" 
2267 N N1    . DC  C 7   ? 0.8448 0.3576 0.4221 0.0380  -0.1022 0.0063  7   DC  D N1    
2268 C C2    . DC  C 7   ? 0.8606 0.3474 0.4057 0.0298  -0.0985 0.0025  7   DC  D C2    
2269 O O2    . DC  C 7   ? 0.9151 0.3634 0.4212 0.0289  -0.0769 0.0046  7   DC  D O2    
2270 N N3    . DC  C 7   ? 0.8476 0.3493 0.4019 0.0217  -0.1190 -0.0024 7   DC  D N3    
2271 C C4    . DC  C 7   ? 0.8304 0.3704 0.4227 0.0287  -0.1378 -0.0039 7   DC  D C4    
2272 N N4    . DC  C 7   ? 0.8395 0.4040 0.4473 0.0236  -0.1538 -0.0045 7   DC  D N4    
2273 C C5    . DC  C 7   ? 0.8061 0.3594 0.4209 0.0407  -0.1401 -0.0037 7   DC  D C5    
2274 C C6    . DC  C 7   ? 0.8115 0.3498 0.4175 0.0411  -0.1247 0.0016  7   DC  D C6    
2275 P P     . DC  C 8   ? 0.9309 0.5337 0.5966 0.0646  -0.0246 0.0653  8   DC  D P     
2276 O OP1   . DC  C 8   ? 0.9777 0.5904 0.6478 0.0704  0.0055  0.0869  8   DC  D OP1   
2277 O OP2   . DC  C 8   ? 0.8931 0.5317 0.5962 0.0556  -0.0534 0.0612  8   DC  D OP2   
2278 O "O5'" . DC  C 8   ? 0.9253 0.5166 0.5774 0.0813  -0.0104 0.0593  8   DC  D "O5'" 
2279 C "C5'" . DC  C 8   ? 0.9549 0.4922 0.5549 0.0881  0.0127  0.0556  8   DC  D "C5'" 
2280 C "C4'" . DC  C 8   ? 0.9668 0.4869 0.5537 0.0945  0.0142  0.0468  8   DC  D "C4'" 
2281 O "O4'" . DC  C 8   ? 0.9465 0.4569 0.5236 0.0767  -0.0155 0.0300  8   DC  D "O4'" 
2282 C "C3'" . DC  C 8   ? 0.9504 0.5200 0.5838 0.1089  0.0159  0.0572  8   DC  D "C3'" 
2283 O "O3'" . DC  C 8   ? 1.0156 0.5532 0.6244 0.1241  0.0386  0.0601  8   DC  D "O3'" 
2284 C "C2'" . DC  C 8   ? 0.8945 0.4861 0.5452 0.0951  -0.0171 0.0434  8   DC  D "C2'" 
2285 C "C1'" . DC  C 8   ? 0.9004 0.4424 0.5070 0.0810  -0.0241 0.0285  8   DC  D "C1'" 
2286 N N1    . DC  C 8   ? 0.8559 0.4149 0.4749 0.0680  -0.0544 0.0161  8   DC  D N1    
2287 C C2    . DC  C 8   ? 0.8471 0.3870 0.4460 0.0564  -0.0632 0.0080  8   DC  D C2    
2288 O O2    . DC  C 8   ? 0.8843 0.3828 0.4474 0.0520  -0.0491 0.0083  8   DC  D O2    
2289 N N3    . DC  C 8   ? 0.8086 0.3762 0.4283 0.0505  -0.0866 0.0013  8   DC  D N3    
2290 C C4    . DC  C 8   ? 0.7981 0.3953 0.4453 0.0575  -0.0994 -0.0011 8   DC  D C4    
2291 N N4    . DC  C 8   ? 0.7968 0.4155 0.4599 0.0578  -0.1176 -0.0072 8   DC  D N4    
2292 C C5    . DC  C 8   ? 0.8100 0.4158 0.4695 0.0643  -0.0941 0.0040  8   DC  D C5    
2293 C C6    . DC  C 8   ? 0.8255 0.4193 0.4760 0.0682  -0.0723 0.0143  8   DC  D C6    
2294 P P     . DA  C 9   ? 1.0251 0.5835 0.6558 0.1550  0.0700  0.0837  9   DA  D P     
2295 O OP1   . DA  C 9   ? 1.0708 0.6211 0.6928 0.1676  0.0983  0.0959  9   DA  D OP1   
2296 O OP2   . DA  C 9   ? 0.9894 0.6187 0.6776 0.1579  0.0517  0.0948  9   DA  D OP2   
2297 O "O5'" . DA  C 9   ? 1.0567 0.5480 0.6373 0.1639  0.0875  0.0777  9   DA  D "O5'" 
2298 C "C5'" . DA  C 9   ? 1.0821 0.4933 0.5937 0.1482  0.0907  0.0592  9   DA  D "C5'" 
2299 C "C4'" . DA  C 9   ? 1.0648 0.4390 0.5502 0.1335  0.0793  0.0488  9   DA  D "C4'" 
2300 O "O4'" . DA  C 9   ? 0.9946 0.4072 0.5056 0.1064  0.0422  0.0374  9   DA  D "O4'" 
2301 C "C3'" . DA  C 9   ? 1.0342 0.4212 0.5404 0.1543  0.0919  0.0641  9   DA  D "C3'" 
2302 O "O3'" . DA  C 9   ? 1.1121 0.4129 0.5562 0.1523  0.1080  0.0592  9   DA  D "O3'" 
2303 C "C2'" . DA  C 9   ? 0.9446 0.3976 0.4990 0.1387  0.0598  0.0622  9   DA  D "C2'" 
2304 C "C1'" . DA  C 9   ? 0.9393 0.3827 0.4785 0.1070  0.0339  0.0423  9   DA  D "C1'" 
2305 N N9    . DA  C 9   ? 0.8415 0.3517 0.4275 0.0978  0.0056  0.0378  9   DA  D N9    
2306 C C8    . DA  C 9   ? 0.8056 0.3681 0.4315 0.1064  -0.0023 0.0424  9   DA  D C8    
2307 N N7    . DA  C 9   ? 0.7605 0.3586 0.4095 0.0956  -0.0276 0.0331  9   DA  D N7    
2308 C C5    . DA  C 9   ? 0.7552 0.3335 0.3858 0.0804  -0.0358 0.0241  9   DA  D C5    
2309 C C6    . DA  C 9   ? 0.7185 0.3225 0.3637 0.0689  -0.0572 0.0150  9   DA  D C6    
2310 N N6    . DA  C 9   ? 0.7015 0.3434 0.3734 0.0741  -0.0728 0.0095  9   DA  D N6    
2311 N N1    . DA  C 9   ? 0.7345 0.3234 0.3657 0.0526  -0.0608 0.0133  9   DA  D N1    
2312 C C2    . DA  C 9   ? 0.7825 0.3198 0.3769 0.0443  -0.0463 0.0170  9   DA  D C2    
2313 N N3    . DA  C 9   ? 0.8293 0.3253 0.3975 0.0574  -0.0233 0.0225  9   DA  D N3    
2314 C C4    . DA  C 9   ? 0.8070 0.3324 0.3996 0.0774  -0.0181 0.0271  9   DA  D C4    
2315 P P     . DT  C 10  ? 1.1280 0.4063 0.5685 0.1752  0.1281  0.0762  10  DT  D P     
2316 O OP1   . DT  C 10  ? 1.2352 0.3995 0.5932 0.1784  0.1542  0.0692  10  DT  D OP1   
2317 O OP2   . DT  C 10  ? 1.0863 0.4384 0.5878 0.2101  0.1388  0.1008  10  DT  D OP2   
2318 O "O5'" . DT  C 10  ? 1.0519 0.3587 0.5119 0.1450  0.0975  0.0716  10  DT  D "O5'" 
2319 C "C5'" . DT  C 10  ? 1.0528 0.3200 0.4773 0.1058  0.0784  0.0539  10  DT  D "C5'" 
2320 C "C4'" . DT  C 10  ? 1.0069 0.3343 0.4729 0.0852  0.0528  0.0555  10  DT  D "C4'" 
2321 O "O4'" . DT  C 10  ? 0.9335 0.3435 0.4531 0.0863  0.0322  0.0512  10  DT  D "O4'" 
2322 C "C3'" . DT  C 10  ? 1.0180 0.3661 0.5046 0.1018  0.0626  0.0749  10  DT  D "C3'" 
2323 O "O3'" . DT  C 10  ? 1.0999 0.3877 0.5470 0.0783  0.0651  0.0769  10  DT  D "O3'" 
2324 C "C2'" . DT  C 10  ? 0.9293 0.3748 0.4762 0.1000  0.0399  0.0757  10  DT  D "C2'" 
2325 C "C1'" . DT  C 10  ? 0.8885 0.3536 0.4442 0.0815  0.0193  0.0567  10  DT  D "C1'" 
2326 N N1    . DT  C 10  ? 0.8169 0.3569 0.4204 0.0918  0.0035  0.0538  10  DT  D N1    
2327 C C2    . DT  C 10  ? 0.7750 0.3572 0.4012 0.0770  -0.0178 0.0444  10  DT  D C2    
2328 O O2    . DT  C 10  ? 0.7828 0.3587 0.4024 0.0557  -0.0249 0.0417  10  DT  D O2    
2329 N N3    . DT  C 10  ? 0.7364 0.3679 0.3932 0.0876  -0.0305 0.0397  10  DT  D N3    
2330 C C4    . DT  C 10  ? 0.7259 0.3744 0.3966 0.1045  -0.0278 0.0450  10  DT  D C4    
2331 O O4    . DT  C 10  ? 0.7112 0.3958 0.4028 0.1062  -0.0434 0.0389  10  DT  D O4    
2332 C C5    . DT  C 10  ? 0.7746 0.3942 0.4326 0.1194  -0.0053 0.0594  10  DT  D C5    
2333 C C7    . DT  C 10  ? 0.7750 0.4267 0.4587 0.1382  -0.0004 0.0729  10  DT  D C7    
2334 C C6    . DT  C 10  ? 0.8047 0.3680 0.4274 0.1156  0.0110  0.0620  10  DT  D C6    
2335 P P     A DC  C 11  ? 1.1218 0.4044 0.5711 0.0902  0.0783  0.0997  11  DC  D P     
2336 P P     B DC  C 11  ? 1.1284 0.4256 0.5853 0.0817  0.0714  0.0976  11  DC  D P     
2337 O OP1   A DC  C 11  ? 1.2379 0.4112 0.6200 0.0767  0.0940  0.1014  11  DC  D OP1   
2338 O OP1   B DC  C 11  ? 1.2328 0.4245 0.6255 0.0693  0.0875  0.1011  11  DC  D OP1   
2339 O OP2   A DC  C 11  ? 1.0664 0.4002 0.5524 0.1326  0.0893  0.1167  11  DC  D OP2   
2340 O OP2   B DC  C 11  ? 1.0725 0.4285 0.5695 0.1207  0.0794  0.1148  11  DC  D OP2   
2341 O "O5'" A DC  C 11  ? 1.0697 0.4231 0.5579 0.0619  0.0548  0.1005  11  DC  D "O5'" 
2342 O "O5'" B DC  C 11  ? 1.0906 0.4550 0.5837 0.0477  0.0448  0.0928  11  DC  D "O5'" 
2343 C "C5'" A DC  C 11  ? 1.0652 0.4203 0.5505 0.0209  0.0345  0.0870  11  DC  D "C5'" 
2344 C "C5'" B DC  C 11  ? 1.1178 0.4620 0.5948 0.0066  0.0271  0.0792  11  DC  D "C5'" 
2345 C "C4'" A DC  C 11  ? 0.9903 0.4395 0.5299 0.0120  0.0177  0.0895  11  DC  D "C4'" 
2346 C "C4'" B DC  C 11  ? 1.0585 0.4922 0.5883 -0.0110 0.0050  0.0779  11  DC  D "C4'" 
2347 O "O4'" A DC  C 11  ? 0.9185 0.4281 0.4938 0.0338  0.0079  0.0789  11  DC  D "O4'" 
2348 O "O4'" B DC  C 11  ? 0.9825 0.4842 0.5533 0.0158  -0.0018 0.0708  11  DC  D "O4'" 
2349 C "C3'" A DC  C 11  ? 0.9815 0.4605 0.5352 0.0230  0.0284  0.1100  11  DC  D "C3'" 
2350 C "C3'" B DC  C 11  ? 1.0617 0.5327 0.6127 -0.0202 0.0087  0.0962  11  DC  D "C3'" 
2351 O "O3'" A DC  C 11  ? 1.0201 0.4949 0.5702 -0.0120 0.0260  0.1202  11  DC  D "O3'" 
2352 O "O3'" B DC  C 11  ? 1.0691 0.5763 0.6418 -0.0575 -0.0088 0.0967  11  DC  D "O3'" 
2353 C "C2'" A DC  C 11  ? 0.9033 0.4713 0.5025 0.0444  0.0191  0.1065  11  DC  D "C2'" 
2354 C "C2'" B DC  C 11  ? 0.9940 0.5401 0.5850 0.0146  0.0107  0.0990  11  DC  D "C2'" 
2355 C "C1'" A DC  C 11  ? 0.8639 0.4460 0.4763 0.0449  0.0040  0.0853  11  DC  D "C1'" 
2356 C "C1'" B DC  C 11  ? 0.9469 0.5192 0.5560 0.0231  -0.0042 0.0792  11  DC  D "C1'" 
2357 N N1    A DC  C 11  ? 0.8061 0.4229 0.4376 0.0749  0.0013  0.0808  11  DC  D N1    
2358 N N1    B DC  C 11  ? 0.9021 0.5138 0.5317 0.0566  -0.0036 0.0768  11  DC  D N1    
2359 C C2    A DC  C 11  ? 0.7426 0.4155 0.4030 0.0785  -0.0151 0.0680  11  DC  D C2    
2360 C C2    B DC  C 11  ? 0.8458 0.5235 0.5080 0.0644  -0.0164 0.0688  11  DC  D C2    
2361 O O2    A DC  C 11  ? 0.7334 0.4340 0.4080 0.0641  -0.0237 0.0626  11  DC  D O2    
2362 O O2    B DC  C 11  ? 0.8307 0.5415 0.5102 0.0503  -0.0235 0.0667  11  DC  D O2    
2363 N N3    A DC  C 11  ? 0.7017 0.3950 0.3736 0.0973  -0.0210 0.0633  11  DC  D N3    
2364 N N3    B DC  C 11  ? 0.8142 0.5162 0.4867 0.0873  -0.0203 0.0651  11  DC  D N3    
2365 C C4    A DC  C 11  ? 0.7112 0.3872 0.3773 0.1134  -0.0111 0.0741  11  DC  D C4    
2366 C C4    B DC  C 11  ? 0.8270 0.5057 0.4908 0.1022  -0.0126 0.0720  11  DC  D C4    
2367 N N4    A DC  C 11  ? 0.6757 0.3819 0.3599 0.1259  -0.0202 0.0725  11  DC  D N4    
2368 N N4    B DC  C 11  ? 0.8001 0.5114 0.4798 0.1181  -0.0208 0.0709  11  DC  D N4    
2369 C C5    A DC  C 11  ? 0.7680 0.3937 0.4096 0.1177  0.0090  0.0889  11  DC  D C5    
2370 C C5    B DC  C 11  ? 0.8827 0.5026 0.5197 0.1021  0.0049  0.0823  11  DC  D C5    
2371 C C6    A DC  C 11  ? 0.8122 0.4027 0.4322 0.0978  0.0145  0.0902  11  DC  D C6    
2372 C C6    B DC  C 11  ? 0.9219 0.5025 0.5369 0.0789  0.0087  0.0821  11  DC  D C6    
2373 P P     A DG  C 12  ? 1.0561 0.5358 0.6032 -0.0100 0.0413  0.1463  12  DG  D P     
2374 P P     B DG  C 12  ? 1.1112 0.6409 0.6966 -0.0849 -0.0044 0.1189  12  DG  D P     
2375 O OP1   A DG  C 12  ? 1.1257 0.5569 0.6485 -0.0541 0.0415  0.1566  12  DG  D OP1   
2376 O OP1   B DG  C 12  ? 1.1349 0.6737 0.7293 -0.1321 -0.0249 0.1195  12  DG  D OP1   
2377 O OP2   A DG  C 12  ? 1.0498 0.5041 0.5803 0.0301  0.0573  0.1570  12  DG  D OP2   
2378 O OP2   B DG  C 12  ? 1.1624 0.6220 0.7057 -0.0778 0.0169  0.1336  12  DG  D OP2   
2379 O "O5'" A DG  C 12  ? 1.0230 0.6090 0.6204 -0.0034 0.0340  0.1475  12  DG  D "O5'" 
2380 O "O5'" B DG  C 12  ? 1.0559 0.6883 0.6949 -0.0579 -0.0013 0.1237  12  DG  D "O5'" 
2381 C "C5'" A DG  C 12  ? 1.0161 0.6560 0.6476 -0.0267 0.0192  0.1386  12  DG  D "C5'" 
2382 C "C5'" B DG  C 12  ? 1.0737 0.7228 0.7122 -0.0421 0.0167  0.1417  12  DG  D "C5'" 
2383 C "C4'" A DG  C 12  ? 0.9781 0.7059 0.6469 -0.0038 0.0184  0.1359  12  DG  D "C4'" 
2384 C "C4'" B DG  C 12  ? 1.0246 0.7524 0.6951 -0.0097 0.0177  0.1369  12  DG  D "C4'" 
2385 O "O4'" A DG  C 12  ? 0.9312 0.6663 0.6017 0.0279  0.0112  0.1176  12  DG  D "O4'" 
2386 O "O4'" B DG  C 12  ? 0.9919 0.7081 0.6553 0.0210  0.0122  0.1198  12  DG  D "O4'" 
2387 C "C3'" A DG  C 12  ? 1.0149 0.7697 0.6793 0.0080  0.0353  0.1562  12  DG  D "C3'" 
2388 C "C3'" B DG  C 12  ? 1.0485 0.8015 0.7136 0.0040  0.0350  0.1568  12  DG  D "C3'" 
2389 O "O3'" A DG  C 12  ? 1.0286 0.8605 0.7258 0.0069  0.0382  0.1590  12  DG  D "O3'" 
2390 O "O3'" B DG  C 12  ? 1.0421 0.8742 0.7394 0.0068  0.0381  0.1589  12  DG  D "O3'" 
2391 C "C2'" A DG  C 12  ? 0.9767 0.7268 0.6260 0.0457  0.0354  0.1503  12  DG  D "C2'" 
2392 C "C2'" B DG  C 12  ? 1.0221 0.7625 0.6695 0.0411  0.0356  0.1511  12  DG  D "C2'" 
2393 C "C1'" A DG  C 12  ? 0.9090 0.6741 0.5764 0.0548  0.0186  0.1240  12  DG  D "C1'" 
2394 C "C1'" B DG  C 12  ? 0.9672 0.7154 0.6301 0.0496  0.0190  0.1251  12  DG  D "C1'" 
2395 N N9    A DG  C 12  ? 0.8648 0.6085 0.5214 0.0785  0.0135  0.1166  12  DG  D N9    
2396 N N9    B DG  C 12  ? 0.9382 0.6595 0.5882 0.0734  0.0162  0.1195  12  DG  D N9    
2397 C C8    A DG  C 12  ? 0.8812 0.5701 0.5172 0.0853  0.0205  0.1249  12  DG  D C8    
2398 C C8    B DG  C 12  ? 0.9647 0.6267 0.5906 0.0795  0.0254  0.1293  12  DG  D C8    
2399 N N7    A DG  C 12  ? 0.8482 0.5430 0.4896 0.1065  0.0143  0.1186  12  DG  D N7    
2400 N N7    B DG  C 12  ? 0.9386 0.6037 0.5681 0.1036  0.0221  0.1258  12  DG  D N7    
2401 C C5    A DG  C 12  ? 0.7986 0.5461 0.4589 0.1106  -0.0001 0.1035  12  DG  D C5    
2402 C C5    B DG  C 12  ? 0.8880 0.6094 0.5398 0.1090  0.0066  0.1107  12  DG  D C5    
2403 C C6    A DG  C 12  ? 0.7546 0.5274 0.4252 0.1252  -0.0144 0.0924  12  DG  D C6    
2404 C C6    B DG  C 12  ? 0.8515 0.5998 0.5154 0.1262  -0.0059 0.1025  12  DG  D C6    
2405 O O6    A DG  C 12  ? 0.7314 0.4967 0.4060 0.1365  -0.0172 0.0965  12  DG  D O6    
2406 O O6    B DG  C 12  ? 0.8429 0.5815 0.5099 0.1399  -0.0055 0.1090  12  DG  D O6    
2407 N N1    A DG  C 12  ? 0.7370 0.5471 0.4134 0.1257  -0.0250 0.0769  12  DG  D N1    
2408 N N1    B DG  C 12  ? 0.8260 0.6146 0.5000 0.1252  -0.0195 0.0857  12  DG  D N1    
2409 C C2    A DG  C 12  ? 0.7525 0.5829 0.4321 0.1181  -0.0189 0.0744  12  DG  D C2    
2410 C C2    B DG  C 12  ? 0.8285 0.6382 0.5058 0.1159  -0.0169 0.0802  12  DG  D C2    
2411 N N2    A DG  C 12  ? 0.7463 0.6066 0.4279 0.1269  -0.0260 0.0586  12  DG  D N2    
2412 N N2    B DG  C 12  ? 0.8184 0.6591 0.5001 0.1235  -0.0268 0.0637  12  DG  D N2    
2413 N N3    A DG  C 12  ? 0.7755 0.5969 0.4557 0.1028  -0.0058 0.0884  12  DG  D N3    
2414 N N3    B DG  C 12  ? 0.8501 0.6506 0.5266 0.1000  -0.0047 0.0918  12  DG  D N3    
2415 C C4    A DG  C 12  ? 0.8057 0.5811 0.4731 0.0974  0.0013  0.1014  12  DG  D C4    
2416 C C4    B DG  C 12  ? 0.8851 0.6376 0.5464 0.0944  0.0048  0.1058  12  DG  D C4    
2417 P P     . DC  C 13  ? 1.0806 0.9493 0.7737 0.0092  0.0590  0.1838  13  DC  D P     
2418 O OP1   . DC  C 13  ? 1.0902 1.0284 0.8245 -0.0081 0.0644  0.1921  13  DC  D OP1   
2419 O OP2   . DC  C 13  ? 1.1398 0.9446 0.7973 -0.0024 0.0689  0.2056  13  DC  D OP2   
2420 O "O5'" . DC  C 13  ? 1.0550 0.9511 0.7336 0.0508  0.0598  0.1716  13  DC  D "O5'" 
2421 C "C5'" . DC  C 13  ? 1.0196 0.9602 0.7178 0.0694  0.0520  0.1485  13  DC  D "C5'" 
2422 C "C4'" . DC  C 13  ? 1.0155 0.9495 0.6865 0.1001  0.0437  0.1328  13  DC  D "C4'" 
2423 O "O4'" . DC  C 13  ? 1.0041 0.8889 0.6664 0.1006  0.0299  0.1276  13  DC  D "O4'" 
2424 C "C3'" . DC  C 13  ? 1.0494 0.9926 0.6848 0.1147  0.0552  0.1482  13  DC  D "C3'" 
2425 O "O3'" . DC  C 13  ? 1.0728 1.0607 0.6997 0.1322  0.0640  0.1384  13  DC  D "O3'" 
2426 C "C2'" . DC  C 13  ? 1.0369 0.9485 0.6499 0.1297  0.0381  0.1427  13  DC  D "C2'" 
2427 C "C1'" . DC  C 13  ? 0.9935 0.8791 0.6313 0.1228  0.0232  0.1254  13  DC  D "C1'" 
2428 N N1    . DC  C 13  ? 0.9721 0.8150 0.6036 0.1256  0.0175  0.1346  13  DC  D N1    
2429 C C2    . DC  C 13  ? 0.9325 0.7762 0.5651 0.1398  0.0005  0.1233  13  DC  D C2    
2430 O O2    . DC  C 13  ? 0.9128 0.7815 0.5442 0.1461  -0.0122 0.1039  13  DC  D O2    
2431 N N3    . DC  C 13  ? 0.9237 0.7384 0.5585 0.1462  -0.0002 0.1352  13  DC  D N3    
2432 C C4    . DC  C 13  ? 0.9537 0.7277 0.5799 0.1423  0.0160  0.1546  13  DC  D C4    
2433 N N4    . DC  C 13  ? 0.9594 0.7036 0.5855 0.1561  0.0195  0.1665  13  DC  D N4    
2434 C C5    . DC  C 13  ? 0.9921 0.7529 0.6088 0.1238  0.0305  0.1642  13  DC  D C5    
2435 C C6    . DC  C 13  ? 0.9903 0.7927 0.6145 0.1146  0.0303  0.1553  13  DC  D C6    
2436 P P     . DT  C 14  ? 1.1256 1.1321 0.7067 0.1476  0.0798  0.1525  14  DT  D P     
2437 O OP1   . DT  C 14  ? 1.1412 1.1970 0.7289 0.1572  0.1020  0.1497  14  DT  D OP1   
2438 O OP2   . DT  C 14  ? 1.1475 1.1300 0.7139 0.1347  0.0869  0.1842  14  DT  D OP2   
2439 O "O5'" . DT  C 14  ? 1.1213 1.1096 0.6640 0.1684  0.0570  0.1303  14  DT  D "O5'" 
2440 C "C5'" . DT  C 14  ? 1.0825 1.0673 0.6331 0.1778  0.0415  0.0980  14  DT  D "C5'" 
2441 C "C4'" . DT  C 14  ? 1.0684 1.0292 0.5871 0.1852  0.0144  0.0842  14  DT  D "C4'" 
2442 O "O4'" . DT  C 14  ? 1.0260 0.9657 0.5691 0.1740  -0.0003 0.0961  14  DT  D "O4'" 
2443 C "C3'" . DT  C 14  ? 1.1073 1.0718 0.5669 0.1954  0.0126  0.0917  14  DT  D "C3'" 
2444 O "O3'" . DT  C 14  ? 1.1387 1.0897 0.5593 0.2045  -0.0064 0.0633  14  DT  D "O3'" 
2445 C "C2'" . DT  C 14  ? 1.0850 1.0393 0.5499 0.1882  -0.0006 0.1178  14  DT  D "C2'" 
2446 C "C1'" . DT  C 14  ? 1.0215 0.9589 0.5345 0.1794  -0.0144 0.1087  14  DT  D "C1'" 
2447 N N1    . DT  C 14  ? 0.9657 0.8874 0.5033 0.1745  -0.0133 0.1350  14  DT  D N1    
2448 C C2    . DT  C 14  ? 0.9236 0.8378 0.4792 0.1761  -0.0331 0.1355  14  DT  D C2    
2449 O O2    . DT  C 14  ? 0.9004 0.8222 0.4538 0.1760  -0.0550 0.1176  14  DT  D O2    
2450 N N3    . DT  C 14  ? 0.9211 0.8155 0.4964 0.1778  -0.0244 0.1593  14  DT  D N3    
2451 C C4    . DT  C 14  ? 0.9365 0.8071 0.5095 0.1743  -0.0015 0.1800  14  DT  D C4    
2452 O O4    . DT  C 14  ? 0.9389 0.7801 0.5218 0.1793  0.0052  0.1981  14  DT  D O4    
2453 C C5    . DT  C 14  ? 0.9645 0.8464 0.5210 0.1655  0.0147  0.1798  14  DT  D C5    
2454 C C7    . DT  C 14  ? 1.0001 0.8581 0.5523 0.1541  0.0381  0.2049  14  DT  D C7    
2455 C C6    . DT  C 14  ? 0.9660 0.8778 0.5090 0.1680  0.0097  0.1584  14  DT  D C6    
2456 P P     . DC  C 15  ? 1.2241 1.1732 0.5646 0.2172  -0.0053 0.0577  15  DC  D P     
2457 O OP1   . DC  C 15  ? 1.2737 1.1985 0.5796 0.2285  -0.0110 0.0203  15  DC  D OP1   
2458 O OP2   . DC  C 15  ? 1.2490 1.2230 0.5773 0.2225  0.0271  0.0832  15  DC  D OP2   
2459 O "O5'" . DC  C 15  ? 1.2130 1.1555 0.5331 0.2070  -0.0396 0.0708  15  DC  D "O5'" 
2460 C "C5'" . DC  C 15  ? 1.1523 1.0813 0.4934 0.1958  -0.0729 0.0575  15  DC  D "C5'" 
2461 C "C4'" . DC  C 15  ? 1.1154 1.0596 0.4638 0.1877  -0.0977 0.0852  15  DC  D "C4'" 
2462 O "O4'" . DC  C 15  ? 1.0507 1.0048 0.4575 0.1883  -0.0822 0.1133  15  DC  D "O4'" 
2463 C "C3'" . DC  C 15  ? 1.1720 1.1269 0.4576 0.1922  -0.1037 0.1034  15  DC  D "C3'" 
2464 O "O3'" . DC  C 15  ? 1.2022 1.1648 0.4709 0.1810  -0.1451 0.1069  15  DC  D "O3'" 
2465 C "C2'" . DC  C 15  ? 1.1375 1.1082 0.4542 0.1983  -0.0817 0.1433  15  DC  D "C2'" 
2466 C "C1'" . DC  C 15  ? 1.0606 1.0295 0.4515 0.1932  -0.0855 0.1475  15  DC  D "C1'" 
2467 N N1    . DC  C 15  ? 1.0092 0.9720 0.4388 0.1969  -0.0594 0.1752  15  DC  D N1    
2468 C C2    . DC  C 15  ? 0.9518 0.9113 0.4290 0.1988  -0.0657 0.1923  15  DC  D C2    
2469 O O2    . DC  C 15  ? 0.9150 0.8887 0.4100 0.1965  -0.0918 0.1869  15  DC  D O2    
2470 N N3    . DC  C 15  ? 0.9522 0.8897 0.4519 0.2024  -0.0413 0.2147  15  DC  D N3    
2471 C C4    . DC  C 15  ? 0.9880 0.9129 0.4687 0.1987  -0.0156 0.2234  15  DC  D C4    
2472 N N4    . DC  C 15  ? 1.0005 0.8939 0.4959 0.1980  0.0048  0.2465  15  DC  D N4    
2473 C C5    . DC  C 15  ? 1.0177 0.9596 0.4595 0.1960  -0.0081 0.2106  15  DC  D C5    
2474 C C6    . DC  C 15  ? 1.0282 0.9863 0.4424 0.1982  -0.0290 0.1861  15  DC  D C6    
2475 P P     . DA  C 16  ? 0.7952 0.9028 0.4759 0.2121  0.0355  0.1808  16  DA  D P     
2476 O OP1   . DA  C 16  ? 0.8849 0.9836 0.5269 0.2856  0.0771  0.2131  16  DA  D OP1   
2477 O OP2   . DA  C 16  ? 0.7877 0.9321 0.4779 0.2060  0.0356  0.1904  16  DA  D OP2   
2478 O "O5'" . DA  C 16  ? 0.7780 0.7422 0.4290 0.1746  0.0207  0.1278  16  DA  D "O5'" 
2479 C "C5'" . DA  C 16  ? 0.7727 0.6865 0.4149 0.1675  0.0162  0.1094  16  DA  D "C5'" 
2480 C "C4'" . DA  C 16  ? 0.7284 0.5923 0.3919 0.1070  -0.0164 0.0701  16  DA  D "C4'" 
2481 O "O4'" . DA  C 16  ? 0.6579 0.6052 0.3763 0.0637  -0.0421 0.0733  16  DA  D "O4'" 
2482 C "C3'" . DA  C 16  ? 0.7402 0.5342 0.3830 0.0860  -0.0224 0.0484  16  DA  D "C3'" 
2483 O "O3'" . DA  C 16  ? 0.7599 0.4853 0.3983 0.0549  -0.0367 0.0194  16  DA  D "O3'" 
2484 C "C2'" . DA  C 16  ? 0.6681 0.5346 0.3582 0.0559  -0.0423 0.0557  16  DA  D "C2'" 
2485 C "C1'" . DA  C 16  ? 0.6294 0.5546 0.3596 0.0293  -0.0568 0.0580  16  DA  D "C1'" 
2486 N N9    . DA  C 16  ? 0.5949 0.6111 0.3555 0.0008  -0.0661 0.0742  16  DA  D N9    
2487 C C8    . DA  C 16  ? 0.6042 0.7002 0.3707 0.0150  -0.0587 0.1012  16  DA  D C8    
2488 N N7    . DA  C 16  ? 0.5868 0.7608 0.3754 -0.0294 -0.0702 0.1102  16  DA  D N7    
2489 C C5    . DA  C 16  ? 0.5608 0.6926 0.3505 -0.0724 -0.0819 0.0876  16  DA  D C5    
2490 C C6    . DA  C 16  ? 0.5631 0.7177 0.3515 -0.1368 -0.0902 0.0818  16  DA  D C6    
2491 N N6    . DA  C 16  ? 0.5675 0.8140 0.3561 -0.1770 -0.0931 0.0995  16  DA  D N6    
2492 N N1    . DA  C 16  ? 0.5789 0.6572 0.3567 -0.1623 -0.0917 0.0583  16  DA  D N1    
2493 C C2    . DA  C 16  ? 0.5638 0.5669 0.3432 -0.1271 -0.0899 0.0434  16  DA  D C2    
2494 N N3    . DA  C 16  ? 0.5640 0.5446 0.3425 -0.0748 -0.0854 0.0455  16  DA  D N3    
2495 C C4    . DA  C 16  ? 0.5644 0.6024 0.3433 -0.0502 -0.0798 0.0666  16  DA  D C4    
2496 C C1    . ORP C 17  ? 1.0961 0.5168 0.4267 0.0282  0.0248  -0.0118 17  ORP D C1    
2497 O O1    . ORP C 17  ? 1.1650 0.5664 0.4510 0.0673  0.0593  0.0057  17  ORP D O1    
2498 C C2    . ORP C 17  ? 0.9840 0.4810 0.3912 -0.0103 -0.0198 -0.0119 17  ORP D C2    
2499 C C3    . ORP C 17  ? 0.8643 0.4511 0.3680 0.0066  -0.0362 0.0007  17  ORP D C3    
2500 O O3    . ORP C 17  ? 0.8617 0.5032 0.3929 0.0208  -0.0356 0.0184  17  ORP D O3    
2501 C C4    . ORP C 17  ? 0.8706 0.4467 0.3611 0.0445  -0.0115 0.0060  17  ORP D C4    
2502 O O4    . ORP C 17  ? 1.0040 0.4763 0.3938 0.0561  0.0227  -0.0029 17  ORP D O4    
2503 C C5    . ORP C 17  ? 0.8296 0.4278 0.3696 0.0298  -0.0303 -0.0030 17  ORP D C5    
2504 O O5    . ORP C 17  ? 0.9337 0.5119 0.4478 0.0647  -0.0055 0.0022  17  ORP D O5    
2505 P P     . ORP C 17  ? 0.8771 0.4951 0.4422 0.0631  -0.0177 0.0014  17  ORP D P     
2506 O O1P   . ORP C 17  ? 0.9371 0.5332 0.4601 0.1098  0.0149  0.0148  17  ORP D O1P   
2507 O O2P   . ORP C 17  ? 0.8409 0.4356 0.4294 0.0206  -0.0418 -0.0210 17  ORP D O2P   
2508 P P     . DG  C 18  ? 0.8053 0.5411 0.4060 0.0290  -0.0441 0.0370  18  DG  D P     
2509 O OP1   . DG  C 18  ? 0.8427 0.6084 0.4326 0.0478  -0.0298 0.0548  18  DG  D OP1   
2510 O OP2   . DG  C 18  ? 0.7634 0.5403 0.4007 0.0368  -0.0453 0.0411  18  DG  D OP2   
2511 O "O5'" . DG  C 18  ? 0.7558 0.4959 0.3927 -0.0117 -0.0737 0.0278  18  DG  D "O5'" 
2512 C "C5'" . DG  C 18  ? 0.7249 0.4653 0.3543 -0.0251 -0.0813 0.0323  18  DG  D "C5'" 
2513 C "C4'" . DG  C 18  ? 0.6494 0.4223 0.3312 -0.0462 -0.0989 0.0381  18  DG  D "C4'" 
2514 O "O4'" . DG  C 18  ? 0.6039 0.4210 0.3147 -0.0461 -0.0932 0.0464  18  DG  D "O4'" 
2515 C "C3'" . DG  C 18  ? 0.6401 0.4126 0.3145 -0.0587 -0.1084 0.0466  18  DG  D "C3'" 
2516 O "O3'" . DG  C 18  ? 0.6119 0.3950 0.3236 -0.0702 -0.1192 0.0550  18  DG  D "O3'" 
2517 C "C2'" . DG  C 18  ? 0.6217 0.4221 0.2988 -0.0514 -0.0986 0.0560  18  DG  D "C2'" 
2518 C "C1'" . DG  C 18  ? 0.6130 0.4448 0.3244 -0.0541 -0.0936 0.0563  18  DG  D "C1'" 
2519 N N9    . DG  C 18  ? 0.6049 0.4856 0.3167 -0.0475 -0.0821 0.0658  18  DG  D N9    
2520 C C8    . DG  C 18  ? 0.6260 0.5236 0.3158 -0.0184 -0.0676 0.0734  18  DG  D C8    
2521 N N7    . DG  C 18  ? 0.6307 0.6002 0.3373 -0.0157 -0.0591 0.0898  18  DG  D N7    
2522 C C5    . DG  C 18  ? 0.5972 0.5878 0.3293 -0.0555 -0.0697 0.0865  18  DG  D C5    
2523 C C6    . DG  C 18  ? 0.5966 0.6609 0.3440 -0.0853 -0.0677 0.0979  18  DG  D C6    
2524 O O6    . DG  C 18  ? 0.6074 0.7583 0.3632 -0.0781 -0.0602 0.1188  18  DG  D O6    
2525 N N1    . DG  C 18  ? 0.5916 0.6217 0.3366 -0.1295 -0.0712 0.0863  18  DG  D N1    
2526 C C2    . DG  C 18  ? 0.5846 0.5307 0.3247 -0.1306 -0.0739 0.0727  18  DG  D C2    
2527 N N2    . DG  C 18  ? 0.5981 0.5048 0.3247 -0.1668 -0.0651 0.0675  18  DG  D N2    
2528 N N3    . DG  C 18  ? 0.5634 0.4677 0.3041 -0.1002 -0.0807 0.0680  18  DG  D N3    
2529 C C4    . DG  C 18  ? 0.5805 0.5062 0.3129 -0.0699 -0.0796 0.0721  18  DG  D C4    
2530 P P     . DT  C 19  ? 0.6325 0.4294 0.3466 -0.0785 -0.1305 0.0736  19  DT  D P     
2531 O OP1   . DT  C 19  ? 0.6612 0.4722 0.4034 -0.0822 -0.1392 0.0847  19  DT  D OP1   
2532 O OP2   . DT  C 19  ? 0.6523 0.4403 0.3176 -0.0861 -0.1345 0.0712  19  DT  D OP2   
2533 O "O5'" . DT  C 19  ? 0.6180 0.4208 0.3511 -0.0736 -0.1187 0.0855  19  DT  D "O5'" 
2534 C "C5'" . DT  C 19  ? 0.6055 0.3953 0.3629 -0.0737 -0.1053 0.0875  19  DT  D "C5'" 
2535 C "C4'" . DT  C 19  ? 0.6419 0.4231 0.3889 -0.0819 -0.0891 0.0918  19  DT  D "C4'" 
2536 O "O4'" . DT  C 19  ? 0.6264 0.4330 0.3608 -0.0886 -0.0893 0.0801  19  DT  D "O4'" 
2537 C "C3'" . DT  C 19  ? 0.6784 0.4576 0.4151 -0.0761 -0.0869 0.1119  19  DT  D "C3'" 
2538 O "O3'" . DT  C 19  ? 0.7443 0.4854 0.4800 -0.0728 -0.0637 0.1270  19  DT  D "O3'" 
2539 C "C2'" . DT  C 19  ? 0.6710 0.4643 0.3861 -0.0868 -0.0839 0.1045  19  DT  D "C2'" 
2540 C "C1'" . DT  C 19  ? 0.6614 0.4718 0.3812 -0.0986 -0.0798 0.0879  19  DT  D "C1'" 
2541 N N1    . DT  C 19  ? 0.6384 0.4925 0.3492 -0.0964 -0.0807 0.0846  19  DT  D N1    
2542 C C2    . DT  C 19  ? 0.6223 0.5130 0.3317 -0.1180 -0.0704 0.0859  19  DT  D C2    
2543 O O2    . DT  C 19  ? 0.6369 0.5102 0.3378 -0.1478 -0.0596 0.0848  19  DT  D O2    
2544 N N3    . DT  C 19  ? 0.6046 0.5524 0.3145 -0.1054 -0.0688 0.0916  19  DT  D N3    
2545 C C4    . DT  C 19  ? 0.6161 0.5629 0.3152 -0.0707 -0.0689 0.0934  19  DT  D C4    
2546 O O4    . DT  C 19  ? 0.6397 0.6362 0.3362 -0.0532 -0.0577 0.1050  19  DT  D O4    
2547 C C5    . DT  C 19  ? 0.6262 0.5129 0.3110 -0.0603 -0.0784 0.0846  19  DT  D C5    
2548 C C7    . DT  C 19  ? 0.6727 0.5296 0.3184 -0.0369 -0.0732 0.0819  19  DT  D C7    
2549 C C6    . DT  C 19  ? 0.6207 0.4779 0.3188 -0.0748 -0.0874 0.0821  19  DT  D C6    
2550 P P     . DA  C 20  ? 0.8113 0.5377 0.5375 -0.0544 -0.0502 0.1593  20  DA  D P     
2551 O OP1   . DA  C 20  ? 0.8474 0.5291 0.5764 -0.0358 -0.0210 0.1792  20  DA  D OP1   
2552 O OP2   . DA  C 20  ? 0.7812 0.5596 0.5159 -0.0459 -0.0774 0.1724  20  DA  D OP2   
2553 O "O5'" . DA  C 20  ? 0.8368 0.5340 0.5253 -0.0759 -0.0323 0.1504  20  DA  D "O5'" 
2554 C "C5'" . DA  C 20  ? 0.8739 0.5174 0.5321 -0.1017 -0.0032 0.1384  20  DA  D "C5'" 
2555 C "C4'" . DA  C 20  ? 0.8853 0.5280 0.5091 -0.1330 0.0052  0.1292  20  DA  D "C4'" 
2556 O "O4'" . DA  C 20  ? 0.8131 0.5303 0.4589 -0.1423 -0.0221 0.1140  20  DA  D "O4'" 
2557 C "C3'" . DA  C 20  ? 0.9264 0.5525 0.5299 -0.1185 0.0140  0.1493  20  DA  D "C3'" 
2558 O "O3'" . DA  C 20  ? 1.0388 0.5947 0.5848 -0.1466 0.0515  0.1484  20  DA  D "O3'" 
2559 C "C2'" . DA  C 20  ? 0.8716 0.5673 0.4900 -0.1226 -0.0145 0.1407  20  DA  D "C2'" 
2560 C "C1'" . DA  C 20  ? 0.8309 0.5684 0.4613 -0.1475 -0.0229 0.1185  20  DA  D "C1'" 
2561 N N9    . DA  C 20  ? 0.7718 0.5730 0.4245 -0.1335 -0.0466 0.1131  20  DA  D N9    
2562 C C8    . DA  C 20  ? 0.7378 0.5484 0.4033 -0.1062 -0.0657 0.1156  20  DA  D C8    
2563 N N7    . DA  C 20  ? 0.7300 0.5753 0.3948 -0.0983 -0.0732 0.1086  20  DA  D N7    
2564 C C5    . DA  C 20  ? 0.7183 0.6011 0.3840 -0.1157 -0.0616 0.1067  20  DA  D C5    
2565 C C6    . DA  C 20  ? 0.7163 0.6584 0.3848 -0.1087 -0.0574 0.1096  20  DA  D C6    
2566 N N6    . DA  C 20  ? 0.7456 0.6909 0.4044 -0.0769 -0.0576 0.1110  20  DA  D N6    
2567 N N1    . DA  C 20  ? 0.6990 0.6964 0.3726 -0.1365 -0.0482 0.1148  20  DA  D N1    
2568 C C2    . DA  C 20  ? 0.7391 0.7095 0.3984 -0.1771 -0.0406 0.1107  20  DA  D C2    
2569 N N3    . DA  C 20  ? 0.7751 0.6648 0.4191 -0.1825 -0.0358 0.1057  20  DA  D N3    
2570 C C4    . DA  C 20  ? 0.7464 0.6056 0.4024 -0.1454 -0.0482 0.1072  20  DA  D C4    
2571 P P     . DC  C 21  ? 1.1395 0.6302 0.6419 -0.1285 0.0827  0.1742  21  DC  D P     
2572 O OP1   . DC  C 21  ? 1.2391 0.6214 0.6921 -0.1223 0.1327  0.1861  21  DC  D OP1   
2573 O OP2   . DC  C 21  ? 1.0840 0.6329 0.6259 -0.0866 0.0546  0.1974  21  DC  D OP2   
2574 O "O5'" . DC  C 21  ? 1.1955 0.6844 0.6534 -0.1791 0.0911  0.1565  21  DC  D "O5'" 
2575 C "C5'" . DC  C 21  ? 1.1846 0.7127 0.6368 -0.2335 0.0840  0.1297  21  DC  D "C5'" 
2576 C "C4'" . DC  C 21  ? 1.1596 0.7641 0.6183 -0.2568 0.0666  0.1239  21  DC  D "C4'" 
2577 O "O4'" . DC  C 21  ? 1.0561 0.7617 0.5793 -0.2329 0.0278  0.1206  21  DC  D "O4'" 
2578 C "C3'" . DC  C 21  ? 1.1942 0.7755 0.6326 -0.2378 0.0741  0.1393  21  DC  D "C3'" 
2579 O "O3'" . DC  C 21  ? 1.2583 0.8509 0.6570 -0.2876 0.0875  0.1311  21  DC  D "O3'" 
2580 C "C2'" . DC  C 21  ? 1.1029 0.7650 0.6005 -0.1966 0.0351  0.1448  21  DC  D "C2'" 
2581 C "C1'" . DC  C 21  ? 1.0294 0.7704 0.5602 -0.2151 0.0167  0.1287  21  DC  D "C1'" 
2582 N N1    . DC  C 21  ? 0.9279 0.7280 0.5043 -0.1775 -0.0129 0.1290  21  DC  D N1    
2583 C C2    . DC  C 21  ? 0.8804 0.7594 0.4753 -0.1806 -0.0214 0.1255  21  DC  D C2    
2584 O O2    . DC  C 21  ? 0.8840 0.8074 0.4710 -0.2175 -0.0111 0.1247  21  DC  D O2    
2585 N N3    . DC  C 21  ? 0.8404 0.7453 0.4549 -0.1446 -0.0367 0.1261  21  DC  D N3    
2586 C C4    . DC  C 21  ? 0.8328 0.6963 0.4464 -0.1200 -0.0492 0.1269  21  DC  D C4    
2587 N N4    . DC  C 21  ? 0.8147 0.6879 0.4262 -0.0966 -0.0586 0.1242  21  DC  D N4    
2588 C C5    . DC  C 21  ? 0.8606 0.6723 0.4686 -0.1194 -0.0480 0.1346  21  DC  D C5    
2589 C C6    . DC  C 21  ? 0.9035 0.6808 0.4931 -0.1415 -0.0268 0.1374  21  DC  D C6    
2590 P P     . DA  C 22  ? 1.3597 0.8621 0.6854 -0.3010 0.1245  0.1403  22  DA  D P     
2591 O OP1   . DA  C 22  ? 1.4841 0.8609 0.7334 -0.3269 0.1718  0.1377  22  DA  D OP1   
2592 O OP2   . DA  C 22  ? 1.3131 0.8210 0.6644 -0.2432 0.1107  0.1613  22  DA  D OP2   
2593 O "O5'" . DA  C 22  ? 1.3592 0.9313 0.6680 -0.3613 0.1222  0.1283  22  DA  D "O5'" 
2594 C "C5'" . DA  C 22  ? 1.3399 0.9855 0.6546 -0.4177 0.1146  0.1141  22  DA  D "C5'" 
2595 C "C4'" . DA  C 22  ? 1.2699 1.0565 0.6307 -0.4273 0.0897  0.1189  22  DA  D "C4'" 
2596 O "O4'" . DA  C 22  ? 1.1542 1.0123 0.5928 -0.3621 0.0569  0.1264  22  DA  D "O4'" 
2597 C "C3'" . DA  C 22  ? 1.3138 1.0965 0.6474 -0.4333 0.1009  0.1261  22  DA  D "C3'" 
2598 O "O3'" . DA  C 22  ? 1.3476 1.2345 0.6767 -0.4928 0.1013  0.1276  22  DA  D "O3'" 
2599 C "C2'" . DA  C 22  ? 1.2173 1.0338 0.6094 -0.3572 0.0753  0.1379  22  DA  D "C2'" 
2600 C "C1'" . DA  C 22  ? 1.1239 1.0170 0.5793 -0.3296 0.0491  0.1371  22  DA  D "C1'" 
2601 N N9    . DA  C 22  ? 1.0518 0.9222 0.5409 -0.2646 0.0299  0.1410  22  DA  D N9    
2602 C C8    . DA  C 22  ? 1.0645 0.8497 0.5432 -0.2364 0.0304  0.1435  22  DA  D C8    
2603 N N7    . DA  C 22  ? 1.0117 0.8108 0.5234 -0.1923 0.0078  0.1471  22  DA  D N7    
2604 C C5    . DA  C 22  ? 0.9521 0.8291 0.4887 -0.1861 -0.0024 0.1447  22  DA  D C5    
2605 C C6    . DA  C 22  ? 0.9038 0.8078 0.4601 -0.1496 -0.0173 0.1452  22  DA  D C6    
2606 N N6    . DA  C 22  ? 0.8948 0.7584 0.4486 -0.1245 -0.0318 0.1451  22  DA  D N6    
2607 N N1    . DA  C 22  ? 0.8884 0.8627 0.4585 -0.1417 -0.0122 0.1494  22  DA  D N1    
2608 C C2    . DA  C 22  ? 0.8988 0.9383 0.4737 -0.1725 0.0002  0.1560  22  DA  D C2    
2609 N N3    . DA  C 22  ? 0.9274 0.9572 0.4832 -0.2217 0.0095  0.1527  22  DA  D N3    
2610 C C4    . DA  C 22  ? 0.9685 0.9012 0.4994 -0.2245 0.0107  0.1450  22  DA  D C4    
2611 P P     . DG  C 23  ? 1.4448 1.3206 0.7196 -0.5352 0.1236  0.1303  23  DG  D P     
2612 O OP1   . DG  C 23  ? 1.5147 1.4515 0.7455 -0.6341 0.1361  0.1250  23  DG  D OP1   
2613 O OP2   . DG  C 23  ? 1.5190 1.2387 0.7360 -0.5093 0.1488  0.1282  23  DG  D OP2   
2614 O "O5'" . DG  C 23  ? 1.3533 1.3469 0.6990 -0.4826 0.1005  0.1483  23  DG  D "O5'" 
2615 C "C5'" . DG  C 23  ? 1.2606 1.4024 0.6774 -0.4652 0.0787  0.1622  23  DG  D "C5'" 
2616 C "C4'" . DG  C 23  ? 1.1867 1.3669 0.6509 -0.3886 0.0678  0.1770  23  DG  D "C4'" 
2617 O "O4'" . DG  C 23  ? 1.1316 1.2301 0.6112 -0.3276 0.0541  0.1692  23  DG  D "O4'" 
2618 C "C3'" . DG  C 23  ? 1.2297 1.3757 0.6630 -0.3836 0.0813  0.1814  23  DG  D "C3'" 
2619 O "O3'" . DG  C 23  ? 1.2203 1.4737 0.6937 -0.3486 0.0811  0.2030  23  DG  D "O3'" 
2620 C "C2'" . DG  C 23  ? 1.2121 1.2304 0.6298 -0.3323 0.0753  0.1725  23  DG  D "C2'" 
2621 C "C1'" . DG  C 23  ? 1.1237 1.1720 0.5910 -0.2874 0.0551  0.1728  23  DG  D "C1'" 
2622 N N9    . DG  C 23  ? 1.0678 1.0237 0.5317 -0.2489 0.0428  0.1655  23  DG  D N9    
2623 C C8    . DG  C 23  ? 1.0951 0.9518 0.5264 -0.2550 0.0485  0.1607  23  DG  D C8    
2624 N N7    . DG  C 23  ? 1.0636 0.8812 0.5085 -0.2138 0.0326  0.1628  23  DG  D N7    
2625 C C5    . DG  C 23  ? 1.0075 0.8837 0.4837 -0.1853 0.0172  0.1630  23  DG  D C5    
2626 C C6    . DG  C 23  ? 0.9791 0.8410 0.4663 -0.1484 -0.0010 0.1625  23  DG  D C6    
2627 O O6    . DG  C 23  ? 0.9903 0.8075 0.4754 -0.1353 -0.0137 0.1646  23  DG  D O6    
2628 N N1    . DG  C 23  ? 0.9455 0.8545 0.4424 -0.1276 0.0002  0.1629  23  DG  D N1    
2629 C C2    . DG  C 23  ? 0.9213 0.9032 0.4296 -0.1322 0.0164  0.1708  23  DG  D C2    
2630 N N2    . DG  C 23  ? 0.8913 0.9057 0.4037 -0.0973 0.0251  0.1780  23  DG  D N2    
2631 N N3    . DG  C 23  ? 0.9397 0.9611 0.4495 -0.1701 0.0272  0.1747  23  DG  D N3    
2632 C C4    . DG  C 23  ? 0.9948 0.9516 0.4829 -0.1996 0.0268  0.1667  23  DG  D C4    
2633 P P     . DA  C 24  ? 1.2698 1.5706 0.7237 -0.3710 0.0994  0.2164  24  DA  D P     
2634 O OP1   . DA  C 24  ? 1.2924 1.7241 0.7534 -0.4418 0.1054  0.2292  24  DA  D OP1   
2635 O OP2   . DA  C 24  ? 1.3229 1.4861 0.7181 -0.3760 0.1082  0.2009  24  DA  D OP2   
2636 O "O5'" . DA  C 24  ? 1.2211 1.5807 0.7141 -0.2944 0.1028  0.2389  24  DA  D "O5'" 
2637 C "C5'" . DA  C 24  ? 1.1557 1.5931 0.6982 -0.2475 0.0985  0.2554  24  DA  D "C5'" 
2638 C "C4'" . DA  C 24  ? 1.1369 1.5005 0.6708 -0.1708 0.1037  0.2559  24  DA  D "C4'" 
2639 O "O4'" . DA  C 24  ? 1.1154 1.3512 0.6266 -0.1639 0.0839  0.2280  24  DA  D "O4'" 
2640 C "C3'" . DA  C 24  ? 1.1823 1.5072 0.6812 -0.1494 0.1230  0.2624  24  DA  D "C3'" 
2641 O "O3'" . DA  C 24  ? 1.2175 1.5672 0.7204 -0.0826 0.1466  0.2848  24  DA  D "O3'" 
2642 C "C2'" . DA  C 24  ? 1.1820 1.3561 0.6336 -0.1524 0.1073  0.2341  24  DA  D "C2'" 
2643 C "C1'" . DA  C 24  ? 1.1330 1.2716 0.6013 -0.1383 0.0869  0.2208  24  DA  D "C1'" 
2644 N N9    . DA  C 24  ? 1.1072 1.1442 0.5520 -0.1559 0.0670  0.2004  24  DA  D N9    
2645 C C8    . DA  C 24  ? 1.1134 1.1172 0.5435 -0.2000 0.0649  0.1923  24  DA  D C8    
2646 N N7    . DA  C 24  ? 1.1115 1.0303 0.5258 -0.1939 0.0517  0.1835  24  DA  D N7    
2647 C C5    . DA  C 24  ? 1.0861 0.9916 0.5080 -0.1536 0.0382  0.1825  24  DA  D C5    
2648 C C6    . DA  C 24  ? 1.0766 0.9236 0.4906 -0.1353 0.0186  0.1783  24  DA  D C6    
2649 N N6    . DA  C 24  ? 1.0863 0.8856 0.4940 -0.1433 0.0106  0.1805  24  DA  D N6    
2650 N N1    . DA  C 24  ? 1.0679 0.9076 0.4734 -0.1089 0.0124  0.1756  24  DA  D N1    
2651 C C2    . DA  C 24  ? 1.0735 0.9494 0.4771 -0.0901 0.0310  0.1793  24  DA  D C2    
2652 N N3    . DA  C 24  ? 1.0799 1.0239 0.5012 -0.0928 0.0515  0.1901  24  DA  D N3    
2653 C C4    . DA  C 24  ? 1.0856 1.0483 0.5176 -0.1305 0.0505  0.1902  24  DA  D C4    
2654 P P     . DG  C 25  ? 1.2978 1.6313 0.7653 -0.0493 0.1795  0.3016  25  DG  D P     
2655 O OP1   . DG  C 25  ? 1.3133 1.7486 0.8081 0.0090  0.2146  0.3424  25  DG  D OP1   
2656 O OP2   . DG  C 25  ? 1.3246 1.6671 0.7787 -0.1027 0.1770  0.2966  25  DG  D OP2   
2657 O "O5'" . DG  C 25  ? 1.3199 1.4862 0.7215 -0.0226 0.1753  0.2758  25  DG  D "O5'" 
2658 C "C5'" . DG  C 25  ? 1.2880 1.3975 0.6805 0.0064  0.1683  0.2651  25  DG  D "C5'" 
2659 C "C4'" . DG  C 25  ? 1.3010 1.2674 0.6272 0.0019  0.1543  0.2386  25  DG  D "C4'" 
2660 O "O4'" . DG  C 25  ? 1.2394 1.1787 0.5811 -0.0417 0.1145  0.2180  25  DG  D "O4'" 
2661 C "C3'" . DG  C 25  ? 1.3685 1.2659 0.6293 0.0042  0.1728  0.2390  25  DG  D "C3'" 
2662 O "O3'" . DG  C 25  ? 1.4586 1.2508 0.6433 0.0317  0.1918  0.2319  25  DG  D "O3'" 
2663 C "C2'" . DG  C 25  ? 1.3294 1.1868 0.5842 -0.0436 0.1374  0.2215  25  DG  D "C2'" 
2664 C "C1'" . DG  C 25  ? 1.2591 1.1125 0.5468 -0.0561 0.1053  0.2078  25  DG  D "C1'" 
2665 N N9    . DG  C 25  ? 1.1812 1.0276 0.4875 -0.0928 0.0788  0.2005  25  DG  D N9    
2666 C C8    . DG  C 25  ? 1.1446 1.0383 0.4787 -0.1225 0.0818  0.2042  25  DG  D C8    
2667 N N7    . DG  C 25  ? 1.1293 0.9830 0.4622 -0.1452 0.0652  0.1976  25  DG  D N7    
2668 C C5    . DG  C 25  ? 1.1206 0.9202 0.4379 -0.1277 0.0450  0.1934  25  DG  D C5    
2669 C C6    . DG  C 25  ? 1.1121 0.8674 0.4251 -0.1323 0.0245  0.1949  25  DG  D C6    
2670 O O6    . DG  C 25  ? 1.1251 0.8623 0.4425 -0.1459 0.0265  0.1997  25  DG  D O6    
2671 N N1    . DG  C 25  ? 1.0982 0.8293 0.3943 -0.1191 0.0052  0.1939  25  DG  D N1    
2672 C C2    . DG  C 25  ? 1.1195 0.8413 0.3877 -0.1071 0.0108  0.1867  25  DG  D C2    
2673 N N2    . DG  C 25  ? 1.1349 0.8241 0.3722 -0.1100 -0.0078 0.1838  25  DG  D N2    
2674 N N3    . DG  C 25  ? 1.1449 0.8873 0.4088 -0.0935 0.0378  0.1858  25  DG  D N3    
2675 C C4    . DG  C 25  ? 1.1421 0.9351 0.4393 -0.1027 0.0512  0.1918  25  DG  D C4    
2676 P P     . DC  C 26  ? 1.5745 1.2660 0.6628 0.0367  0.2198  0.2305  26  DC  D P     
2677 O OP1   . DC  C 26  ? 1.6676 1.2838 0.6848 0.0811  0.2668  0.2363  26  DC  D OP1   
2678 O OP2   . DC  C 26  ? 1.5664 1.3150 0.6754 0.0298  0.2315  0.2455  26  DC  D OP2   
2679 O "O5'" . DC  C 26  ? 1.5579 1.1685 0.6046 -0.0108 0.1756  0.2052  26  DC  D "O5'" 
2680 C "C5'" . DC  C 26  ? 1.5177 1.0922 0.5562 -0.0225 0.1503  0.1896  26  DC  D "C5'" 
2681 C "C4'" . DC  C 26  ? 1.4968 1.0324 0.5080 -0.0674 0.1082  0.1782  26  DC  D "C4'" 
2682 O "O4'" . DC  C 26  ? 1.3933 0.9991 0.4841 -0.0824 0.0759  0.1833  26  DC  D "O4'" 
2683 C "C3'" . DC  C 26  ? 1.5749 1.0463 0.5043 -0.0869 0.1163  0.1788  26  DC  D "C3'" 
2684 O "O3'" . DC  C 26  ? 1.6649 1.0569 0.5072 -0.1180 0.1046  0.1667  26  DC  D "O3'" 
2685 C "C2'" . DC  C 26  ? 1.5071 1.0298 0.4866 -0.1067 0.0863  0.1878  26  DC  D "C2'" 
2686 C "C1'" . DC  C 26  ? 1.4135 0.9959 0.4752 -0.1082 0.0565  0.1875  26  DC  D "C1'" 
2687 N N1    . DC  C 26  ? 1.3443 0.9804 0.4687 -0.1136 0.0482  0.1969  26  DC  D N1    
2688 C C2    . DC  C 26  ? 1.3276 0.9681 0.4726 -0.1276 0.0189  0.2046  26  DC  D C2    
2689 O O2    . DC  C 26  ? 1.3478 0.9719 0.4707 -0.1367 -0.0058 0.2078  26  DC  D O2    
2690 N N3    . DC  C 26  ? 1.2945 0.9570 0.4767 -0.1318 0.0233  0.2117  26  DC  D N3    
2691 C C4    . DC  C 26  ? 1.2682 0.9597 0.4682 -0.1349 0.0482  0.2087  26  DC  D C4    
2692 N N4    . DC  C 26  ? 1.2549 0.9517 0.4712 -0.1514 0.0555  0.2126  26  DC  D N4    
2693 C C5    . DC  C 26  ? 1.2736 0.9892 0.4672 -0.1220 0.0715  0.2055  26  DC  D C5    
2694 C C6    . DC  C 26  ? 1.3116 0.9936 0.4682 -0.1054 0.0737  0.2009  26  DC  D C6    
2695 P P     . DT  C 27  ? 1.7995 1.0936 0.5158 -0.1461 0.1225  0.1626  27  DT  D P     
2696 O OP1   . DT  C 27  ? 1.9175 1.1135 0.5280 -0.1683 0.1383  0.1460  27  DT  D OP1   
2697 O OP2   . DT  C 27  ? 1.8221 1.1096 0.5304 -0.1158 0.1640  0.1725  27  DT  D OP2   
2698 O "O5'" . DT  C 27  ? 1.7734 1.1081 0.5041 -0.1890 0.0692  0.1714  27  DT  D "O5'" 
2699 C "C5'" . DT  C 27  ? 1.6906 1.0858 0.4775 -0.2071 0.0225  0.1763  27  DT  D "C5'" 
2700 C "C4'" . DT  C 27  ? 1.6501 1.1000 0.4664 -0.2243 -0.0143 0.1988  27  DT  D "C4'" 
2701 O "O4'" . DT  C 27  ? 1.5439 1.0511 0.4557 -0.1908 -0.0121 0.2093  27  DT  D "O4'" 
2702 C "C3'" . DT  C 27  ? 1.7312 1.1386 0.4660 -0.2480 -0.0085 0.2055  27  DT  D "C3'" 
2703 O "O3'" . DT  C 27  ? 1.7638 1.2144 0.4853 -0.2828 -0.0513 0.2279  27  DT  D "O3'" 
2704 C "C2'" . DT  C 27  ? 1.6667 1.0977 0.4581 -0.2136 0.0111  0.2136  27  DT  D "C2'" 
2705 C "C1'" . DT  C 27  ? 1.5446 1.0490 0.4397 -0.1941 -0.0101 0.2238  27  DT  D "C1'" 
2706 N N1    . DT  C 27  ? 1.4536 0.9858 0.4133 -0.1676 0.0109  0.2257  27  DT  D N1    
2707 C C2    . DT  C 27  ? 1.3948 0.9622 0.4073 -0.1612 -0.0026 0.2426  27  DT  D C2    
2708 O O2    . DT  C 27  ? 1.3969 0.9843 0.4165 -0.1649 -0.0295 0.2618  27  DT  D O2    
2709 N N3    . DT  C 27  ? 1.3489 0.9270 0.3975 -0.1516 0.0215  0.2399  27  DT  D N3    
2710 C C4    . DT  C 27  ? 1.3453 0.9311 0.3988 -0.1476 0.0512  0.2269  27  DT  D C4    
2711 O O4    . DT  C 27  ? 1.3046 0.9148 0.3905 -0.1512 0.0674  0.2272  27  DT  D O4    
2712 C C5    . DT  C 27  ? 1.4033 0.9655 0.4137 -0.1411 0.0653  0.2168  27  DT  D C5    
2713 C C7    . DT  C 27  ? 1.4145 0.9963 0.4300 -0.1243 0.1037  0.2138  27  DT  D C7    
2714 C C6    . DT  C 27  ? 1.4501 0.9725 0.4079 -0.1521 0.0475  0.2143  27  DT  D C6    
2715 P P     . DG  C 28  ? 1.8770 1.2861 0.4755 -0.3480 -0.0667 0.2263  28  DG  D P     
2716 O OP1   . DG  C 28  ? 1.9078 1.2976 0.4773 -0.3737 -0.0712 0.2083  28  DG  D OP1   
2717 O OP2   . DG  C 28  ? 1.9702 1.2901 0.4737 -0.3582 -0.0323 0.2150  28  DG  D OP2   
2718 O "O5'" . DG  C 28  ? 1.8716 1.3836 0.5052 -0.3654 -0.1160 0.2685  28  DG  D "O5'" 
2719 C "C5'" . DG  C 28  ? 1.7867 1.3972 0.5243 -0.3410 -0.1447 0.2933  28  DG  D "C5'" 
2720 C "C4'" . DG  C 28  ? 1.7485 1.4216 0.5506 -0.3037 -0.1534 0.3336  28  DG  D "C4'" 
2721 O "O4'" . DG  C 28  ? 1.6852 1.3211 0.5429 -0.2544 -0.1185 0.3190  28  DG  D "O4'" 
2722 C "C3'" . DG  C 28  ? 1.8266 1.5019 0.5635 -0.3264 -0.1620 0.3581  28  DG  D "C3'" 
2723 O "O3'" . DG  C 28  ? 1.8375 1.6198 0.6116 -0.3202 -0.1953 0.4131  28  DG  D "O3'" 
2724 C "C2'" . DG  C 28  ? 1.7993 1.4146 0.5506 -0.2864 -0.1240 0.3471  28  DG  D "C2'" 
2725 C "C1'" . DG  C 28  ? 1.6860 1.3158 0.5341 -0.2398 -0.1091 0.3404  28  DG  D "C1'" 
2726 N N9    . DG  C 28  ? 1.6289 1.2023 0.4918 -0.2153 -0.0694 0.3148  28  DG  D N9    
2727 C C8    . DG  C 28  ? 1.6406 1.1542 0.4612 -0.2235 -0.0416 0.2820  28  DG  D C8    
2728 N N7    . DG  C 28  ? 1.5990 1.0987 0.4532 -0.1996 -0.0108 0.2717  28  DG  D N7    
2729 C C5    . DG  C 28  ? 1.5555 1.0881 0.4650 -0.1805 -0.0162 0.2932  28  DG  D C5    
2730 C C6    . DG  C 28  ? 1.5183 1.0433 0.4636 -0.1641 0.0107  0.2919  28  DG  D C6    
2731 O O6    . DG  C 28  ? 1.5041 1.0149 0.4505 -0.1658 0.0389  0.2739  28  DG  D O6    
2732 N N1    . DG  C 28  ? 1.5134 1.0499 0.4867 -0.1470 0.0065  0.3186  28  DG  D N1    
2733 C C2    . DG  C 28  ? 1.5229 1.0958 0.5040 -0.1375 -0.0217 0.3501  28  DG  D C2    
2734 N N2    . DG  C 28  ? 1.5210 1.0946 0.5261 -0.1093 -0.0112 0.3800  28  DG  D N2    
2735 N N3    . DG  C 28  ? 1.5456 1.1524 0.5057 -0.1569 -0.0540 0.3545  28  DG  D N3    
2736 C C4    . DG  C 28  ? 1.5695 1.1438 0.4869 -0.1823 -0.0488 0.3218  28  DG  D C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   105 ?   ?   ?   A . n 
A 1 2   SER 2   106 ?   ?   ?   A . n 
A 1 3   HIS 3   107 ?   ?   ?   A . n 
A 1 4   MET 4   108 ?   ?   ?   A . n 
A 1 5   ALA 5   109 ?   ?   ?   A . n 
A 1 6   SER 6   110 ?   ?   ?   A . n 
A 1 7   PHE 7   111 111 PHE PHE A . n 
A 1 8   ASN 8   112 112 ASN ASN A . n 
A 1 9   GLY 9   113 113 GLY GLY A . n 
A 1 10  VAL 10  114 114 VAL VAL A . n 
A 1 11  SER 11  115 115 SER SER A . n 
A 1 12  GLU 12  116 116 GLU GLU A . n 
A 1 13  ALA 13  117 117 ALA ALA A . n 
A 1 14  GLU 14  118 118 GLU GLU A . n 
A 1 15  LEU 15  119 119 LEU LEU A . n 
A 1 16  LEU 16  120 120 LEU LEU A . n 
A 1 17  THR 17  121 121 THR THR A . n 
A 1 18  LYS 18  122 122 LYS LYS A . n 
A 1 19  THR 19  123 123 THR THR A . n 
A 1 20  LEU 20  124 124 LEU LEU A . n 
A 1 21  PRO 21  125 125 PRO PRO A . n 
A 1 22  ASP 22  126 126 ASP ASP A . n 
A 1 23  ILE 23  127 127 ILE ILE A . n 
A 1 24  LEU 24  128 128 LEU LEU A . n 
A 1 25  THR 25  129 129 THR THR A . n 
A 1 26  PHE 26  130 130 PHE PHE A . n 
A 1 27  ASN 27  131 131 ASN ASN A . n 
A 1 28  LEU 28  132 132 LEU LEU A . n 
A 1 29  ASP 29  133 133 ASP ASP A . n 
A 1 30  ILE 30  134 134 ILE ILE A . n 
A 1 31  VAL 31  135 135 VAL VAL A . n 
A 1 32  ILE 32  136 136 ILE ILE A . n 
A 1 33  ILE 33  137 137 ILE ILE A . n 
A 1 34  GLY 34  138 138 GLY GLY A . n 
A 1 35  ILE 35  139 139 ILE ILE A . n 
A 1 36  ASN 36  140 140 ASN ASN A . n 
A 1 37  PRO 37  141 141 PRO PRO A . n 
A 1 38  GLY 38  142 142 GLY GLY A . n 
A 1 39  LEU 39  143 143 LEU LEU A . n 
A 1 40  MET 40  144 144 MET MET A . n 
A 1 41  ALA 41  145 145 ALA ALA A . n 
A 1 42  ALA 42  146 146 ALA ALA A . n 
A 1 43  TYR 43  147 147 TYR TYR A . n 
A 1 44  LYS 44  148 148 LYS LYS A . n 
A 1 45  GLY 45  149 149 GLY GLY A . n 
A 1 46  HIS 46  150 150 HIS HIS A . n 
A 1 47  HIS 47  151 151 HIS HIS A . n 
A 1 48  TYR 48  152 152 TYR TYR A . n 
A 1 49  PRO 49  153 153 PRO PRO A . n 
A 1 50  GLY 50  154 154 GLY GLY A . n 
A 1 51  PRO 51  155 155 PRO PRO A . n 
A 1 52  GLY 52  156 156 GLY GLY A . n 
A 1 53  ASN 53  157 157 ASN ASN A . n 
A 1 54  HIS 54  158 158 HIS HIS A . n 
A 1 55  PHE 55  159 159 PHE PHE A . n 
A 1 56  TRP 56  160 160 TRP TRP A . n 
A 1 57  LYS 57  161 161 LYS LYS A . n 
A 1 58  CYS 58  162 162 CYS CYS A . n 
A 1 59  LEU 59  163 163 LEU LEU A . n 
A 1 60  PHE 60  164 164 PHE PHE A . n 
A 1 61  MET 61  165 165 MET MET A . n 
A 1 62  SER 62  166 166 SER SER A . n 
A 1 63  GLY 63  167 167 GLY GLY A . n 
A 1 64  LEU 64  168 168 LEU LEU A . n 
A 1 65  SER 65  169 169 SER SER A . n 
A 1 66  GLU 66  170 170 GLU GLU A . n 
A 1 67  VAL 67  171 171 VAL VAL A . n 
A 1 68  GLN 68  172 172 GLN GLN A . n 
A 1 69  LEU 69  173 173 LEU LEU A . n 
A 1 70  ASN 70  174 174 ASN ASN A . n 
A 1 71  HIS 71  175 175 HIS HIS A . n 
A 1 72  MET 72  176 176 MET MET A . n 
A 1 73  ASP 73  177 177 ASP ASP A . n 
A 1 74  ASP 74  178 178 ASP ASP A . n 
A 1 75  HIS 75  179 179 HIS HIS A . n 
A 1 76  THR 76  180 180 THR THR A . n 
A 1 77  LEU 77  181 181 LEU LEU A . n 
A 1 78  PRO 78  182 182 PRO PRO A . n 
A 1 79  GLY 79  183 183 GLY GLY A . n 
A 1 80  LYS 80  184 184 LYS LYS A . n 
A 1 81  TYR 81  185 185 TYR TYR A . n 
A 1 82  GLY 82  186 186 GLY GLY A . n 
A 1 83  ILE 83  187 187 ILE ILE A . n 
A 1 84  GLY 84  188 188 GLY GLY A . n 
A 1 85  PHE 85  189 189 PHE PHE A . n 
A 1 86  THR 86  190 190 THR THR A . n 
A 1 87  ASN 87  191 191 ASN ASN A . n 
A 1 88  MET 88  192 192 MET MET A . n 
A 1 89  VAL 89  193 193 VAL VAL A . n 
A 1 90  GLU 90  194 194 GLU GLU A . n 
A 1 91  ARG 91  195 195 ARG ARG A . n 
A 1 92  THR 92  196 196 THR THR A . n 
A 1 93  THR 93  197 197 THR THR A . n 
A 1 94  PRO 94  198 198 PRO PRO A . n 
A 1 95  GLY 95  199 199 GLY GLY A . n 
A 1 96  SER 96  200 200 SER SER A . n 
A 1 97  LYS 97  201 201 LYS LYS A . n 
A 1 98  ASP 98  202 202 ASP ASP A . n 
A 1 99  LEU 99  203 203 LEU LEU A . n 
A 1 100 SER 100 204 204 SER SER A . n 
A 1 101 SER 101 205 205 SER SER A . n 
A 1 102 LYS 102 206 206 LYS LYS A . n 
A 1 103 GLU 103 207 207 GLU GLU A . n 
A 1 104 PHE 104 208 208 PHE PHE A . n 
A 1 105 ARG 105 209 209 ARG ARG A . n 
A 1 106 GLU 106 210 210 GLU GLU A . n 
A 1 107 GLY 107 211 211 GLY GLY A . n 
A 1 108 GLY 108 212 212 GLY GLY A . n 
A 1 109 ARG 109 213 213 ARG ARG A . n 
A 1 110 ILE 110 214 214 ILE ILE A . n 
A 1 111 LEU 111 215 215 LEU LEU A . n 
A 1 112 VAL 112 216 216 VAL VAL A . n 
A 1 113 GLN 113 217 217 GLN GLN A . n 
A 1 114 LYS 114 218 218 LYS LYS A . n 
A 1 115 LEU 115 219 219 LEU LEU A . n 
A 1 116 GLN 116 220 220 GLN GLN A . n 
A 1 117 LYS 117 221 221 LYS LYS A . n 
A 1 118 TYR 118 222 222 TYR TYR A . n 
A 1 119 GLN 119 223 223 GLN GLN A . n 
A 1 120 PRO 120 224 224 PRO PRO A . n 
A 1 121 ARG 121 225 225 ARG ARG A . n 
A 1 122 ILE 122 226 226 ILE ILE A . n 
A 1 123 ALA 123 227 227 ALA ALA A . n 
A 1 124 VAL 124 228 228 VAL VAL A . n 
A 1 125 PHE 125 229 229 PHE PHE A . n 
A 1 126 ASN 126 230 230 ASN ASN A . n 
A 1 127 GLY 127 231 231 GLY GLY A . n 
A 1 128 LYS 128 232 232 LYS LYS A . n 
A 1 129 CYS 129 233 233 CYS CYS A . n 
A 1 130 ILE 130 234 234 ILE ILE A . n 
A 1 131 TYR 131 235 235 TYR TYR A . n 
A 1 132 GLU 132 236 236 GLU GLU A . n 
A 1 133 ILE 133 237 237 ILE ILE A . n 
A 1 134 PHE 134 238 238 PHE PHE A . n 
A 1 135 SER 135 239 239 SER SER A . n 
A 1 136 LYS 136 240 240 LYS LYS A . n 
A 1 137 GLU 137 241 241 GLU GLU A . n 
A 1 138 VAL 138 242 242 VAL VAL A . n 
A 1 139 PHE 139 243 243 PHE PHE A . n 
A 1 140 GLY 140 244 244 GLY GLY A . n 
A 1 141 VAL 141 245 245 VAL VAL A . n 
A 1 142 LYS 142 246 246 LYS LYS A . n 
A 1 143 VAL 143 247 247 VAL VAL A . n 
A 1 144 LYS 144 248 248 LYS LYS A . n 
A 1 145 ASN 145 249 249 ASN ASN A . n 
A 1 146 LEU 146 250 250 LEU LEU A . n 
A 1 147 GLU 147 251 251 GLU GLU A . n 
A 1 148 PHE 148 252 252 PHE PHE A . n 
A 1 149 GLY 149 253 253 GLY GLY A . n 
A 1 150 LEU 150 254 254 LEU LEU A . n 
A 1 151 GLN 151 255 255 GLN GLN A . n 
A 1 152 PRO 152 256 256 PRO PRO A . n 
A 1 153 HIS 153 257 257 HIS HIS A . n 
A 1 154 LYS 154 258 258 LYS LYS A . n 
A 1 155 ILE 155 259 259 ILE ILE A . n 
A 1 156 PRO 156 260 260 PRO PRO A . n 
A 1 157 ASP 157 261 261 ASP ASP A . n 
A 1 158 THR 158 262 262 THR THR A . n 
A 1 159 GLU 159 263 263 GLU GLU A . n 
A 1 160 THR 160 264 264 THR THR A . n 
A 1 161 LEU 161 265 265 LEU LEU A . n 
A 1 162 CYS 162 266 266 CYS CYS A . n 
A 1 163 TYR 163 267 267 TYR TYR A . n 
A 1 164 VAL 164 268 268 VAL VAL A . n 
A 1 165 MET 165 269 269 MET MET A . n 
A 1 166 PRO 166 270 270 PRO PRO A . n 
A 1 167 SER 167 271 271 SER SER A . n 
A 1 168 SER 168 272 272 SER SER A . n 
A 1 169 SER 169 273 273 SER SER A . n 
A 1 170 ALA 170 274 274 ALA ALA A . n 
A 1 171 ARG 171 275 275 ARG ARG A . n 
A 1 172 CYS 172 276 276 CYS CYS A . n 
A 1 173 ALA 173 277 277 ALA ALA A . n 
A 1 174 GLN 174 278 278 GLN GLN A . n 
A 1 175 PHE 175 279 279 PHE PHE A . n 
A 1 176 PRO 176 280 280 PRO PRO A . n 
A 1 177 ARG 177 281 281 ARG ARG A . n 
A 1 178 ALA 178 282 282 ALA ALA A . n 
A 1 179 GLN 179 283 283 GLN GLN A . n 
A 1 180 ASP 180 284 284 ASP ASP A . n 
A 1 181 LYS 181 285 285 LYS LYS A . n 
A 1 182 VAL 182 286 286 VAL VAL A . n 
A 1 183 HIS 183 287 287 HIS HIS A . n 
A 1 184 TYR 184 288 288 TYR TYR A . n 
A 1 185 TYR 185 289 289 TYR TYR A . n 
A 1 186 ILE 186 290 290 ILE ILE A . n 
A 1 187 LYS 187 291 291 LYS LYS A . n 
A 1 188 LEU 188 292 292 LEU LEU A . n 
A 1 189 LYS 189 293 293 LYS LYS A . n 
A 1 190 ASP 190 294 294 ASP ASP A . n 
A 1 191 LEU 191 295 295 LEU LEU A . n 
A 1 192 ARG 192 296 296 ARG ARG A . n 
A 1 193 ASP 193 297 297 ASP ASP A . n 
A 1 194 GLN 194 298 298 GLN GLN A . n 
A 1 195 LEU 195 299 299 LEU LEU A . n 
A 1 196 LYS 196 300 300 LYS LYS A . n 
A 1 197 GLY 197 301 301 GLY GLY A . n 
A 1 198 ILE 198 302 302 ILE ILE A . n 
A 1 199 GLU 199 303 303 GLU GLU A . n 
A 1 200 ARG 200 304 304 ARG ARG A . n 
A 1 201 ASN 201 305 305 ASN ASN A . n 
A 1 202 MET 202 306 ?   ?   ?   A . n 
A 1 203 ASP 203 307 ?   ?   ?   A . n 
A 1 204 VAL 204 308 ?   ?   ?   A . n 
B 2 1   DC  1   1   1   DC  DC  C . n 
B 2 2   DA  2   2   2   DA  DA  C . n 
B 2 3   DG  3   3   3   DG  DG  C . n 
B 2 4   DC  4   4   4   DC  DC  C . n 
B 2 5   DT  5   5   5   DT  DT  C . n 
B 2 6   DC  6   6   6   DC  DC  C . n 
B 2 7   DT  7   7   7   DT  DT  C . n 
B 2 8   DG  8   8   8   DG  DG  C . n 
B 2 9   DT  9   9   9   DT  DT  C . n 
B 2 10  DA  10  10  10  DA  DA  C . n 
B 2 11  DC  11  11  11  DC  DC  C . n 
B 2 12  DG  12  12  12  DG  DG  C . n 
B 2 13  DT  13  13  13  DT  DT  C . n 
B 2 14  DG  14  14  14  DG  DG  C . n 
B 2 15  DA  15  15  15  DA  DA  C . n 
B 2 16  DG  16  16  16  DG  DG  C . n 
B 2 17  DC  17  17  17  DC  DC  C . n 
B 2 18  DG  18  18  18  DG  DG  C . n 
B 2 19  DA  19  19  19  DA  DA  C . n 
B 2 20  DT  20  20  20  DT  DT  C . n 
B 2 21  DG  21  21  21  DG  DG  C . n 
B 2 22  DG  22  22  22  DG  DG  C . n 
B 2 23  DA  23  23  23  DA  DA  C . n 
B 2 24  DC  24  24  24  DC  DC  C . n 
B 2 25  DA  25  25  25  DA  DA  C . n 
B 2 26  DG  26  26  26  DG  DG  C . n 
B 2 27  DC  27  27  27  DC  DC  C . n 
B 2 28  DT  28  28  28  DT  DT  C . n 
C 3 1   DA  1   1   1   DA  DA  D . n 
C 3 2   DG  2   2   2   DG  DG  D . n 
C 3 3   DC  3   3   3   DC  DC  D . n 
C 3 4   DT  4   4   4   DT  DT  D . n 
C 3 5   DG  5   5   5   DG  DG  D . n 
C 3 6   DT  6   6   6   DT  DT  D . n 
C 3 7   DC  7   7   7   DC  DC  D . n 
C 3 8   DC  8   8   8   DC  DC  D . n 
C 3 9   DA  9   9   9   DA  DA  D . n 
C 3 10  DT  10  10  10  DT  DT  D . n 
C 3 11  DC  11  11  11  DC  DC  D . n 
C 3 12  DG  12  12  12  DG  DG  D . n 
C 3 13  DC  13  13  13  DC  DC  D . n 
C 3 14  DT  14  14  14  DT  DT  D . n 
C 3 15  DC  15  15  15  DC  DC  D . n 
C 3 16  DA  16  16  16  DA  DA  D . n 
C 3 17  ORP 17  17  17  ORP ORF D . n 
C 3 18  DG  18  18  18  DG  DG  D . n 
C 3 19  DT  19  19  19  DT  DT  D . n 
C 3 20  DA  20  20  20  DA  DA  D . n 
C 3 21  DC  21  21  21  DC  DC  D . n 
C 3 22  DA  22  22  22  DA  DA  D . n 
C 3 23  DG  23  23  23  DG  DG  D . n 
C 3 24  DA  24  24  24  DA  DA  D . n 
C 3 25  DG  25  25  25  DG  DG  D . n 
C 3 26  DC  26  26  26  DC  DC  D . n 
C 3 27  DT  27  27  27  DT  DT  D . n 
C 3 28  DG  28  28  28  DG  DG  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 EDO 1   401 2   EDO EDO A . 
E 5 ACY 1   402 1   ACY ACY A . 
F 6 HOH 1   501 20  HOH HOH A . 
F 6 HOH 2   502 11  HOH HOH A . 
F 6 HOH 3   503 16  HOH HOH A . 
F 6 HOH 4   504 21  HOH HOH A . 
F 6 HOH 5   505 90  HOH HOH A . 
F 6 HOH 6   506 26  HOH HOH A . 
F 6 HOH 7   507 293 HOH HOH A . 
F 6 HOH 8   508 48  HOH HOH A . 
F 6 HOH 9   509 72  HOH HOH A . 
F 6 HOH 10  510 102 HOH HOH A . 
F 6 HOH 11  511 100 HOH HOH A . 
F 6 HOH 12  512 37  HOH HOH A . 
F 6 HOH 13  513 13  HOH HOH A . 
F 6 HOH 14  514 94  HOH HOH A . 
F 6 HOH 15  515 27  HOH HOH A . 
F 6 HOH 16  516 69  HOH HOH A . 
F 6 HOH 17  517 58  HOH HOH A . 
F 6 HOH 18  518 35  HOH HOH A . 
F 6 HOH 19  519 247 HOH HOH A . 
F 6 HOH 20  520 55  HOH HOH A . 
F 6 HOH 21  521 8   HOH HOH A . 
F 6 HOH 22  522 320 HOH HOH A . 
F 6 HOH 23  523 272 HOH HOH A . 
F 6 HOH 24  524 114 HOH HOH A . 
F 6 HOH 25  525 30  HOH HOH A . 
F 6 HOH 26  526 40  HOH HOH A . 
F 6 HOH 27  527 214 HOH HOH A . 
F 6 HOH 28  528 189 HOH HOH A . 
F 6 HOH 29  529 86  HOH HOH A . 
F 6 HOH 30  530 1   HOH HOH A . 
F 6 HOH 31  531 15  HOH HOH A . 
F 6 HOH 32  532 23  HOH HOH A . 
F 6 HOH 33  533 323 HOH HOH A . 
F 6 HOH 34  534 19  HOH HOH A . 
F 6 HOH 35  535 54  HOH HOH A . 
F 6 HOH 36  536 7   HOH HOH A . 
F 6 HOH 37  537 60  HOH HOH A . 
F 6 HOH 38  538 297 HOH HOH A . 
F 6 HOH 39  539 47  HOH HOH A . 
F 6 HOH 40  540 224 HOH HOH A . 
F 6 HOH 41  541 300 HOH HOH A . 
F 6 HOH 42  542 91  HOH HOH A . 
F 6 HOH 43  543 25  HOH HOH A . 
F 6 HOH 44  544 299 HOH HOH A . 
F 6 HOH 45  545 113 HOH HOH A . 
F 6 HOH 46  546 101 HOH HOH A . 
F 6 HOH 47  547 18  HOH HOH A . 
F 6 HOH 48  548 96  HOH HOH A . 
F 6 HOH 49  549 52  HOH HOH A . 
F 6 HOH 50  550 9   HOH HOH A . 
F 6 HOH 51  551 108 HOH HOH A . 
F 6 HOH 52  552 3   HOH HOH A . 
F 6 HOH 53  553 98  HOH HOH A . 
F 6 HOH 54  554 4   HOH HOH A . 
F 6 HOH 55  555 109 HOH HOH A . 
F 6 HOH 56  556 321 HOH HOH A . 
F 6 HOH 57  557 57  HOH HOH A . 
F 6 HOH 58  558 12  HOH HOH A . 
F 6 HOH 59  559 36  HOH HOH A . 
F 6 HOH 60  560 184 HOH HOH A . 
F 6 HOH 61  561 68  HOH HOH A . 
F 6 HOH 62  562 322 HOH HOH A . 
F 6 HOH 63  563 45  HOH HOH A . 
F 6 HOH 64  564 33  HOH HOH A . 
F 6 HOH 65  565 42  HOH HOH A . 
F 6 HOH 66  566 32  HOH HOH A . 
F 6 HOH 67  567 186 HOH HOH A . 
F 6 HOH 68  568 93  HOH HOH A . 
F 6 HOH 69  569 82  HOH HOH A . 
F 6 HOH 70  570 29  HOH HOH A . 
F 6 HOH 71  571 221 HOH HOH A . 
F 6 HOH 72  572 14  HOH HOH A . 
F 6 HOH 73  573 103 HOH HOH A . 
F 6 HOH 74  574 71  HOH HOH A . 
F 6 HOH 75  575 61  HOH HOH A . 
F 6 HOH 76  576 240 HOH HOH A . 
F 6 HOH 77  577 199 HOH HOH A . 
F 6 HOH 78  578 28  HOH HOH A . 
F 6 HOH 79  579 53  HOH HOH A . 
F 6 HOH 80  580 77  HOH HOH A . 
F 6 HOH 81  581 111 HOH HOH A . 
F 6 HOH 82  582 50  HOH HOH A . 
F 6 HOH 83  583 2   HOH HOH A . 
F 6 HOH 84  584 62  HOH HOH A . 
F 6 HOH 85  585 5   HOH HOH A . 
F 6 HOH 86  586 106 HOH HOH A . 
F 6 HOH 87  587 39  HOH HOH A . 
F 6 HOH 88  588 43  HOH HOH A . 
F 6 HOH 89  589 38  HOH HOH A . 
F 6 HOH 90  590 279 HOH HOH A . 
F 6 HOH 91  591 41  HOH HOH A . 
F 6 HOH 92  592 88  HOH HOH A . 
F 6 HOH 93  593 252 HOH HOH A . 
F 6 HOH 94  594 267 HOH HOH A . 
F 6 HOH 95  595 263 HOH HOH A . 
F 6 HOH 96  596 219 HOH HOH A . 
F 6 HOH 97  597 46  HOH HOH A . 
F 6 HOH 98  598 268 HOH HOH A . 
F 6 HOH 99  599 254 HOH HOH A . 
F 6 HOH 100 600 143 HOH HOH A . 
F 6 HOH 101 601 292 HOH HOH A . 
F 6 HOH 102 602 204 HOH HOH A . 
F 6 HOH 103 603 250 HOH HOH A . 
F 6 HOH 104 604 298 HOH HOH A . 
F 6 HOH 105 605 99  HOH HOH A . 
F 6 HOH 106 606 115 HOH HOH A . 
F 6 HOH 107 607 287 HOH HOH A . 
F 6 HOH 108 608 296 HOH HOH A . 
F 6 HOH 109 609 211 HOH HOH A . 
F 6 HOH 110 610 183 HOH HOH A . 
F 6 HOH 111 611 31  HOH HOH A . 
F 6 HOH 112 612 201 HOH HOH A . 
F 6 HOH 113 613 213 HOH HOH A . 
F 6 HOH 114 614 294 HOH HOH A . 
F 6 HOH 115 615 258 HOH HOH A . 
F 6 HOH 116 616 63  HOH HOH A . 
G 6 HOH 1   101 271 HOH HOH C . 
G 6 HOH 2   102 303 HOH HOH C . 
G 6 HOH 3   103 128 HOH HOH C . 
G 6 HOH 4   104 306 HOH HOH C . 
G 6 HOH 5   105 130 HOH HOH C . 
G 6 HOH 6   106 302 HOH HOH C . 
G 6 HOH 7   107 125 HOH HOH C . 
G 6 HOH 8   108 147 HOH HOH C . 
G 6 HOH 9   109 165 HOH HOH C . 
G 6 HOH 10  110 285 HOH HOH C . 
G 6 HOH 11  111 162 HOH HOH C . 
G 6 HOH 12  112 163 HOH HOH C . 
G 6 HOH 13  113 151 HOH HOH C . 
G 6 HOH 14  114 312 HOH HOH C . 
G 6 HOH 15  115 144 HOH HOH C . 
G 6 HOH 16  116 126 HOH HOH C . 
G 6 HOH 17  117 305 HOH HOH C . 
G 6 HOH 18  118 304 HOH HOH C . 
G 6 HOH 19  119 288 HOH HOH C . 
G 6 HOH 20  120 235 HOH HOH C . 
G 6 HOH 21  121 107 HOH HOH C . 
G 6 HOH 22  122 313 HOH HOH C . 
G 6 HOH 23  123 132 HOH HOH C . 
G 6 HOH 24  124 97  HOH HOH C . 
G 6 HOH 25  125 311 HOH HOH C . 
G 6 HOH 26  126 159 HOH HOH C . 
G 6 HOH 27  127 161 HOH HOH C . 
G 6 HOH 28  128 145 HOH HOH C . 
G 6 HOH 29  129 167 HOH HOH C . 
G 6 HOH 30  130 131 HOH HOH C . 
G 6 HOH 31  131 185 HOH HOH C . 
G 6 HOH 32  132 316 HOH HOH C . 
G 6 HOH 33  133 174 HOH HOH C . 
G 6 HOH 34  134 242 HOH HOH C . 
G 6 HOH 35  135 168 HOH HOH C . 
G 6 HOH 36  136 251 HOH HOH C . 
G 6 HOH 37  137 309 HOH HOH C . 
G 6 HOH 38  138 245 HOH HOH C . 
G 6 HOH 39  139 314 HOH HOH C . 
G 6 HOH 40  140 243 HOH HOH C . 
G 6 HOH 41  141 291 HOH HOH C . 
G 6 HOH 42  142 80  HOH HOH C . 
G 6 HOH 43  143 275 HOH HOH C . 
H 6 HOH 1   101 142 HOH HOH D . 
H 6 HOH 2   102 157 HOH HOH D . 
H 6 HOH 3   103 120 HOH HOH D . 
H 6 HOH 4   104 152 HOH HOH D . 
H 6 HOH 5   105 44  HOH HOH D . 
H 6 HOH 6   106 150 HOH HOH D . 
H 6 HOH 7   107 301 HOH HOH D . 
H 6 HOH 8   108 17  HOH HOH D . 
H 6 HOH 9   109 230 HOH HOH D . 
H 6 HOH 10  110 209 HOH HOH D . 
H 6 HOH 11  111 202 HOH HOH D . 
H 6 HOH 12  112 10  HOH HOH D . 
H 6 HOH 13  113 234 HOH HOH D . 
H 6 HOH 14  114 123 HOH HOH D . 
H 6 HOH 15  115 148 HOH HOH D . 
H 6 HOH 16  116 187 HOH HOH D . 
H 6 HOH 17  117 164 HOH HOH D . 
H 6 HOH 18  118 137 HOH HOH D . 
H 6 HOH 19  119 169 HOH HOH D . 
H 6 HOH 20  120 307 HOH HOH D . 
H 6 HOH 21  121 149 HOH HOH D . 
H 6 HOH 22  122 308 HOH HOH D . 
H 6 HOH 23  123 95  HOH HOH D . 
H 6 HOH 24  124 6   HOH HOH D . 
H 6 HOH 25  125 237 HOH HOH D . 
H 6 HOH 26  126 156 HOH HOH D . 
H 6 HOH 27  127 295 HOH HOH D . 
H 6 HOH 28  128 290 HOH HOH D . 
H 6 HOH 29  129 210 HOH HOH D . 
H 6 HOH 30  130 139 HOH HOH D . 
H 6 HOH 31  131 315 HOH HOH D . 
H 6 HOH 32  132 154 HOH HOH D . 
H 6 HOH 33  133 155 HOH HOH D . 
H 6 HOH 34  134 173 HOH HOH D . 
H 6 HOH 35  135 197 HOH HOH D . 
H 6 HOH 36  136 22  HOH HOH D . 
H 6 HOH 37  137 310 HOH HOH D . 
H 6 HOH 38  138 122 HOH HOH D . 
H 6 HOH 39  139 112 HOH HOH D . 
H 6 HOH 40  140 121 HOH HOH D . 
H 6 HOH 41  141 146 HOH HOH D . 
H 6 HOH 42  142 289 HOH HOH D . 
H 6 HOH 43  143 223 HOH HOH D . 
H 6 HOH 44  144 135 HOH HOH D . 
H 6 HOH 45  145 76  HOH HOH D . 
H 6 HOH 46  146 274 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5100  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  17990 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-09-16 
2 'Structure model' 1 1 2015-09-30 
3 'Structure model' 1 2 2015-11-11 
4 'Structure model' 1 3 2017-09-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' pdbx_audit_support    
3 4 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_pdbx_audit_support.funding_organization'  
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 26.7746 -16.7768 35.0298 0.4198  0.5243 0.1483 0.1015  0.0355  0.2035  11.4354 1.6755  22.9657 
0.3822  -8.4001 5.3758  0.2000  0.2855  0.1396  0.0769  0.1157  -0.4454 0.2787  0.3439  -0.3157 
'X-RAY DIFFRACTION' 2  ? refined 11.5015 -11.2291 25.1003 0.3883  0.0913 0.1058 -0.0445 0.0404  -0.0298 4.4486  4.1929  5.5224  
-1.3052 1.8164  -2.3175 0.0874  -0.1633 -0.3293 0.2029  -0.1238 0.3602  0.5443  0.1073  0.0364  
'X-RAY DIFFRACTION' 3  ? refined 13.9079 -6.3040  33.8523 0.4984  0.1337 0.0684 0.0203  -0.0004 0.0162  2.3590  4.1977  3.6266  
-1.4538 -1.1496 -1.2670 -0.2041 -0.3039 -0.1194 1.2120  0.0565  0.0267  0.2146  0.1727  0.1475  
'X-RAY DIFFRACTION' 4  ? refined 3.1478  -5.1456  34.1539 0.4028  0.1567 0.1916 -0.0463 0.2090  0.0104  2.0879  4.4368  7.3797  
0.4707  0.6561  1.7826  -0.0504 -0.3341 0.0073  1.2054  -0.0015 0.7418  0.2515  -0.5019 0.0519  
'X-RAY DIFFRACTION' 5  ? refined 20.3378 -10.0596 20.9139 0.5039  0.3450 0.0478 0.0093  0.0517  0.0326  7.7083  6.7809  6.8796  
-2.4489 -0.9329 -4.7548 -0.0451 0.0440  -0.0816 0.0713  -0.2972 -0.0523 -0.2411 0.9826  0.3423  
'X-RAY DIFFRACTION' 6  ? refined 18.1610 -7.9513  12.9642 0.4816  0.2817 0.0235 0.0131  0.0709  0.0017  10.3975 4.6817  4.2434  
2.1676  -0.4678 -1.4359 0.2524  0.0854  -0.0991 -0.3341 -0.4627 -0.1009 0.2377  0.7638  0.2103  
'X-RAY DIFFRACTION' 7  ? refined 4.4817  -4.9482  17.1027 0.3276  0.1468 0.1727 -0.0304 -0.0412 -0.0400 4.5940  4.2277  2.9480  
0.4843  0.9180  -0.4900 -0.1556 0.1603  -0.1800 -0.5129 0.0319  0.5332  0.1460  -0.2881 0.1237  
'X-RAY DIFFRACTION' 8  ? refined 13.2617 1.9406   9.7446  0.4709  0.1665 0.0246 -0.0255 0.0408  0.0166  6.1019  3.5625  3.6686  
1.0496  0.2785  1.3761  -0.0723 0.3999  0.1888  -0.5831 -0.0079 -0.0099 -0.3593 0.4092  0.0802  
'X-RAY DIFFRACTION' 9  ? refined 9.4239  9.6862   13.6228 -0.0032 0.1892 0.2586 0.0926  -0.0238 0.0661  7.2692  0.0000  5.1266  
-4.9248 -0.9356 -4.3277 0.0361  0.2096  0.4613  -1.1769 -0.1144 0.0405  -0.3084 0.0981  0.0783  
'X-RAY DIFFRACTION' 10 ? refined 0.4713  -0.3995  12.3809 0.3574  0.1637 0.1906 -0.0794 -0.1003 -0.0201 3.2446  5.1171  8.7514  
1.6955  0.4096  3.7381  -0.0402 0.3194  -0.0619 -0.3385 0.0188  0.5412  0.2386  -0.3995 0.0214  
'X-RAY DIFFRACTION' 11 ? refined 17.4140 5.8420   27.0717 0.3088  0.1242 0.0706 0.0133  -0.0088 -0.0040 1.9777  2.1944  5.3265  
0.2895  3.4050  0.8586  -0.0757 0.0259  0.2620  0.2739  -0.0853 0.1537  -0.0906 0.3363  0.1610  
'X-RAY DIFFRACTION' 12 ? refined 1.4210  6.9707   27.1247 0.2689  0.1009 0.1870 0.0707  0.0664  -0.0598 6.3860  1.7838  4.1880  
0.7865  1.8507  0.3085  -0.1299 -0.3102 0.2788  0.3877  -0.0764 0.6636  -0.2993 -0.6425 0.2063  
'X-RAY DIFFRACTION' 13 ? refined 25.3317 17.7771  0.1219  0.8124  0.5368 0.0425 -0.0025 0.1761  0.1536  9.0894  4.5977  3.7566  
-2.4560 -1.9858 -1.2868 0.3958  -0.3854 0.2903  -0.0503 -0.0872 1.3394  -0.0131 -0.4977 -0.3086 
'X-RAY DIFFRACTION' 14 ? refined 29.0259 6.5756   9.9875  0.6093  0.7123 0.0221 -0.0749 0.0935  0.1029  8.4070  11.4540 8.6392  
3.9627  4.3945  5.1790  0.0560  0.5655  -1.2290 -0.1037 0.3760  -0.0096 0.4138  0.4243  -0.4321 
'X-RAY DIFFRACTION' 15 ? refined 26.5149 5.5970   34.5797 0.3165  0.2898 0.0018 0.0048  -0.1406 0.0248  6.3953  5.4870  9.9490  
-0.8739 -0.0737 -0.2922 0.2975  -0.2368 0.0857  0.3752  -0.2726 -0.1892 -0.2673 0.8782  -0.0249 
'X-RAY DIFFRACTION' 16 ? refined 33.6836 -5.7518  64.2077 0.6225  0.2226 0.2070 0.0375  -0.2068 -0.0105 1.5506  8.7114  13.3361 
0.3436  0.9666  -3.3458 0.2298  -0.0593 0.0085  0.6376  -0.1254 -0.2389 -1.0663 0.4397  -0.1045 
'X-RAY DIFFRACTION' 17 ? refined 33.5574 -3.4218  58.0817 0.5325  0.1065 0.1431 0.0100  -0.1143 -0.0006 3.2148  5.3731  7.2099  
0.2092  -0.2458 -2.7787 0.3844  0.1112  0.1023  0.7912  -0.2271 -0.3050 -0.6452 0.5292  -0.1573 
'X-RAY DIFFRACTION' 18 ? refined 27.3302 9.3570   12.3343 0.5961  0.4758 0.1418 -0.0936 -0.0369 0.1423  2.2250  3.2518  12.7148 
2.1227  -5.3832 -4.2148 0.0939  0.1700  0.2280  -0.7057 -0.1229 -0.0698 -0.0804 0.9724  0.0289  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? '{ A|111 - A|117 }' 
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? '{ A|118 - A|144 }' 
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? '{ A|145 - A|162 }' 
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? '{ A|163 - A|190 }' 
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? '{ A|191 - A|200 }' 
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? '{ A|201 - A|216 }' 
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? '{ A|217 - A|233 }' 
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? '{ A|234 - A|247 }' 
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? '{ A|248 - A|257 }' 
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '{ A|258 - A|267 }' 
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? '{ A|268 - A|280 }' 
'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? '{ A|281 - A|303 }' 
'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? '{ C|1 - C|4 }'     
'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? '{ C|5 - C|8 }'     
'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? '{ C|9 - C|17 }'    
'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? '{ C|18 - C|28 }'   
'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? '{ D|1 - D|15 }'    
'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? '{ D|16 - D|28 }'   
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? BUSTER-TNT  ? ? ? 2.10.2 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? 0.5.4  2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15   3 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? Blu-Ice     ? ? ? .      4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .      5 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .      6 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            "O3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DC 
_pdbx_validate_rmsd_bond.auth_seq_id_1             8 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            "C3'" 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DC 
_pdbx_validate_rmsd_bond.auth_seq_id_2             8 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.382 
_pdbx_validate_rmsd_bond.bond_target_value         1.419 
_pdbx_validate_rmsd_bond.bond_deviation            -0.037 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.006 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DG 3  ? ? "C1'" C DG 3  ? ? N9 C DG 3  ? ? 110.86 108.30 2.56 0.30 N 
2 1 "O4'" C DC 4  ? ? "C1'" C DC 4  ? ? N1 C DC 4  ? ? 110.42 108.30 2.12 0.30 N 
3 1 "O4'" C DC 17 ? ? "C1'" C DC 17 ? ? N1 C DC 17 ? ? 110.21 108.30 1.91 0.30 N 
4 1 "O4'" C DT 28 ? ? "C1'" C DT 28 ? ? N1 C DT 28 ? ? 110.61 108.30 2.31 0.30 N 
5 1 "O4'" D DT 4  ? ? "C1'" D DT 4  ? ? N1 D DT 4  ? ? 110.14 108.30 1.84 0.30 N 
6 1 "O4'" D DC 8  ? ? "C1'" D DC 8  ? ? N1 D DC 8  ? ? 110.18 108.30 1.88 0.30 N 
7 1 "O4'" D DC 21 ? ? "C1'" D DC 21 ? ? N1 D DC 21 ? ? 110.53 108.30 2.23 0.30 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     249 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -107.54 
_pdbx_validate_torsion.psi             64.40 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 184 ? CG  ? A LYS 80  CG  
2  1 Y 1 A LYS 184 ? CD  ? A LYS 80  CD  
3  1 Y 1 A LYS 184 ? CE  ? A LYS 80  CE  
4  1 Y 1 A LYS 184 ? NZ  ? A LYS 80  NZ  
5  1 Y 1 A LYS 201 ? CG  ? A LYS 97  CG  
6  1 Y 1 A LYS 201 ? CD  ? A LYS 97  CD  
7  1 Y 1 A LYS 201 ? CE  ? A LYS 97  CE  
8  1 Y 1 A LYS 201 ? NZ  ? A LYS 97  NZ  
9  1 Y 1 A LYS 206 ? CG  ? A LYS 102 CG  
10 1 Y 1 A LYS 206 ? CD  ? A LYS 102 CD  
11 1 Y 1 A LYS 206 ? CE  ? A LYS 102 CE  
12 1 Y 1 A LYS 206 ? NZ  ? A LYS 102 NZ  
13 1 Y 1 A LYS 248 ? CG  ? A LYS 144 CG  
14 1 Y 1 A LYS 248 ? CD  ? A LYS 144 CD  
15 1 Y 1 A LYS 248 ? CE  ? A LYS 144 CE  
16 1 Y 1 A LYS 248 ? NZ  ? A LYS 144 NZ  
17 1 Y 1 A ASN 249 ? CG  ? A ASN 145 CG  
18 1 Y 1 A ASN 249 ? OD1 ? A ASN 145 OD1 
19 1 Y 1 A ASN 249 ? ND2 ? A ASN 145 ND2 
20 1 Y 1 A ILE 302 ? CG1 ? A ILE 198 CG1 
21 1 Y 1 A ILE 302 ? CG2 ? A ILE 198 CG2 
22 1 Y 1 A ILE 302 ? CD1 ? A ILE 198 CD1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 105 ? A GLY 1   
2 1 Y 1 A SER 106 ? A SER 2   
3 1 Y 1 A HIS 107 ? A HIS 3   
4 1 Y 1 A MET 108 ? A MET 4   
5 1 Y 1 A ALA 109 ? A ALA 5   
6 1 Y 1 A SER 110 ? A SER 6   
7 1 Y 1 A MET 306 ? A MET 202 
8 1 Y 1 A ASP 307 ? A ASP 203 
9 1 Y 1 A VAL 308 ? A VAL 204 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4Z7Z 'double helix'        
4Z7Z 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1  1_555 C DG 28 1_555 0.065  -0.088 -0.130 10.538  -8.012  -5.256 1  C_DC1:DG28_D  C 1  ? D 28 ? 19 1 
1 B DA 2  1_555 C DT 27 1_555 -0.416 -0.150 0.226  12.521  -9.471  2.731  2  C_DA2:DT27_D  C 2  ? D 27 ? 20 1 
1 B DG 3  1_555 C DC 26 1_555 -0.497 -0.134 0.273  12.580  -11.178 1.035  3  C_DG3:DC26_D  C 3  ? D 26 ? 19 1 
1 B DC 4  1_555 C DG 25 1_555 0.485  -0.219 0.167  1.040   -19.934 2.805  4  C_DC4:DG25_D  C 4  ? D 25 ? 19 1 
1 B DT 5  1_555 C DA 24 1_555 0.094  -0.187 0.038  -6.265  -15.010 -2.402 5  C_DT5:DA24_D  C 5  ? D 24 ? 20 1 
1 B DC 6  1_555 C DG 23 1_555 0.078  -0.209 0.193  -10.874 -11.628 0.671  6  C_DC6:DG23_D  C 6  ? D 23 ? 19 1 
1 B DT 7  1_555 C DA 22 1_555 0.022  -0.145 0.201  -9.346  -8.459  2.986  7  C_DT7:DA22_D  C 7  ? D 22 ? 20 1 
1 B DG 8  1_555 C DC 21 1_555 -0.375 -0.250 -0.035 -9.357  -3.951  -1.097 8  C_DG8:DC21_D  C 8  ? D 21 ? 19 1 
1 B DT 9  1_555 C DA 20 1_555 -0.762 -0.159 0.140  -1.418  -7.984  3.971  9  C_DT9:DA20_D  C 9  ? D 20 ? 20 1 
1 B DA 10 1_555 C DT 19 1_555 0.006  -0.164 0.038  5.463   -8.138  4.095  10 C_DA10:DT19_D C 10 ? D 19 ? 20 1 
1 B DC 11 1_555 C DG 18 1_555 0.352  -0.206 -0.474 13.045  -11.091 0.028  11 C_DC11:DG18_D C 11 ? D 18 ? 19 1 
1 B DT 13 1_555 C DA 16 1_555 -0.260 -0.098 0.092  -14.069 -10.847 -3.003 12 C_DT13:DA16_D C 13 ? D 16 ? 20 1 
1 B DG 14 1_555 C DC 15 1_555 -0.418 -0.285 -0.370 -4.099  -4.563  0.280  13 C_DG14:DC15_D C 14 ? D 15 ? 19 1 
1 B DA 15 1_555 C DT 14 1_555 -0.036 -0.236 -0.102 -0.707  -9.462  1.392  14 C_DA15:DT14_D C 15 ? D 14 ? 20 1 
1 B DG 16 1_555 C DC 13 1_555 -0.349 -0.142 0.077  6.250   -9.784  3.648  15 C_DG16:DC13_D C 16 ? D 13 ? 19 1 
1 B DC 17 1_555 C DG 12 1_555 0.830  -0.452 0.131  1.034   -14.282 -0.727 16 C_DC17:DG12_D C 17 ? D 12 ? 19 1 
1 B DG 18 1_555 C DC 11 1_555 -0.543 -0.228 -0.308 -5.825  -16.196 2.156  17 C_DG18:DC11_D C 18 ? D 11 ? 19 1 
1 B DA 19 1_555 C DT 10 1_555 -0.111 -0.128 0.001  -3.742  -12.232 2.648  18 C_DA19:DT10_D C 19 ? D 10 ? 20 1 
1 B DT 20 1_555 C DA 9  1_555 -0.168 -0.221 0.129  -4.468  -11.187 -0.171 19 C_DT20:DA9_D  C 20 ? D 9  ? 20 1 
1 B DG 21 1_555 C DC 8  1_555 -0.423 -0.298 -0.046 -3.975  -6.782  -0.970 20 C_DG21:DC8_D  C 21 ? D 8  ? 19 1 
1 B DG 22 1_555 C DC 7  1_555 -0.305 -0.151 -0.163 -4.445  -10.077 1.111  21 C_DG22:DC7_D  C 22 ? D 7  ? 19 1 
1 B DA 23 1_555 C DT 6  1_555 0.190  -0.080 0.044  -2.883  -8.673  -1.040 22 C_DA23:DT6_D  C 23 ? D 6  ? 20 1 
1 B DC 24 1_555 C DG 5  1_555 0.198  -0.165 0.082  5.619   -5.141  -0.885 23 C_DC24:DG5_D  C 24 ? D 5  ? 19 1 
1 B DA 25 1_555 C DT 4  1_555 -0.052 -0.191 -0.028 9.400   -10.541 -1.195 24 C_DA25:DT4_D  C 25 ? D 4  ? 20 1 
1 B DG 26 1_555 C DC 3  1_555 -0.310 -0.085 0.072  7.902   -10.157 0.701  25 C_DG26:DC3_D  C 26 ? D 3  ? 19 1 
1 B DC 27 1_555 C DG 2  1_555 0.433  -0.130 0.098  1.092   -15.996 -0.237 26 C_DC27:DG2_D  C 27 ? D 2  ? 19 1 
1 B DT 28 1_555 C DA 1  1_555 0.120  -0.106 0.277  -2.234  -18.671 8.911  27 C_DT28:DA1_D  C 28 ? D 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1  1_555 C DG 28 1_555 B DA 2  1_555 C DT 27 1_555 0.879  0.446  3.277 3.070  -1.003 36.166 0.857  -0.977 3.325 -1.612 
-4.934 36.305 1  CC_DC1DA2:DT27DG28_DD   C 1  ? D 28 ? C 2  ? D 27 ? 
1 B DA 2  1_555 C DT 27 1_555 B DG 3  1_555 C DC 26 1_555 -0.123 0.188  3.338 -1.407 6.530  29.388 -1.010 -0.059 3.304 12.666 
2.729  30.121 2  CC_DA2DG3:DC26DT27_DD   C 2  ? D 27 ? C 3  ? D 26 ? 
1 B DG 3  1_555 C DC 26 1_555 B DC 4  1_555 C DG 25 1_555 0.202  -0.629 3.503 2.137  0.033  39.741 -0.929 -0.032 3.509 0.048  
-3.141 39.796 3  CC_DG3DC4:DG25DC26_DD   C 3  ? D 26 ? C 4  ? D 25 ? 
1 B DC 4  1_555 C DG 25 1_555 B DT 5  1_555 C DA 24 1_555 -0.466 -0.645 3.397 3.507  7.890  33.175 -2.349 1.350  3.103 13.536 
-6.017 34.249 4  CC_DC4DT5:DA24DG25_DD   C 4  ? D 25 ? C 5  ? D 24 ? 
1 B DT 5  1_555 C DA 24 1_555 B DC 6  1_555 C DG 23 1_555 0.562  -0.041 3.266 0.790  1.354  40.162 -0.214 -0.728 3.273 1.972  
-1.149 40.191 5  CC_DT5DC6:DG23DA24_DD   C 5  ? D 24 ? C 6  ? D 23 ? 
1 B DC 6  1_555 C DG 23 1_555 B DT 7  1_555 C DA 22 1_555 -0.174 -0.016 3.270 0.365  3.436  30.942 -0.685 0.394  3.247 6.414  
-0.681 31.130 6  CC_DC6DT7:DA22DG23_DD   C 6  ? D 23 ? C 7  ? D 22 ? 
1 B DT 7  1_555 C DA 22 1_555 B DG 8  1_555 C DC 21 1_555 0.251  0.494  3.344 1.235  5.201  37.793 0.076  -0.223 3.386 7.980  
-1.895 38.155 7  CC_DT7DG8:DC21DA22_DD   C 7  ? D 22 ? C 8  ? D 21 ? 
1 B DG 8  1_555 C DC 21 1_555 B DT 9  1_555 C DA 20 1_555 -0.170 -0.313 3.115 -0.237 0.461  28.115 -0.747 0.297  3.111 0.949  
0.488  28.119 8  CC_DG8DT9:DA20DC21_DD   C 8  ? D 21 ? C 9  ? D 20 ? 
1 B DT 9  1_555 C DA 20 1_555 B DA 10 1_555 C DT 19 1_555 -0.101 0.500  3.152 0.451  6.779  38.480 -0.050 0.205  3.189 10.188 
-0.678 39.053 9  CC_DT9DA10:DT19DA20_DD  C 9  ? D 20 ? C 10 ? D 19 ? 
1 B DA 10 1_555 C DT 19 1_555 B DC 11 1_555 C DG 18 1_555 -0.040 0.154  3.056 5.107  -1.266 33.249 0.459  0.846  3.009 -2.196 
-8.856 33.651 10 CC_DA10DC11:DG18DT19_DD C 10 ? D 19 ? C 11 ? D 18 ? 
1 B DT 13 1_555 C DA 16 1_555 B DG 14 1_555 C DC 15 1_555 0.885  1.296  3.245 2.602  5.191  35.394 1.339  -1.054 3.449 8.468  
-4.244 35.852 11 CC_DT13DG14:DC15DA16_DD C 13 ? D 16 ? C 14 ? D 15 ? 
1 B DG 14 1_555 C DC 15 1_555 B DA 15 1_555 C DT 14 1_555 -1.028 0.648  3.185 -5.817 4.976  36.819 0.351  0.829  3.359 7.775  
9.089  37.579 12 CC_DG14DA15:DT14DC15_DD C 14 ? D 15 ? C 15 ? D 14 ? 
1 B DA 15 1_555 C DT 14 1_555 B DG 16 1_555 C DC 13 1_555 0.530  -0.017 3.183 -2.434 3.778  29.494 -0.793 -1.520 3.104 7.366  
4.746  29.827 13 CC_DA15DG16:DC13DT14_DD C 15 ? D 14 ? C 16 ? D 13 ? 
1 B DG 16 1_555 C DC 13 1_555 B DC 17 1_555 C DG 12 1_555 -0.972 0.097  3.351 -1.656 -1.149 42.393 0.255  1.169  3.381 -1.588 
2.289  42.439 14 CC_DG16DC17:DG12DC13_DD C 16 ? D 13 ? C 17 ? D 12 ? 
1 B DC 17 1_555 C DG 12 1_555 B DG 18 1_555 C DC 11 1_555 0.105  0.615  3.447 4.766  13.823 29.345 -1.541 0.721  3.370 25.396 
-8.757 32.714 15 CC_DC17DG18:DC11DG12_DD C 17 ? D 12 ? C 18 ? D 11 ? 
1 B DG 18 1_555 C DC 11 1_555 B DA 19 1_555 C DT 10 1_555 -0.059 0.048  3.128 -4.076 3.774  39.112 -0.355 -0.373 3.109 5.603  
6.051  39.490 16 CC_DG18DA19:DT10DC11_DD C 18 ? D 11 ? C 19 ? D 10 ? 
1 B DA 19 1_555 C DT 10 1_555 B DT 20 1_555 C DA 9  1_555 -0.383 -0.632 3.269 -0.804 -0.787 29.056 -1.086 0.585  3.294 -1.569 
1.602  29.078 17 CC_DA19DT20:DA9DT10_DD  C 19 ? D 10 ? C 20 ? D 9  ? 
1 B DT 20 1_555 C DA 9  1_555 B DG 21 1_555 C DC 8  1_555 0.807  0.573  3.271 2.483  3.727  35.053 0.383  -0.956 3.359 6.157  
-4.101 35.329 18 CC_DT20DG21:DC8DA9_DD   C 20 ? D 9  ? C 21 ? D 8  ? 
1 B DG 21 1_555 C DC 8  1_555 B DG 22 1_555 C DC 7  1_555 -0.901 0.478  3.299 -2.590 3.397  36.850 0.286  1.061  3.382 5.352  
4.081  37.089 19 CC_DG21DG22:DC7DC8_DD   C 21 ? D 8  ? C 22 ? D 7  ? 
1 B DG 22 1_555 C DC 7  1_555 B DA 23 1_555 C DT 6  1_555 -0.477 0.109  3.215 -2.946 0.269  38.034 0.132  0.361  3.242 0.412  
4.512  38.145 20 CC_DG22DA23:DT6DC7_DD   C 22 ? D 7  ? C 23 ? D 6  ? 
1 B DA 23 1_555 C DT 6  1_555 B DC 24 1_555 C DG 5  1_555 0.843  -0.276 3.103 -0.324 0.168  31.418 -0.540 -1.615 3.093 0.310  
0.598  31.420 21 CC_DA23DC24:DG5DT6_DD   C 23 ? D 6  ? C 24 ? D 5  ? 
1 B DC 24 1_555 C DG 5  1_555 B DA 25 1_555 C DT 4  1_555 -0.074 0.551  3.311 3.496  6.285  35.387 -0.023 0.626  3.334 10.209 
-5.678 36.088 22 CC_DC24DA25:DT4DG5_DD   C 24 ? D 5  ? C 25 ? D 4  ? 
1 B DA 25 1_555 C DT 4  1_555 B DG 26 1_555 C DC 3  1_555 -0.615 0.063  3.350 -4.283 5.764  32.008 -0.918 0.325  3.362 10.292 
7.647  32.783 23 CC_DA25DG26:DC3DT4_DD   C 25 ? D 4  ? C 26 ? D 3  ? 
1 B DG 26 1_555 C DC 3  1_555 B DC 27 1_555 C DG 2  1_555 0.109  -0.362 3.405 -0.025 2.570  33.594 -1.059 -0.192 3.369 4.439  
0.044  33.690 24 CC_DG26DC27:DG2DC3_DD   C 26 ? D 3  ? C 27 ? D 2  ? 
1 B DC 27 1_555 C DG 2  1_555 B DT 28 1_555 C DA 1  1_555 0.408  -0.117 3.315 2.097  5.658  30.751 -1.300 -0.354 3.262 10.542 
-3.907 31.324 25 CC_DC27DT28:DA1DG2_DD   C 27 ? D 2  ? C 28 ? D 1  ? 
# 
_pdbx_audit_support.funding_organization   'National Institutes of Health/National Institute of General Medical Sciences' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           R01-GM72711 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 1,2-ETHANEDIOL EDO 
5 'ACETIC ACID'  ACY 
6 water          HOH 
#