data_4Z9L
# 
_entry.id   4Z9L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4Z9L         
WWPDB D_1000208875 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2015-05-06 
_pdbx_database_PDB_obs_spr.pdb_id           4Z9L 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1PMQ 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        
;This entry represents a re-refinement of PDB entry 1PMQ. The structure factors were treated using the Diffraction Anisotropy Server. The 880 and ANP ligands have been remodelled to achieve improvement to both stereochemistry and the fit to electron density.
;
_pdbx_database_related.db_id          1PMQ 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4Z9L 
_pdbx_database_status.recvd_initial_deposition_date   2015-04-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Scapin, G.'     1 
'Patel, S.B.'    2 
'Lisnock, J.'    3 
'Becker, J.W.'   4 
'Lograsso, P.V.' 5 
'Smart, O.S.'    6 
'Bricogne, G.'   7 
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? UK ? ? primary Chem.Biol.                                                       CBOLE2 2050 1074-5521         ? ? 10 
? 705 712 'The structure of JNK3 in complex with small molecule inhibitors: structural basis for potency and selectivity.' 2003 ? 
?                            12954329 ? 
? ? ? ? ? ? ? US ? ? 1       'Multifaceted Roles Of Crystallography In Modern Drug Discovery' ?      ?    978-94-017-9718-4 ? ? ?  
? 165 181 'Achieving High Quality Ligand Chemistry in Protein-Ligand Crystal Structures for Drug Design'                   2015 ? 
10.1007/978-94-017-9719-1_13 ?        ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Scapin, G.'     1 
primary 'Patel, S.B.'    2 
primary 'Lisnock, J.'    3 
primary 'Becker, J.W.'   4 
primary 'LoGrasso, P.V.' 5 
1       'Smart, O.S.'    6 
1       'Bricogne, G.'   7 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4Z9L 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     50.951 
_cell.length_a_esd                 ? 
_cell.length_b                     71.525 
_cell.length_b_esd                 ? 
_cell.length_c                     106.000 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4Z9L 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Mitogen-activated protein kinase 10'                                                                    
42001.641 1  2.7.11.24 ? 'UNP residues 40-401' ? 
2 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER'                                                            506.196 
1  ?         ? ?                     ? 
3 non-polymer syn 'CYCLOHEXYL-{4-[5-(3,4-DICHLOROPHENYL)-2-PIPERIDIN-4-YL-3-PROPYL-3H-IMIDAZOL-4-YL]-PYRIMIDIN-2-YL}AMINE' 513.505 
1  ?         ? ?                     ? 
4 non-polymer syn 'UNKNOWN ATOM OR ION'                                                                                    ? 3  ? 
? ?                     ? 
5 water       nat water                                                                                                    18.015 
67 ?         ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;MAPK 10,MAP kinase p49 3F12,Stress-activated protein kinase 1b,SAPK1b,Stress-activated protein kinase JNK3,c-Jun N-terminal kinase 3
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVV
KSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIE
QLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHP
YINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVV
KSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIE
QLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHP
YINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   LYS n 
1 5   SER n 
1 6   LYS n 
1 7   VAL n 
1 8   ASP n 
1 9   ASN n 
1 10  GLN n 
1 11  PHE n 
1 12  TYR n 
1 13  SER n 
1 14  VAL n 
1 15  GLU n 
1 16  VAL n 
1 17  GLY n 
1 18  ASP n 
1 19  SER n 
1 20  THR n 
1 21  PHE n 
1 22  THR n 
1 23  VAL n 
1 24  LEU n 
1 25  LYS n 
1 26  ARG n 
1 27  TYR n 
1 28  GLN n 
1 29  ASN n 
1 30  LEU n 
1 31  LYS n 
1 32  PRO n 
1 33  ILE n 
1 34  GLY n 
1 35  SER n 
1 36  GLY n 
1 37  ALA n 
1 38  GLN n 
1 39  GLY n 
1 40  ILE n 
1 41  VAL n 
1 42  CYS n 
1 43  ALA n 
1 44  ALA n 
1 45  TYR n 
1 46  ASP n 
1 47  ALA n 
1 48  VAL n 
1 49  LEU n 
1 50  ASP n 
1 51  ARG n 
1 52  ASN n 
1 53  VAL n 
1 54  ALA n 
1 55  ILE n 
1 56  LYS n 
1 57  LYS n 
1 58  LEU n 
1 59  SER n 
1 60  ARG n 
1 61  PRO n 
1 62  PHE n 
1 63  GLN n 
1 64  ASN n 
1 65  GLN n 
1 66  THR n 
1 67  HIS n 
1 68  ALA n 
1 69  LYS n 
1 70  ARG n 
1 71  ALA n 
1 72  TYR n 
1 73  ARG n 
1 74  GLU n 
1 75  LEU n 
1 76  VAL n 
1 77  LEU n 
1 78  MET n 
1 79  LYS n 
1 80  CYS n 
1 81  VAL n 
1 82  ASN n 
1 83  HIS n 
1 84  LYS n 
1 85  ASN n 
1 86  ILE n 
1 87  ILE n 
1 88  SER n 
1 89  LEU n 
1 90  LEU n 
1 91  ASN n 
1 92  VAL n 
1 93  PHE n 
1 94  THR n 
1 95  PRO n 
1 96  GLN n 
1 97  LYS n 
1 98  THR n 
1 99  LEU n 
1 100 GLU n 
1 101 GLU n 
1 102 PHE n 
1 103 GLN n 
1 104 ASP n 
1 105 VAL n 
1 106 TYR n 
1 107 LEU n 
1 108 VAL n 
1 109 MET n 
1 110 GLU n 
1 111 LEU n 
1 112 MET n 
1 113 ASP n 
1 114 ALA n 
1 115 ASN n 
1 116 LEU n 
1 117 CYS n 
1 118 GLN n 
1 119 VAL n 
1 120 ILE n 
1 121 GLN n 
1 122 MET n 
1 123 GLU n 
1 124 LEU n 
1 125 ASP n 
1 126 HIS n 
1 127 GLU n 
1 128 ARG n 
1 129 MET n 
1 130 SER n 
1 131 TYR n 
1 132 LEU n 
1 133 LEU n 
1 134 TYR n 
1 135 GLN n 
1 136 MET n 
1 137 LEU n 
1 138 CYS n 
1 139 GLY n 
1 140 ILE n 
1 141 LYS n 
1 142 HIS n 
1 143 LEU n 
1 144 HIS n 
1 145 SER n 
1 146 ALA n 
1 147 GLY n 
1 148 ILE n 
1 149 ILE n 
1 150 HIS n 
1 151 ARG n 
1 152 ASP n 
1 153 LEU n 
1 154 LYS n 
1 155 PRO n 
1 156 SER n 
1 157 ASN n 
1 158 ILE n 
1 159 VAL n 
1 160 VAL n 
1 161 LYS n 
1 162 SER n 
1 163 ASP n 
1 164 CYS n 
1 165 THR n 
1 166 LEU n 
1 167 LYS n 
1 168 ILE n 
1 169 LEU n 
1 170 ASP n 
1 171 PHE n 
1 172 GLY n 
1 173 LEU n 
1 174 ALA n 
1 175 ARG n 
1 176 THR n 
1 177 ALA n 
1 178 GLY n 
1 179 THR n 
1 180 SER n 
1 181 PHE n 
1 182 MET n 
1 183 MET n 
1 184 THR n 
1 185 PRO n 
1 186 TYR n 
1 187 VAL n 
1 188 VAL n 
1 189 THR n 
1 190 ARG n 
1 191 TYR n 
1 192 TYR n 
1 193 ARG n 
1 194 ALA n 
1 195 PRO n 
1 196 GLU n 
1 197 VAL n 
1 198 ILE n 
1 199 LEU n 
1 200 GLY n 
1 201 MET n 
1 202 GLY n 
1 203 TYR n 
1 204 LYS n 
1 205 GLU n 
1 206 ASN n 
1 207 VAL n 
1 208 ASP n 
1 209 ILE n 
1 210 TRP n 
1 211 SER n 
1 212 VAL n 
1 213 GLY n 
1 214 CYS n 
1 215 ILE n 
1 216 MET n 
1 217 GLY n 
1 218 GLU n 
1 219 MET n 
1 220 VAL n 
1 221 ARG n 
1 222 HIS n 
1 223 LYS n 
1 224 ILE n 
1 225 LEU n 
1 226 PHE n 
1 227 PRO n 
1 228 GLY n 
1 229 ARG n 
1 230 ASP n 
1 231 TYR n 
1 232 ILE n 
1 233 ASP n 
1 234 GLN n 
1 235 TRP n 
1 236 ASN n 
1 237 LYS n 
1 238 VAL n 
1 239 ILE n 
1 240 GLU n 
1 241 GLN n 
1 242 LEU n 
1 243 GLY n 
1 244 THR n 
1 245 PRO n 
1 246 CYS n 
1 247 PRO n 
1 248 GLU n 
1 249 PHE n 
1 250 MET n 
1 251 LYS n 
1 252 LYS n 
1 253 LEU n 
1 254 GLN n 
1 255 PRO n 
1 256 THR n 
1 257 VAL n 
1 258 ARG n 
1 259 ASN n 
1 260 TYR n 
1 261 VAL n 
1 262 GLU n 
1 263 ASN n 
1 264 ARG n 
1 265 PRO n 
1 266 LYS n 
1 267 TYR n 
1 268 ALA n 
1 269 GLY n 
1 270 LEU n 
1 271 THR n 
1 272 PHE n 
1 273 PRO n 
1 274 LYS n 
1 275 LEU n 
1 276 PHE n 
1 277 PRO n 
1 278 ASP n 
1 279 SER n 
1 280 LEU n 
1 281 PHE n 
1 282 PRO n 
1 283 ALA n 
1 284 ASP n 
1 285 SER n 
1 286 GLU n 
1 287 HIS n 
1 288 ASN n 
1 289 LYS n 
1 290 LEU n 
1 291 LYS n 
1 292 ALA n 
1 293 SER n 
1 294 GLN n 
1 295 ALA n 
1 296 ARG n 
1 297 ASP n 
1 298 LEU n 
1 299 LEU n 
1 300 SER n 
1 301 LYS n 
1 302 MET n 
1 303 LEU n 
1 304 VAL n 
1 305 ILE n 
1 306 ASP n 
1 307 PRO n 
1 308 ALA n 
1 309 LYS n 
1 310 ARG n 
1 311 ILE n 
1 312 SER n 
1 313 VAL n 
1 314 ASP n 
1 315 ASP n 
1 316 ALA n 
1 317 LEU n 
1 318 GLN n 
1 319 HIS n 
1 320 PRO n 
1 321 TYR n 
1 322 ILE n 
1 323 ASN n 
1 324 VAL n 
1 325 TRP n 
1 326 TYR n 
1 327 ASP n 
1 328 PRO n 
1 329 ALA n 
1 330 GLU n 
1 331 VAL n 
1 332 GLU n 
1 333 ALA n 
1 334 PRO n 
1 335 PRO n 
1 336 PRO n 
1 337 GLN n 
1 338 ILE n 
1 339 TYR n 
1 340 ASP n 
1 341 LYS n 
1 342 GLN n 
1 343 LEU n 
1 344 ASP n 
1 345 GLU n 
1 346 ARG n 
1 347 GLU n 
1 348 HIS n 
1 349 THR n 
1 350 ILE n 
1 351 GLU n 
1 352 GLU n 
1 353 TRP n 
1 354 LYS n 
1 355 GLU n 
1 356 LEU n 
1 357 ILE n 
1 358 TYR n 
1 359 LYS n 
1 360 GLU n 
1 361 VAL n 
1 362 MET n 
1 363 ASN n 
1 364 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   364 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MAPK10, JNK3, JNK3A, PRKM10, SAPK1B' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET15B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MK10_HUMAN 
_struct_ref.pdbx_db_accession          P53779 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVN
HKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKS
DCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQL
GTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYI
NVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNS
;
_struct_ref.pdbx_align_begin           40 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4Z9L 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 364 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P53779 
_struct_ref_seq.db_align_beg                  40 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  401 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       40 
_struct_ref_seq.pdbx_auth_seq_align_end       401 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4Z9L MET A 1 ? UNP P53779 ? ? 'expression tag' 38 1 
1 4Z9L ALA A 2 ? UNP P53779 ? ? 'expression tag' 39 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
880 non-polymer         . 'CYCLOHEXYL-{4-[5-(3,4-DICHLOROPHENYL)-2-PIPERIDIN-4-YL-3-PROPYL-3H-IMIDAZOL-4-YL]-PYRIMIDIN-2-YL}AMINE' 
? 'C27 H34 Cl2 N6'    513.505 
ALA 'L-peptide linking' y ALANINE                                                                                                  
? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER'                                                            
? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                                                                                 
? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                               
? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                          
? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                                 
? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                                
? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                          
? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                                  
? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                                
? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                                    
? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                               
? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                                  
? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                                   
? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                               
? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                            
? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                                  
? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                                   
? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                                                
? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                               
? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                                 
? 'C9 H11 N O3'       181.189 
UNX non-polymer         . 'UNKNOWN ATOM OR ION'                                                                                    
? ?                   ?       
VAL 'L-peptide linking' y VALINE                                                                                                   
? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4Z9L 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.30 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         46.50 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG MME 550, ETHYLENE GLYCOL,  HEPES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         MARRESEARCH 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2000-06-07 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            25.31 
_reflns.entry_id                         4Z9L 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.2 
_reflns.d_resolution_low                 17.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       19586 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.0 
_reflns.percent_possible_obs             95.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.061 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.20 
_reflns_shell.d_res_low                   2.30 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        80.1 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            7.8069 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -3.0291 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -4.7778 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               29.49 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.9182 
_refine.correlation_coeff_Fo_to_Fc_free          0.8926 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4Z9L 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.10 
_refine.ls_d_res_low                             16.94 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     19586 
_refine.ls_number_reflns_R_free                  957 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    84.31 
_refine.ls_percent_reflns_R_free                 4.89 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2010 
_refine.ls_R_factor_R_free                       0.2258 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1997 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      1PMN 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.188 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.187 
_refine.pdbx_overall_SU_R_Blow_DPI               0.256 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.256 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        4Z9L 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.294 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2636 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         69 
_refine_hist.number_atoms_solvent             67 
_refine_hist.number_atoms_total               2772 
_refine_hist.d_res_high                       2.10 
_refine_hist.d_res_low                        16.94 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 2826 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 0.99  ? 3889 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 961  ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 64   ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 447  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 2826 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_nbd                     ?     ?            
'X-RAY DIFFRACTION' ? 3.23  ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 16.71 ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 355  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? 1    ? t_sum_occupancies         1.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 3303 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.21 
_refine_ls_shell.number_reflns_all                1182 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             65 
_refine_ls_shell.number_reflns_R_work             1117 
_refine_ls_shell.percent_reflns_obs               35.39 
_refine_ls_shell.percent_reflns_R_free            5.50 
_refine_ls_shell.R_factor_all                     0.1870 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3129 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.1792 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     4Z9L 
_struct.title                        'THE STRUCTURE OF JNK3 IN COMPLEX WITH AN IMIDAZOLE-PYRIMIDINE INHIBITOR' 
_struct.pdbx_descriptor              'MITOGEN-ACTIVATED PROTEIN KINASE 10 (E.C.2.7.11.24)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4Z9L 
_struct_keywords.text            'MAP KINASE, APOPTOSIS, INHIBITION, TRANSFERASE, TRANSFERASE-INHIBITOR complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/INHIBITOR 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 61  ? GLN A 63  ? PRO A 98  GLN A 100 5 ? 3  
HELX_P HELX_P2  AA2 ASN A 64  ? MET A 78  ? ASN A 101 MET A 115 1 ? 15 
HELX_P HELX_P3  AA3 LEU A 116 ? GLN A 121 ? LEU A 153 GLN A 158 1 ? 6  
HELX_P HELX_P4  AA4 ASP A 125 ? ALA A 146 ? ASP A 162 ALA A 183 1 ? 22 
HELX_P HELX_P5  AA5 LYS A 154 ? SER A 156 ? LYS A 191 SER A 193 5 ? 3  
HELX_P HELX_P6  AA6 ALA A 194 ? LEU A 199 ? ALA A 231 LEU A 236 1 ? 6  
HELX_P HELX_P7  AA7 ASN A 206 ? HIS A 222 ? ASN A 243 HIS A 259 1 ? 17 
HELX_P HELX_P8  AA8 ASP A 230 ? GLY A 243 ? ASP A 267 GLY A 280 1 ? 14 
HELX_P HELX_P9  AA9 CYS A 246 ? LYS A 251 ? CYS A 283 LYS A 288 1 ? 6  
HELX_P HELX_P10 AB1 GLN A 254 ? ASN A 263 ? GLN A 291 ASN A 300 1 ? 10 
HELX_P HELX_P11 AB2 THR A 271 ? PHE A 276 ? THR A 308 PHE A 313 1 ? 6  
HELX_P HELX_P12 AB3 PRO A 277 ? PHE A 281 ? PRO A 314 PHE A 318 5 ? 5  
HELX_P HELX_P13 AB4 SER A 285 ? LEU A 303 ? SER A 322 LEU A 340 1 ? 19 
HELX_P HELX_P14 AB5 SER A 312 ? HIS A 319 ? SER A 349 HIS A 356 1 ? 8  
HELX_P HELX_P15 AB6 HIS A 319 ? VAL A 324 ? HIS A 356 VAL A 361 1 ? 6  
HELX_P HELX_P16 AB7 ASP A 327 ? GLU A 332 ? ASP A 364 GLU A 369 1 ? 6  
HELX_P HELX_P17 AB8 THR A 349 ? ASN A 363 ? THR A 386 ASN A 400 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 11  ? VAL A 16  ? PHE A 48  VAL A 53  
AA1 2 SER A 19  ? LEU A 24  ? SER A 56  LEU A 61  
AA2 1 TYR A 27  ? SER A 35  ? TYR A 64  SER A 72  
AA2 2 ILE A 40  ? ASP A 46  ? ILE A 77  ASP A 83  
AA2 3 ARG A 51  ? SER A 59  ? ARG A 88  SER A 96  
AA2 4 ASP A 104 ? GLU A 110 ? ASP A 141 GLU A 147 
AA2 5 ASN A 91  ? PHE A 93  ? ASN A 128 PHE A 130 
AA3 1 ALA A 114 ? ASN A 115 ? ALA A 151 ASN A 152 
AA3 2 ILE A 158 ? VAL A 160 ? ILE A 195 VAL A 197 
AA3 3 LEU A 166 ? ILE A 168 ? LEU A 203 ILE A 205 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 16  ? N VAL A 53  O SER A 19  ? O SER A 56  
AA2 1 2 N GLN A 28  ? N GLN A 65  O TYR A 45  ? O TYR A 82  
AA2 2 3 N ALA A 44  ? N ALA A 81  O VAL A 53  ? O VAL A 90  
AA2 3 4 N LEU A 58  ? N LEU A 95  O VAL A 105 ? O VAL A 142 
AA2 4 5 O TYR A 106 ? O TYR A 143 N PHE A 93  ? N PHE A 130 
AA3 1 2 N ALA A 114 ? N ALA A 151 O VAL A 160 ? O VAL A 197 
AA3 2 3 N VAL A 159 ? N VAL A 196 O LYS A 167 ? O LYS A 204 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ANP 501 ? 12 'binding site for residue ANP A 501' 
AC2 Software A 880 502 ? 15 'binding site for residue 880 A 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 GLY A 36  ? GLY A 73  . ? 1_555 ? 
2  AC1 12 ALA A 37  ? ALA A 74  . ? 1_555 ? 
3  AC1 12 GLN A 38  ? GLN A 75  . ? 1_555 ? 
4  AC1 12 ARG A 70  ? ARG A 107 . ? 1_555 ? 
5  AC1 12 SER A 156 ? SER A 193 . ? 1_555 ? 
6  AC1 12 ASN A 157 ? ASN A 194 . ? 1_555 ? 
7  AC1 12 THR A 189 ? THR A 226 . ? 1_555 ? 
8  AC1 12 TYR A 192 ? TYR A 229 . ? 1_555 ? 
9  AC1 12 GLU A 218 ? GLU A 255 . ? 1_555 ? 
10 AC1 12 ILE A 224 ? ILE A 261 . ? 1_555 ? 
11 AC1 12 880 C .   ? 880 A 502 . ? 1_555 ? 
12 AC1 12 HOH G .   ? HOH A 612 . ? 1_555 ? 
13 AC2 15 ILE A 33  ? ILE A 70  . ? 1_555 ? 
14 AC2 15 VAL A 41  ? VAL A 78  . ? 1_555 ? 
15 AC2 15 ALA A 54  ? ALA A 91  . ? 1_555 ? 
16 AC2 15 LYS A 56  ? LYS A 93  . ? 1_555 ? 
17 AC2 15 ILE A 87  ? ILE A 124 . ? 1_555 ? 
18 AC2 15 LEU A 107 ? LEU A 144 . ? 1_555 ? 
19 AC2 15 MET A 109 ? MET A 146 . ? 1_555 ? 
20 AC2 15 GLU A 110 ? GLU A 147 . ? 1_555 ? 
21 AC2 15 MET A 112 ? MET A 149 . ? 1_555 ? 
22 AC2 15 ASP A 113 ? ASP A 150 . ? 1_555 ? 
23 AC2 15 GLN A 118 ? GLN A 155 . ? 1_555 ? 
24 AC2 15 SER A 156 ? SER A 193 . ? 1_555 ? 
25 AC2 15 ASN A 157 ? ASN A 194 . ? 1_555 ? 
26 AC2 15 ANP B .   ? ANP A 501 . ? 1_555 ? 
27 AC2 15 HOH G .   ? HOH A 630 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4Z9L 
_atom_sites.fract_transf_matrix[1][1]   0.019627 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013981 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009434 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
O  
P  
S  
X  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N      . ASP A 1 8   ? 21.826 16.760  58.663 1.00 49.54  ? 45  ASP A N      1 
ATOM   2    C  CA     . ASP A 1 8   ? 20.700 15.881  58.371 1.00 47.84  ? 45  ASP A CA     1 
ATOM   3    C  C      . ASP A 1 8   ? 21.165 14.432  58.202 1.00 47.15  ? 45  ASP A C      1 
ATOM   4    O  O      . ASP A 1 8   ? 21.836 14.091  57.215 1.00 44.87  ? 45  ASP A O      1 
ATOM   5    C  CB     . ASP A 1 8   ? 19.939 16.367  57.128 1.00 49.04  ? 45  ASP A CB     1 
ATOM   6    C  CG     . ASP A 1 8   ? 18.520 15.838  56.972 1.00 58.74  ? 45  ASP A CG     1 
ATOM   7    O  OD1    . ASP A 1 8   ? 18.301 14.638  57.231 1.00 55.98  ? 45  ASP A OD1    1 
ATOM   8    O  OD2    . ASP A 1 8   ? 17.646 16.608  56.503 1.00 68.39  ? 45  ASP A OD2    1 
ATOM   9    N  N      . ASN A 1 9   ? 20.782 13.588  59.194 1.00 40.21  ? 46  ASN A N      1 
ATOM   10   C  CA     . ASN A 1 9   ? 21.035 12.151  59.322 1.00 38.55  ? 46  ASN A CA     1 
ATOM   11   C  C      . ASN A 1 9   ? 20.538 11.323  58.123 1.00 34.61  ? 46  ASN A C      1 
ATOM   12   O  O      . ASN A 1 9   ? 20.985 10.190  57.947 1.00 30.14  ? 46  ASN A O      1 
ATOM   13   C  CB     . ASN A 1 9   ? 20.355 11.630  60.603 1.00 42.80  ? 46  ASN A CB     1 
ATOM   14   C  CG     . ASN A 1 9   ? 18.847 11.824  60.592 1.00 74.58  ? 46  ASN A CG     1 
ATOM   15   O  OD1    . ASN A 1 9   ? 18.084 10.946  60.162 1.00 68.10  ? 46  ASN A OD1    1 
ATOM   16   N  ND2    . ASN A 1 9   ? 18.385 13.004  61.005 1.00 68.83  ? 46  ASN A ND2    1 
ATOM   17   N  N      . GLN A 1 10  ? 19.577 11.860  57.344 1.00 29.62  ? 47  GLN A N      1 
ATOM   18   C  CA     . GLN A 1 10  ? 19.011 11.165  56.174 1.00 28.00  ? 47  GLN A CA     1 
ATOM   19   C  C      . GLN A 1 10  ? 19.965 11.120  54.995 1.00 28.05  ? 47  GLN A C      1 
ATOM   20   O  O      . GLN A 1 10  ? 19.766 10.319  54.084 1.00 27.24  ? 47  GLN A O      1 
ATOM   21   C  CB     . GLN A 1 10  ? 17.678 11.807  55.728 1.00 28.71  ? 47  GLN A CB     1 
ATOM   22   C  CG     . GLN A 1 10  ? 16.531 11.641  56.738 1.00 41.02  ? 47  GLN A CG     1 
ATOM   23   C  CD     . GLN A 1 10  ? 15.310 12.467  56.384 1.00 50.67  ? 47  GLN A CD     1 
ATOM   24   O  OE1    . GLN A 1 10  ? 14.171 11.977  56.410 1.00 35.23  ? 47  GLN A OE1    1 
ATOM   25   N  NE2    . GLN A 1 10  ? 15.514 13.744  56.055 1.00 48.24  ? 47  GLN A NE2    1 
ATOM   26   N  N      . PHE A 1 11  ? 20.985 11.985  54.998 1.00 23.99  ? 48  PHE A N      1 
ATOM   27   C  CA     . PHE A 1 11  ? 21.910 12.143  53.870 1.00 22.85  ? 48  PHE A CA     1 
ATOM   28   C  C      . PHE A 1 11  ? 23.335 11.713  54.186 1.00 29.79  ? 48  PHE A C      1 
ATOM   29   O  O      . PHE A 1 11  ? 23.727 11.677  55.352 1.00 29.69  ? 48  PHE A O      1 
ATOM   30   C  CB     . PHE A 1 11  ? 21.928 13.622  53.413 1.00 22.20  ? 48  PHE A CB     1 
ATOM   31   C  CG     . PHE A 1 11  ? 20.599 14.187  52.955 1.00 21.54  ? 48  PHE A CG     1 
ATOM   32   C  CD1    . PHE A 1 11  ? 19.703 14.738  53.871 1.00 23.28  ? 48  PHE A CD1    1 
ATOM   33   C  CD2    . PHE A 1 11  ? 20.264 14.214  51.608 1.00 20.05  ? 48  PHE A CD2    1 
ATOM   34   C  CE1    . PHE A 1 11  ? 18.476 15.269  53.448 1.00 21.76  ? 48  PHE A CE1    1 
ATOM   35   C  CE2    . PHE A 1 11  ? 19.032 14.730  51.188 1.00 21.75  ? 48  PHE A CE2    1 
ATOM   36   C  CZ     . PHE A 1 11  ? 18.146 15.253  52.116 1.00 20.22  ? 48  PHE A CZ     1 
ATOM   37   N  N      . TYR A 1 12  ? 24.115 11.426  53.129 1.00 26.31  ? 49  TYR A N      1 
ATOM   38   C  CA     . TYR A 1 12  ? 25.539 11.112  53.234 1.00 26.89  ? 49  TYR A CA     1 
ATOM   39   C  C      . TYR A 1 12  ? 26.271 11.691  52.020 1.00 30.88  ? 49  TYR A C      1 
ATOM   40   O  O      . TYR A 1 12  ? 25.684 11.798  50.945 1.00 28.00  ? 49  TYR A O      1 
ATOM   41   C  CB     . TYR A 1 12  ? 25.809 9.602   53.443 1.00 27.71  ? 49  TYR A CB     1 
ATOM   42   C  CG     . TYR A 1 12  ? 25.748 8.781   52.176 1.00 26.31  ? 49  TYR A CG     1 
ATOM   43   C  CD1    . TYR A 1 12  ? 24.526 8.429   51.608 1.00 26.22  ? 49  TYR A CD1    1 
ATOM   44   C  CD2    . TYR A 1 12  ? 26.910 8.313   51.569 1.00 27.63  ? 49  TYR A CD2    1 
ATOM   45   C  CE1    . TYR A 1 12  ? 24.461 7.665   50.443 1.00 22.08  ? 49  TYR A CE1    1 
ATOM   46   C  CE2    . TYR A 1 12  ? 26.858 7.538   50.406 1.00 27.57  ? 49  TYR A CE2    1 
ATOM   47   C  CZ     . TYR A 1 12  ? 25.630 7.238   49.836 1.00 26.83  ? 49  TYR A CZ     1 
ATOM   48   O  OH     . TYR A 1 12  ? 25.568 6.495   48.692 1.00 25.40  ? 49  TYR A OH     1 
ATOM   49   N  N      . SER A 1 13  ? 27.538 12.077  52.191 1.00 31.17  ? 50  SER A N      1 
ATOM   50   C  CA     . SER A 1 13  ? 28.321 12.667  51.100 1.00 31.17  ? 50  SER A CA     1 
ATOM   51   C  C      . SER A 1 13  ? 29.319 11.707  50.469 1.00 37.37  ? 50  SER A C      1 
ATOM   52   O  O      . SER A 1 13  ? 29.998 10.971  51.185 1.00 38.06  ? 50  SER A O      1 
ATOM   53   C  CB     . SER A 1 13  ? 29.028 13.931  51.574 1.00 34.09  ? 50  SER A CB     1 
ATOM   54   O  OG     . SER A 1 13  ? 28.091 14.977  51.750 1.00 37.92  ? 50  SER A OG     1 
ATOM   55   N  N      . VAL A 1 14  ? 29.410 11.727  49.121 1.00 34.08  ? 51  VAL A N      1 
ATOM   56   C  CA     . VAL A 1 14  ? 30.342 10.903  48.336 1.00 35.27  ? 51  VAL A CA     1 
ATOM   57   C  C      . VAL A 1 14  ? 31.159 11.764  47.387 1.00 41.49  ? 51  VAL A C      1 
ATOM   58   O  O      . VAL A 1 14  ? 30.625 12.705  46.796 1.00 38.62  ? 51  VAL A O      1 
ATOM   59   C  CB     . VAL A 1 14  ? 29.707 9.703   47.579 1.00 38.94  ? 51  VAL A CB     1 
ATOM   60   C  CG1    . VAL A 1 14  ? 29.711 8.440   48.427 1.00 40.50  ? 51  VAL A CG1    1 
ATOM   61   C  CG2    . VAL A 1 14  ? 28.313 10.014  47.052 1.00 37.07  ? 51  VAL A CG2    1 
ATOM   62   N  N      . GLU A 1 15  ? 32.450 11.434  47.230 1.00 43.01  ? 52  GLU A N      1 
ATOM   63   C  CA     . GLU A 1 15  ? 33.332 12.159  46.321 1.00 44.65  ? 52  GLU A CA     1 
ATOM   64   C  C      . GLU A 1 15  ? 33.143 11.645  44.907 1.00 48.91  ? 52  GLU A C      1 
ATOM   65   O  O      . GLU A 1 15  ? 33.350 10.461  44.661 1.00 50.28  ? 52  GLU A O      1 
ATOM   66   C  CB     . GLU A 1 15  ? 34.807 12.069  46.763 1.00 48.50  ? 52  GLU A CB     1 
ATOM   67   C  CG     . GLU A 1 15  ? 35.220 13.165  47.735 1.00 62.27  ? 52  GLU A CG     1 
ATOM   68   C  CD     . GLU A 1 15  ? 34.999 14.593  47.267 1.00 92.01  ? 52  GLU A CD     1 
ATOM   69   O  OE1    . GLU A 1 15  ? 35.415 14.927  46.134 1.00 98.81  ? 52  GLU A OE1    1 
ATOM   70   O  OE2    . GLU A 1 15  ? 34.401 15.379  48.037 1.00 86.77  ? 52  GLU A OE2    1 
ATOM   71   N  N      . VAL A 1 16  ? 32.677 12.520  43.999 1.00 44.35  ? 53  VAL A N      1 
ATOM   72   C  CA     . VAL A 1 16  ? 32.440 12.211  42.581 1.00 44.04  ? 53  VAL A CA     1 
ATOM   73   C  C      . VAL A 1 16  ? 33.293 13.184  41.743 1.00 49.45  ? 53  VAL A C      1 
ATOM   74   O  O      . VAL A 1 16  ? 32.873 14.315  41.450 1.00 47.91  ? 53  VAL A O      1 
ATOM   75   C  CB     . VAL A 1 16  ? 30.927 12.195  42.207 1.00 46.13  ? 53  VAL A CB     1 
ATOM   76   C  CG1    . VAL A 1 16  ? 30.717 12.019  40.706 1.00 45.22  ? 53  VAL A CG1    1 
ATOM   77   C  CG2    . VAL A 1 16  ? 30.183 11.104  42.976 1.00 46.12  ? 53  VAL A CG2    1 
ATOM   78   N  N      . GLY A 1 17  ? 34.517 12.744  41.443 1.00 48.17  ? 54  GLY A N      1 
ATOM   79   C  CA     . GLY A 1 17  ? 35.501 13.534  40.718 1.00 49.18  ? 54  GLY A CA     1 
ATOM   80   C  C      . GLY A 1 17  ? 35.928 14.706  41.570 1.00 55.63  ? 54  GLY A C      1 
ATOM   81   O  O      . GLY A 1 17  ? 36.515 14.517  42.643 1.00 57.11  ? 54  GLY A O      1 
ATOM   82   N  N      . ASP A 1 18  ? 35.562 15.918  41.131 1.00 51.93  ? 55  ASP A N      1 
ATOM   83   C  CA     . ASP A 1 18  ? 35.849 17.162  41.849 1.00 52.80  ? 55  ASP A CA     1 
ATOM   84   C  C      . ASP A 1 18  ? 34.629 17.582  42.675 1.00 55.23  ? 55  ASP A C      1 
ATOM   85   O  O      . ASP A 1 18  ? 34.755 18.386  43.606 1.00 56.14  ? 55  ASP A O      1 
ATOM   86   C  CB     . ASP A 1 18  ? 36.238 18.273  40.859 1.00 55.02  ? 55  ASP A CB     1 
ATOM   87   N  N      . SER A 1 19  ? 33.456 17.006  42.341 1.00 48.45  ? 56  SER A N      1 
ATOM   88   C  CA     . SER A 1 19  ? 32.161 17.294  42.959 1.00 45.87  ? 56  SER A CA     1 
ATOM   89   C  C      . SER A 1 19  ? 31.803 16.388  44.147 1.00 44.88  ? 56  SER A C      1 
ATOM   90   O  O      . SER A 1 19  ? 32.229 15.236  44.214 1.00 45.30  ? 56  SER A O      1 
ATOM   91   C  CB     . SER A 1 19  ? 31.061 17.208  41.905 1.00 48.54  ? 56  SER A CB     1 
ATOM   92   O  OG     . SER A 1 19  ? 29.842 17.744  42.391 1.00 60.39  ? 56  SER A OG     1 
ATOM   93   N  N      . THR A 1 20  ? 30.991 16.917  45.068 1.00 36.80  ? 57  THR A N      1 
ATOM   94   C  CA     . THR A 1 20  ? 30.481 16.167  46.204 1.00 34.22  ? 57  THR A CA     1 
ATOM   95   C  C      . THR A 1 20  ? 28.984 15.892  45.978 1.00 30.26  ? 57  THR A C      1 
ATOM   96   O  O      . THR A 1 20  ? 28.197 16.826  45.767 1.00 27.98  ? 57  THR A O      1 
ATOM   97   C  CB     . THR A 1 20  ? 30.763 16.888  47.541 1.00 40.35  ? 57  THR A CB     1 
ATOM   98   O  OG1    . THR A 1 20  ? 32.155 17.177  47.650 1.00 41.24  ? 57  THR A OG1    1 
ATOM   99   C  CG2    . THR A 1 20  ? 30.347 16.056  48.744 1.00 37.82  ? 57  THR A CG2    1 
ATOM   100  N  N      . PHE A 1 21  ? 28.604 14.613  45.997 1.00 22.33  ? 58  PHE A N      1 
ATOM   101  C  CA     . PHE A 1 21  ? 27.203 14.238  45.891 1.00 20.66  ? 58  PHE A CA     1 
ATOM   102  C  C      . PHE A 1 21  ? 26.665 13.979  47.307 1.00 25.07  ? 58  PHE A C      1 
ATOM   103  O  O      . PHE A 1 21  ? 27.131 13.050  47.970 1.00 26.45  ? 58  PHE A O      1 
ATOM   104  C  CB     . PHE A 1 21  ? 27.028 13.009  44.979 1.00 21.74  ? 58  PHE A CB     1 
ATOM   105  C  CG     . PHE A 1 21  ? 26.657 13.302  43.538 1.00 22.02  ? 58  PHE A CG     1 
ATOM   106  C  CD1    . PHE A 1 21  ? 27.511 14.028  42.715 1.00 25.04  ? 58  PHE A CD1    1 
ATOM   107  C  CD2    . PHE A 1 21  ? 25.471 12.813  42.994 1.00 21.40  ? 58  PHE A CD2    1 
ATOM   108  C  CE1    . PHE A 1 21  ? 27.187 14.255  41.372 1.00 24.43  ? 58  PHE A CE1    1 
ATOM   109  C  CE2    . PHE A 1 21  ? 25.140 13.057  41.658 1.00 22.57  ? 58  PHE A CE2    1 
ATOM   110  C  CZ     . PHE A 1 21  ? 26.001 13.771  40.853 1.00 21.33  ? 58  PHE A CZ     1 
ATOM   111  N  N      . THR A 1 22  ? 25.745 14.834  47.799 1.00 20.84  ? 59  THR A N      1 
ATOM   112  C  CA     . THR A 1 22  ? 25.120 14.656  49.133 1.00 20.81  ? 59  THR A CA     1 
ATOM   113  C  C      . THR A 1 22  ? 23.723 14.126  48.871 1.00 23.42  ? 59  THR A C      1 
ATOM   114  O  O      . THR A 1 22  ? 22.835 14.866  48.434 1.00 20.40  ? 59  THR A O      1 
ATOM   115  C  CB     . THR A 1 22  ? 25.172 15.916  49.972 1.00 24.98  ? 59  THR A CB     1 
ATOM   116  O  OG1    . THR A 1 22  ? 26.534 16.326  50.033 1.00 26.85  ? 59  THR A OG1    1 
ATOM   117  C  CG2    . THR A 1 22  ? 24.613 15.705  51.398 1.00 22.94  ? 59  THR A CG2    1 
ATOM   118  N  N      . VAL A 1 23  ? 23.569 12.807  49.025 1.00 20.06  ? 60  VAL A N      1 
ATOM   119  C  CA     . VAL A 1 23  ? 22.331 12.131  48.660 1.00 19.16  ? 60  VAL A CA     1 
ATOM   120  C  C      . VAL A 1 23  ? 21.673 11.416  49.833 1.00 23.13  ? 60  VAL A C      1 
ATOM   121  O  O      . VAL A 1 23  ? 22.342 11.129  50.821 1.00 23.21  ? 60  VAL A O      1 
ATOM   122  C  CB     . VAL A 1 23  ? 22.571 11.180  47.454 1.00 22.34  ? 60  VAL A CB     1 
ATOM   123  C  CG1    . VAL A 1 23  ? 23.175 11.935  46.266 1.00 20.96  ? 60  VAL A CG1    1 
ATOM   124  C  CG2    . VAL A 1 23  ? 23.461 9.984   47.851 1.00 23.39  ? 60  VAL A CG2    1 
ATOM   125  N  N      . LEU A 1 24  ? 20.378 11.063  49.681 1.00 19.79  ? 61  LEU A N      1 
ATOM   126  C  CA     . LEU A 1 24  ? 19.612 10.293  50.673 1.00 19.43  ? 61  LEU A CA     1 
ATOM   127  C  C      . LEU A 1 24  ? 20.272 8.923   50.772 1.00 23.76  ? 61  LEU A C      1 
ATOM   128  O  O      . LEU A 1 24  ? 20.705 8.385   49.759 1.00 21.40  ? 61  LEU A O      1 
ATOM   129  C  CB     . LEU A 1 24  ? 18.148 10.141  50.203 1.00 18.39  ? 61  LEU A CB     1 
ATOM   130  C  CG     . LEU A 1 24  ? 17.284 11.421  50.249 1.00 19.47  ? 61  LEU A CG     1 
ATOM   131  C  CD1    . LEU A 1 24  ? 16.038 11.268  49.378 1.00 16.42  ? 61  LEU A CD1    1 
ATOM   132  C  CD2    . LEU A 1 24  ? 16.910 11.791  51.691 1.00 16.88  ? 61  LEU A CD2    1 
ATOM   133  N  N      . LYS A 1 25  ? 20.394 8.386   51.995 1.00 22.25  ? 62  LYS A N      1 
ATOM   134  C  CA     . LYS A 1 25  ? 21.060 7.106   52.280 1.00 21.20  ? 62  LYS A CA     1 
ATOM   135  C  C      . LYS A 1 25  ? 20.477 5.913   51.526 1.00 23.58  ? 62  LYS A C      1 
ATOM   136  O  O      . LYS A 1 25  ? 21.180 4.931   51.353 1.00 25.53  ? 62  LYS A O      1 
ATOM   137  C  CB     . LYS A 1 25  ? 21.127 6.844   53.795 1.00 22.78  ? 62  LYS A CB     1 
ATOM   138  C  CG     . LYS A 1 25  ? 22.127 7.773   54.479 1.00 23.58  ? 62  LYS A CG     1 
ATOM   139  C  CD     . LYS A 1 25  ? 22.058 7.667   56.006 1.00 27.94  ? 62  LYS A CD     1 
ATOM   140  C  CE     . LYS A 1 25  ? 23.247 8.318   56.650 1.00 33.19  ? 62  LYS A CE     1 
ATOM   141  N  NZ     . LYS A 1 25  ? 23.093 8.386   58.122 1.00 34.95  ? 62  LYS A NZ     1 
ATOM   142  N  N      . ARG A 1 26  ? 19.248 6.013   51.013 1.00 18.97  ? 63  ARG A N      1 
ATOM   143  C  CA     . ARG A 1 26  ? 18.621 4.974   50.184 1.00 18.65  ? 63  ARG A CA     1 
ATOM   144  C  C      . ARG A 1 26  ? 19.391 4.717   48.848 1.00 23.31  ? 63  ARG A C      1 
ATOM   145  O  O      . ARG A 1 26  ? 19.207 3.660   48.261 1.00 24.61  ? 63  ARG A O      1 
ATOM   146  C  CB     . ARG A 1 26  ? 17.155 5.359   49.865 1.00 18.28  ? 63  ARG A CB     1 
ATOM   147  C  CG     . ARG A 1 26  ? 16.999 6.616   48.961 1.00 21.62  ? 63  ARG A CG     1 
ATOM   148  C  CD     . ARG A 1 26  ? 15.554 7.024   48.704 1.00 18.74  ? 63  ARG A CD     1 
ATOM   149  N  NE     . ARG A 1 26  ? 14.827 6.125   47.797 1.00 12.53  ? 63  ARG A NE     1 
ATOM   150  C  CZ     . ARG A 1 26  ? 13.518 6.197   47.584 1.00 24.60  ? 63  ARG A CZ     1 
ATOM   151  N  NH1    . ARG A 1 26  ? 12.780 7.091   48.233 1.00 24.28  ? 63  ARG A NH1    1 
ATOM   152  N  NH2    . ARG A 1 26  ? 12.935 5.379   46.723 1.00 16.05  ? 63  ARG A NH2    1 
ATOM   153  N  N      . TYR A 1 27  ? 20.176 5.707   48.346 1.00 19.26  ? 64  TYR A N      1 
ATOM   154  C  CA     . TYR A 1 27  ? 20.946 5.632   47.087 1.00 17.83  ? 64  TYR A CA     1 
ATOM   155  C  C      . TYR A 1 27  ? 22.345 5.223   47.390 1.00 23.41  ? 64  TYR A C      1 
ATOM   156  O  O      . TYR A 1 27  ? 23.057 5.921   48.105 1.00 23.98  ? 64  TYR A O      1 
ATOM   157  C  CB     . TYR A 1 27  ? 20.917 6.973   46.332 1.00 16.91  ? 64  TYR A CB     1 
ATOM   158  C  CG     . TYR A 1 27  ? 19.512 7.422   46.036 1.00 16.11  ? 64  TYR A CG     1 
ATOM   159  C  CD1    . TYR A 1 27  ? 18.663 6.646   45.251 1.00 17.62  ? 64  TYR A CD1    1 
ATOM   160  C  CD2    . TYR A 1 27  ? 19.010 8.608   46.573 1.00 15.34  ? 64  TYR A CD2    1 
ATOM   161  C  CE1    . TYR A 1 27  ? 17.353 7.047   44.989 1.00 18.06  ? 64  TYR A CE1    1 
ATOM   162  C  CE2    . TYR A 1 27  ? 17.692 8.996   46.354 1.00 15.73  ? 64  TYR A CE2    1 
ATOM   163  C  CZ     . TYR A 1 27  ? 16.874 8.225   45.538 1.00 19.41  ? 64  TYR A CZ     1 
ATOM   164  O  OH     . TYR A 1 27  ? 15.567 8.583   45.322 1.00 16.56  ? 64  TYR A OH     1 
ATOM   165  N  N      . GLN A 1 28  ? 22.719 4.052   46.898 1.00 22.64  ? 65  GLN A N      1 
ATOM   166  C  CA     . GLN A 1 28  ? 23.967 3.407   47.238 1.00 23.39  ? 65  GLN A CA     1 
ATOM   167  C  C      . GLN A 1 28  ? 24.821 3.088   46.035 1.00 26.33  ? 65  GLN A C      1 
ATOM   168  O  O      . GLN A 1 28  ? 24.294 2.919   44.930 1.00 24.33  ? 65  GLN A O      1 
ATOM   169  C  CB     . GLN A 1 28  ? 23.635 2.115   48.006 1.00 26.77  ? 65  GLN A CB     1 
ATOM   170  C  CG     . GLN A 1 28  ? 23.090 2.374   49.417 1.00 41.15  ? 65  GLN A CG     1 
ATOM   171  C  CD     . GLN A 1 28  ? 22.169 1.289   49.939 1.00 57.28  ? 65  GLN A CD     1 
ATOM   172  O  OE1    . GLN A 1 28  ? 22.206 0.122   49.511 1.00 48.26  ? 65  GLN A OE1    1 
ATOM   173  N  NE2    . GLN A 1 28  ? 21.334 1.655   50.908 1.00 50.42  ? 65  GLN A NE2    1 
ATOM   174  N  N      . ASN A 1 29  ? 26.143 2.917   46.283 1.00 24.70  ? 66  ASN A N      1 
ATOM   175  C  CA     . ASN A 1 29  ? 27.170 2.566   45.302 1.00 25.73  ? 66  ASN A CA     1 
ATOM   176  C  C      . ASN A 1 29  ? 27.152 3.558   44.147 1.00 25.95  ? 66  ASN A C      1 
ATOM   177  O  O      . ASN A 1 29  ? 27.021 3.158   42.992 1.00 24.14  ? 66  ASN A O      1 
ATOM   178  C  CB     . ASN A 1 29  ? 26.992 1.110   44.800 1.00 27.63  ? 66  ASN A CB     1 
ATOM   179  C  CG     . ASN A 1 29  ? 28.191 0.534   44.075 1.00 55.95  ? 66  ASN A CG     1 
ATOM   180  O  OD1    . ASN A 1 29  ? 28.051 -0.139  43.048 1.00 53.19  ? 66  ASN A OD1    1 
ATOM   181  N  ND2    . ASN A 1 29  ? 29.393 0.767   44.592 1.00 47.13  ? 66  ASN A ND2    1 
ATOM   182  N  N      . LEU A 1 30  ? 27.249 4.862   44.469 1.00 22.09  ? 67  LEU A N      1 
ATOM   183  C  CA     . LEU A 1 30  ? 27.217 5.896   43.444 1.00 21.36  ? 67  LEU A CA     1 
ATOM   184  C  C      . LEU A 1 30  ? 28.397 5.770   42.467 1.00 26.38  ? 67  LEU A C      1 
ATOM   185  O  O      . LEU A 1 30  ? 29.537 5.580   42.889 1.00 26.56  ? 67  LEU A O      1 
ATOM   186  C  CB     . LEU A 1 30  ? 27.098 7.299   44.059 1.00 20.60  ? 67  LEU A CB     1 
ATOM   187  C  CG     . LEU A 1 30  ? 25.675 7.879   44.155 1.00 23.15  ? 67  LEU A CG     1 
ATOM   188  C  CD1    . LEU A 1 30  ? 24.853 7.200   45.248 1.00 24.45  ? 67  LEU A CD1    1 
ATOM   189  C  CD2    . LEU A 1 30  ? 25.715 9.373   44.387 1.00 22.87  ? 67  LEU A CD2    1 
ATOM   190  N  N      . LYS A 1 31  ? 28.106 5.810   41.162 1.00 22.68  ? 68  LYS A N      1 
ATOM   191  C  CA     . LYS A 1 31  ? 29.136 5.690   40.124 1.00 23.28  ? 68  LYS A CA     1 
ATOM   192  C  C      . LYS A 1 31  ? 28.931 6.776   39.067 1.00 26.73  ? 68  LYS A C      1 
ATOM   193  O  O      . LYS A 1 31  ? 27.849 6.833   38.481 1.00 24.49  ? 68  LYS A O      1 
ATOM   194  C  CB     . LYS A 1 31  ? 29.120 4.283   39.476 1.00 26.02  ? 68  LYS A CB     1 
ATOM   195  C  CG     . LYS A 1 31  ? 29.361 3.133   40.462 1.00 44.61  ? 68  LYS A CG     1 
ATOM   196  C  CD     . LYS A 1 31  ? 29.980 1.896   39.826 1.00 65.05  ? 68  LYS A CD     1 
ATOM   197  C  CE     . LYS A 1 31  ? 30.468 0.938   40.896 1.00 84.48  ? 68  LYS A CE     1 
ATOM   198  N  NZ     . LYS A 1 31  ? 31.375 -0.114  40.359 1.00 94.57  ? 68  LYS A NZ     1 
ATOM   199  N  N      . PRO A 1 32  ? 29.944 7.622   38.772 1.00 25.11  ? 69  PRO A N      1 
ATOM   200  C  CA     . PRO A 1 32  ? 29.762 8.650   37.720 1.00 23.24  ? 69  PRO A CA     1 
ATOM   201  C  C      . PRO A 1 32  ? 29.433 8.010   36.370 1.00 26.47  ? 69  PRO A C      1 
ATOM   202  O  O      . PRO A 1 32  ? 30.025 6.974   36.038 1.00 27.48  ? 69  PRO A O      1 
ATOM   203  C  CB     . PRO A 1 32  ? 31.122 9.359   37.669 1.00 25.92  ? 69  PRO A CB     1 
ATOM   204  C  CG     . PRO A 1 32  ? 31.795 9.019   38.958 1.00 32.98  ? 69  PRO A CG     1 
ATOM   205  C  CD     . PRO A 1 32  ? 31.305 7.669   39.348 1.00 28.77  ? 69  PRO A CD     1 
ATOM   206  N  N      . ILE A 1 33  ? 28.456 8.572   35.609 1.00 20.07  ? 70  ILE A N      1 
ATOM   207  C  CA     . ILE A 1 33  ? 28.097 7.978   34.288 1.00 18.61  ? 70  ILE A CA     1 
ATOM   208  C  C      . ILE A 1 33  ? 28.119 9.017   33.170 1.00 22.16  ? 70  ILE A C      1 
ATOM   209  O  O      . ILE A 1 33  ? 27.903 8.682   32.004 1.00 21.53  ? 70  ILE A O      1 
ATOM   210  C  CB     . ILE A 1 33  ? 26.780 7.153   34.285 1.00 20.36  ? 70  ILE A CB     1 
ATOM   211  C  CG1    . ILE A 1 33  ? 25.566 7.993   34.748 1.00 17.85  ? 70  ILE A CG1    1 
ATOM   212  C  CG2    . ILE A 1 33  ? 26.943 5.852   35.123 1.00 22.92  ? 70  ILE A CG2    1 
ATOM   213  C  CD1    . ILE A 1 33  ? 24.149 7.304   34.597 1.00 15.28  ? 70  ILE A CD1    1 
ATOM   214  N  N      . GLY A 1 34  ? 28.390 10.264  33.535 1.00 19.16  ? 71  GLY A N      1 
ATOM   215  C  CA     . GLY A 1 34  ? 28.478 11.345  32.568 1.00 18.79  ? 71  GLY A CA     1 
ATOM   216  C  C      . GLY A 1 34  ? 28.122 12.691  33.136 1.00 23.12  ? 71  GLY A C      1 
ATOM   217  O  O      . GLY A 1 34  ? 27.445 12.796  34.160 1.00 23.15  ? 71  GLY A O      1 
ATOM   218  N  N      . SER A 1 35  ? 28.582 13.724  32.456 1.00 19.90  ? 72  SER A N      1 
ATOM   219  C  CA     . SER A 1 35  ? 28.348 15.105  32.837 1.00 19.96  ? 72  SER A CA     1 
ATOM   220  C  C      . SER A 1 35  ? 28.200 15.958  31.580 1.00 24.02  ? 72  SER A C      1 
ATOM   221  O  O      . SER A 1 35  ? 28.595 15.550  30.484 1.00 22.76  ? 72  SER A O      1 
ATOM   222  C  CB     . SER A 1 35  ? 29.480 15.622  33.724 1.00 22.51  ? 72  SER A CB     1 
ATOM   223  O  OG     . SER A 1 35  ? 30.717 15.657  33.034 1.00 29.02  ? 72  SER A OG     1 
ATOM   224  N  N      . GLY A 1 36  ? 27.604 17.115  31.767 1.00 21.74  ? 73  GLY A N      1 
ATOM   225  C  CA     . GLY A 1 36  ? 27.379 18.105  30.724 1.00 22.16  ? 73  GLY A CA     1 
ATOM   226  C  C      . GLY A 1 36  ? 27.383 19.481  31.350 1.00 26.65  ? 73  GLY A C      1 
ATOM   227  O  O      . GLY A 1 36  ? 27.687 19.612  32.532 1.00 25.04  ? 73  GLY A O      1 
ATOM   228  N  N      . ALA A 1 37  ? 27.014 20.505  30.574 1.00 25.76  ? 74  ALA A N      1 
ATOM   229  C  CA     . ALA A 1 37  ? 26.979 21.906  31.015 1.00 26.94  ? 74  ALA A CA     1 
ATOM   230  C  C      . ALA A 1 37  ? 26.036 22.118  32.198 1.00 31.43  ? 74  ALA A C      1 
ATOM   231  O  O      . ALA A 1 37  ? 26.346 22.904  33.083 1.00 32.56  ? 74  ALA A O      1 
ATOM   232  C  CB     . ALA A 1 37  ? 26.569 22.799  29.849 1.00 27.75  ? 74  ALA A CB     1 
ATOM   233  N  N      . GLN A 1 38  ? 24.928 21.362  32.242 1.00 28.36  ? 75  GLN A N      1 
ATOM   234  C  CA     . GLN A 1 38  ? 23.896 21.451  33.276 1.00 28.35  ? 75  GLN A CA     1 
ATOM   235  C  C      . GLN A 1 38  ? 24.212 20.748  34.600 1.00 33.04  ? 75  GLN A C      1 
ATOM   236  O  O      . GLN A 1 38  ? 23.782 21.224  35.642 1.00 33.55  ? 75  GLN A O      1 
ATOM   237  C  CB     . GLN A 1 38  ? 22.556 20.937  32.728 1.00 28.79  ? 75  GLN A CB     1 
ATOM   238  C  CG     . GLN A 1 38  ? 21.358 21.583  33.415 1.00 38.15  ? 75  GLN A CG     1 
ATOM   239  C  CD     . GLN A 1 38  ? 20.110 20.749  33.358 1.00 39.18  ? 75  GLN A CD     1 
ATOM   240  O  OE1    . GLN A 1 38  ? 20.137 19.586  32.946 1.00 30.48  ? 75  GLN A OE1    1 
ATOM   241  N  NE2    . GLN A 1 38  ? 18.977 21.343  33.748 1.00 24.44  ? 75  GLN A NE2    1 
ATOM   242  N  N      . GLY A 1 39  ? 24.871 19.597  34.556 1.00 29.77  ? 76  GLY A N      1 
ATOM   243  C  CA     . GLY A 1 39  ? 25.177 18.860  35.780 1.00 29.04  ? 76  GLY A CA     1 
ATOM   244  C  C      . GLY A 1 39  ? 25.864 17.516  35.621 1.00 29.16  ? 76  GLY A C      1 
ATOM   245  O  O      . GLY A 1 39  ? 26.146 17.066  34.509 1.00 26.83  ? 76  GLY A O      1 
ATOM   246  N  N      . ILE A 1 40  ? 26.169 16.891  36.772 1.00 24.38  ? 77  ILE A N      1 
ATOM   247  C  CA     . ILE A 1 40  ? 26.852 15.607  36.883 1.00 22.22  ? 77  ILE A CA     1 
ATOM   248  C  C      . ILE A 1 40  ? 25.793 14.541  37.109 1.00 19.58  ? 77  ILE A C      1 
ATOM   249  O  O      . ILE A 1 40  ? 24.837 14.761  37.858 1.00 18.49  ? 77  ILE A O      1 
ATOM   250  C  CB     . ILE A 1 40  ? 27.903 15.613  38.041 1.00 27.03  ? 77  ILE A CB     1 
ATOM   251  C  CG1    . ILE A 1 40  ? 28.743 16.933  38.097 1.00 29.24  ? 77  ILE A CG1    1 
ATOM   252  C  CG2    . ILE A 1 40  ? 28.802 14.357  38.028 1.00 27.07  ? 77  ILE A CG2    1 
ATOM   253  C  CD1    . ILE A 1 40  ? 29.595 17.296  36.879 1.00 40.97  ? 77  ILE A CD1    1 
ATOM   254  N  N      . VAL A 1 41  ? 25.976 13.384  36.470 1.00 12.34  ? 78  VAL A N      1 
ATOM   255  C  CA     . VAL A 1 41  ? 25.050 12.264  36.586 1.00 11.04  ? 78  VAL A CA     1 
ATOM   256  C  C      . VAL A 1 41  ? 25.761 11.037  37.143 1.00 15.56  ? 78  VAL A C      1 
ATOM   257  O  O      . VAL A 1 41  ? 26.855 10.705  36.690 1.00 14.48  ? 78  VAL A O      1 
ATOM   258  C  CB     . VAL A 1 41  ? 24.331 11.957  35.235 1.00 12.22  ? 78  VAL A CB     1 
ATOM   259  C  CG1    . VAL A 1 41  ? 23.271 10.883  35.416 1.00 10.63  ? 78  VAL A CG1    1 
ATOM   260  C  CG2    . VAL A 1 41  ? 23.727 13.227  34.629 1.00 10.80  ? 78  VAL A CG2    1 
ATOM   261  N  N      . CYS A 1 42  ? 25.123 10.361  38.124 1.00 13.84  ? 79  CYS A N      1 
ATOM   262  C  CA     . CYS A 1 42  ? 25.621 9.126   38.722 1.00 16.36  ? 79  CYS A CA     1 
ATOM   263  C  C      . CYS A 1 42  ? 24.603 8.022   38.516 1.00 18.59  ? 79  CYS A C      1 
ATOM   264  O  O      . CYS A 1 42  ? 23.419 8.303   38.433 1.00 17.69  ? 79  CYS A O      1 
ATOM   265  C  CB     . CYS A 1 42  ? 25.899 9.318   40.219 1.00 18.60  ? 79  CYS A CB     1 
ATOM   266  S  SG     . CYS A 1 42  ? 27.416 10.236  40.591 1.00 23.97  ? 79  CYS A SG     1 
ATOM   267  N  N      . ALA A 1 43  ? 25.059 6.772   38.499 1.00 16.41  ? 80  ALA A N      1 
ATOM   268  C  CA     . ALA A 1 43  ? 24.240 5.565   38.544 1.00 16.83  ? 80  ALA A CA     1 
ATOM   269  C  C      . ALA A 1 43  ? 24.275 5.216   40.054 1.00 21.23  ? 80  ALA A C      1 
ATOM   270  O  O      . ALA A 1 43  ? 25.269 5.523   40.733 1.00 20.26  ? 80  ALA A O      1 
ATOM   271  C  CB     . ALA A 1 43  ? 24.896 4.436   37.774 1.00 18.33  ? 80  ALA A CB     1 
ATOM   272  N  N      . ALA A 1 44  ? 23.202 4.594   40.570 1.00 16.46  ? 81  ALA A N      1 
ATOM   273  C  CA     . ALA A 1 44  ? 23.093 4.213   41.971 1.00 16.60  ? 81  ALA A CA     1 
ATOM   274  C  C      . ALA A 1 44  ? 22.052 3.144   42.112 1.00 22.05  ? 81  ALA A C      1 
ATOM   275  O  O      . ALA A 1 44  ? 21.195 2.981   41.242 1.00 21.51  ? 81  ALA A O      1 
ATOM   276  C  CB     . ALA A 1 44  ? 22.678 5.419   42.814 1.00 16.38  ? 81  ALA A CB     1 
ATOM   277  N  N      . TYR A 1 45  ? 22.125 2.426   43.216 1.00 19.89  ? 82  TYR A N      1 
ATOM   278  C  CA     . TYR A 1 45  ? 21.148 1.430   43.602 1.00 21.15  ? 82  TYR A CA     1 
ATOM   279  C  C      . TYR A 1 45  ? 20.221 2.103   44.624 1.00 23.72  ? 82  TYR A C      1 
ATOM   280  O  O      . TYR A 1 45  ? 20.693 2.659   45.619 1.00 21.26  ? 82  TYR A O      1 
ATOM   281  C  CB     . TYR A 1 45  ? 21.827 0.197   44.228 1.00 23.75  ? 82  TYR A CB     1 
ATOM   282  C  CG     . TYR A 1 45  ? 20.835 -0.781  44.826 1.00 27.44  ? 82  TYR A CG     1 
ATOM   283  C  CD1    . TYR A 1 45  ? 19.896 -1.435  44.026 1.00 29.74  ? 82  TYR A CD1    1 
ATOM   284  C  CD2    . TYR A 1 45  ? 20.814 -1.032  46.191 1.00 28.66  ? 82  TYR A CD2    1 
ATOM   285  C  CE1    . TYR A 1 45  ? 18.950 -2.295  44.581 1.00 32.53  ? 82  TYR A CE1    1 
ATOM   286  C  CE2    . TYR A 1 45  ? 19.907 -1.927  46.748 1.00 31.05  ? 82  TYR A CE2    1 
ATOM   287  C  CZ     . TYR A 1 45  ? 18.958 -2.535  45.946 1.00 37.67  ? 82  TYR A CZ     1 
ATOM   288  O  OH     . TYR A 1 45  ? 18.057 -3.404  46.515 1.00 40.27  ? 82  TYR A OH     1 
ATOM   289  N  N      . ASP A 1 46  ? 18.918 2.112   44.337 1.00 20.42  ? 83  ASP A N      1 
ATOM   290  C  CA     . ASP A 1 46  ? 17.940 2.648   45.270 1.00 20.15  ? 83  ASP A CA     1 
ATOM   291  C  C      . ASP A 1 46  ? 17.474 1.433   46.118 1.00 24.91  ? 83  ASP A C      1 
ATOM   292  O  O      . ASP A 1 46  ? 16.712 0.608   45.620 1.00 23.43  ? 83  ASP A O      1 
ATOM   293  C  CB     . ASP A 1 46  ? 16.762 3.307   44.512 1.00 20.67  ? 83  ASP A CB     1 
ATOM   294  C  CG     . ASP A 1 46  ? 15.638 3.844   45.403 1.00 23.76  ? 83  ASP A CG     1 
ATOM   295  O  OD1    . ASP A 1 46  ? 15.671 3.590   46.619 1.00 22.53  ? 83  ASP A OD1    1 
ATOM   296  O  OD2    . ASP A 1 46  ? 14.694 4.452   44.864 1.00 22.79  ? 83  ASP A OD2    1 
ATOM   297  N  N      . ALA A 1 47  ? 17.942 1.327   47.373 1.00 23.38  ? 84  ALA A N      1 
ATOM   298  C  CA     . ALA A 1 47  ? 17.553 0.243   48.310 1.00 25.84  ? 84  ALA A CA     1 
ATOM   299  C  C      . ALA A 1 47  ? 16.051 0.259   48.676 1.00 29.92  ? 84  ALA A C      1 
ATOM   300  O  O      . ALA A 1 47  ? 15.521 -0.767  49.071 1.00 30.27  ? 84  ALA A O      1 
ATOM   301  C  CB     . ALA A 1 47  ? 18.397 0.313   49.580 1.00 27.02  ? 84  ALA A CB     1 
ATOM   302  N  N      . VAL A 1 48  ? 15.364 1.411   48.542 1.00 25.54  ? 85  VAL A N      1 
ATOM   303  C  CA     . VAL A 1 48  ? 13.932 1.486   48.863 1.00 26.87  ? 85  VAL A CA     1 
ATOM   304  C  C      . VAL A 1 48  ? 13.106 0.862   47.721 1.00 31.41  ? 85  VAL A C      1 
ATOM   305  O  O      . VAL A 1 48  ? 12.203 0.074   47.978 1.00 33.55  ? 85  VAL A O      1 
ATOM   306  C  CB     . VAL A 1 48  ? 13.475 2.936   49.225 1.00 28.40  ? 85  VAL A CB     1 
ATOM   307  C  CG1    . VAL A 1 48  ? 11.954 3.057   49.262 1.00 28.71  ? 85  VAL A CG1    1 
ATOM   308  C  CG2    . VAL A 1 48  ? 14.081 3.390   50.550 1.00 28.22  ? 85  VAL A CG2    1 
ATOM   309  N  N      . LEU A 1 49  ? 13.398 1.228   46.478 1.00 26.99  ? 86  LEU A N      1 
ATOM   310  C  CA     . LEU A 1 49  ? 12.651 0.682   45.342 1.00 27.05  ? 86  LEU A CA     1 
ATOM   311  C  C      . LEU A 1 49  ? 13.173 -0.670  44.851 1.00 30.38  ? 86  LEU A C      1 
ATOM   312  O  O      . LEU A 1 49  ? 12.441 -1.372  44.153 1.00 28.93  ? 86  LEU A O      1 
ATOM   313  C  CB     . LEU A 1 49  ? 12.565 1.677   44.178 1.00 24.84  ? 86  LEU A CB     1 
ATOM   314  C  CG     . LEU A 1 49  ? 11.654 2.903   44.385 1.00 29.47  ? 86  LEU A CG     1 
ATOM   315  C  CD1    . LEU A 1 49  ? 11.825 3.905   43.255 1.00 26.48  ? 86  LEU A CD1    1 
ATOM   316  C  CD2    . LEU A 1 49  ? 10.175 2.497   44.537 1.00 34.25  ? 86  LEU A CD2    1 
ATOM   317  N  N      . ASP A 1 50  ? 14.421 -1.040  45.242 1.00 27.75  ? 87  ASP A N      1 
ATOM   318  C  CA     . ASP A 1 50  ? 15.132 -2.241  44.791 1.00 29.78  ? 87  ASP A CA     1 
ATOM   319  C  C      . ASP A 1 50  ? 15.312 -2.143  43.260 1.00 34.03  ? 87  ASP A C      1 
ATOM   320  O  O      . ASP A 1 50  ? 15.018 -3.084  42.512 1.00 36.09  ? 87  ASP A O      1 
ATOM   321  C  CB     . ASP A 1 50  ? 14.429 -3.549  45.255 1.00 33.74  ? 87  ASP A CB     1 
ATOM   322  C  CG     . ASP A 1 50  ? 15.147 -4.824  44.869 1.00 45.44  ? 87  ASP A CG     1 
ATOM   323  O  OD1    . ASP A 1 50  ? 16.390 -4.859  44.973 1.00 45.65  ? 87  ASP A OD1    1 
ATOM   324  O  OD2    . ASP A 1 50  ? 14.466 -5.782  44.446 1.00 52.96  ? 87  ASP A OD2    1 
ATOM   325  N  N      . ARG A 1 51  ? 15.732 -0.946  42.804 1.00 27.31  ? 88  ARG A N      1 
ATOM   326  C  CA     . ARG A 1 51  ? 15.940 -0.599  41.402 1.00 25.74  ? 88  ARG A CA     1 
ATOM   327  C  C      . ARG A 1 51  ? 17.188 0.259   41.260 1.00 28.41  ? 88  ARG A C      1 
ATOM   328  O  O      . ARG A 1 51  ? 17.498 1.067   42.144 1.00 25.27  ? 88  ARG A O      1 
ATOM   329  C  CB     . ARG A 1 51  ? 14.780 0.290   40.896 1.00 27.82  ? 88  ARG A CB     1 
ATOM   330  C  CG     . ARG A 1 51  ? 13.529 -0.417  40.451 1.00 42.34  ? 88  ARG A CG     1 
ATOM   331  C  CD     . ARG A 1 51  ? 12.405 0.597   40.316 1.00 54.32  ? 88  ARG A CD     1 
ATOM   332  N  NE     . ARG A 1 51  ? 12.403 1.304   39.030 1.00 57.27  ? 88  ARG A NE     1 
ATOM   333  C  CZ     . ARG A 1 51  ? 11.413 2.094   38.617 1.00 68.25  ? 88  ARG A CZ     1 
ATOM   334  N  NH1    . ARG A 1 51  ? 10.344 2.289   39.385 1.00 52.27  ? 88  ARG A NH1    1 
ATOM   335  N  NH2    . ARG A 1 51  ? 11.485 2.700   37.437 1.00 46.16  ? 88  ARG A NH2    1 
ATOM   336  N  N      . ASN A 1 52  ? 17.832 0.184   40.084 1.00 24.17  ? 89  ASN A N      1 
ATOM   337  C  CA     . ASN A 1 52  ? 18.957 1.070   39.797 1.00 21.21  ? 89  ASN A CA     1 
ATOM   338  C  C      . ASN A 1 52  ? 18.388 2.347   39.257 1.00 18.83  ? 89  ASN A C      1 
ATOM   339  O  O      . ASN A 1 52  ? 17.432 2.339   38.467 1.00 14.87  ? 89  ASN A O      1 
ATOM   340  C  CB     . ASN A 1 52  ? 19.910 0.456   38.784 1.00 24.57  ? 89  ASN A CB     1 
ATOM   341  C  CG     . ASN A 1 52  ? 20.483 -0.833  39.277 1.00 40.25  ? 89  ASN A CG     1 
ATOM   342  O  OD1    . ASN A 1 52  ? 21.137 -0.899  40.327 1.00 26.63  ? 89  ASN A OD1    1 
ATOM   343  N  ND2    . ASN A 1 52  ? 20.132 -1.891  38.590 1.00 37.39  ? 89  ASN A ND2    1 
ATOM   344  N  N      . VAL A 1 53  ? 18.988 3.457   39.682 1.00 14.76  ? 90  VAL A N      1 
ATOM   345  C  CA     . VAL A 1 53  ? 18.566 4.788   39.299 1.00 12.58  ? 90  VAL A CA     1 
ATOM   346  C  C      . VAL A 1 53  ? 19.717 5.617   38.777 1.00 14.59  ? 90  VAL A C      1 
ATOM   347  O  O      . VAL A 1 53  ? 20.887 5.321   39.040 1.00 14.55  ? 90  VAL A O      1 
ATOM   348  C  CB     . VAL A 1 53  ? 17.850 5.512   40.480 1.00 15.26  ? 90  VAL A CB     1 
ATOM   349  C  CG1    . VAL A 1 53  ? 16.565 4.777   40.890 1.00 16.46  ? 90  VAL A CG1    1 
ATOM   350  C  CG2    . VAL A 1 53  ? 18.791 5.701   41.672 1.00 14.78  ? 90  VAL A CG2    1 
ATOM   351  N  N      . ALA A 1 54  ? 19.362 6.689   38.092 1.00 9.89   ? 91  ALA A N      1 
ATOM   352  C  CA     . ALA A 1 54  ? 20.274 7.717   37.614 1.00 9.44   ? 91  ALA A CA     1 
ATOM   353  C  C      . ALA A 1 54  ? 19.967 8.931   38.488 1.00 14.54  ? 91  ALA A C      1 
ATOM   354  O  O      . ALA A 1 54  ? 18.792 9.229   38.733 1.00 14.82  ? 91  ALA A O      1 
ATOM   355  C  CB     . ALA A 1 54  ? 19.985 8.035   36.150 1.00 8.95   ? 91  ALA A CB     1 
ATOM   356  N  N      . ILE A 1 55  ? 21.007 9.569   39.030 1.00 12.32  ? 92  ILE A N      1 
ATOM   357  C  CA     . ILE A 1 55  ? 20.879 10.749  39.885 1.00 12.08  ? 92  ILE A CA     1 
ATOM   358  C  C      . ILE A 1 55  ? 21.615 11.904  39.249 1.00 15.00  ? 92  ILE A C      1 
ATOM   359  O  O      . ILE A 1 55  ? 22.825 11.818  39.040 1.00 14.63  ? 92  ILE A O      1 
ATOM   360  C  CB     . ILE A 1 55  ? 21.387 10.509  41.334 1.00 15.65  ? 92  ILE A CB     1 
ATOM   361  C  CG1    . ILE A 1 55  ? 20.693 9.288   41.978 1.00 16.86  ? 92  ILE A CG1    1 
ATOM   362  C  CG2    . ILE A 1 55  ? 21.190 11.781  42.189 1.00 15.09  ? 92  ILE A CG2    1 
ATOM   363  C  CD1    . ILE A 1 55  ? 21.271 8.885   43.328 1.00 21.52  ? 92  ILE A CD1    1 
ATOM   364  N  N      . LYS A 1 56  ? 20.893 12.988  38.962 1.00 11.88  ? 93  LYS A N      1 
ATOM   365  C  CA     . LYS A 1 56  ? 21.482 14.194  38.408 1.00 10.71  ? 93  LYS A CA     1 
ATOM   366  C  C      . LYS A 1 56  ? 21.543 15.285  39.463 1.00 14.67  ? 93  LYS A C      1 
ATOM   367  O  O      . LYS A 1 56  ? 20.521 15.626  40.073 1.00 13.66  ? 93  LYS A O      1 
ATOM   368  C  CB     . LYS A 1 56  ? 20.692 14.682  37.188 1.00 11.54  ? 93  LYS A CB     1 
ATOM   369  C  CG     . LYS A 1 56  ? 21.294 15.958  36.572 1.00 10.05  ? 93  LYS A CG     1 
ATOM   370  C  CD     . LYS A 1 56  ? 20.829 16.236  35.143 1.00 20.86  ? 93  LYS A CD     1 
ATOM   371  C  CE     . LYS A 1 56  ? 19.468 16.870  35.045 1.00 26.84  ? 93  LYS A CE     1 
ATOM   372  N  NZ     . LYS A 1 56  ? 19.089 17.169  33.633 1.00 23.63  ? 93  LYS A NZ     1 
ATOM   373  N  N      . LYS A 1 57  ? 22.728 15.876  39.626 1.00 11.42  ? 94  LYS A N      1 
ATOM   374  C  CA     . LYS A 1 57  ? 22.931 16.999  40.541 1.00 10.72  ? 94  LYS A CA     1 
ATOM   375  C  C      . LYS A 1 57  ? 22.967 18.296  39.724 1.00 14.13  ? 94  LYS A C      1 
ATOM   376  O  O      . LYS A 1 57  ? 23.698 18.395  38.734 1.00 12.43  ? 94  LYS A O      1 
ATOM   377  C  CB     . LYS A 1 57  ? 24.251 16.836  41.305 1.00 12.90  ? 94  LYS A CB     1 
ATOM   378  C  CG     . LYS A 1 57  ? 24.549 17.965  42.300 1.00 19.84  ? 94  LYS A CG     1 
ATOM   379  C  CD     . LYS A 1 57  ? 25.959 17.889  42.821 1.00 24.95  ? 94  LYS A CD     1 
ATOM   380  C  CE     . LYS A 1 57  ? 26.243 19.019  43.786 1.00 28.18  ? 94  LYS A CE     1 
ATOM   381  N  NZ     . LYS A 1 57  ? 27.678 19.057  44.149 1.00 31.36  ? 94  LYS A NZ     1 
ATOM   382  N  N      . LEU A 1 58  ? 22.204 19.292  40.165 1.00 12.28  ? 95  LEU A N      1 
ATOM   383  C  CA     . LEU A 1 58  ? 22.190 20.642  39.582 1.00 11.76  ? 95  LEU A CA     1 
ATOM   384  C  C      . LEU A 1 58  ? 22.819 21.505  40.654 1.00 18.14  ? 95  LEU A C      1 
ATOM   385  O  O      . LEU A 1 58  ? 22.252 21.633  41.744 1.00 18.76  ? 95  LEU A O      1 
ATOM   386  C  CB     . LEU A 1 58  ? 20.755 21.129  39.256 1.00 11.05  ? 95  LEU A CB     1 
ATOM   387  C  CG     . LEU A 1 58  ? 19.897 20.253  38.302 1.00 15.66  ? 95  LEU A CG     1 
ATOM   388  C  CD1    . LEU A 1 58  ? 18.542 20.899  38.045 1.00 16.43  ? 95  LEU A CD1    1 
ATOM   389  C  CD2    . LEU A 1 58  ? 20.617 19.958  36.997 1.00 13.83  ? 95  LEU A CD2    1 
ATOM   390  N  N      . SER A 1 59  ? 24.032 22.017  40.392 1.00 16.48  ? 96  SER A N      1 
ATOM   391  C  CA     . SER A 1 59  ? 24.757 22.857  41.350 1.00 17.98  ? 96  SER A CA     1 
ATOM   392  C  C      . SER A 1 59  ? 24.364 24.287  41.139 1.00 19.76  ? 96  SER A C      1 
ATOM   393  O  O      . SER A 1 59  ? 24.670 24.841  40.086 1.00 17.97  ? 96  SER A O      1 
ATOM   394  C  CB     . SER A 1 59  ? 26.267 22.711  41.169 1.00 25.37  ? 96  SER A CB     1 
ATOM   395  O  OG     . SER A 1 59  ? 26.657 21.347  41.186 1.00 39.36  ? 96  SER A OG     1 
ATOM   396  N  N      . ARG A 1 60  ? 23.695 24.892  42.143 1.00 18.42  ? 97  ARG A N      1 
ATOM   397  C  CA     . ARG A 1 60  ? 23.212 26.280  42.155 1.00 19.15  ? 97  ARG A CA     1 
ATOM   398  C  C      . ARG A 1 60  ? 22.537 26.593  40.794 1.00 23.28  ? 97  ARG A C      1 
ATOM   399  O  O      . ARG A 1 60  ? 23.092 27.371  40.018 1.00 23.68  ? 97  ARG A O      1 
ATOM   400  C  CB     . ARG A 1 60  ? 24.359 27.265  42.502 1.00 19.71  ? 97  ARG A CB     1 
ATOM   401  C  CG     . ARG A 1 60  ? 25.062 26.963  43.837 1.00 25.22  ? 97  ARG A CG     1 
ATOM   402  C  CD     . ARG A 1 60  ? 26.152 27.973  44.180 1.00 20.92  ? 97  ARG A CD     1 
ATOM   403  N  NE     . ARG A 1 60  ? 25.623 29.316  44.428 1.00 22.95  ? 97  ARG A NE     1 
ATOM   404  C  CZ     . ARG A 1 60  ? 25.071 29.738  45.564 1.00 39.25  ? 97  ARG A CZ     1 
ATOM   405  N  NH1    . ARG A 1 60  ? 24.967 28.922  46.607 1.00 29.38  ? 97  ARG A NH1    1 
ATOM   406  N  NH2    . ARG A 1 60  ? 24.622 30.980  45.668 1.00 29.60  ? 97  ARG A NH2    1 
ATOM   407  N  N      . PRO A 1 61  ? 21.403 25.925  40.438 1.00 16.25  ? 98  PRO A N      1 
ATOM   408  C  CA     . PRO A 1 61  ? 20.830 26.139  39.092 1.00 14.75  ? 98  PRO A CA     1 
ATOM   409  C  C      . PRO A 1 61  ? 20.379 27.570  38.848 1.00 18.08  ? 98  PRO A C      1 
ATOM   410  O  O      . PRO A 1 61  ? 20.246 27.976  37.707 1.00 17.21  ? 98  PRO A O      1 
ATOM   411  C  CB     . PRO A 1 61  ? 19.669 25.139  39.027 1.00 14.54  ? 98  PRO A CB     1 
ATOM   412  C  CG     . PRO A 1 61  ? 19.302 24.900  40.481 1.00 19.46  ? 98  PRO A CG     1 
ATOM   413  C  CD     . PRO A 1 61  ? 20.610 24.942  41.209 1.00 15.65  ? 98  PRO A CD     1 
ATOM   414  N  N      . PHE A 1 62  ? 20.164 28.320  39.928 1.00 17.43  ? 99  PHE A N      1 
ATOM   415  C  CA     . PHE A 1 62  ? 19.768 29.729  39.909 1.00 18.10  ? 99  PHE A CA     1 
ATOM   416  C  C      . PHE A 1 62  ? 20.965 30.690  39.660 1.00 23.37  ? 99  PHE A C      1 
ATOM   417  O  O      . PHE A 1 62  ? 20.752 31.899  39.650 1.00 23.00  ? 99  PHE A O      1 
ATOM   418  C  CB     . PHE A 1 62  ? 19.070 30.084  41.227 1.00 20.36  ? 99  PHE A CB     1 
ATOM   419  C  CG     . PHE A 1 62  ? 19.866 29.668  42.443 1.00 21.25  ? 99  PHE A CG     1 
ATOM   420  C  CD1    . PHE A 1 62  ? 20.922 30.447  42.903 1.00 22.10  ? 99  PHE A CD1    1 
ATOM   421  C  CD2    . PHE A 1 62  ? 19.608 28.454  43.085 1.00 20.90  ? 99  PHE A CD2    1 
ATOM   422  C  CE1    . PHE A 1 62  ? 21.706 30.015  43.976 1.00 23.84  ? 99  PHE A CE1    1 
ATOM   423  C  CE2    . PHE A 1 62  ? 20.392 28.032  44.153 1.00 23.10  ? 99  PHE A CE2    1 
ATOM   424  C  CZ     . PHE A 1 62  ? 21.420 28.828  44.607 1.00 22.05  ? 99  PHE A CZ     1 
ATOM   425  N  N      . GLN A 1 63  ? 22.207 30.157  39.464 1.00 21.17  ? 100 GLN A N      1 
ATOM   426  C  CA     . GLN A 1 63  ? 23.441 30.940  39.255 1.00 22.21  ? 100 GLN A CA     1 
ATOM   427  C  C      . GLN A 1 63  ? 23.360 31.915  38.081 1.00 27.32  ? 100 GLN A C      1 
ATOM   428  O  O      . GLN A 1 63  ? 23.952 32.983  38.151 1.00 28.35  ? 100 GLN A O      1 
ATOM   429  C  CB     . GLN A 1 63  ? 24.693 30.054  39.142 1.00 22.31  ? 100 GLN A CB     1 
ATOM   430  C  CG     . GLN A 1 63  ? 24.755 29.132  37.951 1.00 19.59  ? 100 GLN A CG     1 
ATOM   431  C  CD     . GLN A 1 63  ? 25.973 28.265  38.063 1.00 35.02  ? 100 GLN A CD     1 
ATOM   432  O  OE1    . GLN A 1 63  ? 27.046 28.618  37.577 1.00 32.11  ? 100 GLN A OE1    1 
ATOM   433  N  NE2    . GLN A 1 63  ? 25.855 27.142  38.771 1.00 18.70  ? 100 GLN A NE2    1 
ATOM   434  N  N      . ASN A 1 64  ? 22.633 31.556  37.013 1.00 22.79  ? 101 ASN A N      1 
ATOM   435  C  CA     . ASN A 1 64  ? 22.418 32.479  35.902 1.00 24.39  ? 101 ASN A CA     1 
ATOM   436  C  C      . ASN A 1 64  ? 21.070 32.191  35.237 1.00 28.09  ? 101 ASN A C      1 
ATOM   437  O  O      . ASN A 1 64  ? 20.484 31.143  35.491 1.00 24.56  ? 101 ASN A O      1 
ATOM   438  C  CB     . ASN A 1 64  ? 23.591 32.486  34.904 1.00 25.47  ? 101 ASN A CB     1 
ATOM   439  C  CG     . ASN A 1 64  ? 23.887 31.185  34.235 1.00 32.42  ? 101 ASN A CG     1 
ATOM   440  O  OD1    . ASN A 1 64  ? 23.092 30.660  33.459 1.00 25.30  ? 101 ASN A OD1    1 
ATOM   441  N  ND2    . ASN A 1 64  ? 25.080 30.678  34.473 1.00 27.18  ? 101 ASN A ND2    1 
ATOM   442  N  N      . GLN A 1 65  ? 20.601 33.112  34.390 1.00 26.91  ? 102 GLN A N      1 
ATOM   443  C  CA     . GLN A 1 65  ? 19.329 33.046  33.658 1.00 27.66  ? 102 GLN A CA     1 
ATOM   444  C  C      . GLN A 1 65  ? 19.146 31.783  32.843 1.00 27.87  ? 102 GLN A C      1 
ATOM   445  O  O      . GLN A 1 65  ? 18.055 31.207  32.854 1.00 26.46  ? 102 GLN A O      1 
ATOM   446  C  CB     . GLN A 1 65  ? 19.199 34.271  32.737 1.00 31.59  ? 102 GLN A CB     1 
ATOM   447  C  CG     . GLN A 1 65  ? 17.765 34.749  32.530 1.00 56.74  ? 102 GLN A CG     1 
ATOM   448  C  CD     . GLN A 1 65  ? 17.221 35.555  33.687 1.00 74.46  ? 102 GLN A CD     1 
ATOM   449  O  OE1    . GLN A 1 65  ? 16.013 35.559  33.940 1.00 69.12  ? 102 GLN A OE1    1 
ATOM   450  N  NE2    . GLN A 1 65  ? 18.089 36.262  34.408 1.00 68.76  ? 102 GLN A NE2    1 
ATOM   451  N  N      . THR A 1 66  ? 20.211 31.348  32.148 1.00 24.73  ? 103 THR A N      1 
ATOM   452  C  CA     . THR A 1 66  ? 20.218 30.147  31.304 1.00 24.53  ? 103 THR A CA     1 
ATOM   453  C  C      . THR A 1 66  ? 20.023 28.862  32.110 1.00 28.72  ? 103 THR A C      1 
ATOM   454  O  O      . THR A 1 66  ? 19.127 28.078  31.778 1.00 27.73  ? 103 THR A O      1 
ATOM   455  C  CB     . THR A 1 66  ? 21.480 30.122  30.424 1.00 38.68  ? 103 THR A CB     1 
ATOM   456  O  OG1    . THR A 1 66  ? 21.617 31.399  29.784 1.00 45.50  ? 103 THR A OG1    1 
ATOM   457  C  CG2    . THR A 1 66  ? 21.444 29.016  29.380 1.00 34.22  ? 103 THR A CG2    1 
ATOM   458  N  N      . HIS A 1 67  ? 20.856 28.625  33.147 1.00 26.86  ? 104 HIS A N      1 
ATOM   459  C  CA     . HIS A 1 67  ? 20.707 27.420  33.973 1.00 26.28  ? 104 HIS A CA     1 
ATOM   460  C  C      . HIS A 1 67  ? 19.371 27.453  34.712 1.00 25.25  ? 104 HIS A C      1 
ATOM   461  O  O      . HIS A 1 67  ? 18.713 26.422  34.812 1.00 23.39  ? 104 HIS A O      1 
ATOM   462  C  CB     . HIS A 1 67  ? 21.854 27.278  35.008 1.00 29.00  ? 104 HIS A CB     1 
ATOM   463  C  CG     . HIS A 1 67  ? 23.176 26.896  34.424 1.00 34.01  ? 104 HIS A CG     1 
ATOM   464  N  ND1    . HIS A 1 67  ? 23.337 25.734  33.686 1.00 35.85  ? 104 HIS A ND1    1 
ATOM   465  C  CD2    . HIS A 1 67  ? 24.366 27.526  34.509 1.00 38.21  ? 104 HIS A CD2    1 
ATOM   466  C  CE1    . HIS A 1 67  ? 24.611 25.702  33.340 1.00 36.25  ? 104 HIS A CE1    1 
ATOM   467  N  NE2    . HIS A 1 67  ? 25.271 26.761  33.811 1.00 37.99  ? 104 HIS A NE2    1 
ATOM   468  N  N      . ALA A 1 68  ? 18.981 28.638  35.223 1.00 20.10  ? 105 ALA A N      1 
ATOM   469  C  CA     . ALA A 1 68  ? 17.766 28.836  36.019 1.00 20.17  ? 105 ALA A CA     1 
ATOM   470  C  C      . ALA A 1 68  ? 16.489 28.579  35.258 1.00 24.77  ? 105 ALA A C      1 
ATOM   471  O  O      . ALA A 1 68  ? 15.655 27.819  35.740 1.00 23.87  ? 105 ALA A O      1 
ATOM   472  C  CB     . ALA A 1 68  ? 17.754 30.223  36.645 1.00 21.89  ? 105 ALA A CB     1 
ATOM   473  N  N      . LYS A 1 69  ? 16.335 29.197  34.078 1.00 22.58  ? 106 LYS A N      1 
ATOM   474  C  CA     . LYS A 1 69  ? 15.167 29.018  33.220 1.00 23.01  ? 106 LYS A CA     1 
ATOM   475  C  C      . LYS A 1 69  ? 15.022 27.527  32.901 1.00 24.94  ? 106 LYS A C      1 
ATOM   476  O  O      . LYS A 1 69  ? 13.943 26.969  33.105 1.00 24.23  ? 106 LYS A O      1 
ATOM   477  C  CB     . LYS A 1 69  ? 15.324 29.846  31.930 1.00 26.72  ? 106 LYS A CB     1 
ATOM   478  C  CG     . LYS A 1 69  ? 14.113 29.833  30.994 1.00 51.14  ? 106 LYS A CG     1 
ATOM   479  C  CD     . LYS A 1 69  ? 13.096 30.929  31.324 1.00 66.84  ? 106 LYS A CD     1 
ATOM   480  C  CE     . LYS A 1 69  ? 11.965 31.006  30.321 1.00 78.34  ? 106 LYS A CE     1 
ATOM   481  N  NZ     . LYS A 1 69  ? 12.398 31.593  29.022 1.00 83.57  ? 106 LYS A NZ     1 
ATOM   482  N  N      . ARG A 1 70  ? 16.121 26.879  32.457 1.00 19.70  ? 107 ARG A N      1 
ATOM   483  C  CA     . ARG A 1 70  ? 16.105 25.456  32.136 1.00 18.80  ? 107 ARG A CA     1 
ATOM   484  C  C      . ARG A 1 70  ? 15.719 24.591  33.327 1.00 21.47  ? 107 ARG A C      1 
ATOM   485  O  O      . ARG A 1 70  ? 14.806 23.788  33.184 1.00 20.90  ? 107 ARG A O      1 
ATOM   486  C  CB     . ARG A 1 70  ? 17.423 24.975  31.494 1.00 20.01  ? 107 ARG A CB     1 
ATOM   487  C  CG     . ARG A 1 70  ? 17.301 23.550  30.959 1.00 24.77  ? 107 ARG A CG     1 
ATOM   488  C  CD     . ARG A 1 70  ? 18.575 23.025  30.358 1.00 31.80  ? 107 ARG A CD     1 
ATOM   489  N  NE     . ARG A 1 70  ? 18.557 21.562  30.326 1.00 32.14  ? 107 ARG A NE     1 
ATOM   490  C  CZ     . ARG A 1 70  ? 19.525 20.808  29.820 1.00 45.88  ? 107 ARG A CZ     1 
ATOM   491  N  NH1    . ARG A 1 70  ? 20.611 21.370  29.304 1.00 37.50  ? 107 ARG A NH1    1 
ATOM   492  N  NH2    . ARG A 1 70  ? 19.414 19.488  29.821 1.00 34.30  ? 107 ARG A NH2    1 
ATOM   493  N  N      . ALA A 1 71  ? 16.368 24.774  34.505 1.00 16.35  ? 108 ALA A N      1 
ATOM   494  C  CA     . ALA A 1 71  ? 16.044 23.986  35.680 1.00 16.61  ? 108 ALA A CA     1 
ATOM   495  C  C      . ALA A 1 71  ? 14.601 24.186  36.117 1.00 21.09  ? 108 ALA A C      1 
ATOM   496  O  O      . ALA A 1 71  ? 13.936 23.213  36.469 1.00 18.23  ? 108 ALA A O      1 
ATOM   497  C  CB     . ALA A 1 71  ? 16.987 24.324  36.836 1.00 17.72  ? 108 ALA A CB     1 
ATOM   498  N  N      . TYR A 1 72  ? 14.123 25.442  36.116 1.00 20.54  ? 109 TYR A N      1 
ATOM   499  C  CA     . TYR A 1 72  ? 12.755 25.731  36.542 1.00 23.20  ? 109 TYR A CA     1 
ATOM   500  C  C      . TYR A 1 72  ? 11.708 25.140  35.561 1.00 27.22  ? 109 TYR A C      1 
ATOM   501  O  O      . TYR A 1 72  ? 10.794 24.430  35.997 1.00 27.47  ? 109 TYR A O      1 
ATOM   502  C  CB     . TYR A 1 72  ? 12.546 27.238  36.768 1.00 26.43  ? 109 TYR A CB     1 
ATOM   503  C  CG     . TYR A 1 72  ? 11.116 27.595  37.103 1.00 30.52  ? 109 TYR A CG     1 
ATOM   504  C  CD1    . TYR A 1 72  ? 10.607 27.392  38.383 1.00 33.30  ? 109 TYR A CD1    1 
ATOM   505  C  CD2    . TYR A 1 72  ? 10.263 28.119  36.135 1.00 32.46  ? 109 TYR A CD2    1 
ATOM   506  C  CE1    . TYR A 1 72  ? 9.288  27.714  38.696 1.00 36.52  ? 109 TYR A CE1    1 
ATOM   507  C  CE2    . TYR A 1 72  ? 8.938  28.433  36.433 1.00 34.99  ? 109 TYR A CE2    1 
ATOM   508  C  CZ     . TYR A 1 72  ? 8.453  28.220  37.712 1.00 43.54  ? 109 TYR A CZ     1 
ATOM   509  O  OH     . TYR A 1 72  ? 7.147  28.514  38.001 1.00 49.65  ? 109 TYR A OH     1 
ATOM   510  N  N      . ARG A 1 73  ? 11.861 25.426  34.265 1.00 23.01  ? 110 ARG A N      1 
ATOM   511  C  CA     . ARG A 1 73  ? 10.962 24.942  33.211 1.00 23.94  ? 110 ARG A CA     1 
ATOM   512  C  C      . ARG A 1 73  ? 10.906 23.400  33.201 1.00 27.67  ? 110 ARG A C      1 
ATOM   513  O  O      . ARG A 1 73  ? 9.817  22.837  33.118 1.00 28.05  ? 110 ARG A O      1 
ATOM   514  C  CB     . ARG A 1 73  ? 11.371 25.510  31.845 1.00 21.32  ? 110 ARG A CB     1 
ATOM   515  C  CG     . ARG A 1 73  ? 10.428 25.162  30.703 1.00 39.31  ? 110 ARG A CG     1 
ATOM   516  C  CD     . ARG A 1 73  ? 10.739 25.967  29.448 1.00 47.17  ? 110 ARG A CD     1 
ATOM   517  N  NE     . ARG A 1 73  ? 10.041 25.451  28.267 1.00 52.54  ? 110 ARG A NE     1 
ATOM   518  C  CZ     . ARG A 1 73  ? 10.561 24.575  27.413 1.00 61.92  ? 110 ARG A CZ     1 
ATOM   519  N  NH1    . ARG A 1 73  ? 11.787 24.099  27.601 1.00 41.82  ? 110 ARG A NH1    1 
ATOM   520  N  NH2    . ARG A 1 73  ? 9.860  24.169  26.363 1.00 53.92  ? 110 ARG A NH2    1 
ATOM   521  N  N      . GLU A 1 74  ? 12.061 22.730  33.372 1.00 22.16  ? 111 GLU A N      1 
ATOM   522  C  CA     . GLU A 1 74  ? 12.112 21.268  33.414 1.00 20.33  ? 111 GLU A CA     1 
ATOM   523  C  C      . GLU A 1 74  ? 11.407 20.651  34.622 1.00 24.36  ? 111 GLU A C      1 
ATOM   524  O  O      . GLU A 1 74  ? 10.647 19.703  34.440 1.00 22.43  ? 111 GLU A O      1 
ATOM   525  C  CB     A GLU A 1 74  ? 13.571 20.795  33.481 0.50 20.69  ? 111 GLU A CB     1 
ATOM   526  C  CB     B GLU A 1 74  ? 13.498 20.723  33.087 0.50 20.49  ? 111 GLU A CB     1 
ATOM   527  C  CG     A GLU A 1 74  ? 14.308 20.771  32.158 0.50 26.71  ? 111 GLU A CG     1 
ATOM   528  C  CG     B GLU A 1 74  ? 13.879 21.134  31.672 0.50 23.96  ? 111 GLU A CG     1 
ATOM   529  C  CD     A GLU A 1 74  ? 15.782 20.415  32.228 0.50 34.10  ? 111 GLU A CD     1 
ATOM   530  C  CD     B GLU A 1 74  ? 14.954 20.361  30.941 0.50 26.94  ? 111 GLU A CD     1 
ATOM   531  O  OE1    A GLU A 1 74  ? 16.358 20.354  33.342 0.50 9.12   ? 111 GLU A OE1    1 
ATOM   532  O  OE1    B GLU A 1 74  ? 14.985 20.450  29.693 0.50 6.22   ? 111 GLU A OE1    1 
ATOM   533  O  OE2    A GLU A 1 74  ? 16.368 20.207  31.143 0.50 27.62  ? 111 GLU A OE2    1 
ATOM   534  O  OE2    B GLU A 1 74  ? 15.775 19.689  31.604 0.50 20.83  ? 111 GLU A OE2    1 
ATOM   535  N  N      . LEU A 1 75  ? 11.620 21.222  35.841 1.00 23.00  ? 112 LEU A N      1 
ATOM   536  C  CA     . LEU A 1 75  ? 10.992 20.794  37.096 1.00 24.59  ? 112 LEU A CA     1 
ATOM   537  C  C      . LEU A 1 75  ? 9.468  20.874  36.982 1.00 30.98  ? 112 LEU A C      1 
ATOM   538  O  O      . LEU A 1 75  ? 8.774  19.932  37.359 1.00 31.39  ? 112 LEU A O      1 
ATOM   539  C  CB     . LEU A 1 75  ? 11.464 21.678  38.273 1.00 25.52  ? 112 LEU A CB     1 
ATOM   540  C  CG     . LEU A 1 75  ? 12.767 21.284  38.966 1.00 30.66  ? 112 LEU A CG     1 
ATOM   541  C  CD1    . LEU A 1 75  ? 13.257 22.410  39.871 1.00 31.29  ? 112 LEU A CD1    1 
ATOM   542  C  CD2    . LEU A 1 75  ? 12.593 20.006  39.792 1.00 34.78  ? 112 LEU A CD2    1 
ATOM   543  N  N      . VAL A 1 76  ? 8.960  22.005  36.455 1.00 28.74  ? 113 VAL A N      1 
ATOM   544  C  CA     . VAL A 1 76  ? 7.535  22.245  36.234 1.00 30.29  ? 113 VAL A CA     1 
ATOM   545  C  C      . VAL A 1 76  ? 6.973  21.261  35.167 1.00 34.67  ? 113 VAL A C      1 
ATOM   546  O  O      . VAL A 1 76  ? 6.021  20.539  35.463 1.00 36.15  ? 113 VAL A O      1 
ATOM   547  C  CB     . VAL A 1 76  ? 7.251  23.743  35.906 1.00 34.22  ? 113 VAL A CB     1 
ATOM   548  C  CG1    . VAL A 1 76  ? 5.825  23.953  35.398 1.00 35.25  ? 113 VAL A CG1    1 
ATOM   549  C  CG2    . VAL A 1 76  ? 7.528  24.631  37.124 1.00 34.63  ? 113 VAL A CG2    1 
ATOM   550  N  N      . LEU A 1 77  ? 7.588  21.205  33.973 1.00 29.92  ? 114 LEU A N      1 
ATOM   551  C  CA     . LEU A 1 77  ? 7.140  20.337  32.868 1.00 29.83  ? 114 LEU A CA     1 
ATOM   552  C  C      . LEU A 1 77  ? 7.152  18.848  33.195 1.00 35.04  ? 114 LEU A C      1 
ATOM   553  O  O      . LEU A 1 77  ? 6.229  18.161  32.773 1.00 36.36  ? 114 LEU A O      1 
ATOM   554  C  CB     . LEU A 1 77  ? 7.884  20.611  31.557 1.00 28.48  ? 114 LEU A CB     1 
ATOM   555  C  CG     . LEU A 1 77  ? 7.669  21.994  30.945 1.00 33.58  ? 114 LEU A CG     1 
ATOM   556  C  CD1    . LEU A 1 77  ? 8.436  22.150  29.659 1.00 31.96  ? 114 LEU A CD1    1 
ATOM   557  C  CD2    . LEU A 1 77  ? 6.186  22.331  30.774 1.00 38.29  ? 114 LEU A CD2    1 
ATOM   558  N  N      . MET A 1 78  ? 8.133  18.357  33.986 1.00 32.23  ? 115 MET A N      1 
ATOM   559  C  CA     . MET A 1 78  ? 8.203  16.948  34.419 1.00 33.07  ? 115 MET A CA     1 
ATOM   560  C  C      . MET A 1 78  ? 6.987  16.483  35.257 1.00 43.30  ? 115 MET A C      1 
ATOM   561  O  O      . MET A 1 78  ? 6.791  15.276  35.417 1.00 43.20  ? 115 MET A O      1 
ATOM   562  C  CB     . MET A 1 78  ? 9.509  16.658  35.173 1.00 33.65  ? 115 MET A CB     1 
ATOM   563  C  CG     . MET A 1 78  ? 10.672 16.395  34.240 1.00 34.18  ? 115 MET A CG     1 
ATOM   564  S  SD     . MET A 1 78  ? 12.269 16.079  35.031 1.00 36.00  ? 115 MET A SD     1 
ATOM   565  C  CE     . MET A 1 78  ? 12.438 17.471  36.117 1.00 33.47  ? 115 MET A CE     1 
ATOM   566  N  N      . LYS A 1 79  ? 6.197  17.441  35.799 1.00 43.27  ? 116 LYS A N      1 
ATOM   567  C  CA     . LYS A 1 79  ? 4.970  17.208  36.569 1.00 45.74  ? 116 LYS A CA     1 
ATOM   568  C  C      . LYS A 1 79  ? 3.782  17.402  35.614 1.00 53.30  ? 116 LYS A C      1 
ATOM   569  O  O      . LYS A 1 79  ? 2.800  16.664  35.680 1.00 54.95  ? 116 LYS A O      1 
ATOM   570  C  CB     . LYS A 1 79  ? 4.883  18.183  37.761 1.00 49.29  ? 116 LYS A CB     1 
ATOM   571  N  N      . CYS A 1 80  ? 3.904  18.368  34.689 1.00 50.48  ? 117 CYS A N      1 
ATOM   572  C  CA     . CYS A 1 80  ? 2.904  18.662  33.669 1.00 51.11  ? 117 CYS A CA     1 
ATOM   573  C  C      . CYS A 1 80  ? 3.217  17.821  32.412 1.00 52.96  ? 117 CYS A C      1 
ATOM   574  O  O      . CYS A 1 80  ? 3.326  18.373  31.315 1.00 54.07  ? 117 CYS A O      1 
ATOM   575  C  CB     . CYS A 1 80  ? 2.877  20.161  33.366 1.00 51.90  ? 117 CYS A CB     1 
ATOM   576  N  N      . VAL A 1 81  ? 3.405  16.483  32.595 1.00 45.73  ? 118 VAL A N      1 
ATOM   577  C  CA     . VAL A 1 81  ? 3.712  15.458  31.574 1.00 42.26  ? 118 VAL A CA     1 
ATOM   578  C  C      . VAL A 1 81  ? 3.593  14.037  32.153 1.00 40.87  ? 118 VAL A C      1 
ATOM   579  O  O      . VAL A 1 81  ? 4.125  13.773  33.227 1.00 38.30  ? 118 VAL A O      1 
ATOM   580  C  CB     . VAL A 1 81  ? 5.076  15.658  30.864 1.00 43.51  ? 118 VAL A CB     1 
ATOM   581  N  N      . ASN A 1 82  ? 2.920  13.120  31.429 1.00 36.21  ? 119 ASN A N      1 
ATOM   582  C  CA     . ASN A 1 82  ? 2.769  11.722  31.863 1.00 35.65  ? 119 ASN A CA     1 
ATOM   583  C  C      . ASN A 1 82  ? 2.800  10.761  30.654 1.00 36.67  ? 119 ASN A C      1 
ATOM   584  O  O      . ASN A 1 82  ? 1.757  10.451  30.070 1.00 38.69  ? 119 ASN A O      1 
ATOM   585  C  CB     . ASN A 1 82  ? 1.505  11.537  32.724 1.00 34.76  ? 119 ASN A CB     1 
ATOM   586  C  CG     . ASN A 1 82  ? 1.259  10.121  33.178 1.00 55.17  ? 119 ASN A CG     1 
ATOM   587  O  OD1    . ASN A 1 82  ? 2.167  9.416   33.630 1.00 45.45  ? 119 ASN A OD1    1 
ATOM   588  N  ND2    . ASN A 1 82  ? 0.016  9.677   33.065 1.00 50.98  ? 119 ASN A ND2    1 
ATOM   589  N  N      . HIS A 1 83  ? 4.009  10.298  30.281 1.00 27.25  ? 120 HIS A N      1 
ATOM   590  C  CA     . HIS A 1 83  ? 4.205  9.428   29.122 1.00 24.30  ? 120 HIS A CA     1 
ATOM   591  C  C      . HIS A 1 83  ? 5.502  8.643   29.251 1.00 24.84  ? 120 HIS A C      1 
ATOM   592  O  O      . HIS A 1 83  ? 6.520  9.196   29.646 1.00 22.48  ? 120 HIS A O      1 
ATOM   593  C  CB     . HIS A 1 83  ? 4.197  10.264  27.840 1.00 23.02  ? 120 HIS A CB     1 
ATOM   594  C  CG     . HIS A 1 83  ? 4.041  9.464   26.588 1.00 25.66  ? 120 HIS A CG     1 
ATOM   595  N  ND1    . HIS A 1 83  ? 5.124  8.873   25.974 1.00 25.42  ? 120 HIS A ND1    1 
ATOM   596  C  CD2    . HIS A 1 83  ? 2.933  9.223   25.853 1.00 28.08  ? 120 HIS A CD2    1 
ATOM   597  C  CE1    . HIS A 1 83  ? 4.637  8.267   24.904 1.00 25.69  ? 120 HIS A CE1    1 
ATOM   598  N  NE2    . HIS A 1 83  ? 3.325  8.445   24.792 1.00 27.43  ? 120 HIS A NE2    1 
ATOM   599  N  N      . LYS A 1 84  ? 5.470  7.368   28.875 1.00 22.13  ? 121 LYS A N      1 
ATOM   600  C  CA     . LYS A 1 84  ? 6.617  6.461   28.969 1.00 21.00  ? 121 LYS A CA     1 
ATOM   601  C  C      . LYS A 1 84  ? 7.776  6.809   28.025 1.00 21.77  ? 121 LYS A C      1 
ATOM   602  O  O      . LYS A 1 84  ? 8.892  6.354   28.275 1.00 21.48  ? 121 LYS A O      1 
ATOM   603  C  CB     . LYS A 1 84  ? 6.190  4.997   28.805 1.00 24.00  ? 121 LYS A CB     1 
ATOM   604  C  CG     . LYS A 1 84  ? 5.591  4.667   27.449 1.00 31.96  ? 121 LYS A CG     1 
ATOM   605  C  CD     . LYS A 1 84  ? 5.350  3.190   27.345 1.00 35.07  ? 121 LYS A CD     1 
ATOM   606  C  CE     . LYS A 1 84  ? 4.375  2.886   26.258 1.00 39.60  ? 121 LYS A CE     1 
ATOM   607  N  NZ     . LYS A 1 84  ? 3.766  1.537   26.444 1.00 59.16  ? 121 LYS A NZ     1 
ATOM   608  N  N      . ASN A 1 85  ? 7.540  7.641   26.984 1.00 16.10  ? 122 ASN A N      1 
ATOM   609  C  CA     . ASN A 1 85  ? 8.630  8.047   26.094 1.00 14.33  ? 122 ASN A CA     1 
ATOM   610  C  C      . ASN A 1 85  ? 9.221  9.395   26.479 1.00 15.82  ? 122 ASN A C      1 
ATOM   611  O  O      . ASN A 1 85  ? 10.111 9.886   25.785 1.00 14.19  ? 122 ASN A O      1 
ATOM   612  C  CB     . ASN A 1 85  ? 8.234  7.985   24.611 1.00 13.12  ? 122 ASN A CB     1 
ATOM   613  C  CG     . ASN A 1 85  ? 7.792  6.603   24.209 1.00 23.07  ? 122 ASN A CG     1 
ATOM   614  O  OD1    . ASN A 1 85  ? 6.703  6.423   23.689 1.00 16.94  ? 122 ASN A OD1    1 
ATOM   615  N  ND2    . ASN A 1 85  ? 8.585  5.585   24.524 1.00 17.16  ? 122 ASN A ND2    1 
ATOM   616  N  N      . ILE A 1 86  ? 8.757  9.970   27.614 1.00 12.84  ? 123 ILE A N      1 
ATOM   617  C  CA     . ILE A 1 86  ? 9.271  11.240  28.158 1.00 10.88  ? 123 ILE A CA     1 
ATOM   618  C  C      . ILE A 1 86  ? 9.798  10.962  29.574 1.00 15.37  ? 123 ILE A C      1 
ATOM   619  O  O      . ILE A 1 86  ? 9.142  10.245  30.346 1.00 13.60  ? 123 ILE A O      1 
ATOM   620  C  CB     . ILE A 1 86  ? 8.190  12.373  28.187 1.00 14.06  ? 123 ILE A CB     1 
ATOM   621  C  CG1    . ILE A 1 86  ? 7.557  12.664  26.788 1.00 15.10  ? 123 ILE A CG1    1 
ATOM   622  C  CG2    . ILE A 1 86  ? 8.727  13.664  28.835 1.00 14.04  ? 123 ILE A CG2    1 
ATOM   623  C  CD1    . ILE A 1 86  ? 8.547  13.177  25.677 1.00 16.38  ? 123 ILE A CD1    1 
ATOM   624  N  N      . ILE A 1 87  ? 10.951 11.575  29.933 1.00 12.09  ? 124 ILE A N      1 
ATOM   625  C  CA     . ILE A 1 87  ? 11.506 11.477  31.283 1.00 12.58  ? 124 ILE A CA     1 
ATOM   626  C  C      . ILE A 1 87  ? 10.387 11.641  32.344 1.00 18.41  ? 124 ILE A C      1 
ATOM   627  O  O      . ILE A 1 87  ? 9.501  12.504  32.222 1.00 19.13  ? 124 ILE A O      1 
ATOM   628  C  CB     . ILE A 1 87  ? 12.636 12.517  31.503 1.00 14.80  ? 124 ILE A CB     1 
ATOM   629  C  CG1    . ILE A 1 87  ? 13.261 12.326  32.924 1.00 16.62  ? 124 ILE A CG1    1 
ATOM   630  C  CG2    . ILE A 1 87  ? 12.163 13.977  31.204 1.00 12.72  ? 124 ILE A CG2    1 
ATOM   631  C  CD1    . ILE A 1 87  ? 14.138 13.358  33.391 1.00 28.02  ? 124 ILE A CD1    1 
ATOM   632  N  N      . SER A 1 88  ? 10.441 10.804  33.360 1.00 16.21  ? 125 SER A N      1 
ATOM   633  C  CA     . SER A 1 88  ? 9.523  10.797  34.496 1.00 17.99  ? 125 SER A CA     1 
ATOM   634  C  C      . SER A 1 88  ? 10.411 10.738  35.751 1.00 20.66  ? 125 SER A C      1 
ATOM   635  O  O      . SER A 1 88  ? 11.347 9.948   35.793 1.00 20.30  ? 125 SER A O      1 
ATOM   636  C  CB     . SER A 1 88  ? 8.638  9.549   34.420 1.00 23.74  ? 125 SER A CB     1 
ATOM   637  O  OG     . SER A 1 88  ? 7.722  9.493   35.496 1.00 44.31  ? 125 SER A OG     1 
ATOM   638  N  N      . LEU A 1 89  ? 10.135 11.557  36.757 1.00 17.78  ? 126 LEU A N      1 
ATOM   639  C  CA     . LEU A 1 89  ? 10.938 11.562  37.977 1.00 17.61  ? 126 LEU A CA     1 
ATOM   640  C  C      . LEU A 1 89  ? 10.468 10.561  39.000 1.00 20.50  ? 126 LEU A C      1 
ATOM   641  O  O      . LEU A 1 89  ? 9.266  10.461  39.256 1.00 21.20  ? 126 LEU A O      1 
ATOM   642  C  CB     . LEU A 1 89  ? 10.903 12.941  38.651 1.00 18.61  ? 126 LEU A CB     1 
ATOM   643  C  CG     . LEU A 1 89  ? 11.668 14.072  38.009 1.00 23.36  ? 126 LEU A CG     1 
ATOM   644  C  CD1    . LEU A 1 89  ? 11.755 15.231  38.987 1.00 23.97  ? 126 LEU A CD1    1 
ATOM   645  C  CD2    . LEU A 1 89  ? 13.061 13.619  37.514 1.00 23.80  ? 126 LEU A CD2    1 
ATOM   646  N  N      . LEU A 1 90  ? 11.424 9.874   39.646 1.00 16.25  ? 127 LEU A N      1 
ATOM   647  C  CA     . LEU A 1 90  ? 11.139 8.990   40.777 1.00 16.55  ? 127 LEU A CA     1 
ATOM   648  C  C      . LEU A 1 90  ? 11.252 9.808   42.047 1.00 20.17  ? 127 LEU A C      1 
ATOM   649  O  O      . LEU A 1 90  ? 10.517 9.567   43.008 1.00 20.14  ? 127 LEU A O      1 
ATOM   650  C  CB     . LEU A 1 90  ? 12.130 7.818   40.834 1.00 16.41  ? 127 LEU A CB     1 
ATOM   651  C  CG     . LEU A 1 90  ? 11.984 6.792   39.704 1.00 19.48  ? 127 LEU A CG     1 
ATOM   652  C  CD1    . LEU A 1 90  ? 13.155 5.862   39.685 1.00 18.91  ? 127 LEU A CD1    1 
ATOM   653  C  CD2    . LEU A 1 90  ? 10.671 6.023   39.820 1.00 22.52  ? 127 LEU A CD2    1 
ATOM   654  N  N      . ASN A 1 91  ? 12.181 10.794  42.050 1.00 16.09  ? 128 ASN A N      1 
ATOM   655  C  CA     . ASN A 1 91  ? 12.421 11.617  43.230 1.00 16.11  ? 128 ASN A CA     1 
ATOM   656  C  C      . ASN A 1 91  ? 13.090 12.932  42.882 1.00 16.19  ? 128 ASN A C      1 
ATOM   657  O  O      . ASN A 1 91  ? 13.733 13.051  41.851 1.00 13.66  ? 128 ASN A O      1 
ATOM   658  C  CB     . ASN A 1 91  ? 13.301 10.830  44.241 1.00 15.96  ? 128 ASN A CB     1 
ATOM   659  C  CG     . ASN A 1 91  ? 13.057 11.148  45.695 1.00 26.62  ? 128 ASN A CG     1 
ATOM   660  O  OD1    . ASN A 1 91  ? 12.326 12.069  46.047 1.00 16.95  ? 128 ASN A OD1    1 
ATOM   661  N  ND2    . ASN A 1 91  ? 13.686 10.391  46.579 1.00 17.66  ? 128 ASN A ND2    1 
ATOM   662  N  N      . VAL A 1 92  ? 12.947 13.906  43.768 1.00 14.44  ? 129 VAL A N      1 
ATOM   663  C  CA     . VAL A 1 92  ? 13.582 15.229  43.704 1.00 15.51  ? 129 VAL A CA     1 
ATOM   664  C  C      . VAL A 1 92  ? 13.873 15.627  45.153 1.00 18.48  ? 129 VAL A C      1 
ATOM   665  O  O      . VAL A 1 92  ? 13.023 15.444  46.024 1.00 17.47  ? 129 VAL A O      1 
ATOM   666  C  CB     . VAL A 1 92  ? 12.773 16.316  42.913 1.00 21.29  ? 129 VAL A CB     1 
ATOM   667  C  CG1    . VAL A 1 92  ? 11.295 16.327  43.318 1.00 23.34  ? 129 VAL A CG1    1 
ATOM   668  C  CG2    . VAL A 1 92  ? 13.392 17.721  43.084 1.00 20.45  ? 129 VAL A CG2    1 
ATOM   669  N  N      . PHE A 1 93  ? 15.097 16.086  45.421 1.00 14.98  ? 130 PHE A N      1 
ATOM   670  C  CA     . PHE A 1 93  ? 15.462 16.475  46.777 1.00 15.31  ? 130 PHE A CA     1 
ATOM   671  C  C      . PHE A 1 93  ? 16.588 17.463  46.803 1.00 18.26  ? 130 PHE A C      1 
ATOM   672  O  O      . PHE A 1 93  ? 17.347 17.577  45.850 1.00 16.96  ? 130 PHE A O      1 
ATOM   673  C  CB     . PHE A 1 93  ? 15.835 15.235  47.641 1.00 16.55  ? 130 PHE A CB     1 
ATOM   674  C  CG     . PHE A 1 93  ? 17.079 14.479  47.218 1.00 15.35  ? 130 PHE A CG     1 
ATOM   675  C  CD1    . PHE A 1 93  ? 18.328 14.820  47.730 1.00 15.36  ? 130 PHE A CD1    1 
ATOM   676  C  CD2    . PHE A 1 93  ? 16.990 13.387  46.360 1.00 16.16  ? 130 PHE A CD2    1 
ATOM   677  C  CE1    . PHE A 1 93  ? 19.465 14.091  47.390 1.00 15.87  ? 130 PHE A CE1    1 
ATOM   678  C  CE2    . PHE A 1 93  ? 18.133 12.657  46.008 1.00 17.98  ? 130 PHE A CE2    1 
ATOM   679  C  CZ     . PHE A 1 93  ? 19.365 13.016  46.527 1.00 15.85  ? 130 PHE A CZ     1 
ATOM   680  N  N      . THR A 1 94  ? 16.720 18.132  47.935 1.00 16.11  ? 131 THR A N      1 
ATOM   681  C  CA     . THR A 1 94  ? 17.835 19.002  48.244 1.00 15.99  ? 131 THR A CA     1 
ATOM   682  C  C      . THR A 1 94  ? 18.327 18.613  49.637 1.00 21.19  ? 131 THR A C      1 
ATOM   683  O  O      . THR A 1 94  ? 17.519 18.497  50.554 1.00 20.83  ? 131 THR A O      1 
ATOM   684  C  CB     . THR A 1 94  ? 17.515 20.528  48.092 1.00 21.93  ? 131 THR A CB     1 
ATOM   685  O  OG1    . THR A 1 94  ? 18.670 21.270  48.502 1.00 15.09  ? 131 THR A OG1    1 
ATOM   686  C  CG2    . THR A 1 94  ? 16.338 21.001  48.939 1.00 23.65  ? 131 THR A CG2    1 
ATOM   687  N  N      . PRO A 1 95  ? 19.646 18.456  49.837 1.00 20.02  ? 132 PRO A N      1 
ATOM   688  C  CA     . PRO A 1 95  ? 20.149 18.215  51.202 1.00 21.01  ? 132 PRO A CA     1 
ATOM   689  C  C      . PRO A 1 95  ? 20.046 19.455  52.094 1.00 28.87  ? 132 PRO A C      1 
ATOM   690  O  O      . PRO A 1 95  ? 20.087 19.319  53.318 1.00 30.31  ? 132 PRO A O      1 
ATOM   691  C  CB     . PRO A 1 95  ? 21.619 17.836  50.989 1.00 22.47  ? 132 PRO A CB     1 
ATOM   692  C  CG     . PRO A 1 95  ? 21.848 17.842  49.511 1.00 25.16  ? 132 PRO A CG     1 
ATOM   693  C  CD     . PRO A 1 95  ? 20.748 18.593  48.866 1.00 20.08  ? 132 PRO A CD     1 
ATOM   694  N  N      . GLN A 1 96  ? 19.932 20.665  51.493 1.00 25.53  ? 133 GLN A N      1 
ATOM   695  C  CA     . GLN A 1 96  ? 19.851 21.933  52.242 1.00 26.12  ? 133 GLN A CA     1 
ATOM   696  C  C      . GLN A 1 96  ? 18.448 22.189  52.817 1.00 33.55  ? 133 GLN A C      1 
ATOM   697  O  O      . GLN A 1 96  ? 17.440 22.002  52.133 1.00 32.41  ? 133 GLN A O      1 
ATOM   698  C  CB     . GLN A 1 96  ? 20.365 23.106  51.408 1.00 26.49  ? 133 GLN A CB     1 
ATOM   699  C  CG     . GLN A 1 96  ? 21.851 22.980  51.080 1.00 23.61  ? 133 GLN A CG     1 
ATOM   700  C  CD     . GLN A 1 96  ? 22.110 22.359  49.732 1.00 27.46  ? 133 GLN A CD     1 
ATOM   701  O  OE1    . GLN A 1 96  ? 21.394 22.591  48.745 1.00 21.67  ? 133 GLN A OE1    1 
ATOM   702  N  NE2    . GLN A 1 96  ? 23.152 21.552  49.659 1.00 20.58  ? 133 GLN A NE2    1 
ATOM   703  N  N      . LYS A 1 97  ? 18.405 22.605  54.094 1.00 34.60  ? 134 LYS A N      1 
ATOM   704  C  CA     . LYS A 1 97  ? 17.197 22.761  54.921 1.00 36.28  ? 134 LYS A CA     1 
ATOM   705  C  C      . LYS A 1 97  ? 16.422 24.060  54.771 1.00 41.26  ? 134 LYS A C      1 
ATOM   706  O  O      . LYS A 1 97  ? 15.225 24.090  55.071 1.00 42.24  ? 134 LYS A O      1 
ATOM   707  C  CB     . LYS A 1 97  ? 17.553 22.574  56.396 1.00 40.11  ? 134 LYS A CB     1 
ATOM   708  C  CG     . LYS A 1 97  ? 18.012 21.161  56.758 1.00 56.76  ? 134 LYS A CG     1 
ATOM   709  C  CD     . LYS A 1 97  ? 18.551 21.125  58.190 1.00 69.02  ? 134 LYS A CD     1 
ATOM   710  C  CE     . LYS A 1 97  ? 19.328 19.865  58.476 1.00 86.93  ? 134 LYS A CE     1 
ATOM   711  N  NZ     . LYS A 1 97  ? 19.865 19.847  59.864 1.00 101.59 ? 134 LYS A NZ     1 
ATOM   712  N  N      . THR A 1 98  ? 17.096 25.136  54.374 1.00 37.13  ? 135 THR A N      1 
ATOM   713  C  CA     . THR A 1 98  ? 16.472 26.457  54.273 1.00 37.48  ? 135 THR A CA     1 
ATOM   714  C  C      . THR A 1 98  ? 16.764 27.090  52.931 1.00 39.47  ? 135 THR A C      1 
ATOM   715  O  O      . THR A 1 98  ? 17.752 26.719  52.294 1.00 37.67  ? 135 THR A O      1 
ATOM   716  C  CB     . THR A 1 98  ? 17.010 27.364  55.411 1.00 43.29  ? 135 THR A CB     1 
ATOM   717  O  OG1    . THR A 1 98  ? 18.437 27.460  55.313 1.00 43.35  ? 135 THR A OG1    1 
ATOM   718  C  CG2    . THR A 1 98  ? 16.625 26.862  56.816 1.00 38.43  ? 135 THR A CG2    1 
ATOM   719  N  N      . LEU A 1 99  ? 15.942 28.087  52.526 1.00 35.82  ? 136 LEU A N      1 
ATOM   720  C  CA     . LEU A 1 99  ? 16.139 28.854  51.298 1.00 34.86  ? 136 LEU A CA     1 
ATOM   721  C  C      . LEU A 1 99  ? 17.516 29.530  51.338 1.00 37.38  ? 136 LEU A C      1 
ATOM   722  O  O      . LEU A 1 99  ? 18.216 29.545  50.326 1.00 34.55  ? 136 LEU A O      1 
ATOM   723  C  CB     . LEU A 1 99  ? 15.024 29.914  51.129 1.00 36.16  ? 136 LEU A CB     1 
ATOM   724  C  CG     . LEU A 1 99  ? 15.192 30.946  49.990 1.00 40.63  ? 136 LEU A CG     1 
ATOM   725  C  CD1    . LEU A 1 99  ? 15.136 30.291  48.622 1.00 38.64  ? 136 LEU A CD1    1 
ATOM   726  C  CD2    . LEU A 1 99  ? 14.154 32.020  50.081 1.00 43.44  ? 136 LEU A CD2    1 
ATOM   727  N  N      . GLU A 1 100 ? 17.898 30.074  52.518 1.00 34.97  ? 137 GLU A N      1 
ATOM   728  C  CA     . GLU A 1 100 ? 19.183 30.732  52.736 1.00 35.65  ? 137 GLU A CA     1 
ATOM   729  C  C      . GLU A 1 100 ? 20.333 29.780  52.407 1.00 37.27  ? 137 GLU A C      1 
ATOM   730  O  O      . GLU A 1 100 ? 21.217 30.146  51.637 1.00 37.49  ? 137 GLU A O      1 
ATOM   731  C  CB     . GLU A 1 100 ? 19.296 31.270  54.186 1.00 38.82  ? 137 GLU A CB     1 
ATOM   732  N  N      . GLU A 1 101 ? 20.285 28.541  52.928 1.00 32.00  ? 138 GLU A N      1 
ATOM   733  C  CA     . GLU A 1 101 ? 21.323 27.537  52.665 1.00 29.88  ? 138 GLU A CA     1 
ATOM   734  C  C      . GLU A 1 101 ? 21.190 26.831  51.336 1.00 29.15  ? 138 GLU A C      1 
ATOM   735  O  O      . GLU A 1 101 ? 22.158 26.210  50.912 1.00 29.07  ? 138 GLU A O      1 
ATOM   736  C  CB     . GLU A 1 101 ? 21.396 26.492  53.791 1.00 31.42  ? 138 GLU A CB     1 
ATOM   737  C  CG     . GLU A 1 101 ? 21.775 27.067  55.142 1.00 42.16  ? 138 GLU A CG     1 
ATOM   738  C  CD     . GLU A 1 101 ? 21.597 26.060  56.260 1.00 60.73  ? 138 GLU A CD     1 
ATOM   739  O  OE1    . GLU A 1 101 ? 22.615 25.481  56.703 1.00 51.49  ? 138 GLU A OE1    1 
ATOM   740  O  OE2    . GLU A 1 101 ? 20.434 25.802  56.647 1.00 52.60  ? 138 GLU A OE2    1 
ATOM   741  N  N      . PHE A 1 102 ? 20.006 26.884  50.697 1.00 23.63  ? 139 PHE A N      1 
ATOM   742  C  CA     . PHE A 1 102 ? 19.700 26.182  49.434 1.00 21.39  ? 139 PHE A CA     1 
ATOM   743  C  C      . PHE A 1 102 ? 20.753 26.341  48.352 1.00 24.31  ? 139 PHE A C      1 
ATOM   744  O  O      . PHE A 1 102 ? 21.075 27.453  47.967 1.00 25.06  ? 139 PHE A O      1 
ATOM   745  C  CB     . PHE A 1 102 ? 18.316 26.569  48.885 1.00 22.40  ? 139 PHE A CB     1 
ATOM   746  C  CG     . PHE A 1 102 ? 17.957 25.982  47.530 1.00 21.88  ? 139 PHE A CG     1 
ATOM   747  C  CD1    . PHE A 1 102 ? 17.968 24.606  47.322 1.00 23.37  ? 139 PHE A CD1    1 
ATOM   748  C  CD2    . PHE A 1 102 ? 17.569 26.805  46.481 1.00 22.63  ? 139 PHE A CD2    1 
ATOM   749  C  CE1    . PHE A 1 102 ? 17.606 24.068  46.083 1.00 22.71  ? 139 PHE A CE1    1 
ATOM   750  C  CE2    . PHE A 1 102 ? 17.189 26.267  45.249 1.00 23.90  ? 139 PHE A CE2    1 
ATOM   751  C  CZ     . PHE A 1 102 ? 17.224 24.902  45.054 1.00 20.90  ? 139 PHE A CZ     1 
ATOM   752  N  N      . GLN A 1 103 ? 21.282 25.233  47.850 1.00 19.73  ? 140 GLN A N      1 
ATOM   753  C  CA     . GLN A 1 103 ? 22.276 25.313  46.779 1.00 19.13  ? 140 GLN A CA     1 
ATOM   754  C  C      . GLN A 1 103 ? 21.983 24.354  45.633 1.00 23.69  ? 140 GLN A C      1 
ATOM   755  O  O      . GLN A 1 103 ? 21.934 24.765  44.470 1.00 23.79  ? 140 GLN A O      1 
ATOM   756  C  CB     . GLN A 1 103 ? 23.688 25.048  47.307 1.00 20.86  ? 140 GLN A CB     1 
ATOM   757  C  CG     . GLN A 1 103 ? 24.218 26.131  48.245 1.00 41.79  ? 140 GLN A CG     1 
ATOM   758  C  CD     . GLN A 1 103 ? 25.721 26.141  48.272 1.00 56.58  ? 140 GLN A CD     1 
ATOM   759  O  OE1    . GLN A 1 103 ? 26.389 26.556  47.307 1.00 46.20  ? 140 GLN A OE1    1 
ATOM   760  N  NE2    . GLN A 1 103 ? 26.283 25.672  49.376 1.00 47.45  ? 140 GLN A NE2    1 
ATOM   761  N  N      . ASP A 1 104 ? 21.810 23.072  45.971 1.00 17.91  ? 141 ASP A N      1 
ATOM   762  C  CA     . ASP A 1 104 ? 21.704 21.992  45.022 1.00 16.35  ? 141 ASP A CA     1 
ATOM   763  C  C      . ASP A 1 104 ? 20.373 21.302  44.951 1.00 19.29  ? 141 ASP A C      1 
ATOM   764  O  O      . ASP A 1 104 ? 19.676 21.160  45.958 1.00 19.77  ? 141 ASP A O      1 
ATOM   765  C  CB     . ASP A 1 104 ? 22.800 20.963  45.323 1.00 18.08  ? 141 ASP A CB     1 
ATOM   766  C  CG     . ASP A 1 104 ? 24.165 21.611  45.493 1.00 23.69  ? 141 ASP A CG     1 
ATOM   767  O  OD1    . ASP A 1 104 ? 24.556 22.402  44.617 1.00 24.59  ? 141 ASP A OD1    1 
ATOM   768  O  OD2    . ASP A 1 104 ? 24.830 21.335  46.506 1.00 23.65  ? 141 ASP A OD2    1 
ATOM   769  N  N      . VAL A 1 105 ? 20.049 20.846  43.745 1.00 13.02  ? 142 VAL A N      1 
ATOM   770  C  CA     . VAL A 1 105 ? 18.858 20.070  43.430 1.00 12.29  ? 142 VAL A CA     1 
ATOM   771  C  C      . VAL A 1 105 ? 19.336 18.746  42.858 1.00 14.46  ? 142 VAL A C      1 
ATOM   772  O  O      . VAL A 1 105 ? 20.164 18.740  41.927 1.00 11.10  ? 142 VAL A O      1 
ATOM   773  C  CB     . VAL A 1 105 ? 17.945 20.789  42.410 1.00 15.55  ? 142 VAL A CB     1 
ATOM   774  C  CG1    . VAL A 1 105 ? 16.795 19.881  41.959 1.00 14.67  ? 142 VAL A CG1    1 
ATOM   775  C  CG2    . VAL A 1 105 ? 17.413 22.090  42.987 1.00 16.21  ? 142 VAL A CG2    1 
ATOM   776  N  N      . TYR A 1 106 ? 18.776 17.630  43.394 1.00 10.92  ? 143 TYR A N      1 
ATOM   777  C  CA     . TYR A 1 106 ? 19.040 16.277  42.924 1.00 9.46   ? 143 TYR A CA     1 
ATOM   778  C  C      . TYR A 1 106 ? 17.760 15.700  42.324 1.00 12.43  ? 143 TYR A C      1 
ATOM   779  O  O      . TYR A 1 106 ? 16.691 15.731  42.949 1.00 13.26  ? 143 TYR A O      1 
ATOM   780  C  CB     . TYR A 1 106 ? 19.550 15.393  44.072 1.00 10.82  ? 143 TYR A CB     1 
ATOM   781  C  CG     . TYR A 1 106 ? 20.913 15.795  44.596 1.00 12.23  ? 143 TYR A CG     1 
ATOM   782  C  CD1    . TYR A 1 106 ? 21.053 16.842  45.504 1.00 14.38  ? 143 TYR A CD1    1 
ATOM   783  C  CD2    . TYR A 1 106 ? 22.070 15.172  44.136 1.00 13.05  ? 143 TYR A CD2    1 
ATOM   784  C  CE1    . TYR A 1 106 ? 22.305 17.226  45.978 1.00 15.04  ? 143 TYR A CE1    1 
ATOM   785  C  CE2    . TYR A 1 106 ? 23.324 15.527  44.626 1.00 14.26  ? 143 TYR A CE2    1 
ATOM   786  C  CZ     . TYR A 1 106 ? 23.437 16.559  45.543 1.00 19.84  ? 143 TYR A CZ     1 
ATOM   787  O  OH     . TYR A 1 106 ? 24.670 16.946  45.999 1.00 20.09  ? 143 TYR A OH     1 
ATOM   788  N  N      . LEU A 1 107 ? 17.872 15.172  41.122 1.00 8.23   ? 144 LEU A N      1 
ATOM   789  C  CA     . LEU A 1 107 ? 16.746 14.575  40.402 1.00 8.17   ? 144 LEU A CA     1 
ATOM   790  C  C      . LEU A 1 107 ? 17.055 13.126  40.202 1.00 11.09  ? 144 LEU A C      1 
ATOM   791  O  O      . LEU A 1 107 ? 18.197 12.780  39.909 1.00 11.97  ? 144 LEU A O      1 
ATOM   792  C  CB     . LEU A 1 107 ? 16.540 15.258  39.022 1.00 7.30   ? 144 LEU A CB     1 
ATOM   793  C  CG     . LEU A 1 107 ? 16.388 16.798  39.013 1.00 12.14  ? 144 LEU A CG     1 
ATOM   794  C  CD1    . LEU A 1 107 ? 16.319 17.309  37.602 1.00 12.26  ? 144 LEU A CD1    1 
ATOM   795  C  CD2    . LEU A 1 107 ? 15.118 17.227  39.724 1.00 17.90  ? 144 LEU A CD2    1 
ATOM   796  N  N      . VAL A 1 108 ? 16.048 12.281  40.358 1.00 7.21   ? 145 VAL A N      1 
ATOM   797  C  CA     . VAL A 1 108 ? 16.216 10.853  40.241 1.00 7.66   ? 145 VAL A CA     1 
ATOM   798  C  C      . VAL A 1 108 ? 15.238 10.296  39.209 1.00 11.56  ? 145 VAL A C      1 
ATOM   799  O  O      . VAL A 1 108 ? 14.057 10.630  39.238 1.00 13.94  ? 145 VAL A O      1 
ATOM   800  C  CB     . VAL A 1 108 ? 16.044 10.136  41.615 1.00 11.25  ? 145 VAL A CB     1 
ATOM   801  C  CG1    . VAL A 1 108 ? 16.369 8.650   41.503 1.00 10.87  ? 145 VAL A CG1    1 
ATOM   802  C  CG2    . VAL A 1 108 ? 16.885 10.785  42.722 1.00 11.98  ? 145 VAL A CG2    1 
ATOM   803  N  N      . MET A 1 109 ? 15.717 9.395   38.355 1.00 7.48   ? 146 MET A N      1 
ATOM   804  C  CA     . MET A 1 109 ? 14.872 8.653   37.411 1.00 7.62   ? 146 MET A CA     1 
ATOM   805  C  C      . MET A 1 109 ? 15.428 7.241   37.277 1.00 13.99  ? 146 MET A C      1 
ATOM   806  O  O      . MET A 1 109 ? 16.533 6.967   37.738 1.00 14.23  ? 146 MET A O      1 
ATOM   807  C  CB     . MET A 1 109 ? 14.825 9.347   36.031 1.00 7.43   ? 146 MET A CB     1 
ATOM   808  C  CG     . MET A 1 109 ? 16.134 9.260   35.253 1.00 9.19   ? 146 MET A CG     1 
ATOM   809  S  SD     . MET A 1 109 ? 16.005 9.994   33.595 1.00 12.30  ? 146 MET A SD     1 
ATOM   810  C  CE     . MET A 1 109 ? 15.216 8.671   32.706 1.00 8.80   ? 146 MET A CE     1 
ATOM   811  N  N      . GLU A 1 110 ? 14.700 6.376   36.565 1.00 14.37  ? 147 GLU A N      1 
ATOM   812  C  CA     . GLU A 1 110 ? 15.081 5.012   36.235 1.00 16.87  ? 147 GLU A CA     1 
ATOM   813  C  C      . GLU A 1 110 ? 16.451 5.008   35.526 1.00 17.01  ? 147 GLU A C      1 
ATOM   814  O  O      . GLU A 1 110 ? 16.669 5.841   34.655 1.00 12.82  ? 147 GLU A O      1 
ATOM   815  C  CB     . GLU A 1 110 ? 14.063 4.488   35.227 1.00 19.67  ? 147 GLU A CB     1 
ATOM   816  C  CG     . GLU A 1 110 ? 13.988 2.983   35.219 1.00 40.02  ? 147 GLU A CG     1 
ATOM   817  C  CD     . GLU A 1 110 ? 13.291 2.428   34.003 1.00 48.41  ? 147 GLU A CD     1 
ATOM   818  O  OE1    . GLU A 1 110 ? 12.309 3.049   33.539 1.00 31.83  ? 147 GLU A OE1    1 
ATOM   819  O  OE2    . GLU A 1 110 ? 13.730 1.363   33.517 1.00 46.49  ? 147 GLU A OE2    1 
ATOM   820  N  N      . LEU A 1 111 ? 17.354 4.085   35.887 1.00 14.45  ? 148 LEU A N      1 
ATOM   821  C  CA     . LEU A 1 111 ? 18.646 4.009   35.210 1.00 14.55  ? 148 LEU A CA     1 
ATOM   822  C  C      . LEU A 1 111 ? 18.453 3.410   33.813 1.00 18.51  ? 148 LEU A C      1 
ATOM   823  O  O      . LEU A 1 111 ? 17.876 2.334   33.690 1.00 20.31  ? 148 LEU A O      1 
ATOM   824  C  CB     . LEU A 1 111 ? 19.662 3.155   35.992 1.00 15.56  ? 148 LEU A CB     1 
ATOM   825  C  CG     . LEU A 1 111 ? 21.076 3.040   35.345 1.00 18.92  ? 148 LEU A CG     1 
ATOM   826  C  CD1    . LEU A 1 111 ? 21.802 4.455   35.279 1.00 16.65  ? 148 LEU A CD1    1 
ATOM   827  C  CD2    . LEU A 1 111 ? 21.935 2.008   36.083 1.00 16.31  ? 148 LEU A CD2    1 
ATOM   828  N  N      . MET A 1 112 ? 18.907 4.111   32.780 1.00 13.56  ? 149 MET A N      1 
ATOM   829  C  CA     . MET A 1 112 ? 18.834 3.595   31.407 1.00 13.82  ? 149 MET A CA     1 
ATOM   830  C  C      . MET A 1 112 ? 20.175 2.967   31.017 1.00 17.18  ? 149 MET A C      1 
ATOM   831  O  O      . MET A 1 112 ? 21.176 3.187   31.685 1.00 15.90  ? 149 MET A O      1 
ATOM   832  C  CB     . MET A 1 112 ? 18.326 4.668   30.415 1.00 14.04  ? 149 MET A CB     1 
ATOM   833  C  CG     . MET A 1 112 ? 17.017 5.327   30.869 1.00 16.20  ? 149 MET A CG     1 
ATOM   834  S  SD     . MET A 1 112 ? 15.581 4.235   30.709 1.00 21.38  ? 149 MET A SD     1 
ATOM   835  C  CE     . MET A 1 112 ? 15.230 4.352   28.905 1.00 16.63  ? 149 MET A CE     1 
ATOM   836  N  N      . ASP A 1 113 ? 20.180 2.139   29.991 1.00 17.66  ? 150 ASP A N      1 
ATOM   837  C  CA     . ASP A 1 113 ? 21.363 1.388   29.561 1.00 17.59  ? 150 ASP A CA     1 
ATOM   838  C  C      . ASP A 1 113 ? 22.302 2.131   28.646 1.00 21.22  ? 150 ASP A C      1 
ATOM   839  O  O      . ASP A 1 113 ? 23.505 1.890   28.697 1.00 22.43  ? 150 ASP A O      1 
ATOM   840  C  CB     . ASP A 1 113 ? 20.940 0.072   28.917 1.00 18.95  ? 150 ASP A CB     1 
ATOM   841  C  CG     . ASP A 1 113 ? 20.249 -0.818  29.922 1.00 26.72  ? 150 ASP A CG     1 
ATOM   842  O  OD1    . ASP A 1 113 ? 20.731 -0.898  31.069 1.00 29.49  ? 150 ASP A OD1    1 
ATOM   843  O  OD2    . ASP A 1 113 ? 19.228 -1.425  29.567 1.00 26.91  ? 150 ASP A OD2    1 
ATOM   844  N  N      . ALA A 1 114 ? 21.780 3.007   27.795 1.00 15.57  ? 151 ALA A N      1 
ATOM   845  C  CA     . ALA A 1 114 ? 22.640 3.707   26.842 1.00 15.99  ? 151 ALA A CA     1 
ATOM   846  C  C      . ALA A 1 114 ? 21.950 4.940   26.350 1.00 18.94  ? 151 ALA A C      1 
ATOM   847  O  O      . ALA A 1 114 ? 20.748 5.082   26.565 1.00 18.79  ? 151 ALA A O      1 
ATOM   848  C  CB     . ALA A 1 114 ? 22.946 2.793   25.649 1.00 17.75  ? 151 ALA A CB     1 
ATOM   849  N  N      . ASN A 1 115 ? 22.694 5.830   25.685 1.00 14.10  ? 152 ASN A N      1 
ATOM   850  C  CA     . ASN A 1 115 ? 22.084 6.984   25.055 1.00 12.76  ? 152 ASN A CA     1 
ATOM   851  C  C      . ASN A 1 115 ? 21.927 6.650   23.548 1.00 17.14  ? 152 ASN A C      1 
ATOM   852  O  O      . ASN A 1 115 ? 22.404 5.596   23.102 1.00 17.87  ? 152 ASN A O      1 
ATOM   853  C  CB     . ASN A 1 115 ? 22.863 8.282   25.342 1.00 11.37  ? 152 ASN A CB     1 
ATOM   854  C  CG     . ASN A 1 115 ? 24.250 8.355   24.746 1.00 29.81  ? 152 ASN A CG     1 
ATOM   855  O  OD1    . ASN A 1 115 ? 24.626 7.611   23.839 1.00 22.47  ? 152 ASN A OD1    1 
ATOM   856  N  ND2    . ASN A 1 115 ? 25.052 9.269   25.244 1.00 20.69  ? 152 ASN A ND2    1 
ATOM   857  N  N      . LEU A 1 116 ? 21.257 7.509   22.776 1.00 12.69  ? 153 LEU A N      1 
ATOM   858  C  CA     . LEU A 1 116 ? 21.023 7.248   21.363 1.00 12.62  ? 153 LEU A CA     1 
ATOM   859  C  C      . LEU A 1 116 ? 22.304 7.392   20.535 1.00 18.14  ? 153 LEU A C      1 
ATOM   860  O  O      . LEU A 1 116 ? 22.385 6.790   19.472 1.00 18.25  ? 153 LEU A O      1 
ATOM   861  C  CB     . LEU A 1 116 ? 19.890 8.156   20.851 1.00 12.23  ? 153 LEU A CB     1 
ATOM   862  C  CG     . LEU A 1 116 ? 19.100 7.730   19.602 1.00 16.51  ? 153 LEU A CG     1 
ATOM   863  C  CD1    . LEU A 1 116 ? 18.476 6.326   19.759 1.00 16.22  ? 153 LEU A CD1    1 
ATOM   864  C  CD2    . LEU A 1 116 ? 17.992 8.739   19.319 1.00 13.64  ? 153 LEU A CD2    1 
ATOM   865  N  N      . CYS A 1 117 ? 23.326 8.125   21.040 1.00 16.17  ? 154 CYS A N      1 
ATOM   866  C  CA     . CYS A 1 117 ? 24.637 8.275   20.380 1.00 18.13  ? 154 CYS A CA     1 
ATOM   867  C  C      . CYS A 1 117 ? 25.270 6.880   20.210 1.00 22.15  ? 154 CYS A C      1 
ATOM   868  O  O      . CYS A 1 117 ? 25.749 6.547   19.133 1.00 21.03  ? 154 CYS A O      1 
ATOM   869  C  CB     . CYS A 1 117 ? 25.559 9.181   21.191 1.00 19.41  ? 154 CYS A CB     1 
ATOM   870  S  SG     . CYS A 1 117 ? 25.005 10.894  21.300 1.00 23.36  ? 154 CYS A SG     1 
ATOM   871  N  N      . GLN A 1 118 ? 25.279 6.099   21.297 1.00 18.54  ? 155 GLN A N      1 
ATOM   872  C  CA     . GLN A 1 118 ? 25.813 4.742   21.349 1.00 20.26  ? 155 GLN A CA     1 
ATOM   873  C  C      . GLN A 1 118 ? 25.057 3.830   20.394 1.00 25.01  ? 155 GLN A C      1 
ATOM   874  O  O      . GLN A 1 118 ? 25.687 3.089   19.644 1.00 26.54  ? 155 GLN A O      1 
ATOM   875  C  CB     . GLN A 1 118 ? 25.777 4.216   22.788 1.00 21.35  ? 155 GLN A CB     1 
ATOM   876  C  CG     . GLN A 1 118 ? 26.690 5.004   23.729 1.00 22.09  ? 155 GLN A CG     1 
ATOM   877  C  CD     . GLN A 1 118 ? 26.495 4.553   25.155 1.00 41.19  ? 155 GLN A CD     1 
ATOM   878  O  OE1    . GLN A 1 118 ? 25.536 4.936   25.827 1.00 29.15  ? 155 GLN A OE1    1 
ATOM   879  N  NE2    . GLN A 1 118 ? 27.367 3.681   25.627 1.00 41.44  ? 155 GLN A NE2    1 
ATOM   880  N  N      . VAL A 1 119 ? 23.717 3.949   20.369 1.00 22.09  ? 156 VAL A N      1 
ATOM   881  C  CA     . VAL A 1 119 ? 22.816 3.210   19.466 1.00 22.78  ? 156 VAL A CA     1 
ATOM   882  C  C      . VAL A 1 119 ? 23.142 3.568   17.987 1.00 25.10  ? 156 VAL A C      1 
ATOM   883  O  O      . VAL A 1 119 ? 23.188 2.677   17.129 1.00 25.89  ? 156 VAL A O      1 
ATOM   884  C  CB     . VAL A 1 119 ? 21.337 3.476   19.861 1.00 26.38  ? 156 VAL A CB     1 
ATOM   885  C  CG1    . VAL A 1 119 ? 20.366 3.057   18.779 1.00 27.39  ? 156 VAL A CG1    1 
ATOM   886  C  CG2    . VAL A 1 119 ? 20.999 2.785   21.165 1.00 26.49  ? 156 VAL A CG2    1 
ATOM   887  N  N      . ILE A 1 120 ? 23.421 4.864   17.709 1.00 17.36  ? 157 ILE A N      1 
ATOM   888  C  CA     . ILE A 1 120 ? 23.814 5.356   16.372 1.00 15.46  ? 157 ILE A CA     1 
ATOM   889  C  C      . ILE A 1 120 ? 25.107 4.675   15.878 1.00 21.76  ? 157 ILE A C      1 
ATOM   890  O  O      . ILE A 1 120 ? 25.233 4.413   14.689 1.00 21.16  ? 157 ILE A O      1 
ATOM   891  C  CB     . ILE A 1 120 ? 23.941 6.913   16.384 1.00 16.46  ? 157 ILE A CB     1 
ATOM   892  C  CG1    . ILE A 1 120 ? 22.593 7.567   16.073 1.00 15.51  ? 157 ILE A CG1    1 
ATOM   893  C  CG2    . ILE A 1 120 ? 25.100 7.451   15.468 1.00 15.63  ? 157 ILE A CG2    1 
ATOM   894  C  CD1    . ILE A 1 120 ? 22.446 9.058   16.580 1.00 13.97  ? 157 ILE A CD1    1 
ATOM   895  N  N      . GLN A 1 121 ? 26.063 4.404   16.780 1.00 22.53  ? 158 GLN A N      1 
ATOM   896  C  CA     . GLN A 1 121 ? 27.333 3.744   16.431 1.00 24.85  ? 158 GLN A CA     1 
ATOM   897  C  C      . GLN A 1 121 ? 27.179 2.234   16.101 1.00 31.34  ? 158 GLN A C      1 
ATOM   898  O  O      . GLN A 1 121 ? 28.174 1.573   15.778 1.00 34.05  ? 158 GLN A O      1 
ATOM   899  C  CB     . GLN A 1 121 ? 28.353 3.921   17.566 1.00 26.79  ? 158 GLN A CB     1 
ATOM   900  C  CG     . GLN A 1 121 ? 28.914 5.330   17.716 1.00 41.47  ? 158 GLN A CG     1 
ATOM   901  C  CD     . GLN A 1 121 ? 29.841 5.375   18.908 1.00 63.56  ? 158 GLN A CD     1 
ATOM   902  O  OE1    . GLN A 1 121 ? 29.407 5.476   20.059 1.00 56.16  ? 158 GLN A OE1    1 
ATOM   903  N  NE2    . GLN A 1 121 ? 31.136 5.223   18.667 1.00 62.99  ? 158 GLN A NE2    1 
ATOM   904  N  N      . MET A 1 122 ? 25.968 1.678   16.223 1.00 25.53  ? 159 MET A N      1 
ATOM   905  C  CA     . MET A 1 122 ? 25.765 0.258   15.919 1.00 25.85  ? 159 MET A CA     1 
ATOM   906  C  C      . MET A 1 122 ? 24.818 0.056   14.741 1.00 26.30  ? 159 MET A C      1 
ATOM   907  O  O      . MET A 1 122 ? 24.075 0.966   14.378 1.00 22.28  ? 159 MET A O      1 
ATOM   908  C  CB     . MET A 1 122 ? 25.344 -0.564  17.160 1.00 29.16  ? 159 MET A CB     1 
ATOM   909  C  CG     . MET A 1 122 ? 24.038 -0.160  17.809 1.00 33.06  ? 159 MET A CG     1 
ATOM   910  S  SD     . MET A 1 122 ? 23.730 -0.893  19.455 1.00 39.31  ? 159 MET A SD     1 
ATOM   911  C  CE     . MET A 1 122 ? 24.912 -0.051  20.434 1.00 36.73  ? 159 MET A CE     1 
ATOM   912  N  N      . GLU A 1 123 ? 24.870 -1.129  14.118 1.00 22.19  ? 160 GLU A N      1 
ATOM   913  C  CA     . GLU A 1 123 ? 23.954 -1.469  13.048 1.00 21.69  ? 160 GLU A CA     1 
ATOM   914  C  C      . GLU A 1 123 ? 22.676 -1.942  13.687 1.00 28.90  ? 160 GLU A C      1 
ATOM   915  O  O      . GLU A 1 123 ? 22.703 -2.807  14.573 1.00 31.33  ? 160 GLU A O      1 
ATOM   916  C  CB     . GLU A 1 123 ? 24.510 -2.612  12.219 1.00 24.71  ? 160 GLU A CB     1 
ATOM   917  C  CG     . GLU A 1 123 ? 25.600 -2.190  11.266 1.00 31.85  ? 160 GLU A CG     1 
ATOM   918  C  CD     . GLU A 1 123 ? 25.977 -3.271  10.286 1.00 43.80  ? 160 GLU A CD     1 
ATOM   919  O  OE1    . GLU A 1 123 ? 25.427 -4.392  10.395 1.00 33.56  ? 160 GLU A OE1    1 
ATOM   920  O  OE2    . GLU A 1 123 ? 26.824 -2.996  9.408  1.00 31.05  ? 160 GLU A OE2    1 
ATOM   921  N  N      . LEU A 1 124 ? 21.559 -1.358  13.289 1.00 24.59  ? 161 LEU A N      1 
ATOM   922  C  CA     . LEU A 1 124 ? 20.272 -1.806  13.808 1.00 24.84  ? 161 LEU A CA     1 
ATOM   923  C  C      . LEU A 1 124 ? 19.488 -2.456  12.685 1.00 28.76  ? 161 LEU A C      1 
ATOM   924  O  O      . LEU A 1 124 ? 19.606 -2.045  11.527 1.00 28.42  ? 161 LEU A O      1 
ATOM   925  C  CB     . LEU A 1 124 ? 19.442 -0.634  14.366 1.00 23.60  ? 161 LEU A CB     1 
ATOM   926  C  CG     . LEU A 1 124 ? 19.997 0.151   15.542 1.00 27.64  ? 161 LEU A CG     1 
ATOM   927  C  CD1    . LEU A 1 124 ? 19.313 1.466   15.636 1.00 27.15  ? 161 LEU A CD1    1 
ATOM   928  C  CD2    . LEU A 1 124 ? 19.865 -0.628  16.854 1.00 30.69  ? 161 LEU A CD2    1 
ATOM   929  N  N      . ASP A 1 125 ? 18.631 -3.420  13.029 1.00 24.49  ? 162 ASP A N      1 
ATOM   930  C  CA     . ASP A 1 125 ? 17.713 -3.986  12.039 1.00 25.05  ? 162 ASP A CA     1 
ATOM   931  C  C      . ASP A 1 125 ? 16.516 -2.979  11.963 1.00 27.00  ? 162 ASP A C      1 
ATOM   932  O  O      . ASP A 1 125 ? 16.447 -2.024  12.761 1.00 24.60  ? 162 ASP A O      1 
ATOM   933  C  CB     . ASP A 1 125 ? 17.241 -5.383  12.488 1.00 29.20  ? 162 ASP A CB     1 
ATOM   934  C  CG     . ASP A 1 125 ? 16.522 -5.337  13.816 1.00 45.01  ? 162 ASP A CG     1 
ATOM   935  O  OD1    . ASP A 1 125 ? 17.159 -4.963  14.818 1.00 48.57  ? 162 ASP A OD1    1 
ATOM   936  O  OD2    . ASP A 1 125 ? 15.301 -5.530  13.828 1.00 50.47  ? 162 ASP A OD2    1 
ATOM   937  N  N      . HIS A 1 126 ? 15.581 -3.207  11.040 1.00 22.57  ? 163 HIS A N      1 
ATOM   938  C  CA     . HIS A 1 126 ? 14.427 -2.334  10.825 1.00 20.89  ? 163 HIS A CA     1 
ATOM   939  C  C      . HIS A 1 126 ? 13.397 -2.338  11.936 1.00 22.79  ? 163 HIS A C      1 
ATOM   940  O  O      . HIS A 1 126 ? 12.756 -1.315  12.111 1.00 20.89  ? 163 HIS A O      1 
ATOM   941  C  CB     . HIS A 1 126 ? 13.755 -2.644  9.472  1.00 22.09  ? 163 HIS A CB     1 
ATOM   942  C  CG     . HIS A 1 126 ? 14.638 -2.304  8.324  1.00 24.33  ? 163 HIS A CG     1 
ATOM   943  N  ND1    . HIS A 1 126 ? 14.856 -1.000  7.952  1.00 24.10  ? 163 HIS A ND1    1 
ATOM   944  C  CD2    . HIS A 1 126 ? 15.346 -3.119  7.507  1.00 27.28  ? 163 HIS A CD2    1 
ATOM   945  C  CE1    . HIS A 1 126 ? 15.675 -1.053  6.914  1.00 24.14  ? 163 HIS A CE1    1 
ATOM   946  N  NE2    . HIS A 1 126 ? 15.999 -2.308  6.610  1.00 25.98  ? 163 HIS A NE2    1 
ATOM   947  N  N      . GLU A 1 127 ? 13.209 -3.466  12.660 1.00 21.67  ? 164 GLU A N      1 
ATOM   948  C  CA     . GLU A 1 127 ? 12.257 -3.580  13.780 1.00 23.12  ? 164 GLU A CA     1 
ATOM   949  C  C      . GLU A 1 127 ? 12.689 -2.636  14.891 1.00 26.52  ? 164 GLU A C      1 
ATOM   950  O  O      . GLU A 1 127 ? 11.877 -1.840  15.353 1.00 26.42  ? 164 GLU A O      1 
ATOM   951  C  CB     . GLU A 1 127 ? 12.164 -5.046  14.287 1.00 27.42  ? 164 GLU A CB     1 
ATOM   952  C  CG     . GLU A 1 127 ? 11.480 -5.249  15.636 1.00 42.18  ? 164 GLU A CG     1 
ATOM   953  C  CD     . GLU A 1 127 ? 11.773 -6.555  16.357 1.00 66.68  ? 164 GLU A CD     1 
ATOM   954  O  OE1    . GLU A 1 127 ? 12.557 -6.528  17.334 1.00 58.89  ? 164 GLU A OE1    1 
ATOM   955  O  OE2    . GLU A 1 127 ? 11.189 -7.596  15.976 1.00 58.03  ? 164 GLU A OE2    1 
ATOM   956  N  N      . ARG A 1 128 ? 13.977 -2.676  15.264 1.00 22.41  ? 165 ARG A N      1 
ATOM   957  C  CA     . ARG A 1 128 ? 14.546 -1.828  16.317 1.00 20.50  ? 165 ARG A CA     1 
ATOM   958  C  C      . ARG A 1 128 ? 14.622 -0.385  15.872 1.00 23.61  ? 165 ARG A C      1 
ATOM   959  O  O      . ARG A 1 128 ? 14.151 0.497   16.595 1.00 20.56  ? 165 ARG A O      1 
ATOM   960  C  CB     . ARG A 1 128 ? 15.906 -2.358  16.797 1.00 20.18  ? 165 ARG A CB     1 
ATOM   961  C  CG     . ARG A 1 128 ? 15.787 -3.664  17.588 1.00 29.94  ? 165 ARG A CG     1 
ATOM   962  C  CD     . ARG A 1 128 ? 17.143 -4.183  18.024 1.00 42.38  ? 165 ARG A CD     1 
ATOM   963  N  NE     . ARG A 1 128 ? 17.033 -5.420  18.800 1.00 56.79  ? 165 ARG A NE     1 
ATOM   964  C  CZ     . ARG A 1 128 ? 17.132 -6.645  18.290 1.00 74.48  ? 165 ARG A CZ     1 
ATOM   965  N  NH1    . ARG A 1 128 ? 17.350 -6.816  16.992 1.00 65.01  ? 165 ARG A NH1    1 
ATOM   966  N  NH2    . ARG A 1 128 ? 17.016 -7.709  19.077 1.00 57.73  ? 165 ARG A NH2    1 
ATOM   967  N  N      . MET A 1 129 ? 15.142 -0.138  14.648 1.00 22.67  ? 166 MET A N      1 
ATOM   968  C  CA     . MET A 1 129 ? 15.203 1.224   14.141 1.00 21.49  ? 166 MET A CA     1 
ATOM   969  C  C      . MET A 1 129 ? 13.816 1.844   14.062 1.00 20.66  ? 166 MET A C      1 
ATOM   970  O  O      . MET A 1 129 ? 13.631 2.905   14.636 1.00 16.93  ? 166 MET A O      1 
ATOM   971  C  CB     . MET A 1 129 ? 15.958 1.340   12.823 1.00 24.81  ? 166 MET A CB     1 
ATOM   972  C  CG     . MET A 1 129 ? 16.302 2.784   12.504 1.00 29.46  ? 166 MET A CG     1 
ATOM   973  S  SD     . MET A 1 129 ? 17.113 3.037   10.914 1.00 37.12  ? 166 MET A SD     1 
ATOM   974  C  CE     . MET A 1 129 ? 18.696 2.318   11.246 1.00 34.49  ? 166 MET A CE     1 
ATOM   975  N  N      . SER A 1 130 ? 12.826 1.156   13.436 1.00 16.27  ? 167 SER A N      1 
ATOM   976  C  CA     . SER A 1 130 ? 11.455 1.691   13.365 1.00 14.90  ? 167 SER A CA     1 
ATOM   977  C  C      . SER A 1 130 ? 10.815 1.870   14.764 1.00 16.31  ? 167 SER A C      1 
ATOM   978  O  O      . SER A 1 130 ? 10.117 2.850   14.977 1.00 16.06  ? 167 SER A O      1 
ATOM   979  C  CB     . SER A 1 130 ? 10.569 0.834   12.461 1.00 16.36  ? 167 SER A CB     1 
ATOM   980  O  OG     . SER A 1 130 ? 10.301 -0.449  13.008 1.00 18.34  ? 167 SER A OG     1 
ATOM   981  N  N      . TYR A 1 131 ? 11.049 0.934   15.703 1.00 13.84  ? 168 TYR A N      1 
ATOM   982  C  CA     . TYR A 1 131 ? 10.481 1.035   17.059 1.00 13.93  ? 168 TYR A CA     1 
ATOM   983  C  C      . TYR A 1 131 ? 11.007 2.268   17.807 1.00 16.82  ? 168 TYR A C      1 
ATOM   984  O  O      . TYR A 1 131 ? 10.216 3.015   18.381 1.00 17.92  ? 168 TYR A O      1 
ATOM   985  C  CB     . TYR A 1 131 ? 10.706 -0.249  17.876 1.00 14.80  ? 168 TYR A CB     1 
ATOM   986  C  CG     . TYR A 1 131 ? 10.024 -0.241  19.226 1.00 17.32  ? 168 TYR A CG     1 
ATOM   987  C  CD1    . TYR A 1 131 ? 8.676  0.083   19.347 1.00 20.09  ? 168 TYR A CD1    1 
ATOM   988  C  CD2    . TYR A 1 131 ? 10.714 -0.606  20.380 1.00 19.14  ? 168 TYR A CD2    1 
ATOM   989  C  CE1    . TYR A 1 131 ? 8.040  0.081   20.588 1.00 21.82  ? 168 TYR A CE1    1 
ATOM   990  C  CE2    . TYR A 1 131 ? 10.079 -0.650  21.623 1.00 20.62  ? 168 TYR A CE2    1 
ATOM   991  C  CZ     . TYR A 1 131 ? 8.748  -0.285  21.724 1.00 27.36  ? 168 TYR A CZ     1 
ATOM   992  O  OH     . TYR A 1 131 ? 8.139  -0.276  22.949 1.00 24.62  ? 168 TYR A OH     1 
ATOM   993  N  N      . LEU A 1 132 ? 12.325 2.516   17.749 1.00 13.51  ? 169 LEU A N      1 
ATOM   994  C  CA     . LEU A 1 132 ? 12.933 3.715   18.356 1.00 12.92  ? 169 LEU A CA     1 
ATOM   995  C  C      . LEU A 1 132 ? 12.350 5.016   17.789 1.00 16.28  ? 169 LEU A C      1 
ATOM   996  O  O      . LEU A 1 132 ? 12.026 5.953   18.539 1.00 15.24  ? 169 LEU A O      1 
ATOM   997  C  CB     . LEU A 1 132 ? 14.467 3.697   18.189 1.00 12.56  ? 169 LEU A CB     1 
ATOM   998  C  CG     . LEU A 1 132 ? 15.223 2.553   18.916 1.00 18.03  ? 169 LEU A CG     1 
ATOM   999  C  CD1    . LEU A 1 132 ? 16.645 2.431   18.421 1.00 18.35  ? 169 LEU A CD1    1 
ATOM   1000 C  CD2    . LEU A 1 132 ? 15.156 2.677   20.429 1.00 17.63  ? 169 LEU A CD2    1 
ATOM   1001 N  N      . LEU A 1 133 ? 12.199 5.073   16.466 1.00 13.68  ? 170 LEU A N      1 
ATOM   1002 C  CA     . LEU A 1 133 ? 11.669 6.273   15.797 1.00 11.69  ? 170 LEU A CA     1 
ATOM   1003 C  C      . LEU A 1 133 ? 10.186 6.468   16.170 1.00 14.91  ? 170 LEU A C      1 
ATOM   1004 O  O      . LEU A 1 133 ? 9.782  7.584   16.476 1.00 13.88  ? 170 LEU A O      1 
ATOM   1005 C  CB     . LEU A 1 133 ? 11.866 6.152   14.282 1.00 11.22  ? 170 LEU A CB     1 
ATOM   1006 C  CG     . LEU A 1 133 ? 13.329 6.176   13.779 1.00 14.64  ? 170 LEU A CG     1 
ATOM   1007 C  CD1    . LEU A 1 133 ? 13.424 5.598   12.363 1.00 14.90  ? 170 LEU A CD1    1 
ATOM   1008 C  CD2    . LEU A 1 133 ? 13.907 7.605   13.796 1.00 13.97  ? 170 LEU A CD2    1 
ATOM   1009 N  N      . TYR A 1 134 ? 9.403  5.364   16.211 1.00 13.20  ? 171 TYR A N      1 
ATOM   1010 C  CA     . TYR A 1 134 ? 7.993  5.376   16.628 1.00 14.06  ? 171 TYR A CA     1 
ATOM   1011 C  C      . TYR A 1 134 ? 7.869  5.993   18.046 1.00 18.18  ? 171 TYR A C      1 
ATOM   1012 O  O      . TYR A 1 134 ? 7.005  6.838   18.285 1.00 17.14  ? 171 TYR A O      1 
ATOM   1013 C  CB     . TYR A 1 134 ? 7.419  3.945   16.615 1.00 15.36  ? 171 TYR A CB     1 
ATOM   1014 C  CG     . TYR A 1 134 ? 6.117  3.806   17.379 1.00 17.49  ? 171 TYR A CG     1 
ATOM   1015 C  CD1    . TYR A 1 134 ? 4.926  4.314   16.865 1.00 19.00  ? 171 TYR A CD1    1 
ATOM   1016 C  CD2    . TYR A 1 134 ? 6.075  3.164   18.618 1.00 18.97  ? 171 TYR A CD2    1 
ATOM   1017 C  CE1    . TYR A 1 134 ? 3.732  4.200   17.568 1.00 19.66  ? 171 TYR A CE1    1 
ATOM   1018 C  CE2    . TYR A 1 134 ? 4.883  3.041   19.329 1.00 20.67  ? 171 TYR A CE2    1 
ATOM   1019 C  CZ     . TYR A 1 134 ? 3.714  3.557   18.797 1.00 29.54  ? 171 TYR A CZ     1 
ATOM   1020 O  OH     . TYR A 1 134 ? 2.544  3.472   19.509 1.00 36.36  ? 171 TYR A OH     1 
ATOM   1021 N  N      . GLN A 1 135 ? 8.759  5.575   18.966 1.00 14.49  ? 172 GLN A N      1 
ATOM   1022 C  CA     . GLN A 1 135 ? 8.791  6.067   20.348 1.00 14.28  ? 172 GLN A CA     1 
ATOM   1023 C  C      . GLN A 1 135 ? 9.162  7.540   20.441 1.00 17.16  ? 172 GLN A C      1 
ATOM   1024 O  O      . GLN A 1 135 ? 8.554  8.268   21.228 1.00 17.72  ? 172 GLN A O      1 
ATOM   1025 C  CB     . GLN A 1 135 ? 9.717  5.213   21.213 1.00 14.68  ? 172 GLN A CB     1 
ATOM   1026 C  CG     . GLN A 1 135 ? 9.129  3.841   21.514 1.00 17.98  ? 172 GLN A CG     1 
ATOM   1027 C  CD     . GLN A 1 135 ? 10.118 3.036   22.294 1.00 23.62  ? 172 GLN A CD     1 
ATOM   1028 O  OE1    . GLN A 1 135 ? 10.077 3.014   23.516 1.00 17.62  ? 172 GLN A OE1    1 
ATOM   1029 N  NE2    . GLN A 1 135 ? 11.080 2.429   21.599 1.00 14.77  ? 172 GLN A NE2    1 
ATOM   1030 N  N      . MET A 1 136 ? 10.112 7.998   19.621 1.00 13.50  ? 173 MET A N      1 
ATOM   1031 C  CA     . MET A 1 136 ? 10.475 9.421   19.603 1.00 13.20  ? 173 MET A CA     1 
ATOM   1032 C  C      . MET A 1 136 ? 9.235  10.217  19.161 1.00 16.52  ? 173 MET A C      1 
ATOM   1033 O  O      . MET A 1 136 ? 8.869  11.194  19.827 1.00 15.09  ? 173 MET A O      1 
ATOM   1034 C  CB     . MET A 1 136 ? 11.653 9.712   18.644 1.00 15.09  ? 173 MET A CB     1 
ATOM   1035 C  CG     . MET A 1 136 ? 12.995 9.157   19.103 1.00 17.76  ? 173 MET A CG     1 
ATOM   1036 S  SD     . MET A 1 136 ? 14.246 9.349   17.805 1.00 21.96  ? 173 MET A SD     1 
ATOM   1037 C  CE     . MET A 1 136 ? 14.840 7.743   17.690 1.00 18.97  ? 173 MET A CE     1 
ATOM   1038 N  N      . LEU A 1 137 ? 8.539  9.730   18.094 1.00 11.10  ? 174 LEU A N      1 
ATOM   1039 C  CA     . LEU A 1 137 ? 7.326  10.381  17.580 1.00 10.51  ? 174 LEU A CA     1 
ATOM   1040 C  C      . LEU A 1 137 ? 6.197  10.416  18.609 1.00 16.25  ? 174 LEU A C      1 
ATOM   1041 O  O      . LEU A 1 137 ? 5.520  11.435  18.685 1.00 17.07  ? 174 LEU A O      1 
ATOM   1042 C  CB     . LEU A 1 137 ? 6.841  9.757   16.254 1.00 10.12  ? 174 LEU A CB     1 
ATOM   1043 C  CG     . LEU A 1 137 ? 7.778  9.928   15.047 1.00 12.89  ? 174 LEU A CG     1 
ATOM   1044 C  CD1    . LEU A 1 137 ? 7.440  8.918   13.933 1.00 13.73  ? 174 LEU A CD1    1 
ATOM   1045 C  CD2    . LEU A 1 137 ? 7.750  11.378  14.505 1.00 11.10  ? 174 LEU A CD2    1 
ATOM   1046 N  N      . CYS A 1 138 ? 6.002  9.318   19.396 1.00 13.31  ? 175 CYS A N      1 
ATOM   1047 C  CA     . CYS A 1 138 ? 5.000  9.222   20.471 1.00 15.53  ? 175 CYS A CA     1 
ATOM   1048 C  C      . CYS A 1 138 ? 5.328  10.283  21.522 1.00 18.50  ? 175 CYS A C      1 
ATOM   1049 O  O      . CYS A 1 138 ? 4.430  11.004  21.956 1.00 19.66  ? 175 CYS A O      1 
ATOM   1050 C  CB     . CYS A 1 138 ? 4.985  7.829   21.099 1.00 16.88  ? 175 CYS A CB     1 
ATOM   1051 S  SG     . CYS A 1 138 ? 4.205  6.555   20.077 1.00 23.10  ? 175 CYS A SG     1 
ATOM   1052 N  N      . GLY A 1 139 ? 6.604  10.341  21.916 1.00 13.66  ? 176 GLY A N      1 
ATOM   1053 C  CA     . GLY A 1 139 ? 7.140  11.301  22.885 1.00 12.76  ? 176 GLY A CA     1 
ATOM   1054 C  C      . GLY A 1 139 ? 6.901  12.736  22.455 1.00 17.20  ? 176 GLY A C      1 
ATOM   1055 O  O      . GLY A 1 139 ? 6.289  13.504  23.200 1.00 18.42  ? 176 GLY A O      1 
ATOM   1056 N  N      . ILE A 1 140 ? 7.332  13.094  21.226 1.00 14.21  ? 177 ILE A N      1 
ATOM   1057 C  CA     . ILE A 1 140 ? 7.142  14.433  20.627 1.00 14.78  ? 177 ILE A CA     1 
ATOM   1058 C  C      . ILE A 1 140 ? 5.644  14.778  20.523 1.00 18.90  ? 177 ILE A C      1 
ATOM   1059 O  O      . ILE A 1 140 ? 5.256  15.886  20.891 1.00 18.03  ? 177 ILE A O      1 
ATOM   1060 C  CB     . ILE A 1 140 ? 7.851  14.524  19.241 1.00 18.30  ? 177 ILE A CB     1 
ATOM   1061 C  CG1    . ILE A 1 140 ? 9.383  14.461  19.398 1.00 18.67  ? 177 ILE A CG1    1 
ATOM   1062 C  CG2    . ILE A 1 140 ? 7.461  15.766  18.479 1.00 18.28  ? 177 ILE A CG2    1 
ATOM   1063 C  CD1    . ILE A 1 140 ? 10.030 13.692  18.232 1.00 22.14  ? 177 ILE A CD1    1 
ATOM   1064 N  N      . LYS A 1 141 ? 4.803  13.818  20.051 1.00 16.86  ? 178 LYS A N      1 
ATOM   1065 C  CA     . LYS A 1 141 ? 3.348  14.020  19.925 1.00 18.50  ? 178 LYS A CA     1 
ATOM   1066 C  C      . LYS A 1 141 ? 2.756  14.426  21.298 1.00 22.02  ? 178 LYS A C      1 
ATOM   1067 O  O      . LYS A 1 141 ? 1.973  15.376  21.389 1.00 22.06  ? 178 LYS A O      1 
ATOM   1068 C  CB     . LYS A 1 141 ? 2.672  12.747  19.366 1.00 21.74  ? 178 LYS A CB     1 
ATOM   1069 C  CG     . LYS A 1 141 ? 1.162  12.659  19.522 1.00 32.11  ? 178 LYS A CG     1 
ATOM   1070 C  CD     . LYS A 1 141 ? 0.431  13.075  18.270 1.00 39.38  ? 178 LYS A CD     1 
ATOM   1071 C  CE     . LYS A 1 141 ? -1.037 12.725  18.346 1.00 43.41  ? 178 LYS A CE     1 
ATOM   1072 N  NZ     . LYS A 1 141 ? -1.864 13.713  17.609 1.00 48.63  ? 178 LYS A NZ     1 
ATOM   1073 N  N      . HIS A 1 142 ? 3.177  13.733  22.354 1.00 17.67  ? 179 HIS A N      1 
ATOM   1074 C  CA     . HIS A 1 142 ? 2.731  14.017  23.712 1.00 17.89  ? 179 HIS A CA     1 
ATOM   1075 C  C      . HIS A 1 142 ? 3.115  15.452  24.130 1.00 20.21  ? 179 HIS A C      1 
ATOM   1076 O  O      . HIS A 1 142 ? 2.276  16.177  24.653 1.00 19.98  ? 179 HIS A O      1 
ATOM   1077 C  CB     . HIS A 1 142 ? 3.302  12.987  24.683 1.00 18.27  ? 179 HIS A CB     1 
ATOM   1078 C  CG     . HIS A 1 142 ? 2.635  13.012  26.015 1.00 23.42  ? 179 HIS A CG     1 
ATOM   1079 N  ND1    . HIS A 1 142 ? 1.345  12.539  26.183 1.00 27.95  ? 179 HIS A ND1    1 
ATOM   1080 C  CD2    . HIS A 1 142 ? 3.105  13.435  27.207 1.00 25.04  ? 179 HIS A CD2    1 
ATOM   1081 C  CE1    . HIS A 1 142 ? 1.081  12.670  27.471 1.00 28.12  ? 179 HIS A CE1    1 
ATOM   1082 N  NE2    . HIS A 1 142 ? 2.114  13.191  28.129 1.00 26.96  ? 179 HIS A NE2    1 
ATOM   1083 N  N      . LEU A 1 143 ? 4.348  15.875  23.829 1.00 15.98  ? 180 LEU A N      1 
ATOM   1084 C  CA     . LEU A 1 143 ? 4.796  17.244  24.105 1.00 15.87  ? 180 LEU A CA     1 
ATOM   1085 C  C      . LEU A 1 143 ? 3.941  18.282  23.372 1.00 22.21  ? 180 LEU A C      1 
ATOM   1086 O  O      . LEU A 1 143 ? 3.480  19.241  24.008 1.00 23.67  ? 180 LEU A O      1 
ATOM   1087 C  CB     . LEU A 1 143 ? 6.293  17.415  23.779 1.00 14.19  ? 180 LEU A CB     1 
ATOM   1088 C  CG     . LEU A 1 143 ? 7.253  16.612  24.695 1.00 17.95  ? 180 LEU A CG     1 
ATOM   1089 C  CD1    . LEU A 1 143 ? 8.688  16.900  24.353 1.00 17.58  ? 180 LEU A CD1    1 
ATOM   1090 C  CD2    . LEU A 1 143 ? 7.029  16.946  26.178 1.00 17.99  ? 180 LEU A CD2    1 
ATOM   1091 N  N      . HIS A 1 144 ? 3.668  18.051  22.059 1.00 18.43  ? 181 HIS A N      1 
ATOM   1092 C  CA     . HIS A 1 144 ? 2.855  18.938  21.210 1.00 18.96  ? 181 HIS A CA     1 
ATOM   1093 C  C      . HIS A 1 144 ? 1.431  19.126  21.718 1.00 26.06  ? 181 HIS A C      1 
ATOM   1094 O  O      . HIS A 1 144 ? 0.925  20.247  21.689 1.00 27.11  ? 181 HIS A O      1 
ATOM   1095 C  CB     . HIS A 1 144 ? 2.842  18.442  19.756 1.00 19.09  ? 181 HIS A CB     1 
ATOM   1096 C  CG     . HIS A 1 144 ? 4.168  18.539  19.061 1.00 20.51  ? 181 HIS A CG     1 
ATOM   1097 N  ND1    . HIS A 1 144 ? 4.341  18.049  17.777 1.00 21.41  ? 181 HIS A ND1    1 
ATOM   1098 C  CD2    . HIS A 1 144 ? 5.342  19.076  19.488 1.00 20.44  ? 181 HIS A CD2    1 
ATOM   1099 C  CE1    . HIS A 1 144 ? 5.594  18.320  17.458 1.00 19.59  ? 181 HIS A CE1    1 
ATOM   1100 N  NE2    . HIS A 1 144 ? 6.240  18.928  18.460 1.00 19.32  ? 181 HIS A NE2    1 
ATOM   1101 N  N      . SER A 1 145 ? 0.803  18.040  22.217 1.00 24.45  ? 182 SER A N      1 
ATOM   1102 C  CA     . SER A 1 145 ? -0.561 18.041  22.759 1.00 26.78  ? 182 SER A CA     1 
ATOM   1103 C  C      . SER A 1 145 ? -0.687 18.930  24.008 1.00 33.90  ? 182 SER A C      1 
ATOM   1104 O  O      . SER A 1 145 ? -1.778 19.409  24.314 1.00 34.99  ? 182 SER A O      1 
ATOM   1105 C  CB     . SER A 1 145 ? -1.037 16.616  23.035 1.00 29.25  ? 182 SER A CB     1 
ATOM   1106 O  OG     . SER A 1 145 ? -0.443 16.053  24.196 1.00 34.68  ? 182 SER A OG     1 
ATOM   1107 N  N      . ALA A 1 146 ? 0.442  19.167  24.701 1.00 31.43  ? 183 ALA A N      1 
ATOM   1108 C  CA     . ALA A 1 146 ? 0.540  20.023  25.894 1.00 31.79  ? 183 ALA A CA     1 
ATOM   1109 C  C      . ALA A 1 146 ? 1.054  21.424  25.536 1.00 35.25  ? 183 ALA A C      1 
ATOM   1110 O  O      . ALA A 1 146 ? 1.315  22.213  26.438 1.00 36.65  ? 183 ALA A O      1 
ATOM   1111 C  CB     . ALA A 1 146 ? 1.476  19.386  26.903 1.00 30.91  ? 183 ALA A CB     1 
ATOM   1112 N  N      . GLY A 1 147 ? 1.210  21.704  24.239 1.00 30.02  ? 184 GLY A N      1 
ATOM   1113 C  CA     . GLY A 1 147 ? 1.707  22.980  23.734 1.00 28.94  ? 184 GLY A CA     1 
ATOM   1114 C  C      . GLY A 1 147 ? 3.217  23.131  23.812 1.00 29.28  ? 184 GLY A C      1 
ATOM   1115 O  O      . GLY A 1 147 ? 3.733  24.238  23.624 1.00 29.52  ? 184 GLY A O      1 
ATOM   1116 N  N      . ILE A 1 148 ? 3.941  22.015  24.062 1.00 21.67  ? 185 ILE A N      1 
ATOM   1117 C  CA     . ILE A 1 148 ? 5.398  21.999  24.160 1.00 18.84  ? 185 ILE A CA     1 
ATOM   1118 C  C      . ILE A 1 148 ? 6.022  21.628  22.808 1.00 19.77  ? 185 ILE A C      1 
ATOM   1119 O  O      . ILE A 1 148 ? 5.921  20.478  22.368 1.00 17.59  ? 185 ILE A O      1 
ATOM   1120 C  CB     . ILE A 1 148 ? 5.910  21.083  25.323 1.00 20.77  ? 185 ILE A CB     1 
ATOM   1121 C  CG1    . ILE A 1 148 ? 5.389  21.548  26.703 1.00 22.19  ? 185 ILE A CG1    1 
ATOM   1122 C  CG2    . ILE A 1 148 ? 7.444  20.947  25.315 1.00 19.56  ? 185 ILE A CG2    1 
ATOM   1123 C  CD1    . ILE A 1 148 ? 5.214  20.367  27.735 1.00 30.84  ? 185 ILE A CD1    1 
ATOM   1124 N  N      . ILE A 1 149 ? 6.700  22.593  22.181 1.00 16.09  ? 186 ILE A N      1 
ATOM   1125 C  CA     . ILE A 1 149 ? 7.414  22.350  20.924 1.00 16.48  ? 186 ILE A CA     1 
ATOM   1126 C  C      . ILE A 1 149 ? 8.896  22.379  21.282 1.00 19.51  ? 186 ILE A C      1 
ATOM   1127 O  O      . ILE A 1 149 ? 9.391  23.405  21.716 1.00 20.78  ? 186 ILE A O      1 
ATOM   1128 C  CB     . ILE A 1 149 ? 6.983  23.262  19.741 1.00 20.32  ? 186 ILE A CB     1 
ATOM   1129 C  CG1    . ILE A 1 149 ? 5.468  23.075  19.438 1.00 22.06  ? 186 ILE A CG1    1 
ATOM   1130 C  CG2    . ILE A 1 149 ? 7.802  22.888  18.504 1.00 18.99  ? 186 ILE A CG2    1 
ATOM   1131 C  CD1    . ILE A 1 149 ? 4.766  24.234  18.590 1.00 29.87  ? 186 ILE A CD1    1 
ATOM   1132 N  N      . HIS A 1 150 ? 9.560  21.217  21.198 1.00 13.57  ? 187 HIS A N      1 
ATOM   1133 C  CA     . HIS A 1 150 ? 10.920 20.974  21.670 1.00 11.65  ? 187 HIS A CA     1 
ATOM   1134 C  C      . HIS A 1 150 ? 11.969 21.902  21.035 1.00 17.44  ? 187 HIS A C      1 
ATOM   1135 O  O      . HIS A 1 150 ? 12.582 22.699  21.757 1.00 16.92  ? 187 HIS A O      1 
ATOM   1136 C  CB     . HIS A 1 150 ? 11.290 19.482  21.508 1.00 9.65   ? 187 HIS A CB     1 
ATOM   1137 C  CG     . HIS A 1 150 ? 12.417 19.029  22.379 1.00 10.50  ? 187 HIS A CG     1 
ATOM   1138 N  ND1    . HIS A 1 150 ? 13.711 19.465  22.168 1.00 10.18  ? 187 HIS A ND1    1 
ATOM   1139 C  CD2    . HIS A 1 150 ? 12.410 18.144  23.410 1.00 10.97  ? 187 HIS A CD2    1 
ATOM   1140 C  CE1    . HIS A 1 150 ? 14.451 18.844  23.081 1.00 9.25   ? 187 HIS A CE1    1 
ATOM   1141 N  NE2    . HIS A 1 150 ? 13.706 18.046  23.859 1.00 9.68   ? 187 HIS A NE2    1 
ATOM   1142 N  N      . ARG A 1 151 ? 12.201 21.743  19.721 1.00 13.71  ? 188 ARG A N      1 
ATOM   1143 C  CA     . ARG A 1 151 ? 13.120 22.506  18.853 1.00 15.09  ? 188 ARG A CA     1 
ATOM   1144 C  C      . ARG A 1 151 ? 14.598 22.170  19.020 1.00 19.99  ? 188 ARG A C      1 
ATOM   1145 O  O      . ARG A 1 151 ? 15.399 22.655  18.219 1.00 22.25  ? 188 ARG A O      1 
ATOM   1146 C  CB     . ARG A 1 151 ? 12.926 24.031  18.959 1.00 13.85  ? 188 ARG A CB     1 
ATOM   1147 C  CG     . ARG A 1 151 ? 11.677 24.558  18.280 1.00 22.13  ? 188 ARG A CG     1 
ATOM   1148 C  CD     . ARG A 1 151 ? 11.699 26.077  18.212 1.00 28.68  ? 188 ARG A CD     1 
ATOM   1149 N  NE     . ARG A 1 151 ? 11.479 26.679  19.531 1.00 39.21  ? 188 ARG A NE     1 
ATOM   1150 C  CZ     . ARG A 1 151 ? 11.867 27.898  19.897 1.00 50.93  ? 188 ARG A CZ     1 
ATOM   1151 N  NH1    . ARG A 1 151 ? 12.500 28.690  19.039 1.00 44.73  ? 188 ARG A NH1    1 
ATOM   1152 N  NH2    . ARG A 1 151 ? 11.613 28.339  21.117 1.00 39.88  ? 188 ARG A NH2    1 
ATOM   1153 N  N      . ASP A 1 152 ? 14.973 21.345  20.014 1.00 14.45  ? 189 ASP A N      1 
ATOM   1154 C  CA     . ASP A 1 152 ? 16.379 20.996  20.211 1.00 12.44  ? 189 ASP A CA     1 
ATOM   1155 C  C      . ASP A 1 152 ? 16.588 19.531  20.504 1.00 13.45  ? 189 ASP A C      1 
ATOM   1156 O  O      . ASP A 1 152 ? 17.472 19.180  21.287 1.00 13.16  ? 189 ASP A O      1 
ATOM   1157 C  CB     . ASP A 1 152 ? 17.056 21.885  21.271 1.00 15.24  ? 189 ASP A CB     1 
ATOM   1158 C  CG     . ASP A 1 152 ? 18.584 21.929  21.215 1.00 26.04  ? 189 ASP A CG     1 
ATOM   1159 O  OD1    . ASP A 1 152 ? 19.162 21.525  20.172 1.00 25.88  ? 189 ASP A OD1    1 
ATOM   1160 O  OD2    . ASP A 1 152 ? 19.200 22.328  22.223 1.00 32.72  ? 189 ASP A OD2    1 
ATOM   1161 N  N      . LEU A 1 153 ? 15.826 18.658  19.857 1.00 10.19  ? 190 LEU A N      1 
ATOM   1162 C  CA     . LEU A 1 153 ? 16.034 17.230  20.085 1.00 11.08  ? 190 LEU A CA     1 
ATOM   1163 C  C      . LEU A 1 153 ? 17.397 16.827  19.582 1.00 14.23  ? 190 LEU A C      1 
ATOM   1164 O  O      . LEU A 1 153 ? 17.777 17.196  18.458 1.00 12.05  ? 190 LEU A O      1 
ATOM   1165 C  CB     . LEU A 1 153 ? 15.012 16.396  19.328 1.00 12.97  ? 190 LEU A CB     1 
ATOM   1166 C  CG     . LEU A 1 153 ? 13.635 16.322  19.891 1.00 19.60  ? 190 LEU A CG     1 
ATOM   1167 C  CD1    . LEU A 1 153 ? 12.672 15.996  18.777 1.00 21.46  ? 190 LEU A CD1    1 
ATOM   1168 C  CD2    . LEU A 1 153 ? 13.580 15.310  21.081 1.00 18.96  ? 190 LEU A CD2    1 
ATOM   1169 N  N      . LYS A 1 154 ? 18.117 16.029  20.389 1.00 10.84  ? 191 LYS A N      1 
ATOM   1170 C  CA     . LYS A 1 154 ? 19.434 15.533  19.991 1.00 10.24  ? 191 LYS A CA     1 
ATOM   1171 C  C      . LYS A 1 154 ? 19.674 14.158  20.615 1.00 12.30  ? 191 LYS A C      1 
ATOM   1172 O  O      . LYS A 1 154 ? 19.091 13.855  21.662 1.00 12.44  ? 191 LYS A O      1 
ATOM   1173 C  CB     . LYS A 1 154 ? 20.559 16.553  20.301 1.00 11.13  ? 191 LYS A CB     1 
ATOM   1174 C  CG     . LYS A 1 154 ? 20.799 16.792  21.781 1.00 8.99   ? 191 LYS A CG     1 
ATOM   1175 C  CD     . LYS A 1 154 ? 21.657 18.075  22.000 1.00 24.42  ? 191 LYS A CD     1 
ATOM   1176 C  CE     . LYS A 1 154 ? 20.804 19.274  22.379 1.00 36.64  ? 191 LYS A CE     1 
ATOM   1177 N  NZ     . LYS A 1 154 ? 21.589 20.544  22.426 1.00 51.10  ? 191 LYS A NZ     1 
ATOM   1178 N  N      . PRO A 1 155 ? 20.501 13.298  19.987 1.00 8.05   ? 192 PRO A N      1 
ATOM   1179 C  CA     . PRO A 1 155 ? 20.659 11.941  20.506 1.00 7.84   ? 192 PRO A CA     1 
ATOM   1180 C  C      . PRO A 1 155 ? 21.324 11.831  21.875 1.00 11.13  ? 192 PRO A C      1 
ATOM   1181 O  O      . PRO A 1 155 ? 21.037 10.880  22.593 1.00 10.04  ? 192 PRO A O      1 
ATOM   1182 C  CB     . PRO A 1 155 ? 21.449 11.216  19.405 1.00 10.47  ? 192 PRO A CB     1 
ATOM   1183 C  CG     . PRO A 1 155 ? 22.061 12.234  18.607 1.00 15.86  ? 192 PRO A CG     1 
ATOM   1184 C  CD     . PRO A 1 155 ? 21.219 13.471  18.707 1.00 10.45  ? 192 PRO A CD     1 
ATOM   1185 N  N      . SER A 1 156 ? 22.168 12.789  22.263 1.00 8.86   ? 193 SER A N      1 
ATOM   1186 C  CA     . SER A 1 156 ? 22.776 12.742  23.600 1.00 9.39   ? 193 SER A CA     1 
ATOM   1187 C  C      . SER A 1 156 ? 21.719 12.936  24.708 1.00 12.14  ? 193 SER A C      1 
ATOM   1188 O  O      . SER A 1 156 ? 21.968 12.544  25.837 1.00 14.12  ? 193 SER A O      1 
ATOM   1189 C  CB     . SER A 1 156 ? 23.885 13.776  23.731 1.00 13.53  ? 193 SER A CB     1 
ATOM   1190 O  OG     . SER A 1 156 ? 23.349 15.080  23.609 1.00 19.81  ? 193 SER A OG     1 
ATOM   1191 N  N      . ASN A 1 157 ? 20.528 13.459  24.367 1.00 7.64   ? 194 ASN A N      1 
ATOM   1192 C  CA     . ASN A 1 157 ? 19.423 13.666  25.325 1.00 7.25   ? 194 ASN A CA     1 
ATOM   1193 C  C      . ASN A 1 157 ? 18.293 12.653  25.181 1.00 10.67  ? 194 ASN A C      1 
ATOM   1194 O  O      . ASN A 1 157 ? 17.188 12.866  25.669 1.00 9.37   ? 194 ASN A O      1 
ATOM   1195 C  CB     . ASN A 1 157 ? 18.902 15.082  25.266 1.00 7.73   ? 194 ASN A CB     1 
ATOM   1196 C  CG     . ASN A 1 157 ? 19.802 16.011  26.014 1.00 21.19  ? 194 ASN A CG     1 
ATOM   1197 O  OD1    . ASN A 1 157 ? 20.317 15.675  27.078 1.00 22.58  ? 194 ASN A OD1    1 
ATOM   1198 N  ND2    . ASN A 1 157 ? 20.011 17.182  25.475 1.00 15.72  ? 194 ASN A ND2    1 
ATOM   1199 N  N      . ILE A 1 158 ? 18.603 11.530  24.533 1.00 7.32   ? 195 ILE A N      1 
ATOM   1200 C  CA     . ILE A 1 158 ? 17.672 10.437  24.370 1.00 7.86   ? 195 ILE A CA     1 
ATOM   1201 C  C      . ILE A 1 158 ? 18.378 9.205   24.867 1.00 12.27  ? 195 ILE A C      1 
ATOM   1202 O  O      . ILE A 1 158 ? 19.516 8.918   24.459 1.00 11.53  ? 195 ILE A O      1 
ATOM   1203 C  CB     . ILE A 1 158 ? 17.166 10.292  22.915 1.00 10.67  ? 195 ILE A CB     1 
ATOM   1204 C  CG1    . ILE A 1 158 ? 16.474 11.604  22.428 1.00 10.03  ? 195 ILE A CG1    1 
ATOM   1205 C  CG2    . ILE A 1 158 ? 16.225 9.123   22.831 1.00 12.61  ? 195 ILE A CG2    1 
ATOM   1206 C  CD1    . ILE A 1 158 ? 16.420 11.808  20.881 1.00 14.31  ? 195 ILE A CD1    1 
ATOM   1207 N  N      . VAL A 1 159 ? 17.714 8.497   25.780 1.00 8.82   ? 196 VAL A N      1 
ATOM   1208 C  CA     . VAL A 1 159 ? 18.251 7.280   26.368 1.00 9.19   ? 196 VAL A CA     1 
ATOM   1209 C  C      . VAL A 1 159 ? 17.378 6.097   26.072 1.00 13.20  ? 196 VAL A C      1 
ATOM   1210 O  O      . VAL A 1 159 ? 16.191 6.245   25.833 1.00 12.62  ? 196 VAL A O      1 
ATOM   1211 C  CB     . VAL A 1 159 ? 18.566 7.427   27.882 1.00 13.01  ? 196 VAL A CB     1 
ATOM   1212 C  CG1    . VAL A 1 159 ? 19.833 8.250   28.086 1.00 12.29  ? 196 VAL A CG1    1 
ATOM   1213 C  CG2    . VAL A 1 159 ? 17.379 8.037   28.641 1.00 12.18  ? 196 VAL A CG2    1 
ATOM   1214 N  N      . VAL A 1 160 ? 17.985 4.919   26.066 1.00 12.28  ? 197 VAL A N      1 
ATOM   1215 C  CA     . VAL A 1 160 ? 17.327 3.667   25.729 1.00 14.40  ? 197 VAL A CA     1 
ATOM   1216 C  C      . VAL A 1 160 ? 17.710 2.573   26.736 1.00 18.91  ? 197 VAL A C      1 
ATOM   1217 O  O      . VAL A 1 160 ? 18.754 2.655   27.395 1.00 18.27  ? 197 VAL A O      1 
ATOM   1218 C  CB     . VAL A 1 160 ? 17.646 3.206   24.260 1.00 17.96  ? 197 VAL A CB     1 
ATOM   1219 C  CG1    . VAL A 1 160 ? 17.343 4.296   23.222 1.00 16.14  ? 197 VAL A CG1    1 
ATOM   1220 C  CG2    . VAL A 1 160 ? 19.084 2.716   24.132 1.00 18.24  ? 197 VAL A CG2    1 
ATOM   1221 N  N      . LYS A 1 161 ? 16.875 1.546   26.808 1.00 18.91  ? 198 LYS A N      1 
ATOM   1222 C  CA     . LYS A 1 161 ? 17.107 0.335   27.589 1.00 21.86  ? 198 LYS A CA     1 
ATOM   1223 C  C      . LYS A 1 161 ? 17.399 -0.806  26.617 1.00 28.00  ? 198 LYS A C      1 
ATOM   1224 O  O      . LYS A 1 161 ? 17.095 -0.695  25.414 1.00 25.01  ? 198 LYS A O      1 
ATOM   1225 C  CB     . LYS A 1 161 ? 15.876 -0.035  28.428 1.00 25.91  ? 198 LYS A CB     1 
ATOM   1226 C  CG     . LYS A 1 161 ? 15.745 0.738   29.733 1.00 33.55  ? 198 LYS A CG     1 
ATOM   1227 C  CD     . LYS A 1 161 ? 14.954 -0.039  30.774 1.00 43.15  ? 198 LYS A CD     1 
ATOM   1228 C  CE     . LYS A 1 161 ? 13.462 0.087   30.575 1.00 57.48  ? 198 LYS A CE     1 
ATOM   1229 N  NZ     . LYS A 1 161 ? 12.706 -0.533  31.692 1.00 69.48  ? 198 LYS A NZ     1 
ATOM   1230 N  N      . SER A 1 162 ? 17.938 -1.934  27.156 1.00 27.58  ? 199 SER A N      1 
ATOM   1231 C  CA     . SER A 1 162 ? 18.253 -3.159  26.406 1.00 29.19  ? 199 SER A CA     1 
ATOM   1232 C  C      . SER A 1 162 ? 17.030 -3.750  25.698 1.00 31.49  ? 199 SER A C      1 
ATOM   1233 O  O      . SER A 1 162 ? 17.202 -4.468  24.716 1.00 32.13  ? 199 SER A O      1 
ATOM   1234 C  CB     . SER A 1 162 ? 18.837 -4.221  27.339 1.00 36.06  ? 199 SER A CB     1 
ATOM   1235 O  OG     . SER A 1 162 ? 20.157 -3.887  27.733 1.00 51.05  ? 199 SER A OG     1 
ATOM   1236 N  N      . ASP A 1 163 ? 15.805 -3.462  26.201 1.00 26.62  ? 200 ASP A N      1 
ATOM   1237 C  CA     . ASP A 1 163 ? 14.544 -3.947  25.629 1.00 27.57  ? 200 ASP A CA     1 
ATOM   1238 C  C      . ASP A 1 163 ? 14.023 -3.014  24.506 1.00 31.88  ? 200 ASP A C      1 
ATOM   1239 O  O      . ASP A 1 163 ? 12.870 -3.148  24.100 1.00 31.31  ? 200 ASP A O      1 
ATOM   1240 C  CB     . ASP A 1 163 ? 13.481 -4.152  26.735 1.00 29.63  ? 200 ASP A CB     1 
ATOM   1241 C  CG     . ASP A 1 163 ? 13.001 -2.889  27.439 1.00 33.81  ? 200 ASP A CG     1 
ATOM   1242 O  OD1    . ASP A 1 163 ? 13.548 -1.795  27.148 1.00 29.67  ? 200 ASP A OD1    1 
ATOM   1243 O  OD2    . ASP A 1 163 ? 12.085 -2.992  28.290 1.00 39.55  ? 200 ASP A OD2    1 
ATOM   1244 N  N      . CYS A 1 164 ? 14.858 -2.024  24.071 1.00 29.70  ? 201 CYS A N      1 
ATOM   1245 C  CA     . CYS A 1 164 ? 14.588 -1.053  22.988 1.00 29.48  ? 201 CYS A CA     1 
ATOM   1246 C  C      . CYS A 1 164 ? 13.608 0.078   23.394 1.00 28.33  ? 201 CYS A C      1 
ATOM   1247 O  O      . CYS A 1 164 ? 13.218 0.872   22.544 1.00 27.54  ? 201 CYS A O      1 
ATOM   1248 C  CB     . CYS A 1 164 ? 14.138 -1.773  21.708 1.00 32.97  ? 201 CYS A CB     1 
ATOM   1249 S  SG     . CYS A 1 164 ? 14.767 -1.035  20.174 1.00 37.44  ? 201 CYS A SG     1 
ATOM   1250 N  N      . THR A 1 165 ? 13.228 0.178   24.686 1.00 23.27  ? 202 THR A N      1 
ATOM   1251 C  CA     . THR A 1 165 ? 12.348 1.264   25.153 1.00 21.74  ? 202 THR A CA     1 
ATOM   1252 C  C      . THR A 1 165 ? 13.154 2.576   25.266 1.00 21.32  ? 202 THR A C      1 
ATOM   1253 O  O      . THR A 1 165 ? 14.341 2.564   25.593 1.00 21.15  ? 202 THR A O      1 
ATOM   1254 C  CB     . THR A 1 165 ? 11.575 0.888   26.404 1.00 29.77  ? 202 THR A CB     1 
ATOM   1255 O  OG1    . THR A 1 165 ? 12.516 0.673   27.443 1.00 28.15  ? 202 THR A OG1    1 
ATOM   1256 C  CG2    . THR A 1 165 ? 10.666 -0.344  26.193 1.00 30.37  ? 202 THR A CG2    1 
ATOM   1257 N  N      . LEU A 1 166 ? 12.508 3.686   24.962 1.00 13.79  ? 203 LEU A N      1 
ATOM   1258 C  CA     . LEU A 1 166 ? 13.164 4.962   24.793 1.00 11.39  ? 203 LEU A CA     1 
ATOM   1259 C  C      . LEU A 1 166 ? 12.483 6.080   25.558 1.00 14.48  ? 203 LEU A C      1 
ATOM   1260 O  O      . LEU A 1 166 ? 11.246 6.076   25.718 1.00 14.23  ? 203 LEU A O      1 
ATOM   1261 C  CB     . LEU A 1 166 ? 13.161 5.243   23.254 1.00 10.68  ? 203 LEU A CB     1 
ATOM   1262 C  CG     . LEU A 1 166 ? 13.715 6.591   22.716 1.00 12.75  ? 203 LEU A CG     1 
ATOM   1263 C  CD1    . LEU A 1 166 ? 14.285 6.430   21.287 1.00 11.59  ? 203 LEU A CD1    1 
ATOM   1264 C  CD2    . LEU A 1 166 ? 12.650 7.682   22.724 1.00 12.34  ? 203 LEU A CD2    1 
ATOM   1265 N  N      . LYS A 1 167 ? 13.309 7.058   26.003 1.00 9.73   ? 204 LYS A N      1 
ATOM   1266 C  CA     . LYS A 1 167 ? 12.875 8.263   26.705 1.00 8.82   ? 204 LYS A CA     1 
ATOM   1267 C  C      . LYS A 1 167 ? 13.659 9.482   26.254 1.00 12.22  ? 204 LYS A C      1 
ATOM   1268 O  O      . LYS A 1 167 ? 14.880 9.405   26.101 1.00 12.91  ? 204 LYS A O      1 
ATOM   1269 C  CB     . LYS A 1 167 ? 13.010 8.098   28.232 1.00 10.63  ? 204 LYS A CB     1 
ATOM   1270 C  CG     . LYS A 1 167 ? 12.156 6.954   28.813 1.00 18.34  ? 204 LYS A CG     1 
ATOM   1271 C  CD     . LYS A 1 167 ? 12.219 6.926   30.341 1.00 23.42  ? 204 LYS A CD     1 
ATOM   1272 C  CE     . LYS A 1 167 ? 11.669 5.635   30.919 1.00 28.29  ? 204 LYS A CE     1 
ATOM   1273 N  NZ     . LYS A 1 167 ? 10.188 5.545   30.817 1.00 24.24  ? 204 LYS A NZ     1 
ATOM   1274 N  N      . ILE A 1 168 ? 12.953 10.615  26.052 1.00 7.68   ? 205 ILE A N      1 
ATOM   1275 C  CA     . ILE A 1 168 ? 13.517 11.925  25.761 1.00 5.98   ? 205 ILE A CA     1 
ATOM   1276 C  C      . ILE A 1 168 ? 13.751 12.537  27.150 1.00 10.29  ? 205 ILE A C      1 
ATOM   1277 O  O      . ILE A 1 168 ? 12.833 12.527  27.976 1.00 9.34   ? 205 ILE A O      1 
ATOM   1278 C  CB     . ILE A 1 168 ? 12.522 12.754  24.920 1.00 9.27   ? 205 ILE A CB     1 
ATOM   1279 C  CG1    . ILE A 1 168 ? 12.215 12.011  23.553 1.00 9.92   ? 205 ILE A CG1    1 
ATOM   1280 C  CG2    . ILE A 1 168 ? 13.051 14.207  24.682 1.00 7.99   ? 205 ILE A CG2    1 
ATOM   1281 C  CD1    . ILE A 1 168 ? 11.067 12.696  22.681 1.00 13.80  ? 205 ILE A CD1    1 
ATOM   1282 N  N      . LEU A 1 169 ? 14.970 13.015  27.430 1.00 7.69   ? 206 LEU A N      1 
ATOM   1283 C  CA     . LEU A 1 169 ? 15.313 13.553  28.764 1.00 7.90   ? 206 LEU A CA     1 
ATOM   1284 C  C      . LEU A 1 169 ? 14.953 14.990  29.012 1.00 13.16  ? 206 LEU A C      1 
ATOM   1285 O  O      . LEU A 1 169 ? 14.849 15.390  30.161 1.00 11.62  ? 206 LEU A O      1 
ATOM   1286 C  CB     . LEU A 1 169 ? 16.821 13.370  29.035 1.00 7.33   ? 206 LEU A CB     1 
ATOM   1287 C  CG     . LEU A 1 169 ? 17.349 11.917  28.953 1.00 9.33   ? 206 LEU A CG     1 
ATOM   1288 C  CD1    . LEU A 1 169 ? 18.875 11.899  28.938 1.00 7.75   ? 206 LEU A CD1    1 
ATOM   1289 C  CD2    . LEU A 1 169 ? 16.785 11.085  30.084 1.00 11.46  ? 206 LEU A CD2    1 
ATOM   1290 N  N      . ASP A 1 170 ? 14.862 15.803  27.948 1.00 10.76  ? 207 ASP A N      1 
ATOM   1291 C  CA     . ASP A 1 170 ? 14.666 17.227  28.104 1.00 9.90   ? 207 ASP A CA     1 
ATOM   1292 C  C      . ASP A 1 170 ? 13.441 17.764  27.355 1.00 13.25  ? 207 ASP A C      1 
ATOM   1293 O  O      . ASP A 1 170 ? 12.773 17.033  26.615 1.00 8.93   ? 207 ASP A O      1 
ATOM   1294 C  CB     . ASP A 1 170 ? 15.949 17.933  27.646 1.00 11.28  ? 207 ASP A CB     1 
ATOM   1295 C  CG     . ASP A 1 170 ? 16.112 17.961  26.137 1.00 15.71  ? 207 ASP A CG     1 
ATOM   1296 O  OD1    . ASP A 1 170 ? 15.753 16.947  25.472 1.00 17.20  ? 207 ASP A OD1    1 
ATOM   1297 O  OD2    . ASP A 1 170 ? 16.469 19.021  25.608 1.00 23.55  ? 207 ASP A OD2    1 
ATOM   1298 N  N      . PHE A 1 171 ? 13.182 19.072  27.539 1.00 11.53  ? 208 PHE A N      1 
ATOM   1299 C  CA     . PHE A 1 171 ? 12.034 19.759  26.967 1.00 11.93  ? 208 PHE A CA     1 
ATOM   1300 C  C      . PHE A 1 171 ? 12.427 20.861  25.988 1.00 16.72  ? 208 PHE A C      1 
ATOM   1301 O  O      . PHE A 1 171 ? 11.556 21.588  25.530 1.00 18.10  ? 208 PHE A O      1 
ATOM   1302 C  CB     . PHE A 1 171 ? 11.113 20.260  28.100 1.00 14.03  ? 208 PHE A CB     1 
ATOM   1303 C  CG     . PHE A 1 171 ? 10.603 19.126  28.963 1.00 15.07  ? 208 PHE A CG     1 
ATOM   1304 C  CD1    . PHE A 1 171 ? 9.443  18.437  28.622 1.00 18.08  ? 208 PHE A CD1    1 
ATOM   1305 C  CD2    . PHE A 1 171 ? 11.303 18.723  30.104 1.00 16.44  ? 208 PHE A CD2    1 
ATOM   1306 C  CE1    . PHE A 1 171 ? 8.986  17.363  29.408 1.00 19.22  ? 208 PHE A CE1    1 
ATOM   1307 C  CE2    . PHE A 1 171 ? 10.862 17.637  30.871 1.00 19.37  ? 208 PHE A CE2    1 
ATOM   1308 C  CZ     . PHE A 1 171 ? 9.701  16.966  30.523 1.00 17.99  ? 208 PHE A CZ     1 
ATOM   1309 N  N      . GLY A 1 172 ? 13.711 20.903  25.610 1.00 13.53  ? 209 GLY A N      1 
ATOM   1310 C  CA     . GLY A 1 172 ? 14.266 21.809  24.611 1.00 15.01  ? 209 GLY A CA     1 
ATOM   1311 C  C      . GLY A 1 172 ? 14.250 23.294  24.916 1.00 23.02  ? 209 GLY A C      1 
ATOM   1312 O  O      . GLY A 1 172 ? 14.438 23.695  26.057 1.00 25.54  ? 209 GLY A O      1 
ATOM   1313 N  N      . LEU A 1 173 ? 14.116 24.114  23.868 1.00 21.13  ? 210 LEU A N      1 
ATOM   1314 C  CA     . LEU A 1 173 ? 14.081 25.579  23.953 1.00 28.55  ? 210 LEU A CA     1 
ATOM   1315 C  C      . LEU A 1 173 ? 12.636 25.982  24.114 1.00 27.82  ? 210 LEU A C      1 
ATOM   1316 O  O      . LEU A 1 173 ? 12.326 26.742  25.011 1.00 36.62  ? 210 LEU A O      1 
ATOM   1317 C  CB     . LEU A 1 173 ? 14.647 26.232  22.667 1.00 28.81  ? 210 LEU A CB     1 
ATOM   1318 C  CG     . LEU A 1 173 ? 15.812 25.526  21.939 1.00 32.02  ? 210 LEU A CG     1 
ATOM   1319 C  CD1    . LEU A 1 173 ? 15.996 26.081  20.528 1.00 31.57  ? 210 LEU A CD1    1 
ATOM   1320 C  CD2    . LEU A 1 173 ? 17.106 25.635  22.725 1.00 34.76  ? 210 LEU A CD2    1 
ATOM   1321 N  N      . SER A 1 180 ? 21.070 33.829  27.578 1.00 65.52  ? 217 SER A N      1 
ATOM   1322 C  CA     . SER A 1 180 ? 21.545 32.973  26.488 1.00 64.22  ? 217 SER A CA     1 
ATOM   1323 C  C      . SER A 1 180 ? 23.081 32.840  26.451 1.00 66.33  ? 217 SER A C      1 
ATOM   1324 O  O      . SER A 1 180 ? 23.612 32.080  25.628 1.00 65.72  ? 217 SER A O      1 
ATOM   1325 C  CB     . SER A 1 180 ? 21.007 33.463  25.146 1.00 68.98  ? 217 SER A CB     1 
ATOM   1326 O  OG     . SER A 1 180 ? 21.338 34.824  24.920 1.00 81.18  ? 217 SER A OG     1 
ATOM   1327 N  N      . PHE A 1 181 ? 23.785 33.567  27.352 1.00 60.87  ? 218 PHE A N      1 
ATOM   1328 C  CA     . PHE A 1 181 ? 25.244 33.546  27.477 1.00 59.64  ? 218 PHE A CA     1 
ATOM   1329 C  C      . PHE A 1 181 ? 25.714 32.631  28.615 1.00 62.29  ? 218 PHE A C      1 
ATOM   1330 O  O      . PHE A 1 181 ? 25.213 32.716  29.740 1.00 60.84  ? 218 PHE A O      1 
ATOM   1331 C  CB     . PHE A 1 181 ? 25.819 34.974  27.641 1.00 62.28  ? 218 PHE A CB     1 
ATOM   1332 C  CG     . PHE A 1 181 ? 27.274 35.045  28.055 1.00 63.18  ? 218 PHE A CG     1 
ATOM   1333 C  CD1    . PHE A 1 181 ? 28.287 34.712  27.163 1.00 65.28  ? 218 PHE A CD1    1 
ATOM   1334 C  CD2    . PHE A 1 181 ? 27.630 35.450  29.335 1.00 65.09  ? 218 PHE A CD2    1 
ATOM   1335 C  CE1    . PHE A 1 181 ? 29.629 34.768  27.550 1.00 67.11  ? 218 PHE A CE1    1 
ATOM   1336 C  CE2    . PHE A 1 181 ? 28.973 35.515  29.720 1.00 68.55  ? 218 PHE A CE2    1 
ATOM   1337 C  CZ     . PHE A 1 181 ? 29.964 35.179  28.823 1.00 67.00  ? 218 PHE A CZ     1 
ATOM   1338 N  N      . MET A 1 182 ? 26.714 31.793  28.315 1.00 59.05  ? 219 MET A N      1 
ATOM   1339 C  CA     . MET A 1 182 ? 27.322 30.868  29.268 1.00 58.33  ? 219 MET A CA     1 
ATOM   1340 C  C      . MET A 1 182 ? 28.835 31.108  29.338 1.00 63.03  ? 219 MET A C      1 
ATOM   1341 O  O      . MET A 1 182 ? 29.498 31.166  28.295 1.00 63.33  ? 219 MET A O      1 
ATOM   1342 C  CB     . MET A 1 182 ? 27.010 29.410  28.885 1.00 58.68  ? 219 MET A CB     1 
ATOM   1343 N  N      . MET A 1 183 ? 29.366 31.264  30.570 1.00 58.98  ? 220 MET A N      1 
ATOM   1344 C  CA     . MET A 1 183 ? 30.788 31.488  30.842 1.00 77.04  ? 220 MET A CA     1 
ATOM   1345 C  C      . MET A 1 183 ? 31.569 30.172  30.787 1.00 120.51 ? 220 MET A C      1 
ATOM   1346 O  O      . MET A 1 183 ? 32.787 30.159  30.971 1.00 89.95  ? 220 MET A O      1 
ATOM   1347 C  CB     . MET A 1 183 ? 30.973 32.168  32.210 1.00 80.13  ? 220 MET A CB     1 
ATOM   1348 C  CG     . MET A 1 183 ? 31.119 33.667  32.129 1.00 85.36  ? 220 MET A CG     1 
ATOM   1349 S  SD     . MET A 1 183 ? 32.757 34.163  31.559 1.00 91.79  ? 220 MET A SD     1 
ATOM   1350 C  CE     . MET A 1 183 ? 32.700 35.884  31.911 1.00 90.72  ? 220 MET A CE     1 
ATOM   1351 N  N      . VAL A 1 188 ? 27.496 24.241  22.517 1.00 37.03  ? 225 VAL A N      1 
ATOM   1352 C  CA     . VAL A 1 188 ? 26.204 23.573  22.386 1.00 35.29  ? 225 VAL A CA     1 
ATOM   1353 C  C      . VAL A 1 188 ? 25.999 22.977  20.993 1.00 35.42  ? 225 VAL A C      1 
ATOM   1354 O  O      . VAL A 1 188 ? 26.364 23.592  19.997 1.00 36.24  ? 225 VAL A O      1 
ATOM   1355 C  CB     . VAL A 1 188 ? 25.014 24.469  22.811 1.00 39.31  ? 225 VAL A CB     1 
ATOM   1356 N  N      . THR A 1 189 ? 25.390 21.790  20.943 1.00 28.22  ? 226 THR A N      1 
ATOM   1357 C  CA     . THR A 1 189 ? 25.097 20.997  19.740 1.00 26.22  ? 226 THR A CA     1 
ATOM   1358 C  C      . THR A 1 189 ? 23.932 21.581  18.924 1.00 26.96  ? 226 THR A C      1 
ATOM   1359 O  O      . THR A 1 189 ? 22.785 21.553  19.371 1.00 26.62  ? 226 THR A O      1 
ATOM   1360 C  CB     . THR A 1 189 ? 24.856 19.534  20.161 1.00 25.94  ? 226 THR A CB     1 
ATOM   1361 O  OG1    . THR A 1 189 ? 25.980 19.109  20.925 1.00 23.18  ? 226 THR A OG1    1 
ATOM   1362 C  CG2    . THR A 1 189 ? 24.628 18.590  18.976 1.00 22.41  ? 226 THR A CG2    1 
ATOM   1363 N  N      . ARG A 1 190 ? 24.226 22.038  17.708 1.00 21.94  ? 227 ARG A N      1 
ATOM   1364 C  CA     . ARG A 1 190 ? 23.243 22.626  16.791 1.00 21.50  ? 227 ARG A CA     1 
ATOM   1365 C  C      . ARG A 1 190 ? 22.901 21.734  15.581 1.00 23.92  ? 227 ARG A C      1 
ATOM   1366 O  O      . ARG A 1 190 ? 21.964 22.048  14.835 1.00 23.54  ? 227 ARG A O      1 
ATOM   1367 C  CB     . ARG A 1 190 ? 23.760 23.991  16.297 1.00 23.48  ? 227 ARG A CB     1 
ATOM   1368 C  CG     . ARG A 1 190 ? 23.718 25.077  17.352 1.00 36.18  ? 227 ARG A CG     1 
ATOM   1369 C  CD     . ARG A 1 190 ? 24.272 26.374  16.797 1.00 51.64  ? 227 ARG A CD     1 
ATOM   1370 N  NE     . ARG A 1 190 ? 24.566 27.332  17.862 1.00 67.26  ? 227 ARG A NE     1 
ATOM   1371 C  CZ     . ARG A 1 190 ? 25.739 27.431  18.480 1.00 80.11  ? 227 ARG A CZ     1 
ATOM   1372 N  NH1    . ARG A 1 190 ? 26.748 26.635  18.140 1.00 62.25  ? 227 ARG A NH1    1 
ATOM   1373 N  NH2    . ARG A 1 190 ? 25.913 28.329  19.440 1.00 68.25  ? 227 ARG A NH2    1 
ATOM   1374 N  N      . TYR A 1 191 ? 23.650 20.631  15.384 1.00 20.37  ? 228 TYR A N      1 
ATOM   1375 C  CA     . TYR A 1 191 ? 23.500 19.705  14.239 1.00 20.15  ? 228 TYR A CA     1 
ATOM   1376 C  C      . TYR A 1 191 ? 22.058 19.281  13.872 1.00 19.40  ? 228 TYR A C      1 
ATOM   1377 O  O      . TYR A 1 191 ? 21.810 18.997  12.712 1.00 17.18  ? 228 TYR A O      1 
ATOM   1378 C  CB     . TYR A 1 191 ? 24.347 18.424  14.447 1.00 21.15  ? 228 TYR A CB     1 
ATOM   1379 C  CG     . TYR A 1 191 ? 25.744 18.656  14.978 1.00 25.01  ? 228 TYR A CG     1 
ATOM   1380 C  CD1    . TYR A 1 191 ? 26.548 19.674  14.468 1.00 29.68  ? 228 TYR A CD1    1 
ATOM   1381 C  CD2    . TYR A 1 191 ? 26.288 17.823  15.950 1.00 25.29  ? 228 TYR A CD2    1 
ATOM   1382 C  CE1    . TYR A 1 191 ? 27.839 19.887  14.949 1.00 32.38  ? 228 TYR A CE1    1 
ATOM   1383 C  CE2    . TYR A 1 191 ? 27.576 18.029  16.443 1.00 26.98  ? 228 TYR A CE2    1 
ATOM   1384 C  CZ     . TYR A 1 191 ? 28.356 19.052  15.925 1.00 37.83  ? 228 TYR A CZ     1 
ATOM   1385 O  OH     . TYR A 1 191 ? 29.635 19.255  16.384 1.00 42.84  ? 228 TYR A OH     1 
ATOM   1386 N  N      . TYR A 1 192 ? 21.127 19.212  14.867 1.00 13.72  ? 229 TYR A N      1 
ATOM   1387 C  CA     . TYR A 1 192 ? 19.747 18.696  14.712 1.00 10.85  ? 229 TYR A CA     1 
ATOM   1388 C  C      . TYR A 1 192 ? 18.682 19.777  14.595 1.00 15.01  ? 229 TYR A C      1 
ATOM   1389 O  O      . TYR A 1 192 ? 17.522 19.463  14.368 1.00 14.38  ? 229 TYR A O      1 
ATOM   1390 C  CB     . TYR A 1 192 ? 19.432 17.727  15.877 1.00 10.25  ? 229 TYR A CB     1 
ATOM   1391 C  CG     . TYR A 1 192 ? 20.535 16.713  16.040 1.00 9.79   ? 229 TYR A CG     1 
ATOM   1392 C  CD1    . TYR A 1 192 ? 21.635 16.980  16.853 1.00 10.62  ? 229 TYR A CD1    1 
ATOM   1393 C  CD2    . TYR A 1 192 ? 20.565 15.560  15.261 1.00 10.32  ? 229 TYR A CD2    1 
ATOM   1394 C  CE1    . TYR A 1 192 ? 22.721 16.116  16.904 1.00 10.20  ? 229 TYR A CE1    1 
ATOM   1395 C  CE2    . TYR A 1 192 ? 21.651 14.689  15.299 1.00 11.25  ? 229 TYR A CE2    1 
ATOM   1396 C  CZ     . TYR A 1 192 ? 22.729 14.979  16.120 1.00 16.66  ? 229 TYR A CZ     1 
ATOM   1397 O  OH     . TYR A 1 192 ? 23.777 14.113  16.218 1.00 16.05  ? 229 TYR A OH     1 
ATOM   1398 N  N      . ARG A 1 193 ? 19.091 21.040  14.651 1.00 12.73  ? 230 ARG A N      1 
ATOM   1399 C  CA     . ARG A 1 193 ? 18.189 22.189  14.574 1.00 13.91  ? 230 ARG A CA     1 
ATOM   1400 C  C      . ARG A 1 193 ? 17.651 22.431  13.194 1.00 17.63  ? 230 ARG A C      1 
ATOM   1401 O  O      . ARG A 1 193 ? 18.383 22.352  12.205 1.00 16.24  ? 230 ARG A O      1 
ATOM   1402 C  CB     . ARG A 1 193 ? 18.821 23.452  15.168 1.00 12.29  ? 230 ARG A CB     1 
ATOM   1403 C  CG     . ARG A 1 193 ? 18.849 23.335  16.705 1.00 16.67  ? 230 ARG A CG     1 
ATOM   1404 C  CD     . ARG A 1 193 ? 19.519 24.499  17.401 1.00 21.48  ? 230 ARG A CD     1 
ATOM   1405 N  NE     . ARG A 1 193 ? 19.753 24.184  18.813 1.00 21.28  ? 230 ARG A NE     1 
ATOM   1406 C  CZ     . ARG A 1 193 ? 20.247 25.036  19.698 1.00 33.84  ? 230 ARG A CZ     1 
ATOM   1407 N  NH1    . ARG A 1 193 ? 20.538 26.280  19.340 1.00 28.50  ? 230 ARG A NH1    1 
ATOM   1408 N  NH2    . ARG A 1 193 ? 20.441 24.658  20.954 1.00 25.72  ? 230 ARG A NH2    1 
ATOM   1409 N  N      . ALA A 1 194 ? 16.338 22.673  13.142 1.00 14.93  ? 231 ALA A N      1 
ATOM   1410 C  CA     . ALA A 1 194 ? 15.592 22.856  11.910 1.00 16.45  ? 231 ALA A CA     1 
ATOM   1411 C  C      . ALA A 1 194 ? 15.976 24.141  11.168 1.00 22.13  ? 231 ALA A C      1 
ATOM   1412 O  O      . ALA A 1 194 ? 16.317 25.126  11.816 1.00 21.96  ? 231 ALA A O      1 
ATOM   1413 C  CB     . ALA A 1 194 ? 14.107 22.835  12.203 1.00 17.25  ? 231 ALA A CB     1 
ATOM   1414 N  N      . PRO A 1 195 ? 15.906 24.155  9.814  1.00 19.87  ? 232 PRO A N      1 
ATOM   1415 C  CA     . PRO A 1 195 ? 16.205 25.400  9.065  1.00 20.52  ? 232 PRO A CA     1 
ATOM   1416 C  C      . PRO A 1 195 ? 15.432 26.616  9.576  1.00 28.71  ? 232 PRO A C      1 
ATOM   1417 O  O      . PRO A 1 195 ? 16.021 27.696  9.705  1.00 29.79  ? 232 PRO A O      1 
ATOM   1418 C  CB     . PRO A 1 195 ? 15.815 25.051  7.626  1.00 21.76  ? 232 PRO A CB     1 
ATOM   1419 C  CG     . PRO A 1 195 ? 15.960 23.553  7.553  1.00 24.07  ? 232 PRO A CG     1 
ATOM   1420 C  CD     . PRO A 1 195 ? 15.500 23.064  8.893  1.00 18.88  ? 232 PRO A CD     1 
ATOM   1421 N  N      . GLU A 1 196 ? 14.148 26.440  9.936  1.00 25.95  ? 233 GLU A N      1 
ATOM   1422 C  CA     . GLU A 1 196 ? 13.352 27.552  10.475 1.00 27.33  ? 233 GLU A CA     1 
ATOM   1423 C  C      . GLU A 1 196 ? 13.849 28.053  11.876 1.00 30.82  ? 233 GLU A C      1 
ATOM   1424 O  O      . GLU A 1 196 ? 13.574 29.202  12.226 1.00 32.12  ? 233 GLU A O      1 
ATOM   1425 C  CB     . GLU A 1 196 ? 11.838 27.264  10.459 1.00 28.72  ? 233 GLU A CB     1 
ATOM   1426 C  CG     . GLU A 1 196 ? 11.378 26.107  11.312 1.00 33.02  ? 233 GLU A CG     1 
ATOM   1427 C  CD     . GLU A 1 196 ? 11.318 24.766  10.606 1.00 36.46  ? 233 GLU A CD     1 
ATOM   1428 O  OE1    . GLU A 1 196 ? 12.205 24.476  9.773  1.00 18.82  ? 233 GLU A OE1    1 
ATOM   1429 O  OE2    . GLU A 1 196 ? 10.392 23.988  10.916 1.00 26.16  ? 233 GLU A OE2    1 
ATOM   1430 N  N      . VAL A 1 197 ? 14.641 27.245  12.606 1.00 25.41  ? 234 VAL A N      1 
ATOM   1431 C  CA     . VAL A 1 197 ? 15.260 27.629  13.890 1.00 25.13  ? 234 VAL A CA     1 
ATOM   1432 C  C      . VAL A 1 197 ? 16.593 28.357  13.581 1.00 33.12  ? 234 VAL A C      1 
ATOM   1433 O  O      . VAL A 1 197 ? 16.856 29.417  14.150 1.00 35.49  ? 234 VAL A O      1 
ATOM   1434 C  CB     . VAL A 1 197 ? 15.444 26.423  14.871 1.00 26.55  ? 234 VAL A CB     1 
ATOM   1435 C  CG1    . VAL A 1 197 ? 16.196 26.820  16.145 1.00 25.78  ? 234 VAL A CG1    1 
ATOM   1436 C  CG2    . VAL A 1 197 ? 14.110 25.784  15.233 1.00 25.36  ? 234 VAL A CG2    1 
ATOM   1437 N  N      . ILE A 1 198 ? 17.412 27.790  12.666 1.00 29.98  ? 235 ILE A N      1 
ATOM   1438 C  CA     . ILE A 1 198 ? 18.708 28.323  12.196 1.00 30.87  ? 235 ILE A CA     1 
ATOM   1439 C  C      . ILE A 1 198 ? 18.563 29.740  11.618 1.00 34.49  ? 235 ILE A C      1 
ATOM   1440 O  O      . ILE A 1 198 ? 19.433 30.592  11.821 1.00 35.66  ? 235 ILE A O      1 
ATOM   1441 C  CB     . ILE A 1 198 ? 19.307 27.365  11.097 1.00 34.45  ? 235 ILE A CB     1 
ATOM   1442 C  CG1    . ILE A 1 198 ? 19.679 25.989  11.676 1.00 34.15  ? 235 ILE A CG1    1 
ATOM   1443 C  CG2    . ILE A 1 198 ? 20.510 27.993  10.364 1.00 36.49  ? 235 ILE A CG2    1 
ATOM   1444 C  CD1    . ILE A 1 198 ? 19.776 24.859  10.606 1.00 43.32  ? 235 ILE A CD1    1 
ATOM   1445 N  N      . LEU A 1 199 ? 17.475 29.972  10.878 1.00 29.90  ? 236 LEU A N      1 
ATOM   1446 C  CA     . LEU A 1 199 ? 17.255 31.215  10.151 1.00 30.71  ? 236 LEU A CA     1 
ATOM   1447 C  C      . LEU A 1 199 ? 16.305 32.233  10.832 1.00 35.60  ? 236 LEU A C      1 
ATOM   1448 O  O      . LEU A 1 199 ? 16.000 33.262  10.222 1.00 39.14  ? 236 LEU A O      1 
ATOM   1449 C  CB     . LEU A 1 199 ? 16.787 30.879  8.717  1.00 30.42  ? 236 LEU A CB     1 
ATOM   1450 C  CG     . LEU A 1 199 ? 17.659 29.887  7.885  1.00 33.36  ? 236 LEU A CG     1 
ATOM   1451 C  CD1    . LEU A 1 199 ? 16.973 29.506  6.583  1.00 32.83  ? 236 LEU A CD1    1 
ATOM   1452 C  CD2    . LEU A 1 199 ? 19.049 30.447  7.591  1.00 37.09  ? 236 LEU A CD2    1 
ATOM   1453 N  N      . GLY A 1 200 ? 15.909 31.973  12.080 1.00 29.61  ? 237 GLY A N      1 
ATOM   1454 C  CA     . GLY A 1 200 ? 15.034 32.840  12.873 1.00 30.42  ? 237 GLY A CA     1 
ATOM   1455 C  C      . GLY A 1 200 ? 13.700 33.124  12.215 1.00 38.62  ? 237 GLY A C      1 
ATOM   1456 O  O      . GLY A 1 200 ? 13.273 34.276  12.103 1.00 40.10  ? 237 GLY A O      1 
ATOM   1457 N  N      . MET A 1 201 ? 13.090 32.072  11.681 1.00 36.31  ? 238 MET A N      1 
ATOM   1458 C  CA     . MET A 1 201 ? 11.809 32.087  10.973 1.00 37.43  ? 238 MET A CA     1 
ATOM   1459 C  C      . MET A 1 201 ? 10.764 31.692  12.014 1.00 39.54  ? 238 MET A C      1 
ATOM   1460 O  O      . MET A 1 201 ? 11.119 31.280  13.126 1.00 38.81  ? 238 MET A O      1 
ATOM   1461 C  CB     . MET A 1 201 ? 11.891 30.960  9.932  1.00 39.45  ? 238 MET A CB     1 
ATOM   1462 C  CG     . MET A 1 201 ? 11.199 31.190  8.638  1.00 45.33  ? 238 MET A CG     1 
ATOM   1463 S  SD     . MET A 1 201 ? 11.569 29.818  7.479  1.00 49.63  ? 238 MET A SD     1 
ATOM   1464 C  CE     . MET A 1 201 ? 13.319 29.720  7.650  1.00 44.91  ? 238 MET A CE     1 
ATOM   1465 N  N      . GLY A 1 202 ? 9.494  31.735  11.641 1.00 35.01  ? 239 GLY A N      1 
ATOM   1466 C  CA     . GLY A 1 202 ? 8.463  31.212  12.525 1.00 33.98  ? 239 GLY A CA     1 
ATOM   1467 C  C      . GLY A 1 202 ? 8.535  29.688  12.460 1.00 34.04  ? 239 GLY A C      1 
ATOM   1468 O  O      . GLY A 1 202 ? 9.199  29.143  11.572 1.00 30.71  ? 239 GLY A O      1 
ATOM   1469 N  N      . TYR A 1 203 ? 7.895  28.983  13.400 1.00 30.25  ? 240 TYR A N      1 
ATOM   1470 C  CA     . TYR A 1 203 ? 7.913  27.515  13.380 1.00 28.45  ? 240 TYR A CA     1 
ATOM   1471 C  C      . TYR A 1 203 ? 6.578  26.974  13.831 1.00 34.23  ? 240 TYR A C      1 
ATOM   1472 O  O      . TYR A 1 203 ? 5.864  27.639  14.586 1.00 35.76  ? 240 TYR A O      1 
ATOM   1473 C  CB     . TYR A 1 203 ? 9.045  26.958  14.280 1.00 26.59  ? 240 TYR A CB     1 
ATOM   1474 C  CG     . TYR A 1 203 ? 8.906  27.311  15.754 1.00 26.37  ? 240 TYR A CG     1 
ATOM   1475 C  CD1    . TYR A 1 203 ? 8.174  26.503  16.619 1.00 27.33  ? 240 TYR A CD1    1 
ATOM   1476 C  CD2    . TYR A 1 203 ? 9.551  28.420  16.289 1.00 27.30  ? 240 TYR A CD2    1 
ATOM   1477 C  CE1    . TYR A 1 203 ? 7.983  26.855  17.952 1.00 26.11  ? 240 TYR A CE1    1 
ATOM   1478 C  CE2    . TYR A 1 203 ? 9.406  28.760  17.636 1.00 28.06  ? 240 TYR A CE2    1 
ATOM   1479 C  CZ     . TYR A 1 203 ? 8.622  27.969  18.464 1.00 32.52  ? 240 TYR A CZ     1 
ATOM   1480 O  OH     . TYR A 1 203 ? 8.472  28.269  19.792 1.00 31.22  ? 240 TYR A OH     1 
ATOM   1481 N  N      . LYS A 1 204 ? 6.257  25.760  13.395 1.00 29.42  ? 241 LYS A N      1 
ATOM   1482 C  CA     . LYS A 1 204 ? 5.080  25.022  13.850 1.00 29.11  ? 241 LYS A CA     1 
ATOM   1483 C  C      . LYS A 1 204 ? 5.568  23.665  14.455 1.00 28.80  ? 241 LYS A C      1 
ATOM   1484 O  O      . LYS A 1 204 ? 6.779  23.478  14.641 1.00 25.61  ? 241 LYS A O      1 
ATOM   1485 C  CB     . LYS A 1 204 ? 4.010  24.890  12.745 1.00 32.12  ? 241 LYS A CB     1 
ATOM   1486 C  CG     . LYS A 1 204 ? 4.431  24.070  11.520 1.00 46.01  ? 241 LYS A CG     1 
ATOM   1487 C  CD     . LYS A 1 204 ? 3.351  24.084  10.433 1.00 49.10  ? 241 LYS A CD     1 
ATOM   1488 C  CE     . LYS A 1 204 ? 3.814  23.441  9.157  1.00 54.38  ? 241 LYS A CE     1 
ATOM   1489 N  NZ     . LYS A 1 204 ? 2.681  23.167  8.237  1.00 63.43  ? 241 LYS A NZ     1 
ATOM   1490 N  N      . GLU A 1 205 ? 4.648  22.757  14.790 1.00 24.64  ? 242 GLU A N      1 
ATOM   1491 C  CA     . GLU A 1 205 ? 4.965  21.447  15.392 1.00 23.11  ? 242 GLU A CA     1 
ATOM   1492 C  C      . GLU A 1 205 ? 6.045  20.633  14.641 1.00 22.65  ? 242 GLU A C      1 
ATOM   1493 O  O      . GLU A 1 205 ? 6.962  20.120  15.280 1.00 19.91  ? 242 GLU A O      1 
ATOM   1494 C  CB     . GLU A 1 205 ? 3.684  20.603  15.533 1.00 25.77  ? 242 GLU A CB     1 
ATOM   1495 C  CG     . GLU A 1 205 ? 2.781  21.016  16.694 1.00 32.87  ? 242 GLU A CG     1 
ATOM   1496 C  CD     . GLU A 1 205 ? 1.994  22.302  16.550 1.00 45.15  ? 242 GLU A CD     1 
ATOM   1497 O  OE1    . GLU A 1 205 ? 1.867  22.821  15.416 1.00 54.66  ? 242 GLU A OE1    1 
ATOM   1498 O  OE2    . GLU A 1 205 ? 1.498  22.795  17.585 1.00 46.69  ? 242 GLU A OE2    1 
ATOM   1499 N  N      . ASN A 1 206 ? 5.979  20.580  13.295 1.00 19.46  ? 243 ASN A N      1 
ATOM   1500 C  CA     . ASN A 1 206 ? 6.909  19.775  12.475 1.00 18.71  ? 243 ASN A CA     1 
ATOM   1501 C  C      . ASN A 1 206 ? 8.365  20.300  12.462 1.00 20.01  ? 243 ASN A C      1 
ATOM   1502 O  O      . ASN A 1 206 ? 9.230  19.704  11.807 1.00 18.61  ? 243 ASN A O      1 
ATOM   1503 C  CB     . ASN A 1 206 ? 6.375  19.541  11.055 1.00 19.76  ? 243 ASN A CB     1 
ATOM   1504 C  CG     . ASN A 1 206 ? 6.392  20.733  10.135 1.00 25.64  ? 243 ASN A CG     1 
ATOM   1505 O  OD1    . ASN A 1 206 ? 6.784  21.849  10.503 1.00 16.59  ? 243 ASN A OD1    1 
ATOM   1506 N  ND2    . ASN A 1 206 ? 6.001  20.488  8.894  1.00 18.45  ? 243 ASN A ND2    1 
ATOM   1507 N  N      . VAL A 1 207 ? 8.660  21.348  13.245 1.00 15.86  ? 244 VAL A N      1 
ATOM   1508 C  CA     . VAL A 1 207 ? 10.047 21.770  13.446 1.00 15.15  ? 244 VAL A CA     1 
ATOM   1509 C  C      . VAL A 1 207 ? 10.829 20.545  14.063 1.00 17.18  ? 244 VAL A C      1 
ATOM   1510 O  O      . VAL A 1 207 ? 11.983 20.304  13.712 1.00 16.41  ? 244 VAL A O      1 
ATOM   1511 C  CB     . VAL A 1 207 ? 10.136 23.047  14.315 1.00 20.54  ? 244 VAL A CB     1 
ATOM   1512 C  CG1    . VAL A 1 207 ? 9.820  22.773  15.787 1.00 20.04  ? 244 VAL A CG1    1 
ATOM   1513 C  CG2    . VAL A 1 207 ? 11.488 23.705  14.181 1.00 20.23  ? 244 VAL A CG2    1 
ATOM   1514 N  N      . ASP A 1 208 ? 10.149 19.754  14.923 1.00 12.38  ? 245 ASP A N      1 
ATOM   1515 C  CA     . ASP A 1 208 ? 10.706 18.571  15.580 1.00 11.49  ? 245 ASP A CA     1 
ATOM   1516 C  C      . ASP A 1 208 ? 10.900 17.397  14.633 1.00 11.67  ? 245 ASP A C      1 
ATOM   1517 O  O      . ASP A 1 208 ? 11.732 16.528  14.899 1.00 9.17   ? 245 ASP A O      1 
ATOM   1518 C  CB     . ASP A 1 208 ? 9.874  18.180  16.815 1.00 13.30  ? 245 ASP A CB     1 
ATOM   1519 C  CG     . ASP A 1 208 ? 9.995  19.218  17.923 1.00 20.77  ? 245 ASP A CG     1 
ATOM   1520 O  OD1    . ASP A 1 208 ? 11.092 19.778  18.086 1.00 20.90  ? 245 ASP A OD1    1 
ATOM   1521 O  OD2    . ASP A 1 208 ? 9.002  19.430  18.654 1.00 18.65  ? 245 ASP A OD2    1 
ATOM   1522 N  N      . ILE A 1 209 ? 10.155 17.383  13.522 1.00 8.85   ? 246 ILE A N      1 
ATOM   1523 C  CA     . ILE A 1 209 ? 10.269 16.335  12.502 1.00 8.30   ? 246 ILE A CA     1 
ATOM   1524 C  C      . ILE A 1 209 ? 11.637 16.422  11.805 1.00 12.80  ? 246 ILE A C      1 
ATOM   1525 O  O      . ILE A 1 209 ? 12.194 15.394  11.449 1.00 13.58  ? 246 ILE A O      1 
ATOM   1526 C  CB     . ILE A 1 209 ? 9.055  16.389  11.500 1.00 11.81  ? 246 ILE A CB     1 
ATOM   1527 C  CG1    . ILE A 1 209 ? 7.777  15.777  12.131 1.00 12.47  ? 246 ILE A CG1    1 
ATOM   1528 C  CG2    . ILE A 1 209 ? 9.386  15.705  10.171 1.00 11.60  ? 246 ILE A CG2    1 
ATOM   1529 C  CD1    . ILE A 1 209 ? 7.795  14.167  12.377 1.00 11.47  ? 246 ILE A CD1    1 
ATOM   1530 N  N      . TRP A 1 210 ? 12.191 17.640  11.631 1.00 11.66  ? 247 TRP A N      1 
ATOM   1531 C  CA     . TRP A 1 210 ? 13.500 17.795  11.014 1.00 11.22  ? 247 TRP A CA     1 
ATOM   1532 C  C      . TRP A 1 210 ? 14.572 17.123  11.873 1.00 14.84  ? 247 TRP A C      1 
ATOM   1533 O  O      . TRP A 1 210 ? 15.434 16.415  11.338 1.00 15.96  ? 247 TRP A O      1 
ATOM   1534 C  CB     . TRP A 1 210 ? 13.834 19.263  10.764 1.00 10.17  ? 247 TRP A CB     1 
ATOM   1535 C  CG     . TRP A 1 210 ? 15.252 19.469  10.305 1.00 10.51  ? 247 TRP A CG     1 
ATOM   1536 C  CD1    . TRP A 1 210 ? 16.362 19.582  11.097 1.00 12.97  ? 247 TRP A CD1    1 
ATOM   1537 C  CD2    . TRP A 1 210 ? 15.706 19.588  8.959  1.00 10.62  ? 247 TRP A CD2    1 
ATOM   1538 N  NE1    . TRP A 1 210 ? 17.478 19.752  10.319 1.00 12.61  ? 247 TRP A NE1    1 
ATOM   1539 C  CE2    . TRP A 1 210 ? 17.108 19.761  9.003  1.00 14.26  ? 247 TRP A CE2    1 
ATOM   1540 C  CE3    . TRP A 1 210 ? 15.069 19.545  7.705  1.00 12.65  ? 247 TRP A CE3    1 
ATOM   1541 C  CZ2    . TRP A 1 210 ? 17.883 19.900  7.847  1.00 14.11  ? 247 TRP A CZ2    1 
ATOM   1542 C  CZ3    . TRP A 1 210 ? 15.846 19.650  6.555  1.00 14.60  ? 247 TRP A CZ3    1 
ATOM   1543 C  CH2    . TRP A 1 210 ? 17.230 19.852  6.634  1.00 14.97  ? 247 TRP A CH2    1 
ATOM   1544 N  N      . SER A 1 211 ? 14.514 17.337  13.190 1.00 9.38   ? 248 SER A N      1 
ATOM   1545 C  CA     . SER A 1 211 ? 15.484 16.761  14.140 1.00 8.73   ? 248 SER A CA     1 
ATOM   1546 C  C      . SER A 1 211 ? 15.393 15.242  14.127 1.00 11.24  ? 248 SER A C      1 
ATOM   1547 O  O      . SER A 1 211 ? 16.427 14.578  14.134 1.00 10.51  ? 248 SER A O      1 
ATOM   1548 C  CB     . SER A 1 211 ? 15.235 17.292  15.545 1.00 10.15  ? 248 SER A CB     1 
ATOM   1549 O  OG     . SER A 1 211 ? 15.213 18.708  15.501 1.00 15.24  ? 248 SER A OG     1 
ATOM   1550 N  N      . VAL A 1 212 ? 14.171 14.695  14.051 1.00 8.73   ? 249 VAL A N      1 
ATOM   1551 C  CA     . VAL A 1 212 ? 13.967 13.234  13.932 1.00 9.04   ? 249 VAL A CA     1 
ATOM   1552 C  C      . VAL A 1 212 ? 14.607 12.735  12.600 1.00 13.56  ? 249 VAL A C      1 
ATOM   1553 O  O      . VAL A 1 212 ? 15.216 11.670  12.580 1.00 13.64  ? 249 VAL A O      1 
ATOM   1554 C  CB     . VAL A 1 212 ? 12.465 12.829  14.037 1.00 12.33  ? 249 VAL A CB     1 
ATOM   1555 C  CG1    . VAL A 1 212 ? 12.270 11.319  13.801 1.00 12.09  ? 249 VAL A CG1    1 
ATOM   1556 C  CG2    . VAL A 1 212 ? 11.875 13.239  15.377 1.00 10.63  ? 249 VAL A CG2    1 
ATOM   1557 N  N      . GLY A 1 213 ? 14.447 13.501  11.517 1.00 11.48  ? 250 GLY A N      1 
ATOM   1558 C  CA     . GLY A 1 213 ? 15.045 13.164  10.223 1.00 11.13  ? 250 GLY A CA     1 
ATOM   1559 C  C      . GLY A 1 213 ? 16.561 13.087  10.306 1.00 13.16  ? 250 GLY A C      1 
ATOM   1560 O  O      . GLY A 1 213 ? 17.169 12.163  9.761  1.00 11.31  ? 250 GLY A O      1 
ATOM   1561 N  N      . CYS A 1 214 ? 17.184 14.090  10.981 1.00 8.97   ? 251 CYS A N      1 
ATOM   1562 C  CA     . CYS A 1 214 ? 18.635 14.174  11.219 1.00 8.68   ? 251 CYS A CA     1 
ATOM   1563 C  C      . CYS A 1 214 ? 19.110 12.979  12.001 1.00 11.40  ? 251 CYS A C      1 
ATOM   1564 O  O      . CYS A 1 214 ? 20.147 12.410  11.677 1.00 11.72  ? 251 CYS A O      1 
ATOM   1565 C  CB     . CYS A 1 214 ? 18.988 15.462  11.954 1.00 8.35   ? 251 CYS A CB     1 
ATOM   1566 S  SG     . CYS A 1 214 ? 18.744 16.951  10.979 1.00 12.77  ? 251 CYS A SG     1 
ATOM   1567 N  N      . ILE A 1 215 ? 18.361 12.615  13.043 1.00 8.34   ? 252 ILE A N      1 
ATOM   1568 C  CA     . ILE A 1 215 ? 18.674 11.463  13.900 1.00 9.42   ? 252 ILE A CA     1 
ATOM   1569 C  C      . ILE A 1 215 ? 18.546 10.171  13.089 1.00 13.13  ? 252 ILE A C      1 
ATOM   1570 O  O      . ILE A 1 215 ? 19.471 9.344   13.089 1.00 12.52  ? 252 ILE A O      1 
ATOM   1571 C  CB     . ILE A 1 215 ? 17.806 11.470  15.185 1.00 12.33  ? 252 ILE A CB     1 
ATOM   1572 C  CG1    . ILE A 1 215 ? 18.227 12.654  16.112 1.00 13.46  ? 252 ILE A CG1    1 
ATOM   1573 C  CG2    . ILE A 1 215 ? 17.878 10.094  15.898 1.00 12.25  ? 252 ILE A CG2    1 
ATOM   1574 C  CD1    . ILE A 1 215 ? 17.222 13.026  17.282 1.00 17.85  ? 252 ILE A CD1    1 
ATOM   1575 N  N      . MET A 1 216 ? 17.438 10.027  12.348 1.00 10.05  ? 253 MET A N      1 
ATOM   1576 C  CA     . MET A 1 216 ? 17.211 8.828   11.524 1.00 9.81   ? 253 MET A CA     1 
ATOM   1577 C  C      . MET A 1 216 ? 18.301 8.675   10.475 1.00 17.69  ? 253 MET A C      1 
ATOM   1578 O  O      . MET A 1 216 ? 18.830 7.574   10.313 1.00 18.92  ? 253 MET A O      1 
ATOM   1579 C  CB     . MET A 1 216 ? 15.841 8.851   10.863 1.00 11.25  ? 253 MET A CB     1 
ATOM   1580 C  CG     . MET A 1 216 ? 15.598 7.637   9.993  1.00 14.01  ? 253 MET A CG     1 
ATOM   1581 S  SD     . MET A 1 216 ? 13.967 7.696   9.280  1.00 16.86  ? 253 MET A SD     1 
ATOM   1582 C  CE     . MET A 1 216 ? 13.930 6.114   8.471  1.00 14.45  ? 253 MET A CE     1 
ATOM   1583 N  N      . GLY A 1 217 ? 18.619 9.774   9.785  1.00 14.16  ? 254 GLY A N      1 
ATOM   1584 C  CA     . GLY A 1 217 ? 19.671 9.827   8.777  1.00 14.75  ? 254 GLY A CA     1 
ATOM   1585 C  C      . GLY A 1 217 ? 21.001 9.405   9.365  1.00 19.27  ? 254 GLY A C      1 
ATOM   1586 O  O      . GLY A 1 217 ? 21.744 8.629   8.751  1.00 20.92  ? 254 GLY A O      1 
ATOM   1587 N  N      . GLU A 1 218 ? 21.276 9.878   10.590 1.00 13.96  ? 255 GLU A N      1 
ATOM   1588 C  CA     . GLU A 1 218 ? 22.492 9.532   11.316 1.00 13.79  ? 255 GLU A CA     1 
ATOM   1589 C  C      . GLU A 1 218 ? 22.492 8.063   11.761 1.00 20.18  ? 255 GLU A C      1 
ATOM   1590 O  O      . GLU A 1 218 ? 23.559 7.462   11.818 1.00 20.38  ? 255 GLU A O      1 
ATOM   1591 C  CB     . GLU A 1 218 ? 22.674 10.453  12.515 1.00 13.47  ? 255 GLU A CB     1 
ATOM   1592 C  CG     . GLU A 1 218 ? 24.027 10.322  13.178 1.00 18.32  ? 255 GLU A CG     1 
ATOM   1593 C  CD     . GLU A 1 218 ? 24.313 11.390  14.207 1.00 28.87  ? 255 GLU A CD     1 
ATOM   1594 O  OE1    . GLU A 1 218 ? 23.658 12.455  14.154 1.00 19.34  ? 255 GLU A OE1    1 
ATOM   1595 O  OE2    . GLU A 1 218 ? 25.232 11.185  15.030 1.00 24.25  ? 255 GLU A OE2    1 
ATOM   1596 N  N      . MET A 1 219 ? 21.312 7.486   12.061 1.00 20.25  ? 256 MET A N      1 
ATOM   1597 C  CA     . MET A 1 219 ? 21.200 6.066   12.465 1.00 22.76  ? 256 MET A CA     1 
ATOM   1598 C  C      . MET A 1 219 ? 21.643 5.155   11.326 1.00 27.72  ? 256 MET A C      1 
ATOM   1599 O  O      . MET A 1 219 ? 22.334 4.174   11.561 1.00 29.09  ? 256 MET A O      1 
ATOM   1600 C  CB     . MET A 1 219 ? 19.777 5.720   12.941 1.00 25.56  ? 256 MET A CB     1 
ATOM   1601 C  CG     . MET A 1 219 ? 19.607 5.940   14.415 1.00 30.56  ? 256 MET A CG     1 
ATOM   1602 S  SD     . MET A 1 219 ? 17.913 6.205   14.970 1.00 36.94  ? 256 MET A SD     1 
ATOM   1603 C  CE     . MET A 1 219 ? 17.431 4.587   15.374 1.00 34.83  ? 256 MET A CE     1 
ATOM   1604 N  N      . VAL A 1 220 ? 21.310 5.551   10.093 1.00 23.97  ? 257 VAL A N      1 
ATOM   1605 C  CA     . VAL A 1 220 ? 21.612 4.867   8.851  1.00 25.75  ? 257 VAL A CA     1 
ATOM   1606 C  C      . VAL A 1 220 ? 23.083 5.102   8.411  1.00 28.94  ? 257 VAL A C      1 
ATOM   1607 O  O      . VAL A 1 220 ? 23.787 4.138   8.122  1.00 27.46  ? 257 VAL A O      1 
ATOM   1608 C  CB     . VAL A 1 220 ? 20.571 5.318   7.782  1.00 30.14  ? 257 VAL A CB     1 
ATOM   1609 C  CG1    . VAL A 1 220 ? 20.888 4.743   6.413  1.00 31.45  ? 257 VAL A CG1    1 
ATOM   1610 C  CG2    . VAL A 1 220 ? 19.156 4.932   8.211  1.00 29.66  ? 257 VAL A CG2    1 
ATOM   1611 N  N      . ARG A 1 221 ? 23.536 6.378   8.351  1.00 25.44  ? 258 ARG A N      1 
ATOM   1612 C  CA     . ARG A 1 221 ? 24.901 6.720   7.906  1.00 25.63  ? 258 ARG A CA     1 
ATOM   1613 C  C      . ARG A 1 221 ? 25.988 6.413   8.945  1.00 29.35  ? 258 ARG A C      1 
ATOM   1614 O  O      . ARG A 1 221 ? 27.149 6.271   8.572  1.00 31.36  ? 258 ARG A O      1 
ATOM   1615 C  CB     . ARG A 1 221 ? 25.002 8.215   7.566  1.00 22.96  ? 258 ARG A CB     1 
ATOM   1616 C  CG     . ARG A 1 221 ? 24.373 8.633   6.274  1.00 26.67  ? 258 ARG A CG     1 
ATOM   1617 C  CD     . ARG A 1 221 ? 25.015 9.930   5.825  1.00 27.13  ? 258 ARG A CD     1 
ATOM   1618 N  NE     . ARG A 1 221 ? 24.300 10.493  4.684  1.00 33.56  ? 258 ARG A NE     1 
ATOM   1619 C  CZ     . ARG A 1 221 ? 24.325 11.773  4.336  1.00 44.30  ? 258 ARG A CZ     1 
ATOM   1620 N  NH1    . ARG A 1 221 ? 25.047 12.647  5.035  1.00 26.26  ? 258 ARG A NH1    1 
ATOM   1621 N  NH2    . ARG A 1 221 ? 23.625 12.195  3.290  1.00 27.44  ? 258 ARG A NH2    1 
ATOM   1622 N  N      . HIS A 1 222 ? 25.630 6.403   10.237 1.00 23.69  ? 259 HIS A N      1 
ATOM   1623 C  CA     . HIS A 1 222 ? 26.542 6.251   11.389 1.00 24.06  ? 259 HIS A CA     1 
ATOM   1624 C  C      . HIS A 1 222 ? 27.465 7.488   11.501 1.00 31.58  ? 259 HIS A C      1 
ATOM   1625 O  O      . HIS A 1 222 ? 28.528 7.429   12.117 1.00 33.01  ? 259 HIS A O      1 
ATOM   1626 C  CB     . HIS A 1 222 ? 27.304 4.895   11.407 1.00 24.74  ? 259 HIS A CB     1 
ATOM   1627 C  CG     . HIS A 1 222 ? 26.402 3.714   11.249 1.00 26.65  ? 259 HIS A CG     1 
ATOM   1628 N  ND1    . HIS A 1 222 ? 25.622 3.265   12.286 1.00 26.40  ? 259 HIS A ND1    1 
ATOM   1629 C  CD2    . HIS A 1 222 ? 26.155 2.956   10.155 1.00 28.26  ? 259 HIS A CD2    1 
ATOM   1630 C  CE1    . HIS A 1 222 ? 24.924 2.258   11.800 1.00 26.38  ? 259 HIS A CE1    1 
ATOM   1631 N  NE2    . HIS A 1 222 ? 25.214 2.032   10.523 1.00 27.63  ? 259 HIS A NE2    1 
ATOM   1632 N  N      . LYS A 1 223 ? 27.002 8.627   10.932 1.00 28.97  ? 260 LYS A N      1 
ATOM   1633 C  CA     . LYS A 1 223 ? 27.699 9.915   10.887 1.00 28.25  ? 260 LYS A CA     1 
ATOM   1634 C  C      . LYS A 1 223 ? 26.704 11.046  10.952 1.00 28.60  ? 260 LYS A C      1 
ATOM   1635 O  O      . LYS A 1 223 ? 25.641 10.962  10.315 1.00 27.88  ? 260 LYS A O      1 
ATOM   1636 C  CB     . LYS A 1 223 ? 28.494 10.049  9.578  1.00 31.42  ? 260 LYS A CB     1 
ATOM   1637 C  CG     . LYS A 1 223 ? 29.897 9.474   9.645  1.00 54.37  ? 260 LYS A CG     1 
ATOM   1638 C  CD     . LYS A 1 223 ? 30.681 9.731   8.346  1.00 67.24  ? 260 LYS A CD     1 
ATOM   1639 C  CE     . LYS A 1 223 ? 30.590 8.585   7.363  1.00 77.77  ? 260 LYS A CE     1 
ATOM   1640 N  NZ     . LYS A 1 223 ? 31.442 8.814   6.170  1.00 89.64  ? 260 LYS A NZ     1 
ATOM   1641 N  N      . ILE A 1 224 ? 27.065 12.131  11.682 1.00 22.77  ? 261 ILE A N      1 
ATOM   1642 C  CA     . ILE A 1 224 ? 26.252 13.350  11.795 1.00 21.04  ? 261 ILE A CA     1 
ATOM   1643 C  C      . ILE A 1 224 ? 25.944 13.814  10.368 1.00 24.58  ? 261 ILE A C      1 
ATOM   1644 O  O      . ILE A 1 224 ? 26.867 13.857  9.541  1.00 26.17  ? 261 ILE A O      1 
ATOM   1645 C  CB     . ILE A 1 224 ? 27.007 14.452  12.599 1.00 24.45  ? 261 ILE A CB     1 
ATOM   1646 C  CG1    . ILE A 1 224 ? 27.309 13.987  14.049 1.00 24.10  ? 261 ILE A CG1    1 
ATOM   1647 C  CG2    . ILE A 1 224 ? 26.228 15.780  12.594 1.00 24.36  ? 261 ILE A CG2    1 
ATOM   1648 C  CD1    . ILE A 1 224 ? 28.440 14.813  14.801 1.00 28.88  ? 261 ILE A CD1    1 
ATOM   1649 N  N      . LEU A 1 225 ? 24.664 14.096  10.051 1.00 19.08  ? 262 LEU A N      1 
ATOM   1650 C  CA     . LEU A 1 225 ? 24.317 14.551  8.685  1.00 18.42  ? 262 LEU A CA     1 
ATOM   1651 C  C      . LEU A 1 225 ? 24.901 15.933  8.360  1.00 24.73  ? 262 LEU A C      1 
ATOM   1652 O  O      . LEU A 1 225 ? 25.488 16.113  7.295  1.00 24.76  ? 262 LEU A O      1 
ATOM   1653 C  CB     . LEU A 1 225 ? 22.797 14.616  8.465  1.00 16.83  ? 262 LEU A CB     1 
ATOM   1654 C  CG     . LEU A 1 225 ? 21.958 13.346  8.461  1.00 19.93  ? 262 LEU A CG     1 
ATOM   1655 C  CD1    . LEU A 1 225 ? 20.602 13.663  7.897  1.00 18.05  ? 262 LEU A CD1    1 
ATOM   1656 C  CD2    . LEU A 1 225 ? 22.599 12.221  7.609  1.00 23.01  ? 262 LEU A CD2    1 
ATOM   1657 N  N      . PHE A 1 226 ? 24.679 16.924  9.252  1.00 22.15  ? 263 PHE A N      1 
ATOM   1658 C  CA     . PHE A 1 226 ? 25.120 18.312  9.027  1.00 23.19  ? 263 PHE A CA     1 
ATOM   1659 C  C      . PHE A 1 226 ? 26.025 18.795  10.183 1.00 30.02  ? 263 PHE A C      1 
ATOM   1660 O  O      . PHE A 1 226 ? 25.538 19.434  11.123 1.00 30.16  ? 263 PHE A O      1 
ATOM   1661 C  CB     . PHE A 1 226 ? 23.885 19.215  8.787  1.00 24.12  ? 263 PHE A CB     1 
ATOM   1662 C  CG     . PHE A 1 226 ? 22.805 18.587  7.910  1.00 23.61  ? 263 PHE A CG     1 
ATOM   1663 C  CD1    . PHE A 1 226 ? 23.035 18.340  6.562  1.00 25.41  ? 263 PHE A CD1    1 
ATOM   1664 C  CD2    . PHE A 1 226 ? 21.568 18.233  8.443  1.00 22.34  ? 263 PHE A CD2    1 
ATOM   1665 C  CE1    . PHE A 1 226 ? 22.037 17.761  5.755  1.00 26.05  ? 263 PHE A CE1    1 
ATOM   1666 C  CE2    . PHE A 1 226 ? 20.570 17.673  7.634  1.00 23.78  ? 263 PHE A CE2    1 
ATOM   1667 C  CZ     . PHE A 1 226 ? 20.808 17.448  6.295  1.00 23.33  ? 263 PHE A CZ     1 
ATOM   1668 N  N      . PRO A 1 227 ? 27.334 18.421  10.171 1.00 29.47  ? 264 PRO A N      1 
ATOM   1669 C  CA     . PRO A 1 227 ? 28.212 18.778  11.296 1.00 30.99  ? 264 PRO A CA     1 
ATOM   1670 C  C      . PRO A 1 227 ? 28.795 20.194  11.223 1.00 40.72  ? 264 PRO A C      1 
ATOM   1671 O  O      . PRO A 1 227 ? 29.976 20.384  10.910 1.00 43.58  ? 264 PRO A O      1 
ATOM   1672 C  CB     . PRO A 1 227 ? 29.277 17.674  11.266 1.00 32.96  ? 264 PRO A CB     1 
ATOM   1673 C  CG     . PRO A 1 227 ? 29.372 17.284  9.832  1.00 37.48  ? 264 PRO A CG     1 
ATOM   1674 C  CD     . PRO A 1 227 ? 28.064 17.622  9.159  1.00 32.25  ? 264 PRO A CD     1 
ATOM   1675 N  N      . GLY A 1 228 ? 27.962 21.176  11.545 1.00 38.34  ? 265 GLY A N      1 
ATOM   1676 C  CA     . GLY A 1 228 ? 28.355 22.582  11.517 1.00 39.97  ? 265 GLY A CA     1 
ATOM   1677 C  C      . GLY A 1 228 ? 28.959 23.106  12.805 1.00 43.39  ? 265 GLY A C      1 
ATOM   1678 O  O      . GLY A 1 228 ? 28.435 22.837  13.888 1.00 40.70  ? 265 GLY A O      1 
ATOM   1679 N  N      . ARG A 1 229 ? 30.046 23.907  12.681 1.00 42.68  ? 266 ARG A N      1 
ATOM   1680 C  CA     . ARG A 1 229 ? 30.748 24.560  13.797 1.00 43.22  ? 266 ARG A CA     1 
ATOM   1681 C  C      . ARG A 1 229 ? 29.951 25.773  14.300 1.00 46.06  ? 266 ARG A C      1 
ATOM   1682 O  O      . ARG A 1 229 ? 30.132 26.207  15.442 1.00 46.17  ? 266 ARG A O      1 
ATOM   1683 C  CB     . ARG A 1 229 ? 32.156 24.990  13.370 1.00 46.50  ? 266 ARG A CB     1 
ATOM   1684 N  N      . ASP A 1 230 ? 29.051 26.295  13.443 1.00 40.71  ? 267 ASP A N      1 
ATOM   1685 C  CA     . ASP A 1 230 ? 28.174 27.440  13.701 1.00 39.82  ? 267 ASP A CA     1 
ATOM   1686 C  C      . ASP A 1 230 ? 26.976 27.366  12.738 1.00 40.66  ? 267 ASP A C      1 
ATOM   1687 O  O      . ASP A 1 230 ? 26.964 26.498  11.860 1.00 37.82  ? 267 ASP A O      1 
ATOM   1688 C  CB     . ASP A 1 230 ? 28.956 28.762  13.504 1.00 44.23  ? 267 ASP A CB     1 
ATOM   1689 C  CG     . ASP A 1 230 ? 29.676 28.846  12.169 1.00 53.25  ? 267 ASP A CG     1 
ATOM   1690 O  OD1    . ASP A 1 230 ? 28.999 29.051  11.145 1.00 52.10  ? 267 ASP A OD1    1 
ATOM   1691 O  OD2    . ASP A 1 230 ? 30.911 28.645  12.146 1.00 61.63  ? 267 ASP A OD2    1 
ATOM   1692 N  N      . TYR A 1 231 ? 25.988 28.288  12.888 1.00 38.09  ? 268 TYR A N      1 
ATOM   1693 C  CA     . TYR A 1 231 ? 24.777 28.344  12.052 1.00 37.69  ? 268 TYR A CA     1 
ATOM   1694 C  C      . TYR A 1 231 ? 25.057 28.552  10.562 1.00 40.09  ? 268 TYR A C      1 
ATOM   1695 O  O      . TYR A 1 231 ? 24.353 27.973  9.736  1.00 40.19  ? 268 TYR A O      1 
ATOM   1696 C  CB     . TYR A 1 231 ? 23.775 29.397  12.566 1.00 40.05  ? 268 TYR A CB     1 
ATOM   1697 C  CG     . TYR A 1 231 ? 22.874 28.940  13.699 1.00 41.71  ? 268 TYR A CG     1 
ATOM   1698 C  CD1    . TYR A 1 231 ? 22.288 27.674  13.687 1.00 42.36  ? 268 TYR A CD1    1 
ATOM   1699 C  CD2    . TYR A 1 231 ? 22.525 29.808  14.731 1.00 43.43  ? 268 TYR A CD2    1 
ATOM   1700 C  CE1    . TYR A 1 231 ? 21.430 27.262  14.709 1.00 42.13  ? 268 TYR A CE1    1 
ATOM   1701 C  CE2    . TYR A 1 231 ? 21.675 29.405  15.763 1.00 43.08  ? 268 TYR A CE2    1 
ATOM   1702 C  CZ     . TYR A 1 231 ? 21.129 28.131  15.747 1.00 46.42  ? 268 TYR A CZ     1 
ATOM   1703 O  OH     . TYR A 1 231 ? 20.276 27.748  16.749 1.00 42.23  ? 268 TYR A OH     1 
ATOM   1704 N  N      . ILE A 1 232 ? 26.076 29.378  10.225 1.00 34.63  ? 269 ILE A N      1 
ATOM   1705 C  CA     . ILE A 1 232 ? 26.508 29.662  8.845  1.00 34.06  ? 269 ILE A CA     1 
ATOM   1706 C  C      . ILE A 1 232 ? 26.968 28.339  8.221  1.00 34.51  ? 269 ILE A C      1 
ATOM   1707 O  O      . ILE A 1 232 ? 26.418 27.923  7.210  1.00 33.00  ? 269 ILE A O      1 
ATOM   1708 C  CB     . ILE A 1 232 ? 27.646 30.747  8.803  1.00 38.41  ? 269 ILE A CB     1 
ATOM   1709 C  CG1    . ILE A 1 232 ? 27.182 32.124  9.391  1.00 39.67  ? 269 ILE A CG1    1 
ATOM   1710 C  CG2    . ILE A 1 232 ? 28.277 30.882  7.398  1.00 37.83  ? 269 ILE A CG2    1 
ATOM   1711 C  CD1    . ILE A 1 232 ? 26.269 33.057  8.497  1.00 50.59  ? 269 ILE A CD1    1 
ATOM   1712 N  N      . ASP A 1 233 ? 27.962 27.681  8.844  1.00 31.41  ? 270 ASP A N      1 
ATOM   1713 C  CA     . ASP A 1 233 ? 28.506 26.386  8.423  1.00 31.62  ? 270 ASP A CA     1 
ATOM   1714 C  C      . ASP A 1 233 ? 27.388 25.313  8.332  1.00 35.40  ? 270 ASP A C      1 
ATOM   1715 O  O      . ASP A 1 233 ? 27.337 24.566  7.349  1.00 35.15  ? 270 ASP A O      1 
ATOM   1716 C  CB     . ASP A 1 233 ? 29.592 25.950  9.423  1.00 34.22  ? 270 ASP A CB     1 
ATOM   1717 C  CG     . ASP A 1 233 ? 30.450 24.794  8.960  1.00 46.83  ? 270 ASP A CG     1 
ATOM   1718 O  OD1    . ASP A 1 233 ? 30.822 24.771  7.767  1.00 51.15  ? 270 ASP A OD1    1 
ATOM   1719 O  OD2    . ASP A 1 233 ? 30.801 23.947  9.803  1.00 50.34  ? 270 ASP A OD2    1 
ATOM   1720 N  N      . GLN A 1 234 ? 26.482 25.270  9.356  1.00 30.54  ? 271 GLN A N      1 
ATOM   1721 C  CA     . GLN A 1 234 ? 25.310 24.380  9.457  1.00 28.06  ? 271 GLN A CA     1 
ATOM   1722 C  C      . GLN A 1 234 ? 24.436 24.540  8.200  1.00 30.68  ? 271 GLN A C      1 
ATOM   1723 O  O      . GLN A 1 234 ? 24.132 23.544  7.541  1.00 29.89  ? 271 GLN A O      1 
ATOM   1724 C  CB     . GLN A 1 234 ? 24.486 24.774  10.703 1.00 28.63  ? 271 GLN A CB     1 
ATOM   1725 C  CG     . GLN A 1 234 ? 23.304 23.880  11.029 1.00 41.18  ? 271 GLN A CG     1 
ATOM   1726 C  CD     . GLN A 1 234 ? 23.730 22.601  11.687 1.00 59.06  ? 271 GLN A CD     1 
ATOM   1727 O  OE1    . GLN A 1 234 ? 23.340 21.511  11.255 1.00 54.71  ? 271 GLN A OE1    1 
ATOM   1728 N  NE2    . GLN A 1 234 ? 24.548 22.708  12.737 1.00 49.54  ? 271 GLN A NE2    1 
ATOM   1729 N  N      . TRP A 1 235 ? 24.064 25.801  7.862  1.00 26.29  ? 272 TRP A N      1 
ATOM   1730 C  CA     . TRP A 1 235 ? 23.260 26.102  6.681  1.00 26.29  ? 272 TRP A CA     1 
ATOM   1731 C  C      . TRP A 1 235 ? 23.930 25.640  5.377  1.00 31.03  ? 272 TRP A C      1 
ATOM   1732 O  O      . TRP A 1 235 ? 23.234 25.082  4.525  1.00 27.48  ? 272 TRP A O      1 
ATOM   1733 C  CB     . TRP A 1 235 ? 22.840 27.582  6.616  1.00 26.04  ? 272 TRP A CB     1 
ATOM   1734 C  CG     . TRP A 1 235 ? 21.932 27.883  5.452  1.00 27.81  ? 272 TRP A CG     1 
ATOM   1735 C  CD1    . TRP A 1 235 ? 22.223 28.653  4.365  1.00 32.48  ? 272 TRP A CD1    1 
ATOM   1736 C  CD2    . TRP A 1 235 ? 20.633 27.313  5.204  1.00 26.45  ? 272 TRP A CD2    1 
ATOM   1737 N  NE1    . TRP A 1 235 ? 21.161 28.662  3.493  1.00 32.21  ? 272 TRP A NE1    1 
ATOM   1738 C  CE2    . TRP A 1 235 ? 20.180 27.827  3.973  1.00 31.25  ? 272 TRP A CE2    1 
ATOM   1739 C  CE3    . TRP A 1 235 ? 19.789 26.451  5.931  1.00 26.07  ? 272 TRP A CE3    1 
ATOM   1740 C  CZ2    . TRP A 1 235 ? 18.917 27.516  3.449  1.00 29.94  ? 272 TRP A CZ2    1 
ATOM   1741 C  CZ3    . TRP A 1 235 ? 18.550 26.123  5.398  1.00 27.22  ? 272 TRP A CZ3    1 
ATOM   1742 C  CH2    . TRP A 1 235 ? 18.124 26.658  4.175  1.00 28.99  ? 272 TRP A CH2    1 
ATOM   1743 N  N      . ASN A 1 236 ? 25.278 25.815  5.250  1.00 30.84  ? 273 ASN A N      1 
ATOM   1744 C  CA     . ASN A 1 236 ? 26.018 25.363  4.054  1.00 32.65  ? 273 ASN A CA     1 
ATOM   1745 C  C      . ASN A 1 236 ? 25.971 23.853  3.861  1.00 34.92  ? 273 ASN A C      1 
ATOM   1746 O  O      . ASN A 1 236 ? 25.706 23.417  2.751  1.00 34.88  ? 273 ASN A O      1 
ATOM   1747 C  CB     . ASN A 1 236 ? 27.473 25.865  4.028  1.00 35.62  ? 273 ASN A CB     1 
ATOM   1748 C  CG     . ASN A 1 236 ? 27.616 27.364  3.961  1.00 42.16  ? 273 ASN A CG     1 
ATOM   1749 O  OD1    . ASN A 1 236 ? 26.881 28.062  3.248  1.00 29.07  ? 273 ASN A OD1    1 
ATOM   1750 N  ND2    . ASN A 1 236 ? 28.551 27.894  4.745  1.00 32.30  ? 273 ASN A ND2    1 
ATOM   1751 N  N      . LYS A 1 237 ? 26.169 23.065  4.943  1.00 31.15  ? 274 LYS A N      1 
ATOM   1752 C  CA     . LYS A 1 237 ? 26.141 21.593  4.931  1.00 29.12  ? 274 LYS A CA     1 
ATOM   1753 C  C      . LYS A 1 237 ? 24.755 21.067  4.533  1.00 28.84  ? 274 LYS A C      1 
ATOM   1754 O  O      . LYS A 1 237 ? 24.669 20.035  3.879  1.00 28.01  ? 274 LYS A O      1 
ATOM   1755 C  CB     . LYS A 1 237 ? 26.535 21.014  6.311  1.00 31.14  ? 274 LYS A CB     1 
ATOM   1756 C  CG     . LYS A 1 237 ? 27.911 21.410  6.834  1.00 39.41  ? 274 LYS A CG     1 
ATOM   1757 C  CD     . LYS A 1 237 ? 29.049 20.581  6.268  1.00 49.02  ? 274 LYS A CD     1 
ATOM   1758 C  CE     . LYS A 1 237 ? 30.250 20.595  7.193  1.00 62.36  ? 274 LYS A CE     1 
ATOM   1759 N  NZ     . LYS A 1 237 ? 30.885 21.936  7.290  1.00 69.24  ? 274 LYS A NZ     1 
ATOM   1760 N  N      . VAL A 1 238 ? 23.673 21.761  4.962  1.00 22.31  ? 275 VAL A N      1 
ATOM   1761 C  CA     . VAL A 1 238 ? 22.286 21.408  4.624  1.00 19.87  ? 275 VAL A CA     1 
ATOM   1762 C  C      . VAL A 1 238 ? 22.079 21.576  3.090  1.00 25.14  ? 275 VAL A C      1 
ATOM   1763 O  O      . VAL A 1 238 ? 21.626 20.635  2.423  1.00 22.70  ? 275 VAL A O      1 
ATOM   1764 C  CB     . VAL A 1 238 ? 21.255 22.263  5.428  1.00 21.60  ? 275 VAL A CB     1 
ATOM   1765 C  CG1    . VAL A 1 238 ? 19.856 22.166  4.817  1.00 21.14  ? 275 VAL A CG1    1 
ATOM   1766 C  CG2    . VAL A 1 238 ? 21.231 21.896  6.916  1.00 19.43  ? 275 VAL A CG2    1 
ATOM   1767 N  N      . ILE A 1 239 ? 22.391 22.785  2.556  1.00 24.41  ? 276 ILE A N      1 
ATOM   1768 C  CA     . ILE A 1 239 ? 22.177 23.113  1.147  1.00 26.36  ? 276 ILE A CA     1 
ATOM   1769 C  C      . ILE A 1 239 ? 23.090 22.308  0.225  1.00 30.01  ? 276 ILE A C      1 
ATOM   1770 O  O      . ILE A 1 239 ? 22.630 21.938  -0.848 1.00 28.07  ? 276 ILE A O      1 
ATOM   1771 C  CB     . ILE A 1 239 ? 22.184 24.627  0.811  1.00 31.82  ? 276 ILE A CB     1 
ATOM   1772 C  CG1    . ILE A 1 239 ? 23.592 25.256  0.888  1.00 34.23  ? 276 ILE A CG1    1 
ATOM   1773 C  CG2    . ILE A 1 239 ? 21.168 25.364  1.694  1.00 32.60  ? 276 ILE A CG2    1 
ATOM   1774 C  CD1    . ILE A 1 239 ? 23.733 26.716  0.222  1.00 40.98  ? 276 ILE A CD1    1 
ATOM   1775 N  N      . GLU A 1 240 ? 24.340 21.994  0.654  1.00 28.09  ? 277 GLU A N      1 
ATOM   1776 C  CA     . GLU A 1 240 ? 25.296 21.168  -0.112 1.00 29.60  ? 277 GLU A CA     1 
ATOM   1777 C  C      . GLU A 1 240 ? 24.714 19.774  -0.392 1.00 32.24  ? 277 GLU A C      1 
ATOM   1778 O  O      . GLU A 1 240 ? 24.976 19.206  -1.444 1.00 31.97  ? 277 GLU A O      1 
ATOM   1779 C  CB     . GLU A 1 240 ? 26.610 20.988  0.672  1.00 31.29  ? 277 GLU A CB     1 
ATOM   1780 C  CG     . GLU A 1 240 ? 27.625 22.088  0.443  1.00 44.65  ? 277 GLU A CG     1 
ATOM   1781 C  CD     . GLU A 1 240 ? 28.684 22.253  1.519  1.00 67.30  ? 277 GLU A CD     1 
ATOM   1782 O  OE1    . GLU A 1 240 ? 29.225 23.377  1.640  1.00 69.67  ? 277 GLU A OE1    1 
ATOM   1783 O  OE2    . GLU A 1 240 ? 28.975 21.269  2.239  1.00 55.83  ? 277 GLU A OE2    1 
ATOM   1784 N  N      . GLN A 1 241 ? 23.913 19.237  0.546  1.00 28.22  ? 278 GLN A N      1 
ATOM   1785 C  CA     . GLN A 1 241 ? 23.355 17.881  0.426  1.00 26.67  ? 278 GLN A CA     1 
ATOM   1786 C  C      . GLN A 1 241 ? 21.938 17.792  -0.127 1.00 29.68  ? 278 GLN A C      1 
ATOM   1787 O  O      . GLN A 1 241 ? 21.681 16.958  -1.000 1.00 29.45  ? 278 GLN A O      1 
ATOM   1788 C  CB     . GLN A 1 241 ? 23.432 17.176  1.771  1.00 26.19  ? 278 GLN A CB     1 
ATOM   1789 C  CG     . GLN A 1 241 ? 24.839 16.735  2.110  1.00 37.60  ? 278 GLN A CG     1 
ATOM   1790 C  CD     . GLN A 1 241 ? 24.864 16.038  3.434  1.00 46.31  ? 278 GLN A CD     1 
ATOM   1791 O  OE1    . GLN A 1 241 ? 24.262 14.971  3.617  1.00 37.26  ? 278 GLN A OE1    1 
ATOM   1792 N  NE2    . GLN A 1 241 ? 25.563 16.634  4.383  1.00 37.19  ? 278 GLN A NE2    1 
ATOM   1793 N  N      . LEU A 1 242 ? 21.017 18.611  0.402  1.00 25.80  ? 279 LEU A N      1 
ATOM   1794 C  CA     . LEU A 1 242 ? 19.601 18.614  0.003  1.00 24.71  ? 279 LEU A CA     1 
ATOM   1795 C  C      . LEU A 1 242 ? 19.296 19.610  -1.108 1.00 29.48  ? 279 LEU A C      1 
ATOM   1796 O  O      . LEU A 1 242 ? 18.235 19.534  -1.739 1.00 29.04  ? 279 LEU A O      1 
ATOM   1797 C  CB     . LEU A 1 242 ? 18.684 18.890  1.229  1.00 22.84  ? 279 LEU A CB     1 
ATOM   1798 C  CG     . LEU A 1 242 ? 18.827 17.990  2.476  1.00 24.80  ? 279 LEU A CG     1 
ATOM   1799 C  CD1    . LEU A 1 242 ? 17.841 18.395  3.530  1.00 22.52  ? 279 LEU A CD1    1 
ATOM   1800 C  CD2    . LEU A 1 242 ? 18.542 16.541  2.170  1.00 25.37  ? 279 LEU A CD2    1 
ATOM   1801 N  N      . GLY A 1 243 ? 20.202 20.560  -1.313 1.00 27.45  ? 280 GLY A N      1 
ATOM   1802 C  CA     . GLY A 1 243 ? 20.031 21.580  -2.337 1.00 28.60  ? 280 GLY A CA     1 
ATOM   1803 C  C      . GLY A 1 243 ? 19.367 22.827  -1.808 1.00 32.66  ? 280 GLY A C      1 
ATOM   1804 O  O      . GLY A 1 243 ? 18.800 22.819  -0.715 1.00 31.39  ? 280 GLY A O      1 
ATOM   1805 N  N      . THR A 1 244 ? 19.425 23.893  -2.607 1.00 30.76  ? 281 THR A N      1 
ATOM   1806 C  CA     . THR A 1 244 ? 18.848 25.206  -2.350 1.00 31.61  ? 281 THR A CA     1 
ATOM   1807 C  C      . THR A 1 244 ? 17.315 25.072  -2.268 1.00 35.64  ? 281 THR A C      1 
ATOM   1808 O  O      . THR A 1 244 ? 16.715 24.497  -3.173 1.00 35.51  ? 281 THR A O      1 
ATOM   1809 C  CB     . THR A 1 244 ? 19.312 26.170  -3.459 1.00 40.52  ? 281 THR A CB     1 
ATOM   1810 O  OG1    . THR A 1 244 ? 20.737 26.129  -3.517 1.00 42.09  ? 281 THR A OG1    1 
ATOM   1811 C  CG2    . THR A 1 244 ? 18.831 27.611  -3.253 1.00 37.59  ? 281 THR A CG2    1 
ATOM   1812 N  N      . PRO A 1 245 ? 16.660 25.583  -1.200 1.00 31.66  ? 282 PRO A N      1 
ATOM   1813 C  CA     . PRO A 1 245 ? 15.187 25.469  -1.128 1.00 31.59  ? 282 PRO A CA     1 
ATOM   1814 C  C      . PRO A 1 245 ? 14.452 26.295  -2.197 1.00 38.66  ? 282 PRO A C      1 
ATOM   1815 O  O      . PRO A 1 245 ? 15.052 27.179  -2.808 1.00 41.04  ? 282 PRO A O      1 
ATOM   1816 C  CB     . PRO A 1 245 ? 14.865 25.950  0.289  1.00 32.00  ? 282 PRO A CB     1 
ATOM   1817 C  CG     . PRO A 1 245 ? 15.997 26.867  0.633  1.00 36.23  ? 282 PRO A CG     1 
ATOM   1818 C  CD     . PRO A 1 245 ? 17.212 26.306  -0.033 1.00 31.58  ? 282 PRO A CD     1 
ATOM   1819 N  N      . CYS A 1 246 ? 13.149 26.007  -2.404 1.00 34.91  ? 283 CYS A N      1 
ATOM   1820 C  CA     . CYS A 1 246 ? 12.230 26.666  -3.346 1.00 36.86  ? 283 CYS A CA     1 
ATOM   1821 C  C      . CYS A 1 246 ? 12.130 28.204  -3.132 1.00 39.58  ? 283 CYS A C      1 
ATOM   1822 O  O      . CYS A 1 246 ? 12.388 28.667  -2.009 1.00 36.22  ? 283 CYS A O      1 
ATOM   1823 C  CB     . CYS A 1 246 ? 10.852 26.016  -3.246 1.00 38.37  ? 283 CYS A CB     1 
ATOM   1824 S  SG     . CYS A 1 246 ? 10.014 26.305  -1.660 1.00 42.85  ? 283 CYS A SG     1 
ATOM   1825 N  N      . PRO A 1 247 ? 11.672 28.997  -4.156 1.00 37.70  ? 284 PRO A N      1 
ATOM   1826 C  CA     . PRO A 1 247 ? 11.503 30.444  -3.950 1.00 38.65  ? 284 PRO A CA     1 
ATOM   1827 C  C      . PRO A 1 247 ? 10.427 30.765  -2.913 1.00 43.46  ? 284 PRO A C      1 
ATOM   1828 O  O      . PRO A 1 247 ? 10.569 31.745  -2.190 1.00 43.32  ? 284 PRO A O      1 
ATOM   1829 C  CB     . PRO A 1 247 ? 11.113 30.973  -5.346 1.00 43.06  ? 284 PRO A CB     1 
ATOM   1830 C  CG     . PRO A 1 247 ? 11.469 29.895  -6.302 1.00 46.78  ? 284 PRO A CG     1 
ATOM   1831 C  CD     . PRO A 1 247 ? 11.308 28.615  -5.539 1.00 40.21  ? 284 PRO A CD     1 
ATOM   1832 N  N      . GLU A 1 248 ? 9.375  29.925  -2.806 1.00 40.65  ? 285 GLU A N      1 
ATOM   1833 C  CA     . GLU A 1 248 ? 8.299  30.100  -1.813 1.00 40.92  ? 285 GLU A CA     1 
ATOM   1834 C  C      . GLU A 1 248 ? 8.835  30.072  -0.354 1.00 42.55  ? 285 GLU A C      1 
ATOM   1835 O  O      . GLU A 1 248 ? 8.258  30.743  0.497  1.00 44.22  ? 285 GLU A O      1 
ATOM   1836 C  CB     . GLU A 1 248 ? 7.213  29.022  -1.998 1.00 42.17  ? 285 GLU A CB     1 
ATOM   1837 N  N      . PHE A 1 249 ? 9.922  29.286  -0.068 1.00 34.42  ? 286 PHE A N      1 
ATOM   1838 C  CA     . PHE A 1 249 ? 10.568 29.220  1.256  1.00 31.15  ? 286 PHE A CA     1 
ATOM   1839 C  C      . PHE A 1 249 ? 11.284 30.536  1.519  1.00 37.32  ? 286 PHE A C      1 
ATOM   1840 O  O      . PHE A 1 249 ? 11.185 31.074  2.619  1.00 36.50  ? 286 PHE A O      1 
ATOM   1841 C  CB     . PHE A 1 249 ? 11.566 28.053  1.336  1.00 29.45  ? 286 PHE A CB     1 
ATOM   1842 C  CG     . PHE A 1 249 ? 12.376 27.973  2.612  1.00 28.11  ? 286 PHE A CG     1 
ATOM   1843 C  CD1    . PHE A 1 249 ? 11.836 27.413  3.766  1.00 28.48  ? 286 PHE A CD1    1 
ATOM   1844 C  CD2    . PHE A 1 249 ? 13.682 28.448  2.657  1.00 28.85  ? 286 PHE A CD2    1 
ATOM   1845 C  CE1    . PHE A 1 249 ? 12.593 27.324  4.941  1.00 27.91  ? 286 PHE A CE1    1 
ATOM   1846 C  CE2    . PHE A 1 249 ? 14.437 28.358  3.824  1.00 30.22  ? 286 PHE A CE2    1 
ATOM   1847 C  CZ     . PHE A 1 249 ? 13.894 27.777  4.955  1.00 27.21  ? 286 PHE A CZ     1 
ATOM   1848 N  N      . MET A 1 250 ? 12.009 31.044  0.502  1.00 39.19  ? 287 MET A N      1 
ATOM   1849 C  CA     . MET A 1 250 ? 12.723 32.339  0.528  1.00 41.92  ? 287 MET A CA     1 
ATOM   1850 C  C      . MET A 1 250 ? 11.762 33.479  0.871  1.00 46.88  ? 287 MET A C      1 
ATOM   1851 O  O      . MET A 1 250 ? 12.136 34.380  1.622  1.00 47.80  ? 287 MET A O      1 
ATOM   1852 C  CB     . MET A 1 250 ? 13.388 32.649  -0.831 1.00 45.64  ? 287 MET A CB     1 
ATOM   1853 C  CG     . MET A 1 250 ? 14.222 31.516  -1.404 1.00 48.25  ? 287 MET A CG     1 
ATOM   1854 S  SD     . MET A 1 250 ? 15.535 30.994  -0.282 1.00 50.42  ? 287 MET A SD     1 
ATOM   1855 C  CE     . MET A 1 250 ? 16.539 30.064  -1.392 1.00 46.81  ? 287 MET A CE     1 
ATOM   1856 N  N      . LYS A 1 251 ? 10.518 33.410  0.343  1.00 43.82  ? 288 LYS A N      1 
ATOM   1857 C  CA     . LYS A 1 251 ? 9.437  34.374  0.565  1.00 46.57  ? 288 LYS A CA     1 
ATOM   1858 C  C      . LYS A 1 251 ? 8.999  34.487  2.047  1.00 50.36  ? 288 LYS A C      1 
ATOM   1859 O  O      . LYS A 1 251 ? 8.452  35.521  2.448  1.00 51.32  ? 288 LYS A O      1 
ATOM   1860 C  CB     . LYS A 1 251 ? 8.235  34.028  -0.333 1.00 50.86  ? 288 LYS A CB     1 
ATOM   1861 N  N      . LYS A 1 252 ? 9.246  33.434  2.852  1.00 45.03  ? 289 LYS A N      1 
ATOM   1862 C  CA     . LYS A 1 252 ? 8.888  33.419  4.269  1.00 44.30  ? 289 LYS A CA     1 
ATOM   1863 C  C      . LYS A 1 252 ? 10.001 33.971  5.166  1.00 48.85  ? 289 LYS A C      1 
ATOM   1864 O  O      . LYS A 1 252 ? 9.757  34.219  6.345  1.00 49.24  ? 289 LYS A O      1 
ATOM   1865 C  CB     . LYS A 1 252 ? 8.461  32.018  4.725  1.00 44.56  ? 289 LYS A CB     1 
ATOM   1866 C  CG     . LYS A 1 252 ? 7.197  31.500  4.050  1.00 53.41  ? 289 LYS A CG     1 
ATOM   1867 C  CD     . LYS A 1 252 ? 6.713  30.201  4.670  1.00 60.58  ? 289 LYS A CD     1 
ATOM   1868 C  CE     . LYS A 1 252 ? 7.410  28.972  4.134  1.00 63.75  ? 289 LYS A CE     1 
ATOM   1869 N  NZ     . LYS A 1 252 ? 6.886  27.747  4.779  1.00 65.47  ? 289 LYS A NZ     1 
ATOM   1870 N  N      . LEU A 1 253 ? 11.209 34.188  4.613  1.00 44.38  ? 290 LEU A N      1 
ATOM   1871 C  CA     . LEU A 1 253 ? 12.343 34.720  5.382  1.00 43.06  ? 290 LEU A CA     1 
ATOM   1872 C  C      . LEU A 1 253 ? 12.270 36.248  5.526  1.00 48.86  ? 290 LEU A C      1 
ATOM   1873 O  O      . LEU A 1 253 ? 11.828 36.930  4.590  1.00 50.16  ? 290 LEU A O      1 
ATOM   1874 C  CB     . LEU A 1 253 ? 13.670 34.347  4.684  1.00 42.32  ? 290 LEU A CB     1 
ATOM   1875 C  CG     . LEU A 1 253 ? 14.086 32.863  4.694  1.00 43.34  ? 290 LEU A CG     1 
ATOM   1876 C  CD1    . LEU A 1 253 ? 15.075 32.565  3.587  1.00 42.74  ? 290 LEU A CD1    1 
ATOM   1877 C  CD2    . LEU A 1 253 ? 14.706 32.487  6.022  1.00 43.90  ? 290 LEU A CD2    1 
ATOM   1878 N  N      . GLN A 1 254 ? 12.779 36.780  6.665  1.00 44.95  ? 291 GLN A N      1 
ATOM   1879 C  CA     . GLN A 1 254 ? 12.904 38.220  6.941  1.00 47.39  ? 291 GLN A CA     1 
ATOM   1880 C  C      . GLN A 1 254 ? 13.852 38.834  5.886  1.00 51.03  ? 291 GLN A C      1 
ATOM   1881 O  O      . GLN A 1 254 ? 14.750 38.122  5.434  1.00 48.79  ? 291 GLN A O      1 
ATOM   1882 C  CB     . GLN A 1 254 ? 13.432 38.462  8.373  1.00 48.05  ? 291 GLN A CB     1 
ATOM   1883 N  N      . PRO A 1 255 ? 13.644 40.092  5.423  1.00 50.93  ? 292 PRO A N      1 
ATOM   1884 C  CA     . PRO A 1 255 ? 14.487 40.636  4.329  1.00 52.12  ? 292 PRO A CA     1 
ATOM   1885 C  C      . PRO A 1 255 ? 16.003 40.383  4.416  1.00 54.36  ? 292 PRO A C      1 
ATOM   1886 O  O      . PRO A 1 255 ? 16.594 39.960  3.417  1.00 52.46  ? 292 PRO A O      1 
ATOM   1887 C  CB     . PRO A 1 255 ? 14.168 42.126  4.345  1.00 56.96  ? 292 PRO A CB     1 
ATOM   1888 C  CG     . PRO A 1 255 ? 12.794 42.212  4.898  1.00 61.54  ? 292 PRO A CG     1 
ATOM   1889 C  CD     . PRO A 1 255 ? 12.600 41.061  5.831  1.00 54.47  ? 292 PRO A CD     1 
ATOM   1890 N  N      . THR A 1 256 ? 16.622 40.613  5.604  1.00 50.63  ? 293 THR A N      1 
ATOM   1891 C  CA     . THR A 1 256 ? 18.065 40.416  5.833  1.00 49.80  ? 293 THR A CA     1 
ATOM   1892 C  C      . THR A 1 256 ? 18.484 38.951  5.675  1.00 49.49  ? 293 THR A C      1 
ATOM   1893 O  O      . THR A 1 256 ? 19.464 38.685  4.978  1.00 48.91  ? 293 THR A O      1 
ATOM   1894 C  CB     . THR A 1 256 ? 18.528 41.005  7.175  1.00 57.94  ? 293 THR A CB     1 
ATOM   1895 O  OG1    . THR A 1 256 ? 17.921 40.278  8.247  1.00 57.78  ? 293 THR A OG1    1 
ATOM   1896 C  CG2    . THR A 1 256 ? 18.239 42.486  7.292  1.00 59.17  ? 293 THR A CG2    1 
ATOM   1897 N  N      . VAL A 1 257 ? 17.748 38.009  6.317  1.00 42.96  ? 294 VAL A N      1 
ATOM   1898 C  CA     . VAL A 1 257 ? 18.028 36.574  6.206  1.00 39.93  ? 294 VAL A CA     1 
ATOM   1899 C  C      . VAL A 1 257 ? 17.795 36.127  4.752  1.00 44.06  ? 294 VAL A C      1 
ATOM   1900 O  O      . VAL A 1 257 ? 18.634 35.412  4.210  1.00 42.52  ? 294 VAL A O      1 
ATOM   1901 C  CB     . VAL A 1 257 ? 17.266 35.671  7.225  1.00 41.85  ? 294 VAL A CB     1 
ATOM   1902 C  CG1    . VAL A 1 257 ? 17.870 34.273  7.267  1.00 39.00  ? 294 VAL A CG1    1 
ATOM   1903 C  CG2    . VAL A 1 257 ? 17.263 36.272  8.630  1.00 42.00  ? 294 VAL A CG2    1 
ATOM   1904 N  N      . ARG A 1 258 ? 16.690 36.594  4.120  1.00 42.37  ? 295 ARG A N      1 
ATOM   1905 C  CA     . ARG A 1 258 ? 16.317 36.282  2.740  1.00 43.93  ? 295 ARG A CA     1 
ATOM   1906 C  C      . ARG A 1 258 ? 17.412 36.649  1.748  1.00 51.79  ? 295 ARG A C      1 
ATOM   1907 O  O      . ARG A 1 258 ? 17.710 35.850  0.863  1.00 50.98  ? 295 ARG A O      1 
ATOM   1908 C  CB     . ARG A 1 258 ? 14.998 36.964  2.351  1.00 47.10  ? 295 ARG A CB     1 
ATOM   1909 N  N      . ASN A 1 259 ? 18.025 37.850  1.909  1.00 50.98  ? 296 ASN A N      1 
ATOM   1910 C  CA     . ASN A 1 259 ? 19.113 38.339  1.059  1.00 51.75  ? 296 ASN A CA     1 
ATOM   1911 C  C      . ASN A 1 259 ? 20.345 37.450  1.232  1.00 50.99  ? 296 ASN A C      1 
ATOM   1912 O  O      . ASN A 1 259 ? 20.930 37.045  0.228  1.00 48.82  ? 296 ASN A O      1 
ATOM   1913 C  CB     . ASN A 1 259 ? 19.437 39.805  1.367  1.00 56.38  ? 296 ASN A CB     1 
ATOM   1914 C  CG     . ASN A 1 259 ? 20.563 40.375  0.536  1.00 85.42  ? 296 ASN A CG     1 
ATOM   1915 O  OD1    . ASN A 1 259 ? 21.742 40.322  0.914  1.00 76.93  ? 296 ASN A OD1    1 
ATOM   1916 N  ND2    . ASN A 1 259 ? 20.223 40.913  -0.623 1.00 82.21  ? 296 ASN A ND2    1 
ATOM   1917 N  N      . TYR A 1 260 ? 20.711 37.121  2.496  1.00 46.01  ? 297 TYR A N      1 
ATOM   1918 C  CA     . TYR A 1 260 ? 21.835 36.231  2.805  1.00 45.58  ? 297 TYR A CA     1 
ATOM   1919 C  C      . TYR A 1 260 ? 21.643 34.807  2.214  1.00 47.85  ? 297 TYR A C      1 
ATOM   1920 O  O      . TYR A 1 260 ? 22.584 34.259  1.637  1.00 46.98  ? 297 TYR A O      1 
ATOM   1921 C  CB     . TYR A 1 260 ? 22.120 36.160  4.324  1.00 46.50  ? 297 TYR A CB     1 
ATOM   1922 C  CG     . TYR A 1 260 ? 23.193 35.142  4.655  1.00 49.01  ? 297 TYR A CG     1 
ATOM   1923 C  CD1    . TYR A 1 260 ? 24.533 35.398  4.373  1.00 53.00  ? 297 TYR A CD1    1 
ATOM   1924 C  CD2    . TYR A 1 260 ? 22.857 33.873  5.127  1.00 47.72  ? 297 TYR A CD2    1 
ATOM   1925 C  CE1    . TYR A 1 260 ? 25.517 34.440  4.602  1.00 53.82  ? 297 TYR A CE1    1 
ATOM   1926 C  CE2    . TYR A 1 260 ? 23.830 32.892  5.321  1.00 47.71  ? 297 TYR A CE2    1 
ATOM   1927 C  CZ     . TYR A 1 260 ? 25.160 33.183  5.060  1.00 58.11  ? 297 TYR A CZ     1 
ATOM   1928 O  OH     . TYR A 1 260 ? 26.136 32.242  5.263  1.00 60.40  ? 297 TYR A OH     1 
ATOM   1929 N  N      . VAL A 1 261 ? 20.445 34.214  2.393  1.00 43.72  ? 298 VAL A N      1 
ATOM   1930 C  CA     . VAL A 1 261 ? 20.100 32.860  1.922  1.00 41.83  ? 298 VAL A CA     1 
ATOM   1931 C  C      . VAL A 1 261 ? 20.089 32.813  0.378  1.00 48.94  ? 298 VAL A C      1 
ATOM   1932 O  O      . VAL A 1 261 ? 20.656 31.879  -0.193 1.00 48.92  ? 298 VAL A O      1 
ATOM   1933 C  CB     . VAL A 1 261 ? 18.792 32.312  2.579  1.00 42.65  ? 298 VAL A CB     1 
ATOM   1934 C  CG1    . VAL A 1 261 ? 18.318 31.018  1.920  1.00 40.65  ? 298 VAL A CG1    1 
ATOM   1935 C  CG2    . VAL A 1 261 ? 18.970 32.103  4.085  1.00 40.72  ? 298 VAL A CG2    1 
ATOM   1936 N  N      . GLU A 1 262 ? 19.497 33.838  -0.283 1.00 47.99  ? 299 GLU A N      1 
ATOM   1937 C  CA     . GLU A 1 262 ? 19.430 33.944  -1.747 1.00 49.25  ? 299 GLU A CA     1 
ATOM   1938 C  C      . GLU A 1 262 ? 20.784 34.275  -2.397 1.00 55.15  ? 299 GLU A C      1 
ATOM   1939 O  O      . GLU A 1 262 ? 20.939 34.055  -3.606 1.00 55.46  ? 299 GLU A O      1 
ATOM   1940 C  CB     . GLU A 1 262 ? 18.369 34.966  -2.196 1.00 52.59  ? 299 GLU A CB     1 
ATOM   1941 C  CG     . GLU A 1 262 ? 16.928 34.473  -2.160 1.00 63.62  ? 299 GLU A CG     1 
ATOM   1942 C  CD     . GLU A 1 262 ? 15.874 35.465  -2.635 1.00 88.31  ? 299 GLU A CD     1 
ATOM   1943 O  OE1    . GLU A 1 262 ? 16.202 36.663  -2.800 1.00 90.55  ? 299 GLU A OE1    1 
ATOM   1944 O  OE2    . GLU A 1 262 ? 14.711 35.043  -2.836 1.00 74.79  ? 299 GLU A OE2    1 
ATOM   1945 N  N      . ASN A 1 263 ? 21.749 34.834  -1.623 1.00 51.76  ? 300 ASN A N      1 
ATOM   1946 C  CA     . ASN A 1 263 ? 23.070 35.181  -2.175 1.00 53.53  ? 300 ASN A CA     1 
ATOM   1947 C  C      . ASN A 1 263 ? 24.143 34.110  -1.865 1.00 55.37  ? 300 ASN A C      1 
ATOM   1948 O  O      . ASN A 1 263 ? 25.309 34.287  -2.229 1.00 56.39  ? 300 ASN A O      1 
ATOM   1949 C  CB     . ASN A 1 263 ? 23.519 36.600  -1.764 1.00 58.70  ? 300 ASN A CB     1 
ATOM   1950 N  N      . ARG A 1 264 ? 23.739 32.981  -1.245 1.00 48.64  ? 301 ARG A N      1 
ATOM   1951 C  CA     . ARG A 1 264 ? 24.639 31.853  -0.962 1.00 48.01  ? 301 ARG A CA     1 
ATOM   1952 C  C      . ARG A 1 264 ? 24.914 31.054  -2.277 1.00 53.21  ? 301 ARG A C      1 
ATOM   1953 O  O      . ARG A 1 264 ? 24.086 31.128  -3.187 1.00 51.92  ? 301 ARG A O      1 
ATOM   1954 C  CB     . ARG A 1 264 ? 24.021 30.925  0.111  1.00 46.18  ? 301 ARG A CB     1 
ATOM   1955 N  N      . PRO A 1 265 ? 26.046 30.303  -2.416 1.00 52.12  ? 302 PRO A N      1 
ATOM   1956 C  CA     . PRO A 1 265 ? 26.250 29.499  -3.643 1.00 52.83  ? 302 PRO A CA     1 
ATOM   1957 C  C      . PRO A 1 265 ? 25.132 28.457  -3.807 1.00 52.84  ? 302 PRO A C      1 
ATOM   1958 O  O      . PRO A 1 265 ? 24.845 27.721  -2.859 1.00 49.58  ? 302 PRO A O      1 
ATOM   1959 C  CB     . PRO A 1 265 ? 27.606 28.811  -3.404 1.00 55.22  ? 302 PRO A CB     1 
ATOM   1960 C  CG     . PRO A 1 265 ? 28.243 29.550  -2.276 1.00 60.03  ? 302 PRO A CG     1 
ATOM   1961 C  CD     . PRO A 1 265 ? 27.129 30.066  -1.438 1.00 54.20  ? 302 PRO A CD     1 
ATOM   1962 N  N      . LYS A 1 266 ? 24.458 28.457  -4.978 1.00 48.96  ? 303 LYS A N      1 
ATOM   1963 C  CA     . LYS A 1 266 ? 23.335 27.564  -5.284 1.00 46.51  ? 303 LYS A CA     1 
ATOM   1964 C  C      . LYS A 1 266 ? 23.754 26.095  -5.514 1.00 48.52  ? 303 LYS A C      1 
ATOM   1965 O  O      . LYS A 1 266 ? 24.867 25.811  -5.976 1.00 48.99  ? 303 LYS A O      1 
ATOM   1966 C  CB     . LYS A 1 266 ? 22.504 28.106  -6.460 1.00 49.70  ? 303 LYS A CB     1 
ATOM   1967 N  N      . TYR A 1 267 ? 22.851 25.170  -5.152 1.00 41.97  ? 304 TYR A N      1 
ATOM   1968 C  CA     . TYR A 1 267 ? 23.033 23.726  -5.247 1.00 39.95  ? 304 TYR A CA     1 
ATOM   1969 C  C      . TYR A 1 267 ? 21.738 23.039  -5.678 1.00 39.82  ? 304 TYR A C      1 
ATOM   1970 O  O      . TYR A 1 267 ? 20.682 23.285  -5.089 1.00 37.53  ? 304 TYR A O      1 
ATOM   1971 C  CB     . TYR A 1 267 ? 23.484 23.144  -3.895 1.00 40.69  ? 304 TYR A CB     1 
ATOM   1972 C  CG     . TYR A 1 267 ? 24.934 23.391  -3.532 1.00 45.72  ? 304 TYR A CG     1 
ATOM   1973 C  CD1    . TYR A 1 267 ? 25.955 22.637  -4.104 1.00 49.27  ? 304 TYR A CD1    1 
ATOM   1974 C  CD2    . TYR A 1 267 ? 25.278 24.307  -2.540 1.00 47.23  ? 304 TYR A CD2    1 
ATOM   1975 C  CE1    . TYR A 1 267 ? 27.289 22.839  -3.755 1.00 52.11  ? 304 TYR A CE1    1 
ATOM   1976 C  CE2    . TYR A 1 267 ? 26.608 24.502  -2.165 1.00 49.62  ? 304 TYR A CE2    1 
ATOM   1977 C  CZ     . TYR A 1 267 ? 27.611 23.766  -2.778 1.00 60.84  ? 304 TYR A CZ     1 
ATOM   1978 O  OH     . TYR A 1 267 ? 28.927 23.939  -2.418 1.00 65.36  ? 304 TYR A OH     1 
ATOM   1979 N  N      . ALA A 1 268 ? 21.826 22.157  -6.688 1.00 35.97  ? 305 ALA A N      1 
ATOM   1980 C  CA     . ALA A 1 268 ? 20.697 21.348  -7.157 1.00 35.17  ? 305 ALA A CA     1 
ATOM   1981 C  C      . ALA A 1 268 ? 20.289 20.337  -6.054 1.00 38.16  ? 305 ALA A C      1 
ATOM   1982 O  O      . ALA A 1 268 ? 19.106 20.018  -5.913 1.00 37.91  ? 305 ALA A O      1 
ATOM   1983 C  CB     . ALA A 1 268 ? 21.084 20.599  -8.421 1.00 36.61  ? 305 ALA A CB     1 
ATOM   1984 N  N      . GLY A 1 269 ? 21.273 19.879  -5.277 1.00 32.42  ? 306 GLY A N      1 
ATOM   1985 C  CA     . GLY A 1 269 ? 21.059 18.919  -4.210 1.00 31.07  ? 306 GLY A CA     1 
ATOM   1986 C  C      . GLY A 1 269 ? 21.109 17.489  -4.692 1.00 35.79  ? 306 GLY A C      1 
ATOM   1987 O  O      . GLY A 1 269 ? 21.044 17.220  -5.899 1.00 35.75  ? 306 GLY A O      1 
ATOM   1988 N  N      . LEU A 1 270 ? 21.241 16.566  -3.736 1.00 31.48  ? 307 LEU A N      1 
ATOM   1989 C  CA     . LEU A 1 270 ? 21.316 15.145  -4.036 1.00 31.62  ? 307 LEU A CA     1 
ATOM   1990 C  C      . LEU A 1 270 ? 19.985 14.462  -3.793 1.00 34.23  ? 307 LEU A C      1 
ATOM   1991 O  O      . LEU A 1 270 ? 19.225 14.884  -2.916 1.00 32.52  ? 307 LEU A O      1 
ATOM   1992 C  CB     . LEU A 1 270 ? 22.455 14.472  -3.236 1.00 31.33  ? 307 LEU A CB     1 
ATOM   1993 C  CG     . LEU A 1 270 ? 23.853 15.092  -3.436 1.00 37.15  ? 307 LEU A CG     1 
ATOM   1994 C  CD1    . LEU A 1 270 ? 24.843 14.540  -2.433 1.00 36.90  ? 307 LEU A CD1    1 
ATOM   1995 C  CD2    . LEU A 1 270 ? 24.358 14.909  -4.881 1.00 39.78  ? 307 LEU A CD2    1 
ATOM   1996 N  N      . THR A 1 271 ? 19.687 13.427  -4.605 1.00 31.32  ? 308 THR A N      1 
ATOM   1997 C  CA     . THR A 1 271 ? 18.470 12.611  -4.482 1.00 30.53  ? 308 THR A CA     1 
ATOM   1998 C  C      . THR A 1 271 ? 18.632 11.735  -3.236 1.00 33.27  ? 308 THR A C      1 
ATOM   1999 O  O      . THR A 1 271 ? 19.766 11.456  -2.839 1.00 32.27  ? 308 THR A O      1 
ATOM   2000 C  CB     . THR A 1 271 ? 18.266 11.709  -5.733 1.00 34.77  ? 308 THR A CB     1 
ATOM   2001 O  OG1    . THR A 1 271 ? 19.248 10.673  -5.722 1.00 38.25  ? 308 THR A OG1    1 
ATOM   2002 C  CG2    . THR A 1 271 ? 18.325 12.477  -7.047 1.00 30.25  ? 308 THR A CG2    1 
ATOM   2003 N  N      . PHE A 1 272 ? 17.515 11.262  -2.651 1.00 30.05  ? 309 PHE A N      1 
ATOM   2004 C  CA     . PHE A 1 272 ? 17.570 10.421  -1.455 1.00 29.22  ? 309 PHE A CA     1 
ATOM   2005 C  C      . PHE A 1 272 ? 18.249 9.052   -1.722 1.00 33.43  ? 309 PHE A C      1 
ATOM   2006 O  O      . PHE A 1 272 ? 19.093 8.699   -0.890 1.00 32.03  ? 309 PHE A O      1 
ATOM   2007 C  CB     . PHE A 1 272 ? 16.217 10.326  -0.737 1.00 29.71  ? 309 PHE A CB     1 
ATOM   2008 C  CG     . PHE A 1 272 ? 16.064 11.567  0.119  1.00 29.89  ? 309 PHE A CG     1 
ATOM   2009 C  CD1    . PHE A 1 272 ? 15.584 12.759  -0.428 1.00 31.96  ? 309 PHE A CD1    1 
ATOM   2010 C  CD2    . PHE A 1 272 ? 16.490 11.574  1.446  1.00 30.03  ? 309 PHE A CD2    1 
ATOM   2011 C  CE1    . PHE A 1 272 ? 15.473 13.914  0.352  1.00 31.53  ? 309 PHE A CE1    1 
ATOM   2012 C  CE2    . PHE A 1 272 ? 16.415 12.741  2.216  1.00 31.81  ? 309 PHE A CE2    1 
ATOM   2013 C  CZ     . PHE A 1 272 ? 15.907 13.903  1.664  1.00 30.25  ? 309 PHE A CZ     1 
ATOM   2014 N  N      . PRO A 1 273 ? 18.092 8.355   -2.884 1.00 31.37  ? 310 PRO A N      1 
ATOM   2015 C  CA     . PRO A 1 273 ? 18.929 7.154   -3.116 1.00 31.38  ? 310 PRO A CA     1 
ATOM   2016 C  C      . PRO A 1 273 ? 20.431 7.497   -3.086 1.00 34.44  ? 310 PRO A C      1 
ATOM   2017 O  O      . PRO A 1 273 ? 21.206 6.696   -2.594 1.00 33.99  ? 310 PRO A O      1 
ATOM   2018 C  CB     . PRO A 1 273 ? 18.501 6.666   -4.515 1.00 34.10  ? 310 PRO A CB     1 
ATOM   2019 C  CG     . PRO A 1 273 ? 17.163 7.261   -4.738 1.00 39.00  ? 310 PRO A CG     1 
ATOM   2020 C  CD     . PRO A 1 273 ? 17.172 8.588   -4.021 1.00 33.75  ? 310 PRO A CD     1 
ATOM   2021 N  N      . LYS A 1 274 ? 20.831 8.689   -3.578 1.00 31.85  ? 311 LYS A N      1 
ATOM   2022 C  CA     . LYS A 1 274 ? 22.230 9.135   -3.579 1.00 33.27  ? 311 LYS A CA     1 
ATOM   2023 C  C      . LYS A 1 274 ? 22.695 9.486   -2.175 1.00 39.37  ? 311 LYS A C      1 
ATOM   2024 O  O      . LYS A 1 274 ? 23.780 9.051   -1.775 1.00 40.99  ? 311 LYS A O      1 
ATOM   2025 C  CB     . LYS A 1 274 ? 22.441 10.319  -4.535 1.00 37.23  ? 311 LYS A CB     1 
ATOM   2026 C  CG     . LYS A 1 274 ? 22.877 9.901   -5.933 1.00 51.79  ? 311 LYS A CG     1 
ATOM   2027 C  CD     . LYS A 1 274 ? 22.865 11.082  -6.901 1.00 62.94  ? 311 LYS A CD     1 
ATOM   2028 C  CE     . LYS A 1 274 ? 23.690 10.837  -8.145 1.00 81.58  ? 311 LYS A CE     1 
ATOM   2029 N  NZ     . LYS A 1 274 ? 23.140 9.742   -8.994 1.00 93.60  ? 311 LYS A NZ     1 
ATOM   2030 N  N      . LEU A 1 275 ? 21.855 10.228  -1.411 1.00 34.42  ? 312 LEU A N      1 
ATOM   2031 C  CA     . LEU A 1 275 ? 22.117 10.615  -0.017 1.00 32.98  ? 312 LEU A CA     1 
ATOM   2032 C  C      . LEU A 1 275 ? 22.250 9.405   0.915  1.00 34.14  ? 312 LEU A C      1 
ATOM   2033 O  O      . LEU A 1 275 ? 23.152 9.377   1.754  1.00 33.78  ? 312 LEU A O      1 
ATOM   2034 C  CB     . LEU A 1 275 ? 21.001 11.547  0.503  1.00 32.49  ? 312 LEU A CB     1 
ATOM   2035 C  CG     . LEU A 1 275 ? 20.979 12.990  -0.026 1.00 37.51  ? 312 LEU A CG     1 
ATOM   2036 C  CD1    . LEU A 1 275 ? 19.651 13.648  0.270  1.00 36.07  ? 312 LEU A CD1    1 
ATOM   2037 C  CD2    . LEU A 1 275 ? 22.122 13.822  0.551  1.00 41.80  ? 312 LEU A CD2    1 
ATOM   2038 N  N      . PHE A 1 276 ? 21.350 8.407   0.769  1.00 28.48  ? 313 PHE A N      1 
ATOM   2039 C  CA     . PHE A 1 276 ? 21.327 7.199   1.597  1.00 27.34  ? 313 PHE A CA     1 
ATOM   2040 C  C      . PHE A 1 276 ? 21.398 5.965   0.683  1.00 34.98  ? 313 PHE A C      1 
ATOM   2041 O  O      . PHE A 1 276 ? 20.376 5.306   0.464  1.00 34.73  ? 313 PHE A O      1 
ATOM   2042 C  CB     . PHE A 1 276 ? 20.077 7.186   2.498  1.00 27.09  ? 313 PHE A CB     1 
ATOM   2043 C  CG     . PHE A 1 276 ? 19.985 8.423   3.362  1.00 26.57  ? 313 PHE A CG     1 
ATOM   2044 C  CD1    . PHE A 1 276 ? 20.696 8.512   4.558  1.00 26.58  ? 313 PHE A CD1    1 
ATOM   2045 C  CD2    . PHE A 1 276 ? 19.238 9.526   2.951  1.00 26.67  ? 313 PHE A CD2    1 
ATOM   2046 C  CE1    . PHE A 1 276 ? 20.658 9.680   5.325  1.00 26.09  ? 313 PHE A CE1    1 
ATOM   2047 C  CE2    . PHE A 1 276 ? 19.189 10.689  3.730  1.00 27.67  ? 313 PHE A CE2    1 
ATOM   2048 C  CZ     . PHE A 1 276 ? 19.905 10.758  4.906  1.00 24.34  ? 313 PHE A CZ     1 
ATOM   2049 N  N      . PRO A 1 277 ? 22.594 5.650   0.118  1.00 33.61  ? 314 PRO A N      1 
ATOM   2050 C  CA     . PRO A 1 277 ? 22.680 4.528   -0.832 1.00 34.65  ? 314 PRO A CA     1 
ATOM   2051 C  C      . PRO A 1 277 ? 22.320 3.165   -0.273 1.00 38.73  ? 314 PRO A C      1 
ATOM   2052 O  O      . PRO A 1 277 ? 22.289 2.959   0.940  1.00 37.22  ? 314 PRO A O      1 
ATOM   2053 C  CB     . PRO A 1 277 ? 24.131 4.583   -1.337 1.00 37.29  ? 314 PRO A CB     1 
ATOM   2054 C  CG     . PRO A 1 277 ? 24.597 5.946   -1.055 1.00 41.79  ? 314 PRO A CG     1 
ATOM   2055 C  CD     . PRO A 1 277 ? 23.902 6.331   0.236  1.00 35.64  ? 314 PRO A CD     1 
ATOM   2056 N  N      . ASP A 1 278 ? 22.018 2.237   -1.196 1.00 38.21  ? 315 ASP A N      1 
ATOM   2057 C  CA     . ASP A 1 278 ? 21.677 0.833   -0.952 1.00 39.11  ? 315 ASP A CA     1 
ATOM   2058 C  C      . ASP A 1 278 ? 22.684 0.184   -0.013 1.00 43.17  ? 315 ASP A C      1 
ATOM   2059 O  O      . ASP A 1 278 ? 22.282 -0.563  0.875  1.00 42.52  ? 315 ASP A O      1 
ATOM   2060 C  CB     . ASP A 1 278 ? 21.616 0.074   -2.301 1.00 42.28  ? 315 ASP A CB     1 
ATOM   2061 C  CG     . ASP A 1 278 ? 20.596 0.642   -3.279 1.00 55.51  ? 315 ASP A CG     1 
ATOM   2062 O  OD1    . ASP A 1 278 ? 19.652 1.333   -2.825 1.00 55.15  ? 315 ASP A OD1    1 
ATOM   2063 O  OD2    . ASP A 1 278 ? 20.749 0.409   -4.502 1.00 63.54  ? 315 ASP A OD2    1 
ATOM   2064 N  N      . SER A 1 279 ? 23.988 0.525   -0.178 1.00 41.05  ? 316 SER A N      1 
ATOM   2065 C  CA     . SER A 1 279 ? 25.118 0.075   0.649  1.00 41.67  ? 316 SER A CA     1 
ATOM   2066 C  C      . SER A 1 279 ? 24.850 0.246   2.156  1.00 42.28  ? 316 SER A C      1 
ATOM   2067 O  O      . SER A 1 279 ? 25.302 -0.582  2.951  1.00 42.04  ? 316 SER A O      1 
ATOM   2068 C  CB     . SER A 1 279 ? 26.379 0.848   0.274  1.00 46.51  ? 316 SER A CB     1 
ATOM   2069 N  N      . LEU A 1 280 ? 24.109 1.312   2.544  1.00 35.57  ? 317 LEU A N      1 
ATOM   2070 C  CA     . LEU A 1 280 ? 23.771 1.587   3.955  1.00 33.62  ? 317 LEU A CA     1 
ATOM   2071 C  C      . LEU A 1 280 ? 22.647 0.680   4.477  1.00 35.94  ? 317 LEU A C      1 
ATOM   2072 O  O      . LEU A 1 280 ? 22.442 0.595   5.678  1.00 34.02  ? 317 LEU A O      1 
ATOM   2073 C  CB     . LEU A 1 280 ? 23.405 3.076   4.172  1.00 32.22  ? 317 LEU A CB     1 
ATOM   2074 C  CG     . LEU A 1 280 ? 24.456 4.146   3.795  1.00 36.79  ? 317 LEU A CG     1 
ATOM   2075 C  CD1    . LEU A 1 280 ? 23.910 5.541   4.033  1.00 34.68  ? 317 LEU A CD1    1 
ATOM   2076 C  CD2    . LEU A 1 280 ? 25.749 3.985   4.607  1.00 40.69  ? 317 LEU A CD2    1 
ATOM   2077 N  N      . PHE A 1 281 ? 21.940 -0.014  3.579  1.00 33.92  ? 318 PHE A N      1 
ATOM   2078 C  CA     . PHE A 1 281 ? 20.814 -0.862  3.963  1.00 43.69  ? 318 PHE A CA     1 
ATOM   2079 C  C      . PHE A 1 281 ? 21.086 -2.360  3.784  1.00 86.23  ? 318 PHE A C      1 
ATOM   2080 O  O      . PHE A 1 281 ? 21.594 -2.789  2.750  1.00 55.20  ? 318 PHE A O      1 
ATOM   2081 C  CB     . PHE A 1 281 ? 19.546 -0.418  3.209  1.00 43.98  ? 318 PHE A CB     1 
ATOM   2082 C  CG     . PHE A 1 281 ? 19.057 0.963   3.590  1.00 42.15  ? 318 PHE A CG     1 
ATOM   2083 C  CD1    . PHE A 1 281 ? 18.229 1.147   4.691  1.00 42.25  ? 318 PHE A CD1    1 
ATOM   2084 C  CD2    . PHE A 1 281 ? 19.419 2.080   2.841  1.00 42.34  ? 318 PHE A CD2    1 
ATOM   2085 C  CE1    . PHE A 1 281 ? 17.782 2.421   5.048  1.00 40.60  ? 318 PHE A CE1    1 
ATOM   2086 C  CE2    . PHE A 1 281 ? 18.967 3.356   3.198  1.00 43.10  ? 318 PHE A CE2    1 
ATOM   2087 C  CZ     . PHE A 1 281 ? 18.146 3.515   4.296  1.00 39.72  ? 318 PHE A CZ     1 
ATOM   2088 N  N      . ASP A 1 284 ? 19.031 -7.571  2.499  1.00 45.22  ? 321 ASP A N      1 
ATOM   2089 C  CA     . ASP A 1 284 ? 19.378 -8.939  2.104  1.00 46.97  ? 321 ASP A CA     1 
ATOM   2090 C  C      . ASP A 1 284 ? 18.116 -9.703  1.701  1.00 47.97  ? 321 ASP A C      1 
ATOM   2091 O  O      . ASP A 1 284 ? 17.943 -10.003 0.516  1.00 50.17  ? 321 ASP A O      1 
ATOM   2092 C  CB     . ASP A 1 284 ? 20.161 -9.673  3.224  1.00 49.92  ? 321 ASP A CB     1 
ATOM   2093 N  N      . SER A 1 285 ? 17.215 -9.970  2.677  1.00 38.89  ? 322 SER A N      1 
ATOM   2094 C  CA     . SER A 1 285 ? 15.942 -10.655 2.458  1.00 37.19  ? 322 SER A CA     1 
ATOM   2095 C  C      . SER A 1 285 ? 14.969 -9.677  1.757  1.00 35.99  ? 322 SER A C      1 
ATOM   2096 O  O      . SER A 1 285 ? 15.257 -8.492  1.675  1.00 31.71  ? 322 SER A O      1 
ATOM   2097 C  CB     . SER A 1 285 ? 15.355 -11.120 3.790  1.00 36.04  ? 322 SER A CB     1 
ATOM   2098 O  OG     . SER A 1 285 ? 14.788 -10.031 4.501  1.00 38.03  ? 322 SER A OG     1 
ATOM   2099 N  N      . GLU A 1 286 ? 13.829 -10.174 1.263  1.00 33.38  ? 323 GLU A N      1 
ATOM   2100 C  CA     . GLU A 1 286 ? 12.813 -9.335  0.620  1.00 31.43  ? 323 GLU A CA     1 
ATOM   2101 C  C      . GLU A 1 286 ? 12.200 -8.379  1.652  1.00 32.73  ? 323 GLU A C      1 
ATOM   2102 O  O      . GLU A 1 286 ? 11.972 -7.193  1.367  1.00 29.29  ? 323 GLU A O      1 
ATOM   2103 C  CB     . GLU A 1 286 ? 11.740 -10.216 -0.037 1.00 34.04  ? 323 GLU A CB     1 
ATOM   2104 C  CG     . GLU A 1 286 ? 12.227 -10.917 -1.303 1.00 36.28  ? 323 GLU A CG     1 
ATOM   2105 C  CD     . GLU A 1 286 ? 12.572 -10.023 -2.485 1.00 34.69  ? 323 GLU A CD     1 
ATOM   2106 O  OE1    . GLU A 1 286 ? 12.262 -8.809  -2.449 1.00 29.22  ? 323 GLU A OE1    1 
ATOM   2107 O  OE2    . GLU A 1 286 ? 13.096 -10.562 -3.484 1.00 37.06  ? 323 GLU A OE2    1 
ATOM   2108 N  N      . HIS A 1 287 ? 11.966 -8.904  2.870  1.00 31.33  ? 324 HIS A N      1 
ATOM   2109 C  CA     . HIS A 1 287 ? 11.445 -8.114  3.983  1.00 31.57  ? 324 HIS A CA     1 
ATOM   2110 C  C      . HIS A 1 287 ? 12.305 -6.860  4.159  1.00 32.17  ? 324 HIS A C      1 
ATOM   2111 O  O      . HIS A 1 287 ? 11.768 -5.746  4.190  1.00 30.67  ? 324 HIS A O      1 
ATOM   2112 C  CB     . HIS A 1 287 ? 11.435 -8.951  5.290  1.00 33.91  ? 324 HIS A CB     1 
ATOM   2113 C  CG     . HIS A 1 287 ? 11.133 -8.142  6.516  1.00 36.74  ? 324 HIS A CG     1 
ATOM   2114 N  ND1    . HIS A 1 287 ? 9.842  -8.011  6.993  1.00 39.63  ? 324 HIS A ND1    1 
ATOM   2115 C  CD2    . HIS A 1 287 ? 11.970 -7.447  7.325  1.00 36.33  ? 324 HIS A CD2    1 
ATOM   2116 C  CE1    . HIS A 1 287 ? 9.933  -7.240  8.065  1.00 36.83  ? 324 HIS A CE1    1 
ATOM   2117 N  NE2    . HIS A 1 287 ? 11.192 -6.873  8.296  1.00 35.58  ? 324 HIS A NE2    1 
ATOM   2118 N  N      . ASN A 1 288 ? 13.642 -7.047  4.266  1.00 27.89  ? 325 ASN A N      1 
ATOM   2119 C  CA     . ASN A 1 288 ? 14.585 -5.945  4.507  1.00 25.62  ? 325 ASN A CA     1 
ATOM   2120 C  C      . ASN A 1 288 ? 14.684 -4.988  3.332  1.00 27.32  ? 325 ASN A C      1 
ATOM   2121 O  O      . ASN A 1 288 ? 14.851 -3.798  3.540  1.00 26.67  ? 325 ASN A O      1 
ATOM   2122 C  CB     . ASN A 1 288 ? 15.965 -6.486  4.938  1.00 24.12  ? 325 ASN A CB     1 
ATOM   2123 C  CG     . ASN A 1 288 ? 15.978 -7.000  6.361  1.00 40.43  ? 325 ASN A CG     1 
ATOM   2124 O  OD1    . ASN A 1 288 ? 15.131 -6.638  7.188  1.00 31.42  ? 325 ASN A OD1    1 
ATOM   2125 N  ND2    . ASN A 1 288 ? 16.926 -7.880  6.677  1.00 32.22  ? 325 ASN A ND2    1 
ATOM   2126 N  N      . LYS A 1 289 ? 14.545 -5.503  2.107  1.00 25.40  ? 326 LYS A N      1 
ATOM   2127 C  CA     . LYS A 1 289 ? 14.561 -4.708  0.883  1.00 24.64  ? 326 LYS A CA     1 
ATOM   2128 C  C      . LYS A 1 289 ? 13.378 -3.738  0.893  1.00 25.57  ? 326 LYS A C      1 
ATOM   2129 O  O      . LYS A 1 289 ? 13.565 -2.570  0.602  1.00 23.32  ? 326 LYS A O      1 
ATOM   2130 C  CB     . LYS A 1 289 ? 14.528 -5.616  -0.359 1.00 28.84  ? 326 LYS A CB     1 
ATOM   2131 C  CG     . LYS A 1 289 ? 15.866 -6.291  -0.665 1.00 31.17  ? 326 LYS A CG     1 
ATOM   2132 C  CD     . LYS A 1 289 ? 15.804 -7.113  -1.943 1.00 33.70  ? 326 LYS A CD     1 
ATOM   2133 C  CE     . LYS A 1 289 ? 17.164 -7.645  -2.318 1.00 34.70  ? 326 LYS A CE     1 
ATOM   2134 N  NZ     . LYS A 1 289 ? 17.078 -8.715  -3.336 1.00 40.72  ? 326 LYS A NZ     1 
ATOM   2135 N  N      . LEU A 1 290 ? 12.175 -4.221  1.272  1.00 23.88  ? 327 LEU A N      1 
ATOM   2136 C  CA     . LEU A 1 290 ? 10.958 -3.410  1.335  1.00 23.00  ? 327 LEU A CA     1 
ATOM   2137 C  C      . LEU A 1 290 ? 11.067 -2.388  2.430  1.00 25.26  ? 327 LEU A C      1 
ATOM   2138 O  O      . LEU A 1 290 ? 10.782 -1.220  2.192  1.00 24.86  ? 327 LEU A O      1 
ATOM   2139 C  CB     . LEU A 1 290 ? 9.697  -4.283  1.508  1.00 24.57  ? 327 LEU A CB     1 
ATOM   2140 C  CG     . LEU A 1 290 ? 8.326  -3.582  1.528  1.00 27.91  ? 327 LEU A CG     1 
ATOM   2141 C  CD1    . LEU A 1 290 ? 8.097  -2.742  0.263  1.00 26.16  ? 327 LEU A CD1    1 
ATOM   2142 C  CD2    . LEU A 1 290 ? 7.218  -4.601  1.671  1.00 31.73  ? 327 LEU A CD2    1 
ATOM   2143 N  N      . LYS A 1 291 ? 11.516 -2.812  3.622  1.00 22.45  ? 328 LYS A N      1 
ATOM   2144 C  CA     . LYS A 1 291 ? 11.730 -1.920  4.755  1.00 20.14  ? 328 LYS A CA     1 
ATOM   2145 C  C      . LYS A 1 291 ? 12.780 -0.847  4.438  1.00 23.60  ? 328 LYS A C      1 
ATOM   2146 O  O      . LYS A 1 291 ? 12.591 0.296   4.836  1.00 24.65  ? 328 LYS A O      1 
ATOM   2147 C  CB     . LYS A 1 291 ? 12.103 -2.725  6.004  1.00 21.87  ? 328 LYS A CB     1 
ATOM   2148 C  CG     . LYS A 1 291 ? 10.966 -3.600  6.543  1.00 26.89  ? 328 LYS A CG     1 
ATOM   2149 C  CD     . LYS A 1 291 ? 10.018 -2.800  7.405  1.00 40.35  ? 328 LYS A CD     1 
ATOM   2150 C  CE     . LYS A 1 291 ? 8.572  -3.125  7.134  1.00 51.75  ? 328 LYS A CE     1 
ATOM   2151 N  NZ     . LYS A 1 291 ? 7.676  -2.003  7.545  1.00 53.09  ? 328 LYS A NZ     1 
ATOM   2152 N  N      . ALA A 1 292 ? 13.863 -1.190  3.699  1.00 19.49  ? 329 ALA A N      1 
ATOM   2153 C  CA     . ALA A 1 292 ? 14.887 -0.203  3.304  1.00 18.40  ? 329 ALA A CA     1 
ATOM   2154 C  C      . ALA A 1 292 ? 14.242 0.883   2.425  1.00 22.12  ? 329 ALA A C      1 
ATOM   2155 O  O      . ALA A 1 292 ? 14.495 2.064   2.634  1.00 20.11  ? 329 ALA A O      1 
ATOM   2156 C  CB     . ALA A 1 292 ? 16.013 -0.883  2.537  1.00 20.00  ? 329 ALA A CB     1 
ATOM   2157 N  N      . SER A 1 293 ? 13.395 0.461   1.452  1.00 18.60  ? 330 SER A N      1 
ATOM   2158 C  CA     . SER A 1 293 ? 12.628 1.336   0.550  1.00 18.02  ? 330 SER A CA     1 
ATOM   2159 C  C      . SER A 1 293 ? 11.694 2.263   1.378  1.00 19.47  ? 330 SER A C      1 
ATOM   2160 O  O      . SER A 1 293 ? 11.610 3.460   1.114  1.00 18.94  ? 330 SER A O      1 
ATOM   2161 C  CB     . SER A 1 293 ? 11.810 0.474   -0.421 1.00 21.07  ? 330 SER A CB     1 
ATOM   2162 O  OG     . SER A 1 293 ? 10.767 1.229   -1.010 1.00 33.55  ? 330 SER A OG     1 
ATOM   2163 N  N      . GLN A 1 294 ? 11.012 1.711   2.391  1.00 17.20  ? 331 GLN A N      1 
ATOM   2164 C  CA     . GLN A 1 294 ? 10.120 2.514   3.236  1.00 16.60  ? 331 GLN A CA     1 
ATOM   2165 C  C      . GLN A 1 294 ? 10.881 3.494   4.135  1.00 19.76  ? 331 GLN A C      1 
ATOM   2166 O  O      . GLN A 1 294 ? 10.411 4.622   4.307  1.00 18.52  ? 331 GLN A O      1 
ATOM   2167 C  CB     . GLN A 1 294 ? 9.186  1.639   4.065  1.00 18.12  ? 331 GLN A CB     1 
ATOM   2168 C  CG     . GLN A 1 294 ? 8.206  0.819   3.231  1.00 16.15  ? 331 GLN A CG     1 
ATOM   2169 C  CD     . GLN A 1 294 ? 7.458  -0.152  4.103  1.00 29.53  ? 331 GLN A CD     1 
ATOM   2170 O  OE1    . GLN A 1 294 ? 7.882  -0.478  5.203  1.00 28.07  ? 331 GLN A OE1    1 
ATOM   2171 N  NE2    . GLN A 1 294 ? 6.347  -0.669  3.615  1.00 22.78  ? 331 GLN A NE2    1 
ATOM   2172 N  N      . ALA A 1 295 ? 12.053 3.082   4.690  1.00 16.15  ? 332 ALA A N      1 
ATOM   2173 C  CA     . ALA A 1 295 ? 12.888 3.955   5.543  1.00 14.76  ? 332 ALA A CA     1 
ATOM   2174 C  C      . ALA A 1 295 ? 13.385 5.148   4.735  1.00 19.79  ? 332 ALA A C      1 
ATOM   2175 O  O      . ALA A 1 295 ? 13.353 6.269   5.229  1.00 18.68  ? 332 ALA A O      1 
ATOM   2176 C  CB     . ALA A 1 295 ? 14.085 3.187   6.069  1.00 15.16  ? 332 ALA A CB     1 
ATOM   2177 N  N      . ARG A 1 296 ? 13.826 4.908   3.480  1.00 16.75  ? 333 ARG A N      1 
ATOM   2178 C  CA     . ARG A 1 296 ? 14.319 5.982   2.646  1.00 17.50  ? 333 ARG A CA     1 
ATOM   2179 C  C      . ARG A 1 296 ? 13.199 6.959   2.281  1.00 19.75  ? 333 ARG A C      1 
ATOM   2180 O  O      . ARG A 1 296 ? 13.415 8.168   2.362  1.00 16.62  ? 333 ARG A O      1 
ATOM   2181 C  CB     . ARG A 1 296 ? 15.089 5.451   1.429  1.00 22.18  ? 333 ARG A CB     1 
ATOM   2182 C  CG     . ARG A 1 296 ? 15.873 6.555   0.713  1.00 35.27  ? 333 ARG A CG     1 
ATOM   2183 C  CD     . ARG A 1 296 ? 16.265 6.135   -0.692 1.00 52.76  ? 333 ARG A CD     1 
ATOM   2184 N  NE     . ARG A 1 296 ? 17.433 5.254   -0.679 1.00 59.05  ? 333 ARG A NE     1 
ATOM   2185 C  CZ     . ARG A 1 296 ? 17.402 3.951   -0.932 1.00 72.23  ? 333 ARG A CZ     1 
ATOM   2186 N  NH1    . ARG A 1 296 ? 16.258 3.355   -1.249 1.00 61.59  ? 333 ARG A NH1    1 
ATOM   2187 N  NH2    . ARG A 1 296 ? 18.516 3.236   -0.885 1.00 57.40  ? 333 ARG A NH2    1 
ATOM   2188 N  N      . ASP A 1 297 ? 11.989 6.438   1.983  1.00 17.87  ? 334 ASP A N      1 
ATOM   2189 C  CA     . ASP A 1 297 ? 10.805 7.265   1.694  1.00 17.62  ? 334 ASP A CA     1 
ATOM   2190 C  C      . ASP A 1 297 ? 10.456 8.173   2.898  1.00 19.64  ? 334 ASP A C      1 
ATOM   2191 O  O      . ASP A 1 297 ? 10.086 9.332   2.699  1.00 18.29  ? 334 ASP A O      1 
ATOM   2192 C  CB     . ASP A 1 297 ? 9.589  6.391   1.326  1.00 19.70  ? 334 ASP A CB     1 
ATOM   2193 C  CG     . ASP A 1 297 ? 8.356  7.207   0.975  1.00 26.99  ? 334 ASP A CG     1 
ATOM   2194 O  OD1    . ASP A 1 297 ? 8.361  7.872   -0.085 1.00 31.94  ? 334 ASP A OD1    1 
ATOM   2195 O  OD2    . ASP A 1 297 ? 7.420  7.233   1.783  1.00 22.59  ? 334 ASP A OD2    1 
ATOM   2196 N  N      . LEU A 1 298 ? 10.549 7.638   4.133  1.00 16.03  ? 335 LEU A N      1 
ATOM   2197 C  CA     . LEU A 1 298 ? 10.276 8.438   5.330  1.00 15.21  ? 335 LEU A CA     1 
ATOM   2198 C  C      . LEU A 1 298 ? 11.355 9.509   5.519  1.00 19.83  ? 335 LEU A C      1 
ATOM   2199 O  O      . LEU A 1 298 ? 11.004 10.656  5.781  1.00 20.80  ? 335 LEU A O      1 
ATOM   2200 C  CB     . LEU A 1 298 ? 10.126 7.564   6.580  1.00 14.56  ? 335 LEU A CB     1 
ATOM   2201 C  CG     . LEU A 1 298 ? 9.835  8.314   7.900  1.00 16.85  ? 335 LEU A CG     1 
ATOM   2202 C  CD1    . LEU A 1 298 ? 8.540  9.122   7.823  1.00 16.37  ? 335 LEU A CD1    1 
ATOM   2203 C  CD2    . LEU A 1 298 ? 9.827  7.335   9.084  1.00 15.71  ? 335 LEU A CD2    1 
ATOM   2204 N  N      . LEU A 1 299 ? 12.651 9.158   5.328  1.00 17.29  ? 336 LEU A N      1 
ATOM   2205 C  CA     . LEU A 1 299 ? 13.766 10.115  5.414  1.00 16.87  ? 336 LEU A CA     1 
ATOM   2206 C  C      . LEU A 1 299 ? 13.556 11.254  4.451  1.00 18.88  ? 336 LEU A C      1 
ATOM   2207 O  O      . LEU A 1 299 ? 13.726 12.399  4.848  1.00 19.42  ? 336 LEU A O      1 
ATOM   2208 C  CB     . LEU A 1 299 ? 15.106 9.461   5.076  1.00 17.38  ? 336 LEU A CB     1 
ATOM   2209 C  CG     . LEU A 1 299 ? 15.914 8.922   6.222  1.00 22.39  ? 336 LEU A CG     1 
ATOM   2210 C  CD1    . LEU A 1 299 ? 17.097 8.077   5.690  1.00 24.04  ? 336 LEU A CD1    1 
ATOM   2211 C  CD2    . LEU A 1 299 ? 16.373 10.051  7.165  1.00 20.02  ? 336 LEU A CD2    1 
ATOM   2212 N  N      . SER A 1 300 ? 13.129 10.946  3.200  1.00 15.36  ? 337 SER A N      1 
ATOM   2213 C  CA     . SER A 1 300 ? 12.859 11.941  2.154  1.00 14.99  ? 337 SER A CA     1 
ATOM   2214 C  C      . SER A 1 300 ? 11.751 12.932  2.522  1.00 19.01  ? 337 SER A C      1 
ATOM   2215 O  O      . SER A 1 300 ? 11.718 14.032  1.974  1.00 18.73  ? 337 SER A O      1 
ATOM   2216 C  CB     . SER A 1 300 ? 12.577 11.265  0.810  1.00 16.69  ? 337 SER A CB     1 
ATOM   2217 O  OG     . SER A 1 300 ? 11.259 10.764  0.708  1.00 18.41  ? 337 SER A OG     1 
ATOM   2218 N  N      . LYS A 1 301 ? 10.843 12.541  3.437  1.00 15.62  ? 338 LYS A N      1 
ATOM   2219 C  CA     . LYS A 1 301 ? 9.699  13.371  3.835  1.00 15.67  ? 338 LYS A CA     1 
ATOM   2220 C  C      . LYS A 1 301 ? 9.962  14.179  5.077  1.00 18.28  ? 338 LYS A C      1 
ATOM   2221 O  O      . LYS A 1 301 ? 9.324  15.214  5.285  1.00 19.12  ? 338 LYS A O      1 
ATOM   2222 C  CB     . LYS A 1 301 ? 8.440  12.506  3.989  1.00 19.55  ? 338 LYS A CB     1 
ATOM   2223 C  CG     . LYS A 1 301 ? 7.908  11.984  2.645  1.00 21.20  ? 338 LYS A CG     1 
ATOM   2224 C  CD     . LYS A 1 301 ? 6.834  10.925  2.854  1.00 23.27  ? 338 LYS A CD     1 
ATOM   2225 C  CE     . LYS A 1 301 ? 6.364  10.261  1.569  1.00 28.07  ? 338 LYS A CE     1 
ATOM   2226 N  NZ     . LYS A 1 301 ? 5.939  11.242  0.539  1.00 39.09  ? 338 LYS A NZ     1 
ATOM   2227 N  N      . MET A 1 302 ? 10.917 13.740  5.893  1.00 13.24  ? 339 MET A N      1 
ATOM   2228 C  CA     . MET A 1 302 ? 11.274 14.456  7.123  1.00 12.14  ? 339 MET A CA     1 
ATOM   2229 C  C      . MET A 1 302 ? 12.361 15.477  6.862  1.00 15.93  ? 339 MET A C      1 
ATOM   2230 O  O      . MET A 1 302 ? 12.332 16.561  7.437  1.00 14.55  ? 339 MET A O      1 
ATOM   2231 C  CB     . MET A 1 302 ? 11.725 13.477  8.222  1.00 13.03  ? 339 MET A CB     1 
ATOM   2232 C  CG     . MET A 1 302 ? 10.631 12.439  8.606  1.00 17.04  ? 339 MET A CG     1 
ATOM   2233 S  SD     . MET A 1 302 ? 10.901 11.580  10.192 1.00 18.88  ? 339 MET A SD     1 
ATOM   2234 C  CE     . MET A 1 302 ? 12.298 10.680  9.806  1.00 15.78  ? 339 MET A CE     1 
ATOM   2235 N  N      . LEU A 1 303 ? 13.351 15.108  6.023  1.00 13.94  ? 340 LEU A N      1 
ATOM   2236 C  CA     . LEU A 1 303 ? 14.495 15.944  5.698  1.00 14.26  ? 340 LEU A CA     1 
ATOM   2237 C  C      . LEU A 1 303 ? 14.148 16.893  4.557  1.00 18.77  ? 340 LEU A C      1 
ATOM   2238 O  O      . LEU A 1 303 ? 14.752 16.852  3.479  1.00 18.74  ? 340 LEU A O      1 
ATOM   2239 C  CB     . LEU A 1 303 ? 15.717 15.063  5.374  1.00 14.47  ? 340 LEU A CB     1 
ATOM   2240 C  CG     . LEU A 1 303 ? 16.441 14.441  6.576  1.00 18.03  ? 340 LEU A CG     1 
ATOM   2241 C  CD1    . LEU A 1 303 ? 17.507 13.510  6.094  1.00 19.11  ? 340 LEU A CD1    1 
ATOM   2242 C  CD2    . LEU A 1 303 ? 17.043 15.529  7.509  1.00 17.33  ? 340 LEU A CD2    1 
ATOM   2243 N  N      . VAL A 1 304 ? 13.127 17.728  4.805  1.00 15.15  ? 341 VAL A N      1 
ATOM   2244 C  CA     . VAL A 1 304 ? 12.604 18.719  3.875  1.00 15.62  ? 341 VAL A CA     1 
ATOM   2245 C  C      . VAL A 1 304 ? 12.842 20.093  4.520  1.00 19.63  ? 341 VAL A C      1 
ATOM   2246 O  O      . VAL A 1 304 ? 12.303 20.362  5.589  1.00 18.60  ? 341 VAL A O      1 
ATOM   2247 C  CB     . VAL A 1 304 ? 11.105 18.446  3.573  1.00 20.16  ? 341 VAL A CB     1 
ATOM   2248 C  CG1    . VAL A 1 304 ? 10.506 19.542  2.681  1.00 20.96  ? 341 VAL A CG1    1 
ATOM   2249 C  CG2    . VAL A 1 304 ? 10.918 17.060  2.923  1.00 20.28  ? 341 VAL A CG2    1 
ATOM   2250 N  N      . ILE A 1 305 ? 13.625 20.962  3.855  1.00 18.30  ? 342 ILE A N      1 
ATOM   2251 C  CA     . ILE A 1 305 ? 13.960 22.304  4.349  1.00 18.58  ? 342 ILE A CA     1 
ATOM   2252 C  C      . ILE A 1 305 ? 12.710 23.139  4.646  1.00 22.97  ? 342 ILE A C      1 
ATOM   2253 O  O      . ILE A 1 305 ? 12.602 23.676  5.743  1.00 21.41  ? 342 ILE A O      1 
ATOM   2254 C  CB     . ILE A 1 305 ? 14.962 23.042  3.420  1.00 22.25  ? 342 ILE A CB     1 
ATOM   2255 C  CG1    . ILE A 1 305 ? 16.305 22.252  3.332  1.00 21.78  ? 342 ILE A CG1    1 
ATOM   2256 C  CG2    . ILE A 1 305 ? 15.182 24.495  3.890  1.00 22.12  ? 342 ILE A CG2    1 
ATOM   2257 C  CD1    . ILE A 1 305 ? 17.217 22.638  2.166  1.00 22.57  ? 342 ILE A CD1    1 
ATOM   2258 N  N      . ASP A 1 306 ? 11.772 23.214  3.693  1.00 21.11  ? 343 ASP A N      1 
ATOM   2259 C  CA     . ASP A 1 306 ? 10.543 23.993  3.839  1.00 21.76  ? 343 ASP A CA     1 
ATOM   2260 C  C      . ASP A 1 306 ? 9.539  23.296  4.786  1.00 25.63  ? 343 ASP A C      1 
ATOM   2261 O  O      . ASP A 1 306 ? 9.026  22.236  4.422  1.00 26.28  ? 343 ASP A O      1 
ATOM   2262 C  CB     . ASP A 1 306 ? 9.915  24.268  2.444  1.00 24.17  ? 343 ASP A CB     1 
ATOM   2263 C  CG     . ASP A 1 306 ? 8.788  25.298  2.425  1.00 32.87  ? 343 ASP A CG     1 
ATOM   2264 O  OD1    . ASP A 1 306 ? 8.419  25.795  3.501  1.00 34.01  ? 343 ASP A OD1    1 
ATOM   2265 O  OD2    . ASP A 1 306 ? 8.285  25.608  1.325  1.00 40.91  ? 343 ASP A OD2    1 
ATOM   2266 N  N      . PRO A 1 307 ? 9.218  23.875  5.980  1.00 21.66  ? 344 PRO A N      1 
ATOM   2267 C  CA     . PRO A 1 307 ? 8.251  23.203  6.887  1.00 20.35  ? 344 PRO A CA     1 
ATOM   2268 C  C      . PRO A 1 307 ? 6.840  23.069  6.313  1.00 26.03  ? 344 PRO A C      1 
ATOM   2269 O  O      . PRO A 1 307 ? 6.083  22.208  6.763  1.00 25.39  ? 344 PRO A O      1 
ATOM   2270 C  CB     . PRO A 1 307 ? 8.267  24.057  8.161  1.00 21.31  ? 344 PRO A CB     1 
ATOM   2271 C  CG     . PRO A 1 307 ? 8.935  25.332  7.790  1.00 26.23  ? 344 PRO A CG     1 
ATOM   2272 C  CD     . PRO A 1 307 ? 9.766  25.116  6.578  1.00 22.35  ? 344 PRO A CD     1 
ATOM   2273 N  N      . ALA A 1 308 ? 6.486  23.908  5.316  1.00 23.85  ? 345 ALA A N      1 
ATOM   2274 C  CA     . ALA A 1 308 ? 5.181  23.852  4.645  1.00 25.95  ? 345 ALA A CA     1 
ATOM   2275 C  C      . ALA A 1 308 ? 5.041  22.558  3.843  1.00 30.85  ? 345 ALA A C      1 
ATOM   2276 O  O      . ALA A 1 308 ? 3.915  22.134  3.585  1.00 34.00  ? 345 ALA A O      1 
ATOM   2277 C  CB     . ALA A 1 308 ? 5.006  25.058  3.710  1.00 28.07  ? 345 ALA A CB     1 
ATOM   2278 N  N      . LYS A 1 309 ? 6.184  21.950  3.426  1.00 24.98  ? 346 LYS A N      1 
ATOM   2279 C  CA     . LYS A 1 309 ? 6.247  20.732  2.608  1.00 24.22  ? 346 LYS A CA     1 
ATOM   2280 C  C      . LYS A 1 309 ? 6.788  19.512  3.367  1.00 24.35  ? 346 LYS A C      1 
ATOM   2281 O  O      . LYS A 1 309 ? 6.915  18.432  2.786  1.00 21.75  ? 346 LYS A O      1 
ATOM   2282 C  CB     . LYS A 1 309 ? 7.119  20.974  1.370  1.00 28.16  ? 346 LYS A CB     1 
ATOM   2283 C  CG     . LYS A 1 309 ? 6.514  21.931  0.364  1.00 40.03  ? 346 LYS A CG     1 
ATOM   2284 C  CD     . LYS A 1 309 ? 7.326  21.950  -0.920 1.00 49.25  ? 346 LYS A CD     1 
ATOM   2285 C  CE     . LYS A 1 309 ? 8.304  23.102  -0.969 1.00 60.18  ? 346 LYS A CE     1 
ATOM   2286 N  NZ     . LYS A 1 309 ? 7.615  24.410  -1.136 1.00 56.82  ? 346 LYS A NZ     1 
ATOM   2287 N  N      . ARG A 1 310 ? 7.121  19.691  4.652  1.00 19.96  ? 347 ARG A N      1 
ATOM   2288 C  CA     . ARG A 1 310 ? 7.660  18.638  5.528  1.00 17.98  ? 347 ARG A CA     1 
ATOM   2289 C  C      . ARG A 1 310 ? 6.510  17.896  6.195  1.00 21.84  ? 347 ARG A C      1 
ATOM   2290 O  O      . ARG A 1 310 ? 5.573  18.523  6.688  1.00 23.27  ? 347 ARG A O      1 
ATOM   2291 C  CB     . ARG A 1 310 ? 8.547  19.281  6.626  1.00 16.01  ? 347 ARG A CB     1 
ATOM   2292 C  CG     . ARG A 1 310 ? 9.420  18.284  7.411  1.00 14.36  ? 347 ARG A CG     1 
ATOM   2293 C  CD     . ARG A 1 310 ? 10.106 18.998  8.563  1.00 19.59  ? 347 ARG A CD     1 
ATOM   2294 N  NE     . ARG A 1 310 ? 10.945 20.088  8.067  1.00 14.32  ? 347 ARG A NE     1 
ATOM   2295 C  CZ     . ARG A 1 310 ? 11.211 21.200  8.735  1.00 24.41  ? 347 ARG A CZ     1 
ATOM   2296 N  NH1    . ARG A 1 310 ? 10.727 21.380  9.955  1.00 15.67  ? 347 ARG A NH1    1 
ATOM   2297 N  NH2    . ARG A 1 310 ? 11.966 22.142  8.190  1.00 15.09  ? 347 ARG A NH2    1 
ATOM   2298 N  N      . ILE A 1 311 ? 6.623  16.578  6.281  1.00 16.78  ? 348 ILE A N      1 
ATOM   2299 C  CA     . ILE A 1 311 ? 5.629  15.728  6.921  1.00 17.33  ? 348 ILE A CA     1 
ATOM   2300 C  C      . ILE A 1 311 ? 5.393  16.121  8.405  1.00 20.56  ? 348 ILE A C      1 
ATOM   2301 O  O      . ILE A 1 311 ? 6.322  16.573  9.087  1.00 18.54  ? 348 ILE A O      1 
ATOM   2302 C  CB     . ILE A 1 311 ? 6.039  14.243  6.743  1.00 20.25  ? 348 ILE A CB     1 
ATOM   2303 C  CG1    . ILE A 1 311 ? 4.821  13.310  6.905  1.00 22.99  ? 348 ILE A CG1    1 
ATOM   2304 C  CG2    . ILE A 1 311 ? 7.228  13.855  7.656  1.00 18.36  ? 348 ILE A CG2    1 
ATOM   2305 C  CD1    . ILE A 1 311 ? 5.034  11.787  6.652  1.00 31.65  ? 348 ILE A CD1    1 
ATOM   2306 N  N      . SER A 1 312 ? 4.154  15.945  8.888  1.00 16.90  ? 349 SER A N      1 
ATOM   2307 C  CA     . SER A 1 312 ? 3.793  16.254  10.266 1.00 16.87  ? 349 SER A CA     1 
ATOM   2308 C  C      . SER A 1 312 ? 4.131  15.063  11.162 1.00 21.59  ? 349 SER A C      1 
ATOM   2309 O  O      . SER A 1 312 ? 4.483  13.988  10.652 1.00 20.72  ? 349 SER A O      1 
ATOM   2310 C  CB     . SER A 1 312 ? 2.301  16.554  10.350 1.00 20.32  ? 349 SER A CB     1 
ATOM   2311 O  OG     . SER A 1 312 ? 1.551  15.418  9.952  1.00 26.37  ? 349 SER A OG     1 
ATOM   2312 N  N      . VAL A 1 313 ? 4.006  15.243  12.493 1.00 18.03  ? 350 VAL A N      1 
ATOM   2313 C  CA     . VAL A 1 313 ? 4.205  14.157  13.477 1.00 16.65  ? 350 VAL A CA     1 
ATOM   2314 C  C      . VAL A 1 313 ? 3.126  13.079  13.241 1.00 19.74  ? 350 VAL A C      1 
ATOM   2315 O  O      . VAL A 1 313 ? 3.467  11.896  13.156 1.00 18.53  ? 350 VAL A O      1 
ATOM   2316 C  CB     . VAL A 1 313 ? 4.265  14.674  14.951 1.00 20.08  ? 350 VAL A CB     1 
ATOM   2317 C  CG1    . VAL A 1 313 ? 4.142  13.529  15.972 1.00 19.96  ? 350 VAL A CG1    1 
ATOM   2318 C  CG2    . VAL A 1 313 ? 5.546  15.459  15.196 1.00 18.29  ? 350 VAL A CG2    1 
ATOM   2319 N  N      . ASP A 1 314 ? 1.849  13.507  13.052 1.00 17.05  ? 351 ASP A N      1 
ATOM   2320 C  CA     . ASP A 1 314 ? 0.701  12.615  12.785 1.00 19.03  ? 351 ASP A CA     1 
ATOM   2321 C  C      . ASP A 1 314 ? 0.835  11.781  11.520 1.00 20.46  ? 351 ASP A C      1 
ATOM   2322 O  O      . ASP A 1 314 ? 0.501  10.599  11.530 1.00 19.23  ? 351 ASP A O      1 
ATOM   2323 C  CB     . ASP A 1 314 ? -0.632 13.391  12.753 1.00 22.48  ? 351 ASP A CB     1 
ATOM   2324 C  CG     . ASP A 1 314 ? -1.087 13.872  14.115 1.00 32.43  ? 351 ASP A CG     1 
ATOM   2325 O  OD1    . ASP A 1 314 ? -0.572 13.357  15.129 1.00 31.77  ? 351 ASP A OD1    1 
ATOM   2326 O  OD2    . ASP A 1 314 ? -1.969 14.752  14.166 1.00 40.41  ? 351 ASP A OD2    1 
ATOM   2327 N  N      . ASP A 1 315 ? 1.323  12.388  10.438 1.00 17.80  ? 352 ASP A N      1 
ATOM   2328 C  CA     . ASP A 1 315 ? 1.506  11.666  9.182  1.00 18.16  ? 352 ASP A CA     1 
ATOM   2329 C  C      . ASP A 1 315 ? 2.698  10.719  9.264  1.00 19.97  ? 352 ASP A C      1 
ATOM   2330 O  O      . ASP A 1 315 ? 2.601  9.587   8.783  1.00 19.34  ? 352 ASP A O      1 
ATOM   2331 C  CB     . ASP A 1 315 ? 1.546  12.626  7.995  1.00 20.56  ? 352 ASP A CB     1 
ATOM   2332 C  CG     . ASP A 1 315 ? 0.209  13.332  7.758  1.00 30.59  ? 352 ASP A CG     1 
ATOM   2333 O  OD1    . ASP A 1 315 ? -0.846 12.788  8.185  1.00 30.74  ? 352 ASP A OD1    1 
ATOM   2334 O  OD2    . ASP A 1 315 ? 0.212  14.400  7.126  1.00 34.64  ? 352 ASP A OD2    1 
ATOM   2335 N  N      . ALA A 1 316 ? 3.762  11.118  9.982  1.00 15.54  ? 353 ALA A N      1 
ATOM   2336 C  CA     . ALA A 1 316 ? 4.924  10.235  10.223 1.00 15.34  ? 353 ALA A CA     1 
ATOM   2337 C  C      . ALA A 1 316 ? 4.502  8.955   10.977 1.00 20.45  ? 353 ALA A C      1 
ATOM   2338 O  O      . ALA A 1 316 ? 4.999  7.878   10.678 1.00 19.98  ? 353 ALA A O      1 
ATOM   2339 C  CB     . ALA A 1 316 ? 5.996  10.971  11.015 1.00 14.23  ? 353 ALA A CB     1 
ATOM   2340 N  N      . LEU A 1 317 ? 3.568  9.079   11.940 1.00 17.69  ? 354 LEU A N      1 
ATOM   2341 C  CA     . LEU A 1 317 ? 3.053  7.963   12.727 1.00 17.85  ? 354 LEU A CA     1 
ATOM   2342 C  C      . LEU A 1 317 ? 2.194  7.016   11.912 1.00 24.67  ? 354 LEU A C      1 
ATOM   2343 O  O      . LEU A 1 317 ? 2.043  5.862   12.301 1.00 26.01  ? 354 LEU A O      1 
ATOM   2344 C  CB     . LEU A 1 317 ? 2.275  8.484   13.953 1.00 18.26  ? 354 LEU A CB     1 
ATOM   2345 C  CG     . LEU A 1 317 ? 3.134  8.983   15.120 1.00 19.57  ? 354 LEU A CG     1 
ATOM   2346 C  CD1    . LEU A 1 317 ? 2.327  9.906   16.022 1.00 19.97  ? 354 LEU A CD1    1 
ATOM   2347 C  CD2    . LEU A 1 317 ? 3.756  7.803   15.909 1.00 19.35  ? 354 LEU A CD2    1 
ATOM   2348 N  N      . GLN A 1 318 ? 1.628  7.502   10.783 1.00 22.50  ? 355 GLN A N      1 
ATOM   2349 C  CA     . GLN A 1 318 ? 0.775  6.748   9.852  1.00 23.71  ? 355 GLN A CA     1 
ATOM   2350 C  C      . GLN A 1 318 ? 1.612  6.193   8.702  1.00 26.30  ? 355 GLN A C      1 
ATOM   2351 O  O      . GLN A 1 318 ? 1.089  5.448   7.885  1.00 26.36  ? 355 GLN A O      1 
ATOM   2352 C  CB     . GLN A 1 318 ? -0.339 7.649   9.278  1.00 27.04  ? 355 GLN A CB     1 
ATOM   2353 C  CG     . GLN A 1 318 ? -1.401 8.076   10.280 1.00 46.22  ? 355 GLN A CG     1 
ATOM   2354 C  CD     . GLN A 1 318 ? -2.403 6.988   10.522 1.00 71.79  ? 355 GLN A CD     1 
ATOM   2355 O  OE1    . GLN A 1 318 ? -2.184 6.078   11.323 1.00 71.08  ? 355 GLN A OE1    1 
ATOM   2356 N  NE2    . GLN A 1 318 ? -3.530 7.066   9.841  1.00 67.44  ? 355 GLN A NE2    1 
ATOM   2357 N  N      . HIS A 1 319 ? 2.907  6.580   8.616  1.00 20.85  ? 356 HIS A N      1 
ATOM   2358 C  CA     . HIS A 1 319 ? 3.786  6.106   7.552  1.00 18.70  ? 356 HIS A CA     1 
ATOM   2359 C  C      . HIS A 1 319 ? 4.005  4.578   7.702  1.00 23.83  ? 356 HIS A C      1 
ATOM   2360 O  O      . HIS A 1 319 ? 4.204  4.127   8.830  1.00 22.96  ? 356 HIS A O      1 
ATOM   2361 C  CB     . HIS A 1 319 ? 5.129  6.865   7.560  1.00 16.08  ? 356 HIS A CB     1 
ATOM   2362 C  CG     . HIS A 1 319 ? 5.984  6.547   6.367  1.00 18.39  ? 356 HIS A CG     1 
ATOM   2363 N  ND1    . HIS A 1 319 ? 6.726  5.375   6.301  1.00 19.10  ? 356 HIS A ND1    1 
ATOM   2364 C  CD2    . HIS A 1 319 ? 6.115  7.209   5.196  1.00 19.09  ? 356 HIS A CD2    1 
ATOM   2365 C  CE1    . HIS A 1 319 ? 7.318  5.391   5.121  1.00 17.97  ? 356 HIS A CE1    1 
ATOM   2366 N  NE2    . HIS A 1 319 ? 6.960  6.456   4.412  1.00 18.54  ? 356 HIS A NE2    1 
ATOM   2367 N  N      . PRO A 1 320 ? 4.011  3.786   6.599  1.00 21.96  ? 357 PRO A N      1 
ATOM   2368 C  CA     . PRO A 1 320 ? 4.203  2.324   6.722  1.00 22.71  ? 357 PRO A CA     1 
ATOM   2369 C  C      . PRO A 1 320 ? 5.415  1.858   7.525  1.00 26.46  ? 357 PRO A C      1 
ATOM   2370 O  O      . PRO A 1 320 ? 5.311  0.852   8.212  1.00 27.68  ? 357 PRO A O      1 
ATOM   2371 C  CB     . PRO A 1 320 ? 4.301  1.859   5.268  1.00 24.54  ? 357 PRO A CB     1 
ATOM   2372 C  CG     . PRO A 1 320 ? 3.533  2.848   4.518  1.00 29.04  ? 357 PRO A CG     1 
ATOM   2373 C  CD     . PRO A 1 320 ? 3.791  4.160   5.185  1.00 24.00  ? 357 PRO A CD     1 
ATOM   2374 N  N      . TYR A 1 321 ? 6.549  2.567   7.442  1.00 21.62  ? 358 TYR A N      1 
ATOM   2375 C  CA     . TYR A 1 321 ? 7.753  2.203   8.199  1.00 20.47  ? 358 TYR A CA     1 
ATOM   2376 C  C      . TYR A 1 321 ? 7.529  2.214   9.720  1.00 23.20  ? 358 TYR A C      1 
ATOM   2377 O  O      . TYR A 1 321 ? 8.109  1.381   10.417 1.00 20.93  ? 358 TYR A O      1 
ATOM   2378 C  CB     . TYR A 1 321 ? 8.924  3.133   7.844  1.00 19.80  ? 358 TYR A CB     1 
ATOM   2379 C  CG     . TYR A 1 321 ? 10.274 2.604   8.290  1.00 20.62  ? 358 TYR A CG     1 
ATOM   2380 C  CD1    . TYR A 1 321 ? 10.805 1.433   7.742  1.00 22.87  ? 358 TYR A CD1    1 
ATOM   2381 C  CD2    . TYR A 1 321 ? 11.041 3.292   9.229  1.00 19.52  ? 358 TYR A CD2    1 
ATOM   2382 C  CE1    . TYR A 1 321 ? 12.049 0.948   8.144  1.00 22.39  ? 358 TYR A CE1    1 
ATOM   2383 C  CE2    . TYR A 1 321 ? 12.281 2.809   9.646  1.00 19.43  ? 358 TYR A CE2    1 
ATOM   2384 C  CZ     . TYR A 1 321 ? 12.785 1.643   9.094  1.00 22.22  ? 358 TYR A CZ     1 
ATOM   2385 O  OH     . TYR A 1 321 ? 14.023 1.192   9.478  1.00 15.47  ? 358 TYR A OH     1 
ATOM   2386 N  N      . ILE A 1 322 ? 6.675  3.145   10.210 1.00 20.25  ? 359 ILE A N      1 
ATOM   2387 C  CA     . ILE A 1 322 ? 6.356  3.416   11.623 1.00 19.66  ? 359 ILE A CA     1 
ATOM   2388 C  C      . ILE A 1 322 ? 5.064  2.733   12.114 1.00 25.22  ? 359 ILE A C      1 
ATOM   2389 O  O      . ILE A 1 322 ? 5.023  2.234   13.254 1.00 23.73  ? 359 ILE A O      1 
ATOM   2390 C  CB     . ILE A 1 322 ? 6.288  4.968   11.833 1.00 21.73  ? 359 ILE A CB     1 
ATOM   2391 C  CG1    . ILE A 1 322 ? 7.595  5.691   11.385 1.00 21.13  ? 359 ILE A CG1    1 
ATOM   2392 C  CG2    . ILE A 1 322 ? 5.886  5.392   13.269 1.00 20.10  ? 359 ILE A CG2    1 
ATOM   2393 C  CD1    . ILE A 1 322 ? 8.949  5.198   12.121 1.00 23.20  ? 359 ILE A CD1    1 
ATOM   2394 N  N      . ASN A 1 323 ? 4.006  2.776   11.263 1.00 22.26  ? 360 ASN A N      1 
ATOM   2395 C  CA     . ASN A 1 323 ? 2.633  2.312   11.483 1.00 24.73  ? 360 ASN A CA     1 
ATOM   2396 C  C      . ASN A 1 323 ? 2.473  0.932   12.116 1.00 29.66  ? 360 ASN A C      1 
ATOM   2397 O  O      . ASN A 1 323 ? 1.440  0.681   12.740 1.00 30.73  ? 360 ASN A O      1 
ATOM   2398 C  CB     . ASN A 1 323 ? 1.847  2.349   10.156 1.00 32.29  ? 360 ASN A CB     1 
ATOM   2399 C  CG     . ASN A 1 323 ? 0.399  2.740   10.284 1.00 66.04  ? 360 ASN A CG     1 
ATOM   2400 O  OD1    . ASN A 1 323 ? -0.067 3.230   11.322 1.00 64.43  ? 360 ASN A OD1    1 
ATOM   2401 N  ND2    . ASN A 1 323 ? -0.337 2.584   9.199  1.00 62.28  ? 360 ASN A ND2    1 
ATOM   2402 N  N      . VAL A 1 324 ? 3.458  0.030   11.934 1.00 26.82  ? 361 VAL A N      1 
ATOM   2403 C  CA     . VAL A 1 324 ? 3.421  -1.348  12.464 1.00 28.64  ? 361 VAL A CA     1 
ATOM   2404 C  C      . VAL A 1 324 ? 3.378  -1.388  13.997 1.00 31.09  ? 361 VAL A C      1 
ATOM   2405 O  O      . VAL A 1 324 ? 2.910  -2.368  14.569 1.00 30.99  ? 361 VAL A O      1 
ATOM   2406 C  CB     . VAL A 1 324 ? 4.546  -2.265  11.897 1.00 32.68  ? 361 VAL A CB     1 
ATOM   2407 C  CG1    . VAL A 1 324 ? 4.592  -2.204  10.370 1.00 32.42  ? 361 VAL A CG1    1 
ATOM   2408 C  CG2    . VAL A 1 324 ? 5.918  -1.943  12.506 1.00 30.47  ? 361 VAL A CG2    1 
ATOM   2409 N  N      . TRP A 1 325 ? 3.870  -0.326  14.650 1.00 27.16  ? 362 TRP A N      1 
ATOM   2410 C  CA     . TRP A 1 325 ? 3.927  -0.225  16.112 1.00 26.97  ? 362 TRP A CA     1 
ATOM   2411 C  C      . TRP A 1 325 ? 2.744  0.535   16.689 1.00 31.44  ? 362 TRP A C      1 
ATOM   2412 O  O      . TRP A 1 325 ? 2.545  0.486   17.900 1.00 31.39  ? 362 TRP A O      1 
ATOM   2413 C  CB     . TRP A 1 325 ? 5.245  0.459   16.541 1.00 23.56  ? 362 TRP A CB     1 
ATOM   2414 C  CG     . TRP A 1 325 ? 6.468  -0.215  16.013 1.00 23.76  ? 362 TRP A CG     1 
ATOM   2415 C  CD1    . TRP A 1 325 ? 7.311  0.252   15.051 1.00 25.27  ? 362 TRP A CD1    1 
ATOM   2416 C  CD2    . TRP A 1 325 ? 6.944  -1.516  16.368 1.00 25.25  ? 362 TRP A CD2    1 
ATOM   2417 N  NE1    . TRP A 1 325 ? 8.298  -0.666  14.801 1.00 24.94  ? 362 TRP A NE1    1 
ATOM   2418 C  CE2    . TRP A 1 325 ? 8.086  -1.773  15.580 1.00 28.19  ? 362 TRP A CE2    1 
ATOM   2419 C  CE3    . TRP A 1 325 ? 6.530  -2.490  17.301 1.00 28.79  ? 362 TRP A CE3    1 
ATOM   2420 C  CZ2    . TRP A 1 325 ? 8.790  -2.983  15.653 1.00 28.86  ? 362 TRP A CZ2    1 
ATOM   2421 C  CZ3    . TRP A 1 325 ? 7.226  -3.691  17.369 1.00 31.12  ? 362 TRP A CZ3    1 
ATOM   2422 C  CH2    . TRP A 1 325 ? 8.335  -3.932  16.545 1.00 30.79  ? 362 TRP A CH2    1 
ATOM   2423 N  N      . TYR A 1 326 ? 1.988  1.269   15.830 1.00 28.75  ? 363 TYR A N      1 
ATOM   2424 C  CA     . TYR A 1 326 ? 0.871  2.137   16.206 1.00 29.09  ? 363 TYR A CA     1 
ATOM   2425 C  C      . TYR A 1 326 ? -0.021 1.552   17.269 1.00 35.72  ? 363 TYR A C      1 
ATOM   2426 O  O      . TYR A 1 326 ? -0.647 0.524   17.048 1.00 37.06  ? 363 TYR A O      1 
ATOM   2427 C  CB     . TYR A 1 326 ? 0.032  2.605   14.996 1.00 30.26  ? 363 TYR A CB     1 
ATOM   2428 C  CG     . TYR A 1 326 ? -0.788 3.846   15.293 1.00 31.68  ? 363 TYR A CG     1 
ATOM   2429 C  CD1    . TYR A 1 326 ? -1.997 3.762   15.983 1.00 35.01  ? 363 TYR A CD1    1 
ATOM   2430 C  CD2    . TYR A 1 326 ? -0.332 5.111   14.928 1.00 31.04  ? 363 TYR A CD2    1 
ATOM   2431 C  CE1    . TYR A 1 326 ? -2.730 4.904   16.301 1.00 36.40  ? 363 TYR A CE1    1 
ATOM   2432 C  CE2    . TYR A 1 326 ? -1.061 6.261   15.233 1.00 32.03  ? 363 TYR A CE2    1 
ATOM   2433 C  CZ     . TYR A 1 326 ? -2.260 6.152   15.917 1.00 41.89  ? 363 TYR A CZ     1 
ATOM   2434 O  OH     . TYR A 1 326 ? -2.990 7.284   16.191 1.00 44.01  ? 363 TYR A OH     1 
ATOM   2435 N  N      . ASP A 1 327 ? -0.064 2.219   18.429 1.00 34.03  ? 364 ASP A N      1 
ATOM   2436 C  CA     . ASP A 1 327 ? -0.905 1.842   19.566 1.00 36.63  ? 364 ASP A CA     1 
ATOM   2437 C  C      . ASP A 1 327 ? -1.600 3.122   20.066 1.00 42.90  ? 364 ASP A C      1 
ATOM   2438 O  O      . ASP A 1 327 ? -0.914 4.070   20.482 1.00 40.96  ? 364 ASP A O      1 
ATOM   2439 C  CB     . ASP A 1 327 ? -0.070 1.159   20.666 1.00 37.82  ? 364 ASP A CB     1 
ATOM   2440 C  CG     . ASP A 1 327 ? -0.808 0.610   21.894 1.00 44.86  ? 364 ASP A CG     1 
ATOM   2441 O  OD1    . ASP A 1 327 ? -2.006 0.931   22.069 1.00 45.22  ? 364 ASP A OD1    1 
ATOM   2442 O  OD2    . ASP A 1 327 ? -0.166 -0.098  22.703 1.00 46.55  ? 364 ASP A OD2    1 
ATOM   2443 N  N      . PRO A 1 328 ? -2.956 3.176   19.988 1.00 42.68  ? 365 PRO A N      1 
ATOM   2444 C  CA     . PRO A 1 328 ? -3.685 4.385   20.420 1.00 42.96  ? 365 PRO A CA     1 
ATOM   2445 C  C      . PRO A 1 328 ? -3.416 4.835   21.855 1.00 45.09  ? 365 PRO A C      1 
ATOM   2446 O  O      . PRO A 1 328 ? -3.487 6.031   22.137 1.00 43.33  ? 365 PRO A O      1 
ATOM   2447 C  CB     . PRO A 1 328 ? -5.161 4.001   20.218 1.00 47.94  ? 365 PRO A CB     1 
ATOM   2448 C  CG     . PRO A 1 328 ? -5.130 2.946   19.184 1.00 53.03  ? 365 PRO A CG     1 
ATOM   2449 C  CD     . PRO A 1 328 ? -3.894 2.152   19.485 1.00 47.07  ? 365 PRO A CD     1 
ATOM   2450 N  N      . ALA A 1 329 ? -3.095 3.891   22.751 1.00 41.95  ? 366 ALA A N      1 
ATOM   2451 C  CA     . ALA A 1 329 ? -2.795 4.192   24.152 1.00 41.53  ? 366 ALA A CA     1 
ATOM   2452 C  C      . ALA A 1 329 ? -1.486 4.995   24.285 1.00 43.11  ? 366 ALA A C      1 
ATOM   2453 O  O      . ALA A 1 329 ? -1.360 5.805   25.202 1.00 42.52  ? 366 ALA A O      1 
ATOM   2454 C  CB     . ALA A 1 329 ? -2.711 2.900   24.951 1.00 43.35  ? 366 ALA A CB     1 
ATOM   2455 N  N      . GLU A 1 330 ? -0.538 4.793   23.345 1.00 37.16  ? 367 GLU A N      1 
ATOM   2456 C  CA     . GLU A 1 330 ? 0.771  5.463   23.321 1.00 33.76  ? 367 GLU A CA     1 
ATOM   2457 C  C      . GLU A 1 330 ? 0.765  6.754   22.508 1.00 35.81  ? 367 GLU A C      1 
ATOM   2458 O  O      . GLU A 1 330 ? 1.413  7.722   22.898 1.00 32.89  ? 367 GLU A O      1 
ATOM   2459 C  CB     . GLU A 1 330 ? 1.864  4.509   22.808 1.00 33.90  ? 367 GLU A CB     1 
ATOM   2460 C  CG     . GLU A 1 330 ? 1.874  3.163   23.520 1.00 43.20  ? 367 GLU A CG     1 
ATOM   2461 C  CD     . GLU A 1 330 ? 2.744  2.065   22.936 1.00 56.89  ? 367 GLU A CD     1 
ATOM   2462 O  OE1    . GLU A 1 330 ? 2.822  1.943   21.692 1.00 47.28  ? 367 GLU A OE1    1 
ATOM   2463 O  OE2    . GLU A 1 330 ? 3.297  1.277   23.736 1.00 45.50  ? 367 GLU A OE2    1 
ATOM   2464 N  N      . VAL A 1 331 ? 0.018  6.772   21.393 1.00 34.38  ? 368 VAL A N      1 
ATOM   2465 C  CA     . VAL A 1 331 ? -0.080 7.910   20.470 1.00 33.79  ? 368 VAL A CA     1 
ATOM   2466 C  C      . VAL A 1 331 ? -1.116 8.951   20.940 1.00 40.55  ? 368 VAL A C      1 
ATOM   2467 O  O      . VAL A 1 331 ? -0.908 10.157  20.751 1.00 39.20  ? 368 VAL A O      1 
ATOM   2468 C  CB     . VAL A 1 331 ? -0.388 7.405   19.025 1.00 38.41  ? 368 VAL A CB     1 
ATOM   2469 C  CG1    . VAL A 1 331 ? -0.571 8.567   18.044 1.00 37.93  ? 368 VAL A CG1    1 
ATOM   2470 C  CG2    . VAL A 1 331 ? 0.683  6.431   18.529 1.00 36.61  ? 368 VAL A CG2    1 
ATOM   2471 N  N      . GLU A 1 332 ? -2.244 8.481   21.503 1.00 40.81  ? 369 GLU A N      1 
ATOM   2472 C  CA     . GLU A 1 332 ? -3.352 9.343   21.924 1.00 43.45  ? 369 GLU A CA     1 
ATOM   2473 C  C      . GLU A 1 332 ? -3.532 9.334   23.439 1.00 50.33  ? 369 GLU A C      1 
ATOM   2474 O  O      . GLU A 1 332 ? -4.664 9.405   23.930 1.00 52.39  ? 369 GLU A O      1 
ATOM   2475 C  CB     . GLU A 1 332 ? -4.663 8.930   21.214 1.00 47.46  ? 369 GLU A CB     1 
ATOM   2476 C  CG     . GLU A 1 332 ? -4.608 8.938   19.695 1.00 56.86  ? 369 GLU A CG     1 
ATOM   2477 C  CD     . GLU A 1 332 ? -5.531 7.926   19.044 1.00 80.07  ? 369 GLU A CD     1 
ATOM   2478 O  OE1    . GLU A 1 332 ? -6.716 7.854   19.444 1.00 77.12  ? 369 GLU A OE1    1 
ATOM   2479 O  OE2    . GLU A 1 332 ? -5.070 7.205   18.129 1.00 72.66  ? 369 GLU A OE2    1 
ATOM   2480 N  N      . ALA A 1 333 ? -2.410 9.268   24.180 1.00 47.09  ? 370 ALA A N      1 
ATOM   2481 C  CA     . ALA A 1 333 ? -2.381 9.277   25.647 1.00 48.02  ? 370 ALA A CA     1 
ATOM   2482 C  C      . ALA A 1 333 ? -2.900 10.616  26.189 1.00 55.51  ? 370 ALA A C      1 
ATOM   2483 O  O      . ALA A 1 333 ? -2.889 11.609  25.451 1.00 54.35  ? 370 ALA A O      1 
ATOM   2484 C  CB     . ALA A 1 333 ? -0.964 9.024   26.142 1.00 46.19  ? 370 ALA A CB     1 
ATOM   2485 N  N      . PRO A 1 334 ? -3.739 10.525  27.247 1.00 56.20  ? 371 PRO A N      1 
ATOM   2486 C  CA     . PRO A 1 334 ? -4.206 11.737  27.945 1.00 57.48  ? 371 PRO A CA     1 
ATOM   2487 C  C      . PRO A 1 334 ? -3.139 12.842  28.004 1.00 60.93  ? 371 PRO A C      1 
ATOM   2488 O  O      . PRO A 1 334 ? -2.025 12.586  28.482 1.00 58.74  ? 371 PRO A O      1 
ATOM   2489 C  CB     . PRO A 1 334 ? -4.617 11.217  29.326 1.00 60.60  ? 371 PRO A CB     1 
ATOM   2490 N  N      . PRO A 1 335 ? -3.425 14.035  27.415 1.00 58.58  ? 372 PRO A N      1 
ATOM   2491 C  CA     . PRO A 1 335 ? -2.410 15.100  27.380 1.00 56.27  ? 372 PRO A CA     1 
ATOM   2492 C  C      . PRO A 1 335 ? -2.116 15.761  28.722 1.00 61.18  ? 372 PRO A C      1 
ATOM   2493 O  O      . PRO A 1 335 ? -3.009 15.868  29.567 1.00 63.04  ? 372 PRO A O      1 
ATOM   2494 C  CB     . PRO A 1 335 ? -2.969 16.100  26.369 1.00 58.89  ? 372 PRO A CB     1 
ATOM   2495 C  CG     . PRO A 1 335 ? -4.424 15.894  26.382 1.00 66.57  ? 372 PRO A CG     1 
ATOM   2496 C  CD     . PRO A 1 335 ? -4.681 14.462  26.760 1.00 62.85  ? 372 PRO A CD     1 
ATOM   2497 N  N      . PRO A 1 336 ? -0.864 16.234  28.913 1.00 56.60  ? 373 PRO A N      1 
ATOM   2498 C  CA     . PRO A 1 336 ? -0.496 16.889  30.182 1.00 60.37  ? 373 PRO A CA     1 
ATOM   2499 C  C      . PRO A 1 336 ? -1.326 18.126  30.538 1.00 90.09  ? 373 PRO A C      1 
ATOM   2500 O  O      . PRO A 1 336 ? -1.060 19.225  30.056 1.00 52.25  ? 373 PRO A O      1 
ATOM   2501 C  CB     . PRO A 1 336 ? 0.968  17.261  29.962 1.00 59.08  ? 373 PRO A CB     1 
ATOM   2502 C  CG     . PRO A 1 336 ? 1.451  16.350  28.906 1.00 61.19  ? 373 PRO A CG     1 
ATOM   2503 C  CD     . PRO A 1 336 ? 0.296  16.154  27.999 1.00 57.32  ? 373 PRO A CD     1 
ATOM   2504 N  N      . HIS A 1 348 ? 13.974 36.803  35.486 1.00 44.57  ? 385 HIS A N      1 
ATOM   2505 C  CA     . HIS A 1 348 ? 14.113 37.004  36.930 1.00 44.67  ? 385 HIS A CA     1 
ATOM   2506 C  C      . HIS A 1 348 ? 15.553 37.235  37.342 1.00 46.78  ? 385 HIS A C      1 
ATOM   2507 O  O      . HIS A 1 348 ? 16.464 36.884  36.603 1.00 44.98  ? 385 HIS A O      1 
ATOM   2508 C  CB     . HIS A 1 348 ? 13.581 35.787  37.697 1.00 44.28  ? 385 HIS A CB     1 
ATOM   2509 C  CG     . HIS A 1 348 ? 12.119 35.542  37.531 1.00 48.55  ? 385 HIS A CG     1 
ATOM   2510 N  ND1    . HIS A 1 348 ? 11.180 36.306  38.200 1.00 52.30  ? 385 HIS A ND1    1 
ATOM   2511 C  CD2    . HIS A 1 348 ? 11.481 34.599  36.799 1.00 49.67  ? 385 HIS A CD2    1 
ATOM   2512 C  CE1    . HIS A 1 348 ? 10.004 35.813  37.848 1.00 52.14  ? 385 HIS A CE1    1 
ATOM   2513 N  NE2    . HIS A 1 348 ? 10.136 34.777  37.013 1.00 50.90  ? 385 HIS A NE2    1 
ATOM   2514 N  N      . THR A 1 349 ? 15.761 37.788  38.545 1.00 45.30  ? 386 THR A N      1 
ATOM   2515 C  CA     . THR A 1 349 ? 17.097 37.981  39.121 1.00 45.48  ? 386 THR A CA     1 
ATOM   2516 C  C      . THR A 1 349 ? 17.557 36.617  39.680 1.00 46.27  ? 386 THR A C      1 
ATOM   2517 O  O      . THR A 1 349 ? 16.757 35.678  39.686 1.00 45.05  ? 386 THR A O      1 
ATOM   2518 C  CB     . THR A 1 349 ? 17.063 39.029  40.243 1.00 54.25  ? 386 THR A CB     1 
ATOM   2519 O  OG1    . THR A 1 349 ? 16.099 38.651  41.233 1.00 52.01  ? 386 THR A OG1    1 
ATOM   2520 C  CG2    . THR A 1 349 ? 16.806 40.451  39.731 1.00 55.43  ? 386 THR A CG2    1 
ATOM   2521 N  N      . ILE A 1 350 ? 18.819 36.516  40.172 1.00 40.80  ? 387 ILE A N      1 
ATOM   2522 C  CA     . ILE A 1 350 ? 19.370 35.292  40.784 1.00 38.03  ? 387 ILE A CA     1 
ATOM   2523 C  C      . ILE A 1 350 ? 18.481 34.888  41.972 1.00 35.94  ? 387 ILE A C      1 
ATOM   2524 O  O      . ILE A 1 350 ? 18.039 33.740  42.044 1.00 31.36  ? 387 ILE A O      1 
ATOM   2525 C  CB     . ILE A 1 350 ? 20.856 35.503  41.230 1.00 41.97  ? 387 ILE A CB     1 
ATOM   2526 C  CG1    . ILE A 1 350 ? 21.786 35.630  40.010 1.00 41.22  ? 387 ILE A CG1    1 
ATOM   2527 C  CG2    . ILE A 1 350 ? 21.342 34.378  42.197 1.00 42.51  ? 387 ILE A CG2    1 
ATOM   2528 C  CD1    . ILE A 1 350 ? 23.124 36.189  40.353 1.00 48.08  ? 387 ILE A CD1    1 
ATOM   2529 N  N      . GLU A 1 351 ? 18.199 35.856  42.870 1.00 31.73  ? 388 GLU A N      1 
ATOM   2530 C  CA     . GLU A 1 351 ? 17.400 35.682  44.092 1.00 31.52  ? 388 GLU A CA     1 
ATOM   2531 C  C      . GLU A 1 351 ? 15.978 35.184  43.822 1.00 34.30  ? 388 GLU A C      1 
ATOM   2532 O  O      . GLU A 1 351 ? 15.540 34.272  44.512 1.00 33.80  ? 388 GLU A O      1 
ATOM   2533 C  CB     . GLU A 1 351 ? 17.401 36.966  44.954 1.00 34.96  ? 388 GLU A CB     1 
ATOM   2534 N  N      . GLU A 1 352 ? 15.267 35.759  42.827 1.00 31.25  ? 389 GLU A N      1 
ATOM   2535 C  CA     . GLU A 1 352 ? 13.908 35.314  42.435 1.00 30.92  ? 389 GLU A CA     1 
ATOM   2536 C  C      . GLU A 1 352 ? 13.921 33.869  41.895 1.00 32.77  ? 389 GLU A C      1 
ATOM   2537 O  O      . GLU A 1 352 ? 13.094 33.059  42.317 1.00 32.92  ? 389 GLU A O      1 
ATOM   2538 C  CB     . GLU A 1 352 ? 13.286 36.263  41.395 1.00 33.22  ? 389 GLU A CB     1 
ATOM   2539 C  CG     . GLU A 1 352 ? 12.992 37.662  41.936 1.00 41.92  ? 389 GLU A CG     1 
ATOM   2540 C  CD     . GLU A 1 352 ? 12.858 38.738  40.875 1.00 56.37  ? 389 GLU A CD     1 
ATOM   2541 O  OE1    . GLU A 1 352 ? 13.258 38.490  39.716 1.00 44.15  ? 389 GLU A OE1    1 
ATOM   2542 O  OE2    . GLU A 1 352 ? 12.372 39.841  41.206 1.00 60.34  ? 389 GLU A OE2    1 
ATOM   2543 N  N      . TRP A 1 353 ? 14.870 33.543  40.984 1.00 26.92  ? 390 TRP A N      1 
ATOM   2544 C  CA     . TRP A 1 353 ? 15.046 32.185  40.443 1.00 24.57  ? 390 TRP A CA     1 
ATOM   2545 C  C      . TRP A 1 353 ? 15.352 31.190  41.551 1.00 29.43  ? 390 TRP A C      1 
ATOM   2546 O  O      . TRP A 1 353 ? 14.772 30.104  41.568 1.00 28.43  ? 390 TRP A O      1 
ATOM   2547 C  CB     . TRP A 1 353 ? 16.161 32.148  39.410 1.00 22.26  ? 390 TRP A CB     1 
ATOM   2548 C  CG     . TRP A 1 353 ? 15.781 32.656  38.051 1.00 23.80  ? 390 TRP A CG     1 
ATOM   2549 C  CD1    . TRP A 1 353 ? 16.450 33.595  37.318 1.00 27.08  ? 390 TRP A CD1    1 
ATOM   2550 C  CD2    . TRP A 1 353 ? 14.755 32.130  37.188 1.00 23.20  ? 390 TRP A CD2    1 
ATOM   2551 N  NE1    . TRP A 1 353 ? 15.910 33.686  36.056 1.00 25.60  ? 390 TRP A NE1    1 
ATOM   2552 C  CE2    . TRP A 1 353 ? 14.853 32.817  35.956 1.00 26.30  ? 390 TRP A CE2    1 
ATOM   2553 C  CE3    . TRP A 1 353 ? 13.773 31.123  37.328 1.00 23.68  ? 390 TRP A CE3    1 
ATOM   2554 C  CZ2    . TRP A 1 353 ? 13.967 32.582  34.895 1.00 25.11  ? 390 TRP A CZ2    1 
ATOM   2555 C  CZ3    . TRP A 1 353 ? 12.892 30.899  36.277 1.00 24.28  ? 390 TRP A CZ3    1 
ATOM   2556 C  CH2    . TRP A 1 353 ? 12.999 31.615  35.078 1.00 24.97  ? 390 TRP A CH2    1 
ATOM   2557 N  N      . LYS A 1 354 ? 16.225 31.579  42.510 1.00 27.12  ? 391 LYS A N      1 
ATOM   2558 C  CA     . LYS A 1 354 ? 16.565 30.751  43.660 1.00 26.75  ? 391 LYS A CA     1 
ATOM   2559 C  C      . LYS A 1 354 ? 15.291 30.365  44.398 1.00 31.55  ? 391 LYS A C      1 
ATOM   2560 O  O      . LYS A 1 354 ? 15.093 29.183  44.692 1.00 29.35  ? 391 LYS A O      1 
ATOM   2561 C  CB     . LYS A 1 354 ? 17.525 31.492  44.622 1.00 29.76  ? 391 LYS A CB     1 
ATOM   2562 C  CG     . LYS A 1 354 ? 18.091 30.584  45.723 1.00 31.37  ? 391 LYS A CG     1 
ATOM   2563 C  CD     . LYS A 1 354 ? 19.038 31.327  46.661 1.00 37.17  ? 391 LYS A CD     1 
ATOM   2564 C  CE     . LYS A 1 354 ? 19.743 30.322  47.533 1.00 45.44  ? 391 LYS A CE     1 
ATOM   2565 N  NZ     . LYS A 1 354 ? 20.341 30.915  48.756 1.00 52.99  ? 391 LYS A NZ     1 
ATOM   2566 N  N      . GLU A 1 355 ? 14.413 31.357  44.648 1.00 29.38  ? 392 GLU A N      1 
ATOM   2567 C  CA     . GLU A 1 355 ? 13.168 31.145  45.380 1.00 30.73  ? 392 GLU A CA     1 
ATOM   2568 C  C      . GLU A 1 355 ? 12.157 30.328  44.581 1.00 34.95  ? 392 GLU A C      1 
ATOM   2569 O  O      . GLU A 1 355 ? 11.539 29.420  45.152 1.00 35.35  ? 392 GLU A O      1 
ATOM   2570 C  CB     . GLU A 1 355 ? 12.587 32.476  45.877 1.00 33.75  ? 392 GLU A CB     1 
ATOM   2571 C  CG     . GLU A 1 355 ? 11.746 32.327  47.127 1.00 44.75  ? 392 GLU A CG     1 
ATOM   2572 C  CD     . GLU A 1 355 ? 11.278 33.654  47.688 1.00 64.63  ? 392 GLU A CD     1 
ATOM   2573 O  OE1    . GLU A 1 355 ? 11.972 34.199  48.575 1.00 64.34  ? 392 GLU A OE1    1 
ATOM   2574 O  OE2    . GLU A 1 355 ? 10.242 34.170  47.210 1.00 54.83  ? 392 GLU A OE2    1 
ATOM   2575 N  N      . LEU A 1 356 ? 12.017 30.618  43.271 1.00 30.76  ? 393 LEU A N      1 
ATOM   2576 C  CA     . LEU A 1 356 ? 11.117 29.871  42.389 1.00 31.01  ? 393 LEU A CA     1 
ATOM   2577 C  C      . LEU A 1 356 ? 11.512 28.397  42.289 1.00 34.95  ? 393 LEU A C      1 
ATOM   2578 O  O      . LEU A 1 356 ? 10.640 27.538  42.397 1.00 35.09  ? 393 LEU A O      1 
ATOM   2579 C  CB     . LEU A 1 356 ? 11.018 30.496  40.990 1.00 30.55  ? 393 LEU A CB     1 
ATOM   2580 C  CG     . LEU A 1 356 ? 10.263 31.823  40.889 1.00 36.69  ? 393 LEU A CG     1 
ATOM   2581 C  CD1    . LEU A 1 356 ? 10.529 32.475  39.575 1.00 36.61  ? 393 LEU A CD1    1 
ATOM   2582 C  CD2    . LEU A 1 356 ? 8.760  31.639  41.093 1.00 39.24  ? 393 LEU A CD2    1 
ATOM   2583 N  N      . ILE A 1 357 ? 12.820 28.112  42.116 1.00 30.75  ? 394 ILE A N      1 
ATOM   2584 C  CA     . ILE A 1 357 ? 13.362 26.745  42.013 1.00 28.74  ? 394 ILE A CA     1 
ATOM   2585 C  C      . ILE A 1 357 ? 13.168 26.012  43.341 1.00 32.80  ? 394 ILE A C      1 
ATOM   2586 O  O      . ILE A 1 357 ? 12.655 24.892  43.348 1.00 32.17  ? 394 ILE A O      1 
ATOM   2587 C  CB     . ILE A 1 357 ? 14.838 26.722  41.492 1.00 29.86  ? 394 ILE A CB     1 
ATOM   2588 C  CG1    . ILE A 1 357 ? 14.896 27.157  40.016 1.00 28.72  ? 394 ILE A CG1    1 
ATOM   2589 C  CG2    . ILE A 1 357 ? 15.500 25.340  41.684 1.00 29.02  ? 394 ILE A CG2    1 
ATOM   2590 C  CD1    . ILE A 1 357 ? 16.249 27.645  39.520 1.00 32.45  ? 394 ILE A CD1    1 
ATOM   2591 N  N      . TYR A 1 358 ? 13.544 26.662  44.458 1.00 29.75  ? 395 TYR A N      1 
ATOM   2592 C  CA     . TYR A 1 358 ? 13.398 26.116  45.811 1.00 30.35  ? 395 TYR A CA     1 
ATOM   2593 C  C      . TYR A 1 358 ? 11.948 25.727  46.127 1.00 37.35  ? 395 TYR A C      1 
ATOM   2594 O  O      . TYR A 1 358 ? 11.723 24.671  46.710 1.00 36.78  ? 395 TYR A O      1 
ATOM   2595 C  CB     . TYR A 1 358 ? 13.902 27.114  46.866 1.00 31.52  ? 395 TYR A CB     1 
ATOM   2596 C  CG     . TYR A 1 358 ? 13.899 26.552  48.270 1.00 33.02  ? 395 TYR A CG     1 
ATOM   2597 C  CD1    . TYR A 1 358 ? 14.773 25.530  48.636 1.00 33.45  ? 395 TYR A CD1    1 
ATOM   2598 C  CD2    . TYR A 1 358 ? 13.020 27.036  49.233 1.00 35.48  ? 395 TYR A CD2    1 
ATOM   2599 C  CE1    . TYR A 1 358 ? 14.776 25.009  49.928 1.00 35.24  ? 395 TYR A CE1    1 
ATOM   2600 C  CE2    . TYR A 1 358 ? 13.023 26.533  50.532 1.00 37.68  ? 395 TYR A CE2    1 
ATOM   2601 C  CZ     . TYR A 1 358 ? 13.894 25.509  50.870 1.00 42.06  ? 395 TYR A CZ     1 
ATOM   2602 O  OH     . TYR A 1 358 ? 13.892 25.008  52.140 1.00 41.37  ? 395 TYR A OH     1 
ATOM   2603 N  N      . LYS A 1 359 ? 10.983 26.584  45.736 1.00 36.93  ? 396 LYS A N      1 
ATOM   2604 C  CA     . LYS A 1 359 ? 9.554  26.379  45.959 1.00 38.57  ? 396 LYS A CA     1 
ATOM   2605 C  C      . LYS A 1 359 ? 9.076  25.159  45.190 1.00 41.70  ? 396 LYS A C      1 
ATOM   2606 O  O      . LYS A 1 359 ? 8.347  24.336  45.742 1.00 42.06  ? 396 LYS A O      1 
ATOM   2607 C  CB     . LYS A 1 359 ? 8.754  27.641  45.578 1.00 42.14  ? 396 LYS A CB     1 
ATOM   2608 N  N      . GLU A 1 360 ? 9.550  25.013  43.941 1.00 37.61  ? 397 GLU A N      1 
ATOM   2609 C  CA     . GLU A 1 360 ? 9.245  23.885  43.065 1.00 36.61  ? 397 GLU A CA     1 
ATOM   2610 C  C      . GLU A 1 360 ? 9.773  22.567  43.638 1.00 40.76  ? 397 GLU A C      1 
ATOM   2611 O  O      . GLU A 1 360 ? 9.052  21.570  43.629 1.00 42.43  ? 397 GLU A O      1 
ATOM   2612 C  CB     . GLU A 1 360 ? 9.791  24.140  41.652 1.00 36.66  ? 397 GLU A CB     1 
ATOM   2613 C  CG     . GLU A 1 360 ? 8.999  23.440  40.565 1.00 47.95  ? 397 GLU A CG     1 
ATOM   2614 C  CD     . GLU A 1 360 ? 7.493  23.602  40.651 1.00 63.08  ? 397 GLU A CD     1 
ATOM   2615 O  OE1    . GLU A 1 360 ? 7.013  24.759  40.618 1.00 50.02  ? 397 GLU A OE1    1 
ATOM   2616 O  OE2    . GLU A 1 360 ? 6.797  22.568  40.780 1.00 51.30  ? 397 GLU A OE2    1 
ATOM   2617 N  N      . VAL A 1 361 ? 11.011 22.576  44.164 1.00 35.24  ? 398 VAL A N      1 
ATOM   2618 C  CA     . VAL A 1 361 ? 11.664 21.407  44.772 1.00 33.70  ? 398 VAL A CA     1 
ATOM   2619 C  C      . VAL A 1 361 ? 10.912 20.990  46.058 1.00 38.80  ? 398 VAL A C      1 
ATOM   2620 O  O      . VAL A 1 361 ? 10.675 19.801  46.278 1.00 36.14  ? 398 VAL A O      1 
ATOM   2621 C  CB     . VAL A 1 361 ? 13.186 21.676  45.002 1.00 35.21  ? 398 VAL A CB     1 
ATOM   2622 C  CG1    . VAL A 1 361 ? 13.867 20.546  45.780 1.00 34.27  ? 398 VAL A CG1    1 
ATOM   2623 C  CG2    . VAL A 1 361 ? 13.893 21.906  43.672 1.00 33.58  ? 398 VAL A CG2    1 
ATOM   2624 N  N      . MET A 1 362 ? 10.510 21.978  46.877 1.00 38.67  ? 399 MET A N      1 
ATOM   2625 C  CA     . MET A 1 362 ? 9.795  21.732  48.131 1.00 40.55  ? 399 MET A CA     1 
ATOM   2626 C  C      . MET A 1 362 ? 8.315  21.384  47.936 1.00 47.01  ? 399 MET A C      1 
ATOM   2627 O  O      . MET A 1 362 ? 7.739  20.729  48.805 1.00 48.62  ? 399 MET A O      1 
ATOM   2628 C  CB     . MET A 1 362 ? 9.979  22.914  49.105 1.00 44.14  ? 399 MET A CB     1 
ATOM   2629 C  CG     . MET A 1 362 ? 11.417 23.102  49.574 1.00 47.46  ? 399 MET A CG     1 
ATOM   2630 S  SD     . MET A 1 362 ? 12.065 21.718  50.554 1.00 52.36  ? 399 MET A SD     1 
ATOM   2631 C  CE     . MET A 1 362 ? 12.929 20.875  49.399 1.00 46.85  ? 399 MET A CE     1 
ATOM   2632 N  N      . ASN A 1 363 ? 7.709  21.817  46.801 1.00 44.21  ? 400 ASN A N      1 
ATOM   2633 C  CA     . ASN A 1 363 ? 6.305  21.607  46.412 1.00 73.86  ? 400 ASN A CA     1 
ATOM   2634 C  C      . ASN A 1 363 ? 5.309  22.123  47.452 1.00 115.77 ? 400 ASN A C      1 
ATOM   2635 O  O      . ASN A 1 363 ? 5.531  23.170  48.057 1.00 81.02  ? 400 ASN A O      1 
ATOM   2636 C  CB     . ASN A 1 363 ? 6.023  20.143  46.056 1.00 73.81  ? 400 ASN A CB     1 
HETATM 2637 P  PG     . ANP B 2 .   ? 23.108 19.289  28.098 0.66 35.29  ? 501 ANP A PG     1 
HETATM 2638 O  O1G    . ANP B 2 .   ? 21.723 19.571  27.371 0.66 37.15  ? 501 ANP A O1G    1 
HETATM 2639 O  O2G    . ANP B 2 .   ? 23.618 20.536  28.925 0.66 34.54  ? 501 ANP A O2G    1 
HETATM 2640 O  O3G    . ANP B 2 .   ? 22.872 18.190  29.021 0.66 35.91  ? 501 ANP A O3G    1 
HETATM 2641 P  PB     . ANP B 2 .   ? 25.792 18.684  26.970 0.66 24.41  ? 501 ANP A PB     1 
HETATM 2642 O  O1B    . ANP B 2 .   ? 26.055 17.235  27.536 0.66 23.49  ? 501 ANP A O1B    1 
HETATM 2643 O  O2B    . ANP B 2 .   ? 26.455 19.660  27.819 0.66 22.90  ? 501 ANP A O2B    1 
HETATM 2644 N  N3B    . ANP B 2 .   ? 24.183 18.942  26.901 0.66 31.15  ? 501 ANP A N3B    1 
HETATM 2645 P  PA     . ANP B 2 .   ? 26.066 17.513  24.349 0.66 29.09  ? 501 ANP A PA     1 
HETATM 2646 O  O1A    . ANP B 2 .   ? 25.113 18.125  23.336 0.66 29.77  ? 501 ANP A O1A    1 
HETATM 2647 O  O2A    . ANP B 2 .   ? 25.423 16.335  24.969 0.66 25.82  ? 501 ANP A O2A    1 
HETATM 2648 O  O3A    . ANP B 2 .   ? 26.343 18.589  25.496 0.66 27.29  ? 501 ANP A O3A    1 
HETATM 2649 O  "O5'"  . ANP B 2 .   ? 27.437 17.230  23.553 0.66 31.42  ? 501 ANP A "O5'"  1 
HETATM 2650 C  "C5'"  . ANP B 2 .   ? 28.584 16.629  24.189 0.66 33.19  ? 501 ANP A "C5'"  1 
HETATM 2651 C  "C4'"  . ANP B 2 .   ? 29.660 16.400  23.158 0.66 36.62  ? 501 ANP A "C4'"  1 
HETATM 2652 O  "O4'"  . ANP B 2 .   ? 29.190 15.450  22.174 0.66 35.13  ? 501 ANP A "O4'"  1 
HETATM 2653 C  "C3'"  . ANP B 2 .   ? 30.121 17.642  22.381 0.66 40.44  ? 501 ANP A "C3'"  1 
HETATM 2654 O  "O3'"  . ANP B 2 .   ? 31.539 17.668  22.228 0.66 43.40  ? 501 ANP A "O3'"  1 
HETATM 2655 C  "C2'"  . ANP B 2 .   ? 29.391 17.501  21.038 0.66 38.82  ? 501 ANP A "C2'"  1 
HETATM 2656 O  "O2'"  . ANP B 2 .   ? 30.090 18.102  19.952 0.66 40.85  ? 501 ANP A "O2'"  1 
HETATM 2657 C  "C1'"  . ANP B 2 .   ? 29.354 15.983  20.874 0.66 36.38  ? 501 ANP A "C1'"  1 
HETATM 2658 N  N9     . ANP B 2 .   ? 28.269 15.481  20.032 0.66 34.89  ? 501 ANP A N9     1 
HETATM 2659 C  C8     . ANP B 2 .   ? 26.945 15.823  20.108 0.66 33.58  ? 501 ANP A C8     1 
HETATM 2660 N  N7     . ANP B 2 .   ? 26.163 15.112  19.333 0.66 33.08  ? 501 ANP A N7     1 
HETATM 2661 C  C5     . ANP B 2 .   ? 27.033 14.234  18.707 0.66 34.86  ? 501 ANP A C5     1 
HETATM 2662 C  C6     . ANP B 2 .   ? 26.823 13.183  17.793 0.66 33.80  ? 501 ANP A C6     1 
HETATM 2663 N  N6     . ANP B 2 .   ? 25.618 12.736  17.446 0.66 32.61  ? 501 ANP A N6     1 
HETATM 2664 N  N1     . ANP B 2 .   ? 27.911 12.523  17.331 0.66 35.10  ? 501 ANP A N1     1 
HETATM 2665 C  C2     . ANP B 2 .   ? 29.118 12.874  17.790 0.66 37.01  ? 501 ANP A C2     1 
HETATM 2666 N  N3     . ANP B 2 .   ? 29.436 13.826  18.677 0.66 37.37  ? 501 ANP A N3     1 
HETATM 2667 C  C4     . ANP B 2 .   ? 28.340 14.469  19.107 0.66 35.91  ? 501 ANP A C4     1 
HETATM 2668 H  HNB1   . ANP B 2 .   ? 23.786 18.877  25.969 0.00 30.87  ? 501 ANP A HNB1   1 
HETATM 2669 H  "H5'1" . ANP B 2 .   ? 28.207 15.697  24.608 0.00 32.63  ? 501 ANP A "H5'1" 1 
HETATM 2670 H  "H5'2" . ANP B 2 .   ? 28.959 17.239  25.010 0.00 33.52  ? 501 ANP A "H5'2" 1 
HETATM 2671 H  "H4'"  . ANP B 2 .   ? 30.512 15.888  23.603 0.00 37.35  ? 501 ANP A "H4'"  1 
HETATM 2672 H  "H3'"  . ANP B 2 .   ? 29.833 18.549  22.911 0.00 40.20  ? 501 ANP A "H3'"  1 
HETATM 2673 H  "HO3'" . ANP B 2 .   ? 31.859 16.777  21.927 0.00 43.61  ? 501 ANP A "HO3'" 1 
HETATM 2674 H  "H2'"  . ANP B 2 .   ? 28.398 17.938  21.125 0.00 37.83  ? 501 ANP A "H2'"  1 
HETATM 2675 H  "HO2'" . ANP B 2 .   ? 31.035 17.801  19.989 0.00 41.76  ? 501 ANP A "HO2'" 1 
HETATM 2676 H  "H1'"  . ANP B 2 .   ? 30.299 15.601  20.493 0.00 37.35  ? 501 ANP A "H1'"  1 
HETATM 2677 H  H8     . ANP B 2 .   ? 26.576 16.596  20.779 0.00 33.20  ? 501 ANP A H8     1 
HETATM 2678 H  HN61   . ANP B 2 .   ? 24.795 13.183  17.837 0.00 31.86  ? 501 ANP A HN61   1 
HETATM 2679 H  HN62   . ANP B 2 .   ? 25.492 11.949  16.818 0.00 32.72  ? 501 ANP A HN62   1 
HETATM 2680 H  H2     . ANP B 2 .   ? 29.944 12.280  17.402 0.00 37.99  ? 501 ANP A H2     1 
HETATM 2681 N  N1     . 880 C 3 .   ? 22.200 11.015  30.757 1.00 12.68  ? 502 880 A N1     1 
HETATM 2682 C  C2     . 880 C 3 .   ? 22.278 12.386  30.719 1.00 9.88   ? 502 880 A C2     1 
HETATM 2683 N  N3     . 880 C 3 .   ? 21.450 12.946  31.558 1.00 8.72   ? 502 880 A N3     1 
HETATM 2684 C  C4     . 880 C 3 .   ? 20.801 11.911  32.200 1.00 9.23   ? 502 880 A C4     1 
HETATM 2685 C  C5     . 880 C 3 .   ? 21.236 10.686  31.715 1.00 11.16  ? 502 880 A C5     1 
HETATM 2686 C  C6     . 880 C 3 .   ? 22.960 10.103  29.894 1.00 16.69  ? 502 880 A C6     1 
HETATM 2687 C  C7     . 880 C 3 .   ? 24.334 9.740   30.448 1.00 22.19  ? 502 880 A C7     1 
HETATM 2688 C  C10    . 880 C 3 .   ? 24.786 10.523  31.642 1.00 23.62  ? 502 880 A C10    1 
HETATM 2689 C  C16    . 880 C 3 .   ? 23.205 13.211  29.862 1.00 10.22  ? 502 880 A C16    1 
HETATM 2690 C  C17    . 880 C 3 .   ? 22.389 13.922  28.779 1.00 10.67  ? 502 880 A C17    1 
HETATM 2691 C  C18    . 880 C 3 .   ? 23.290 14.737  27.872 1.00 9.92   ? 502 880 A C18    1 
HETATM 2692 N  N19    . 880 C 3 .   ? 24.062 15.732  28.667 1.00 12.06  ? 502 880 A N19    1 
HETATM 2693 C  C20    . 880 C 3 .   ? 24.868 15.090  29.745 1.00 12.84  ? 502 880 A C20    1 
HETATM 2694 C  C21    . 880 C 3 .   ? 23.978 14.267  30.657 1.00 12.61  ? 502 880 A C21    1 
HETATM 2695 C  C35    A 880 C 3 .   ? 19.710 12.276  33.127 0.71 8.25   ? 502 880 A C35    1 
HETATM 2696 C  C35    B 880 C 3 .   ? 19.855 12.211  33.297 0.29 5.92   ? 502 880 A C35    1 
HETATM 2697 C  C36    . 880 C 3 .   ? 20.753 9.318   32.023 1.00 12.57  ? 502 880 A C36    1 
HETATM 2698 C  C37    A 880 C 3 .   ? 19.646 11.729  34.406 0.71 10.72  ? 502 880 A C37    1 
HETATM 2699 C  C37    B 880 C 3 .   ? 18.863 13.170  33.118 0.29 4.95   ? 502 880 A C37    1 
HETATM 2700 C  C38    A 880 C 3 .   ? 18.662 12.145  35.284 0.71 11.97  ? 502 880 A C38    1 
HETATM 2701 C  C38    B 880 C 3 .   ? 17.910 13.372  34.101 0.29 5.84   ? 502 880 A C38    1 
HETATM 2702 C  C39    A 880 C 3 .   ? 17.716 13.086  34.891 0.71 12.50  ? 502 880 A C39    1 
HETATM 2703 C  C39    B 880 C 3 .   ? 17.943 12.630  35.279 0.29 5.01   ? 502 880 A C39    1 
HETATM 2704 C  C40    A 880 C 3 .   ? 17.771 13.623  33.615 0.71 8.35   ? 502 880 A C40    1 
HETATM 2705 C  C40    B 880 C 3 .   ? 18.940 11.689  35.470 0.29 5.27   ? 502 880 A C40    1 
HETATM 2706 C  C41    A 880 C 3 .   ? 18.766 13.226  32.742 0.71 5.69   ? 502 880 A C41    1 
HETATM 2707 C  C41    B 880 C 3 .   ? 19.885 11.475  34.482 0.29 5.53   ? 502 880 A C41    1 
HETATM 2708 CL CL45   A 880 C 3 .   ? 18.669 11.518  36.894 0.71 14.59  ? 502 880 A CL45   1 
HETATM 2709 CL CL45   B 880 C 3 .   ? 16.673 14.551  33.824 0.29 10.77  ? 502 880 A CL45   1 
HETATM 2710 CL CL46   A 880 C 3 .   ? 16.479 13.623  35.983 0.71 16.59  ? 502 880 A CL46   1 
HETATM 2711 CL CL46   B 880 C 3 .   ? 16.730 12.832  36.504 0.29 4.37   ? 502 880 A CL46   1 
HETATM 2712 C  C47    . 880 C 3 .   ? 19.460 9.073   32.467 1.00 13.01  ? 502 880 A C47    1 
HETATM 2713 C  C48    . 880 C 3 .   ? 19.153 7.767   32.792 1.00 13.92  ? 502 880 A C48    1 
HETATM 2714 N  N49    . 880 C 3 .   ? 20.012 6.747   32.645 1.00 13.50  ? 502 880 A N49    1 
HETATM 2715 C  C50    . 880 C 3 .   ? 21.205 7.073   32.120 1.00 14.76  ? 502 880 A C50    1 
HETATM 2716 N  N51    . 880 C 3 .   ? 21.636 8.323   31.833 1.00 14.88  ? 502 880 A N51    1 
HETATM 2717 N  N54    . 880 C 3 .   ? 22.003 6.043   31.783 1.00 16.29  ? 502 880 A N54    1 
HETATM 2718 C  C55    . 880 C 3 .   ? 23.316 6.085   31.141 1.00 16.99  ? 502 880 A C55    1 
HETATM 2719 C  C56    . 880 C 3 .   ? 24.136 4.851   31.501 1.00 17.00  ? 502 880 A C56    1 
HETATM 2720 C  C57    . 880 C 3 .   ? 25.495 4.878   30.809 1.00 17.10  ? 502 880 A C57    1 
HETATM 2721 C  C58    . 880 C 3 .   ? 25.343 4.995   29.296 1.00 18.73  ? 502 880 A C58    1 
HETATM 2722 C  C59    . 880 C 3 .   ? 24.496 6.211   28.918 1.00 16.56  ? 502 880 A C59    1 
HETATM 2723 C  C60    . 880 C 3 .   ? 23.145 6.192   29.631 1.00 15.68  ? 502 880 A C60    1 
HETATM 2724 H  H061   . 880 C 3 .   ? 23.045 10.564  28.912 0.00 16.40  ? 502 880 A H061   1 
HETATM 2725 H  H062   . 880 C 3 .   ? 22.371 9.213   29.683 0.00 16.82  ? 502 880 A H062   1 
HETATM 2726 H  H071   . 880 C 3 .   ? 25.075 9.847   29.658 0.00 22.40  ? 502 880 A H071   1 
HETATM 2727 H  H072   . 880 C 3 .   ? 24.381 8.681   30.690 0.00 22.75  ? 502 880 A H072   1 
HETATM 2728 H  H101   . 880 C 3 .   ? 25.720 10.129  32.036 0.00 24.40  ? 502 880 A H101   1 
HETATM 2729 H  H102   . 880 C 3 .   ? 24.081 10.495  32.472 0.00 23.48  ? 502 880 A H102   1 
HETATM 2730 H  H103   . 880 C 3 .   ? 24.974 11.570  31.410 0.00 23.33  ? 502 880 A H103   1 
HETATM 2731 H  H16    . 880 C 3 .   ? 23.948 12.588  29.368 0.00 10.60  ? 502 880 A H16    1 
HETATM 2732 H  H171   . 880 C 3 .   ? 21.662 14.589  29.239 0.00 10.41  ? 502 880 A H171   1 
HETATM 2733 H  H172   . 880 C 3 .   ? 21.772 13.216  28.226 0.00 10.45  ? 502 880 A H172   1 
HETATM 2734 H  H181   . 880 C 3 .   ? 22.740 15.239  27.078 0.00 9.60   ? 502 880 A H181   1 
HETATM 2735 H  H182   . 880 C 3 .   ? 23.984 14.080  27.349 0.00 10.14  ? 502 880 A H182   1 
HETATM 2736 H  H19    . 880 C 3 .   ? 23.436 16.425  29.064 0.00 11.78  ? 502 880 A H19    1 
HETATM 2737 H  H201   . 880 C 3 .   ? 25.406 15.850  30.309 0.00 13.17  ? 502 880 A H201   1 
HETATM 2738 H  H202   . 880 C 3 .   ? 25.642 14.466  29.301 0.00 13.21  ? 502 880 A H202   1 
HETATM 2739 H  H211   . 880 C 3 .   ? 24.554 13.826  31.469 0.00 13.04  ? 502 880 A H211   1 
HETATM 2740 H  H212   . 880 C 3 .   ? 23.286 14.937  31.165 0.00 12.32  ? 502 880 A H212   1 
HETATM 2741 H  H37    A 880 C 3 .   ? 20.346 10.957  34.719 0.00 11.17  ? 502 880 A H37    1 
HETATM 2742 H  H37    B 880 C 3 .   ? 18.812 13.755  32.201 0.00 4.62   ? 502 880 A H37    1 
HETATM 2743 H  H40    A 880 C 3 .   ? 17.034 14.367  33.315 0.00 8.33   ? 502 880 A H40    1 
HETATM 2744 H  H40    B 880 C 3 .   ? 18.970 11.126  36.401 0.00 5.63   ? 502 880 A H40    1 
HETATM 2745 H  H41    A 880 C 3 .   ? 18.801 13.654  31.741 0.00 5.35   ? 502 880 A H41    1 
HETATM 2746 H  H41    B 880 C 3 .   ? 20.612 10.675  34.606 0.00 5.76   ? 502 880 A H41    1 
HETATM 2747 H  H47    . 880 C 3 .   ? 18.684 9.835   32.483 0.00 12.62  ? 502 880 A H47    1 
HETATM 2748 H  H48    . 880 C 3 .   ? 18.178 7.489   33.188 0.00 14.15  ? 502 880 A H48    1 
HETATM 2749 H  H54    . 880 C 3 .   ? 21.666 5.115   32.018 0.00 16.86  ? 502 880 A H54    1 
HETATM 2750 H  H55    . 880 C 3 .   ? 23.875 6.936   31.523 0.00 16.77  ? 502 880 A H55    1 
HETATM 2751 H  H561   . 880 C 3 .   ? 23.613 3.937   31.226 0.00 17.44  ? 502 880 A H561   1 
HETATM 2752 H  H562   . 880 C 3 .   ? 24.285 4.772   32.577 0.00 17.45  ? 502 880 A H562   1 
HETATM 2753 H  H571   . 880 C 3 .   ? 26.061 3.983   31.063 0.00 18.24  ? 502 880 A H571   1 
HETATM 2754 H  H572   . 880 C 3 .   ? 26.091 5.701   31.200 0.00 16.97  ? 502 880 A H572   1 
HETATM 2755 H  H581   . 880 C 3 .   ? 24.915 4.082   28.886 0.00 19.15  ? 502 880 A H581   1 
HETATM 2756 H  H582   . 880 C 3 .   ? 26.325 5.067   28.830 0.00 19.25  ? 502 880 A H582   1 
HETATM 2757 H  H591   . 880 C 3 .   ? 24.349 6.247   27.839 0.00 16.32  ? 502 880 A H591   1 
HETATM 2758 H  H592   . 880 C 3 .   ? 25.034 7.129   29.148 0.00 16.36  ? 502 880 A H592   1 
HETATM 2759 H  H601   . 880 C 3 .   ? 22.567 7.072   29.355 0.00 14.86  ? 502 880 A H601   1 
HETATM 2760 H  H602   . 880 C 3 .   ? 22.546 5.357   29.271 0.00 15.98  ? 502 880 A H602   1 
HETATM 2761 H  H192   . 880 C 3 .   ? 24.694 16.220  28.041 0.00 12.27  ? 502 880 A H192   1 
HETATM 2762 X  UNK    . UNX D 4 .   ? 11.985 22.761  -0.099 1.00 53.15  ? 503 UNX A UNK    1 
HETATM 2763 X  UNK    . UNX E 4 .   ? 5.478  7.566   32.943 1.00 59.79  ? 504 UNX A UNK    1 
HETATM 2764 X  UNK    . UNX F 4 .   ? 1.925  6.151   27.843 1.00 53.12  ? 505 UNX A UNK    1 
HETATM 2765 O  O      . HOH G 5 .   ? 24.522 19.026  47.699 1.00 20.92  ? 601 HOH A O      1 
HETATM 2766 O  O      . HOH G 5 .   ? 10.339 25.848  21.834 1.00 33.63  ? 602 HOH A O      1 
HETATM 2767 O  O      . HOH G 5 .   ? 16.082 0.672   34.671 1.00 40.81  ? 603 HOH A O      1 
HETATM 2768 O  O      . HOH G 5 .   ? 5.536  4.358   22.501 1.00 27.76  ? 604 HOH A O      1 
HETATM 2769 O  O      . HOH G 5 .   ? 2.209  16.089  6.605  1.00 32.27  ? 605 HOH A O      1 
HETATM 2770 O  O      . HOH G 5 .   ? 7.792  24.173  11.524 1.00 20.93  ? 606 HOH A O      1 
HETATM 2771 O  O      . HOH G 5 .   ? 14.712 22.062  15.697 1.00 26.24  ? 607 HOH A O      1 
HETATM 2772 O  O      . HOH G 5 .   ? 19.644 16.652  29.491 1.00 27.85  ? 608 HOH A O      1 
HETATM 2773 O  O      . HOH G 5 .   ? 3.789  -0.647  20.005 1.00 32.54  ? 609 HOH A O      1 
HETATM 2774 O  O      . HOH G 5 .   ? 13.980 6.919   43.910 1.00 16.12  ? 610 HOH A O      1 
HETATM 2775 O  O      . HOH G 5 .   ? 15.534 -5.971  9.772  1.00 35.09  ? 611 HOH A O      1 
HETATM 2776 O  O      . HOH G 5 .   ? 23.730 14.901  20.500 1.00 15.01  ? 612 HOH A O      1 
HETATM 2777 O  O      . HOH G 5 .   ? 18.475 19.847  18.159 1.00 29.90  ? 613 HOH A O      1 
HETATM 2778 O  O      . HOH G 5 .   ? 24.157 11.314  26.857 1.00 15.12  ? 614 HOH A O      1 
HETATM 2779 O  O      . HOH G 5 .   ? 25.216 21.889  37.848 1.00 26.86  ? 615 HOH A O      1 
HETATM 2780 O  O      . HOH G 5 .   ? 9.095  7.913   31.735 1.00 22.34  ? 616 HOH A O      1 
HETATM 2781 O  O      . HOH G 5 .   ? 9.077  -1.115  9.937  1.00 27.02  ? 617 HOH A O      1 
HETATM 2782 O  O      . HOH G 5 .   ? 11.001 -6.734  -1.136 1.00 23.22  ? 618 HOH A O      1 
HETATM 2783 O  O      . HOH G 5 .   ? 29.510 26.007  -4.095 1.00 41.32  ? 619 HOH A O      1 
HETATM 2784 O  O      . HOH G 5 .   ? 21.109 20.220  17.681 1.00 24.91  ? 620 HOH A O      1 
HETATM 2785 O  O      . HOH G 5 .   ? 15.473 0.850   37.284 1.00 45.18  ? 621 HOH A O      1 
HETATM 2786 O  O      . HOH G 5 .   ? 11.957 7.282   35.864 1.00 20.79  ? 622 HOH A O      1 
HETATM 2787 O  O      . HOH G 5 .   ? 6.006  1.442   22.964 1.00 28.39  ? 623 HOH A O      1 
HETATM 2788 O  O      . HOH G 5 .   ? 17.532 17.713  30.869 1.00 28.04  ? 624 HOH A O      1 
HETATM 2789 O  O      . HOH G 5 .   ? 13.819 19.345  17.793 1.00 11.46  ? 625 HOH A O      1 
HETATM 2790 O  O      . HOH G 5 .   ? 20.204 20.609  11.080 1.00 18.46  ? 626 HOH A O      1 
HETATM 2791 O  O      . HOH G 5 .   ? 6.666  11.186  31.570 1.00 21.93  ? 627 HOH A O      1 
HETATM 2792 O  O      . HOH G 5 .   ? 7.908  2.492   25.166 1.00 29.87  ? 628 HOH A O      1 
HETATM 2793 O  O      . HOH G 5 .   ? 19.739 23.843  34.882 1.00 27.04  ? 629 HOH A O      1 
HETATM 2794 O  O      . HOH G 5 .   ? 20.682 15.596  31.870 1.00 21.37  ? 630 HOH A O      1 
HETATM 2795 O  O      . HOH G 5 .   ? 22.516 13.978  12.124 1.00 15.64  ? 631 HOH A O      1 
HETATM 2796 O  O      . HOH G 5 .   ? 21.938 2.988   14.061 1.00 30.58  ? 632 HOH A O      1 
HETATM 2797 O  O      . HOH G 5 .   ? 18.029 17.636  23.551 1.00 36.10  ? 633 HOH A O      1 
HETATM 2798 O  O      . HOH G 5 .   ? 2.214  17.460  16.056 1.00 24.43  ? 634 HOH A O      1 
HETATM 2799 O  O      . HOH G 5 .   ? 21.566 1.013   11.791 1.00 37.77  ? 635 HOH A O      1 
HETATM 2800 O  O      . HOH G 5 .   ? 11.091 -5.468  10.729 1.00 33.15  ? 636 HOH A O      1 
HETATM 2801 O  O      . HOH G 5 .   ? 20.839 29.211  0.712  1.00 37.19  ? 637 HOH A O      1 
HETATM 2802 O  O      . HOH G 5 .   ? 26.508 19.281  39.241 1.00 44.01  ? 638 HOH A O      1 
HETATM 2803 O  O      . HOH G 5 .   ? 17.582 8.579   54.628 1.00 28.28  ? 639 HOH A O      1 
HETATM 2804 O  O      . HOH G 5 .   ? 22.762 16.606  11.481 1.00 17.63  ? 640 HOH A O      1 
HETATM 2805 O  O      . HOH G 5 .   ? 14.424 20.194  1.201  1.00 26.25  ? 641 HOH A O      1 
HETATM 2806 O  O      . HOH G 5 .   ? 16.326 17.638  34.322 1.00 34.49  ? 642 HOH A O      1 
HETATM 2807 O  O      . HOH G 5 .   ? 14.246 17.595  0.730  1.00 28.49  ? 643 HOH A O      1 
HETATM 2808 O  O      . HOH G 5 .   ? 3.925  18.043  13.223 1.00 27.02  ? 644 HOH A O      1 
HETATM 2809 O  O      . HOH G 5 .   ? 22.907 33.419  31.417 1.00 44.74  ? 645 HOH A O      1 
HETATM 2810 O  O      A HOH G 5 .   ? 14.801 21.301  28.935 0.50 13.89  ? 646 HOH A O      1 
HETATM 2811 O  O      . HOH G 5 .   ? 19.899 -4.912  15.849 1.00 43.18  ? 647 HOH A O      1 
HETATM 2812 O  O      . HOH G 5 .   ? 1.542  10.632  22.329 1.00 25.89  ? 648 HOH A O      1 
HETATM 2813 O  O      . HOH G 5 .   ? 16.897 -1.851  38.150 1.00 38.25  ? 649 HOH A O      1 
HETATM 2814 O  O      . HOH G 5 .   ? 13.421 -13.106 1.253  1.00 43.38  ? 650 HOH A O      1 
HETATM 2815 O  O      . HOH G 5 .   ? 13.441 -6.241  11.573 1.00 25.56  ? 651 HOH A O      1 
HETATM 2816 O  O      . HOH G 5 .   ? 11.551 8.015   33.305 1.00 25.18  ? 652 HOH A O      1 
HETATM 2817 O  O      . HOH G 5 .   ? 29.257 11.796  54.722 1.00 33.97  ? 653 HOH A O      1 
HETATM 2818 O  O      . HOH G 5 .   ? 3.187  20.505  11.912 1.00 24.42  ? 654 HOH A O      1 
HETATM 2819 O  O      . HOH G 5 .   ? 0.945  16.395  13.878 1.00 37.73  ? 655 HOH A O      1 
HETATM 2820 O  O      . HOH G 5 .   ? 5.934  30.552  15.823 1.00 34.17  ? 656 HOH A O      1 
HETATM 2821 O  O      . HOH G 5 .   ? 12.534 13.223  48.993 1.00 32.81  ? 657 HOH A O      1 
HETATM 2822 O  O      . HOH G 5 .   ? 30.068 11.987  12.762 1.00 32.86  ? 658 HOH A O      1 
HETATM 2823 O  O      . HOH G 5 .   ? 14.062 17.730  49.664 1.00 23.83  ? 659 HOH A O      1 
HETATM 2824 O  O      . HOH G 5 .   ? 22.222 3.304   -4.204 1.00 44.54  ? 660 HOH A O      1 
HETATM 2825 O  O      . HOH G 5 .   ? 26.427 13.581  26.305 1.00 39.92  ? 661 HOH A O      1 
HETATM 2826 O  O      . HOH G 5 .   ? 9.712  6.223   46.885 1.00 30.58  ? 662 HOH A O      1 
HETATM 2827 O  O      . HOH G 5 .   ? 25.209 1.259   40.827 1.00 50.95  ? 663 HOH A O      1 
HETATM 2828 O  O      . HOH G 5 .   ? 31.859 16.384  15.558 1.00 49.51  ? 664 HOH A O      1 
HETATM 2829 O  O      . HOH G 5 .   ? 8.504  -7.684  -0.804 1.00 27.33  ? 665 HOH A O      1 
HETATM 2830 O  O      . HOH G 5 .   ? 29.268 29.795  40.889 1.00 39.72  ? 666 HOH A O      1 
HETATM 2831 O  O      . HOH G 5 .   ? 13.849 14.840  50.717 1.00 31.29  ? 667 HOH A O      1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N      . ASP A 8   ? 0.9714 0.5154 0.3953 0.0311  -0.0717 -0.0176 45  ASP A N      
2    C  CA     . ASP A 8   ? 0.9495 0.4957 0.3724 0.0258  -0.0518 -0.0115 45  ASP A CA     
3    C  C      . ASP A 8   ? 0.9468 0.4821 0.3627 0.0259  -0.0571 -0.0056 45  ASP A C      
4    O  O      . ASP A 8   ? 0.9018 0.4554 0.3476 0.0267  -0.0657 -0.0055 45  ASP A O      
5    C  CB     . ASP A 8   ? 0.9402 0.5196 0.4034 0.0201  -0.0390 -0.0124 45  ASP A CB     
6    C  CG     . ASP A 8   ? 1.0608 0.6484 0.5227 0.0133  -0.0163 -0.0083 45  ASP A CG     
7    O  OD1    . ASP A 8   ? 1.0369 0.6101 0.4801 0.0082  -0.0111 -0.0023 45  ASP A OD1    
8    O  OD2    . ASP A 8   ? 1.1693 0.7791 0.6499 0.0126  -0.0044 -0.0113 45  ASP A OD2    
9    N  N      . ASN A 9   ? 0.8845 0.3870 0.2564 0.0257  -0.0515 -0.0007 46  ASN A N      
10   C  CA     . ASN A 9   ? 0.8804 0.3570 0.2274 0.0263  -0.0549 0.0056  46  ASN A CA     
11   C  C      . ASN A 9   ? 0.8172 0.3089 0.1888 0.0175  -0.0446 0.0101  46  ASN A C      
12   O  O      . ASN A 9   ? 0.7721 0.2440 0.1291 0.0202  -0.0516 0.0142  46  ASN A O      
13   C  CB     . ASN A 9   ? 0.9655 0.4032 0.2575 0.0229  -0.0445 0.0103  46  ASN A CB     
14   C  CG     . ASN A 9   ? 1.3632 0.8138 0.6567 0.0095  -0.0181 0.0123  46  ASN A CG     
15   O  OD1    . ASN A 9   ? 1.2814 0.7322 0.5738 -0.0028 -0.0039 0.0179  46  ASN A OD1    
16   N  ND2    . ASN A 9   ? 1.2845 0.7488 0.5821 0.0116  -0.0113 0.0070  46  ASN A ND2    
17   N  N      . GLN A 10  ? 0.7326 0.2560 0.1368 0.0080  -0.0284 0.0091  47  GLN A N      
18   C  CA     . GLN A 10  ? 0.6981 0.2385 0.1270 -0.0017 -0.0184 0.0126  47  GLN A CA     
19   C  C      . GLN A 10  ? 0.6799 0.2405 0.1455 0.0046  -0.0322 0.0104  47  GLN A C      
20   O  O      . GLN A 10  ? 0.6639 0.2292 0.1419 -0.0006 -0.0284 0.0136  47  GLN A O      
21   C  CB     . GLN A 10  ? 0.6886 0.2606 0.1415 -0.0120 0.0019  0.0112  47  GLN A CB     
22   C  CG     . GLN A 10  ? 0.8597 0.4197 0.2794 -0.0209 0.0203  0.0139  47  GLN A CG     
23   C  CD     . GLN A 10  ? 0.9604 0.5587 0.4061 -0.0259 0.0381  0.0103  47  GLN A CD     
24   O  OE1    . GLN A 10  ? 0.7628 0.3718 0.2039 -0.0392 0.0566  0.0131  47  GLN A OE1    
25   N  NE2    . GLN A 10  ? 0.9137 0.5335 0.3855 -0.0154 0.0328  0.0036  47  GLN A NE2    
26   N  N      . PHE A 11  ? 0.6188 0.1919 0.1009 0.0145  -0.0477 0.0048  48  PHE A N      
27   C  CA     . PHE A 11  ? 0.5826 0.1824 0.1032 0.0192  -0.0594 0.0017  48  PHE A CA     
28   C  C      . PHE A 11  ? 0.6767 0.2674 0.1878 0.0322  -0.0808 -0.0001 48  PHE A C      
29   O  O      . PHE A 11  ? 0.6947 0.2609 0.1725 0.0387  -0.0897 -0.0007 48  PHE A O      
30   C  CB     . PHE A 11  ? 0.5536 0.1832 0.1068 0.0171  -0.0593 -0.0041 48  PHE A CB     
31   C  CG     . PHE A 11  ? 0.5354 0.1803 0.1030 0.0086  -0.0405 -0.0039 48  PHE A CG     
32   C  CD1    . PHE A 11  ? 0.5681 0.2029 0.1136 0.0071  -0.0298 -0.0048 48  PHE A CD1    
33   C  CD2    . PHE A 11  ? 0.4959 0.1673 0.0988 0.0038  -0.0344 -0.0037 48  PHE A CD2    
34   C  CE1    . PHE A 11  ? 0.5377 0.1918 0.0975 0.0024  -0.0131 -0.0058 48  PHE A CE1    
35   C  CE2    . PHE A 11  ? 0.5075 0.1954 0.1235 -0.0018 -0.0186 -0.0043 48  PHE A CE2    
36   C  CZ     . PHE A 11  ? 0.4974 0.1783 0.0926 -0.0018 -0.0082 -0.0056 48  PHE A CZ     
37   N  N      . TYR A 12  ? 0.6151 0.2283 0.1561 0.0370  -0.0892 -0.0016 49  TYR A N      
38   C  CA     . TYR A 12  ? 0.6207 0.2387 0.1625 0.0511  -0.1099 -0.0050 49  TYR A CA     
39   C  C      . TYR A 12  ? 0.6401 0.3025 0.2307 0.0507  -0.1152 -0.0097 49  TYR A C      
40   O  O      . TYR A 12  ? 0.5894 0.2686 0.2059 0.0425  -0.1032 -0.0082 49  TYR A O      
41   C  CB     . TYR A 12  ? 0.6525 0.2388 0.1615 0.0626  -0.1159 -0.0009 49  TYR A CB     
42   C  CG     . TYR A 12  ? 0.6257 0.2209 0.1529 0.0634  -0.1116 0.0013  49  TYR A CG     
43   C  CD1    . TYR A 12  ? 0.6273 0.2142 0.1546 0.0494  -0.0932 0.0063  49  TYR A CD1    
44   C  CD2    . TYR A 12  ? 0.6318 0.2440 0.1741 0.0789  -0.1262 -0.0022 49  TYR A CD2    
45   C  CE1    . TYR A 12  ? 0.5687 0.1606 0.1097 0.0496  -0.0900 0.0080  49  TYR A CE1    
46   C  CE2    . TYR A 12  ? 0.6251 0.2423 0.1803 0.0812  -0.1223 -0.0007 49  TYR A CE2    
47   C  CZ     . TYR A 12  ? 0.6200 0.2253 0.1740 0.0659  -0.1044 0.0045  49  TYR A CZ     
48   O  OH     . TYR A 12  ? 0.5976 0.2053 0.1620 0.0674  -0.1013 0.0058  49  TYR A OH     
49   N  N      . SER A 13  ? 0.6330 0.3158 0.2356 0.0584  -0.1328 -0.0154 50  SER A N      
50   C  CA     . SER A 13  ? 0.6031 0.3306 0.2506 0.0557  -0.1376 -0.0201 50  SER A CA     
51   C  C      . SER A 13  ? 0.6713 0.4171 0.3313 0.0703  -0.1483 -0.0217 50  SER A C      
52   O  O      . SER A 13  ? 0.6923 0.4251 0.3288 0.0861  -0.1621 -0.0229 50  SER A O      
53   C  CB     . SER A 13  ? 0.6303 0.3765 0.2885 0.0497  -0.1484 -0.0263 50  SER A CB     
54   O  OG     . SER A 13  ? 0.6838 0.4188 0.3383 0.0363  -0.1367 -0.0256 50  SER A OG     
55   N  N      . VAL A 14  ? 0.6080 0.3836 0.3031 0.0668  -0.1421 -0.0221 51  VAL A N      
56   C  CA     . VAL A 14  ? 0.6100 0.4088 0.3213 0.0813  -0.1503 -0.0245 51  VAL A CA     
57   C  C      . VAL A 14  ? 0.6561 0.5075 0.4130 0.0743  -0.1527 -0.0299 51  VAL A C      
58   O  O      . VAL A 14  ? 0.6098 0.4714 0.3863 0.0571  -0.1417 -0.0290 51  VAL A O      
59   C  CB     . VAL A 14  ? 0.6674 0.4445 0.3678 0.0872  -0.1407 -0.0194 51  VAL A CB     
60   C  CG1    . VAL A 14  ? 0.7173 0.4504 0.3711 0.1034  -0.1480 -0.0166 51  VAL A CG1    
61   C  CG2    . VAL A 14  ? 0.6465 0.4111 0.3508 0.0692  -0.1212 -0.0143 51  VAL A CG2    
62   N  N      . GLU A 15  ? 0.6590 0.5440 0.4312 0.0881  -0.1669 -0.0356 52  GLU A N      
63   C  CA     . GLU A 15  ? 0.6470 0.5868 0.4625 0.0805  -0.1689 -0.0410 52  GLU A CA     
64   C  C      . GLU A 15  ? 0.6900 0.6431 0.5252 0.0829  -0.1578 -0.0391 52  GLU A C      
65   O  O      . GLU A 15  ? 0.7135 0.6591 0.5379 0.1026  -0.1608 -0.0388 52  GLU A O      
66   C  CB     . GLU A 15  ? 0.6789 0.6580 0.5059 0.0935  -0.1886 -0.0490 52  GLU A CB     
67   C  CG     . GLU A 15  ? 0.8504 0.8384 0.6770 0.0802  -0.1989 -0.0531 52  GLU A CG     
68   C  CD     . GLU A 15  ? 1.2148 1.2177 1.0634 0.0520  -0.1902 -0.0533 52  GLU A CD     
69   O  OE1    . GLU A 15  ? 1.2767 1.3186 1.1592 0.0430  -0.1847 -0.0551 52  GLU A OE1    
70   O  OE2    . GLU A 15  ? 1.1653 1.1379 0.9938 0.0394  -0.1887 -0.0518 52  GLU A OE2    
71   N  N      . VAL A 16  ? 0.6201 0.5862 0.4786 0.0636  -0.1450 -0.0375 53  VAL A N      
72   C  CA     . VAL A 16  ? 0.6054 0.5846 0.4834 0.0628  -0.1336 -0.0357 53  VAL A CA     
73   C  C      . VAL A 16  ? 0.6444 0.6743 0.5603 0.0498  -0.1333 -0.0402 53  VAL A C      
74   O  O      . VAL A 16  ? 0.6217 0.6518 0.5467 0.0291  -0.1257 -0.0388 53  VAL A O      
75   C  CB     . VAL A 16  ? 0.6487 0.5906 0.5136 0.0529  -0.1176 -0.0288 53  VAL A CB     
76   C  CG1    . VAL A 16  ? 0.6251 0.5822 0.5109 0.0505  -0.1070 -0.0276 53  VAL A CG1    
77   C  CG2    . VAL A 16  ? 0.6765 0.5721 0.5036 0.0637  -0.1174 -0.0245 53  VAL A CG2    
78   N  N      . GLY A 17  ? 0.6077 0.6799 0.5425 0.0626  -0.1423 -0.0460 54  GLY A N      
79   C  CA     . GLY A 17  ? 0.5901 0.7175 0.5609 0.0504  -0.1428 -0.0510 54  GLY A CA     
80   C  C      . GLY A 17  ? 0.6668 0.8057 0.6410 0.0320  -0.1511 -0.0542 54  GLY A C      
81   O  O      . GLY A 17  ? 0.6873 0.8307 0.6520 0.0413  -0.1658 -0.0582 54  GLY A O      
82   N  N      . ASP A 18  ? 0.6181 0.7546 0.6002 0.0062  -0.1423 -0.0522 55  ASP A N      
83   C  CA     . ASP A 18  ? 0.6294 0.7675 0.6091 -0.0150 -0.1490 -0.0547 55  ASP A CA     
84   C  C      . ASP A 18  ? 0.6909 0.7705 0.6372 -0.0193 -0.1455 -0.0499 55  ASP A C      
85   O  O      . ASP A 18  ? 0.7107 0.7787 0.6436 -0.0302 -0.1536 -0.0522 55  ASP A O      
86   C  CB     . ASP A 18  ? 0.6406 0.8069 0.6431 -0.0411 -0.1419 -0.0557 55  ASP A CB     
87   N  N      . SER A 19  ? 0.6212 0.6660 0.5536 -0.0105 -0.1337 -0.0439 56  SER A N      
88   C  CA     . SER A 19  ? 0.6146 0.6097 0.5184 -0.0128 -0.1271 -0.0393 56  SER A CA     
89   C  C      . SER A 19  ? 0.6215 0.5868 0.4968 0.0041  -0.1328 -0.0380 56  SER A C      
90   O  O      . SER A 19  ? 0.6251 0.5972 0.4989 0.0217  -0.1382 -0.0385 56  SER A O      
91   C  CB     . SER A 19  ? 0.6529 0.6322 0.5591 -0.0149 -0.1110 -0.0341 56  SER A CB     
92   O  OG     . SER A 19  ? 0.8233 0.7642 0.7071 -0.0196 -0.1040 -0.0309 56  SER A OG     
93   N  N      . THR A 20  ? 0.5399 0.4692 0.3891 -0.0007 -0.1309 -0.0362 57  THR A N      
94   C  CA     . THR A 20  ? 0.5290 0.4247 0.3464 0.0120  -0.1333 -0.0340 57  THR A CA     
95   C  C      . THR A 20  ? 0.4939 0.3583 0.2973 0.0115  -0.1169 -0.0280 57  THR A C      
96   O  O      . THR A 20  ? 0.4684 0.3232 0.2716 0.0004  -0.1078 -0.0270 57  THR A O      
97   C  CB     . THR A 20  ? 0.6186 0.4999 0.4147 0.0081  -0.1443 -0.0373 57  THR A CB     
98   O  OG1    . THR A 20  ? 0.6123 0.5291 0.4255 0.0059  -0.1599 -0.0436 57  THR A OG1    
99   C  CG2    . THR A 20  ? 0.6100 0.4565 0.3704 0.0218  -0.1474 -0.0350 57  THR A CG2    
100  N  N      . PHE A 21  ? 0.4029 0.2520 0.1934 0.0236  -0.1138 -0.0243 58  PHE A N      
101  C  CA     . PHE A 21  ? 0.3955 0.2179 0.1715 0.0214  -0.0990 -0.0189 58  PHE A CA     
102  C  C      . PHE A 21  ? 0.4754 0.2630 0.2142 0.0248  -0.0996 -0.0170 58  PHE A C      
103  O  O      . PHE A 21  ? 0.5046 0.2779 0.2226 0.0361  -0.1082 -0.0165 58  PHE A O      
104  C  CB     . PHE A 21  ? 0.4073 0.2302 0.1884 0.0284  -0.0941 -0.0158 58  PHE A CB     
105  C  CG     . PHE A 21  ? 0.3950 0.2376 0.2040 0.0210  -0.0841 -0.0151 58  PHE A CG     
106  C  CD1    . PHE A 21  ? 0.4126 0.2883 0.2506 0.0167  -0.0877 -0.0188 58  PHE A CD1    
107  C  CD2    . PHE A 21  ? 0.3933 0.2219 0.1981 0.0173  -0.0714 -0.0110 58  PHE A CD2    
108  C  CE1    . PHE A 21  ? 0.3926 0.2832 0.2523 0.0106  -0.0786 -0.0178 58  PHE A CE1    
109  C  CE2    . PHE A 21  ? 0.3944 0.2403 0.2230 0.0117  -0.0636 -0.0106 58  PHE A CE2    
110  C  CZ     . PHE A 21  ? 0.3605 0.2352 0.2150 0.0092  -0.0672 -0.0138 58  PHE A CZ     
111  N  N      . THR A 22  ? 0.4301 0.2036 0.1580 0.0164  -0.0912 -0.0166 59  THR A N      
112  C  CA     . THR A 22  ? 0.4527 0.1940 0.1440 0.0186  -0.0889 -0.0147 59  THR A CA     
113  C  C      . THR A 22  ? 0.4923 0.2213 0.1762 0.0143  -0.0716 -0.0098 59  THR A C      
114  O  O      . THR A 22  ? 0.4475 0.1847 0.1430 0.0073  -0.0603 -0.0101 59  THR A O      
115  C  CB     . THR A 22  ? 0.5111 0.2461 0.1919 0.0145  -0.0928 -0.0187 59  THR A CB     
116  O  OG1    . THR A 22  ? 0.5251 0.2775 0.2174 0.0154  -0.1095 -0.0235 59  THR A OG1    
117  C  CG2    . THR A 22  ? 0.5098 0.2117 0.1501 0.0182  -0.0908 -0.0172 59  THR A CG2    
118  N  N      . VAL A 23  ? 0.4621 0.1728 0.1271 0.0184  -0.0702 -0.0056 60  VAL A N      
119  C  CA     . VAL A 23  ? 0.4557 0.1575 0.1149 0.0112  -0.0547 -0.0008 60  VAL A CA     
120  C  C      . VAL A 23  ? 0.5312 0.1989 0.1488 0.0094  -0.0490 0.0032  60  VAL A C      
121  O  O      . VAL A 23  ? 0.5486 0.1945 0.1389 0.0173  -0.0595 0.0032  60  VAL A O      
122  C  CB     . VAL A 23  ? 0.4881 0.1976 0.1629 0.0129  -0.0553 0.0010  60  VAL A CB     
123  C  CG1    . VAL A 23  ? 0.4457 0.1900 0.1606 0.0133  -0.0589 -0.0029 60  VAL A CG1    
124  C  CG2    . VAL A 23  ? 0.5174 0.2039 0.1672 0.0249  -0.0675 0.0024  60  VAL A CG2    
125  N  N      . LEU A 24  ? 0.4918 0.1560 0.1041 -0.0015 -0.0325 0.0068  61  LEU A N      
126  C  CA     . LEU A 24  ? 0.5107 0.1443 0.0832 -0.0079 -0.0237 0.0115  61  LEU A CA     
127  C  C      . LEU A 24  ? 0.5857 0.1869 0.1301 -0.0026 -0.0331 0.0154  61  LEU A C      
128  O  O      . LEU A 24  ? 0.5482 0.1561 0.1088 0.0008  -0.0382 0.0155  61  LEU A O      
129  C  CB     . LEU A 24  ? 0.4903 0.1371 0.0713 -0.0230 -0.0045 0.0138  61  LEU A CB     
130  C  CG     . LEU A 24  ? 0.4877 0.1634 0.0887 -0.0256 0.0064  0.0097  61  LEU A CG     
131  C  CD1    . LEU A 24  ? 0.4334 0.1347 0.0557 -0.0376 0.0216  0.0104  61  LEU A CD1    
132  C  CD2    . LEU A 24  ? 0.4710 0.1303 0.0400 -0.0250 0.0117  0.0095  61  LEU A CD2    
133  N  N      . LYS A 25  ? 0.5940 0.1579 0.0935 0.0002  -0.0363 0.0183  62  LYS A N      
134  C  CA     . LYS A 25  ? 0.6063 0.1305 0.0686 0.0086  -0.0472 0.0218  62  LYS A CA     
135  C  C      . LYS A 25  ? 0.6463 0.1524 0.0974 -0.0013 -0.0396 0.0268  62  LYS A C      
136  O  O      . LYS A 25  ? 0.6874 0.1659 0.1167 0.0093  -0.0510 0.0283  62  LYS A O      
137  C  CB     . LYS A 25  ? 0.6569 0.1407 0.0680 0.0118  -0.0504 0.0244  62  LYS A CB     
138  C  CG     . LYS A 25  ? 0.6615 0.1562 0.0784 0.0264  -0.0656 0.0186  62  LYS A CG     
139  C  CD     . LYS A 25  ? 0.7464 0.2027 0.1125 0.0286  -0.0673 0.0208  62  LYS A CD     
140  C  CE     . LYS A 25  ? 0.8112 0.2724 0.1774 0.0449  -0.0872 0.0149  62  LYS A CE     
141  N  NZ     . LYS A 25  ? 0.8611 0.2872 0.1795 0.0464  -0.0879 0.0164  62  LYS A NZ     
142  N  N      . ARG A 26  ? 0.5737 0.0984 0.0489 -0.0203 -0.0217 0.0252  63  ARG A N      
143  C  CA     . ARG A 26  ? 0.5720 0.0870 0.0498 -0.0331 -0.0146 0.0240  63  ARG A CA     
144  C  C      . ARG A 26  ? 0.6238 0.1489 0.1127 -0.0220 -0.0251 0.0298  63  ARG A C      
145  O  O      . ARG A 26  ? 0.6539 0.1554 0.1259 -0.0272 -0.0244 0.0329  63  ARG A O      
146  C  CB     . ARG A 26  ? 0.5500 0.0945 0.0499 -0.0545 0.0046  0.0241  63  ARG A CB     
147  C  CG     . ARG A 26  ? 0.5625 0.1580 0.1010 -0.0519 0.0084  0.0272  63  ARG A CG     
148  C  CD     . ARG A 26  ? 0.5089 0.1361 0.0670 -0.0694 0.0269  0.0268  63  ARG A CD     
149  N  NE     . ARG A 26  ? 0.3832 0.0538 0.0393 -0.0738 0.0209  -0.0045 63  ARG A NE     
150  C  CZ     . ARG A 26  ? 0.5689 0.2233 0.1424 -0.1037 0.0498  0.0294  63  ARG A CZ     
151  N  NH1    . ARG A 26  ? 0.5526 0.2345 0.1353 -0.1057 0.0609  0.0268  63  ARG A NH1    
152  N  NH2    . ARG A 26  ? 0.4450 0.1094 0.0556 -0.1137 0.0443  0.0102  63  ARG A NH2    
153  N  N      . TYR A 27  ? 0.5458 0.1095 0.0764 -0.0089 -0.0333 0.0240  64  TYR A N      
154  C  CA     . TYR A 27  ? 0.5105 0.0951 0.0717 0.0017  -0.0419 0.0207  64  TYR A CA     
155  C  C      . TYR A 27  ? 0.5910 0.1611 0.1374 0.0235  -0.0602 0.0186  64  TYR A C      
156  O  O      . TYR A 27  ? 0.5932 0.1741 0.1438 0.0332  -0.0691 0.0153  64  TYR A O      
157  C  CB     . TYR A 27  ? 0.4646 0.1000 0.0777 0.0001  -0.0386 0.0159  64  TYR A CB     
158  C  CG     . TYR A 27  ? 0.4437 0.0966 0.0718 -0.0179 -0.0216 0.0170  64  TYR A CG     
159  C  CD1    . TYR A 27  ? 0.4645 0.1132 0.0917 -0.0305 -0.0127 0.0198  64  TYR A CD1    
160  C  CD2    . TYR A 27  ? 0.4228 0.0963 0.0636 -0.0216 -0.0150 0.0147  64  TYR A CD2    
161  C  CE1    . TYR A 27  ? 0.4574 0.1284 0.1004 -0.0464 0.0021  0.0199  64  TYR A CE1    
162  C  CE2    . TYR A 27  ? 0.4172 0.1098 0.0705 -0.0350 0.0003  0.0148  64  TYR A CE2    
163  C  CZ     . TYR A 27  ? 0.4618 0.1567 0.1189 -0.0473 0.0086  0.0172  64  TYR A CZ     
164  O  OH     . TYR A 27  ? 0.4127 0.1323 0.0842 -0.0601 0.0229  0.0166  64  TYR A OH     
165  N  N      . GLN A 28  ? 0.5971 0.1407 0.1226 0.0319  -0.0666 0.0200  65  GLN A N      
166  C  CA     . GLN A 28  ? 0.6210 0.1443 0.1232 0.0558  -0.0845 0.0180  65  GLN A CA     
167  C  C      . GLN A 28  ? 0.6437 0.1873 0.1695 0.0714  -0.0928 0.0138  65  GLN A C      
168  O  O      . GLN A 28  ? 0.6092 0.1624 0.1527 0.0621  -0.0842 0.0145  65  GLN A O      
169  C  CB     . GLN A 28  ? 0.7074 0.1650 0.1449 0.0553  -0.0857 0.0240  65  GLN A CB     
170  C  CG     . GLN A 28  ? 0.9075 0.3421 0.3141 0.0450  -0.0805 0.0277  65  GLN A CG     
171  C  CD     . GLN A 28  ? 1.1502 0.5264 0.4999 0.0295  -0.0717 0.0353  65  GLN A CD     
172  O  OE1    . GLN A 28  ? 1.0603 0.3963 0.3772 0.0319  -0.0752 0.0381  65  GLN A OE1    
173  N  NE2    . GLN A 28  ? 1.0714 0.4397 0.4048 0.0126  -0.0599 0.0388  65  GLN A NE2    
174  N  N      . ASN A 29  ? 0.6224 0.1712 0.1447 0.0964  -0.1101 0.0092  66  ASN A N      
175  C  CA     . ASN A 29  ? 0.6218 0.1928 0.1632 0.1168  -0.1200 0.0040  66  ASN A CA     
176  C  C      . ASN A 29  ? 0.5861 0.2139 0.1860 0.1070  -0.1119 0.0006  66  ASN A C      
177  O  O      . ASN A 29  ? 0.5577 0.1907 0.1690 0.1070  -0.1074 0.0003  66  ASN A O      
178  C  CB     . ASN A 29  ? 0.6757 0.1978 0.1762 0.1249  -0.1215 0.0068  66  ASN A CB     
179  C  CG     . ASN A 29  ? 1.0287 0.5630 0.5340 0.1539  -0.1349 0.0008  66  ASN A CG     
180  O  OD1    . ASN A 29  ? 0.9987 0.5220 0.5002 0.1568  -0.1320 0.0007  66  ASN A OD1    
181  N  ND2    . ASN A 29  ? 0.9064 0.4651 0.4194 0.1766  -0.1501 -0.0050 66  ASN A ND2    
182  N  N      . LEU A 30  ? 0.5137 0.1794 0.1463 0.0978  -0.1101 -0.0017 67  LEU A N      
183  C  CA     . LEU A 30  ? 0.4717 0.1856 0.1542 0.0872  -0.1026 -0.0045 67  LEU A CA     
184  C  C      . LEU A 30  ? 0.5145 0.2640 0.2238 0.1037  -0.1107 -0.0102 67  LEU A C      
185  O  O      . LEU A 30  ? 0.5136 0.2750 0.2204 0.1224  -0.1249 -0.0147 67  LEU A O      
186  C  CB     . LEU A 30  ? 0.4472 0.1853 0.1504 0.0746  -0.1002 -0.0059 67  LEU A CB     
187  C  CG     . LEU A 30  ? 0.4824 0.2113 0.1859 0.0533  -0.0844 -0.0017 67  LEU A CG     
188  C  CD1    . LEU A 30  ? 0.5287 0.2123 0.1881 0.0489  -0.0805 0.0033  67  LEU A CD1    
189  C  CD2    . LEU A 30  ? 0.4607 0.2184 0.1898 0.0442  -0.0829 -0.0047 67  LEU A CD2    
190  N  N      . LYS A 31  ? 0.4542 0.2207 0.1870 0.0977  -0.1019 -0.0102 68  LYS A N      
191  C  CA     . LYS A 31  ? 0.4415 0.2433 0.1998 0.1119  -0.1068 -0.0155 68  LYS A CA     
192  C  C      . LYS A 31  ? 0.4577 0.2993 0.2584 0.0957  -0.0964 -0.0164 68  LYS A C      
193  O  O      . LYS A 31  ? 0.4336 0.2620 0.2350 0.0813  -0.0848 -0.0125 68  LYS A O      
194  C  CB     . LYS A 31  ? 0.4955 0.2663 0.2269 0.1271  -0.1084 -0.0148 68  LYS A CB     
195  C  CG     . LYS A 31  ? 0.7636 0.4866 0.4450 0.1452  -0.1198 -0.0138 68  LYS A CG     
196  C  CD     . LYS A 31  ? 1.0358 0.7409 0.6949 0.1705  -0.1276 -0.0166 68  LYS A CD     
197  C  CE     . LYS A 31  ? 1.3125 0.9747 0.9225 0.1928  -0.1423 -0.0169 68  LYS A CE     
198  N  NZ     . LYS A 31  ? 1.4494 1.1033 1.0406 0.2250  -0.1534 -0.0221 68  LYS A NZ     
199  N  N      . PRO A 32  ? 0.4098 0.2997 0.2444 0.0971  -0.1005 -0.0216 69  PRO A N      
200  C  CA     . PRO A 32  ? 0.3641 0.2858 0.2332 0.0809  -0.0904 -0.0219 69  PRO A CA     
201  C  C      . PRO A 32  ? 0.4049 0.3234 0.2773 0.0839  -0.0828 -0.0209 69  PRO A C      
202  O  O      . PRO A 32  ? 0.4224 0.3375 0.2841 0.1031  -0.0883 -0.0233 69  PRO A O      
203  C  CB     . PRO A 32  ? 0.3716 0.3434 0.2698 0.0840  -0.0980 -0.0280 69  PRO A CB     
204  C  CG     . PRO A 32  ? 0.4685 0.4352 0.3496 0.0974  -0.1120 -0.0307 69  PRO A CG     
205  C  CD     . PRO A 32  ? 0.4441 0.3628 0.2860 0.1126  -0.1146 -0.0275 69  PRO A CD     
206  N  N      . ILE A 33  ? 0.3210 0.2372 0.2042 0.0668  -0.0710 -0.0178 70  ILE A N      
207  C  CA     . ILE A 33  ? 0.3035 0.2154 0.1883 0.0688  -0.0644 -0.0171 70  ILE A CA     
208  C  C      . ILE A 33  ? 0.3276 0.2713 0.2431 0.0568  -0.0564 -0.0179 70  ILE A C      
209  O  O      . ILE A 33  ? 0.3181 0.2626 0.2374 0.0579  -0.0510 -0.0177 70  ILE A O      
210  C  CB     . ILE A 33  ? 0.3494 0.2173 0.2068 0.0631  -0.0590 -0.0123 70  ILE A CB     
211  C  CG1    . ILE A 33  ? 0.3196 0.1797 0.1791 0.0433  -0.0512 -0.0087 70  ILE A CG1    
212  C  CG2    . ILE A 33  ? 0.4070 0.2373 0.2266 0.0775  -0.0673 -0.0115 70  ILE A CG2    
213  C  CD1    . ILE A 33  ? 0.3045 0.1323 0.1439 0.0331  -0.0440 -0.0045 70  ILE A CD1    
214  N  N      . GLY A 34  ? 0.2764 0.2421 0.2094 0.0453  -0.0564 -0.0187 71  GLY A N      
215  C  CA     . GLY A 34  ? 0.2555 0.2464 0.2121 0.0326  -0.0497 -0.0192 71  GLY A CA     
216  C  C      . GLY A 34  ? 0.3088 0.2997 0.2700 0.0162  -0.0482 -0.0180 71  GLY A C      
217  O  O      . GLY A 34  ? 0.3219 0.2898 0.2678 0.0135  -0.0496 -0.0162 71  GLY A O      
218  N  N      . SER A 35  ? 0.2544 0.2686 0.2333 0.0052  -0.0451 -0.0192 72  SER A N      
219  C  CA     . SER A 35  ? 0.2560 0.2669 0.2357 -0.0107 -0.0442 -0.0186 72  SER A CA     
220  C  C      . SER A 35  ? 0.3018 0.3198 0.2910 -0.0222 -0.0364 -0.0175 72  SER A C      
221  O  O      . SER A 35  ? 0.2769 0.3115 0.2764 -0.0190 -0.0325 -0.0180 72  SER A O      
222  C  CB     . SER A 35  ? 0.2794 0.3109 0.2651 -0.0145 -0.0531 -0.0222 72  SER A CB     
223  O  OG     . SER A 35  ? 0.3419 0.4127 0.3481 -0.0156 -0.0542 -0.0256 72  SER A OG     
224  N  N      . GLY A 36  ? 0.2810 0.2826 0.2625 -0.0342 -0.0344 -0.0161 73  GLY A N      
225  C  CA     . GLY A 36  ? 0.2869 0.2858 0.2694 -0.0456 -0.0283 -0.0147 73  GLY A CA     
226  C  C      . GLY A 36  ? 0.3519 0.3372 0.3235 -0.0590 -0.0311 -0.0151 73  GLY A C      
227  O  O      . GLY A 36  ? 0.3339 0.3172 0.3005 -0.0595 -0.0378 -0.0169 73  GLY A O      
228  N  N      . ALA A 37  ? 0.3480 0.3191 0.3114 -0.0688 -0.0267 -0.0135 74  ALA A N      
229  C  CA     . ALA A 37  ? 0.3760 0.3256 0.3219 -0.0818 -0.0294 -0.0138 74  ALA A CA     
230  C  C      . ALA A 37  ? 0.4475 0.3705 0.3762 -0.0742 -0.0327 -0.0143 74  ALA A C      
231  O  O      . ALA A 37  ? 0.4700 0.3811 0.3860 -0.0818 -0.0383 -0.0161 74  ALA A O      
232  C  CB     . ALA A 37  ? 0.3962 0.3279 0.3304 -0.0893 -0.0239 -0.0115 74  ALA A CB     
233  N  N      . GLN A 38  ? 0.4110 0.3271 0.3394 -0.0602 -0.0290 -0.0132 75  GLN A N      
234  C  CA     . GLN A 38  ? 0.4224 0.3184 0.3361 -0.0521 -0.0296 -0.0137 75  GLN A CA     
235  C  C      . GLN A 38  ? 0.4806 0.3810 0.3938 -0.0476 -0.0345 -0.0149 75  GLN A C      
236  O  O      . GLN A 38  ? 0.4984 0.3812 0.3953 -0.0459 -0.0366 -0.0161 75  GLN A O      
237  C  CB     . GLN A 38  ? 0.4291 0.3210 0.3439 -0.0418 -0.0230 -0.0124 75  GLN A CB     
238  C  CG     . GLN A 38  ? 0.5600 0.4319 0.4575 -0.0354 -0.0216 -0.0136 75  GLN A CG     
239  C  CD     . GLN A 38  ? 0.5695 0.4473 0.4719 -0.0260 -0.0160 -0.0131 75  GLN A CD     
240  O  OE1    . GLN A 38  ? 0.4504 0.3421 0.3658 -0.0251 -0.0139 -0.0116 75  GLN A OE1    
241  N  NE2    . GLN A 38  ? 0.3901 0.2578 0.2806 -0.0190 -0.0135 -0.0149 75  GLN A NE2    
242  N  N      . GLY A 39  ? 0.4278 0.3483 0.3550 -0.0435 -0.0361 -0.0147 76  GLY A N      
243  C  CA     . GLY A 39  ? 0.4201 0.3409 0.3426 -0.0373 -0.0417 -0.0156 76  GLY A CA     
244  C  C      . GLY A 39  ? 0.4120 0.3506 0.3455 -0.0290 -0.0442 -0.0155 76  GLY A C      
245  O  O      . GLY A 39  ? 0.3728 0.3265 0.3199 -0.0275 -0.0411 -0.0150 76  GLY A O      
246  N  N      . ILE A 40  ? 0.3560 0.2903 0.2802 -0.0223 -0.0506 -0.0163 77  ILE A N      
247  C  CA     . ILE A 40  ? 0.3244 0.2686 0.2512 -0.0109 -0.0555 -0.0168 77  ILE A CA     
248  C  C      . ILE A 40  ? 0.3041 0.2247 0.2151 -0.0034 -0.0507 -0.0136 77  ILE A C      
249  O  O      . ILE A 40  ? 0.3021 0.2024 0.1979 -0.0061 -0.0473 -0.0120 77  ILE A O      
250  C  CB     . ILE A 40  ? 0.3843 0.3362 0.3066 -0.0075 -0.0673 -0.0200 77  ILE A CB     
251  C  CG1    . ILE A 40  ? 0.4026 0.3729 0.3356 -0.0211 -0.0722 -0.0233 77  ILE A CG1    
252  C  CG2    . ILE A 40  ? 0.3789 0.3452 0.3044 0.0077  -0.0742 -0.0217 77  ILE A CG2    
253  C  CD1    . ILE A 40  ? 0.5322 0.5353 0.4892 -0.0289 -0.0703 -0.0250 77  ILE A CD1    
254  N  N      . VAL A 41  ? 0.2110 0.1340 0.1238 0.0053  -0.0504 -0.0129 78  VAL A N      
255  C  CA     . VAL A 41  ? 0.2088 0.1069 0.1037 0.0096  -0.0464 -0.0098 78  VAL A CA     
256  C  C      . VAL A 41  ? 0.2749 0.1627 0.1536 0.0233  -0.0547 -0.0103 78  VAL A C      
257  O  O      . VAL A 41  ? 0.2517 0.1583 0.1404 0.0331  -0.0607 -0.0132 78  VAL A O      
258  C  CB     . VAL A 41  ? 0.2206 0.1199 0.1239 0.0067  -0.0382 -0.0083 78  VAL A CB     
259  C  CG1    . VAL A 41  ? 0.2158 0.0889 0.0991 0.0063  -0.0340 -0.0052 78  VAL A CG1    
260  C  CG2    . VAL A 41  ? 0.1946 0.1038 0.1119 -0.0038 -0.0318 -0.0084 78  VAL A CG2    
261  N  N      . CYS A 42  ? 0.2724 0.1297 0.1238 0.0245  -0.0547 -0.0076 79  CYS A N      
262  C  CA     . CYS A 42  ? 0.3199 0.1556 0.1460 0.0379  -0.0627 -0.0072 79  CYS A CA     
263  C  C      . CYS A 42  ? 0.3671 0.1699 0.1693 0.0349  -0.0564 -0.0031 79  CYS A C      
264  O  O      . CYS A 42  ? 0.3575 0.1547 0.1601 0.0210  -0.0465 -0.0005 79  CYS A O      
265  C  CB     . CYS A 42  ? 0.3588 0.1819 0.1661 0.0407  -0.0699 -0.0074 79  CYS A CB     
266  S  SG     . CYS A 42  ? 0.4077 0.2668 0.2361 0.0468  -0.0823 -0.0133 79  CYS A SG     
267  N  N      . ALA A 43  ? 0.3547 0.1350 0.1336 0.0480  -0.0629 -0.0029 80  ALA A N      
268  C  CA     . ALA A 43  ? 0.3853 0.1238 0.1302 0.0448  -0.0596 0.0012  80  ALA A CA     
269  C  C      . ALA A 43  ? 0.4628 0.1706 0.1732 0.0477  -0.0648 0.0034  80  ALA A C      
270  O  O      . ALA A 43  ? 0.4466 0.1648 0.1585 0.0603  -0.0749 0.0005  80  ALA A O      
271  C  CB     . ALA A 43  ? 0.4135 0.1381 0.1449 0.0609  -0.0661 -0.0004 80  ALA A CB     
272  N  N      . ALA A 44  ? 0.4248 0.0965 0.1042 0.0350  -0.0580 0.0083  81  ALA A N      
273  C  CA     . ALA A 44  ? 0.4507 0.0881 0.0920 0.0351  -0.0609 0.0113  81  ALA A CA     
274  C  C      . ALA A 44  ? 0.5471 0.1406 0.1500 0.0212  -0.0536 0.0168  81  ALA A C      
275  O  O      . ALA A 44  ? 0.5354 0.1336 0.1484 0.0069  -0.0444 0.0179  81  ALA A O      
276  C  CB     . ALA A 44  ? 0.4362 0.0939 0.0922 0.0250  -0.0553 0.0112  81  ALA A CB     
277  N  N      . TYR A 45  ? 0.5495 0.0997 0.1065 0.0242  -0.0581 0.0200  82  TYR A N      
278  C  CA     . TYR A 45  ? 0.5963 0.0989 0.1086 0.0075  -0.0508 0.0259  82  TYR A CA     
279  C  C      . TYR A 45  ? 0.6269 0.1366 0.1379 -0.0107 -0.0392 0.0287  82  TYR A C      
280  O  O      . TYR A 45  ? 0.5960 0.1087 0.1030 -0.0020 -0.0439 0.0277  82  TYR A O      
281  C  CB     . TYR A 45  ? 0.6681 0.1116 0.1226 0.0230  -0.0632 0.0282  82  TYR A CB     
282  C  CG     . TYR A 45  ? 0.7516 0.1391 0.1518 0.0025  -0.0555 0.0352  82  TYR A CG     
283  C  CD1    . TYR A 45  ? 0.7887 0.1610 0.1804 -0.0184 -0.0463 0.0379  82  TYR A CD1    
284  C  CD2    . TYR A 45  ? 0.7942 0.1443 0.1505 0.0017  -0.0570 0.0391  82  TYR A CD2    
285  C  CE1    . TYR A 45  ? 0.8567 0.1804 0.1989 -0.0421 -0.0381 0.0443  82  TYR A CE1    
286  C  CE2    . TYR A 45  ? 0.8597 0.1570 0.1631 -0.0201 -0.0488 0.0460  82  TYR A CE2    
287  C  CZ     . TYR A 45  ? 0.9491 0.2352 0.2468 -0.0435 -0.0387 0.0486  82  TYR A CZ     
288  O  OH     . TYR A 45  ? 1.0167 0.2520 0.2613 -0.0690 -0.0299 0.0555  82  TYR A OH     
289  N  N      . ASP A 46  ? 0.5805 0.0979 0.0977 -0.0351 -0.0242 0.0312  83  ASP A N      
290  C  CA     . ASP A 46  ? 0.5752 0.1012 0.0892 -0.0523 -0.0114 0.0333  83  ASP A CA     
291  C  C      . ASP A 46  ? 0.6752 0.1431 0.1280 -0.0656 -0.0080 0.0399  83  ASP A C      
292  O  O      . ASP A 46  ? 0.6680 0.1177 0.1047 -0.0842 -0.0012 0.0429  83  ASP A O      
293  C  CB     . ASP A 46  ? 0.5535 0.1243 0.1075 -0.0704 0.0029  0.0317  83  ASP A CB     
294  C  CG     . ASP A 46  ? 0.5880 0.1742 0.1407 -0.0873 0.0178  0.0330  83  ASP A CG     
295  O  OD1    . ASP A 46  ? 0.5944 0.1512 0.1104 -0.0888 0.0189  0.0362  83  ASP A OD1    
296  O  OD2    . ASP A 46  ? 0.5510 0.1778 0.1370 -0.0985 0.0286  0.0307  83  ASP A OD2    
297  N  N      . ALA A 47  ? 0.6781 0.1154 0.0949 -0.0571 -0.0133 0.0419  84  ALA A N      
298  C  CA     . ALA A 47  ? 0.7511 0.1277 0.1031 -0.0694 -0.0103 0.0487  84  ALA A CA     
299  C  C      . ALA A 47  ? 0.8020 0.1867 0.1482 -0.1020 0.0106  0.0525  84  ALA A C      
300  O  O      . ALA A 47  ? 0.8387 0.1763 0.1350 -0.1205 0.0161  0.0585  84  ALA A O      
301  C  CB     . ALA A 47  ? 0.7866 0.1347 0.1054 -0.0512 -0.0210 0.0493  84  ALA A CB     
302  N  N      . VAL A 48  ? 0.7105 0.1546 0.1055 -0.1092 0.0222  0.0488  85  VAL A N      
303  C  CA     . VAL A 48  ? 0.7210 0.1837 0.1161 -0.1378 0.0423  0.0510  85  VAL A CA     
304  C  C      . VAL A 48  ? 0.7711 0.2439 0.1784 -0.1593 0.0492  0.0516  85  VAL A C      
305  O  O      . VAL A 48  ? 0.8153 0.2677 0.1918 -0.1866 0.0606  0.0562  85  VAL A O      
306  C  CB     . VAL A 48  ? 0.7074 0.2273 0.1445 -0.1341 0.0516  0.0461  85  VAL A CB     
307  C  CG1    . VAL A 48  ? 0.6960 0.2500 0.1449 -0.1609 0.0724  0.0464  85  VAL A CG1    
308  C  CG2    . VAL A 48  ? 0.7197 0.2205 0.1319 -0.1196 0.0470  0.0464  85  VAL A CG2    
309  N  N      . LEU A 49  ? 0.6901 0.1945 0.1409 -0.1487 0.0427  0.0469  86  LEU A N      
310  C  CA     . LEU A 49  ? 0.6832 0.1981 0.1466 -0.1676 0.0476  0.0467  86  LEU A CA     
311  C  C      . LEU A 49  ? 0.7592 0.2147 0.1803 -0.1681 0.0369  0.0501  86  LEU A C      
312  O  O      . LEU A 49  ? 0.7454 0.1941 0.1597 -0.1900 0.0418  0.0514  86  LEU A O      
313  C  CB     . LEU A 49  ? 0.6143 0.1892 0.1404 -0.1582 0.0468  0.0402  86  LEU A CB     
314  C  CG     . LEU A 49  ? 0.6390 0.2746 0.2061 -0.1630 0.0596  0.0362  86  LEU A CG     
315  C  CD1    . LEU A 49  ? 0.5676 0.2502 0.1882 -0.1481 0.0551  0.0301  86  LEU A CD1    
316  C  CD2    . LEU A 49  ? 0.6954 0.3483 0.2575 -0.1946 0.0764  0.0378  86  LEU A CD2    
317  N  N      . ASP A 50  ? 0.7507 0.1626 0.1411 -0.1436 0.0219  0.0512  87  ASP A N      
318  C  CA     . ASP A 50  ? 0.8098 0.1634 0.1582 -0.1346 0.0088  0.0531  87  ASP A CA     
319  C  C      . ASP A 50  ? 0.8409 0.2231 0.2290 -0.1273 0.0038  0.0482  87  ASP A C      
320  O  O      . ASP A 50  ? 0.8844 0.2367 0.2502 -0.1390 0.0026  0.0495  87  ASP A O      
321  C  CB     . ASP A 50  ? 0.9033 0.1929 0.1856 -0.1619 0.0144  0.0602  87  ASP A CB     
322  C  CG     . ASP A 50  ? 1.0930 0.3118 0.3217 -0.1509 0.0000  0.0622  87  ASP A CG     
323  O  OD1    . ASP A 50  ? 1.1046 0.3055 0.3242 -0.1172 -0.0157 0.0599  87  ASP A OD1    
324  O  OD2    . ASP A 50  ? 1.2115 0.3938 0.4068 -0.1757 0.0039  0.0654  87  ASP A OD2    
325  N  N      . ARG A 51  ? 0.7173 0.1574 0.1630 -0.1101 0.0019  0.0426  88  ARG A N      
326  C  CA     . ARG A 51  ? 0.6715 0.1465 0.1600 -0.1018 -0.0017 0.0377  88  ARG A CA     
327  C  C      . ARG A 51  ? 0.6854 0.1882 0.2057 -0.0716 -0.0122 0.0330  88  ARG A C      
328  O  O      . ARG A 51  ? 0.6367 0.1565 0.1671 -0.0636 -0.0123 0.0323  88  ARG A O      
329  C  CB     . ARG A 51  ? 0.6625 0.1956 0.1987 -0.1204 0.0117  0.0354  88  ARG A CB     
330  C  CG     . ARG A 51  ? 0.8519 0.3795 0.3771 -0.1508 0.0212  0.0374  88  ARG A CG     
331  C  CD     . ARG A 51  ? 0.9675 0.5580 0.5386 -0.1651 0.0343  0.0345  88  ARG A CD     
332  N  NE     . ARG A 51  ? 0.9741 0.6085 0.5934 -0.1562 0.0317  0.0291  88  ARG A NE     
333  C  CZ     . ARG A 51  ? 1.0824 0.7698 0.7410 -0.1660 0.0405  0.0257  88  ARG A CZ     
334  N  NH1    . ARG A 51  ? 0.8726 0.5816 0.5319 -0.1846 0.0532  0.0264  88  ARG A NH1    
335  N  NH2    . ARG A 51  ? 0.7792 0.4992 0.4754 -0.1562 0.0367  0.0212  88  ARG A NH2    
336  N  N      . ASN A 52  ? 0.6217 0.1350 0.1616 -0.0572 -0.0197 0.0293  89  ASN A N      
337  C  CA     . ASN A 52  ? 0.5604 0.1092 0.1363 -0.0328 -0.0278 0.0245  89  ASN A CA     
338  C  C      . ASN A 52  ? 0.4940 0.0993 0.1222 -0.0411 -0.0191 0.0216  89  ASN A C      
339  O  O      . ASN A 52  ? 0.4331 0.0553 0.0764 -0.0568 -0.0113 0.0203  89  ASN A O      
340  C  CB     . ASN A 52  ? 0.6074 0.1457 0.1806 -0.0133 -0.0385 0.0215  89  ASN A CB     
341  C  CG     . ASN A 52  ? 0.8449 0.3229 0.3616 -0.0012 -0.0486 0.0236  89  ASN A CG     
342  O  OD1    . ASN A 52  ? 0.6856 0.1461 0.1803 0.0121  -0.0558 0.0243  89  ASN A OD1    
343  N  ND2    . ASN A 52  ? 0.8310 0.2717 0.3182 -0.0075 -0.0491 0.0249  89  ASN A ND2    
344  N  N      . VAL A 53  ? 0.4236 0.0594 0.0778 -0.0296 -0.0216 0.0190  90  VAL A N      
345  C  CA     . VAL A 53  ? 0.3651 0.0495 0.0633 -0.0342 -0.0150 0.0155  90  VAL A CA     
346  C  C      . VAL A 53  ? 0.3715 0.0832 0.0997 -0.0171 -0.0228 0.0118  90  VAL A C      
347  O  O      . VAL A 53  ? 0.3775 0.0793 0.0958 -0.0008 -0.0334 0.0106  90  VAL A O      
348  C  CB     . VAL A 53  ? 0.3974 0.0891 0.0934 -0.0438 -0.0070 0.0172  90  VAL A CB     
349  C  CG1    . VAL A 53  ? 0.4269 0.1004 0.0982 -0.0651 0.0039  0.0211  90  VAL A CG1    
350  C  CG2    . VAL A 53  ? 0.4022 0.0790 0.0804 -0.0306 -0.0152 0.0172  90  VAL A CG2    
351  N  N      . ALA A 54  ? 0.2847 0.0415 0.0498 -0.0207 -0.0179 0.0058  91  ALA A N      
352  C  CA     . ALA A 54  ? 0.2626 0.0402 0.0560 -0.0108 -0.0225 0.0057  91  ALA A CA     
353  C  C      . ALA A 54  ? 0.3194 0.1114 0.1215 -0.0146 -0.0192 0.0048  91  ALA A C      
354  O  O      . ALA A 54  ? 0.3218 0.1175 0.1239 -0.0255 -0.0100 0.0057  91  ALA A O      
355  C  CB     . ALA A 54  ? 0.2403 0.0400 0.0598 -0.0137 -0.0188 0.0040  91  ALA A CB     
356  N  N      . ILE A 55  ? 0.2874 0.0867 0.0940 -0.0056 -0.0270 0.0026  92  ILE A N      
357  C  CA     . ILE A 55  ? 0.2803 0.0882 0.0907 -0.0079 -0.0260 0.0011  92  ILE A CA     
358  C  C      . ILE A 55  ? 0.2998 0.1333 0.1367 -0.0054 -0.0299 -0.0024 92  ILE A C      
359  O  O      . ILE A 55  ? 0.2899 0.1321 0.1338 0.0019  -0.0386 -0.0042 92  ILE A O      
360  C  CB     . ILE A 55  ? 0.3410 0.1284 0.1252 -0.0027 -0.0325 0.0017  92  ILE A CB     
361  C  CG1    . ILE A 55  ? 0.3781 0.1336 0.1291 -0.0068 -0.0283 0.0060  92  ILE A CG1    
362  C  CG2    . ILE A 55  ? 0.3313 0.1252 0.1170 -0.0053 -0.0312 -0.0003 92  ILE A CG2    
363  C  CD1    . ILE A 55  ? 0.4564 0.1856 0.1758 0.0002  -0.0360 0.0071  92  ILE A CD1    
364  N  N      . LYS A 56  ? 0.2521 0.0976 0.1017 -0.0114 -0.0236 -0.0035 93  LYS A N      
365  C  CA     . LYS A 56  ? 0.2255 0.0881 0.0935 -0.0118 -0.0266 -0.0063 93  LYS A CA     
366  C  C      . LYS A 56  ? 0.2804 0.1376 0.1393 -0.0129 -0.0290 -0.0083 93  LYS A C      
367  O  O      . LYS A 56  ? 0.2741 0.1229 0.1220 -0.0144 -0.0227 -0.0082 93  LYS A O      
368  C  CB     . LYS A 56  ? 0.2268 0.1011 0.1107 -0.0158 -0.0195 -0.0065 93  LYS A CB     
369  C  CG     . LYS A 56  ? 0.1999 0.0853 0.0968 -0.0178 -0.0223 -0.0088 93  LYS A CG     
370  C  CD     . LYS A 56  ? 0.3289 0.2240 0.2397 -0.0197 -0.0175 -0.0086 93  LYS A CD     
371  C  CE     . LYS A 56  ? 0.4063 0.2990 0.3144 -0.0199 -0.0110 -0.0093 93  LYS A CE     
372  N  NZ     . LYS A 56  ? 0.3592 0.2600 0.2787 -0.0203 -0.0083 -0.0094 93  LYS A NZ     
373  N  N      . LYS A 57  ? 0.2355 0.0994 0.0992 -0.0127 -0.0380 -0.0107 94  LYS A N      
374  C  CA     . LYS A 57  ? 0.2326 0.0890 0.0859 -0.0152 -0.0422 -0.0132 94  LYS A CA     
375  C  C      . LYS A 57  ? 0.2700 0.1330 0.1340 -0.0216 -0.0412 -0.0151 94  LYS A C      
376  O  O      . LYS A 57  ? 0.2374 0.1164 0.1183 -0.0253 -0.0432 -0.0154 94  LYS A O      
377  C  CB     . LYS A 57  ? 0.2605 0.1198 0.1098 -0.0130 -0.0544 -0.0152 94  LYS A CB     
378  C  CG     . LYS A 57  ? 0.3562 0.2055 0.1920 -0.0170 -0.0606 -0.0182 94  LYS A CG     
379  C  CD     . LYS A 57  ? 0.4166 0.2772 0.2544 -0.0166 -0.0741 -0.0211 94  LYS A CD     
380  C  CE     . LYS A 57  ? 0.4667 0.3151 0.2890 -0.0227 -0.0812 -0.0245 94  LYS A CE     
381  N  NZ     . LYS A 57  ? 0.4986 0.3653 0.3277 -0.0250 -0.0955 -0.0282 94  LYS A NZ     
382  N  N      . LEU A 58  ? 0.2559 0.1044 0.1064 -0.0223 -0.0381 -0.0165 95  LEU A N      
383  C  CA     . LEU A 58  ? 0.2510 0.0947 0.1010 -0.0272 -0.0384 -0.0184 95  LEU A CA     
384  C  C      . LEU A 58  ? 0.3430 0.1714 0.1749 -0.0310 -0.0468 -0.0213 95  LEU A C      
385  O  O      . LEU A 58  ? 0.3628 0.1751 0.1751 -0.0256 -0.0459 -0.0225 95  LEU A O      
386  C  CB     . LEU A 58  ? 0.2467 0.0824 0.0906 -0.0216 -0.0295 -0.0187 95  LEU A CB     
387  C  CG     . LEU A 58  ? 0.2947 0.1458 0.1545 -0.0183 -0.0212 -0.0163 95  LEU A CG     
388  C  CD1    . LEU A 58  ? 0.3071 0.1554 0.1617 -0.0117 -0.0144 -0.0180 95  LEU A CD1    
389  C  CD2    . LEU A 58  ? 0.2606 0.1255 0.1394 -0.0231 -0.0228 -0.0148 95  LEU A CD2    
390  N  N      . SER A 59  ? 0.3177 0.1531 0.1556 -0.0411 -0.0550 -0.0228 96  SER A N      
391  C  CA     . SER A 59  ? 0.3466 0.1688 0.1677 -0.0480 -0.0648 -0.0261 96  SER A CA     
392  C  C      . SER A 59  ? 0.3840 0.1808 0.1860 -0.0535 -0.0642 -0.0279 96  SER A C      
393  O  O      . SER A 59  ? 0.3580 0.1577 0.1670 -0.0626 -0.0634 -0.0273 96  SER A O      
394  C  CB     . SER A 59  ? 0.4265 0.2732 0.2642 -0.0583 -0.0742 -0.0276 96  SER A CB     
395  O  OG     . SER A 59  ? 0.5905 0.4602 0.4448 -0.0498 -0.0751 -0.0263 96  SER A OG     
396  N  N      . ARG A 60  ? 0.3856 0.1545 0.1599 -0.0472 -0.0647 -0.0302 97  ARG A N      
397  C  CA     . ARG A 60  ? 0.4150 0.1508 0.1617 -0.0479 -0.0652 -0.0328 97  ARG A CA     
398  C  C      . ARG A 60  ? 0.4648 0.2008 0.2187 -0.0453 -0.0576 -0.0309 97  ARG A C      
399  O  O      . ARG A 60  ? 0.4742 0.2013 0.2243 -0.0573 -0.0609 -0.0308 97  ARG A O      
400  C  CB     . ARG A 60  ? 0.4330 0.1524 0.1634 -0.0648 -0.0772 -0.0357 97  ARG A CB     
401  C  CG     . ARG A 60  ? 0.5049 0.2255 0.2279 -0.0669 -0.0867 -0.0382 97  ARG A CG     
402  C  CD     . ARG A 60  ? 0.4608 0.1666 0.1673 -0.0859 -0.0994 -0.0418 97  ARG A CD     
403  N  NE     . ARG A 60  ? 0.5155 0.1741 0.1823 -0.0867 -0.1011 -0.0446 97  ARG A NE     
404  C  CZ     . ARG A 60  ? 0.7436 0.3703 0.3775 -0.0763 -0.1034 -0.0479 97  ARG A CZ     
405  N  NH1    . ARG A 60  ? 0.6146 0.2515 0.2503 -0.0659 -0.1040 -0.0484 97  ARG A NH1    
406  N  NH2    . ARG A 60  ? 0.6493 0.2306 0.2446 -0.0755 -0.1053 -0.0508 97  ARG A NH2    
407  N  N      . PRO A 61  ? 0.3678 0.1164 0.1331 -0.0316 -0.0477 -0.0293 98  PRO A N      
408  C  CA     . PRO A 61  ? 0.3448 0.0970 0.1188 -0.0289 -0.0421 -0.0278 98  PRO A CA     
409  C  C      . PRO A 61  ? 0.4086 0.1258 0.1526 -0.0254 -0.0440 -0.0304 98  PRO A C      
410  O  O      . PRO A 61  ? 0.3989 0.1115 0.1436 -0.0267 -0.0426 -0.0292 98  PRO A O      
411  C  CB     . PRO A 61  ? 0.3299 0.1032 0.1192 -0.0157 -0.0325 -0.0267 98  PRO A CB     
412  C  CG     . PRO A 61  ? 0.3988 0.1663 0.1741 -0.0089 -0.0317 -0.0285 98  PRO A CG     
413  C  CD     . PRO A 61  ? 0.3548 0.1154 0.1244 -0.0200 -0.0414 -0.0288 98  PRO A CD     
414  N  N      . PHE A 62  ? 0.4197 0.1089 0.1336 -0.0200 -0.0477 -0.0341 99  PHE A N      
415  C  CA     . PHE A 62  ? 0.4549 0.1018 0.1309 -0.0143 -0.0512 -0.0375 99  PHE A CA     
416  C  C      . PHE A 62  ? 0.5377 0.1561 0.1940 -0.0354 -0.0609 -0.0374 99  PHE A C      
417  O  O      . PHE A 62  ? 0.5604 0.1352 0.1784 -0.0332 -0.0653 -0.0400 99  PHE A O      
418  C  CB     . PHE A 62  ? 0.4988 0.1266 0.1482 0.0009  -0.0511 -0.0422 99  PHE A CB     
419  C  CG     . PHE A 62  ? 0.5093 0.1401 0.1578 -0.0083 -0.0562 -0.0426 99  PHE A CG     
420  C  CD1    . PHE A 62  ? 0.5370 0.1400 0.1627 -0.0238 -0.0674 -0.0444 99  PHE A CD1    
421  C  CD2    . PHE A 62  ? 0.4877 0.1489 0.1573 -0.0031 -0.0505 -0.0412 99  PHE A CD2    
422  C  CE1    . PHE A 62  ? 0.5565 0.1659 0.1833 -0.0319 -0.0737 -0.0451 99  PHE A CE1    
423  C  CE2    . PHE A 62  ? 0.5162 0.1786 0.1831 -0.0105 -0.0564 -0.0414 99  PHE A CE2    
424  C  CZ     . PHE A 62  ? 0.5179 0.1557 0.1641 -0.0236 -0.0683 -0.0437 99  PHE A CZ     
425  N  N      . GLN A 63  ? 0.4937 0.1366 0.1740 -0.0557 -0.0644 -0.0348 100 GLN A N      
426  C  CA     . GLN A 63  ? 0.5164 0.1433 0.1841 -0.0803 -0.0728 -0.0348 100 GLN A CA     
427  C  C      . GLN A 63  ? 0.5978 0.1954 0.2448 -0.0873 -0.0722 -0.0332 100 GLN A C      
428  O  O      . GLN A 63  ? 0.6335 0.1950 0.2486 -0.1038 -0.0794 -0.0344 100 GLN A O      
429  C  CB     . GLN A 63  ? 0.4909 0.1618 0.1950 -0.0972 -0.0750 -0.0328 100 GLN A CB     
430  C  CG     . GLN A 63  ? 0.4316 0.1406 0.1722 -0.0965 -0.0673 -0.0289 100 GLN A CG     
431  C  CD     . GLN A 63  ? 0.6025 0.3536 0.3746 -0.1082 -0.0706 -0.0285 100 GLN A CD     
432  O  OE1    . GLN A 63  ? 0.5598 0.3222 0.3381 -0.1285 -0.0740 -0.0284 100 GLN A OE1    
433  N  NE2    . GLN A 63  ? 0.3821 0.1566 0.1720 -0.0956 -0.0702 -0.0287 100 GLN A NE2    
434  N  N      . ASN A 64  ? 0.5313 0.1416 0.1931 -0.0758 -0.0643 -0.0306 101 ASN A N      
435  C  CA     . ASN A 64  ? 0.5706 0.1484 0.2077 -0.0786 -0.0639 -0.0291 101 ASN A CA     
436  C  C      . ASN A 64  ? 0.6136 0.1971 0.2566 -0.0532 -0.0569 -0.0288 101 ASN A C      
437  O  O      . ASN A 64  ? 0.5465 0.1669 0.2197 -0.0396 -0.0513 -0.0290 101 ASN A O      
438  C  CB     . ASN A 64  ? 0.5754 0.1667 0.2258 -0.1052 -0.0636 -0.0252 101 ASN A CB     
439  C  CG     . ASN A 64  ? 0.6286 0.2754 0.3277 -0.1059 -0.0567 -0.0221 101 ASN A CG     
440  O  OD1    . ASN A 64  ? 0.5294 0.1893 0.2427 -0.0909 -0.0502 -0.0204 101 ASN A OD1    
441  N  ND2    . ASN A 64  ? 0.5431 0.2229 0.2667 -0.1236 -0.0588 -0.0218 101 ASN A ND2    
442  N  N      . GLN A 65  ? 0.6212 0.1677 0.2334 -0.0479 -0.0579 -0.0286 102 GLN A N      
443  C  CA     . GLN A 65  ? 0.6302 0.1783 0.2425 -0.0233 -0.0536 -0.0292 102 GLN A CA     
444  C  C      . GLN A 65  ? 0.6000 0.1998 0.2591 -0.0214 -0.0460 -0.0261 102 GLN A C      
445  O  O      . GLN A 65  ? 0.5689 0.1921 0.2443 -0.0009 -0.0416 -0.0280 102 GLN A O      
446  C  CB     . GLN A 65  ? 0.7122 0.2077 0.2802 -0.0230 -0.0578 -0.0285 102 GLN A CB     
447  C  CG     . GLN A 65  ? 1.0451 0.5208 0.5901 0.0096  -0.0584 -0.0325 102 GLN A CG     
448  C  CD     . GLN A 65  ? 1.2937 0.7340 0.8013 0.0269  -0.0635 -0.0386 102 GLN A CD     
449  O  OE1    . GLN A 65  ? 1.2243 0.6723 0.7295 0.0565  -0.0618 -0.0434 102 GLN A OE1    
450  N  NE2    . GLN A 65  ? 1.2444 0.6469 0.7214 0.0091  -0.0698 -0.0391 102 GLN A NE2    
451  N  N      . THR A 66  ? 0.5470 0.1658 0.2268 -0.0431 -0.0444 -0.0218 103 THR A N      
452  C  CA     . THR A 66  ? 0.5160 0.1795 0.2365 -0.0433 -0.0378 -0.0188 103 THR A CA     
453  C  C      . THR A 66  ? 0.5436 0.2488 0.2988 -0.0366 -0.0344 -0.0197 103 THR A C      
454  O  O      . THR A 66  ? 0.5168 0.2455 0.2914 -0.0228 -0.0295 -0.0199 103 THR A O      
455  C  CB     . THR A 66  ? 0.6900 0.3609 0.4188 -0.0674 -0.0368 -0.0148 103 THR A CB     
456  O  OG1    . THR A 66  ? 0.8052 0.4296 0.4939 -0.0757 -0.0399 -0.0137 103 THR A OG1    
457  C  CG2    . THR A 66  ? 0.6095 0.3183 0.3723 -0.0653 -0.0303 -0.0121 103 THR A CG2    
458  N  N      . HIS A 67  ? 0.5154 0.2288 0.2765 -0.0472 -0.0373 -0.0204 104 HIS A N      
459  C  CA     . HIS A 67  ? 0.4885 0.2343 0.2756 -0.0409 -0.0347 -0.0209 104 HIS A CA     
460  C  C      . HIS A 67  ? 0.4808 0.2206 0.2578 -0.0209 -0.0322 -0.0240 104 HIS A C      
461  O  O      . HIS A 67  ? 0.4411 0.2082 0.2395 -0.0124 -0.0268 -0.0237 104 HIS A O      
462  C  CB     . HIS A 67  ? 0.5203 0.2716 0.3099 -0.0540 -0.0403 -0.0216 104 HIS A CB     
463  C  CG     . HIS A 67  ? 0.5692 0.3438 0.3792 -0.0716 -0.0416 -0.0194 104 HIS A CG     
464  N  ND1    . HIS A 67  ? 0.5711 0.3796 0.4114 -0.0696 -0.0367 -0.0171 104 HIS A ND1    
465  C  CD2    . HIS A 67  ? 0.6261 0.3963 0.4294 -0.0910 -0.0473 -0.0199 104 HIS A CD2    
466  C  CE1    . HIS A 67  ? 0.5665 0.3923 0.4185 -0.0853 -0.0390 -0.0165 104 HIS A CE1    
467  N  NE2    . HIS A 67  ? 0.6015 0.4081 0.4338 -0.0999 -0.0452 -0.0181 104 HIS A NE2    
468  N  N      . ALA A 68  ? 0.4391 0.1429 0.1817 -0.0140 -0.0360 -0.0273 105 ALA A N      
469  C  CA     . ALA A 68  ? 0.4464 0.1445 0.1756 0.0065  -0.0336 -0.0315 105 ALA A CA     
470  C  C      . ALA A 68  ? 0.4952 0.2107 0.2352 0.0238  -0.0278 -0.0325 105 ALA A C      
471  O  O      . ALA A 68  ? 0.4691 0.2122 0.2256 0.0337  -0.0218 -0.0339 105 ALA A O      
472  C  CB     . ALA A 68  ? 0.4983 0.1495 0.1838 0.0110  -0.0401 -0.0353 105 ALA A CB     
473  N  N      . LYS A 69  ? 0.4761 0.1760 0.2059 0.0264  -0.0298 -0.0318 106 LYS A N      
474  C  CA     . LYS A 69  ? 0.4728 0.1895 0.2120 0.0430  -0.0263 -0.0333 106 LYS A CA     
475  C  C      . LYS A 69  ? 0.4678 0.2313 0.2486 0.0374  -0.0199 -0.0306 106 LYS A C      
476  O  O      . LYS A 69  ? 0.4448 0.2358 0.2402 0.0494  -0.0150 -0.0331 106 LYS A O      
477  C  CB     . LYS A 69  ? 0.5358 0.2241 0.2552 0.0426  -0.0307 -0.0318 106 LYS A CB     
478  C  CG     . LYS A 69  ? 0.8396 0.5405 0.5631 0.0622  -0.0297 -0.0340 106 LYS A CG     
479  C  CD     . LYS A 69  ? 1.0581 0.7334 0.7479 0.0881  -0.0336 -0.0402 106 LYS A CD     
480  C  CE     . LYS A 69  ? 1.1987 0.8870 0.8909 0.1088  -0.0346 -0.0431 106 LYS A CE     
481  N  NZ     . LYS A 69  ? 1.2832 0.9381 0.9541 0.1041  -0.0400 -0.0397 106 LYS A NZ     
482  N  N      . ARG A 70  ? 0.3927 0.1651 0.1908 0.0189  -0.0200 -0.0260 107 ARG A N      
483  C  CA     . ARG A 70  ? 0.3581 0.1669 0.1894 0.0136  -0.0151 -0.0235 107 ARG A CA     
484  C  C      . ARG A 70  ? 0.3814 0.2102 0.2240 0.0156  -0.0110 -0.0245 107 ARG A C      
485  O  O      . ARG A 70  ? 0.3604 0.2144 0.2193 0.0208  -0.0059 -0.0251 107 ARG A O      
486  C  CB     . ARG A 70  ? 0.3674 0.1811 0.2117 -0.0035 -0.0162 -0.0192 107 ARG A CB     
487  C  CG     . ARG A 70  ? 0.4080 0.2527 0.2805 -0.0055 -0.0119 -0.0171 107 ARG A CG     
488  C  CD     . ARG A 70  ? 0.4902 0.3428 0.3752 -0.0184 -0.0126 -0.0140 107 ARG A CD     
489  N  NE     . ARG A 70  ? 0.4796 0.3560 0.3856 -0.0188 -0.0097 -0.0127 107 ARG A NE     
490  C  CZ     . ARG A 70  ? 0.6454 0.5337 0.5642 -0.0254 -0.0097 -0.0107 107 ARG A CZ     
491  N  NH1    . ARG A 70  ? 0.5408 0.4260 0.4579 -0.0340 -0.0115 -0.0098 107 ARG A NH1    
492  N  NH2    . ARG A 70  ? 0.4897 0.3925 0.4211 -0.0237 -0.0078 -0.0099 107 ARG A NH2    
493  N  N      . ALA A 71  ? 0.3244 0.1409 0.1559 0.0107  -0.0134 -0.0248 108 ALA A N      
494  C  CA     . ALA A 71  ? 0.3214 0.1517 0.1581 0.0122  -0.0095 -0.0253 108 ALA A CA     
495  C  C      . ALA A 71  ? 0.3769 0.2161 0.2082 0.0274  -0.0039 -0.0293 108 ALA A C      
496  O  O      . ALA A 71  ? 0.3279 0.1917 0.1733 0.0275  0.0027  -0.0290 108 ALA A O      
497  C  CB     . ALA A 71  ? 0.3469 0.1585 0.1678 0.0059  -0.0146 -0.0256 108 ALA A CB     
498  N  N      . TYR A 72  ? 0.3840 0.2032 0.1930 0.0403  -0.0064 -0.0334 109 TYR A N      
499  C  CA     . TYR A 72  ? 0.4155 0.2470 0.2189 0.0583  -0.0012 -0.0385 109 TYR A CA     
500  C  C      . TYR A 72  ? 0.4469 0.3131 0.2742 0.0640  0.0035  -0.0394 109 TYR A C      
501  O  O      . TYR A 72  ? 0.4346 0.3328 0.2764 0.0666  0.0111  -0.0411 109 TYR A O      
502  C  CB     . TYR A 72  ? 0.4795 0.2764 0.2483 0.0739  -0.0064 -0.0433 109 TYR A CB     
503  C  CG     . TYR A 72  ? 0.5277 0.3411 0.2909 0.0969  -0.0014 -0.0499 109 TYR A CG     
504  C  CD1    . TYR A 72  ? 0.5601 0.3859 0.3192 0.1028  0.0051  -0.0529 109 TYR A CD1    
505  C  CD2    . TYR A 72  ? 0.5506 0.3701 0.3126 0.1136  -0.0031 -0.0534 109 TYR A CD2    
506  C  CE1    . TYR A 72  ? 0.5946 0.4424 0.3505 0.1247  0.0109  -0.0597 109 TYR A CE1    
507  C  CE2    . TYR A 72  ? 0.5760 0.4180 0.3355 0.1371  0.0012  -0.0605 109 TYR A CE2    
508  C  CZ     . TYR A 72  ? 0.6793 0.5379 0.4372 0.1422  0.0088  -0.0638 109 TYR A CZ     
509  O  OH     . TYR A 72  ? 0.7470 0.6345 0.5048 0.1657  0.0141  -0.0714 109 TYR A OH     
510  N  N      . ARG A 73  ? 0.3947 0.2547 0.2248 0.0642  -0.0010 -0.0382 110 ARG A N      
511  C  CA     . ARG A 73  ? 0.3899 0.2794 0.2404 0.0692  0.0011  -0.0392 110 ARG A CA     
512  C  C      . ARG A 73  ? 0.4168 0.3384 0.2960 0.0541  0.0070  -0.0359 110 ARG A C      
513  O  O      . ARG A 73  ? 0.4052 0.3602 0.3005 0.0576  0.0121  -0.0385 110 ARG A O      
514  C  CB     . ARG A 73  ? 0.3658 0.2352 0.2091 0.0697  -0.0055 -0.0375 110 ARG A CB     
515  C  CG     . ARG A 73  ? 0.5793 0.4752 0.4392 0.0772  -0.0054 -0.0394 110 ARG A CG     
516  C  CD     . ARG A 73  ? 0.6936 0.5619 0.5369 0.0817  -0.0124 -0.0383 110 ARG A CD     
517  N  NE     . ARG A 73  ? 0.7476 0.6406 0.6081 0.0854  -0.0132 -0.0391 110 ARG A NE     
518  C  CZ     . ARG A 73  ? 0.8582 0.7591 0.7353 0.0707  -0.0125 -0.0348 110 ARG A CZ     
519  N  NH1    . ARG A 73  ? 0.6062 0.4958 0.4867 0.0528  -0.0107 -0.0295 110 ARG A NH1    
520  N  NH2    . ARG A 73  ? 0.7461 0.6672 0.6356 0.0751  -0.0143 -0.0363 110 ARG A NH2    
521  N  N      . GLU A 74  ? 0.3493 0.2603 0.2324 0.0378  0.0061  -0.0307 111 GLU A N      
522  C  CA     . GLU A 74  ? 0.3129 0.2444 0.2153 0.0247  0.0105  -0.0275 111 GLU A CA     
523  C  C      . GLU A 74  ? 0.3580 0.3062 0.2615 0.0232  0.0178  -0.0286 111 GLU A C      
524  O  O      . GLU A 74  ? 0.3202 0.2937 0.2383 0.0173  0.0231  -0.0285 111 GLU A O      
525  C  CB     A GLU A 74  ? 0.3234 0.2376 0.2250 0.0121  0.0068  -0.0227 111 GLU A CB     
526  C  CB     B GLU A 74  ? 0.3186 0.2359 0.2239 0.0120  0.0066  -0.0225 111 GLU A CB     
527  C  CG     A GLU A 74  ? 0.3992 0.3081 0.3075 0.0075  0.0026  -0.0203 111 GLU A CG     
528  C  CG     B GLU A 74  ? 0.3640 0.2746 0.2719 0.0124  0.0023  -0.0216 111 GLU A CG     
529  C  CD     A GLU A 74  ? 0.4961 0.3944 0.4051 -0.0027 -0.0009 -0.0168 111 GLU A CD     
530  C  CD     B GLU A 74  ? 0.3988 0.3082 0.3165 0.0015  0.0005  -0.0176 111 GLU A CD     
531  O  OE1    A GLU A 74  ? 0.1846 0.0754 0.0864 -0.0057 -0.0022 -0.0164 111 GLU A OE1    
532  O  OE1    B GLU A 74  ? 0.1322 0.0475 0.0568 0.0018  -0.0010 -0.0133 111 GLU A OE1    
533  O  OE2    A GLU A 74  ? 0.4112 0.3105 0.3277 -0.0069 -0.0026 -0.0149 111 GLU A OE2    
534  O  OE2    B GLU A 74  ? 0.3215 0.2291 0.2408 -0.0057 0.0002  -0.0154 111 GLU A OE2    
535  N  N      . LEU A 75  ? 0.3517 0.2847 0.2375 0.0275  0.0183  -0.0299 112 LEU A N      
536  C  CA     . LEU A 75  ? 0.3693 0.3143 0.2506 0.0269  0.0260  -0.0311 112 LEU A CA     
537  C  C      . LEU A 75  ? 0.4354 0.4150 0.3267 0.0359  0.0333  -0.0361 112 LEU A C      
538  O  O      . LEU A 75  ? 0.4289 0.4337 0.3300 0.0271  0.0415  -0.0357 112 LEU A O      
539  C  CB     . LEU A 75  ? 0.3980 0.3171 0.2546 0.0336  0.0238  -0.0327 112 LEU A CB     
540  C  CG     . LEU A 75  ? 0.4742 0.3695 0.3211 0.0226  0.0189  -0.0285 112 LEU A CG     
541  C  CD1    . LEU A 75  ? 0.5001 0.3673 0.3214 0.0297  0.0140  -0.0312 112 LEU A CD1    
542  C  CD2    . LEU A 75  ? 0.5227 0.4277 0.3710 0.0127  0.0254  -0.0255 112 LEU A CD2    
543  N  N      . VAL A 76  ? 0.4081 0.3887 0.2951 0.0535  0.0300  -0.0412 113 VAL A N      
544  C  CA     . VAL A 76  ? 0.4121 0.4295 0.3095 0.0668  0.0349  -0.0475 113 VAL A CA     
545  C  C      . VAL A 76  ? 0.4476 0.4978 0.3721 0.0564  0.0363  -0.0465 113 VAL A C      
546  O  O      . VAL A 76  ? 0.4489 0.5367 0.3881 0.0501  0.0445  -0.0484 113 VAL A O      
547  C  CB     . VAL A 76  ? 0.4727 0.4749 0.3525 0.0915  0.0285  -0.0532 113 VAL A CB     
548  C  CG1    . VAL A 76  ? 0.4670 0.5114 0.3608 0.1081  0.0310  -0.0604 113 VAL A CG1    
549  C  CG2    . VAL A 76  ? 0.4971 0.4710 0.3478 0.1020  0.0286  -0.0556 113 VAL A CG2    
550  N  N      . LEU A 77  ? 0.3908 0.4260 0.3199 0.0525  0.0286  -0.0435 114 LEU A N      
551  C  CA     . LEU A 77  ? 0.3743 0.4341 0.3249 0.0434  0.0282  -0.0428 114 LEU A CA     
552  C  C      . LEU A 77  ? 0.4326 0.5047 0.3941 0.0210  0.0343  -0.0386 114 LEU A C      
553  O  O      . LEU A 77  ? 0.4327 0.5380 0.4108 0.0139  0.0376  -0.0406 114 LEU A O      
554  C  CB     . LEU A 77  ? 0.3655 0.4022 0.3143 0.0443  0.0192  -0.0402 114 LEU A CB     
555  C  CG     . LEU A 77  ? 0.4389 0.4628 0.3744 0.0653  0.0125  -0.0443 114 LEU A CG     
556  C  CD1    . LEU A 77  ? 0.4276 0.4277 0.3592 0.0625  0.0052  -0.0408 114 LEU A CD1    
557  C  CD2    . LEU A 77  ? 0.4826 0.5447 0.4275 0.0822  0.0136  -0.0519 114 LEU A CD2    
558  N  N      . MET A 78  ? 0.4098 0.4552 0.3595 0.0102  0.0354  -0.0334 115 MET A N      
559  C  CA     . MET A 78  ? 0.4192 0.4667 0.3705 -0.0096 0.0405  -0.0291 115 MET A CA     
560  C  C      . MET A 78  ? 0.5366 0.6166 0.4921 -0.0165 0.0513  -0.0317 115 MET A C      
561  O  O      . MET A 78  ? 0.5338 0.6180 0.4898 -0.0354 0.0559  -0.0286 115 MET A O      
562  C  CB     . MET A 78  ? 0.4443 0.4556 0.3786 -0.0150 0.0380  -0.0239 115 MET A CB     
563  C  CG     . MET A 78  ? 0.4580 0.4471 0.3935 -0.0177 0.0298  -0.0203 115 MET A CG     
564  S  SD     . MET A 78  ? 0.4980 0.4526 0.4172 -0.0213 0.0250  -0.0155 115 MET A SD     
565  C  CE     . MET A 78  ? 0.4740 0.4184 0.3793 -0.0097 0.0243  -0.0184 115 MET A CE     
566  N  N      . LYS A 79  ? 0.5291 0.6304 0.4847 -0.0015 0.0555  -0.0375 116 LYS A N      
567  C  CA     . LYS A 79  ? 0.5451 0.6860 0.5069 -0.0050 0.0669  -0.0415 116 LYS A CA     
568  C  C      . LYS A 79  ? 0.6172 0.8050 0.6028 0.0013  0.0668  -0.0480 116 LYS A C      
569  O  O      . LYS A 79  ? 0.6200 0.8478 0.6202 -0.0125 0.0745  -0.0500 116 LYS A O      
570  C  CB     . LYS A 79  ? 0.5971 0.7332 0.5426 0.0114  0.0713  -0.0449 116 LYS A CB     
571  N  N      . CYS A 80  ? 0.5828 0.7644 0.5709 0.0209  0.0572  -0.0512 117 CYS A N      
572  C  CA     . CYS A 80  ? 0.5712 0.7917 0.5789 0.0312  0.0537  -0.0576 117 CYS A CA     
573  C  C      . CYS A 80  ? 0.5934 0.8072 0.6116 0.0160  0.0470  -0.0538 117 CYS A C      
574  O  O      . CYS A 80  ? 0.6092 0.8160 0.6293 0.0285  0.0377  -0.0555 117 CYS A O      
575  C  CB     . CYS A 80  ? 0.5884 0.7979 0.5855 0.0619  0.0463  -0.0629 117 CYS A CB     
576  N  N      . VAL A 81  ? 0.5024 0.7127 0.5223 -0.0106 0.0516  -0.0486 118 VAL A N      
577  C  CA     . VAL A 81  ? 0.4603 0.6602 0.4852 -0.0280 0.0465  -0.0447 118 VAL A CA     
578  C  C      . VAL A 81  ? 0.4440 0.6437 0.4650 -0.0563 0.0541  -0.0405 118 VAL A C      
579  O  O      . VAL A 81  ? 0.4248 0.6010 0.4292 -0.0624 0.0594  -0.0362 118 VAL A O      
580  C  CB     . VAL A 81  ? 0.4963 0.6480 0.5088 -0.0225 0.0373  -0.0397 118 VAL A CB     
581  N  N      . ASN A 82  ? 0.3739 0.5956 0.4064 -0.0742 0.0536  -0.0415 119 ASN A N      
582  C  CA     . ASN A 82  ? 0.3720 0.5872 0.3952 -0.1038 0.0598  -0.0374 119 ASN A CA     
583  C  C      . ASN A 82  ? 0.3880 0.5932 0.4122 -0.1192 0.0524  -0.0361 119 ASN A C      
584  O  O      . ASN A 82  ? 0.3948 0.6394 0.4357 -0.1302 0.0522  -0.0409 119 ASN A O      
585  C  CB     . ASN A 82  ? 0.3412 0.6053 0.3743 -0.1168 0.0719  -0.0413 119 ASN A CB     
586  C  CG     . ASN A 82  ? 0.6071 0.8628 0.6264 -0.1506 0.0791  -0.0368 119 ASN A CG     
587  O  OD1    . ASN A 82  ? 0.5101 0.7144 0.5023 -0.1601 0.0789  -0.0296 119 ASN A OD1    
588  N  ND2    . ASN A 82  ? 0.5317 0.8377 0.5676 -0.1697 0.0850  -0.0414 119 ASN A ND2    
589  N  N      . HIS A 83  ? 0.2920 0.4459 0.2977 -0.1191 0.0460  -0.0303 120 HIS A N      
590  C  CA     . HIS A 83  ? 0.2620 0.3982 0.2633 -0.1299 0.0385  -0.0291 120 HIS A CA     
591  C  C      . HIS A 83  ? 0.2968 0.3759 0.2710 -0.1333 0.0355  -0.0222 120 HIS A C      
592  O  O      . HIS A 83  ? 0.2772 0.3326 0.2442 -0.1174 0.0342  -0.0195 120 HIS A O      
593  C  CB     . HIS A 83  ? 0.2361 0.3850 0.2535 -0.1110 0.0294  -0.0332 120 HIS A CB     
594  C  CG     . HIS A 83  ? 0.2716 0.4150 0.2884 -0.1220 0.0221  -0.0341 120 HIS A CG     
595  N  ND1    . HIS A 83  ? 0.2901 0.3875 0.2884 -0.1219 0.0164  -0.0297 120 HIS A ND1    
596  C  CD2    . HIS A 83  ? 0.2849 0.4649 0.3170 -0.1318 0.0191  -0.0395 120 HIS A CD2    
597  C  CE1    . HIS A 83  ? 0.2910 0.3940 0.2912 -0.1320 0.0105  -0.0322 120 HIS A CE1    
598  N  NE2    . HIS A 83  ? 0.2900 0.4419 0.3105 -0.1393 0.0114  -0.0381 120 HIS A NE2    
599  N  N      . LYS A 84  ? 0.2751 0.3323 0.2332 -0.1532 0.0335  -0.0200 121 LYS A N      
600  C  CA     . LYS A 84  ? 0.2891 0.2912 0.2175 -0.1554 0.0300  -0.0142 121 LYS A CA     
601  C  C      . LYS A 84  ? 0.3066 0.2858 0.2349 -0.1349 0.0213  -0.0136 121 LYS A C      
602  O  O      . LYS A 84  ? 0.3226 0.2630 0.2305 -0.1293 0.0188  -0.0097 121 LYS A O      
603  C  CB     . LYS A 84  ? 0.3421 0.3223 0.2474 -0.1822 0.0297  -0.0125 121 LYS A CB     
604  C  CG     . LYS A 84  ? 0.4355 0.4289 0.3500 -0.1902 0.0232  -0.0166 121 LYS A CG     
605  C  CD     . LYS A 84  ? 0.4963 0.4562 0.3800 -0.2170 0.0219  -0.0144 121 LYS A CD     
606  C  CE     . LYS A 84  ? 0.5412 0.5265 0.4368 -0.2322 0.0172  -0.0195 121 LYS A CE     
607  N  NZ     . LYS A 84  ? 0.8057 0.7691 0.6730 -0.2666 0.0186  -0.0180 121 LYS A NZ     
608  N  N      . ASN A 85  ? 0.2193 0.2231 0.1692 -0.1229 0.0170  -0.0177 122 ASN A N      
609  C  CA     . ASN A 85  ? 0.2036 0.1880 0.1528 -0.1050 0.0105  -0.0170 122 ASN A CA     
610  C  C      . ASN A 85  ? 0.2164 0.2082 0.1764 -0.0857 0.0115  -0.0169 122 ASN A C      
611  O  O      . ASN A 85  ? 0.1996 0.1793 0.1601 -0.0724 0.0073  -0.0163 122 ASN A O      
612  C  CB     . ASN A 85  ? 0.1828 0.1761 0.1395 -0.1046 0.0042  -0.0204 122 ASN A CB     
613  C  CG     . ASN A 85  ? 0.3193 0.2974 0.2601 -0.1247 0.0019  -0.0205 122 ASN A CG     
614  O  OD1    . ASN A 85  ? 0.2299 0.2333 0.1805 -0.1365 0.0002  -0.0244 122 ASN A OD1    
615  N  ND2    . ASN A 85  ? 0.2673 0.2035 0.1811 -0.1297 0.0013  -0.0165 122 ASN A ND2    
616  N  N      . ILE A 86  ? 0.1709 0.1804 0.1365 -0.0852 0.0175  -0.0175 123 ILE A N      
617  C  CA     . ILE A 86  ? 0.1439 0.1555 0.1142 -0.0685 0.0182  -0.0176 123 ILE A CA     
618  C  C      . ILE A 86  ? 0.2113 0.2053 0.1673 -0.0719 0.0225  -0.0141 123 ILE A C      
619  O  O      . ILE A 86  ? 0.1900 0.1880 0.1389 -0.0859 0.0281  -0.0134 123 ILE A O      
620  C  CB     . ILE A 86  ? 0.1663 0.2143 0.1535 -0.0596 0.0202  -0.0228 123 ILE A CB     
621  C  CG1    . ILE A 86  ? 0.1690 0.2359 0.1690 -0.0546 0.0146  -0.0269 123 ILE A CG1    
622  C  CG2    . ILE A 86  ? 0.1689 0.2107 0.1539 -0.0432 0.0205  -0.0230 123 ILE A CG2    
623  C  CD1    . ILE A 86  ? 0.1943 0.2381 0.1899 -0.0425 0.0078  -0.0254 123 ILE A CD1    
624  N  N      . ILE A 87  ? 0.1776 0.1534 0.1283 -0.0601 0.0200  -0.0122 124 ILE A N      
625  C  CA     . ILE A 87  ? 0.1939 0.1536 0.1306 -0.0605 0.0224  -0.0096 124 ILE A CA     
626  C  C      . ILE A 87  ? 0.2610 0.2404 0.1979 -0.0665 0.0304  -0.0111 124 ILE A C      
627  O  O      . ILE A 87  ? 0.2560 0.2639 0.2070 -0.0609 0.0330  -0.0153 124 ILE A O      
628  C  CB     . ILE A 87  ? 0.2254 0.1749 0.1622 -0.0467 0.0183  -0.0093 124 ILE A CB     
629  C  CG1    . ILE A 87  ? 0.2595 0.1916 0.1803 -0.0471 0.0190  -0.0068 124 ILE A CG1    
630  C  CG2    . ILE A 87  ? 0.1891 0.1566 0.1377 -0.0360 0.0183  -0.0130 124 ILE A CG2    
631  C  CD1    . ILE A 87  ? 0.4063 0.3322 0.3261 -0.0372 0.0155  -0.0073 124 ILE A CD1    
632  N  N      . SER A 88  ? 0.2444 0.2081 0.1635 -0.0769 0.0341  -0.0080 125 SER A N      
633  C  CA     . SER A 88  ? 0.2637 0.2420 0.1779 -0.0848 0.0432  -0.0086 125 SER A CA     
634  C  C      . SER A 88  ? 0.3144 0.2637 0.2067 -0.0814 0.0429  -0.0052 125 SER A C      
635  O  O      . SER A 88  ? 0.3260 0.2436 0.2016 -0.0829 0.0376  -0.0014 125 SER A O      
636  C  CB     . SER A 88  ? 0.3374 0.3199 0.2447 -0.1069 0.0484  -0.0074 125 SER A CB     
637  O  OG     . SER A 88  ? 0.5935 0.5939 0.4962 -0.1174 0.0589  -0.0079 125 SER A OG     
638  N  N      . LEU A 89  ? 0.2753 0.2344 0.1658 -0.0753 0.0478  -0.0069 126 LEU A N      
639  C  CA     . LEU A 89  ? 0.2895 0.2216 0.1581 -0.0717 0.0467  -0.0041 126 LEU A CA     
640  C  C      . LEU A 89  ? 0.3379 0.2580 0.1832 -0.0870 0.0543  -0.0008 126 LEU A C      
641  O  O      . LEU A 89  ? 0.3369 0.2825 0.1863 -0.0977 0.0646  -0.0023 126 LEU A O      
642  C  CB     . LEU A 89  ? 0.2977 0.2401 0.1694 -0.0576 0.0478  -0.0078 126 LEU A CB     
643  C  CG     . LEU A 89  ? 0.3548 0.2950 0.2378 -0.0425 0.0392  -0.0101 126 LEU A CG     
644  C  CD1    . LEU A 89  ? 0.3668 0.3035 0.2406 -0.0313 0.0397  -0.0129 126 LEU A CD1    
645  C  CD2    . LEU A 89  ? 0.3694 0.2855 0.2494 -0.0416 0.0294  -0.0069 126 LEU A CD2    
646  N  N      . LEU A 90  ? 0.3053 0.1875 0.1246 -0.0875 0.0494  0.0036  127 LEU A N      
647  C  CA     . LEU A 90  ? 0.3266 0.1871 0.1150 -0.1005 0.0557  0.0076  127 LEU A CA     
648  C  C      . LEU A 90  ? 0.3762 0.2356 0.1544 -0.0917 0.0586  0.0066  127 LEU A C      
649  O  O      . LEU A 90  ? 0.3810 0.2417 0.1424 -0.1019 0.0689  0.0078  127 LEU A O      
650  C  CB     . LEU A 90  ? 0.3495 0.1646 0.1094 -0.1022 0.0471  0.0125  127 LEU A CB     
651  C  CG     . LEU A 90  ? 0.3915 0.1977 0.1510 -0.1125 0.0446  0.0139  127 LEU A CG     
652  C  CD1    . LEU A 90  ? 0.4082 0.1697 0.1405 -0.1057 0.0338  0.0172  127 LEU A CD1    
653  C  CD2    . LEU A 90  ? 0.4311 0.2439 0.1806 -0.1375 0.0558  0.0154  127 LEU A CD2    
654  N  N      . ASN A 91  ? 0.3226 0.1794 0.1093 -0.0738 0.0496  0.0042  128 ASN A N      
655  C  CA     . ASN A 91  ? 0.3291 0.1797 0.1032 -0.0645 0.0500  0.0028  128 ASN A CA     
656  C  C      . ASN A 91  ? 0.3219 0.1802 0.1130 -0.0484 0.0417  -0.0014 128 ASN A C      
657  O  O      . ASN A 91  ? 0.2836 0.1440 0.0913 -0.0442 0.0338  -0.0018 128 ASN A O      
658  C  CB     . ASN A 91  ? 0.3521 0.1625 0.0920 -0.0652 0.0444  0.0073  128 ASN A CB     
659  C  CG     . ASN A 91  ? 0.4987 0.2990 0.2139 -0.0643 0.0501  0.0073  128 ASN A CG     
660  O  OD1    . ASN A 91  ? 0.3660 0.1890 0.0891 -0.0608 0.0579  0.0035  128 ASN A OD1    
661  N  ND2    . ASN A 91  ? 0.4083 0.1724 0.0903 -0.0656 0.0456  0.0114  128 ASN A ND2    
662  N  N      . VAL A 92  ? 0.3018 0.1616 0.0851 -0.0403 0.0438  -0.0044 129 VAL A N      
663  C  CA     . VAL A 92  ? 0.3138 0.1723 0.1034 -0.0269 0.0359  -0.0083 129 VAL A CA     
664  C  C      . VAL A 92  ? 0.3670 0.2055 0.1297 -0.0221 0.0350  -0.0090 129 VAL A C      
665  O  O      . VAL A 92  ? 0.3582 0.1996 0.1061 -0.0251 0.0455  -0.0090 129 VAL A O      
666  C  CB     . VAL A 92  ? 0.3712 0.2562 0.1814 -0.0193 0.0395  -0.0134 129 VAL A CB     
667  C  CG1    . VAL A 92  ? 0.3885 0.2990 0.1992 -0.0206 0.0534  -0.0159 129 VAL A CG1    
668  C  CG2    . VAL A 92  ? 0.3662 0.2393 0.1714 -0.0068 0.0316  -0.0172 129 VAL A CG2    
669  N  N      . PHE A 93  ? 0.3315 0.1507 0.0872 -0.0160 0.0226  -0.0095 130 PHE A N      
670  C  CA     . PHE A 93  ? 0.3516 0.1496 0.0803 -0.0115 0.0196  -0.0106 130 PHE A CA     
671  C  C      . PHE A 93  ? 0.3929 0.1796 0.1213 -0.0050 0.0062  -0.0136 130 PHE A C      
672  O  O      . PHE A 93  ? 0.3681 0.1608 0.1155 -0.0059 -0.0018 -0.0136 130 PHE A O      
673  C  CB     . PHE A 93  ? 0.3830 0.1587 0.0872 -0.0171 0.0185  -0.0057 130 PHE A CB     
674  C  CG     . PHE A 93  ? 0.3708 0.1346 0.0779 -0.0172 0.0056  -0.0030 130 PHE A CG     
675  C  CD1    . PHE A 93  ? 0.3785 0.1281 0.0769 -0.0105 -0.0086 -0.0046 130 PHE A CD1    
676  C  CD2    . PHE A 93  ? 0.3768 0.1439 0.0933 -0.0233 0.0073  0.0005  130 PHE A CD2    
677  C  CE1    . PHE A 93  ? 0.3857 0.1298 0.0874 -0.0080 -0.0203 -0.0030 130 PHE A CE1    
678  C  CE2    . PHE A 93  ? 0.4037 0.1596 0.1199 -0.0199 -0.0045 0.0022  130 PHE A CE2    
679  C  CZ     . PHE A 93  ? 0.3818 0.1286 0.0918 -0.0113 -0.0180 0.0003  130 PHE A CZ     
680  N  N      . THR A 94  ? 0.3792 0.1489 0.0840 0.0002  0.0038  -0.0162 131 THR A N      
681  C  CA     . THR A 94  ? 0.3853 0.1396 0.0825 0.0034  -0.0101 -0.0192 131 THR A CA     
682  C  C      . THR A 94  ? 0.4689 0.2000 0.1362 0.0046  -0.0153 -0.0184 131 THR A C      
683  O  O      . THR A 94  ? 0.4744 0.1972 0.1197 0.0067  -0.0060 -0.0183 131 THR A O      
684  C  CB     . THR A 94  ? 0.4624 0.2138 0.1570 0.0096  -0.0104 -0.0247 131 THR A CB     
685  O  OG1    . THR A 94  ? 0.3860 0.1186 0.0687 0.0086  -0.0247 -0.0273 131 THR A OG1    
686  C  CG2    . THR A 94  ? 0.4925 0.2399 0.1663 0.0179  0.0008  -0.0277 131 THR A CG2    
687  N  N      . PRO A 95  ? 0.4579 0.1799 0.1228 0.0038  -0.0303 -0.0184 132 PRO A N      
688  C  CA     . PRO A 95  ? 0.4888 0.1870 0.1224 0.0068  -0.0376 -0.0185 132 PRO A CA     
689  C  C      . PRO A 95  ? 0.6016 0.2829 0.2124 0.0108  -0.0401 -0.0236 132 PRO A C      
690  O  O      . PRO A 95  ? 0.6372 0.2972 0.2171 0.0141  -0.0420 -0.0238 132 PRO A O      
691  C  CB     . PRO A 95  ? 0.5029 0.2043 0.1464 0.0064  -0.0546 -0.0185 132 PRO A CB     
692  C  CG     . PRO A 95  ? 0.5166 0.2434 0.1960 0.0024  -0.0542 -0.0181 132 PRO A CG     
693  C  CD     . PRO A 95  ? 0.4458 0.1812 0.1359 0.0007  -0.0417 -0.0191 132 PRO A CD     
694  N  N      . GLN A 96  ? 0.5540 0.2404 0.1755 0.0110  -0.0407 -0.0277 133 GLN A N      
695  C  CA     . GLN A 96  ? 0.5773 0.2420 0.1732 0.0154  -0.0442 -0.0332 133 GLN A CA     
696  C  C      . GLN A 96  ? 0.6794 0.3392 0.2562 0.0243  -0.0283 -0.0347 133 GLN A C      
697  O  O      . GLN A 96  ? 0.6523 0.3329 0.2462 0.0263  -0.0150 -0.0335 133 GLN A O      
698  C  CB     . GLN A 96  ? 0.5780 0.2427 0.1856 0.0115  -0.0524 -0.0369 133 GLN A CB     
699  C  CG     . GLN A 96  ? 0.5342 0.2058 0.1568 0.0015  -0.0686 -0.0367 133 GLN A CG     
700  C  CD     . GLN A 96  ? 0.5611 0.2616 0.2207 -0.0038 -0.0665 -0.0332 133 GLN A CD     
701  O  OE1    . GLN A 96  ? 0.4790 0.1900 0.1543 -0.0032 -0.0571 -0.0324 133 GLN A OE1    
702  N  NE2    . GLN A 96  ? 0.4650 0.1790 0.1380 -0.0074 -0.0758 -0.0316 133 GLN A NE2    
703  N  N      . LYS A 97  ? 0.7129 0.3475 0.2540 0.0300  -0.0301 -0.0377 134 LYS A N      
704  C  CA     . LYS A 97  ? 0.7441 0.3734 0.2609 0.0395  -0.0152 -0.0395 134 LYS A CA     
705  C  C      . LYS A 97  ? 0.8115 0.4368 0.3195 0.0510  -0.0100 -0.0460 134 LYS A C      
706  O  O      . LYS A 97  ? 0.8226 0.4590 0.3232 0.0602  0.0057  -0.0476 134 LYS A O      
707  C  CB     . LYS A 97  ? 0.8149 0.4160 0.2931 0.0416  -0.0199 -0.0400 134 LYS A CB     
708  C  CG     . LYS A 97  ? 1.0265 0.6272 0.5030 0.0345  -0.0218 -0.0334 134 LYS A CG     
709  C  CD     . LYS A 97  ? 1.2065 0.7744 0.6415 0.0377  -0.0306 -0.0345 134 LYS A CD     
710  C  CE     . LYS A 97  ? 1.4371 0.9983 0.8676 0.0329  -0.0389 -0.0289 134 LYS A CE     
711  N  NZ     . LYS A 97  ? 1.6478 1.1761 1.0360 0.0373  -0.0490 -0.0302 134 LYS A NZ     
712  N  N      . THR A 98  ? 0.7658 0.3740 0.2709 0.0508  -0.0231 -0.0499 135 THR A N      
713  C  CA     . THR A 98  ? 0.7811 0.3744 0.2685 0.0634  -0.0211 -0.0565 135 THR A CA     
714  C  C      . THR A 98  ? 0.7978 0.3952 0.3068 0.0594  -0.0273 -0.0569 135 THR A C      
715  O  O      . THR A 98  ? 0.7650 0.3699 0.2964 0.0450  -0.0368 -0.0533 135 THR A O      
716  C  CB     . THR A 98  ? 0.8839 0.4342 0.3269 0.0673  -0.0325 -0.0619 135 THR A CB     
717  O  OG1    . THR A 98  ? 0.8882 0.4249 0.3341 0.0520  -0.0512 -0.0609 135 THR A OG1    
718  C  CG2    . THR A 98  ? 0.8347 0.3763 0.2490 0.0737  -0.0253 -0.0621 135 THR A CG2    
719  N  N      . LEU A 99  ? 0.7573 0.3476 0.2561 0.0733  -0.0226 -0.0619 136 LEU A N      
720  C  CA     . LEU A 99  ? 0.7433 0.3284 0.2527 0.0714  -0.0288 -0.0627 136 LEU A CA     
721  C  C      . LEU A 99  ? 0.7916 0.3435 0.2854 0.0564  -0.0470 -0.0635 136 LEU A C      
722  O  O      . LEU A 99  ? 0.7459 0.3051 0.2617 0.0429  -0.0534 -0.0606 136 LEU A O      
723  C  CB     . LEU A 99  ? 0.7710 0.3439 0.2590 0.0933  -0.0226 -0.0692 136 LEU A CB     
724  C  CG     . LEU A 99  ? 0.8358 0.3883 0.3195 0.0944  -0.0306 -0.0710 136 LEU A CG     
725  C  CD1    . LEU A 99  ? 0.7839 0.3726 0.3116 0.0862  -0.0268 -0.0657 136 LEU A CD1    
726  C  CD2    . LEU A 99  ? 0.8889 0.4208 0.3409 0.1201  -0.0269 -0.0784 136 LEU A CD2    
727  N  N      . GLU A 100 ? 0.7853 0.3026 0.2409 0.0578  -0.0549 -0.0676 137 GLU A N      
728  C  CA     . GLU A 100 ? 0.8103 0.2967 0.2476 0.0418  -0.0730 -0.0693 137 GLU A CA     
729  C  C      . GLU A 100 ? 0.8095 0.3245 0.2820 0.0218  -0.0804 -0.0639 137 GLU A C      
730  O  O      . GLU A 100 ? 0.8084 0.3232 0.2929 0.0059  -0.0900 -0.0631 137 GLU A O      
731  C  CB     . GLU A 100 ? 0.8789 0.3270 0.2692 0.0477  -0.0795 -0.0747 137 GLU A CB     
732  N  N      . GLU A 101 ? 0.7291 0.2694 0.2175 0.0233  -0.0751 -0.0601 138 GLU A N      
733  C  CA     . GLU A 101 ? 0.6830 0.2503 0.2021 0.0094  -0.0821 -0.0555 138 GLU A CA     
734  C  C      . GLU A 101 ? 0.6477 0.2507 0.2091 0.0056  -0.0746 -0.0505 138 GLU A C      
735  O  O      . GLU A 101 ? 0.6316 0.2552 0.2178 -0.0055 -0.0819 -0.0478 138 GLU A O      
736  C  CB     . GLU A 101 ? 0.7039 0.2752 0.2149 0.0134  -0.0815 -0.0536 138 GLU A CB     
737  C  CG     . GLU A 101 ? 0.8652 0.4021 0.3347 0.0152  -0.0919 -0.0584 138 GLU A CG     
738  C  CD     . GLU A 101 ? 1.1053 0.6416 0.5605 0.0221  -0.0884 -0.0561 138 GLU A CD     
739  O  OE1    . GLU A 101 ? 0.9869 0.5260 0.4434 0.0157  -0.1013 -0.0551 138 GLU A OE1    
740  O  OE2    . GLU A 101 ? 1.0066 0.5419 0.4499 0.0338  -0.0724 -0.0552 138 GLU A OE2    
741  N  N      . PHE A 102 ? 0.5720 0.1844 0.1415 0.0159  -0.0606 -0.0498 139 PHE A N      
742  C  CA     . PHE A 102 ? 0.5200 0.1653 0.1274 0.0137  -0.0525 -0.0453 139 PHE A CA     
743  C  C      . PHE A 102 ? 0.5463 0.2011 0.1763 -0.0007 -0.0616 -0.0437 139 PHE A C      
744  O  O      . PHE A 102 ? 0.5664 0.2014 0.1842 -0.0060 -0.0681 -0.0465 139 PHE A O      
745  C  CB     . PHE A 102 ? 0.5308 0.1814 0.1389 0.0271  -0.0394 -0.0468 139 PHE A CB     
746  C  CG     . PHE A 102 ? 0.5018 0.1835 0.1459 0.0249  -0.0324 -0.0430 139 PHE A CG     
747  C  CD1    . PHE A 102 ? 0.5028 0.2126 0.1727 0.0197  -0.0272 -0.0380 139 PHE A CD1    
748  C  CD2    . PHE A 102 ? 0.5113 0.1899 0.1587 0.0289  -0.0315 -0.0447 139 PHE A CD2    
749  C  CE1    . PHE A 102 ? 0.4758 0.2114 0.1757 0.0176  -0.0212 -0.0350 139 PHE A CE1    
750  C  CE2    . PHE A 102 ? 0.5079 0.2142 0.1862 0.0277  -0.0255 -0.0415 139 PHE A CE2    
751  C  CZ     . PHE A 102 ? 0.4512 0.1865 0.1563 0.0215  -0.0204 -0.0368 139 PHE A CZ     
752  N  N      . GLN A 103 ? 0.4686 0.1522 0.1289 -0.0072 -0.0618 -0.0394 140 GLN A N      
753  C  CA     . GLN A 103 ? 0.4480 0.1468 0.1322 -0.0202 -0.0687 -0.0381 140 GLN A CA     
754  C  C      . GLN A 103 ? 0.4847 0.2136 0.2020 -0.0194 -0.0602 -0.0337 140 GLN A C      
755  O  O      . GLN A 103 ? 0.4794 0.2144 0.2100 -0.0233 -0.0580 -0.0330 140 GLN A O      
756  C  CB     . GLN A 103 ? 0.4668 0.1718 0.1539 -0.0306 -0.0826 -0.0390 140 GLN A CB     
757  C  CG     . GLN A 103 ? 0.7521 0.4277 0.4079 -0.0366 -0.0942 -0.0440 140 GLN A CG     
758  C  CD     . GLN A 103 ? 0.9306 0.6214 0.5980 -0.0519 -0.1089 -0.0456 140 GLN A CD     
759  O  OE1    . GLN A 103 ? 0.7888 0.4931 0.4734 -0.0657 -0.1120 -0.0456 140 GLN A OE1    
760  N  NE2    . GLN A 103 ? 0.8180 0.5089 0.4759 -0.0498 -0.1182 -0.0473 140 GLN A NE2    
761  N  N      . ASP A 104 ? 0.4034 0.1471 0.1299 -0.0148 -0.0560 -0.0306 141 ASP A N      
762  C  CA     . ASP A 104 ? 0.3664 0.1349 0.1201 -0.0151 -0.0502 -0.0266 141 ASP A CA     
763  C  C      . ASP A 104 ? 0.4010 0.1754 0.1565 -0.0078 -0.0368 -0.0243 141 ASP A C      
764  O  O      . ASP A 104 ? 0.4170 0.1809 0.1532 -0.0022 -0.0316 -0.0247 141 ASP A O      
765  C  CB     . ASP A 104 ? 0.3817 0.1616 0.1436 -0.0173 -0.0587 -0.0250 141 ASP A CB     
766  C  CG     . ASP A 104 ? 0.4518 0.2336 0.2145 -0.0257 -0.0728 -0.0282 141 ASP A CG     
767  O  OD1    . ASP A 104 ? 0.4574 0.2456 0.2313 -0.0344 -0.0746 -0.0294 141 ASP A OD1    
768  O  OD2    . ASP A 104 ? 0.4570 0.2340 0.2076 -0.0243 -0.0821 -0.0297 141 ASP A OD2    
769  N  N      . VAL A 105 ? 0.3077 0.1006 0.0863 -0.0091 -0.0312 -0.0219 142 VAL A N      
770  C  CA     . VAL A 105 ? 0.2920 0.0968 0.0780 -0.0058 -0.0192 -0.0197 142 VAL A CA     
771  C  C      . VAL A 105 ? 0.3101 0.1272 0.1121 -0.0099 -0.0202 -0.0158 142 VAL A C      
772  O  O      . VAL A 105 ? 0.2587 0.0854 0.0777 -0.0131 -0.0257 -0.0155 142 VAL A O      
773  C  CB     . VAL A 105 ? 0.3269 0.1407 0.1232 -0.0024 -0.0128 -0.0214 142 VAL A CB     
774  C  CG1    . VAL A 105 ? 0.3051 0.1383 0.1141 -0.0015 -0.0018 -0.0195 142 VAL A CG1    
775  C  CG2    . VAL A 105 ? 0.3477 0.1453 0.1230 0.0054  -0.0123 -0.0259 142 VAL A CG2    
776  N  N      . TYR A 106 ? 0.2687 0.0839 0.0625 -0.0099 -0.0142 -0.0130 143 TYR A N      
777  C  CA     . TYR A 106 ? 0.2465 0.0656 0.0474 -0.0126 -0.0145 -0.0093 143 TYR A CA     
778  C  C      . TYR A 106 ? 0.2781 0.1080 0.0864 -0.0164 -0.0027 -0.0076 143 TYR A C      
779  O  O      . TYR A 106 ? 0.2918 0.1223 0.0898 -0.0176 0.0065  -0.0078 143 TYR A O      
780  C  CB     . TYR A 106 ? 0.2775 0.0779 0.0555 -0.0112 -0.0192 -0.0072 143 TYR A CB     
781  C  CG     . TYR A 106 ? 0.2989 0.0937 0.0723 -0.0073 -0.0330 -0.0095 143 TYR A CG     
782  C  CD1    . TYR A 106 ? 0.3338 0.1192 0.0935 -0.0062 -0.0368 -0.0126 143 TYR A CD1    
783  C  CD2    . TYR A 106 ? 0.3036 0.1052 0.0869 -0.0046 -0.0427 -0.0092 143 TYR A CD2    
784  C  CE1    . TYR A 106 ? 0.3441 0.1269 0.1003 -0.0051 -0.0504 -0.0153 143 TYR A CE1    
785  C  CE2    . TYR A 106 ? 0.3187 0.1225 0.1007 -0.0016 -0.0558 -0.0121 143 TYR A CE2    
786  C  CZ     . TYR A 106 ? 0.3966 0.1915 0.1658 -0.0032 -0.0599 -0.0150 143 TYR A CZ     
787  O  OH     . TYR A 106 ? 0.3983 0.1980 0.1672 -0.0026 -0.0738 -0.0185 143 TYR A OH     
788  N  N      . LEU A 107 ? 0.2154 0.0559 0.0414 -0.0187 -0.0030 -0.0063 144 LEU A N      
789  C  CA     . LEU A 107 ? 0.2078 0.0602 0.0425 -0.0240 0.0062  -0.0051 144 LEU A CA     
790  C  C      . LEU A 107 ? 0.2507 0.0921 0.0785 -0.0282 0.0046  -0.0014 144 LEU A C      
791  O  O      . LEU A 107 ? 0.2636 0.0986 0.0928 -0.0238 -0.0042 -0.0009 144 LEU A O      
792  C  CB     . LEU A 107 ? 0.1827 0.0534 0.0412 -0.0224 0.0065  -0.0069 144 LEU A CB     
793  C  CG     . LEU A 107 ? 0.2420 0.1165 0.1028 -0.0163 0.0058  -0.0109 144 LEU A CG     
794  C  CD1    . LEU A 107 ? 0.2338 0.1197 0.1121 -0.0150 0.0049  -0.0121 144 LEU A CD1    
795  C  CD2    . LEU A 107 ? 0.3155 0.1963 0.1682 -0.0134 0.0144  -0.0133 144 LEU A CD2    
796  N  N      . VAL A 108 ? 0.1900 0.0452 0.0387 -0.0330 0.0102  -0.0022 145 VAL A N      
797  C  CA     . VAL A 108 ? 0.2064 0.0463 0.0384 -0.0374 0.0087  -0.0019 145 VAL A CA     
798  C  C      . VAL A 108 ? 0.2638 0.0966 0.0788 -0.0524 0.0182  0.0048  145 VAL A C      
799  O  O      . VAL A 108 ? 0.2847 0.1373 0.1076 -0.0595 0.0274  0.0035  145 VAL A O      
800  C  CB     . VAL A 108 ? 0.2874 0.0821 0.0580 -0.0472 0.0143  0.0076  145 VAL A CB     
801  C  CG1    . VAL A 108 ? 0.2997 0.0654 0.0479 -0.0509 0.0105  0.0108  145 VAL A CG1    
802  C  CG2    . VAL A 108 ? 0.3042 0.0881 0.0628 -0.0373 0.0076  0.0065  145 VAL A CG2    
803  N  N      . MET A 109 ? 0.1962 0.0496 0.0385 -0.0428 0.0090  -0.0024 146 MET A N      
804  C  CA     . MET A 109 ? 0.1961 0.0545 0.0389 -0.0511 0.0120  -0.0039 146 MET A CA     
805  C  C      . MET A 109 ? 0.3163 0.1076 0.1079 -0.0656 0.0123  0.0100  146 MET A C      
806  O  O      . MET A 109 ? 0.3312 0.1016 0.1078 -0.0544 0.0043  0.0110  146 MET A O      
807  C  CB     . MET A 109 ? 0.1873 0.0558 0.0391 -0.0516 0.0128  -0.0044 146 MET A CB     
808  C  CG     . MET A 109 ? 0.2176 0.0615 0.0700 -0.0476 0.0070  0.0033  146 MET A CG     
809  S  SD     . MET A 109 ? 0.2387 0.1082 0.1203 -0.0443 0.0065  0.0003  146 MET A SD     
810  C  CE     . MET A 109 ? 0.2001 0.0606 0.0736 -0.0556 0.0084  0.0012  146 MET A CE     
811  N  N      . GLU A 110 ? 0.3246 0.1104 0.1108 -0.0782 0.0154  0.0110  147 GLU A N      
812  C  CA     . GLU A 110 ? 0.3781 0.1268 0.1362 -0.0805 0.0101  0.0134  147 GLU A CA     
813  C  C      . GLU A 110 ? 0.3797 0.1230 0.1438 -0.0604 -0.0004 0.0116  147 GLU A C      
814  O  O      . GLU A 110 ? 0.3069 0.0790 0.1014 -0.0536 -0.0012 0.0086  147 GLU A O      
815  C  CB     . GLU A 110 ? 0.4096 0.1651 0.1726 -0.0965 0.0143  0.0128  147 GLU A CB     
816  C  CG     . GLU A 110 ? 0.6959 0.4060 0.4188 -0.1076 0.0120  0.0161  147 GLU A CG     
817  C  CD     . GLU A 110 ? 0.8001 0.5126 0.5268 -0.1205 0.0125  0.0146  147 GLU A CD     
818  O  OE1    . GLU A 110 ? 0.5670 0.3193 0.3230 -0.1306 0.0186  0.0120  147 GLU A OE1    
819  O  OE2    . GLU A 110 ? 0.7982 0.4716 0.4965 -0.1191 0.0059  0.0157  147 GLU A OE2    
820  N  N      . LEU A 111 ? 0.3693 0.0765 0.1031 -0.0506 -0.0082 0.0133  148 LEU A N      
821  C  CA     . LEU A 111 ? 0.3684 0.0760 0.1086 -0.0305 -0.0177 0.0107  148 LEU A CA     
822  C  C      . LEU A 111 ? 0.4192 0.1228 0.1613 -0.0322 -0.0182 0.0094  148 LEU A C      
823  O  O      . LEU A 111 ? 0.4625 0.1337 0.1756 -0.0428 -0.0176 0.0114  148 LEU A O      
824  C  CB     . LEU A 111 ? 0.4046 0.0762 0.1102 -0.0156 -0.0272 0.0118  148 LEU A CB     
825  C  CG     . LEU A 111 ? 0.4423 0.1210 0.1558 0.0081  -0.0372 0.0080  148 LEU A CG     
826  C  CD1    . LEU A 111 ? 0.3836 0.1103 0.1388 0.0158  -0.0379 0.0046  148 LEU A CD1    
827  C  CD2    . LEU A 111 ? 0.4358 0.0750 0.1091 0.0247  -0.0476 0.0086  148 LEU A CD2    
828  N  N      . MET A 112 ? 0.3361 0.0699 0.1091 -0.0236 -0.0191 0.0061  149 MET A N      
829  C  CA     . MET A 112 ? 0.3402 0.0705 0.1144 -0.0228 -0.0201 0.0044  149 MET A CA     
830  C  C      . MET A 112 ? 0.3917 0.1078 0.1535 -0.0011 -0.0286 0.0023  149 MET A C      
831  O  O      . MET A 112 ? 0.3734 0.0947 0.1360 0.0132  -0.0335 0.0014  149 MET A O      
832  C  CB     . MET A 112 ? 0.3179 0.0869 0.1287 -0.0280 -0.0149 0.0023  149 MET A CB     
833  C  CG     . MET A 112 ? 0.3350 0.1221 0.1583 -0.0451 -0.0073 0.0033  149 MET A CG     
834  S  SD     . MET A 112 ? 0.4141 0.1820 0.2165 -0.0676 -0.0032 0.0048  149 MET A SD     
835  C  CE     . MET A 112 ? 0.3418 0.1267 0.1633 -0.0682 -0.0044 0.0014  149 MET A CE     
836  N  N      . ASP A 113 ? 0.4084 0.1061 0.1562 0.0020  -0.0308 0.0010  150 ASP A N      
837  C  CA     . ASP A 113 ? 0.4187 0.1001 0.1496 0.0247  -0.0386 -0.0018 150 ASP A CA     
838  C  C      . ASP A 113 ? 0.4406 0.1616 0.2041 0.0392  -0.0385 -0.0058 150 ASP A C      
839  O  O      . ASP A 113 ? 0.4556 0.1808 0.2159 0.0604  -0.0444 -0.0087 150 ASP A O      
840  C  CB     . ASP A 113 ? 0.4636 0.0997 0.1568 0.0221  -0.0414 -0.0017 150 ASP A CB     
841  C  CG     . ASP A 113 ? 0.5913 0.1808 0.2433 0.0085  -0.0425 0.0025  150 ASP A CG     
842  O  OD1    . ASP A 113 ? 0.6352 0.2127 0.2726 0.0162  -0.0459 0.0041  150 ASP A OD1    
843  O  OD2    . ASP A 113 ? 0.6081 0.1732 0.2411 -0.0110 -0.0399 0.0041  150 ASP A OD2    
844  N  N      . ALA A 114 ? 0.3494 0.0999 0.1424 0.0286  -0.0321 -0.0062 151 ALA A N      
845  C  CA     . ALA A 114 ? 0.3341 0.1192 0.1543 0.0396  -0.0309 -0.0095 151 ALA A CA     
846  C  C      . ALA A 114 ? 0.3517 0.1663 0.2018 0.0252  -0.0240 -0.0087 151 ALA A C      
847  O  O      . ALA A 114 ? 0.3521 0.1604 0.2013 0.0093  -0.0208 -0.0065 151 ALA A O      
848  C  CB     . ALA A 114 ? 0.3674 0.1359 0.1710 0.0509  -0.0329 -0.0123 151 ALA A CB     
849  N  N      . ASN A 115 ? 0.2715 0.1180 0.1463 0.0308  -0.0218 -0.0107 152 ASN A N      
850  C  CA     . ASN A 115 ? 0.2400 0.1079 0.1369 0.0193  -0.0161 -0.0100 152 ASN A CA     
851  C  C      . ASN A 115 ? 0.2974 0.1622 0.1916 0.0215  -0.0144 -0.0116 152 ASN A C      
852  O  O      . ASN A 115 ? 0.3181 0.1663 0.1945 0.0326  -0.0173 -0.0135 152 ASN A O      
853  C  CB     . ASN A 115 ? 0.2044 0.1029 0.1246 0.0195  -0.0145 -0.0104 152 ASN A CB     
854  C  CG     . ASN A 115 ? 0.4276 0.3476 0.3574 0.0311  -0.0147 -0.0131 152 ASN A CG     
855  O  OD1    . ASN A 115 ? 0.3384 0.2547 0.2606 0.0408  -0.0147 -0.0152 152 ASN A OD1    
856  N  ND2    . ASN A 115 ? 0.2985 0.2431 0.2446 0.0297  -0.0148 -0.0137 152 ASN A ND2    
857  N  N      . LEU A 116 ? 0.2324 0.1098 0.1402 0.0126  -0.0105 -0.0112 153 LEU A N      
858  C  CA     . LEU A 116 ? 0.2344 0.1075 0.1377 0.0139  -0.0094 -0.0126 153 LEU A CA     
859  C  C      . LEU A 116 ? 0.2973 0.1858 0.2061 0.0262  -0.0072 -0.0147 153 LEU A C      
860  O  O      . LEU A 116 ? 0.3056 0.1847 0.2033 0.0322  -0.0070 -0.0166 153 LEU A O      
861  C  CB     . LEU A 116 ? 0.2229 0.1046 0.1372 0.0024  -0.0070 -0.0118 153 LEU A CB     
862  C  CG     . LEU A 116 ? 0.2836 0.1548 0.1890 -0.0005 -0.0080 -0.0132 153 LEU A CG     
863  C  CD1    . LEU A 116 ? 0.2962 0.1403 0.1797 -0.0047 -0.0122 -0.0139 153 LEU A CD1    
864  C  CD2    . LEU A 116 ? 0.2389 0.1228 0.1565 -0.0093 -0.0071 -0.0129 153 LEU A CD2    
865  N  N      . CYS A 117 ? 0.2590 0.1717 0.1835 0.0294  -0.0056 -0.0148 154 CYS A N      
866  C  CA     . CYS A 117 ? 0.2735 0.2092 0.2062 0.0394  -0.0025 -0.0173 154 CYS A CA     
867  C  C      . CYS A 117 ? 0.3345 0.2578 0.2494 0.0573  -0.0061 -0.0206 154 CYS A C      
868  O  O      . CYS A 117 ? 0.3204 0.2480 0.2308 0.0666  -0.0033 -0.0232 154 CYS A O      
869  C  CB     . CYS A 117 ? 0.2740 0.2380 0.2255 0.0371  -0.0018 -0.0172 154 CYS A CB     
870  S  SG     . CYS A 117 ? 0.3162 0.2893 0.2819 0.0183  0.0020  -0.0139 154 CYS A SG     
871  N  N      . GLN A 118 ? 0.2990 0.2047 0.2009 0.0631  -0.0123 -0.0207 155 GLN A N      
872  C  CA     . GLN A 118 ? 0.3357 0.2206 0.2133 0.0818  -0.0178 -0.0237 155 GLN A CA     
873  C  C      . GLN A 118 ? 0.4159 0.2663 0.2681 0.0823  -0.0186 -0.0244 155 GLN A C      
874  O  O      . GLN A 118 ? 0.4423 0.2862 0.2799 0.0992  -0.0194 -0.0282 155 GLN A O      
875  C  CB     . GLN A 118 ? 0.3606 0.2263 0.2245 0.0844  -0.0246 -0.0225 155 GLN A CB     
876  C  CG     . GLN A 118 ? 0.3511 0.2507 0.2373 0.0869  -0.0257 -0.0231 155 GLN A CG     
877  C  CD     . GLN A 118 ? 0.6061 0.4828 0.4760 0.0876  -0.0325 -0.0213 155 GLN A CD     
878  O  OE1    . GLN A 118 ? 0.4579 0.3224 0.3273 0.0711  -0.0313 -0.0174 155 GLN A OE1    
879  N  NE2    . GLN A 118 ? 0.6175 0.4862 0.4707 0.1082  -0.0398 -0.0243 155 GLN A NE2    
880  N  N      . VAL A 119 ? 0.3865 0.2183 0.2345 0.0639  -0.0182 -0.0212 156 VAL A N      
881  C  CA     . VAL A 119 ? 0.4126 0.2141 0.2387 0.0588  -0.0197 -0.0218 156 VAL A CA     
882  C  C      . VAL A 119 ? 0.4345 0.2515 0.2678 0.0642  -0.0151 -0.0242 156 VAL A C      
883  O  O      . VAL A 119 ? 0.4601 0.2539 0.2698 0.0732  -0.0171 -0.0270 156 VAL A O      
884  C  CB     . VAL A 119 ? 0.4605 0.2529 0.2889 0.0362  -0.0198 -0.0184 156 VAL A CB     
885  C  CG1    . VAL A 119 ? 0.4836 0.2580 0.2990 0.0274  -0.0210 -0.0195 156 VAL A CG1    
886  C  CG2    . VAL A 119 ? 0.4760 0.2438 0.2866 0.0312  -0.0239 -0.0164 156 VAL A CG2    
887  N  N      . ILE A 120 ? 0.3150 0.1679 0.1768 0.0591  -0.0089 -0.0230 157 ILE A N      
888  C  CA     . ILE A 120 ? 0.2833 0.1526 0.1515 0.0627  -0.0031 -0.0245 157 ILE A CA     
889  C  C      . ILE A 120 ? 0.3636 0.2400 0.2231 0.0840  -0.0016 -0.0290 157 ILE A C      
890  O  O      . ILE A 120 ? 0.3613 0.2330 0.2098 0.0906  0.0012  -0.0313 157 ILE A O      
891  C  CB     . ILE A 120 ? 0.2760 0.1776 0.1717 0.0514  0.0029  -0.0218 157 ILE A CB     
892  C  CG1    . ILE A 120 ? 0.2665 0.1589 0.1641 0.0361  0.0022  -0.0192 157 ILE A CG1    
893  C  CG2    . ILE A 120 ? 0.2530 0.1827 0.1582 0.0581  0.0106  -0.0235 157 ILE A CG2    
894  C  CD1    . ILE A 120 ? 0.2334 0.1460 0.1516 0.0246  0.0052  -0.0161 157 ILE A CD1    
895  N  N      . GLN A 121 ? 0.3675 0.2571 0.2314 0.0961  -0.0036 -0.0306 158 GLN A N      
896  C  CA     . GLN A 121 ? 0.3948 0.2973 0.2522 0.1199  -0.0028 -0.0359 158 GLN A CA     
897  C  C      . GLN A 121 ? 0.5049 0.3629 0.3230 0.1368  -0.0094 -0.0394 158 GLN A C      
898  O  O      . GLN A 121 ? 0.5408 0.4048 0.3481 0.1607  -0.0097 -0.0447 158 GLN A O      
899  C  CB     . GLN A 121 ? 0.4040 0.3360 0.2780 0.1285  -0.0050 -0.0373 158 GLN A CB     
900  C  CG     . GLN A 121 ? 0.5619 0.5422 0.4717 0.1156  0.0018  -0.0357 158 GLN A CG     
901  C  CD     . GLN A 121 ? 0.8286 0.8345 0.7519 0.1237  -0.0027 -0.0377 158 GLN A CD     
902  O  OE1    . GLN A 121 ? 0.7396 0.7319 0.6623 0.1163  -0.0085 -0.0349 158 GLN A OE1    
903  N  NE2    . GLN A 121 ? 0.8051 0.8491 0.7391 0.1408  -0.0006 -0.0431 158 GLN A NE2    
904  N  N      . MET A 122 ? 0.4536 0.2676 0.2488 0.1249  -0.0150 -0.0369 159 MET A N      
905  C  CA     . MET A 122 ? 0.4885 0.2529 0.2408 0.1373  -0.0219 -0.0400 159 MET A CA     
906  C  C      . MET A 122 ? 0.5079 0.2473 0.2441 0.1265  -0.0216 -0.0401 159 MET A C      
907  O  O      . MET A 122 ? 0.4445 0.2003 0.2017 0.1073  -0.0176 -0.0370 159 MET A O      
908  C  CB     . MET A 122 ? 0.5515 0.2771 0.2792 0.1349  -0.0307 -0.0380 159 MET A CB     
909  C  CG     . MET A 122 ? 0.6017 0.3175 0.3369 0.1062  -0.0314 -0.0324 159 MET A CG     
910  S  SD     . MET A 122 ? 0.7006 0.3810 0.4119 0.1018  -0.0389 -0.0293 159 MET A SD     
911  C  CE     . MET A 122 ? 0.6415 0.3687 0.3853 0.1143  -0.0370 -0.0294 159 MET A CE     
912  N  N      . GLU A 123 ? 0.4827 0.1812 0.1793 0.1405  -0.0266 -0.0442 160 GLU A N      
913  C  CA     . GLU A 123 ? 0.4931 0.1620 0.1688 0.1301  -0.0284 -0.0449 160 GLU A CA     
914  C  C      . GLU A 123 ? 0.6026 0.2344 0.2612 0.1073  -0.0357 -0.0416 160 GLU A C      
915  O  O      . GLU A 123 ? 0.6533 0.2514 0.2858 0.1106  -0.0420 -0.0413 160 GLU A O      
916  C  CB     . GLU A 123 ? 0.5567 0.1907 0.1912 0.1539  -0.0319 -0.0510 160 GLU A CB     
917  C  CG     . GLU A 123 ? 0.6302 0.3014 0.2786 0.1743  -0.0231 -0.0552 160 GLU A CG     
918  C  CD     . GLU A 123 ? 0.8078 0.4430 0.4133 0.1972  -0.0260 -0.0617 160 GLU A CD     
919  O  OE1    . GLU A 123 ? 0.7126 0.2885 0.2740 0.1976  -0.0360 -0.0631 160 GLU A OE1    
920  O  OE2    . GLU A 123 ? 0.6338 0.2986 0.2473 0.2142  -0.0178 -0.0656 160 GLU A OE2    
921  N  N      . LEU A 124 ? 0.5406 0.1802 0.2137 0.0841  -0.0349 -0.0392 161 LEU A N      
922  C  CA     . LEU A 124 ? 0.5576 0.1690 0.2170 0.0600  -0.0409 -0.0367 161 LEU A CA     
923  C  C      . LEU A 124 ? 0.6276 0.2064 0.2588 0.0516  -0.0463 -0.0397 161 LEU A C      
924  O  O      . LEU A 124 ? 0.6165 0.2091 0.2542 0.0575  -0.0437 -0.0420 161 LEU A O      
925  C  CB     . LEU A 124 ? 0.5158 0.1656 0.2151 0.0386  -0.0370 -0.0324 161 LEU A CB     
926  C  CG     . LEU A 124 ? 0.5468 0.2286 0.2750 0.0415  -0.0323 -0.0291 161 LEU A CG     
927  C  CD1    . LEU A 124 ? 0.5153 0.2358 0.2805 0.0264  -0.0278 -0.0264 161 LEU A CD1    
928  C  CD2    . LEU A 124 ? 0.6012 0.2553 0.3095 0.0371  -0.0366 -0.0271 161 LEU A CD2    
929  N  N      . ASP A 125 ? 0.5984 0.1342 0.1979 0.0351  -0.0539 -0.0394 162 ASP A N      
930  C  CA     . ASP A 125 ? 0.6234 0.1304 0.1979 0.0209  -0.0603 -0.0423 162 ASP A CA     
931  C  C      . ASP A 125 ? 0.6214 0.1697 0.2347 -0.0040 -0.0586 -0.0401 162 ASP A C      
932  O  O      . ASP A 125 ? 0.5652 0.1537 0.2159 -0.0085 -0.0528 -0.0365 162 ASP A O      
933  C  CB     . ASP A 125 ? 0.7137 0.1583 0.2374 0.0091  -0.0692 -0.0428 162 ASP A CB     
934  C  CG     . ASP A 125 ? 0.9091 0.3583 0.4427 -0.0143 -0.0686 -0.0379 162 ASP A CG     
935  O  OD1    . ASP A 125 ? 0.9427 0.4097 0.4930 -0.0041 -0.0640 -0.0349 162 ASP A OD1    
936  O  OD2    . ASP A 125 ? 0.9812 0.4249 0.5115 -0.0434 -0.0720 -0.0373 162 ASP A OD2    
937  N  N      . HIS A 126 ? 0.5725 0.1102 0.1748 -0.0187 -0.0644 -0.0429 163 HIS A N      
938  C  CA     . HIS A 126 ? 0.5273 0.1039 0.1627 -0.0386 -0.0647 -0.0424 163 HIS A CA     
939  C  C      . HIS A 126 ? 0.5429 0.1317 0.1914 -0.0643 -0.0654 -0.0397 163 HIS A C      
940  O  O      . HIS A 126 ? 0.4910 0.1253 0.1773 -0.0725 -0.0625 -0.0385 163 HIS A O      
941  C  CB     . HIS A 126 ? 0.5532 0.1152 0.1708 -0.0455 -0.0724 -0.0471 163 HIS A CB     
942  C  CG     . HIS A 126 ? 0.5826 0.1457 0.1962 -0.0213 -0.0696 -0.0493 163 HIS A CG     
943  N  ND1    . HIS A 126 ? 0.5532 0.1602 0.2021 -0.0125 -0.0630 -0.0478 163 HIS A ND1    
944  C  CD2    . HIS A 126 ? 0.6458 0.1696 0.2212 -0.0046 -0.0719 -0.0531 163 HIS A CD2    
945  C  CE1    . HIS A 126 ? 0.5630 0.1586 0.1957 0.0069  -0.0607 -0.0502 163 HIS A CE1    
946  N  NE2    . HIS A 126 ? 0.6164 0.1644 0.2062 0.0135  -0.0657 -0.0538 163 HIS A NE2    
947  N  N      . GLU A 127 ? 0.5536 0.1011 0.1686 -0.0770 -0.0691 -0.0388 164 GLU A N      
948  C  CA     . GLU A 127 ? 0.5665 0.1228 0.1891 -0.1037 -0.0683 -0.0360 164 GLU A CA     
949  C  C      . GLU A 127 ? 0.5855 0.1790 0.2431 -0.0950 -0.0595 -0.0316 164 GLU A C      
950  O  O      . GLU A 127 ? 0.5587 0.1948 0.2503 -0.1085 -0.0559 -0.0305 164 GLU A O      
951  C  CB     . GLU A 127 ? 0.6595 0.1531 0.2291 -0.1174 -0.0737 -0.0354 164 GLU A CB     
952  C  CG     . GLU A 127 ? 0.8455 0.3411 0.4160 -0.1421 -0.0706 -0.0313 164 GLU A CG     
953  C  CD     . GLU A 127 ? 1.1969 0.6251 0.7115 -0.1480 -0.0741 -0.0291 164 GLU A CD     
954  O  OE1    . GLU A 127 ? 1.1025 0.5219 0.6130 -0.1332 -0.0701 -0.0254 164 GLU A OE1    
955  O  OE2    . GLU A 127 ? 1.1166 0.4990 0.5891 -0.1686 -0.0815 -0.0310 164 GLU A OE2    
956  N  N      . ARG A 128 ? 0.5404 0.1207 0.1903 -0.0708 -0.0563 -0.0300 165 ARG A N      
957  C  CA     . ARG A 128 ? 0.4962 0.1075 0.1752 -0.0611 -0.0491 -0.0264 165 ARG A CA     
958  C  C      . ARG A 128 ? 0.5033 0.1671 0.2267 -0.0528 -0.0439 -0.0265 165 ARG A C      
959  O  O      . ARG A 128 ? 0.4428 0.1417 0.1965 -0.0608 -0.0396 -0.0243 165 ARG A O      
960  C  CB     . ARG A 128 ? 0.5090 0.0923 0.1655 -0.0376 -0.0491 -0.0256 165 ARG A CB     
961  C  CG     . ARG A 128 ? 0.6662 0.1948 0.2766 -0.0462 -0.0540 -0.0242 165 ARG A CG     
962  C  CD     . ARG A 128 ? 0.8408 0.3422 0.4271 -0.0185 -0.0557 -0.0243 165 ARG A CD     
963  N  NE     . ARG A 128 ? 1.0599 0.5021 0.5958 -0.0252 -0.0614 -0.0227 165 ARG A NE     
964  C  CZ     . ARG A 128 ? 1.3217 0.7036 0.8044 -0.0212 -0.0691 -0.0253 165 ARG A CZ     
965  N  NH1    . ARG A 128 ? 1.2067 0.5820 0.6814 -0.0097 -0.0719 -0.0301 165 ARG A NH1    
966  N  NH2    . ARG A 128 ? 1.1455 0.4693 0.5786 -0.0286 -0.0743 -0.0231 165 ARG A NH2    
967  N  N      . MET A 129 ? 0.4903 0.1569 0.2141 -0.0377 -0.0444 -0.0292 166 MET A N      
968  C  CA     . MET A 129 ? 0.4494 0.1587 0.2083 -0.0312 -0.0399 -0.0290 166 MET A CA     
969  C  C      . MET A 129 ? 0.4227 0.1593 0.2030 -0.0497 -0.0416 -0.0295 166 MET A C      
970  O  O      . MET A 129 ? 0.3545 0.1247 0.1641 -0.0503 -0.0372 -0.0275 166 MET A O      
971  C  CB     . MET A 129 ? 0.4954 0.2006 0.2468 -0.0139 -0.0393 -0.0316 166 MET A CB     
972  C  CG     . MET A 129 ? 0.5307 0.2748 0.3138 -0.0061 -0.0330 -0.0302 166 MET A CG     
973  S  SD     . MET A 129 ? 0.6313 0.3737 0.4052 0.0109  -0.0305 -0.0326 166 MET A SD     
974  C  CE     . MET A 129 ? 0.6073 0.3366 0.3663 0.0315  -0.0262 -0.0333 166 MET A CE     
975  N  N      . SER A 130 ? 0.3770 0.0995 0.1415 -0.0650 -0.0486 -0.0326 167 SER A N      
976  C  CA     . SER A 130 ? 0.3415 0.0966 0.1282 -0.0821 -0.0513 -0.0343 167 SER A CA     
977  C  C      . SER A 130 ? 0.3466 0.1227 0.1504 -0.0968 -0.0473 -0.0319 167 SER A C      
978  O  O      . SER A 130 ? 0.3201 0.1365 0.1536 -0.0996 -0.0455 -0.0323 167 SER A O      
979  C  CB     . SER A 130 ? 0.3728 0.1102 0.1385 -0.0974 -0.0605 -0.0387 167 SER A CB     
980  O  OG     . SER A 130 ? 0.4195 0.1217 0.1555 -0.1150 -0.0635 -0.0385 167 SER A OG     
981  N  N      . TYR A 131 ? 0.3267 0.0888 0.1105 -0.0975 -0.0422 -0.0201 168 TYR A N      
982  C  CA     . TYR A 131 ? 0.3190 0.0974 0.1129 -0.1111 -0.0373 -0.0181 168 TYR A CA     
983  C  C      . TYR A 131 ? 0.3404 0.1350 0.1636 -0.1046 -0.0342 -0.0242 168 TYR A C      
984  O  O      . TYR A 131 ? 0.3338 0.1647 0.1824 -0.1120 -0.0309 -0.0243 168 TYR A O      
985  C  CB     . TYR A 131 ? 0.3558 0.0945 0.1122 -0.1197 -0.0375 -0.0141 168 TYR A CB     
986  C  CG     . TYR A 131 ? 0.3873 0.1194 0.1513 -0.1489 -0.0364 -0.0216 168 TYR A CG     
987  C  CD1    . TYR A 131 ? 0.4019 0.1734 0.1882 -0.1701 -0.0350 -0.0237 168 TYR A CD1    
988  C  CD2    . TYR A 131 ? 0.4247 0.1314 0.1711 -0.1448 -0.0329 -0.0173 168 TYR A CD2    
989  C  CE1    . TYR A 131 ? 0.4165 0.2037 0.2088 -0.1873 -0.0285 -0.0214 168 TYR A CE1    
990  C  CE2    . TYR A 131 ? 0.4396 0.1558 0.1880 -0.1627 -0.0273 -0.0146 168 TYR A CE2    
991  C  CZ     . TYR A 131 ? 0.5032 0.2609 0.2753 -0.1841 -0.0243 -0.0165 168 TYR A CZ     
992  O  OH     . TYR A 131 ? 0.4629 0.2343 0.2382 -0.2008 -0.0172 -0.0141 168 TYR A OH     
993  N  N      . LEU A 132 ? 0.3035 0.0863 0.1236 -0.0834 -0.0322 -0.0224 169 LEU A N      
994  C  CA     . LEU A 132 ? 0.2787 0.0881 0.1242 -0.0702 -0.0264 -0.0202 169 LEU A CA     
995  C  C      . LEU A 132 ? 0.2993 0.1460 0.1731 -0.0673 -0.0257 -0.0219 169 LEU A C      
996  O  O      . LEU A 132 ? 0.2703 0.1436 0.1651 -0.0673 -0.0219 -0.0210 169 LEU A O      
997  C  CB     . LEU A 132 ? 0.2820 0.0760 0.1193 -0.0498 -0.0251 -0.0191 169 LEU A CB     
998  C  CG     . LEU A 132 ? 0.3726 0.1308 0.1815 -0.0459 -0.0265 -0.0176 169 LEU A CG     
999  C  CD1    . LEU A 132 ? 0.3826 0.1310 0.1836 -0.0237 -0.0265 -0.0185 169 LEU A CD1    
1000 C  CD2    . LEU A 132 ? 0.3648 0.1271 0.1780 -0.0517 -0.0234 -0.0144 169 LEU A CD2    
1001 N  N      . LEU A 133 ? 0.2678 0.1134 0.1387 -0.0635 -0.0298 -0.0246 170 LEU A N      
1002 C  CA     . LEU A 133 ? 0.2261 0.1007 0.1173 -0.0583 -0.0307 -0.0264 170 LEU A CA     
1003 C  C      . LEU A 133 ? 0.2521 0.1555 0.1589 -0.0722 -0.0329 -0.0290 170 LEU A C      
1004 O  O      . LEU A 133 ? 0.2230 0.1544 0.1499 -0.0667 -0.0311 -0.0294 170 LEU A O      
1005 C  CB     . LEU A 133 ? 0.2285 0.0905 0.1074 -0.0512 -0.0352 -0.0287 170 LEU A CB     
1006 C  CG     . LEU A 133 ? 0.2818 0.1251 0.1493 -0.0354 -0.0315 -0.0268 170 LEU A CG     
1007 C  CD1    . LEU A 133 ? 0.2986 0.1218 0.1456 -0.0314 -0.0360 -0.0297 170 LEU A CD1    
1008 C  CD2    . LEU A 133 ? 0.2612 0.1237 0.1459 -0.0245 -0.0263 -0.0246 170 LEU A CD2    
1009 N  N      . TYR A 134 ? 0.2366 0.1328 0.1323 -0.0904 -0.0365 -0.0309 171 TYR A N      
1010 C  CA     . TYR A 134 ? 0.2315 0.1600 0.1425 -0.1072 -0.0377 -0.0339 171 TYR A CA     
1011 C  C      . TYR A 134 ? 0.2708 0.2214 0.1987 -0.1074 -0.0299 -0.0316 171 TYR A C      
1012 O  O      . TYR A 134 ? 0.2370 0.2264 0.1877 -0.1062 -0.0291 -0.0343 171 TYR A O      
1013 C  CB     . TYR A 134 ? 0.2615 0.1706 0.1515 -0.1308 -0.0414 -0.0353 171 TYR A CB     
1014 C  CG     . TYR A 134 ? 0.2723 0.2154 0.1770 -0.1527 -0.0396 -0.0374 171 TYR A CG     
1015 C  CD1    . TYR A 134 ? 0.2686 0.2569 0.1966 -0.1575 -0.0441 -0.0431 171 TYR A CD1    
1016 C  CD2    . TYR A 134 ? 0.2981 0.2302 0.1925 -0.1684 -0.0332 -0.0341 171 TYR A CD2    
1017 C  CE1    . TYR A 134 ? 0.2583 0.2860 0.2027 -0.1774 -0.0415 -0.0458 171 TYR A CE1    
1018 C  CE2    . TYR A 134 ? 0.3036 0.2703 0.2114 -0.1902 -0.0298 -0.0361 171 TYR A CE2    
1019 C  CZ     . TYR A 134 ? 0.3903 0.4076 0.3247 -0.1949 -0.0335 -0.0422 171 TYR A CZ     
1020 O  OH     . TYR A 134 ? 0.4570 0.5167 0.4080 -0.2157 -0.0292 -0.0449 171 TYR A OH     
1021 N  N      . GLN A 135 ? 0.2371 0.1618 0.1517 -0.1067 -0.0248 -0.0271 172 GLN A N      
1022 C  CA     . GLN A 135 ? 0.2265 0.1647 0.1515 -0.1065 -0.0177 -0.0246 172 GLN A CA     
1023 C  C      . GLN A 135 ? 0.2497 0.2080 0.1941 -0.0873 -0.0154 -0.0244 172 GLN A C      
1024 O  O      . GLN A 135 ? 0.2425 0.2281 0.2027 -0.0870 -0.0116 -0.0254 172 GLN A O      
1025 C  CB     . GLN A 135 ? 0.2515 0.1530 0.1533 -0.1087 -0.0149 -0.0202 172 GLN A CB     
1026 C  CG     . GLN A 135 ? 0.3082 0.1881 0.1867 -0.1315 -0.0158 -0.0198 172 GLN A CG     
1027 C  CD     . GLN A 135 ? 0.4031 0.2407 0.2534 -0.1291 -0.0147 -0.0155 172 GLN A CD     
1028 O  OE1    . GLN A 135 ? 0.3284 0.1655 0.1757 -0.1346 -0.0096 -0.0127 172 GLN A OE1    
1029 N  NE2    . GLN A 135 ? 0.3100 0.1124 0.1387 -0.1177 -0.0195 -0.0152 172 GLN A NE2    
1030 N  N      . MET A 136 ? 0.2090 0.1536 0.1502 -0.0720 -0.0175 -0.0236 173 MET A N      
1031 C  CA     . MET A 136 ? 0.1965 0.1543 0.1507 -0.0563 -0.0159 -0.0232 173 MET A CA     
1032 C  C      . MET A 136 ? 0.2231 0.2122 0.1925 -0.0542 -0.0191 -0.0276 173 MET A C      
1033 O  O      . MET A 136 ? 0.1946 0.2031 0.1757 -0.0476 -0.0166 -0.0284 173 MET A O      
1034 C  CB     . MET A 136 ? 0.2296 0.1683 0.1755 -0.0439 -0.0170 -0.0216 173 MET A CB     
1035 C  CG     . MET A 136 ? 0.2747 0.1906 0.2094 -0.0409 -0.0140 -0.0183 173 MET A CG     
1036 S  SD     . MET A 136 ? 0.3354 0.2372 0.2617 -0.0284 -0.0143 -0.0177 173 MET A SD     
1037 C  CE     . MET A 136 ? 0.3135 0.1883 0.2189 -0.0298 -0.0159 -0.0177 173 MET A CE     
1038 N  N      . LEU A 137 ? 0.1534 0.1473 0.1210 -0.0593 -0.0252 -0.0310 174 LEU A N      
1039 C  CA     . LEU A 137 ? 0.1303 0.1568 0.1121 -0.0559 -0.0302 -0.0362 174 LEU A CA     
1040 C  C      . LEU A 137 ? 0.1854 0.2480 0.1840 -0.0647 -0.0272 -0.0392 174 LEU A C      
1041 O  O      . LEU A 137 ? 0.1817 0.2728 0.1940 -0.0531 -0.0285 -0.0427 174 LEU A O      
1042 C  CB     . LEU A 137 ? 0.1283 0.1523 0.1038 -0.0593 -0.0366 -0.0379 174 LEU A CB     
1043 C  CG     . LEU A 137 ? 0.1786 0.1734 0.1376 -0.0492 -0.0416 -0.0380 174 LEU A CG     
1044 C  CD1    . LEU A 137 ? 0.1972 0.1809 0.1434 -0.0582 -0.0490 -0.0409 174 LEU A CD1    
1045 C  CD2    . LEU A 137 ? 0.1521 0.1549 0.1148 -0.0302 -0.0440 -0.0388 174 LEU A CD2    
1046 N  N      . CYS A 138 ? 0.1504 0.2104 0.1451 -0.0845 -0.0231 -0.0378 175 CYS A N      
1047 C  CA     . CYS A 138 ? 0.1627 0.2565 0.1710 -0.0966 -0.0178 -0.0400 175 CYS A CA     
1048 C  C      . CYS A 138 ? 0.1958 0.2960 0.2109 -0.0822 -0.0114 -0.0383 175 CYS A C      
1049 O  O      . CYS A 138 ? 0.1925 0.3303 0.2242 -0.0766 -0.0095 -0.0424 175 CYS A O      
1050 C  CB     . CYS A 138 ? 0.1907 0.2666 0.1842 -0.1213 -0.0140 -0.0372 175 CYS A CB     
1051 S  SG     . CYS A 138 ? 0.2729 0.3474 0.2575 -0.1447 -0.0216 -0.0407 175 CYS A SG     
1052 N  N      . GLY A 139 ? 0.1510 0.2156 0.1523 -0.0759 -0.0085 -0.0328 176 GLY A N      
1053 C  CA     . GLY A 139 ? 0.1401 0.2020 0.1429 -0.0634 -0.0036 -0.0307 176 GLY A CA     
1054 C  C      . GLY A 139 ? 0.1883 0.2652 0.1998 -0.0434 -0.0068 -0.0339 176 GLY A C      
1055 O  O      . GLY A 139 ? 0.1933 0.2931 0.2134 -0.0360 -0.0038 -0.0366 176 GLY A O      
1056 N  N      . ILE A 140 ? 0.1572 0.2195 0.1632 -0.0339 -0.0129 -0.0339 177 ILE A N      
1057 C  CA     . ILE A 140 ? 0.1626 0.2297 0.1691 -0.0147 -0.0174 -0.0364 177 ILE A CA     
1058 C  C      . ILE A 140 ? 0.1960 0.3047 0.2175 -0.0094 -0.0208 -0.0434 177 ILE A C      
1059 O  O      . ILE A 140 ? 0.1804 0.3008 0.2037 0.0067  -0.0212 -0.0462 177 ILE A O      
1060 C  CB     . ILE A 140 ? 0.2197 0.2614 0.2140 -0.0094 -0.0227 -0.0347 177 ILE A CB     
1061 C  CG1    . ILE A 140 ? 0.2396 0.2480 0.2217 -0.0108 -0.0186 -0.0287 177 ILE A CG1    
1062 C  CG2    . ILE A 140 ? 0.2202 0.2643 0.2102 0.0086  -0.0287 -0.0375 177 ILE A CG2    
1063 C  CD1    . ILE A 140 ? 0.2934 0.2823 0.2656 -0.0147 -0.0210 -0.0271 177 ILE A CD1    
1064 N  N      . LYS A 141 ? 0.1594 0.2909 0.1903 -0.0229 -0.0238 -0.0467 178 LYS A N      
1065 C  CA     . LYS A 141 ? 0.1579 0.3379 0.2069 -0.0200 -0.0275 -0.0544 178 LYS A CA     
1066 C  C      . LYS A 141 ? 0.1886 0.3987 0.2495 -0.0178 -0.0197 -0.0567 178 LYS A C      
1067 O  O      . LYS A 141 ? 0.1762 0.4161 0.2461 0.0003  -0.0219 -0.0625 178 LYS A O      
1068 C  CB     . LYS A 141 ? 0.1908 0.3884 0.2468 -0.0418 -0.0309 -0.0569 178 LYS A CB     
1069 C  CG     . LYS A 141 ? 0.2946 0.5516 0.3737 -0.0473 -0.0325 -0.0649 178 LYS A CG     
1070 C  CD     . LYS A 141 ? 0.3770 0.6566 0.4627 -0.0345 -0.0447 -0.0715 178 LYS A CD     
1071 C  CE     . LYS A 141 ? 0.3983 0.7420 0.5092 -0.0450 -0.0471 -0.0800 178 LYS A CE     
1072 N  NZ     . LYS A 141 ? 0.4492 0.8277 0.5708 -0.0195 -0.0579 -0.0882 178 LYS A NZ     
1073 N  N      . HIS A 142 ? 0.1383 0.3374 0.1959 -0.0340 -0.0108 -0.0522 179 HIS A N      
1074 C  CA     . HIS A 142 ? 0.1309 0.3532 0.1958 -0.0340 -0.0020 -0.0535 179 HIS A CA     
1075 C  C      . HIS A 142 ? 0.1667 0.3770 0.2243 -0.0083 -0.0019 -0.0539 179 HIS A C      
1076 O  O      . HIS A 142 ? 0.1499 0.3929 0.2164 0.0048  0.0000  -0.0595 179 HIS A O      
1077 C  CB     . HIS A 142 ? 0.1460 0.3467 0.2012 -0.0554 0.0063  -0.0475 179 HIS A CB     
1078 C  CG     . HIS A 142 ? 0.1993 0.4288 0.2616 -0.0611 0.0162  -0.0492 179 HIS A CG     
1079 N  ND1    . HIS A 142 ? 0.2343 0.5135 0.3139 -0.0750 0.0198  -0.0545 179 HIS A ND1    
1080 C  CD2    . HIS A 142 ? 0.2274 0.4432 0.2809 -0.0556 0.0231  -0.0465 179 HIS A CD2    
1081 C  CE1    . HIS A 142 ? 0.2315 0.5253 0.3116 -0.0776 0.0301  -0.0545 179 HIS A CE1    
1082 N  NE2    . HIS A 142 ? 0.2354 0.4901 0.2989 -0.0657 0.0320  -0.0497 179 HIS A NE2    
1083 N  N      . LEU A 143 ? 0.1343 0.2987 0.1743 -0.0010 -0.0045 -0.0486 180 LEU A N      
1084 C  CA     . LEU A 143 ? 0.1434 0.2885 0.1710 0.0203  -0.0058 -0.0486 180 LEU A CA     
1085 C  C      . LEU A 143 ? 0.2172 0.3806 0.2461 0.0429  -0.0134 -0.0552 180 LEU A C      
1086 O  O      . LEU A 143 ? 0.2332 0.4072 0.2592 0.0604  -0.0125 -0.0593 180 LEU A O      
1087 C  CB     . LEU A 143 ? 0.1445 0.2407 0.1540 0.0194  -0.0073 -0.0419 180 LEU A CB     
1088 C  CG     . LEU A 143 ? 0.2002 0.2766 0.2054 0.0035  -0.0008 -0.0360 180 LEU A CG     
1089 C  CD1    . LEU A 143 ? 0.2130 0.2510 0.2040 0.0048  -0.0027 -0.0309 180 LEU A CD1    
1090 C  CD2    . LEU A 143 ? 0.1979 0.2830 0.2026 0.0053  0.0058  -0.0369 180 LEU A CD2    
1091 N  N      . HIS A 144 ? 0.1671 0.3346 0.1985 0.0436  -0.0214 -0.0569 181 HIS A N      
1092 C  CA     . HIS A 144 ? 0.1691 0.3520 0.1992 0.0660  -0.0308 -0.0633 181 HIS A CA     
1093 C  C      . HIS A 144 ? 0.2335 0.4733 0.2834 0.0758  -0.0305 -0.0721 181 HIS A C      
1094 O  O      . HIS A 144 ? 0.2469 0.4935 0.2896 0.1021  -0.0354 -0.0775 181 HIS A O      
1095 C  CB     . HIS A 144 ? 0.1728 0.3505 0.2019 0.0614  -0.0392 -0.0632 181 HIS A CB     
1096 C  CG     . HIS A 144 ? 0.2158 0.3406 0.2229 0.0586  -0.0403 -0.0559 181 HIS A CG     
1097 N  ND1    . HIS A 144 ? 0.2328 0.3460 0.2348 0.0538  -0.0464 -0.0549 181 HIS A ND1    
1098 C  CD2    . HIS A 144 ? 0.2340 0.3189 0.2238 0.0595  -0.0358 -0.0499 181 HIS A CD2    
1099 C  CE1    . HIS A 144 ? 0.2309 0.3001 0.2134 0.0528  -0.0444 -0.0485 181 HIS A CE1    
1100 N  NE2    . HIS A 144 ? 0.2353 0.2877 0.2110 0.0551  -0.0382 -0.0453 181 HIS A NE2    
1101 N  N      . SER A 145 ? 0.1923 0.4719 0.2647 0.0547  -0.0243 -0.0738 182 SER A N      
1102 C  CA     . SER A 145 ? 0.1928 0.5362 0.2885 0.0584  -0.0216 -0.0824 182 SER A CA     
1103 C  C      . SER A 145 ? 0.2826 0.6319 0.3737 0.0753  -0.0143 -0.0846 182 SER A C      
1104 O  O      . SER A 145 ? 0.2754 0.6738 0.3802 0.0914  -0.0141 -0.0933 182 SER A O      
1105 C  CB     . SER A 145 ? 0.2066 0.5828 0.3221 0.0258  -0.0152 -0.0822 182 SER A CB     
1106 O  OG     . SER A 145 ? 0.2837 0.6408 0.3931 0.0075  -0.0034 -0.0759 182 SER A OG     
1107 N  N      . ALA A 146 ? 0.2745 0.5745 0.3453 0.0728  -0.0089 -0.0773 183 ALA A N      
1108 C  CA     . ALA A 146 ? 0.2853 0.5778 0.3448 0.0877  -0.0028 -0.0783 183 ALA A CA     
1109 C  C      . ALA A 146 ? 0.3528 0.6019 0.3846 0.1154  -0.0110 -0.0785 183 ALA A C      
1110 O  O      . ALA A 146 ? 0.3825 0.6124 0.3978 0.1278  -0.0076 -0.0787 183 ALA A O      
1111 C  CB     . ALA A 146 ? 0.2862 0.5500 0.3383 0.0662  0.0069  -0.0704 183 ALA A CB     
1112 N  N      . GLY A 147 ? 0.2956 0.5260 0.3189 0.1233  -0.0216 -0.0782 184 GLY A N      
1113 C  CA     . GLY A 147 ? 0.3082 0.4915 0.3001 0.1463  -0.0300 -0.0776 184 GLY A CA     
1114 C  C      . GLY A 147 ? 0.3403 0.4628 0.3093 0.1339  -0.0280 -0.0682 184 GLY A C      
1115 O  O      . GLY A 147 ? 0.3680 0.4466 0.3069 0.1487  -0.0330 -0.0669 184 GLY A O      
1116 N  N      . ILE A 148 ? 0.2411 0.3601 0.2222 0.1065  -0.0212 -0.0618 185 ILE A N      
1117 C  CA     . ILE A 148 ? 0.2265 0.2978 0.1915 0.0934  -0.0190 -0.0535 185 ILE A CA     
1118 C  C      . ILE A 148 ? 0.2464 0.2973 0.2075 0.0850  -0.0240 -0.0493 185 ILE A C      
1119 O  O      . ILE A 148 ? 0.2070 0.2760 0.1852 0.0697  -0.0229 -0.0482 185 ILE A O      
1120 C  CB     . ILE A 148 ? 0.2460 0.3217 0.2215 0.0729  -0.0094 -0.0495 185 ILE A CB     
1121 C  CG1    . ILE A 148 ? 0.2594 0.3499 0.2338 0.0817  -0.0038 -0.0532 185 ILE A CG1    
1122 C  CG2    . ILE A 148 ? 0.2489 0.2826 0.2116 0.0598  -0.0085 -0.0418 185 ILE A CG2    
1123 C  CD1    . ILE A 148 ? 0.3549 0.4707 0.3463 0.0619  0.0060  -0.0517 185 ILE A CD1    
1124 N  N      . ILE A 149 ? 0.2220 0.2321 0.1572 0.0940  -0.0290 -0.0468 186 ILE A N      
1125 C  CA     . ILE A 149 ? 0.2373 0.2244 0.1646 0.0862  -0.0323 -0.0424 186 ILE A CA     
1126 C  C      . ILE A 149 ? 0.2904 0.2438 0.2070 0.0718  -0.0272 -0.0354 186 ILE A C      
1127 O  O      . ILE A 149 ? 0.3231 0.2478 0.2185 0.0771  -0.0276 -0.0342 186 ILE A O      
1128 C  CB     . ILE A 149 ? 0.2983 0.2690 0.2047 0.1048  -0.0418 -0.0449 186 ILE A CB     
1129 C  CG1    . ILE A 149 ? 0.3001 0.3150 0.2231 0.1192  -0.0478 -0.0531 186 ILE A CG1    
1130 C  CG2    . ILE A 149 ? 0.2920 0.2395 0.1900 0.0938  -0.0431 -0.0398 186 ILE A CG2    
1131 C  CD1    . ILE A 149 ? 0.4113 0.4135 0.3102 0.1470  -0.0593 -0.0580 186 ILE A CD1    
1132 N  N      . HIS A 150 ? 0.2084 0.1678 0.1395 0.0536  -0.0227 -0.0316 187 HIS A N      
1133 C  CA     . HIS A 150 ? 0.1913 0.1315 0.1196 0.0398  -0.0177 -0.0261 187 HIS A CA     
1134 C  C      . HIS A 150 ? 0.2843 0.1887 0.1897 0.0392  -0.0191 -0.0223 187 HIS A C      
1135 O  O      . HIS A 150 ? 0.2886 0.1734 0.1807 0.0381  -0.0180 -0.0209 187 HIS A O      
1136 C  CB     . HIS A 150 ? 0.1559 0.1095 0.1012 0.0249  -0.0143 -0.0239 187 HIS A CB     
1137 C  CG     . HIS A 150 ? 0.1686 0.1142 0.1162 0.0138  -0.0094 -0.0201 187 HIS A CG     
1138 N  ND1    . HIS A 150 ? 0.1751 0.0993 0.1125 0.0096  -0.0086 -0.0164 187 HIS A ND1    
1139 C  CD2    . HIS A 150 ? 0.1671 0.1245 0.1251 0.0062  -0.0058 -0.0197 187 HIS A CD2    
1140 C  CE1    . HIS A 150 ? 0.1602 0.0869 0.1043 0.0015  -0.0054 -0.0145 187 HIS A CE1    
1141 N  NE2    . HIS A 150 ? 0.1568 0.0999 0.1111 -0.0001 -0.0038 -0.0161 187 HIS A NE2    
1142 N  N      . ARG A 151 ? 0.2417 0.1378 0.1414 0.0378  -0.0210 -0.0207 188 ARG A N      
1143 C  CA     . ARG A 151 ? 0.2774 0.1417 0.1541 0.0349  -0.0213 -0.0169 188 ARG A CA     
1144 C  C      . ARG A 151 ? 0.3404 0.1986 0.2204 0.0186  -0.0151 -0.0122 188 ARG A C      
1145 O  O      . ARG A 151 ? 0.3812 0.2193 0.2450 0.0130  -0.0138 -0.0090 188 ARG A O      
1146 C  CB     . ARG A 151 ? 0.2818 0.1156 0.1290 0.0456  -0.0256 -0.0175 188 ARG A CB     
1147 C  CG     . ARG A 151 ? 0.3915 0.2232 0.2262 0.0653  -0.0334 -0.0219 188 ARG A CG     
1148 C  CD     . ARG A 151 ? 0.5015 0.2910 0.2973 0.0761  -0.0382 -0.0217 188 ARG A CD     
1149 N  NE     . ARG A 151 ? 0.6374 0.4236 0.4288 0.0825  -0.0383 -0.0243 188 ARG A NE     
1150 C  CZ     . ARG A 151 ? 0.8110 0.5558 0.5682 0.0851  -0.0405 -0.0233 188 ARG A CZ     
1151 N  NH1    . ARG A 151 ? 0.7583 0.4600 0.4813 0.0802  -0.0426 -0.0192 188 ARG A NH1    
1152 N  NH2    . ARG A 151 ? 0.6727 0.4162 0.4264 0.0920  -0.0407 -0.0263 188 ARG A NH2    
1153 N  N      . ASP A 152 ? 0.2578 0.1341 0.1572 0.0112  -0.0115 -0.0120 189 ASP A N      
1154 C  CA     . ASP A 152 ? 0.2309 0.1068 0.1351 -0.0015 -0.0068 -0.0086 189 ASP A CA     
1155 C  C      . ASP A 152 ? 0.2296 0.1269 0.1544 -0.0056 -0.0044 -0.0088 189 ASP A C      
1156 O  O      . ASP A 152 ? 0.2219 0.1244 0.1538 -0.0119 -0.0021 -0.0076 189 ASP A O      
1157 C  CB     . ASP A 152 ? 0.2732 0.1369 0.1690 -0.0067 -0.0064 -0.0077 189 ASP A CB     
1158 C  CG     . ASP A 152 ? 0.4102 0.2726 0.3065 -0.0204 -0.0028 -0.0046 189 ASP A CG     
1159 O  OD1    . ASP A 152 ? 0.4061 0.2729 0.3044 -0.0246 0.0003  -0.0030 189 ASP A OD1    
1160 O  OD2    . ASP A 152 ? 0.4959 0.3560 0.3913 -0.0267 -0.0030 -0.0044 189 ASP A OD2    
1161 N  N      . LEU A 153 ? 0.1828 0.0901 0.1142 -0.0022 -0.0057 -0.0105 190 LEU A N      
1162 C  CA     . LEU A 153 ? 0.1858 0.1054 0.1297 -0.0067 -0.0041 -0.0105 190 LEU A CA     
1163 C  C      . LEU A 153 ? 0.2268 0.1436 0.1701 -0.0108 -0.0009 -0.0083 190 LEU A C      
1164 O  O      . LEU A 153 ? 0.2044 0.1141 0.1393 -0.0105 0.0002  -0.0073 190 LEU A O      
1165 C  CB     . LEU A 153 ? 0.2063 0.1332 0.1534 -0.0047 -0.0068 -0.0129 190 LEU A CB     
1166 C  CG     . LEU A 153 ? 0.2831 0.2243 0.2372 -0.0028 -0.0092 -0.0160 190 LEU A CG     
1167 C  CD1    . LEU A 153 ? 0.3044 0.2524 0.2585 -0.0002 -0.0136 -0.0188 190 LEU A CD1    
1168 C  CD2    . LEU A 153 ? 0.2694 0.2191 0.2319 -0.0102 -0.0065 -0.0158 190 LEU A CD2    
1169 N  N      . LYS A 154 ? 0.1793 0.1026 0.1301 -0.0136 0.0006  -0.0079 191 LYS A N      
1170 C  CA     . LYS A 154 ? 0.1699 0.0970 0.1223 -0.0146 0.0033  -0.0069 191 LYS A CA     
1171 C  C      . LYS A 154 ? 0.1934 0.1240 0.1498 -0.0125 0.0024  -0.0078 191 LYS A C      
1172 O  O      . LYS A 154 ? 0.1951 0.1245 0.1529 -0.0136 0.0006  -0.0080 191 LYS A O      
1173 C  CB     . LYS A 154 ? 0.1801 0.1101 0.1327 -0.0199 0.0057  -0.0055 191 LYS A CB     
1174 C  CG     . LYS A 154 ? 0.1504 0.0836 0.1077 -0.0223 0.0039  -0.0056 191 LYS A CG     
1175 C  CD     . LYS A 154 ? 0.3475 0.2793 0.3010 -0.0305 0.0048  -0.0044 191 LYS A CD     
1176 C  CE     . LYS A 154 ? 0.5123 0.4263 0.4534 -0.0312 0.0025  -0.0043 191 LYS A CE     
1177 N  NZ     . LYS A 154 ? 0.7025 0.6065 0.6326 -0.0412 0.0029  -0.0030 191 LYS A NZ     
1178 N  N      . PRO A 155 ? 0.1395 0.0720 0.0943 -0.0085 0.0036  -0.0083 192 PRO A N      
1179 C  CA     . PRO A 155 ? 0.1394 0.0674 0.0909 -0.0041 0.0014  -0.0094 192 PRO A CA     
1180 C  C      . PRO A 155 ? 0.1782 0.1110 0.1336 -0.0032 -0.0001 -0.0090 192 PRO A C      
1181 O  O      . PRO A 155 ? 0.1703 0.0926 0.1184 -0.0015 -0.0029 -0.0092 192 PRO A O      
1182 C  CB     . PRO A 155 ? 0.1745 0.1027 0.1206 0.0032  0.0029  -0.0108 192 PRO A CB     
1183 C  CG     . PRO A 155 ? 0.2374 0.1771 0.1882 0.0011  0.0074  -0.0101 192 PRO A CG     
1184 C  CD     . PRO A 155 ? 0.1696 0.1056 0.1217 -0.0066 0.0071  -0.0084 192 PRO A CD     
1185 N  N      . SER A 156 ? 0.1421 0.0883 0.1061 -0.0056 0.0011  -0.0086 193 SER A N      
1186 C  CA     . SER A 156 ? 0.1461 0.0974 0.1132 -0.0048 -0.0017 -0.0088 193 SER A CA     
1187 C  C      . SER A 156 ? 0.1861 0.1261 0.1490 -0.0092 -0.0035 -0.0077 193 SER A C      
1188 O  O      . SER A 156 ? 0.2131 0.1504 0.1730 -0.0074 -0.0063 -0.0077 193 SER A O      
1189 C  CB     . SER A 156 ? 0.1892 0.1587 0.1661 -0.0092 -0.0006 -0.0090 193 SER A CB     
1190 O  OG     . SER A 156 ? 0.2710 0.2349 0.2466 -0.0182 0.0011  -0.0076 193 SER A OG     
1191 N  N      . ASN A 157 ? 0.1314 0.0658 0.0930 -0.0134 -0.0019 -0.0072 194 ASN A N      
1192 C  CA     . ASN A 157 ? 0.1290 0.0583 0.0880 -0.0167 -0.0021 -0.0070 194 ASN A CA     
1193 C  C      . ASN A 157 ? 0.1761 0.0993 0.1301 -0.0185 -0.0019 -0.0073 194 ASN A C      
1194 O  O      . ASN A 157 ? 0.1588 0.0842 0.1131 -0.0221 -0.0007 -0.0078 194 ASN A O      
1195 C  CB     . ASN A 157 ? 0.1342 0.0649 0.0945 -0.0185 -0.0012 -0.0073 194 ASN A CB     
1196 C  CG     . ASN A 157 ? 0.3045 0.2358 0.2646 -0.0205 -0.0023 -0.0070 194 ASN A CG     
1197 O  OD1    . ASN A 157 ? 0.3221 0.2541 0.2818 -0.0206 -0.0041 -0.0070 194 ASN A OD1    
1198 N  ND2    . ASN A 157 ? 0.2371 0.1655 0.1945 -0.0230 -0.0019 -0.0068 194 ASN A ND2    
1199 N  N      . ILE A 158 ? 0.1380 0.0540 0.0861 -0.0164 -0.0030 -0.0075 195 ILE A N      
1200 C  CA     . ILE A 158 ? 0.1513 0.0570 0.0903 -0.0208 -0.0036 -0.0078 195 ILE A CA     
1201 C  C      . ILE A 158 ? 0.2177 0.1064 0.1421 -0.0175 -0.0060 -0.0071 195 ILE A C      
1202 O  O      . ILE A 158 ? 0.2095 0.0968 0.1319 -0.0082 -0.0076 -0.0078 195 ILE A O      
1203 C  CB     . ILE A 158 ? 0.1867 0.0928 0.1260 -0.0213 -0.0040 -0.0092 195 ILE A CB     
1204 C  CG1    . ILE A 158 ? 0.1701 0.0905 0.1203 -0.0217 -0.0030 -0.0101 195 ILE A CG1    
1205 C  CG2    . ILE A 158 ? 0.2188 0.1134 0.1470 -0.0290 -0.0056 -0.0099 195 ILE A CG2    
1206 C  CD1    . ILE A 158 ? 0.2247 0.1450 0.1740 -0.0186 -0.0039 -0.0112 195 ILE A CD1    
1207 N  N      . VAL A 159 ? 0.1823 0.0582 0.0948 -0.0243 -0.0061 -0.0060 196 VAL A N      
1208 C  CA     . VAL A 159 ? 0.2022 0.0539 0.0932 -0.0211 -0.0093 -0.0051 196 VAL A CA     
1209 C  C      . VAL A 159 ? 0.2670 0.0962 0.1383 -0.0306 -0.0101 -0.0048 196 VAL A C      
1210 O  O      . VAL A 159 ? 0.2547 0.0927 0.1319 -0.0429 -0.0074 -0.0052 196 VAL A O      
1211 C  CB     . VAL A 159 ? 0.2533 0.1015 0.1393 -0.0204 -0.0098 -0.0034 196 VAL A CB     
1212 C  CG1    . VAL A 159 ? 0.2344 0.0988 0.1337 -0.0095 -0.0118 -0.0043 196 VAL A CG1    
1213 C  CG2    . VAL A 159 ? 0.2376 0.0957 0.1297 -0.0323 -0.0050 -0.0025 196 VAL A CG2    
1214 N  N      . VAL A 160 ? 0.2734 0.0735 0.1197 -0.0244 -0.0143 -0.0046 197 VAL A N      
1215 C  CA     . VAL A 160 ? 0.3194 0.0886 0.1389 -0.0335 -0.0164 -0.0044 197 VAL A CA     
1216 C  C      . VAL A 160 ? 0.4008 0.1320 0.1859 -0.0314 -0.0200 -0.0023 197 VAL A C      
1217 O  O      . VAL A 160 ? 0.3940 0.1235 0.1765 -0.0166 -0.0228 -0.0021 197 VAL A O      
1218 C  CB     . VAL A 160 ? 0.3694 0.1302 0.1830 -0.0258 -0.0194 -0.0072 197 VAL A CB     
1219 C  CG1    . VAL A 160 ? 0.3254 0.1196 0.1684 -0.0265 -0.0164 -0.0090 197 VAL A CG1    
1220 C  CG2    . VAL A 160 ? 0.3817 0.1291 0.1823 -0.0042 -0.0236 -0.0086 197 VAL A CG2    
1221 N  N      . LYS A 161 ? 0.4206 0.1205 0.1775 -0.0467 -0.0207 -0.0010 198 LYS A N      
1222 C  CA     . LYS A 161 ? 0.4885 0.1402 0.2020 -0.0469 -0.0249 0.0013  198 LYS A CA     
1223 C  C      . LYS A 161 ? 0.5897 0.2027 0.2715 -0.0404 -0.0312 -0.0007 198 LYS A C      
1224 O  O      . LYS A 161 ? 0.5439 0.1687 0.2377 -0.0427 -0.0310 -0.0034 198 LYS A O      
1225 C  CB     . LYS A 161 ? 0.5493 0.1881 0.2472 -0.0732 -0.0202 0.0046  198 LYS A CB     
1226 C  CG     . LYS A 161 ? 0.6343 0.2941 0.3463 -0.0764 -0.0150 0.0070  198 LYS A CG     
1227 C  CD     . LYS A 161 ? 0.7770 0.4065 0.4559 -0.0974 -0.0116 0.0109  198 LYS A CD     
1228 C  CE     . LYS A 161 ? 0.9462 0.5992 0.6385 -0.1249 -0.0038 0.0107  198 LYS A CE     
1229 N  NZ     . LYS A 161 ? 1.1153 0.7462 0.7786 -0.1476 0.0017  0.0147  198 LYS A NZ     
1230 N  N      . SER A 162 ? 0.6164 0.1787 0.2529 -0.0320 -0.0374 0.0005  199 SER A N      
1231 C  CA     . SER A 162 ? 0.6671 0.1805 0.2617 -0.0235 -0.0447 -0.0016 199 SER A CA     
1232 C  C      . SER A 162 ? 0.7085 0.2015 0.2867 -0.0498 -0.0438 -0.0015 199 SER A C      
1233 O  O      . SER A 162 ? 0.7339 0.1984 0.2885 -0.0434 -0.0491 -0.0044 199 SER A O      
1234 C  CB     . SER A 162 ? 0.7901 0.2471 0.3330 -0.0126 -0.0517 0.0004  199 SER A CB     
1235 O  OG     . SER A 162 ? 0.9712 0.4441 0.5244 0.0174  -0.0557 -0.0016 199 SER A OG     
1236 N  N      . ASP A 163 ? 0.6374 0.1466 0.2274 -0.0791 -0.0374 0.0013  200 ASP A N      
1237 C  CA     . ASP A 163 ? 0.6560 0.1559 0.2358 -0.1083 -0.0363 0.0009  200 ASP A CA     
1238 C  C      . ASP A 163 ? 0.6772 0.2305 0.3037 -0.1113 -0.0335 -0.0028 200 ASP A C      
1239 O  O      . ASP A 163 ? 0.6657 0.2282 0.2959 -0.1361 -0.0321 -0.0038 200 ASP A O      
1240 C  CB     . ASP A 163 ? 0.6872 0.1826 0.2561 -0.1388 -0.0302 0.0052  200 ASP A CB     
1241 C  CG     . ASP A 163 ? 0.7040 0.2599 0.3208 -0.1443 -0.0210 0.0061  200 ASP A CG     
1242 O  OD1    . ASP A 163 ? 0.6240 0.2221 0.2811 -0.1243 -0.0199 0.0040  200 ASP A OD1    
1243 O  OD2    . ASP A 163 ? 0.7772 0.3369 0.3887 -0.1689 -0.0146 0.0089  200 ASP A OD2    
1244 N  N      . CYS A 164 ? 0.6256 0.2155 0.2872 -0.0871 -0.0326 -0.0049 201 CYS A N      
1245 C  CA     . CYS A 164 ? 0.5946 0.2298 0.2959 -0.0845 -0.0306 -0.0081 201 CYS A CA     
1246 C  C      . CYS A 164 ? 0.5494 0.2359 0.2909 -0.0989 -0.0238 -0.0075 201 CYS A C      
1247 O  O      . CYS A 164 ? 0.5184 0.2392 0.2887 -0.0981 -0.0229 -0.0102 201 CYS A O      
1248 C  CB     . CYS A 164 ? 0.6520 0.2659 0.3347 -0.0918 -0.0358 -0.0114 201 CYS A CB     
1249 S  SG     . CYS A 164 ? 0.6916 0.3318 0.3990 -0.0702 -0.0370 -0.0156 201 CYS A SG     
1250 N  N      . THR A 165 ? 0.4841 0.1748 0.2254 -0.1099 -0.0191 -0.0044 202 THR A N      
1251 C  CA     . THR A 165 ? 0.4365 0.1759 0.2137 -0.1197 -0.0123 -0.0046 202 THR A CA     
1252 C  C      . THR A 165 ? 0.4104 0.1808 0.2187 -0.0980 -0.0103 -0.0049 202 THR A C      
1253 O  O      . THR A 165 ? 0.4158 0.1714 0.2163 -0.0808 -0.0124 -0.0037 202 THR A O      
1254 C  CB     . THR A 165 ? 0.5443 0.2784 0.3086 -0.1404 -0.0069 -0.0016 202 THR A CB     
1255 O  OG1    . THR A 165 ? 0.5394 0.2464 0.2838 -0.1288 -0.0072 0.0018  202 THR A OG1    
1256 C  CG2    . THR A 165 ? 0.5713 0.2773 0.3051 -0.1674 -0.0083 -0.0014 202 THR A CG2    
1257 N  N      . LEU A 166 ? 0.2900 0.1026 0.1312 -0.0991 -0.0072 -0.0070 203 LEU A N      
1258 C  CA     . LEU A 166 ? 0.2428 0.0806 0.1096 -0.0814 -0.0062 -0.0078 203 LEU A CA     
1259 C  C      . LEU A 166 ? 0.2628 0.1346 0.1528 -0.0840 -0.0009 -0.0081 203 LEU A C      
1260 O  O      . LEU A 166 ? 0.2508 0.1420 0.1480 -0.0983 0.0021  -0.0095 203 LEU A O      
1261 C  CB     . LEU A 166 ? 0.2273 0.0742 0.1041 -0.0751 -0.0096 -0.0108 203 LEU A CB     
1262 C  CG     . LEU A 166 ? 0.2381 0.1085 0.1379 -0.0597 -0.0089 -0.0117 203 LEU A CG     
1263 C  CD1    . LEU A 166 ? 0.2278 0.0894 0.1231 -0.0507 -0.0123 -0.0133 203 LEU A CD1    
1264 C  CD2    . LEU A 166 ? 0.2143 0.1180 0.1367 -0.0633 -0.0067 -0.0136 203 LEU A CD2    
1265 N  N      . LYS A 167 ? 0.1960 0.0764 0.0973 -0.0699 0.0001  -0.0073 204 LYS A N      
1266 C  CA     . LYS A 167 ? 0.1695 0.0765 0.0890 -0.0677 0.0042  -0.0080 204 LYS A CA     
1267 C  C      . LYS A 167 ? 0.2046 0.1215 0.1381 -0.0528 0.0027  -0.0087 204 LYS A C      
1268 O  O      . LYS A 167 ? 0.2195 0.1231 0.1481 -0.0442 0.0002  -0.0075 204 LYS A O      
1269 C  CB     . LYS A 167 ? 0.1991 0.0971 0.1077 -0.0711 0.0076  -0.0055 204 LYS A CB     
1270 C  CG     . LYS A 167 ? 0.3066 0.1929 0.1973 -0.0893 0.0107  -0.0041 204 LYS A CG     
1271 C  CD     . LYS A 167 ? 0.3777 0.2559 0.2562 -0.0923 0.0150  -0.0015 204 LYS A CD     
1272 C  CE     . LYS A 167 ? 0.4563 0.3109 0.3076 -0.1111 0.0177  0.0011  204 LYS A CE     
1273 N  NZ     . LYS A 167 ? 0.3926 0.2746 0.2538 -0.1302 0.0239  -0.0009 204 LYS A NZ     
1274 N  N      . ILE A 168 ? 0.1341 0.0745 0.0833 -0.0497 0.0041  -0.0111 205 ILE A N      
1275 C  CA     . ILE A 168 ? 0.1064 0.0578 0.0630 -0.0347 0.0041  -0.0095 205 ILE A CA     
1276 C  C      . ILE A 168 ? 0.1628 0.1092 0.1190 -0.0361 0.0056  -0.0107 205 ILE A C      
1277 O  O      . ILE A 168 ? 0.1470 0.1039 0.1039 -0.0407 0.0092  -0.0117 205 ILE A O      
1278 C  CB     . ILE A 168 ? 0.1397 0.1046 0.1078 -0.0345 0.0021  -0.0148 205 ILE A CB     
1279 C  CG1    . ILE A 168 ? 0.1488 0.1123 0.1160 -0.0379 -0.0013 -0.0160 205 ILE A CG1    
1280 C  CG2    . ILE A 168 ? 0.1237 0.0868 0.0933 -0.0232 0.0009  -0.0150 205 ILE A CG2    
1281 C  CD1    . ILE A 168 ? 0.1877 0.1722 0.1645 -0.0339 -0.0040 -0.0200 205 ILE A CD1    
1282 N  N      . LEU A 169 ? 0.1341 0.0705 0.0877 -0.0302 0.0039  -0.0092 206 LEU A N      
1283 C  CA     . LEU A 169 ? 0.1391 0.0725 0.0885 -0.0286 0.0048  -0.0086 206 LEU A CA     
1284 C  C      . LEU A 169 ? 0.2024 0.1427 0.1548 -0.0231 0.0054  -0.0106 206 LEU A C      
1285 O  O      . LEU A 169 ? 0.1852 0.1239 0.1323 -0.0222 0.0069  -0.0109 206 LEU A O      
1286 C  CB     . LEU A 169 ? 0.1373 0.0592 0.0822 -0.0256 0.0013  -0.0068 206 LEU A CB     
1287 C  CG     . LEU A 169 ? 0.1696 0.0793 0.1057 -0.0266 -0.0006 -0.0053 206 LEU A CG     
1288 C  CD1    . LEU A 169 ? 0.1502 0.0576 0.0866 -0.0198 -0.0047 -0.0051 206 LEU A CD1    
1289 C  CD2    . LEU A 169 ? 0.2046 0.1036 0.1272 -0.0323 0.0011  -0.0040 206 LEU A CD2    
1290 N  N      . ASP A 170 ? 0.1697 0.1129 0.1263 -0.0184 0.0038  -0.0118 207 ASP A N      
1291 C  CA     . ASP A 170 ? 0.1609 0.1019 0.1133 -0.0115 0.0029  -0.0136 207 ASP A CA     
1292 C  C      . ASP A 170 ? 0.1986 0.1508 0.1540 -0.0047 0.0027  -0.0168 207 ASP A C      
1293 O  O      . ASP A 170 ? 0.1370 0.1017 0.1004 -0.0070 0.0028  -0.0176 207 ASP A O      
1294 C  CB     . ASP A 170 ? 0.1846 0.1118 0.1323 -0.0118 0.0000  -0.0119 207 ASP A CB     
1295 C  CG     . ASP A 170 ? 0.2402 0.1668 0.1901 -0.0114 -0.0011 -0.0114 207 ASP A CG     
1296 O  OD1    . ASP A 170 ? 0.2543 0.1886 0.2107 -0.0129 -0.0005 -0.0114 207 ASP A OD1    
1297 O  OD2    . ASP A 170 ? 0.3457 0.2615 0.2875 -0.0098 -0.0026 -0.0112 207 ASP A OD2    
1298 N  N      . PHE A 171 ? 0.1820 0.1277 0.1284 0.0045  0.0012  -0.0189 208 PHE A N      
1299 C  CA     . PHE A 171 ? 0.1842 0.1392 0.1298 0.0158  -0.0005 -0.0228 208 PHE A CA     
1300 C  C      . PHE A 171 ? 0.2568 0.1905 0.1882 0.0227  -0.0052 -0.0225 208 PHE A C      
1301 O  O      . PHE A 171 ? 0.2758 0.2112 0.2009 0.0353  -0.0082 -0.0259 208 PHE A O      
1302 C  CB     . PHE A 171 ? 0.2080 0.1743 0.1509 0.0244  0.0021  -0.0267 208 PHE A CB     
1303 C  CG     . PHE A 171 ? 0.2098 0.1980 0.1647 0.0153  0.0080  -0.0268 208 PHE A CG     
1304 C  CD1    . PHE A 171 ? 0.2330 0.2515 0.2024 0.0130  0.0102  -0.0295 208 PHE A CD1    
1305 C  CD2    . PHE A 171 ? 0.2324 0.2100 0.1821 0.0075  0.0108  -0.0240 208 PHE A CD2    
1306 C  CE1    . PHE A 171 ? 0.2395 0.2749 0.2160 0.0007  0.0164  -0.0290 208 PHE A CE1    
1307 C  CE2    . PHE A 171 ? 0.2631 0.2548 0.2181 -0.0023 0.0163  -0.0232 208 PHE A CE2    
1308 C  CZ     . PHE A 171 ? 0.2322 0.2516 0.1997 -0.0067 0.0197  -0.0255 208 PHE A CZ     
1309 N  N      . GLY A 172 ? 0.2242 0.1397 0.1503 0.0142  -0.0058 -0.0186 209 GLY A N      
1310 C  CA     . GLY A 172 ? 0.2554 0.1487 0.1661 0.0153  -0.0089 -0.0171 209 GLY A CA     
1311 C  C      . GLY A 172 ? 0.3740 0.2408 0.2600 0.0226  -0.0121 -0.0182 209 GLY A C      
1312 O  O      . GLY A 172 ? 0.4104 0.2701 0.2899 0.0224  -0.0118 -0.0190 209 GLY A O      
1313 N  N      . LEU A 173 ? 0.3627 0.2096 0.2305 0.0286  -0.0156 -0.0181 210 LEU A N      
1314 C  CA     . LEU A 173 ? 0.4792 0.2910 0.3148 0.0363  -0.0199 -0.0191 210 LEU A CA     
1315 C  C      . LEU A 173 ? 0.4692 0.2881 0.2996 0.0579  -0.0234 -0.0247 210 LEU A C      
1316 O  O      . LEU A 173 ? 0.5901 0.3963 0.4050 0.0674  -0.0250 -0.0276 210 LEU A O      
1317 C  CB     . LEU A 173 ? 0.4996 0.2823 0.3129 0.0319  -0.0221 -0.0158 210 LEU A CB     
1318 C  CG     . LEU A 173 ? 0.5335 0.3238 0.3594 0.0136  -0.0175 -0.0111 210 LEU A CG     
1319 C  CD1    . LEU A 173 ? 0.5433 0.3094 0.3470 0.0127  -0.0188 -0.0085 210 LEU A CD1    
1320 C  CD2    . LEU A 173 ? 0.5690 0.3553 0.3962 -0.0035 -0.0147 -0.0085 210 LEU A CD2    
1321 N  N      . SER A 180 ? 1.1267 0.6419 0.7208 -0.0771 -0.0443 -0.0096 217 SER A N      
1322 C  CA     . SER A 180 ? 1.0865 0.6400 0.7136 -0.0871 -0.0371 -0.0055 217 SER A CA     
1323 C  C      . SER A 180 ? 1.1014 0.6753 0.7433 -0.1200 -0.0340 -0.0028 217 SER A C      
1324 O  O      . SER A 180 ? 1.0718 0.6823 0.7429 -0.1285 -0.0273 0.0000  217 SER A O      
1325 C  CB     . SER A 180 ? 1.1659 0.6891 0.7659 -0.0797 -0.0365 -0.0030 217 SER A CB     
1326 O  OG     . SER A 180 ? 1.3598 0.8205 0.9043 -0.0927 -0.0411 -0.0012 217 SER A OG     
1327 N  N      . PHE A 181 ? 1.0463 0.5987 0.6679 -0.1377 -0.0393 -0.0041 218 PHE A N      
1328 C  CA     . PHE A 181 ? 1.0186 0.5936 0.6537 -0.1699 -0.0380 -0.0028 218 PHE A CA     
1329 C  C      . PHE A 181 ? 1.0224 0.6462 0.6982 -0.1692 -0.0395 -0.0060 218 PHE A C      
1330 O  O      . PHE A 181 ? 1.0103 0.6224 0.6790 -0.1560 -0.0452 -0.0096 218 PHE A O      
1331 C  CB     . PHE A 181 ? 1.0881 0.6068 0.6715 -0.1951 -0.0436 -0.0021 218 PHE A CB     
1332 C  CG     . PHE A 181 ? 1.0864 0.6308 0.6832 -0.2296 -0.0443 -0.0023 218 PHE A CG     
1333 C  CD1    . PHE A 181 ? 1.0927 0.6750 0.7128 -0.2531 -0.0366 0.0007  218 PHE A CD1    
1334 C  CD2    . PHE A 181 ? 1.1180 0.6512 0.7040 -0.2381 -0.0530 -0.0062 218 PHE A CD2    
1335 C  CE1    . PHE A 181 ? 1.0998 0.7142 0.7358 -0.2845 -0.0374 -0.0005 218 PHE A CE1    
1336 C  CE2    . PHE A 181 ? 1.1476 0.7092 0.7477 -0.2703 -0.0549 -0.0073 218 PHE A CE2    
1337 C  CZ     . PHE A 181 ? 1.1051 0.7094 0.7314 -0.2935 -0.0471 -0.0045 218 PHE A CZ     
1338 N  N      . MET A 182 ? 0.9504 0.6274 0.6657 -0.1828 -0.0348 -0.0051 219 MET A N      
1339 C  CA     . MET A 182 ? 0.9128 0.6378 0.6659 -0.1824 -0.0369 -0.0081 219 MET A CA     
1340 C  C      . MET A 182 ? 0.9605 0.7111 0.7233 -0.2137 -0.0381 -0.0086 219 MET A C      
1341 O  O      . MET A 182 ? 0.9569 0.7235 0.7258 -0.2305 -0.0315 -0.0060 219 MET A O      
1342 C  CB     . MET A 182 ? 0.8878 0.6591 0.6826 -0.1627 -0.0309 -0.0077 219 MET A CB     
1343 N  N      . MET A 183 ? 0.9072 0.6630 0.6707 -0.2217 -0.0464 -0.0123 220 MET A N      
1344 C  CA     . MET A 183 ? 1.1221 0.9079 0.8972 -0.2511 -0.0498 -0.0143 220 MET A CA     
1345 C  C      . MET A 183 ? 1.6310 1.4893 1.4587 -0.2459 -0.0469 -0.0161 220 MET A C      
1346 O  O      . MET A 183 ? 1.2244 1.1224 1.0709 -0.2666 -0.0494 -0.0187 220 MET A O      
1347 C  CB     . MET A 183 ? 1.1774 0.9376 0.9297 -0.2595 -0.0616 -0.0183 220 MET A CB     
1348 C  CG     . MET A 183 ? 1.2799 0.9819 0.9813 -0.2850 -0.0657 -0.0175 220 MET A CG     
1349 S  SD     . MET A 183 ? 1.3482 1.0820 1.0573 -0.3317 -0.0642 -0.0172 220 MET A SD     
1350 C  CE     . MET A 183 ? 1.3861 1.0358 1.0250 -0.3579 -0.0727 -0.0171 220 MET A CE     
1351 N  N      . VAL A 188 ? 0.5212 0.4507 0.4350 -0.1263 0.0111  0.0006  225 VAL A N      
1352 C  CA     . VAL A 188 ? 0.5037 0.4200 0.4174 -0.1046 0.0095  0.0006  225 VAL A CA     
1353 C  C      . VAL A 188 ? 0.5026 0.4245 0.4186 -0.0979 0.0156  0.0020  225 VAL A C      
1354 O  O      . VAL A 188 ? 0.5204 0.4339 0.4225 -0.1091 0.0208  0.0043  225 VAL A O      
1355 C  CB     . VAL A 188 ? 0.5771 0.4516 0.4649 -0.0990 0.0043  0.0011  225 VAL A CB     
1356 N  N      . THR A 189 ? 0.4030 0.3360 0.3333 -0.0806 0.0148  0.0005  226 THR A N      
1357 C  CA     . THR A 189 ? 0.3752 0.3131 0.3080 -0.0715 0.0189  0.0009  226 THR A CA     
1358 C  C      . THR A 189 ? 0.4026 0.3083 0.3133 -0.0667 0.0180  0.0027  226 THR A C      
1359 O  O      . THR A 189 ? 0.4042 0.2961 0.3113 -0.0563 0.0128  0.0017  226 THR A O      
1360 C  CB     . THR A 189 ? 0.3595 0.3151 0.3108 -0.0567 0.0167  -0.0017 226 THR A CB     
1361 O  OG1    . THR A 189 ? 0.3098 0.2929 0.2778 -0.0591 0.0162  -0.0036 226 THR A OG1    
1362 C  CG2    . THR A 189 ? 0.3132 0.2727 0.2656 -0.0472 0.0200  -0.0020 226 THR A CG2    
1363 N  N      . ARG A 190 ? 0.3470 0.2436 0.2431 -0.0733 0.0230  0.0049  227 ARG A N      
1364 C  CA     . ARG A 190 ? 0.3602 0.2250 0.2316 -0.0680 0.0214  0.0066  227 ARG A CA     
1365 C  C      . ARG A 190 ? 0.3883 0.2589 0.2618 -0.0581 0.0239  0.0062  227 ARG A C      
1366 O  O      . ARG A 190 ? 0.3972 0.2447 0.2525 -0.0506 0.0208  0.0068  227 ARG A O      
1367 C  CB     . ARG A 190 ? 0.4037 0.2422 0.2463 -0.0842 0.0244  0.0101  227 ARG A CB     
1368 C  CG     . ARG A 190 ? 0.5767 0.3931 0.4048 -0.0917 0.0194  0.0103  227 ARG A CG     
1369 C  CD     . ARG A 190 ? 0.7944 0.5792 0.5885 -0.1104 0.0224  0.0141  227 ARG A CD     
1370 N  NE     . ARG A 190 ? 1.0028 0.7694 0.7834 -0.1223 0.0182  0.0140  227 ARG A NE     
1371 C  CZ     . ARG A 190 ? 1.1538 0.9427 0.9473 -0.1416 0.0208  0.0137  227 ARG A CZ     
1372 N  NH1    . ARG A 190 ? 0.9033 0.7369 0.7250 -0.1494 0.0282  0.0132  227 ARG A NH1    
1373 N  NH2    . ARG A 190 ? 1.0162 0.7836 0.7935 -0.1523 0.0156  0.0132  227 ARG A NH2    
1374 N  N      . TYR A 191 ? 0.3268 0.2270 0.2202 -0.0566 0.0285  0.0047  228 TYR A N      
1375 C  CA     . TYR A 191 ? 0.3224 0.2275 0.2158 -0.0476 0.0311  0.0038  228 TYR A CA     
1376 C  C      . TYR A 191 ? 0.3206 0.2091 0.2075 -0.0342 0.0242  0.0024  228 TYR A C      
1377 O  O      . TYR A 191 ? 0.2986 0.1795 0.1746 -0.0297 0.0253  0.0024  228 TYR A O      
1378 C  CB     . TYR A 191 ? 0.3170 0.2540 0.2325 -0.0426 0.0343  0.0010  228 TYR A CB     
1379 C  CG     . TYR A 191 ? 0.3524 0.3166 0.2812 -0.0532 0.0395  0.0008  228 TYR A CG     
1380 C  CD1    . TYR A 191 ? 0.4143 0.3801 0.3333 -0.0695 0.0465  0.0033  228 TYR A CD1    
1381 C  CD2    . TYR A 191 ? 0.3406 0.3298 0.2904 -0.0474 0.0372  -0.0022 228 TYR A CD2    
1382 C  CE1    . TYR A 191 ? 0.4332 0.4302 0.3669 -0.0816 0.0510  0.0024  228 TYR A CE1    
1383 C  CE2    . TYR A 191 ? 0.3472 0.3667 0.3112 -0.0561 0.0405  -0.0034 228 TYR A CE2    
1384 C  CZ     . TYR A 191 ? 0.4843 0.5108 0.4422 -0.0739 0.0476  -0.0013 228 TYR A CZ     
1385 O  OH     . TYR A 191 ? 0.5305 0.5927 0.5046 -0.0848 0.0509  -0.0031 228 TYR A OH     
1386 N  N      . TYR A 192 ? 0.2470 0.1331 0.1413 -0.0285 0.0172  0.0008  229 TYR A N      
1387 C  CA     . TYR A 192 ? 0.2125 0.0931 0.1068 -0.0176 0.0106  -0.0015 229 TYR A CA     
1388 C  C      . TYR A 192 ? 0.2775 0.1376 0.1553 -0.0131 0.0050  -0.0015 229 TYR A C      
1389 O  O      . TYR A 192 ? 0.2692 0.1294 0.1477 -0.0041 -0.0008 -0.0040 229 TYR A O      
1390 C  CB     . TYR A 192 ? 0.1930 0.0895 0.1069 -0.0147 0.0078  -0.0038 229 TYR A CB     
1391 C  CG     . TYR A 192 ? 0.1779 0.0906 0.1034 -0.0160 0.0120  -0.0042 229 TYR A CG     
1392 C  CD1    . TYR A 192 ? 0.1815 0.1063 0.1156 -0.0219 0.0150  -0.0034 229 TYR A CD1    
1393 C  CD2    . TYR A 192 ? 0.1840 0.0990 0.1089 -0.0104 0.0124  -0.0059 229 TYR A CD2    
1394 C  CE1    . TYR A 192 ? 0.1669 0.1098 0.1109 -0.0202 0.0182  -0.0046 229 TYR A CE1    
1395 C  CE2    . TYR A 192 ? 0.1893 0.1174 0.1207 -0.0080 0.0161  -0.0069 229 TYR A CE2    
1396 C  CZ     . TYR A 192 ? 0.2490 0.1931 0.1910 -0.0119 0.0189  -0.0064 229 TYR A CZ     
1397 O  OH     . TYR A 192 ? 0.2333 0.1941 0.1825 -0.0065 0.0213  -0.0083 229 TYR A OH     
1398 N  N      . ARG A 193 ? 0.2605 0.1023 0.1210 -0.0191 0.0063  0.0011  230 ARG A N      
1399 C  CA     . ARG A 193 ? 0.2915 0.1074 0.1296 -0.0124 0.0003  0.0010  230 ARG A CA     
1400 C  C      . ARG A 193 ? 0.3520 0.1494 0.1685 -0.0054 -0.0024 0.0014  230 ARG A C      
1401 O  O      . ARG A 193 ? 0.3398 0.1312 0.1460 -0.0120 0.0030  0.0039  230 ARG A O      
1402 C  CB     . ARG A 193 ? 0.2839 0.0788 0.1044 -0.0219 0.0016  0.0035  230 ARG A CB     
1403 C  CG     . ARG A 193 ? 0.3284 0.1379 0.1671 -0.0230 0.0003  0.0017  230 ARG A CG     
1404 C  CD     . ARG A 193 ? 0.4017 0.1909 0.2234 -0.0338 0.0007  0.0035  230 ARG A CD     
1405 N  NE     . ARG A 193 ? 0.3868 0.1939 0.2280 -0.0362 0.0002  0.0017  230 ARG A NE     
1406 C  CZ     . ARG A 193 ? 0.5540 0.3474 0.3843 -0.0448 -0.0009 0.0022  230 ARG A CZ     
1407 N  NH1    . ARG A 193 ? 0.5086 0.2674 0.3067 -0.0530 -0.0017 0.0044  230 ARG A NH1    
1408 N  NH2    . ARG A 193 ? 0.4397 0.2501 0.2875 -0.0458 -0.0019 0.0004  230 ARG A NH2    
1409 N  N      . ALA A 194 ? 0.3216 0.1134 0.1323 0.0091  -0.0110 -0.0018 231 ALA A N      
1410 C  CA     . ALA A 194 ? 0.3524 0.1290 0.1435 0.0196  -0.0167 -0.0027 231 ALA A CA     
1411 C  C      . ALA A 194 ? 0.4514 0.1869 0.2024 0.0177  -0.0164 0.0012  231 ALA A C      
1412 O  O      . ALA A 194 ? 0.4612 0.1764 0.1968 0.0131  -0.0157 0.0032  231 ALA A O      
1413 C  CB     . ALA A 194 ? 0.3564 0.1444 0.1545 0.0361  -0.0266 -0.0081 231 ALA A CB     
1414 N  N      . PRO A 195 ? 0.4355 0.1542 0.1650 0.0208  -0.0174 0.0025  232 PRO A N      
1415 C  CA     . PRO A 195 ? 0.4741 0.1472 0.1585 0.0186  -0.0174 0.0068  232 PRO A CA     
1416 C  C      . PRO A 195 ? 0.5963 0.2395 0.2549 0.0313  -0.0266 0.0055  232 PRO A C      
1417 O  O      . PRO A 195 ? 0.6328 0.2394 0.2596 0.0223  -0.0243 0.0095  232 PRO A O      
1418 C  CB     . PRO A 195 ? 0.4981 0.1622 0.1665 0.0266  -0.0205 0.0065  232 PRO A CB     
1419 C  CG     . PRO A 195 ? 0.5015 0.2061 0.2068 0.0236  -0.0166 0.0039  232 PRO A CG     
1420 C  CD     . PRO A 195 ? 0.4137 0.1495 0.1542 0.0264  -0.0193 0.0001  232 PRO A CD     
1421 N  N      . GLU A 196 ? 0.5515 0.2114 0.2232 0.0513  -0.0368 -0.0005 233 GLU A N      
1422 C  CA     . GLU A 196 ? 0.5848 0.2205 0.2330 0.0680  -0.0460 -0.0031 233 GLU A CA     
1423 C  C      . GLU A 196 ? 0.6284 0.2611 0.2816 0.0593  -0.0419 -0.0024 233 GLU A C      
1424 O  O      . GLU A 196 ? 0.6678 0.2645 0.2880 0.0686  -0.0475 -0.0028 233 GLU A O      
1425 C  CB     . GLU A 196 ? 0.5894 0.2503 0.2516 0.0928  -0.0576 -0.0107 233 GLU A CB     
1426 C  CG     . GLU A 196 ? 0.6085 0.3249 0.3213 0.0914  -0.0558 -0.0152 233 GLU A CG     
1427 C  CD     . GLU A 196 ? 0.6329 0.3804 0.3720 0.0847  -0.0542 -0.0162 233 GLU A CD     
1428 O  OE1    . GLU A 196 ? 0.4174 0.1509 0.1468 0.0723  -0.0482 -0.0116 233 GLU A OE1    
1429 O  OE2    . GLU A 196 ? 0.4797 0.2660 0.2483 0.0908  -0.0584 -0.0217 233 GLU A OE2    
1430 N  N      . VAL A 197 ? 0.5375 0.2022 0.2258 0.0420  -0.0329 -0.0011 234 VAL A N      
1431 C  CA     . VAL A 197 ? 0.5327 0.1960 0.2263 0.0313  -0.0289 -0.0002 234 VAL A CA     
1432 C  C      . VAL A 197 ? 0.6540 0.2844 0.3200 0.0091  -0.0220 0.0061  234 VAL A C      
1433 O  O      . VAL A 197 ? 0.7044 0.3014 0.3427 0.0045  -0.0237 0.0074  234 VAL A O      
1434 C  CB     . VAL A 197 ? 0.5184 0.2305 0.2600 0.0248  -0.0239 -0.0023 234 VAL A CB     
1435 C  CG1    . VAL A 197 ? 0.5084 0.2178 0.2532 0.0128  -0.0204 -0.0011 234 VAL A CG1    
1436 C  CG2    . VAL A 197 ? 0.4850 0.2282 0.2504 0.0425  -0.0298 -0.0082 234 VAL A CG2    
1437 N  N      . ILE A 198 ? 0.6090 0.2491 0.2808 -0.0049 -0.0142 0.0097  235 ILE A N      
1438 C  CA     . ILE A 198 ? 0.6345 0.2537 0.2846 -0.0284 -0.0055 0.0155  235 ILE A CA     
1439 C  C      . ILE A 198 ? 0.7203 0.2778 0.3124 -0.0285 -0.0099 0.0187  235 ILE A C      
1440 O  O      . ILE A 198 ? 0.7530 0.2824 0.3195 -0.0486 -0.0057 0.0227  235 ILE A O      
1441 C  CB     . ILE A 198 ? 0.6669 0.3102 0.3319 -0.0360 0.0029  0.0173  235 ILE A CB     
1442 C  CG1    . ILE A 198 ? 0.6284 0.3255 0.3438 -0.0379 0.0076  0.0145  235 ILE A CG1    
1443 C  CG2    . ILE A 198 ? 0.7092 0.3307 0.3466 -0.0592 0.0127  0.0232  235 ILE A CG2    
1444 C  CD1    . ILE A 198 ? 0.7324 0.4517 0.4617 -0.0345 0.0118  0.0140  235 ILE A CD1    
1445 N  N      . LEU A 199 ? 0.6771 0.2125 0.2463 -0.0065 -0.0188 0.0169  236 LEU A N      
1446 C  CA     . LEU A 199 ? 0.7286 0.2009 0.2373 -0.0023 -0.0242 0.0200  236 LEU A CA     
1447 C  C      . LEU A 199 ? 0.8128 0.2487 0.2912 0.0188  -0.0367 0.0164  236 LEU A C      
1448 O  O      . LEU A 199 ? 0.8953 0.2736 0.3182 0.0272  -0.0434 0.0183  236 LEU A O      
1449 C  CB     . LEU A 199 ? 0.7318 0.1976 0.2266 0.0090  -0.0266 0.0206  236 LEU A CB     
1450 C  CG     . LEU A 199 ? 0.7509 0.2478 0.2688 -0.0081 -0.0145 0.0235  236 LEU A CG     
1451 C  CD1    . LEU A 199 ? 0.7505 0.2414 0.2553 0.0077  -0.0195 0.0226  236 LEU A CD1    
1452 C  CD2    . LEU A 199 ? 0.8133 0.2886 0.3073 -0.0386 -0.0019 0.0305  236 LEU A CD2    
1453 N  N      . GLY A 200 ? 0.7164 0.1822 0.2265 0.0272  -0.0394 0.0115  237 GLY A N      
1454 C  CA     . GLY A 200 ? 0.7432 0.1827 0.2300 0.0488  -0.0499 0.0069  237 GLY A CA     
1455 C  C      . GLY A 200 ? 0.8589 0.2843 0.3243 0.0819  -0.0624 0.0023  237 GLY A C      
1456 O  O      . GLY A 200 ? 0.9137 0.2839 0.3262 0.0974  -0.0715 0.0017  237 GLY A O      
1457 N  N      . MET A 201 ? 0.8016 0.2741 0.3041 0.0920  -0.0633 -0.0008 238 MET A N      
1458 C  CA     . MET A 201 ? 0.8177 0.2929 0.3114 0.1221  -0.0754 -0.0062 238 MET A CA     
1459 C  C      . MET A 201 ? 0.8158 0.3389 0.3477 0.1420  -0.0803 -0.0146 238 MET A C      
1460 O  O      . MET A 201 ? 0.7861 0.3379 0.3505 0.1298  -0.0731 -0.0150 238 MET A O      
1461 C  CB     . MET A 201 ? 0.8232 0.3318 0.3441 0.1147  -0.0717 -0.0050 238 MET A CB     
1462 C  CG     . MET A 201 ? 0.9152 0.4016 0.4054 0.1333  -0.0817 -0.0062 238 MET A CG     
1463 S  SD     . MET A 201 ? 0.9482 0.4694 0.4681 0.1186  -0.0751 -0.0040 238 MET A SD     
1464 C  CE     . MET A 201 ? 0.8915 0.4022 0.4127 0.0817  -0.0570 0.0047  238 MET A CE     
1465 N  N      . GLY A 202 ? 0.7543 0.2910 0.2849 0.1713  -0.0920 -0.0214 239 GLY A N      
1466 C  CA     . GLY A 202 ? 0.7084 0.3017 0.2811 0.1877  -0.0950 -0.0297 239 GLY A CA     
1467 C  C      . GLY A 202 ? 0.6698 0.3240 0.2994 0.1704  -0.0876 -0.0298 239 GLY A C      
1468 O  O      . GLY A 202 ? 0.6288 0.2782 0.2597 0.1535  -0.0830 -0.0248 239 GLY A O      
1469 N  N      . TYR A 203 ? 0.5891 0.2977 0.2625 0.1735  -0.0858 -0.0354 240 TYR A N      
1470 C  CA     . TYR A 203 ? 0.5328 0.2934 0.2547 0.1566  -0.0796 -0.0356 240 TYR A CA     
1471 C  C      . TYR A 203 ? 0.5759 0.3928 0.3320 0.1714  -0.0846 -0.0443 240 TYR A C      
1472 O  O      . TYR A 203 ? 0.5943 0.4183 0.3462 0.1906  -0.0885 -0.0498 240 TYR A O      
1473 C  CB     . TYR A 203 ? 0.5003 0.2669 0.2432 0.1302  -0.0666 -0.0303 240 TYR A CB     
1474 C  CG     . TYR A 203 ? 0.4918 0.2672 0.2429 0.1335  -0.0638 -0.0327 240 TYR A CG     
1475 C  CD1    . TYR A 203 ? 0.4740 0.3007 0.2638 0.1349  -0.0616 -0.0377 240 TYR A CD1    
1476 C  CD2    . TYR A 203 ? 0.5295 0.2602 0.2475 0.1328  -0.0629 -0.0298 240 TYR A CD2    
1477 C  CE1    . TYR A 203 ? 0.4544 0.2887 0.2488 0.1397  -0.0588 -0.0402 240 TYR A CE1    
1478 C  CE2    . TYR A 203 ? 0.5358 0.2720 0.2581 0.1371  -0.0609 -0.0325 240 TYR A CE2    
1479 C  CZ     . TYR A 203 ? 0.5620 0.3507 0.3228 0.1414  -0.0586 -0.0377 240 TYR A CZ     
1480 O  OH     . TYR A 203 ? 0.5425 0.3372 0.3065 0.1457  -0.0558 -0.0404 240 TYR A OH     
1481 N  N      . LYS A 204 ? 0.4905 0.3479 0.2794 0.1614  -0.0840 -0.0460 241 LYS A N      
1482 C  CA     . LYS A 204 ? 0.4539 0.3716 0.2807 0.1668  -0.0865 -0.0537 241 LYS A CA     
1483 C  C      . LYS A 204 ? 0.4283 0.3748 0.2912 0.1391  -0.0754 -0.0507 241 LYS A C      
1484 O  O      . LYS A 204 ? 0.3984 0.3188 0.2559 0.1215  -0.0669 -0.0436 241 LYS A O      
1485 C  CB     . LYS A 204 ? 0.4844 0.4239 0.3123 0.1828  -0.0992 -0.0601 241 LYS A CB     
1486 C  CG     . LYS A 204 ? 0.6635 0.5944 0.4904 0.1680  -0.1003 -0.0566 241 LYS A CG     
1487 C  CD     . LYS A 204 ? 0.6980 0.6467 0.5210 0.1860  -0.1150 -0.0635 241 LYS A CD     
1488 C  CE     . LYS A 204 ? 0.7743 0.7047 0.5873 0.1740  -0.1168 -0.0599 241 LYS A CE     
1489 N  NZ     . LYS A 204 ? 0.8774 0.8368 0.6957 0.1871  -0.1314 -0.0677 241 LYS A NZ     
1490 N  N      . GLU A 205 ? 0.3468 0.3456 0.2437 0.1353  -0.0758 -0.0562 242 GLU A N      
1491 C  CA     . GLU A 205 ? 0.3099 0.3325 0.2357 0.1102  -0.0666 -0.0539 242 GLU A CA     
1492 C  C      . GLU A 205 ? 0.3141 0.3116 0.2347 0.0912  -0.0628 -0.0473 242 GLU A C      
1493 O  O      . GLU A 205 ? 0.2807 0.2689 0.2070 0.0752  -0.0537 -0.0423 242 GLU A O      
1494 C  CB     . GLU A 205 ? 0.3141 0.3939 0.2712 0.1075  -0.0697 -0.0612 242 GLU A CB     
1495 C  CG     . GLU A 205 ? 0.3866 0.5034 0.3591 0.1185  -0.0677 -0.0672 242 GLU A CG     
1496 C  CD     . GLU A 205 ? 0.5457 0.6660 0.5036 0.1501  -0.0767 -0.0737 242 GLU A CD     
1497 O  OE1    . GLU A 205 ? 0.6795 0.7803 0.6171 0.1649  -0.0871 -0.0749 242 GLU A OE1    
1498 O  OE2    . GLU A 205 ? 0.5564 0.6971 0.5204 0.1615  -0.0735 -0.0778 242 GLU A OE2    
1499 N  N      . ASN A 206 ? 0.2825 0.2673 0.1895 0.0952  -0.0699 -0.0476 243 ASN A N      
1500 C  CA     . ASN A 206 ? 0.2820 0.2459 0.1828 0.0798  -0.0665 -0.0426 243 ASN A CA     
1501 C  C      . ASN A 206 ? 0.3196 0.2415 0.1991 0.0743  -0.0586 -0.0349 243 ASN A C      
1502 O  O      . ASN A 206 ? 0.3090 0.2153 0.1828 0.0634  -0.0544 -0.0310 243 ASN A O      
1503 C  CB     . ASN A 206 ? 0.2988 0.2620 0.1899 0.0857  -0.0765 -0.0457 243 ASN A CB     
1504 C  CG     . ASN A 206 ? 0.3953 0.3258 0.2531 0.1040  -0.0835 -0.0450 243 ASN A CG     
1505 O  OD1    . ASN A 206 ? 0.2962 0.2001 0.1342 0.1128  -0.0815 -0.0423 243 ASN A OD1    
1506 N  ND2    . ASN A 206 ? 0.3089 0.2363 0.1560 0.1087  -0.0923 -0.0474 243 ASN A ND2    
1507 N  N      . VAL A 207 ? 0.2759 0.1821 0.1446 0.0804  -0.0559 -0.0332 244 VAL A N      
1508 C  CA     . VAL A 207 ? 0.2827 0.1566 0.1362 0.0705  -0.0477 -0.0265 244 VAL A CA     
1509 C  C      . VAL A 207 ? 0.2952 0.1852 0.1725 0.0518  -0.0388 -0.0239 244 VAL A C      
1510 O  O      . VAL A 207 ? 0.2928 0.1670 0.1640 0.0414  -0.0329 -0.0193 244 VAL A O      
1511 C  CB     . VAL A 207 ? 0.3628 0.2174 0.2001 0.0786  -0.0475 -0.0260 244 VAL A CB     
1512 C  CG1    . VAL A 207 ? 0.3395 0.2211 0.2006 0.0766  -0.0439 -0.0284 244 VAL A CG1    
1513 C  CG2    . VAL A 207 ? 0.3795 0.1960 0.1932 0.0680  -0.0416 -0.0194 244 VAL A CG2    
1514 N  N      . ASP A 208 ? 0.2153 0.1373 0.1180 0.0485  -0.0384 -0.0273 245 ASP A N      
1515 C  CA     . ASP A 208 ? 0.1940 0.1279 0.1146 0.0333  -0.0318 -0.0254 245 ASP A CA     
1516 C  C      . ASP A 208 ? 0.1955 0.1300 0.1181 0.0254  -0.0323 -0.0252 245 ASP A C      
1517 O  O      . ASP A 208 ? 0.1632 0.0945 0.0906 0.0152  -0.0269 -0.0226 245 ASP A O      
1518 C  CB     . ASP A 208 ? 0.2005 0.1633 0.1413 0.0312  -0.0308 -0.0287 245 ASP A CB     
1519 C  CG     . ASP A 208 ? 0.2984 0.2558 0.2350 0.0375  -0.0282 -0.0283 245 ASP A CG     
1520 O  OD1    . ASP A 208 ? 0.3126 0.2450 0.2365 0.0349  -0.0248 -0.0240 245 ASP A OD1    
1521 O  OD2    . ASP A 208 ? 0.2608 0.2407 0.2069 0.0441  -0.0294 -0.0325 245 ASP A OD2    
1522 N  N      . ILE A 209 ? 0.1613 0.0977 0.0774 0.0318  -0.0397 -0.0283 246 ILE A N      
1523 C  CA     . ILE A 209 ? 0.1566 0.0893 0.0695 0.0257  -0.0416 -0.0287 246 ILE A CA     
1524 C  C      . ILE A 209 ? 0.2285 0.1334 0.1243 0.0237  -0.0357 -0.0237 246 ILE A C      
1525 O  O      . ILE A 209 ? 0.2400 0.1407 0.1354 0.0168  -0.0329 -0.0230 246 ILE A O      
1526 C  CB     . ILE A 209 ? 0.1986 0.1421 0.1082 0.0337  -0.0525 -0.0340 246 ILE A CB     
1527 C  CG1    . ILE A 209 ? 0.1867 0.1677 0.1192 0.0292  -0.0569 -0.0397 246 ILE A CG1    
1528 C  CG2    . ILE A 209 ? 0.2063 0.1331 0.1013 0.0310  -0.0550 -0.0337 246 ILE A CG2    
1529 C  CD1    . ILE A 209 ? 0.1680 0.1568 0.1109 0.0101  -0.0545 -0.0401 246 ILE A CD1    
1530 N  N      . TRP A 210 ? 0.2259 0.1116 0.1057 0.0292  -0.0335 -0.0206 247 TRP A N      
1531 C  CA     . TRP A 210 ? 0.2323 0.0969 0.0970 0.0248  -0.0264 -0.0160 247 TRP A CA     
1532 C  C      . TRP A 210 ? 0.2708 0.1433 0.1498 0.0149  -0.0180 -0.0137 247 TRP A C      
1533 O  O      . TRP A 210 ? 0.2870 0.1562 0.1632 0.0111  -0.0132 -0.0124 247 TRP A O      
1534 C  CB     . TRP A 210 ? 0.2346 0.0753 0.0766 0.0290  -0.0256 -0.0129 247 TRP A CB     
1535 C  CG     . TRP A 210 ? 0.2485 0.0732 0.0777 0.0201  -0.0163 -0.0079 247 TRP A CG     
1536 C  CD1    . TRP A 210 ? 0.2755 0.1044 0.1130 0.0101  -0.0081 -0.0050 247 TRP A CD1    
1537 C  CD2    . TRP A 210 ? 0.2636 0.0697 0.0702 0.0199  -0.0140 -0.0059 247 TRP A CD2    
1538 N  NE1    . TRP A 210 ? 0.2790 0.0974 0.1028 0.0030  -0.0004 -0.0015 247 TRP A NE1    
1539 C  CE2    . TRP A 210 ? 0.3116 0.1148 0.1154 0.0086  -0.0031 -0.0017 247 TRP A CE2    
1540 C  CE3    . TRP A 210 ? 0.2999 0.0930 0.0878 0.0280  -0.0202 -0.0074 247 TRP A CE3    
1541 C  CZ2    . TRP A 210 ? 0.3212 0.1102 0.1045 0.0044  0.0034  0.0011  247 TRP A CZ2    
1542 C  CZ3    . TRP A 210 ? 0.3384 0.1128 0.1035 0.0247  -0.0143 -0.0043 247 TRP A CZ3    
1543 C  CH2    . TRP A 210 ? 0.3446 0.1173 0.1072 0.0127  -0.0020 0.0000  247 TRP A CH2    
1544 N  N      . SER A 211 ? 0.1937 0.0767 0.0862 0.0126  -0.0167 -0.0136 248 SER A N      
1545 C  CA     . SER A 211 ? 0.1787 0.0693 0.0837 0.0050  -0.0104 -0.0118 248 SER A CA     
1546 C  C      . SER A 211 ? 0.2047 0.1039 0.1185 0.0021  -0.0109 -0.0136 248 SER A C      
1547 O  O      . SER A 211 ? 0.1956 0.0936 0.1100 -0.0004 -0.0063 -0.0124 248 SER A O      
1548 C  CB     . SER A 211 ? 0.1910 0.0890 0.1056 0.0042  -0.0104 -0.0119 248 SER A CB     
1549 O  OG     . SER A 211 ? 0.2650 0.1486 0.1655 0.0080  -0.0114 -0.0107 248 SER A OG     
1550 N  N      . VAL A 212 ? 0.1686 0.0760 0.0869 0.0025  -0.0169 -0.0171 249 VAL A N      
1551 C  CA     . VAL A 212 ? 0.1715 0.0803 0.0916 -0.0026 -0.0186 -0.0190 249 VAL A CA     
1552 C  C      . VAL A 212 ? 0.2389 0.1325 0.1437 0.0001  -0.0181 -0.0189 249 VAL A C      
1553 O  O      . VAL A 212 ? 0.2435 0.1302 0.1443 -0.0015 -0.0161 -0.0190 249 VAL A O      
1554 C  CB     . VAL A 212 ? 0.2059 0.1293 0.1332 -0.0062 -0.0253 -0.0231 249 VAL A CB     
1555 C  CG1    . VAL A 212 ? 0.2064 0.1241 0.1291 -0.0147 -0.0277 -0.0249 249 VAL A CG1    
1556 C  CG2    . VAL A 212 ? 0.1736 0.1147 0.1155 -0.0084 -0.0241 -0.0235 249 VAL A CG2    
1557 N  N      . GLY A 213 ? 0.2189 0.1051 0.1122 0.0056  -0.0200 -0.0189 250 GLY A N      
1558 C  CA     . GLY A 213 ? 0.2250 0.0964 0.1014 0.0087  -0.0185 -0.0188 250 GLY A CA     
1559 C  C      . GLY A 213 ? 0.2523 0.1210 0.1269 0.0087  -0.0090 -0.0158 250 GLY A C      
1560 O  O      . GLY A 213 ? 0.2334 0.0961 0.1002 0.0110  -0.0067 -0.0169 250 GLY A O      
1561 N  N      . CYS A 214 ? 0.1952 0.0694 0.0763 0.0066  -0.0038 -0.0127 251 CYS A N      
1562 C  CA     . CYS A 214 ? 0.1886 0.0685 0.0727 0.0046  0.0050  -0.0104 251 CYS A CA     
1563 C  C      . CYS A 214 ? 0.2167 0.1051 0.1112 0.0056  0.0057  -0.0119 251 CYS A C      
1564 O  O      . CYS A 214 ? 0.2205 0.1125 0.1125 0.0093  0.0108  -0.0124 251 CYS A O      
1565 C  CB     . CYS A 214 ? 0.1819 0.0650 0.0704 -0.0007 0.0079  -0.0074 251 CYS A CB     
1566 S  SG     . CYS A 214 ? 0.2518 0.1153 0.1182 -0.0015 0.0080  -0.0048 251 CYS A SG     
1567 N  N      . ILE A 215 ? 0.1737 0.0653 0.0780 0.0032  0.0009  -0.0129 252 ILE A N      
1568 C  CA     . ILE A 215 ? 0.1852 0.0784 0.0941 0.0038  0.0003  -0.0140 252 ILE A CA     
1569 C  C      . ILE A 215 ? 0.2418 0.1209 0.1362 0.0078  -0.0024 -0.0167 252 ILE A C      
1570 O  O      . ILE A 215 ? 0.2372 0.1128 0.1257 0.0142  -0.0002 -0.0177 252 ILE A O      
1571 C  CB     . ILE A 215 ? 0.2173 0.1150 0.1363 -0.0019 -0.0033 -0.0139 252 ILE A CB     
1572 C  CG1    . ILE A 215 ? 0.2244 0.1327 0.1543 -0.0040 -0.0002 -0.0115 252 ILE A CG1    
1573 C  CG2    . ILE A 215 ? 0.2199 0.1103 0.1353 -0.0024 -0.0053 -0.0149 252 ILE A CG2    
1574 C  CD1    . ILE A 215 ? 0.2754 0.1893 0.2137 -0.0081 -0.0030 -0.0117 252 ILE A CD1    
1575 N  N      . MET A 216 ? 0.2082 0.0788 0.0948 0.0053  -0.0080 -0.0185 253 MET A N      
1576 C  CA     . MET A 216 ? 0.2170 0.0699 0.0859 0.0073  -0.0120 -0.0215 253 MET A CA     
1577 C  C      . MET A 216 ? 0.3233 0.1697 0.1791 0.0171  -0.0068 -0.0220 253 MET A C      
1578 O  O      . MET A 216 ? 0.3476 0.1812 0.1901 0.0235  -0.0069 -0.0242 253 MET A O      
1579 C  CB     . MET A 216 ? 0.2377 0.0873 0.1023 0.0018  -0.0196 -0.0238 253 MET A CB     
1580 C  CG     . MET A 216 ? 0.2869 0.1152 0.1303 0.0019  -0.0248 -0.0272 253 MET A CG     
1581 S  SD     . MET A 216 ? 0.3227 0.1536 0.1641 -0.0063 -0.0353 -0.0308 253 MET A SD     
1582 C  CE     . MET A 216 ? 0.3123 0.1121 0.1246 -0.0083 -0.0411 -0.0347 253 MET A CE     
1583 N  N      . GLY A 217 ? 0.2758 0.1295 0.1326 0.0185  -0.0023 -0.0202 254 GLY A N      
1584 C  CA     . GLY A 217 ? 0.2874 0.1400 0.1330 0.0258  0.0049  -0.0202 254 GLY A CA     
1585 C  C      . GLY A 217 ? 0.3380 0.2037 0.1907 0.0319  0.0116  -0.0204 254 GLY A C      
1586 O  O      . GLY A 217 ? 0.3641 0.2261 0.2046 0.0419  0.0148  -0.0230 254 GLY A O      
1587 N  N      . GLU A 218 ? 0.2593 0.1406 0.1307 0.0272  0.0128  -0.0184 255 GLU A N      
1588 C  CA     . GLU A 218 ? 0.2484 0.1462 0.1293 0.0330  0.0172  -0.0190 255 GLU A CA     
1589 C  C      . GLU A 218 ? 0.3375 0.2209 0.2084 0.0421  0.0119  -0.0222 255 GLU A C      
1590 O  O      . GLU A 218 ? 0.3381 0.2293 0.2068 0.0540  0.0148  -0.0245 255 GLU A O      
1591 C  CB     . GLU A 218 ? 0.2321 0.1469 0.1327 0.0247  0.0182  -0.0162 255 GLU A CB     
1592 C  CG     . GLU A 218 ? 0.2818 0.2198 0.1943 0.0298  0.0225  -0.0171 255 GLU A CG     
1593 C  CD     . GLU A 218 ? 0.4042 0.3589 0.3339 0.0197  0.0236  -0.0145 255 GLU A CD     
1594 O  OE1    . GLU A 218 ? 0.2856 0.2339 0.2154 0.0093  0.0235  -0.0117 255 GLU A OE1    
1595 O  OE2    . GLU A 218 ? 0.3357 0.3091 0.2767 0.0233  0.0241  -0.0157 255 GLU A OE2    
1596 N  N      . MET A 219 ? 0.3481 0.2103 0.2109 0.0365  0.0039  -0.0225 256 MET A N      
1597 C  CA     . MET A 219 ? 0.3933 0.2325 0.2390 0.0420  -0.0019 -0.0250 256 MET A CA     
1598 C  C      . MET A 219 ? 0.4701 0.2915 0.2917 0.0547  -0.0018 -0.0288 256 MET A C      
1599 O  O      . MET A 219 ? 0.4960 0.3059 0.3033 0.0677  -0.0030 -0.0314 256 MET A O      
1600 C  CB     . MET A 219 ? 0.4358 0.2582 0.2772 0.0285  -0.0093 -0.0244 256 MET A CB     
1601 C  CG     . MET A 219 ? 0.4915 0.3227 0.3471 0.0217  -0.0099 -0.0219 256 MET A CG     
1602 S  SD     . MET A 219 ? 0.5695 0.4012 0.4327 0.0034  -0.0145 -0.0207 256 MET A SD     
1603 C  CE     . MET A 219 ? 0.5626 0.3612 0.3997 -0.0022 -0.0206 -0.0222 256 MET A CE     
1604 N  N      . VAL A 220 ? 0.4254 0.2445 0.2407 0.0530  -0.0003 -0.0293 257 VAL A N      
1605 C  CA     . VAL A 220 ? 0.4619 0.2637 0.2527 0.0642  0.0003  -0.0330 257 VAL A CA     
1606 C  C      . VAL A 220 ? 0.4933 0.3181 0.2880 0.0786  0.0106  -0.0342 257 VAL A C      
1607 O  O      . VAL A 220 ? 0.4838 0.2987 0.2607 0.0951  0.0112  -0.0384 257 VAL A O      
1608 C  CB     . VAL A 220 ? 0.5233 0.3152 0.3065 0.0551  -0.0030 -0.0327 257 VAL A CB     
1609 C  CG1    . VAL A 220 ? 0.5549 0.3287 0.3112 0.0663  -0.0019 -0.0364 257 VAL A CG1    
1610 C  CG2    . VAL A 220 ? 0.5235 0.2993 0.3041 0.0414  -0.0134 -0.0329 257 VAL A CG2    
1611 N  N      . ARG A 221 ? 0.4318 0.2868 0.2478 0.0723  0.0188  -0.0310 258 ARG A N      
1612 C  CA     . ARG A 221 ? 0.4227 0.3062 0.2451 0.0813  0.0300  -0.0320 258 ARG A CA     
1613 C  C      . ARG A 221 ? 0.4562 0.3647 0.2942 0.0906  0.0321  -0.0338 258 ARG A C      
1614 O  O      . ARG A 221 ? 0.4729 0.4056 0.3131 0.1029  0.0398  -0.0368 258 ARG A O      
1615 C  CB     . ARG A 221 ? 0.3775 0.2812 0.2138 0.0673  0.0376  -0.0276 258 ARG A CB     
1616 C  CG     . ARG A 221 ? 0.4365 0.3221 0.2546 0.0630  0.0386  -0.0265 258 ARG A CG     
1617 C  CD     . ARG A 221 ? 0.4332 0.3395 0.2579 0.0536  0.0495  -0.0228 258 ARG A CD     
1618 N  NE     . ARG A 221 ? 0.5288 0.4132 0.3333 0.0485  0.0490  -0.0208 258 ARG A NE     
1619 C  CZ     . ARG A 221 ? 0.6649 0.5510 0.4674 0.0366  0.0542  -0.0163 258 ARG A CZ     
1620 N  NH1    . ARG A 221 ? 0.4229 0.3322 0.2428 0.0261  0.0608  -0.0133 258 ARG A NH1    
1621 N  NH2    . ARG A 221 ? 0.4671 0.3287 0.2467 0.0348  0.0520  -0.0148 258 ARG A NH2    
1622 N  N      . HIS A 222 ? 0.3812 0.2880 0.2311 0.0845  0.0256  -0.0319 259 HIS A N      
1623 C  CA     . HIS A 222 ? 0.3729 0.3027 0.2385 0.0914  0.0255  -0.0330 259 HIS A CA     
1624 C  C      . HIS A 222 ? 0.4449 0.4181 0.3369 0.0832  0.0347  -0.0312 259 HIS A C      
1625 O  O      . HIS A 222 ? 0.4481 0.4515 0.3547 0.0908  0.0367  -0.0335 259 HIS A O      
1626 C  CB     . HIS A 222 ? 0.3898 0.3123 0.2381 0.1156  0.0228  -0.0388 259 HIS A CB     
1627 C  CG     . HIS A 222 ? 0.4410 0.3142 0.2573 0.1203  0.0136  -0.0403 259 HIS A CG     
1628 N  ND1    . HIS A 222 ? 0.4485 0.2960 0.2585 0.1131  0.0046  -0.0383 259 HIS A ND1    
1629 C  CD2    . HIS A 222 ? 0.4803 0.3254 0.2681 0.1291  0.0124  -0.0435 259 HIS A CD2    
1630 C  CE1    . HIS A 222 ? 0.4729 0.2781 0.2513 0.1155  -0.0017 -0.0402 259 HIS A CE1    
1631 N  NE2    . HIS A 222 ? 0.4950 0.2962 0.2587 0.1256  0.0020  -0.0435 259 HIS A NE2    
1632 N  N      . LYS A 223 ? 0.4103 0.3844 0.3062 0.0667  0.0392  -0.0271 260 LYS A N      
1633 C  CA     . LYS A 223 ? 0.3851 0.3901 0.2983 0.0536  0.0479  -0.0245 260 LYS A CA     
1634 C  C      . LYS A 223 ? 0.3953 0.3833 0.3081 0.0355  0.0459  -0.0193 260 LYS A C      
1635 O  O      . LYS A 223 ? 0.4010 0.3603 0.2979 0.0345  0.0419  -0.0183 260 LYS A O      
1636 C  CB     . LYS A 223 ? 0.4219 0.4436 0.3283 0.0571  0.0591  -0.0261 260 LYS A CB     
1637 C  CG     . LYS A 223 ? 0.6960 0.7564 0.6132 0.0718  0.0651  -0.0314 260 LYS A CG     
1638 C  CD     . LYS A 223 ? 0.8536 0.9359 0.7653 0.0729  0.0785  -0.0328 260 LYS A CD     
1639 C  CE     . LYS A 223 ? 1.0017 1.0643 0.8887 0.0940  0.0787  -0.0374 260 LYS A CE     
1640 N  NZ     . LYS A 223 ? 1.1452 1.2335 1.0272 0.0963  0.0930  -0.0393 260 LYS A NZ     
1641 N  N      . ILE A 224 ? 0.3103 0.3158 0.2388 0.0218  0.0480  -0.0165 261 ILE A N      
1642 C  CA     . ILE A 224 ? 0.2951 0.2839 0.2203 0.0063  0.0463  -0.0119 261 ILE A CA     
1643 C  C      . ILE A 224 ? 0.3518 0.3247 0.2575 0.0030  0.0512  -0.0101 261 ILE A C      
1644 O  O      . ILE A 224 ? 0.3675 0.3568 0.2700 0.0030  0.0607  -0.0107 261 ILE A O      
1645 C  CB     . ILE A 224 ? 0.3264 0.3365 0.2662 -0.0081 0.0496  -0.0098 261 ILE A CB     
1646 C  CG1    . ILE A 224 ? 0.3112 0.3360 0.2686 -0.0038 0.0436  -0.0118 261 ILE A CG1    
1647 C  CG2    . ILE A 224 ? 0.3366 0.3232 0.2656 -0.0224 0.0480  -0.0053 261 ILE A CG2    
1648 C  CD1    . ILE A 224 ? 0.3556 0.4118 0.3300 -0.0160 0.0470  -0.0117 261 ILE A CD1    
1649 N  N      . LEU A 225 ? 0.2965 0.2398 0.1887 0.0015  0.0447  -0.0083 262 LEU A N      
1650 C  CA     . LEU A 225 ? 0.3017 0.2264 0.1717 -0.0001 0.0476  -0.0067 262 LEU A CA     
1651 C  C      . LEU A 225 ? 0.3836 0.3097 0.2461 -0.0148 0.0556  -0.0024 262 LEU A C      
1652 O  O      . LEU A 225 ? 0.3881 0.3158 0.2369 -0.0172 0.0644  -0.0016 262 LEU A O      
1653 C  CB     . LEU A 225 ? 0.2950 0.1914 0.1531 0.0026  0.0373  -0.0065 262 LEU A CB     
1654 C  CG     . LEU A 225 ? 0.3376 0.2247 0.1948 0.0126  0.0289  -0.0103 262 LEU A CG     
1655 C  CD1    . LEU A 225 ? 0.3253 0.1910 0.1693 0.0128  0.0205  -0.0102 262 LEU A CD1    
1656 C  CD2    . LEU A 225 ? 0.3797 0.2677 0.2270 0.0228  0.0328  -0.0136 262 LEU A CD2    
1657 N  N      . PHE A 226 ? 0.3510 0.2724 0.2181 -0.0251 0.0524  0.0003  263 PHE A N      
1658 C  CA     . PHE A 226 ? 0.3715 0.2847 0.2249 -0.0414 0.0583  0.0046  263 PHE A CA     
1659 C  C      . PHE A 226 ? 0.4440 0.3807 0.3160 -0.0537 0.0609  0.0051  263 PHE A C      
1660 O  O      . PHE A 226 ? 0.4494 0.3738 0.3226 -0.0581 0.0543  0.0062  263 PHE A O      
1661 C  CB     . PHE A 226 ? 0.4040 0.2784 0.2340 -0.0414 0.0504  0.0072  263 PHE A CB     
1662 C  CG     . PHE A 226 ? 0.4077 0.2641 0.2254 -0.0272 0.0438  0.0053  263 PHE A CG     
1663 C  CD1    . PHE A 226 ? 0.4391 0.2880 0.2382 -0.0246 0.0492  0.0056  263 PHE A CD1    
1664 C  CD2    . PHE A 226 ? 0.3915 0.2410 0.2163 -0.0174 0.0324  0.0029  263 PHE A CD2    
1665 C  CE1    . PHE A 226 ? 0.4572 0.2890 0.2437 -0.0122 0.0417  0.0034  263 PHE A CE1    
1666 C  CE2    . PHE A 226 ? 0.4176 0.2540 0.2320 -0.0067 0.0254  0.0006  263 PHE A CE2    
1667 C  CZ     . PHE A 226 ? 0.4217 0.2481 0.2166 -0.0041 0.0294  0.0008  263 PHE A CZ     
1668 N  N      . PRO A 227 ? 0.4195 0.3930 0.3072 -0.0577 0.0699  0.0033  264 PRO A N      
1669 C  CA     . PRO A 227 ? 0.4229 0.4237 0.3309 -0.0688 0.0708  0.0026  264 PRO A CA     
1670 C  C      . PRO A 227 ? 0.5521 0.5480 0.4473 -0.0934 0.0768  0.0067  264 PRO A C      
1671 O  O      . PRO A 227 ? 0.5757 0.6027 0.4776 -0.1064 0.0870  0.0064  264 PRO A O      
1672 C  CB     . PRO A 227 ? 0.4258 0.4707 0.3560 -0.0589 0.0762  -0.0022 264 PRO A CB     
1673 C  CG     . PRO A 227 ? 0.4890 0.5311 0.4041 -0.0527 0.0842  -0.0025 264 PRO A CG     
1674 C  CD     . PRO A 227 ? 0.4475 0.4422 0.3358 -0.0505 0.0789  0.0008  264 PRO A CD     
1675 N  N      . GLY A 228 ? 0.5413 0.4985 0.4170 -0.0999 0.0702  0.0101  265 GLY A N      
1676 C  CA     . GLY A 228 ? 0.5752 0.5140 0.4295 -0.1235 0.0738  0.0143  265 GLY A CA     
1677 C  C      . GLY A 228 ? 0.6089 0.5626 0.4771 -0.1376 0.0708  0.0135  265 GLY A C      
1678 O  O      . GLY A 228 ? 0.5710 0.5231 0.4522 -0.1273 0.0613  0.0113  265 GLY A O      
1679 N  N      . ARG A 229 ? 0.5972 0.5640 0.4603 -0.1633 0.0789  0.0153  266 ARG A N      
1680 C  CA     . ARG A 229 ? 0.5966 0.5769 0.4687 -0.1821 0.0763  0.0145  266 ARG A CA     
1681 C  C      . ARG A 229 ? 0.6626 0.5862 0.5015 -0.1901 0.0679  0.0179  266 ARG A C      
1682 O  O      . ARG A 229 ? 0.6624 0.5858 0.5061 -0.1983 0.0614  0.0166  266 ARG A O      
1683 C  CB     . ARG A 229 ? 0.6250 0.6406 0.5014 -0.2094 0.0884  0.0150  266 ARG A CB     
1684 N  N      . ASP A 230 ? 0.6232 0.4975 0.4262 -0.1854 0.0671  0.0218  267 ASP A N      
1685 C  CA     . ASP A 230 ? 0.6449 0.4592 0.4090 -0.1871 0.0588  0.0247  267 ASP A CA     
1686 C  C      . ASP A 230 ? 0.6757 0.4534 0.4157 -0.1667 0.0556  0.0263  267 ASP A C      
1687 O  O      . ASP A 230 ? 0.6290 0.4271 0.3810 -0.1564 0.0609  0.0256  267 ASP A O      
1688 C  CB     . ASP A 230 ? 0.7209 0.5089 0.4508 -0.2199 0.0638  0.0289  267 ASP A CB     
1689 C  CG     . ASP A 230 ? 0.8372 0.6324 0.5538 -0.2363 0.0773  0.0325  267 ASP A CG     
1690 O  OD1    . ASP A 230 ? 0.8458 0.6029 0.5309 -0.2277 0.0782  0.0357  267 ASP A OD1    
1691 O  OD2    . ASP A 230 ? 0.9197 0.7628 0.6590 -0.2561 0.0872  0.0314  267 ASP A OD2    
1692 N  N      . TYR A 231 ? 0.6731 0.3969 0.3775 -0.1601 0.0465  0.0279  268 TYR A N      
1693 C  CA     . TYR A 231 ? 0.6879 0.3765 0.3674 -0.1392 0.0411  0.0286  268 TYR A CA     
1694 C  C      . TYR A 231 ? 0.7338 0.4045 0.3849 -0.1470 0.0492  0.0328  268 TYR A C      
1695 O  O      . TYR A 231 ? 0.7361 0.4049 0.3862 -0.1285 0.0474  0.0320  268 TYR A O      
1696 C  CB     . TYR A 231 ? 0.7470 0.3831 0.3915 -0.1295 0.0294  0.0287  268 TYR A CB     
1697 C  CG     . TYR A 231 ? 0.7546 0.4055 0.4248 -0.1083 0.0200  0.0236  268 TYR A CG     
1698 C  CD1    . TYR A 231 ? 0.7381 0.4265 0.4449 -0.0892 0.0186  0.0199  268 TYR A CD1    
1699 C  CD2    . TYR A 231 ? 0.7916 0.4143 0.4442 -0.1070 0.0123  0.0224  268 TYR A CD2    
1700 C  CE1    . TYR A 231 ? 0.7237 0.4254 0.4515 -0.0722 0.0111  0.0156  268 TYR A CE1    
1701 C  CE2    . TYR A 231 ? 0.7749 0.4125 0.4494 -0.0875 0.0049  0.0177  268 TYR A CE2    
1702 C  CZ     . TYR A 231 ? 0.7909 0.4692 0.5036 -0.0712 0.0049  0.0145  268 TYR A CZ     
1703 O  OH     . TYR A 231 ? 0.7266 0.4194 0.4586 -0.0548 -0.0012 0.0102  268 TYR A OH     
1704 N  N      . ILE A 232 ? 0.6774 0.3346 0.3039 -0.1757 0.0580  0.0372  269 ILE A N      
1705 C  CA     . ILE A 232 ? 0.6861 0.3261 0.2820 -0.1885 0.0682  0.0419  269 ILE A CA     
1706 C  C      . ILE A 232 ? 0.6604 0.3561 0.2947 -0.1812 0.0775  0.0394  269 ILE A C      
1707 O  O      . ILE A 232 ? 0.6488 0.3336 0.2716 -0.1660 0.0777  0.0397  269 ILE A O      
1708 C  CB     . ILE A 232 ? 0.7564 0.3796 0.3235 -0.2265 0.0774  0.0468  269 ILE A CB     
1709 C  CG1    . ILE A 232 ? 0.8108 0.3669 0.3297 -0.2338 0.0671  0.0494  269 ILE A CG1    
1710 C  CG2    . ILE A 232 ? 0.7596 0.3770 0.3009 -0.2433 0.0914  0.0516  269 ILE A CG2    
1711 C  CD1    . ILE A 232 ? 0.9975 0.4747 0.4502 -0.2244 0.0607  0.0538  269 ILE A CD1    
1712 N  N      . ASP A 233 ? 0.5873 0.3411 0.2649 -0.1904 0.0840  0.0363  270 ASP A N      
1713 C  CA     . ASP A 233 ? 0.5592 0.3683 0.2740 -0.1813 0.0922  0.0327  270 ASP A CA     
1714 C  C      . ASP A 233 ? 0.6014 0.4118 0.3318 -0.1487 0.0830  0.0289  270 ASP A C      
1715 O  O      . ASP A 233 ? 0.5949 0.4149 0.3260 -0.1379 0.0877  0.0280  270 ASP A O      
1716 C  CB     . ASP A 233 ? 0.5586 0.4253 0.3162 -0.1916 0.0959  0.0289  270 ASP A CB     
1717 C  CG     . ASP A 233 ? 0.6879 0.6131 0.4785 -0.1856 0.1062  0.0251  270 ASP A CG     
1718 O  OD1    . ASP A 233 ? 0.7472 0.6741 0.5222 -0.1911 0.1175  0.0271  270 ASP A OD1    
1719 O  OD2    . ASP A 233 ? 0.7050 0.6733 0.5344 -0.1755 0.1033  0.0200  270 ASP A OD2    
1720 N  N      . GLN A 234 ? 0.5401 0.3397 0.2805 -0.1346 0.0701  0.0265  271 GLN A N      
1721 C  CA     . GLN A 234 ? 0.5042 0.3037 0.2584 -0.1077 0.0602  0.0228  271 GLN A CA     
1722 C  C      . GLN A 234 ? 0.5602 0.3235 0.2819 -0.0967 0.0575  0.0246  271 GLN A C      
1723 O  O      . GLN A 234 ? 0.5424 0.3193 0.2740 -0.0826 0.0576  0.0222  271 GLN A O      
1724 C  CB     . GLN A 234 ? 0.5150 0.2997 0.2730 -0.1005 0.0484  0.0213  271 GLN A CB     
1725 C  CG     . GLN A 234 ? 0.6657 0.4571 0.4418 -0.0769 0.0389  0.0172  271 GLN A CG     
1726 C  CD     . GLN A 234 ? 0.8643 0.6998 0.6801 -0.0718 0.0405  0.0134  271 GLN A CD     
1727 O  OE1    . GLN A 234 ? 0.8009 0.6492 0.6286 -0.0585 0.0394  0.0109  271 GLN A OE1    
1728 N  NE2    . GLN A 234 ? 0.7308 0.5872 0.5643 -0.0823 0.0423  0.0129  271 GLN A NE2    
1729 N  N      . TRP A 235 ? 0.5349 0.2495 0.2144 -0.1030 0.0545  0.0287  272 TRP A N      
1730 C  CA     . TRP A 235 ? 0.5602 0.2358 0.2030 -0.0921 0.0506  0.0305  272 TRP A CA     
1731 C  C      . TRP A 235 ? 0.6200 0.3047 0.2541 -0.0979 0.0622  0.0323  272 TRP A C      
1732 O  O      . TRP A 235 ? 0.5799 0.2573 0.2069 -0.0812 0.0581  0.0307  272 TRP A O      
1733 C  CB     . TRP A 235 ? 0.5931 0.2099 0.1865 -0.0971 0.0447  0.0346  272 TRP A CB     
1734 C  CG     . TRP A 235 ? 0.6425 0.2179 0.1965 -0.0819 0.0382  0.0359  272 TRP A CG     
1735 C  CD1    . TRP A 235 ? 0.7319 0.2652 0.2372 -0.0923 0.0432  0.0413  272 TRP A CD1    
1736 C  CD2    . TRP A 235 ? 0.6225 0.1988 0.1837 -0.0544 0.0258  0.0313  272 TRP A CD2    
1737 N  NE1    . TRP A 235 ? 0.7468 0.2509 0.2261 -0.0706 0.0333  0.0404  272 TRP A NE1    
1738 C  CE2    . TRP A 235 ? 0.7130 0.2462 0.2282 -0.0474 0.0224  0.0339  272 TRP A CE2    
1739 C  CE3    . TRP A 235 ? 0.5937 0.2028 0.1940 -0.0363 0.0170  0.0252  272 TRP A CE3    
1740 C  CZ2    . TRP A 235 ? 0.7010 0.2261 0.2105 -0.0219 0.0093  0.0299  272 TRP A CZ2    
1741 C  CZ3    . TRP A 235 ? 0.6117 0.2148 0.2075 -0.0138 0.0054  0.0214  272 TRP A CZ3    
1742 C  CH2    . TRP A 235 ? 0.6620 0.2253 0.2142 -0.0062 0.0011  0.0235  272 TRP A CH2    
1743 N  N      . ASN A 236 ? 0.6099 0.3151 0.2469 -0.1212 0.0767  0.0349  273 ASN A N      
1744 C  CA     . ASN A 236 ? 0.6299 0.3502 0.2603 -0.1270 0.0900  0.0362  273 ASN A CA     
1745 C  C      . ASN A 236 ? 0.6334 0.3946 0.2988 -0.1078 0.0905  0.0305  273 ASN A C      
1746 O  O      . ASN A 236 ? 0.6416 0.3927 0.2908 -0.0978 0.0923  0.0302  273 ASN A O      
1747 C  CB     . ASN A 236 ? 0.6605 0.4025 0.2904 -0.1570 0.1061  0.0393  273 ASN A CB     
1748 C  CG     . ASN A 236 ? 0.7748 0.4680 0.3590 -0.1806 0.1074  0.0457  273 ASN A CG     
1749 O  OD1    . ASN A 236 ? 0.6437 0.2800 0.1808 -0.1763 0.1022  0.0496  273 ASN A OD1    
1750 N  ND2    . ASN A 236 ? 0.6400 0.3521 0.2350 -0.2056 0.1132  0.0467  273 ASN A ND2    
1751 N  N      . LYS A 237 ? 0.5578 0.3593 0.2665 -0.1016 0.0877  0.0259  274 LYS A N      
1752 C  CA     . LYS A 237 ? 0.5106 0.3463 0.2497 -0.0832 0.0868  0.0202  274 LYS A CA     
1753 C  C      . LYS A 237 ? 0.5185 0.3287 0.2484 -0.0620 0.0741  0.0180  274 LYS A C      
1754 O  O      . LYS A 237 ? 0.5033 0.3235 0.2373 -0.0493 0.0748  0.0148  274 LYS A O      
1755 C  CB     . LYS A 237 ? 0.5098 0.3837 0.2898 -0.0815 0.0840  0.0164  274 LYS A CB     
1756 C  CG     . LYS A 237 ? 0.5977 0.5060 0.3936 -0.1013 0.0944  0.0171  274 LYS A CG     
1757 C  CD     . LYS A 237 ? 0.6991 0.6519 0.5114 -0.1000 0.1071  0.0140  274 LYS A CD     
1758 C  CE     . LYS A 237 ? 0.8417 0.8429 0.6849 -0.1119 0.1124  0.0118  274 LYS A CE     
1759 N  NZ     . LYS A 237 ? 0.9349 0.9316 0.7644 -0.1418 0.1191  0.0164  274 LYS A NZ     
1760 N  N      . VAL A 238 ? 0.4502 0.2296 0.1679 -0.0577 0.0620  0.0191  275 VAL A N      
1761 C  CA     . VAL A 238 ? 0.4286 0.1879 0.1384 -0.0390 0.0489  0.0165  275 VAL A CA     
1762 C  C      . VAL A 238 ? 0.5170 0.2479 0.1902 -0.0354 0.0506  0.0183  275 VAL A C      
1763 O  O      . VAL A 238 ? 0.4844 0.2191 0.1592 -0.0225 0.0469  0.0149  275 VAL A O      
1764 C  CB     . VAL A 238 ? 0.4601 0.1969 0.1638 -0.0346 0.0366  0.0167  275 VAL A CB     
1765 C  CG1    . VAL A 238 ? 0.4663 0.1819 0.1549 -0.0166 0.0237  0.0142  275 VAL A CG1    
1766 C  CG2    . VAL A 238 ? 0.4115 0.1757 0.1510 -0.0343 0.0334  0.0139  275 VAL A CG2    
1767 N  N      . ILE A 239 ? 0.5307 0.2294 0.1674 -0.0476 0.0554  0.0239  276 ILE A N      
1768 C  CA     . ILE A 239 ? 0.5807 0.2452 0.1756 -0.0450 0.0566  0.0265  276 ILE A CA     
1769 C  C      . ILE A 239 ? 0.6194 0.3052 0.2158 -0.0484 0.0703  0.0260  276 ILE A C      
1770 O  O      . ILE A 239 ? 0.6076 0.2763 0.1826 -0.0373 0.0674  0.0250  276 ILE A O      
1771 C  CB     . ILE A 239 ? 0.6821 0.2976 0.2295 -0.0565 0.0571  0.0329  276 ILE A CB     
1772 C  CG1    . ILE A 239 ? 0.7128 0.3347 0.2529 -0.0842 0.0741  0.0380  276 ILE A CG1    
1773 C  CG2    . ILE A 239 ? 0.7009 0.2936 0.2441 -0.0473 0.0420  0.0320  276 ILE A CG2    
1774 C  CD1    . ILE A 239 ? 0.8380 0.4015 0.3176 -0.1001 0.0773  0.0455  276 ILE A CD1    
1775 N  N      . GLU A 240 ? 0.5735 0.2985 0.1954 -0.0614 0.0840  0.0259  277 GLU A N      
1776 C  CA     . GLU A 240 ? 0.5811 0.3348 0.2088 -0.0620 0.0980  0.0241  277 GLU A CA     
1777 C  C      . GLU A 240 ? 0.6059 0.3707 0.2483 -0.0394 0.0904  0.0178  277 GLU A C      
1778 O  O      . GLU A 240 ? 0.6075 0.3720 0.2351 -0.0332 0.0968  0.0163  277 GLU A O      
1779 C  CB     . GLU A 240 ? 0.5748 0.3777 0.2363 -0.0754 0.1104  0.0231  277 GLU A CB     
1780 C  CG     . GLU A 240 ? 0.7503 0.5528 0.3935 -0.1023 0.1249  0.0288  277 GLU A CG     
1781 C  CD     . GLU A 240 ? 1.0114 0.8578 0.6881 -0.1189 0.1320  0.0280  277 GLU A CD     
1782 O  OE1    . GLU A 240 ? 1.0502 0.8866 0.7104 -0.1442 0.1387  0.0330  277 GLU A OE1    
1783 O  OE2    . GLU A 240 ? 0.8388 0.7273 0.5554 -0.1072 0.1301  0.0224  277 GLU A OE2    
1784 N  N      . GLN A 241 ? 0.5439 0.3159 0.2122 -0.0283 0.0770  0.0140  278 GLN A N      
1785 C  CA     . GLN A 241 ? 0.5169 0.2977 0.1986 -0.0104 0.0691  0.0079  278 GLN A CA     
1786 C  C      . GLN A 241 ? 0.5719 0.3211 0.2346 0.0017  0.0538  0.0062  278 GLN A C      
1787 O  O      . GLN A 241 ? 0.5751 0.3176 0.2261 0.0122  0.0514  0.0029  278 GLN A O      
1788 C  CB     . GLN A 241 ? 0.4878 0.2986 0.2086 -0.0074 0.0650  0.0044  278 GLN A CB     
1789 C  CG     . GLN A 241 ? 0.6127 0.4617 0.3543 -0.0117 0.0783  0.0032  278 GLN A CG     
1790 C  CD     . GLN A 241 ? 0.7038 0.5768 0.4790 -0.0069 0.0727  -0.0002 278 GLN A CD     
1791 O  OE1    . GLN A 241 ? 0.5877 0.4581 0.3698 0.0061  0.0640  -0.0044 278 GLN A OE1    
1792 N  NE2    . GLN A 241 ? 0.5750 0.4694 0.3688 -0.0187 0.0771  0.0017  278 GLN A NE2    
1793 N  N      . LEU A 242 ? 0.5294 0.2615 0.1895 0.0014  0.0427  0.0078  279 LEU A N      
1794 C  CA     . LEU A 242 ? 0.5277 0.2372 0.1741 0.0138  0.0266  0.0053  279 LEU A CA     
1795 C  C      . LEU A 242 ? 0.6158 0.2862 0.2180 0.0150  0.0247  0.0090  279 LEU A C      
1796 O  O      . LEU A 242 ? 0.6218 0.2739 0.2076 0.0271  0.0117  0.0063  279 LEU A O      
1797 C  CB     . LEU A 242 ? 0.4939 0.2110 0.1629 0.0166  0.0149  0.0036  279 LEU A CB     
1798 C  CG     . LEU A 242 ? 0.4939 0.2448 0.2034 0.0153  0.0151  0.0004  279 LEU A CG     
1799 C  CD1    . LEU A 242 ? 0.4585 0.2135 0.1836 0.0182  0.0045  -0.0009 279 LEU A CD1    
1800 C  CD2    . LEU A 242 ? 0.4941 0.2561 0.2136 0.0228  0.0111  -0.0048 279 LEU A CD2    
1801 N  N      . GLY A 243 ? 0.6014 0.2586 0.1831 0.0015  0.0368  0.0149  280 GLY A N      
1802 C  CA     . GLY A 243 ? 0.6467 0.2602 0.1796 0.0003  0.0364  0.0195  280 GLY A CA     
1803 C  C      . GLY A 243 ? 0.7134 0.2980 0.2294 0.0009  0.0267  0.0222  280 GLY A C      
1804 O  O      . GLY A 243 ? 0.6829 0.2831 0.2265 0.0058  0.0180  0.0194  280 GLY A O      
1805 N  N      . THR A 244 ? 0.7208 0.2604 0.1874 -0.0031 0.0280  0.0276  281 THR A N      
1806 C  CA     . THR A 244 ? 0.7562 0.2543 0.1908 -0.0007 0.0187  0.0307  281 THR A CA     
1807 C  C      . THR A 244 ? 0.8072 0.3013 0.2457 0.0247  -0.0026 0.0246  281 THR A C      
1808 O  O      . THR A 244 ? 0.8093 0.3008 0.2390 0.0379  -0.0102 0.0213  281 THR A O      
1809 C  CB     . THR A 244 ? 0.9064 0.3529 0.2802 -0.0105 0.0258  0.0378  281 THR A CB     
1810 O  OG1    . THR A 244 ? 0.9192 0.3826 0.2976 -0.0355 0.0468  0.0422  281 THR A OG1    
1811 C  CG2    . THR A 244 ? 0.9020 0.2946 0.2315 -0.0086 0.0165  0.0417  281 THR A CG2    
1812 N  N      . PRO A 245 ? 0.7516 0.2480 0.2035 0.0319  -0.0125 0.0226  282 PRO A N      
1813 C  CA     . PRO A 245 ? 0.7474 0.2476 0.2054 0.0563  -0.0322 0.0160  282 PRO A CA     
1814 C  C      . PRO A 245 ? 0.8716 0.3223 0.2750 0.0727  -0.0445 0.0167  282 PRO A C      
1815 O  O      . PRO A 245 ? 0.9334 0.3374 0.2885 0.0640  -0.0381 0.0235  282 PRO A O      
1816 C  CB     . PRO A 245 ? 0.7407 0.2535 0.2215 0.0584  -0.0364 0.0142  282 PRO A CB     
1817 C  CG     . PRO A 245 ? 0.8103 0.2968 0.2693 0.0380  -0.0235 0.0215  282 PRO A CG     
1818 C  CD     . PRO A 245 ? 0.7477 0.2441 0.2082 0.0185  -0.0066 0.0255  282 PRO A CD     
1819 N  N      . CYS A 246 ? 0.8182 0.2799 0.2283 0.0957  -0.0626 0.0096  283 CYS A N      
1820 C  CA     . CYS A 246 ? 0.8712 0.2942 0.2353 0.1173  -0.0788 0.0081  283 CYS A CA     
1821 C  C      . CYS A 246 ? 0.9397 0.3089 0.2552 0.1246  -0.0837 0.0122  283 CYS A C      
1822 O  O      . CYS A 246 ? 0.8909 0.2648 0.2206 0.1178  -0.0792 0.0134  283 CYS A O      
1823 C  CB     . CYS A 246 ? 0.8671 0.3286 0.2622 0.1388  -0.0972 -0.0019 283 CYS A CB     
1824 S  SG     . CYS A 246 ? 0.8986 0.3960 0.3336 0.1499  -0.1054 -0.0077 283 CYS A SG     
1825 N  N      . PRO A 247 ? 0.9537 0.2693 0.2094 0.1406  -0.0948 0.0136  284 PRO A N      
1826 C  CA     . PRO A 247 ? 1.0026 0.2602 0.2057 0.1502  -0.1015 0.0170  284 PRO A CA     
1827 C  C      . PRO A 247 ? 1.0486 0.3281 0.2745 0.1740  -0.1166 0.0093  284 PRO A C      
1828 O  O      . PRO A 247 ? 1.0648 0.3130 0.2683 0.1744  -0.1164 0.0117  284 PRO A O      
1829 C  CB     . PRO A 247 ? 1.0991 0.3005 0.2365 0.1661  -0.1124 0.0188  284 PRO A CB     
1830 C  CG     . PRO A 247 ? 1.1341 0.3580 0.2854 0.1558  -0.1051 0.0190  284 PRO A CG     
1831 C  CD     . PRO A 247 ? 0.9992 0.3003 0.2282 0.1511  -0.1024 0.0123  284 PRO A CD     
1832 N  N      . GLU A 248 ? 0.9797 0.3143 0.2503 0.1921  -0.1291 -0.0003 285 GLU A N      
1833 C  CA     . GLU A 248 ? 0.9623 0.3304 0.2619 0.2144  -0.1422 -0.0088 285 GLU A CA     
1834 C  C      . GLU A 248 ? 0.9615 0.3557 0.2997 0.1977  -0.1295 -0.0075 285 GLU A C      
1835 O  O      . GLU A 248 ? 0.9832 0.3766 0.3205 0.2141  -0.1371 -0.0113 285 GLU A O      
1836 C  CB     . GLU A 248 ? 0.9416 0.3728 0.2880 0.2285  -0.1545 -0.0189 285 GLU A CB     
1837 N  N      . PHE A 249 ? 0.8397 0.2576 0.2106 0.1672  -0.1110 -0.0027 286 PHE A N      
1838 C  CA     . PHE A 249 ? 0.7794 0.2199 0.1843 0.1495  -0.0987 -0.0009 286 PHE A CA     
1839 C  C      . PHE A 249 ? 0.8941 0.2744 0.2497 0.1412  -0.0935 0.0061  286 PHE A C      
1840 O  O      . PHE A 249 ? 0.8818 0.2617 0.2434 0.1441  -0.0944 0.0048  286 PHE A O      
1841 C  CB     . PHE A 249 ? 0.7318 0.2094 0.1777 0.1224  -0.0820 0.0020  286 PHE A CB     
1842 C  CG     . PHE A 249 ? 0.6976 0.1958 0.1747 0.1031  -0.0693 0.0044  286 PHE A CG     
1843 C  CD1    . PHE A 249 ? 0.6700 0.2163 0.1957 0.1077  -0.0718 -0.0014 286 PHE A CD1    
1844 C  CD2    . PHE A 249 ? 0.7225 0.1938 0.1799 0.0793  -0.0548 0.0122  286 PHE A CD2    
1845 C  CE1    . PHE A 249 ? 0.6484 0.2118 0.2004 0.0908  -0.0609 0.0007  286 PHE A CE1    
1846 C  CE2    . PHE A 249 ? 0.7228 0.2157 0.2096 0.0619  -0.0445 0.0137  286 PHE A CE2    
1847 C  CZ     . PHE A 249 ? 0.6542 0.1919 0.1877 0.0686  -0.0480 0.0080  286 PHE A CZ     
1848 N  N      . MET A 250 ? 0.9521 0.2801 0.2567 0.1296  -0.0877 0.0136  287 MET A N      
1849 C  CA     . MET A 250 ? 1.0288 0.2892 0.2748 0.1177  -0.0828 0.0213  287 MET A CA     
1850 C  C      . MET A 250 ? 1.1193 0.3373 0.3245 0.1465  -0.1001 0.0177  287 MET A C      
1851 O  O      . MET A 250 ? 1.1509 0.3338 0.3313 0.1394  -0.0978 0.0206  287 MET A O      
1852 C  CB     . MET A 250 ? 1.1106 0.3209 0.3027 0.1047  -0.0763 0.0290  287 MET A CB     
1853 C  CG     . MET A 250 ? 1.1193 0.3692 0.3446 0.0828  -0.0608 0.0314  287 MET A CG     
1854 S  SD     . MET A 250 ? 1.1134 0.4104 0.3921 0.0490  -0.0401 0.0342  287 MET A SD     
1855 C  CE     . MET A 250 ? 1.0585 0.3753 0.3448 0.0288  -0.0233 0.0381  287 MET A CE     
1856 N  N      . LYS A 251 ? 1.0807 0.3045 0.2797 0.1798  -0.1180 0.0106  288 LYS A N      
1857 C  CA     . LYS A 251 ? 1.1379 0.3304 0.3012 0.2150  -0.1370 0.0050  288 LYS A CA     
1858 C  C      . LYS A 251 ? 1.1619 0.3892 0.3625 0.2247  -0.1392 -0.0012 288 LYS A C      
1859 O  O      . LYS A 251 ? 1.2000 0.3884 0.3617 0.2482  -0.1506 -0.0041 288 LYS A O      
1860 C  CB     . LYS A 251 ? 1.1864 0.3967 0.3491 0.2470  -0.1551 -0.0026 288 LYS A CB     
1861 N  N      . LYS A 252 ? 1.0475 0.3444 0.3190 0.2076  -0.1284 -0.0033 289 LYS A N      
1862 C  CA     . LYS A 252 ? 1.0133 0.3471 0.3228 0.2137  -0.1285 -0.0088 289 LYS A CA     
1863 C  C      . LYS A 252 ? 1.0842 0.3893 0.3825 0.1877  -0.1154 -0.0022 289 LYS A C      
1864 O  O      . LYS A 252 ? 1.0791 0.3982 0.3937 0.1941  -0.1164 -0.0061 289 LYS A O      
1865 C  CB     . LYS A 252 ? 0.9620 0.3822 0.3488 0.2104  -0.1254 -0.0149 289 LYS A CB     
1866 C  CG     . LYS A 252 ? 1.0566 0.5133 0.4595 0.2365  -0.1404 -0.0234 289 LYS A CG     
1867 C  CD     . LYS A 252 ? 1.0959 0.6345 0.5714 0.2311  -0.1376 -0.0297 289 LYS A CD     
1868 C  CE     . LYS A 252 ? 1.1178 0.6814 0.6230 0.2043  -0.1267 -0.0259 289 LYS A CE     
1869 N  NZ     . LYS A 252 ? 1.0946 0.7299 0.6632 0.1990  -0.1252 -0.0320 289 LYS A NZ     
1870 N  N      . LEU A 253 ? 1.0503 0.3163 0.3195 0.1583  -0.1034 0.0073  290 LEU A N      
1871 C  CA     . LEU A 253 ? 1.0461 0.2864 0.3037 0.1297  -0.0912 0.0135  290 LEU A CA     
1872 C  C      . LEU A 253 ? 1.1715 0.3298 0.3550 0.1390  -0.0995 0.0157  290 LEU A C      
1873 O  O      . LEU A 253 ? 1.2255 0.3292 0.3511 0.1565  -0.1098 0.0168  290 LEU A O      
1874 C  CB     . LEU A 253 ? 1.0384 0.2748 0.2947 0.0934  -0.0745 0.0222  290 LEU A CB     
1875 C  CG     . LEU A 253 ? 1.0035 0.3143 0.3289 0.0785  -0.0632 0.0211  290 LEU A CG     
1876 C  CD1    . LEU A 253 ? 1.0040 0.3047 0.3153 0.0549  -0.0507 0.0280  290 LEU A CD1    
1877 C  CD2    . LEU A 253 ? 0.9817 0.3326 0.3536 0.0608  -0.0539 0.0204  290 LEU A CD2    
1878 N  N      . GLN A 254 ? 1.1275 0.2723 0.3082 0.1256  -0.0949 0.0167  291 GLN A N      
1879 C  CA     . GLN A 254 ? 1.2104 0.2721 0.3182 0.1279  -0.1011 0.0194  291 GLN A CA     
1880 C  C      . GLN A 254 ? 1.2990 0.2943 0.3455 0.1007  -0.0942 0.0297  291 GLN A C      
1881 O  O      . GLN A 254 ? 1.2504 0.2775 0.3260 0.0707  -0.0795 0.0348  291 GLN A O      
1882 C  CB     . GLN A 254 ? 1.2102 0.2797 0.3356 0.1118  -0.0954 0.0187  291 GLN A CB     
1883 N  N      . PRO A 255 ? 1.3566 0.2611 0.3173 0.1116  -0.1043 0.0325  292 PRO A N      
1884 C  CA     . PRO A 255 ? 1.4138 0.2538 0.3126 0.0846  -0.0971 0.0428  292 PRO A CA     
1885 C  C      . PRO A 255 ? 1.4307 0.2866 0.3481 0.0323  -0.0759 0.0509  292 PRO A C      
1886 O  O      . PRO A 255 ? 1.4038 0.2678 0.3216 0.0124  -0.0650 0.0566  292 PRO A O      
1887 C  CB     . PRO A 255 ? 1.5413 0.2775 0.3456 0.0992  -0.1105 0.0442  292 PRO A CB     
1888 C  CG     . PRO A 255 ? 1.5909 0.3420 0.4054 0.1493  -0.1289 0.0332  292 PRO A CG     
1889 C  CD     . PRO A 255 ? 1.4341 0.2888 0.3467 0.1509  -0.1230 0.0263  292 PRO A CD     
1890 N  N      . THR A 256 ? 1.3748 0.2394 0.3094 0.0111  -0.0702 0.0508  293 THR A N      
1891 C  CA     . THR A 256 ? 1.3500 0.2364 0.3059 -0.0379 -0.0514 0.0572  293 THR A CA     
1892 C  C      . THR A 256 ? 1.2859 0.2684 0.3260 -0.0482 -0.0384 0.0558  293 THR A C      
1893 O  O      . THR A 256 ? 1.2745 0.2675 0.3165 -0.0789 -0.0237 0.0620  293 THR A O      
1894 C  CB     . THR A 256 ? 1.4580 0.3318 0.4118 -0.0545 -0.0514 0.0561  293 THR A CB     
1895 O  OG1    . THR A 256 ? 1.4115 0.3516 0.4321 -0.0316 -0.0561 0.0475  293 THR A OG1    
1896 C  CG2    . THR A 256 ? 1.5389 0.3085 0.4007 -0.0477 -0.0636 0.0579  293 THR A CG2    
1897 N  N      . VAL A 257 ? 1.1583 0.2091 0.2650 -0.0227 -0.0435 0.0477  294 VAL A N      
1898 C  CA     . VAL A 257 ? 1.0663 0.2025 0.2485 -0.0284 -0.0334 0.0457  294 VAL A CA     
1899 C  C      . VAL A 257 ? 1.1232 0.2575 0.2935 -0.0204 -0.0323 0.0477  294 VAL A C      
1900 O  O      . VAL A 257 ? 1.0836 0.2527 0.2794 -0.0423 -0.0183 0.0511  294 VAL A O      
1901 C  CB     . VAL A 257 ? 1.0455 0.2490 0.2954 -0.0053 -0.0392 0.0369  294 VAL A CB     
1902 C  CG1    . VAL A 257 ? 0.9600 0.2416 0.2801 -0.0198 -0.0268 0.0362  294 VAL A CG1    
1903 C  CG2    . VAL A 257 ? 1.0510 0.2444 0.3006 -0.0060 -0.0433 0.0342  294 VAL A CG2    
1904 N  N      . ARG A 258 ? 1.1300 0.2218 0.2579 0.0115  -0.0475 0.0455  295 ARG A N      
1905 C  CA     . ARG A 258 ? 1.1596 0.2415 0.2679 0.0236  -0.0500 0.0468  295 ARG A CA     
1906 C  C      . ARG A 258 ? 1.2873 0.3293 0.3511 -0.0086 -0.0361 0.0564  295 ARG A C      
1907 O  O      . ARG A 258 ? 1.2610 0.3327 0.3434 -0.0151 -0.0276 0.0579  295 ARG A O      
1908 C  CB     . ARG A 258 ? 1.2316 0.2656 0.2923 0.0635  -0.0707 0.0426  295 ARG A CB     
1909 N  N      . ASN A 259 ? 1.3197 0.2942 0.3232 -0.0303 -0.0332 0.0628  296 ASN A N      
1910 C  CA     . ASN A 259 ? 1.3595 0.2920 0.3149 -0.0663 -0.0187 0.0725  296 ASN A CA     
1911 C  C      . ASN A 259 ? 1.3057 0.3100 0.3218 -0.1009 0.0022  0.0743  296 ASN A C      
1912 O  O      . ASN A 259 ? 1.2756 0.2908 0.2884 -0.1163 0.0148  0.0785  296 ASN A O      
1913 C  CB     . ASN A 259 ? 1.4728 0.3179 0.3516 -0.0833 -0.0216 0.0781  296 ASN A CB     
1914 C  CG     . ASN A 259 ? 1.8736 0.6731 0.6988 -0.1250 -0.0058 0.0885  296 ASN A CG     
1915 O  OD1    . ASN A 259 ? 1.7497 0.5768 0.5964 -0.1654 0.0107  0.0921  296 ASN A OD1    
1916 N  ND2    . ASN A 259 ? 1.8792 0.6106 0.6336 -0.1163 -0.0105 0.0933  296 ASN A ND2    
1917 N  N      . TYR A 260 ? 1.2076 0.2622 0.2784 -0.1104 0.0053  0.0706  297 TYR A N      
1918 C  CA     . TYR A 260 ? 1.1567 0.2853 0.2897 -0.1381 0.0228  0.0707  297 TYR A CA     
1919 C  C      . TYR A 260 ? 1.1447 0.3402 0.3332 -0.1224 0.0270  0.0667  297 TYR A C      
1920 O  O      . TYR A 260 ? 1.1167 0.3456 0.3226 -0.1438 0.0431  0.0695  297 TYR A O      
1921 C  CB     . TYR A 260 ? 1.1415 0.3066 0.3188 -0.1457 0.0219  0.0666  297 TYR A CB     
1922 C  CG     . TYR A 260 ? 1.1239 0.3699 0.3682 -0.1678 0.0374  0.0655  297 TYR A CG     
1923 C  CD1    . TYR A 260 ? 1.1753 0.4276 0.4109 -0.2077 0.0541  0.0711  297 TYR A CD1    
1924 C  CD2    . TYR A 260 ? 1.0609 0.3774 0.3747 -0.1480 0.0357  0.0588  297 TYR A CD2    
1925 C  CE1    . TYR A 260 ? 1.1394 0.4696 0.4360 -0.2241 0.0679  0.0691  297 TYR A CE1    
1926 C  CE2    . TYR A 260 ? 1.0188 0.4055 0.3886 -0.1641 0.0491  0.0575  297 TYR A CE2    
1927 C  CZ     . TYR A 260 ? 1.1502 0.5453 0.5123 -0.2005 0.0648  0.0623  297 TYR A CZ     
1928 O  OH     . TYR A 260 ? 1.1370 0.6042 0.5539 -0.2135 0.0773  0.0600  297 TYR A OH     
1929 N  N      . VAL A 261 ? 1.0764 0.2926 0.2922 -0.0861 0.0127  0.0597  298 VAL A N      
1930 C  CA     . VAL A 261 ? 1.0167 0.2907 0.2819 -0.0695 0.0135  0.0550  298 VAL A CA     
1931 C  C      . VAL A 261 ? 1.1293 0.3752 0.3551 -0.0677 0.0168  0.0588  298 VAL A C      
1932 O  O      . VAL A 261 ? 1.1056 0.3931 0.3599 -0.0759 0.0285  0.0588  298 VAL A O      
1933 C  CB     . VAL A 261 ? 1.0054 0.3079 0.3074 -0.0351 -0.0029 0.0465  298 VAL A CB     
1934 C  CG1    . VAL A 261 ? 0.9523 0.3006 0.2916 -0.0189 -0.0042 0.0419  298 VAL A CG1    
1935 C  CG2    . VAL A 261 ? 0.9523 0.2939 0.3010 -0.0399 -0.0023 0.0428  298 VAL A CG2    
1936 N  N      . GLU A 262 ? 1.1647 0.3373 0.3214 -0.0568 0.0067  0.0620  299 GLU A N      
1937 C  CA     . GLU A 262 ? 1.2094 0.3441 0.3179 -0.0541 0.0081  0.0661  299 GLU A CA     
1938 C  C      . GLU A 262 ? 1.2998 0.4175 0.3782 -0.0924 0.0291  0.0748  299 GLU A C      
1939 O  O      . GLU A 262 ? 1.3167 0.4214 0.3692 -0.0941 0.0352  0.0779  299 GLU A O      
1940 C  CB     . GLU A 262 ? 1.2997 0.3585 0.3399 -0.0284 -0.0106 0.0666  299 GLU A CB     
1941 C  CG     . GLU A 262 ? 1.4248 0.5044 0.4881 0.0135  -0.0309 0.0576  299 GLU A CG     
1942 C  CD     . GLU A 262 ? 1.7833 0.7925 0.7796 0.0430  -0.0508 0.0569  299 GLU A CD     
1943 O  OE1    . GLU A 262 ? 1.8599 0.7940 0.7865 0.0325  -0.0505 0.0635  299 GLU A OE1    
1944 O  OE2    . GLU A 262 ? 1.6001 0.6292 0.6123 0.0769  -0.0672 0.0493  299 GLU A OE2    
1945 N  N      . ASN A 263 ? 1.2567 0.3740 0.3360 -0.1240 0.0399  0.0786  300 ASN A N      
1946 C  CA     . ASN A 263 ? 1.2907 0.3988 0.3443 -0.1643 0.0607  0.0864  300 ASN A CA     
1947 C  C      . ASN A 263 ? 1.2608 0.4571 0.3858 -0.1838 0.0788  0.0840  300 ASN A C      
1948 O  O      . ASN A 263 ? 1.2738 0.4794 0.3893 -0.2178 0.0976  0.0891  300 ASN A O      
1949 C  CB     . ASN A 263 ? 1.3979 0.4397 0.3928 -0.1914 0.0617  0.0930  300 ASN A CB     
1950 N  N      . ARG A 264 ? 1.1311 0.3920 0.3249 -0.1616 0.0730  0.0760  301 ARG A N      
1951 C  CA     . ARG A 264 ? 1.0739 0.4165 0.3338 -0.1724 0.0873  0.0725  301 ARG A CA     
1952 C  C      . ARG A 264 ? 1.1341 0.4953 0.3923 -0.1691 0.0983  0.0730  301 ARG A C      
1953 O  O      . ARG A 264 ? 1.1438 0.4641 0.3647 -0.1495 0.0895  0.0736  301 ARG A O      
1954 C  CB     . ARG A 264 ? 1.0121 0.4061 0.3362 -0.1483 0.0760  0.0642  301 ARG A CB     
1955 N  N      . PRO A 265 ? 1.0879 0.5092 0.3833 -0.1860 0.1167  0.0721  302 PRO A N      
1956 C  CA     . PRO A 265 ? 1.0922 0.5304 0.3848 -0.1789 0.1265  0.0715  302 PRO A CA     
1957 C  C      . PRO A 265 ? 1.0800 0.5306 0.3970 -0.1416 0.1112  0.0645  302 PRO A C      
1958 O  O      . PRO A 265 ? 1.0074 0.4998 0.3767 -0.1282 0.1036  0.0583  302 PRO A O      
1959 C  CB     . PRO A 265 ? 1.0823 0.5936 0.4223 -0.1985 0.1463  0.0694  302 PRO A CB     
1960 C  CG     . PRO A 265 ? 1.1359 0.6568 0.4883 -0.2242 0.1489  0.0712  302 PRO A CG     
1961 C  CD     . PRO A 265 ? 1.0783 0.5587 0.4224 -0.2077 0.1278  0.0702  302 PRO A CD     
1962 N  N      . LYS A 266 ? 1.0582 0.4686 0.3336 -0.1261 0.1056  0.0657  303 LYS A N      
1963 C  CA     . LYS A 266 ? 1.0204 0.4363 0.3105 -0.0931 0.0899  0.0592  303 LYS A CA     
1964 C  C      . LYS A 266 ? 1.0108 0.4861 0.3467 -0.0854 0.0980  0.0532  303 LYS A C      
1965 O  O      . LYS A 266 ? 1.0071 0.5082 0.3460 -0.1012 0.1172  0.0548  303 LYS A O      
1966 C  CB     . LYS A 266 ? 1.1030 0.4549 0.3304 -0.0794 0.0798  0.0620  303 LYS A CB     
1967 N  N      . TYR A 267 ? 0.9091 0.4061 0.2794 -0.0610 0.0831  0.0460  304 TYR A N      
1968 C  CA     . TYR A 267 ? 0.8543 0.3990 0.2646 -0.0498 0.0862  0.0395  304 TYR A CA     
1969 C  C      . TYR A 267 ? 0.8572 0.3899 0.2657 -0.0236 0.0676  0.0339  304 TYR A C      
1970 O  O      . TYR A 267 ? 0.8295 0.3515 0.2449 -0.0117 0.0504  0.0316  304 TYR A O      
1971 C  CB     . TYR A 267 ? 0.8267 0.4242 0.2951 -0.0535 0.0885  0.0357  304 TYR A CB     
1972 C  CG     . TYR A 267 ? 0.8751 0.5043 0.3579 -0.0777 0.1081  0.0386  304 TYR A CG     
1973 C  CD1    . TYR A 267 ? 0.9044 0.5696 0.3981 -0.0815 0.1246  0.0369  304 TYR A CD1    
1974 C  CD2    . TYR A 267 ? 0.8924 0.5208 0.3814 -0.0955 0.1093  0.0420  304 TYR A CD2    
1975 C  CE1    . TYR A 267 ? 0.9218 0.6252 0.4330 -0.1032 0.1423  0.0385  304 TYR A CE1    
1976 C  CE2    . TYR A 267 ? 0.9053 0.5689 0.4110 -0.1192 0.1261  0.0439  304 TYR A CE2    
1977 C  CZ     . TYR A 267 ? 1.0297 0.7337 0.5483 -0.1230 0.1427  0.0420  304 TYR A CZ     
1978 O  OH     . TYR A 267 ? 1.0660 0.8129 0.6045 -0.1458 0.1591  0.0428  304 TYR A OH     
1979 N  N      . ALA A 268 ? 0.8097 0.3470 0.2098 -0.0147 0.0710  0.0309  305 ALA A N      
1980 C  CA     . ALA A 268 ? 0.8019 0.3326 0.2019 0.0075  0.0540  0.0247  305 ALA A CA     
1981 C  C      . ALA A 268 ? 0.8078 0.3799 0.2623 0.0157  0.0452  0.0179  305 ALA A C      
1982 O  O      . ALA A 268 ? 0.8033 0.3717 0.2655 0.0299  0.0272  0.0132  305 ALA A O      
1983 C  CB     . ALA A 268 ? 0.8287 0.3556 0.2067 0.0124  0.0620  0.0231  305 ALA A CB     
1984 N  N      . GLY A 269 ? 0.7100 0.3215 0.2001 0.0060  0.0580  0.0174  306 GLY A N      
1985 C  CA     . GLY A 269 ? 0.6653 0.3129 0.2023 0.0119  0.0520  0.0118  306 GLY A CA     
1986 C  C      . GLY A 269 ? 0.7172 0.3798 0.2628 0.0234  0.0517  0.0057  306 GLY A C      
1987 O  O      . GLY A 269 ? 0.7337 0.3762 0.2485 0.0299  0.0525  0.0047  306 GLY A O      
1988 N  N      . LEU A 270 ? 0.6392 0.3336 0.2232 0.0262  0.0504  0.0014  307 LEU A N      
1989 C  CA     . LEU A 270 ? 0.6353 0.3403 0.2259 0.0373  0.0492  -0.0048 307 LEU A CA     
1990 C  C      . LEU A 270 ? 0.6684 0.3653 0.2670 0.0462  0.0299  -0.0099 307 LEU A C      
1991 O  O      . LEU A 270 ? 0.6393 0.3404 0.2559 0.0435  0.0201  -0.0094 307 LEU A O      
1992 C  CB     . LEU A 270 ? 0.6090 0.3513 0.2302 0.0356  0.0610  -0.0066 307 LEU A CB     
1993 C  CG     . LEU A 270 ? 0.6771 0.4384 0.2959 0.0250  0.0811  -0.0026 307 LEU A CG     
1994 C  CD1    . LEU A 270 ? 0.6480 0.4515 0.3026 0.0244  0.0891  -0.0050 307 LEU A CD1    
1995 C  CD2    . LEU A 270 ? 0.7257 0.4752 0.3105 0.0293  0.0918  -0.0029 307 LEU A CD2    
1996 N  N      . THR A 271 ? 0.6406 0.3258 0.2236 0.0561  0.0245  -0.0150 308 THR A N      
1997 C  CA     . THR A 271 ? 0.6310 0.3096 0.2192 0.0617  0.0065  -0.0207 308 THR A CA     
1998 C  C      . THR A 271 ? 0.6464 0.3491 0.2687 0.0598  0.0060  -0.0234 308 THR A C      
1999 O  O      . THR A 271 ? 0.6242 0.3441 0.2578 0.0597  0.0190  -0.0226 308 THR A O      
2000 C  CB     . THR A 271 ? 0.7027 0.3586 0.2599 0.0709  0.0018  -0.0256 308 THR A CB     
2001 O  OG1    . THR A 271 ? 0.7433 0.4077 0.3022 0.0758  0.0121  -0.0285 308 THR A OG1    
2002 C  CG2    . THR A 271 ? 0.6671 0.2970 0.1853 0.0737  0.0048  -0.0228 308 THR A CG2    
2003 N  N      . PHE A 272 ? 0.6000 0.3047 0.2369 0.0586  -0.0089 -0.0269 309 PHE A N      
2004 C  CA     . PHE A 272 ? 0.5746 0.2967 0.2387 0.0556  -0.0101 -0.0290 309 PHE A CA     
2005 C  C      . PHE A 272 ? 0.6342 0.3489 0.2872 0.0626  -0.0063 -0.0333 309 PHE A C      
2006 O  O      . PHE A 272 ? 0.6054 0.3362 0.2753 0.0635  0.0018  -0.0328 309 PHE A O      
2007 C  CB     . PHE A 272 ? 0.5730 0.3013 0.2546 0.0499  -0.0251 -0.0313 309 PHE A CB     
2008 C  CG     . PHE A 272 ? 0.5631 0.3076 0.2650 0.0452  -0.0232 -0.0269 309 PHE A CG     
2009 C  CD1    . PHE A 272 ? 0.5966 0.3321 0.2855 0.0473  -0.0269 -0.0245 309 PHE A CD1    
2010 C  CD2    . PHE A 272 ? 0.5491 0.3137 0.2782 0.0400  -0.0177 -0.0250 309 PHE A CD2    
2011 C  CE1    . PHE A 272 ? 0.5839 0.3283 0.2858 0.0445  -0.0256 -0.0207 309 PHE A CE1    
2012 C  CE2    . PHE A 272 ? 0.5631 0.3389 0.3068 0.0361  -0.0158 -0.0211 309 PHE A CE2    
2013 C  CZ     . PHE A 272 ? 0.5519 0.3164 0.2811 0.0384  -0.0197 -0.0191 309 PHE A CZ     
2014 N  N      . PRO A 273 ? 0.6264 0.3168 0.2487 0.0697  -0.0104 -0.0374 310 PRO A N      
2015 C  CA     . PRO A 273 ? 0.6342 0.3159 0.2423 0.0795  -0.0048 -0.0415 310 PRO A CA     
2016 C  C      . PRO A 273 ? 0.6644 0.3663 0.2778 0.0857  0.0141  -0.0388 310 PRO A C      
2017 O  O      . PRO A 273 ? 0.6541 0.3643 0.2732 0.0933  0.0193  -0.0413 310 PRO A O      
2018 C  CB     . PRO A 273 ? 0.6918 0.3421 0.2617 0.0860  -0.0116 -0.0457 310 PRO A CB     
2019 C  CG     . PRO A 273 ? 0.7556 0.4002 0.3260 0.0776  -0.0261 -0.0454 310 PRO A CG     
2020 C  CD     . PRO A 273 ? 0.6723 0.3409 0.2692 0.0708  -0.0211 -0.0392 310 PRO A CD     
2021 N  N      . LYS A 274 ? 0.6298 0.3399 0.2405 0.0818  0.0239  -0.0339 311 LYS A N      
2022 C  CA     . LYS A 274 ? 0.6374 0.3720 0.2546 0.0831  0.0426  -0.0312 311 LYS A CA     
2023 C  C      . LYS A 274 ? 0.6921 0.4577 0.3462 0.0759  0.0466  -0.0285 311 LYS A C      
2024 O  O      . LYS A 274 ? 0.7007 0.4899 0.3669 0.0821  0.0565  -0.0302 311 LYS A O      
2025 C  CB     . LYS A 274 ? 0.6959 0.4246 0.2939 0.0771  0.0514  -0.0262 311 LYS A CB     
2026 C  CG     . LYS A 274 ? 0.8978 0.6101 0.4600 0.0874  0.0585  -0.0289 311 LYS A CG     
2027 C  CD     . LYS A 274 ? 1.0523 0.7500 0.5891 0.0799  0.0648  -0.0234 311 LYS A CD     
2028 C  CE     . LYS A 274 ? 1.3007 0.9928 0.8060 0.0878  0.0788  -0.0249 311 LYS A CE     
2029 N  NZ     . LYS A 274 ? 1.4724 1.1349 0.9489 0.1025  0.0686  -0.0315 311 LYS A NZ     
2030 N  N      . LEU A 275 ? 0.6235 0.3897 0.2946 0.0648  0.0381  -0.0250 312 LEU A N      
2031 C  CA     . LEU A 275 ? 0.5861 0.3772 0.2900 0.0572  0.0397  -0.0225 312 LEU A CA     
2032 C  C      . LEU A 275 ? 0.5931 0.3921 0.3121 0.0639  0.0353  -0.0267 312 LEU A C      
2033 O  O      . LEU A 275 ? 0.5733 0.3976 0.3127 0.0644  0.0424  -0.0263 312 LEU A O      
2034 C  CB     . LEU A 275 ? 0.5791 0.3635 0.2918 0.0472  0.0296  -0.0192 312 LEU A CB     
2035 C  CG     . LEU A 275 ? 0.6499 0.4261 0.3494 0.0396  0.0338  -0.0139 312 LEU A CG     
2036 C  CD1    . LEU A 275 ? 0.6355 0.3989 0.3361 0.0368  0.0202  -0.0130 312 LEU A CD1    
2037 C  CD2    . LEU A 275 ? 0.6922 0.4904 0.4056 0.0300  0.0473  -0.0095 312 LEU A CD2    
2038 N  N      . PHE A 276 ? 0.5332 0.3090 0.2399 0.0682  0.0230  -0.0308 313 PHE A N      
2039 C  CA     . PHE A 276 ? 0.5182 0.2904 0.2302 0.0731  0.0171  -0.0346 313 PHE A CA     
2040 C  C      . PHE A 276 ? 0.6345 0.3798 0.3149 0.0858  0.0141  -0.0403 313 PHE A C      
2041 O  O      . PHE A 276 ? 0.6451 0.3643 0.3103 0.0827  0.0016  -0.0431 313 PHE A O      
2042 C  CB     . PHE A 276 ? 0.5119 0.2794 0.2379 0.0618  0.0045  -0.0339 313 PHE A CB     
2043 C  CG     . PHE A 276 ? 0.4888 0.2792 0.2416 0.0517  0.0073  -0.0289 313 PHE A CG     
2044 C  CD1    . PHE A 276 ? 0.4743 0.2859 0.2497 0.0505  0.0125  -0.0271 313 PHE A CD1    
2045 C  CD2    . PHE A 276 ? 0.4910 0.2795 0.2429 0.0451  0.0042  -0.0262 313 PHE A CD2    
2046 C  CE1    . PHE A 276 ? 0.4554 0.2846 0.2515 0.0413  0.0149  -0.0229 313 PHE A CE1    
2047 C  CE2    . PHE A 276 ? 0.4920 0.2962 0.2630 0.0376  0.0064  -0.0219 313 PHE A CE2    
2048 C  CZ     . PHE A 276 ? 0.4360 0.2599 0.2287 0.0349  0.0120  -0.0203 313 PHE A CZ     
2049 N  N      . PRO A 277 ? 0.6185 0.3709 0.2875 0.0998  0.0254  -0.0425 314 PRO A N      
2050 C  CA     . PRO A 277 ? 0.6531 0.3763 0.2870 0.1142  0.0228  -0.0485 314 PRO A CA     
2051 C  C      . PRO A 277 ? 0.7182 0.4145 0.3388 0.1197  0.0114  -0.0531 314 PRO A C      
2052 O  O      . PRO A 277 ? 0.6900 0.3945 0.3296 0.1157  0.0081  -0.0519 314 PRO A O      
2053 C  CB     . PRO A 277 ? 0.6800 0.4263 0.3106 0.1290  0.0392  -0.0500 314 PRO A CB     
2054 C  CG     . PRO A 277 ? 0.7158 0.4980 0.3739 0.1169  0.0500  -0.0440 314 PRO A CG     
2055 C  CD     . PRO A 277 ? 0.6267 0.4150 0.3124 0.1029  0.0412  -0.0403 314 PRO A CD     
2056 N  N      . ASP A 278 ? 0.7364 0.3959 0.3196 0.1280  0.0049  -0.0583 315 ASP A N      
2057 C  CA     . ASP A 278 ? 0.7695 0.3905 0.3260 0.1333  -0.0065 -0.0635 315 ASP A CA     
2058 C  C      . ASP A 278 ? 0.8166 0.4456 0.3780 0.1483  -0.0020 -0.0652 315 ASP A C      
2059 O  O      . ASP A 278 ? 0.8168 0.4252 0.3734 0.1442  -0.0114 -0.0658 315 ASP A O      
2060 C  CB     . ASP A 278 ? 0.8374 0.4204 0.3486 0.1450  -0.0100 -0.0694 315 ASP A CB     
2061 C  CG     . ASP A 278 ? 1.0116 0.5839 0.5138 0.1319  -0.0166 -0.0685 315 ASP A CG     
2062 O  OD1    . ASP A 278 ? 0.9944 0.5799 0.5210 0.1129  -0.0232 -0.0645 315 ASP A OD1    
2063 O  OD2    . ASP A 278 ? 1.1309 0.6826 0.6008 0.1422  -0.0154 -0.0721 315 ASP A OD2    
2064 N  N      . SER A 279 ? 0.7754 0.4371 0.3472 0.1647  0.0124  -0.0658 316 SER A N      
2065 C  CA     . SER A 279 ? 0.7737 0.4549 0.3548 0.1823  0.0179  -0.0680 316 SER A CA     
2066 C  C      . SER A 279 ? 0.7677 0.4612 0.3777 0.1699  0.0126  -0.0639 316 SER A C      
2067 O  O      . SER A 279 ? 0.7701 0.4544 0.3729 0.1829  0.0089  -0.0666 316 SER A O      
2068 C  CB     . SER A 279 ? 0.8115 0.5427 0.4130 0.1925  0.0353  -0.0679 316 SER A CB     
2069 N  N      . LEU A 280 ? 0.6670 0.3785 0.3060 0.1465  0.0119  -0.0576 317 LEU A N      
2070 C  CA     . LEU A 280 ? 0.6291 0.3530 0.2953 0.1335  0.0076  -0.0536 317 LEU A CA     
2071 C  C      . LEU A 280 ? 0.6785 0.3612 0.3260 0.1234  -0.0067 -0.0542 317 LEU A C      
2072 O  O      . LEU A 280 ? 0.6486 0.3341 0.3098 0.1160  -0.0105 -0.0518 317 LEU A O      
2073 C  CB     . LEU A 280 ? 0.5891 0.3455 0.2895 0.1143  0.0122  -0.0473 317 LEU A CB     
2074 C  CG     . LEU A 280 ? 0.6270 0.4241 0.3469 0.1169  0.0267  -0.0453 317 LEU A CG     
2075 C  CD1    . LEU A 280 ? 0.5863 0.4011 0.3302 0.0970  0.0283  -0.0391 317 LEU A CD1    
2076 C  CD2    . LEU A 280 ? 0.6600 0.4889 0.3973 0.1294  0.0336  -0.0468 317 LEU A CD2    
2077 N  N      . PHE A 281 ? 0.6768 0.3208 0.2910 0.1220  -0.0145 -0.0576 318 PHE A N      
2078 C  CA     . PHE A 281 ? 0.8201 0.4254 0.4144 0.1078  -0.0280 -0.0584 318 PHE A CA     
2079 C  C      . PHE A 281 ? 1.3914 0.9464 0.9386 0.1224  -0.0348 -0.0641 318 PHE A C      
2080 O  O      . PHE A 281 ? 1.0134 0.5512 0.5326 0.1397  -0.0329 -0.0688 318 PHE A O      
2081 C  CB     . PHE A 281 ? 0.8253 0.4258 0.4198 0.0887  -0.0346 -0.0578 318 PHE A CB     
2082 C  CG     . PHE A 281 ? 0.7748 0.4163 0.4106 0.0739  -0.0311 -0.0524 318 PHE A CG     
2083 C  CD1    . PHE A 281 ? 0.7658 0.4170 0.4227 0.0562  -0.0361 -0.0495 318 PHE A CD1    
2084 C  CD2    . PHE A 281 ? 0.7639 0.4313 0.4134 0.0779  -0.0228 -0.0504 318 PHE A CD2    
2085 C  CE1    . PHE A 281 ? 0.7216 0.4080 0.4129 0.0457  -0.0333 -0.0452 318 PHE A CE1    
2086 C  CE2    . PHE A 281 ? 0.7529 0.4507 0.4339 0.0658  -0.0206 -0.0457 318 PHE A CE2    
2087 C  CZ     . PHE A 281 ? 0.7001 0.4073 0.4018 0.0511  -0.0263 -0.0435 318 PHE A CZ     
2088 N  N      . ASP A 284 ? 1.0269 0.3284 0.3628 0.1114  -0.0839 -0.0826 321 ASP A N      
2089 C  CA     . ASP A 284 ? 1.0941 0.3261 0.3643 0.1282  -0.0920 -0.0890 321 ASP A CA     
2090 C  C      . ASP A 284 ? 1.1373 0.3168 0.3687 0.0999  -0.1069 -0.0913 321 ASP A C      
2091 O  O      . ASP A 284 ? 1.1843 0.3373 0.3849 0.1038  -0.1118 -0.0966 321 ASP A O      
2092 C  CB     . ASP A 284 ? 1.1462 0.3537 0.3968 0.1457  -0.0922 -0.0887 321 ASP A CB     
2093 N  N      . SER A 285 ? 1.0251 0.1931 0.2593 0.0694  -0.1137 -0.0875 322 SER A N      
2094 C  CA     . SER A 285 ? 1.0280 0.1541 0.2311 0.0359  -0.1276 -0.0892 322 SER A CA     
2095 C  C      . SER A 285 ? 0.9822 0.1582 0.2270 0.0143  -0.1285 -0.0887 322 SER A C      
2096 O  O      . SER A 285 ? 0.8908 0.1278 0.1863 0.0235  -0.1182 -0.0857 322 SER A O      
2097 C  CB     . SER A 285 ? 1.0204 0.1293 0.2196 0.0096  -0.1317 -0.0847 322 SER A CB     
2098 O  OG     . SER A 285 ? 1.0015 0.1784 0.2649 -0.0100 -0.1251 -0.0788 322 SER A OG     
2099 N  N      . GLU A 286 ? 0.9662 0.1149 0.1873 -0.0142 -0.1415 -0.0920 323 GLU A N      
2100 C  CA     . GLU A 286 ? 0.9093 0.1127 0.1723 -0.0327 -0.1438 -0.0847 323 GLU A CA     
2101 C  C      . GLU A 286 ? 0.8887 0.1472 0.2075 -0.0540 -0.1395 -0.0863 323 GLU A C      
2102 O  O      . GLU A 286 ? 0.8102 0.1266 0.1761 -0.0521 -0.1347 -0.0846 323 GLU A O      
2103 C  CB     . GLU A 286 ? 0.9735 0.1280 0.1918 -0.0609 -0.1610 -0.0937 323 GLU A CB     
2104 C  CG     . GLU A 286 ? 1.0426 0.1356 0.2003 -0.0418 -0.1682 -0.1051 323 GLU A CG     
2105 C  CD     . GLU A 286 ? 1.0019 0.1335 0.1826 -0.0187 -0.1624 -0.1024 323 GLU A CD     
2106 O  OE1    . GLU A 286 ? 0.8702 0.1021 0.1378 -0.0159 -0.1501 -0.0653 323 GLU A OE1    
2107 O  OE2    . GLU A 286 ? 1.0653 0.1478 0.1952 0.0008  -0.1660 -0.1127 323 GLU A OE2    
2108 N  N      . HIS A 287 ? 0.8772 0.1217 0.1915 -0.0713 -0.1398 -0.0830 324 HIS A N      
2109 C  CA     . HIS A 287 ? 0.8441 0.1442 0.2113 -0.0885 -0.1336 -0.0773 324 HIS A CA     
2110 C  C      . HIS A 287 ? 0.8175 0.1719 0.2327 -0.0620 -0.1199 -0.0733 324 HIS A C      
2111 O  O      . HIS A 287 ? 0.7633 0.1752 0.2268 -0.0691 -0.1167 -0.0713 324 HIS A O      
2112 C  CB     . HIS A 287 ? 0.8923 0.1587 0.2376 -0.1028 -0.1335 -0.0738 324 HIS A CB     
2113 C  CG     . HIS A 287 ? 0.8928 0.2138 0.2894 -0.1143 -0.1249 -0.0678 324 HIS A CG     
2114 N  ND1    . HIS A 287 ? 0.9124 0.2620 0.3312 -0.1499 -0.1281 -0.0670 324 HIS A ND1    
2115 C  CD2    . HIS A 287 ? 0.8670 0.2185 0.2948 -0.0942 -0.1134 -0.0630 324 HIS A CD2    
2116 C  CE1    . HIS A 287 ? 0.8483 0.2423 0.3090 -0.1487 -0.1182 -0.0617 324 HIS A CE1    
2117 N  NE2    . HIS A 287 ? 0.8300 0.2251 0.2969 -0.1164 -0.1097 -0.0591 324 HIS A NE2    
2118 N  N      . ASN A 288 ? 0.7746 0.1106 0.1746 -0.0312 -0.1125 -0.0726 325 ASN A N      
2119 C  CA     . ASN A 288 ? 0.7155 0.1005 0.1574 -0.0079 -0.0992 -0.0689 325 ASN A CA     
2120 C  C      . ASN A 288 ? 0.7195 0.1370 0.1816 0.0034  -0.0957 -0.0704 325 ASN A C      
2121 O  O      . ASN A 288 ? 0.6795 0.1479 0.1858 0.0074  -0.0872 -0.0666 325 ASN A O      
2122 C  CB     . ASN A 288 ? 0.7060 0.0787 0.1318 0.0217  -0.0926 -0.0599 325 ASN A CB     
2123 C  CG     . ASN A 288 ? 0.9259 0.2701 0.3400 0.0124  -0.0937 -0.0653 325 ASN A CG     
2124 O  OD1    . ASN A 288 ? 0.7950 0.1631 0.2360 -0.0127 -0.0939 -0.0613 325 ASN A OD1    
2125 N  ND2    . ASN A 288 ? 0.8486 0.1507 0.2247 0.0343  -0.0943 -0.0669 325 ASN A ND2    
2126 N  N      . LYS A 289 ? 0.7180 0.1027 0.1444 0.0073  -0.1028 -0.0758 326 LYS A N      
2127 C  CA     . LYS A 289 ? 0.6968 0.1050 0.1343 0.0170  -0.1008 -0.0760 326 LYS A CA     
2128 C  C      . LYS A 289 ? 0.6815 0.1326 0.1573 -0.0050 -0.1050 -0.0757 326 LYS A C      
2129 O  O      . LYS A 289 ? 0.6294 0.1203 0.1363 0.0037  -0.0980 -0.0731 326 LYS A O      
2130 C  CB     . LYS A 289 ? 0.7860 0.1409 0.1689 0.0231  -0.1099 -0.0843 326 LYS A CB     
2131 C  CG     . LYS A 289 ? 0.8392 0.1596 0.1856 0.0544  -0.1035 -0.0872 326 LYS A CG     
2132 C  CD     . LYS A 289 ? 0.9065 0.1753 0.1985 0.0619  -0.1121 -0.0943 326 LYS A CD     
2133 C  CE     . LYS A 289 ? 0.9388 0.1818 0.1978 0.0974  -0.1041 -0.0978 326 LYS A CE     
2134 N  NZ     . LYS A 289 ? 1.0576 0.2365 0.2530 0.1046  -0.1143 -0.1055 326 LYS A NZ     
2135 N  N      . LEU A 290 ? 0.6581 0.1107 0.1386 -0.0315 -0.1144 -0.0694 327 LEU A N      
2136 C  CA     . LEU A 290 ? 0.6175 0.1180 0.1384 -0.0503 -0.1182 -0.0657 327 LEU A CA     
2137 C  C      . LEU A 290 ? 0.6204 0.1598 0.1794 -0.0527 -0.1111 -0.0708 327 LEU A C      
2138 O  O      . LEU A 290 ? 0.5907 0.1717 0.1821 -0.0490 -0.1089 -0.0694 327 LEU A O      
2139 C  CB     . LEU A 290 ? 0.6470 0.1328 0.1535 -0.0813 -0.1309 -0.0682 327 LEU A CB     
2140 C  CG     . LEU A 290 ? 0.6672 0.1930 0.2004 -0.1072 -0.1424 -0.0821 327 LEU A CG     
2141 C  CD1    . LEU A 290 ? 0.6356 0.1818 0.1765 -0.0946 -0.1472 -0.0851 327 LEU A CD1    
2142 C  CD2    . LEU A 290 ? 0.7277 0.2361 0.2416 -0.1407 -0.1551 -0.0864 327 LEU A CD2    
2143 N  N      . LYS A 291 ? 0.5873 0.1182 0.1473 -0.0546 -0.1052 -0.0673 328 LYS A N      
2144 C  CA     . LYS A 291 ? 0.5284 0.1043 0.1327 -0.0517 -0.0943 -0.0583 328 LYS A CA     
2145 C  C      . LYS A 291 ? 0.5598 0.1560 0.1808 -0.0277 -0.0843 -0.0589 328 LYS A C      
2146 O  O      . LYS A 291 ? 0.5468 0.1848 0.2048 -0.0281 -0.0794 -0.0557 328 LYS A O      
2147 C  CB     . LYS A 291 ? 0.5639 0.1134 0.1535 -0.0578 -0.0922 -0.0591 328 LYS A CB     
2148 C  CG     . LYS A 291 ? 0.6378 0.1706 0.2133 -0.0887 -0.1009 -0.0604 328 LYS A CG     
2149 C  CD     . LYS A 291 ? 0.7762 0.3612 0.3959 -0.1070 -0.0987 -0.0580 328 LYS A CD     
2150 C  CE     . LYS A 291 ? 0.9169 0.5124 0.5371 -0.1365 -0.1091 -0.0621 328 LYS A CE     
2151 N  NZ     . LYS A 291 ? 0.8957 0.5559 0.5656 -0.1448 -0.1071 -0.0616 328 LYS A NZ     
2152 N  N      . ALA A 292 ? 0.5252 0.0954 0.1198 -0.0064 -0.0803 -0.0604 329 ALA A N      
2153 C  CA     . ALA A 292 ? 0.4980 0.0923 0.1089 0.0145  -0.0689 -0.0579 329 ALA A CA     
2154 C  C      . ALA A 292 ? 0.5313 0.1509 0.1582 0.0118  -0.0710 -0.0579 329 ALA A C      
2155 O  O      . ALA A 292 ? 0.4853 0.1379 0.1408 0.0163  -0.0634 -0.0540 329 ALA A O      
2156 C  CB     . ALA A 292 ? 0.5399 0.1034 0.1166 0.0364  -0.0649 -0.0609 329 ALA A CB     
2157 N  N      . SER A 293 ? 0.4985 0.1018 0.1066 0.0047  -0.0818 -0.0595 330 SER A N      
2158 C  CA     . SER A 293 ? 0.4790 0.1043 0.1013 0.0034  -0.0863 -0.0561 330 SER A CA     
2159 C  C      . SER A 293 ? 0.4747 0.1365 0.1284 -0.0109 -0.0901 -0.0613 330 SER A C      
2160 O  O      . SER A 293 ? 0.4537 0.1404 0.1254 -0.0042 -0.0875 -0.0591 330 SER A O      
2161 C  CB     . SER A 293 ? 0.5432 0.1328 0.1244 -0.0070 -0.1025 -0.0702 330 SER A CB     
2162 O  OG     . SER A 293 ? 0.6890 0.3022 0.2835 -0.0135 -0.1116 -0.0720 330 SER A OG     
2163 N  N      . GLN A 294 ? 0.4350 0.1095 0.1091 -0.0262 -0.0914 -0.0531 331 GLN A N      
2164 C  CA     . GLN A 294 ? 0.4015 0.1172 0.1121 -0.0371 -0.0922 -0.0524 331 GLN A CA     
2165 C  C      . GLN A 294 ? 0.4295 0.1630 0.1582 -0.0294 -0.0827 -0.0543 331 GLN A C      
2166 O  O      . GLN A 294 ? 0.3948 0.1603 0.1487 -0.0277 -0.0824 -0.0530 331 GLN A O      
2167 C  CB     . GLN A 294 ? 0.4222 0.1363 0.1299 -0.0625 -0.1007 -0.0596 331 GLN A CB     
2168 C  CG     . GLN A 294 ? 0.3927 0.1116 0.1095 -0.0645 -0.0987 -0.0343 331 GLN A CG     
2169 C  CD     . GLN A 294 ? 0.5825 0.2761 0.2634 -0.1062 -0.1207 -0.0703 331 GLN A CD     
2170 O  OE1    . GLN A 294 ? 0.5657 0.2521 0.2488 -0.1100 -0.1129 -0.0663 331 GLN A OE1    
2171 N  NE2    . GLN A 294 ? 0.4973 0.1954 0.1728 -0.1250 -0.1320 -0.0734 331 GLN A NE2    
2172 N  N      . ALA A 295 ? 0.3918 0.1086 0.1131 -0.0214 -0.0732 -0.0512 332 ALA A N      
2173 C  CA     . ALA A 295 ? 0.3594 0.0972 0.1041 -0.0124 -0.0617 -0.0460 332 ALA A CA     
2174 C  C      . ALA A 295 ? 0.4178 0.1671 0.1672 0.0011  -0.0564 -0.0441 332 ALA A C      
2175 O  O      . ALA A 295 ? 0.3877 0.1619 0.1602 0.0023  -0.0522 -0.0408 332 ALA A O      
2176 C  CB     . ALA A 295 ? 0.3757 0.0930 0.1074 -0.0042 -0.0546 -0.0445 332 ALA A CB     
2177 N  N      . ARG A 296 ? 0.3949 0.1229 0.1186 0.0108  -0.0566 -0.0461 333 ARG A N      
2178 C  CA     . ARG A 296 ? 0.4029 0.1371 0.1250 0.0218  -0.0509 -0.0439 333 ARG A CA     
2179 C  C      . ARG A 296 ? 0.4231 0.1728 0.1547 0.0181  -0.0589 -0.0443 333 ARG A C      
2180 O  O      . ARG A 296 ? 0.3750 0.1387 0.1179 0.0228  -0.0537 -0.0406 333 ARG A O      
2181 C  CB     . ARG A 296 ? 0.4815 0.1895 0.1718 0.0334  -0.0478 -0.0460 333 ARG A CB     
2182 C  CG     . ARG A 296 ? 0.6458 0.3608 0.3336 0.0433  -0.0377 -0.0425 333 ARG A CG     
2183 C  CD     . ARG A 296 ? 0.8869 0.5771 0.5406 0.0533  -0.0368 -0.0453 333 ARG A CD     
2184 N  NE     . ARG A 296 ? 0.9741 0.6543 0.6151 0.0636  -0.0280 -0.0468 333 ARG A NE     
2185 C  CZ     . ARG A 296 ? 1.1583 0.8113 0.7749 0.0676  -0.0338 -0.0519 333 ARG A CZ     
2186 N  NH1    . ARG A 296 ? 1.0349 0.6679 0.6372 0.0585  -0.0483 -0.0558 333 ARG A NH1    
2187 N  NH2    . ARG A 296 ? 0.9771 0.6225 0.5815 0.0809  -0.0256 -0.0536 333 ARG A NH2    
2188 N  N      . ASP A 297 ? 0.4011 0.1494 0.1285 0.0091  -0.0722 -0.0491 334 ASP A N      
2189 C  CA     . ASP A 297 ? 0.3876 0.1560 0.1259 0.0073  -0.0822 -0.0511 334 ASP A CA     
2190 C  C      . ASP A 297 ? 0.3918 0.1920 0.1624 0.0048  -0.0791 -0.0483 334 ASP A C      
2191 O  O      . ASP A 297 ? 0.3683 0.1814 0.1452 0.0122  -0.0812 -0.0475 334 ASP A O      
2192 C  CB     . ASP A 297 ? 0.4161 0.1843 0.1483 -0.0049 -0.0972 -0.0577 334 ASP A CB     
2193 C  CG     . ASP A 297 ? 0.4955 0.2900 0.2399 -0.0042 -0.1089 -0.0611 334 ASP A CG     
2194 O  OD1    . ASP A 297 ? 0.5667 0.3520 0.2950 0.0080  -0.1126 -0.0614 334 ASP A OD1    
2195 O  OD2    . ASP A 297 ? 0.4212 0.2466 0.1907 -0.0145 -0.1138 -0.0633 334 ASP A OD2    
2196 N  N      . LEU A 298 ? 0.3375 0.1469 0.1245 -0.0048 -0.0748 -0.0472 335 LEU A N      
2197 C  CA     . LEU A 298 ? 0.3085 0.1460 0.1236 -0.0067 -0.0710 -0.0447 335 LEU A CA     
2198 C  C      . LEU A 298 ? 0.3669 0.2022 0.1844 0.0045  -0.0600 -0.0391 335 LEU A C      
2199 O  O      . LEU A 298 ? 0.3704 0.2209 0.1992 0.0094  -0.0604 -0.0379 335 LEU A O      
2200 C  CB     . LEU A 298 ? 0.2938 0.1380 0.1214 -0.0203 -0.0689 -0.0447 335 LEU A CB     
2201 C  CG     . LEU A 298 ? 0.3042 0.1769 0.1593 -0.0226 -0.0644 -0.0424 335 LEU A CG     
2202 C  CD1    . LEU A 298 ? 0.2824 0.1861 0.1536 -0.0218 -0.0725 -0.0461 335 LEU A CD1    
2203 C  CD2    . LEU A 298 ? 0.2881 0.1603 0.1487 -0.0364 -0.0613 -0.0417 335 LEU A CD2    
2204 N  N      . LEU A 299 ? 0.3453 0.1618 0.1501 0.0090  -0.0508 -0.0364 336 LEU A N      
2205 C  CA     . LEU A 299 ? 0.3395 0.1561 0.1455 0.0164  -0.0399 -0.0314 336 LEU A CA     
2206 C  C      . LEU A 299 ? 0.3707 0.1821 0.1646 0.0235  -0.0418 -0.0304 336 LEU A C      
2207 O  O      . LEU A 299 ? 0.3732 0.1910 0.1738 0.0256  -0.0380 -0.0270 336 LEU A O      
2208 C  CB     . LEU A 299 ? 0.3553 0.1573 0.1478 0.0212  -0.0309 -0.0303 336 LEU A CB     
2209 C  CG     . LEU A 299 ? 0.4124 0.2209 0.2173 0.0196  -0.0242 -0.0288 336 LEU A CG     
2210 C  CD1    . LEU A 299 ? 0.4437 0.2383 0.2315 0.0282  -0.0178 -0.0298 336 LEU A CD1    
2211 C  CD2    . LEU A 299 ? 0.3694 0.1967 0.1945 0.0183  -0.0174 -0.0245 336 LEU A CD2    
2212 N  N      . SER A 300 ? 0.3381 0.1346 0.1109 0.0271  -0.0489 -0.0335 337 SER A N      
2213 C  CA     . SER A 300 ? 0.3431 0.1290 0.0976 0.0351  -0.0525 -0.0328 337 SER A CA     
2214 C  C      . SER A 300 ? 0.3852 0.1863 0.1510 0.0379  -0.0614 -0.0338 337 SER A C      
2215 O  O      . SER A 300 ? 0.3905 0.1804 0.1409 0.0460  -0.0624 -0.0317 337 SER A O      
2216 C  CB     . SER A 300 ? 0.3796 0.1462 0.1082 0.0384  -0.0597 -0.0366 337 SER A CB     
2217 O  OG     . SER A 300 ? 0.3967 0.1726 0.1304 0.0347  -0.0745 -0.0425 337 SER A OG     
2218 N  N      . LYS A 301 ? 0.3260 0.1514 0.1160 0.0319  -0.0677 -0.0372 338 LYS A N      
2219 C  CA     . LYS A 301 ? 0.3152 0.1619 0.1185 0.0366  -0.0765 -0.0397 338 LYS A CA     
2220 C  C      . LYS A 301 ? 0.3385 0.1970 0.1590 0.0370  -0.0692 -0.0363 338 LYS A C      
2221 O  O      . LYS A 301 ? 0.3457 0.2124 0.1683 0.0460  -0.0741 -0.0372 338 LYS A O      
2222 C  CB     . LYS A 301 ? 0.3508 0.2223 0.1697 0.0290  -0.0878 -0.0465 338 LYS A CB     
2223 C  CG     . LYS A 301 ? 0.3818 0.2427 0.1811 0.0305  -0.0993 -0.0512 338 LYS A CG     
2224 C  CD     . LYS A 301 ? 0.3952 0.2796 0.2093 0.0170  -0.1092 -0.0578 338 LYS A CD     
2225 C  CE     . LYS A 301 ? 0.4672 0.3389 0.2604 0.0155  -0.1212 -0.0629 338 LYS A CE     
2226 N  NZ     . LYS A 301 ? 0.6133 0.4812 0.3909 0.0322  -0.1306 -0.0647 338 LYS A NZ     
2227 N  N      . MET A 302 ? 0.2719 0.1294 0.1019 0.0290  -0.0583 -0.0327 339 MET A N      
2228 C  CA     . MET A 302 ? 0.2499 0.1166 0.0947 0.0282  -0.0513 -0.0295 339 MET A CA     
2229 C  C      . MET A 302 ? 0.3102 0.1562 0.1387 0.0322  -0.0431 -0.0240 339 MET A C      
2230 O  O      . MET A 302 ? 0.2927 0.1382 0.1220 0.0357  -0.0420 -0.0221 339 MET A O      
2231 C  CB     . MET A 302 ? 0.2519 0.1288 0.1144 0.0175  -0.0450 -0.0287 339 MET A CB     
2232 C  CG     . MET A 302 ? 0.2920 0.1875 0.1681 0.0089  -0.0521 -0.0336 339 MET A CG     
2233 S  SD     . MET A 302 ? 0.3058 0.2118 0.1999 -0.0032 -0.0456 -0.0322 339 MET A SD     
2234 C  CE     . MET A 302 ? 0.2806 0.1604 0.1586 -0.0037 -0.0390 -0.0295 339 MET A CE     
2235 N  N      . LEU A 303 ? 0.2960 0.1249 0.1086 0.0306  -0.0367 -0.0217 340 LEU A N      
2236 C  CA     . LEU A 303 ? 0.3109 0.1231 0.1078 0.0303  -0.0270 -0.0165 340 LEU A CA     
2237 C  C      . LEU A 303 ? 0.3853 0.1747 0.1534 0.0379  -0.0317 -0.0156 340 LEU A C      
2238 O  O      . LEU A 303 ? 0.3981 0.1698 0.1440 0.0383  -0.0273 -0.0138 340 LEU A O      
2239 C  CB     . LEU A 303 ? 0.3149 0.1254 0.1097 0.0260  -0.0171 -0.0153 340 LEU A CB     
2240 C  CG     . LEU A 303 ? 0.3465 0.1745 0.1641 0.0202  -0.0106 -0.0147 340 LEU A CG     
2241 C  CD1    . LEU A 303 ? 0.3624 0.1891 0.1746 0.0210  -0.0031 -0.0151 340 LEU A CD1    
2242 C  CD2    . LEU A 303 ? 0.3328 0.1665 0.1590 0.0154  -0.0044 -0.0108 340 LEU A CD2    
2243 N  N      . VAL A 304 ? 0.3397 0.1294 0.1064 0.0455  -0.0410 -0.0172 341 VAL A N      
2244 C  CA     . VAL A 304 ? 0.3634 0.1295 0.1005 0.0563  -0.0484 -0.0170 341 VAL A CA     
2245 C  C      . VAL A 304 ? 0.4227 0.1739 0.1494 0.0579  -0.0457 -0.0131 341 VAL A C      
2246 O  O      . VAL A 304 ? 0.3980 0.1655 0.1430 0.0607  -0.0490 -0.0152 341 VAL A O      
2247 C  CB     . VAL A 304 ? 0.4143 0.1951 0.1568 0.0671  -0.0642 -0.0238 341 VAL A CB     
2248 C  CG1    . VAL A 304 ? 0.4436 0.1995 0.1535 0.0823  -0.0741 -0.0242 341 VAL A CG1    
2249 C  CG2    . VAL A 304 ? 0.4104 0.2010 0.1590 0.0623  -0.0674 -0.0276 341 VAL A CG2    
2250 N  N      . ILE A 305 ? 0.4277 0.1457 0.1217 0.0554  -0.0397 -0.0077 342 ILE A N      
2251 C  CA     . ILE A 305 ? 0.4455 0.1397 0.1206 0.0540  -0.0370 -0.0035 342 ILE A CA     
2252 C  C      . ILE A 305 ? 0.5066 0.1935 0.1724 0.0716  -0.0508 -0.0072 342 ILE A C      
2253 O  O      . ILE A 305 ? 0.4822 0.1737 0.1574 0.0724  -0.0508 -0.0075 342 ILE A O      
2254 C  CB     . ILE A 305 ? 0.5176 0.1741 0.1535 0.0455  -0.0282 0.0030  342 ILE A CB     
2255 C  CG1    . ILE A 305 ? 0.5010 0.1746 0.1520 0.0285  -0.0128 0.0058  342 ILE A CG1    
2256 C  CG2    . ILE A 305 ? 0.5360 0.1597 0.1446 0.0430  -0.0276 0.0071  342 ILE A CG2    
2257 C  CD1    . ILE A 305 ? 0.5316 0.1783 0.1477 0.0198  -0.0029 0.0110  342 ILE A CD1    
2258 N  N      . ASP A 306 ? 0.4922 0.1699 0.1398 0.0870  -0.0628 -0.0107 343 ASP A N      
2259 C  CA     . ASP A 306 ? 0.5053 0.1792 0.1424 0.1080  -0.0774 -0.0154 343 ASP A CA     
2260 C  C      . ASP A 306 ? 0.5227 0.2472 0.2040 0.1134  -0.0836 -0.0227 343 ASP A C      
2261 O  O      . ASP A 306 ? 0.5141 0.2675 0.2168 0.1121  -0.0879 -0.0271 343 ASP A O      
2262 C  CB     . ASP A 306 ? 0.5557 0.2049 0.1577 0.1233  -0.0892 -0.0171 343 ASP A CB     
2263 C  CG     . ASP A 306 ? 0.6779 0.3136 0.2573 0.1489  -0.1050 -0.0215 343 ASP A CG     
2264 O  OD1    . ASP A 306 ? 0.6844 0.3316 0.2762 0.1559  -0.1067 -0.0238 343 ASP A OD1    
2265 O  OD2    . ASP A 306 ? 0.7982 0.4108 0.3454 0.1636  -0.1160 -0.0230 343 ASP A OD2    
2266 N  N      . PRO A 307 ? 0.4651 0.1999 0.1581 0.1189  -0.0841 -0.0243 344 PRO A N      
2267 C  CA     . PRO A 307 ? 0.4178 0.2033 0.1522 0.1225  -0.0883 -0.0312 344 PRO A CA     
2268 C  C      . PRO A 307 ? 0.4800 0.2900 0.2189 0.1407  -0.1038 -0.0394 344 PRO A C      
2269 O  O      . PRO A 307 ? 0.4445 0.3011 0.2192 0.1378  -0.1065 -0.0451 344 PRO A O      
2270 C  CB     . PRO A 307 ? 0.4301 0.2132 0.1663 0.1270  -0.0854 -0.0309 344 PRO A CB     
2271 C  CG     . PRO A 307 ? 0.5263 0.2539 0.2162 0.1308  -0.0845 -0.0254 344 PRO A CG     
2272 C  CD     . PRO A 307 ? 0.4939 0.1938 0.1614 0.1197  -0.0800 -0.0200 344 PRO A CD     
2273 N  N      . ALA A 308 ? 0.4753 0.2542 0.1766 0.1588  -0.1143 -0.0401 345 ALA A N      
2274 C  CA     . ALA A 308 ? 0.4942 0.2956 0.1962 0.1785  -0.1310 -0.0484 345 ALA A CA     
2275 C  C      . ALA A 308 ? 0.5429 0.3669 0.2623 0.1660  -0.1332 -0.0506 345 ALA A C      
2276 O  O      . ALA A 308 ? 0.5645 0.4260 0.3015 0.1746  -0.1456 -0.0587 345 ALA A O      
2277 C  CB     . ALA A 308 ? 0.5545 0.3075 0.2044 0.2010  -0.1417 -0.0476 345 ALA A CB     
2278 N  N      . LYS A 309 ? 0.4783 0.2797 0.1910 0.1462  -0.1216 -0.0439 346 LYS A N      
2279 C  CA     . LYS A 309 ? 0.4628 0.2740 0.1833 0.1342  -0.1225 -0.0452 346 LYS A CA     
2280 C  C      . LYS A 309 ? 0.4451 0.2807 0.1995 0.1117  -0.1108 -0.0439 346 LYS A C      
2281 O  O      . LYS A 309 ? 0.4094 0.2491 0.1681 0.1010  -0.1108 -0.0450 346 LYS A O      
2282 C  CB     . LYS A 309 ? 0.5427 0.3055 0.2218 0.1330  -0.1191 -0.0393 346 LYS A CB     
2283 C  CG     . LYS A 309 ? 0.7158 0.4500 0.3552 0.1548  -0.1329 -0.0410 346 LYS A CG     
2284 C  CD     . LYS A 309 ? 0.8609 0.5504 0.4601 0.1506  -0.1287 -0.0355 346 LYS A CD     
2285 C  CE     . LYS A 309 ? 1.0287 0.6686 0.5895 0.1491  -0.1185 -0.0268 346 LYS A CE     
2286 N  NZ     . LYS A 309 ? 1.0073 0.6186 0.5331 0.1720  -0.1312 -0.0279 346 LYS A NZ     
2287 N  N      . ARG A 310 ? 0.3789 0.2262 0.1532 0.1055  -0.1016 -0.0417 347 ARG A N      
2288 C  CA     . ARG A 310 ? 0.3377 0.2045 0.1409 0.0863  -0.0909 -0.0401 347 ARG A CA     
2289 C  C      . ARG A 310 ? 0.3600 0.2733 0.1966 0.0829  -0.0972 -0.0471 347 ARG A C      
2290 O  O      . ARG A 310 ? 0.3671 0.3036 0.2136 0.0949  -0.1038 -0.0517 347 ARG A O      
2291 C  CB     . ARG A 310 ? 0.3154 0.1716 0.1212 0.0818  -0.0790 -0.0345 347 ARG A CB     
2292 C  CG     . ARG A 310 ? 0.2841 0.1503 0.1112 0.0636  -0.0672 -0.0315 347 ARG A CG     
2293 C  CD     . ARG A 310 ? 0.3508 0.2115 0.1819 0.0608  -0.0584 -0.0275 347 ARG A CD     
2294 N  NE     . ARG A 310 ? 0.3063 0.1306 0.1072 0.0638  -0.0545 -0.0222 347 ARG A NE     
2295 C  CZ     . ARG A 310 ? 0.4426 0.2517 0.2331 0.0668  -0.0522 -0.0197 347 ARG A CZ     
2296 N  NH1    . ARG A 310 ? 0.3192 0.1479 0.1282 0.0695  -0.0529 -0.0222 347 ARG A NH1    
2297 N  NH2    . ARG A 310 ? 0.3474 0.1199 0.1061 0.0661  -0.0488 -0.0148 347 ARG A NH2    
2298 N  N      . ILE A 311 ? 0.2863 0.2125 0.1386 0.0661  -0.0942 -0.0479 348 ILE A N      
2299 C  CA     . ILE A 311 ? 0.2697 0.2374 0.1513 0.0566  -0.0984 -0.0538 348 ILE A CA     
2300 C  C      . ILE A 311 ? 0.2948 0.2873 0.1993 0.0561  -0.0923 -0.0538 348 ILE A C      
2301 O  O      . ILE A 311 ? 0.2768 0.2504 0.1772 0.0555  -0.0822 -0.0481 348 ILE A O      
2302 C  CB     . ILE A 311 ? 0.3078 0.2699 0.1919 0.0370  -0.0949 -0.0531 348 ILE A CB     
2303 C  CG1    . ILE A 311 ? 0.3232 0.3225 0.2279 0.0250  -0.1033 -0.0602 348 ILE A CG1    
2304 C  CG2    . ILE A 311 ? 0.2876 0.2347 0.1754 0.0266  -0.0807 -0.0468 348 ILE A CG2    
2305 C  CD1    . ILE A 311 ? 0.4380 0.4263 0.3384 0.0049  -0.1028 -0.0606 348 ILE A CD1    
2306 N  N      . SER A 312 ? 0.2259 0.2623 0.1539 0.0559  -0.0984 -0.0606 349 SER A N      
2307 C  CA     . SER A 312 ? 0.2093 0.2733 0.1585 0.0559  -0.0927 -0.0616 349 SER A CA     
2308 C  C      . SER A 312 ? 0.2612 0.3326 0.2263 0.0322  -0.0831 -0.0591 349 SER A C      
2309 O  O      . SER A 312 ? 0.2568 0.3142 0.2162 0.0174  -0.0830 -0.0578 349 SER A O      
2310 C  CB     . SER A 312 ? 0.2304 0.3436 0.1983 0.0662  -0.1026 -0.0707 349 SER A CB     
2311 O  OG     . SER A 312 ? 0.2921 0.4347 0.2750 0.0499  -0.1087 -0.0758 349 SER A OG     
2312 N  N      . VAL A 313 ? 0.2045 0.2948 0.1857 0.0296  -0.0756 -0.0587 350 VAL A N      
2313 C  CA     . VAL A 313 ? 0.1805 0.2780 0.1743 0.0079  -0.0670 -0.0565 350 VAL A CA     
2314 C  C      . VAL A 313 ? 0.2039 0.3343 0.2119 -0.0089 -0.0727 -0.0623 350 VAL A C      
2315 O  O      . VAL A 313 ? 0.1958 0.3104 0.1979 -0.0281 -0.0707 -0.0602 350 VAL A O      
2316 C  CB     . VAL A 313 ? 0.2162 0.3256 0.2210 0.0100  -0.0580 -0.0550 350 VAL A CB     
2317 C  CG1    . VAL A 313 ? 0.2060 0.3291 0.2233 -0.0126 -0.0507 -0.0540 350 VAL A CG1    
2318 C  CG2    . VAL A 313 ? 0.2121 0.2826 0.2002 0.0191  -0.0521 -0.0485 350 VAL A CG2    
2319 N  N      . ASP A 314 ? 0.1498 0.3243 0.1736 -0.0010 -0.0809 -0.0700 351 ASP A N      
2320 C  CA     . ASP A 314 ? 0.1560 0.3709 0.1961 -0.0177 -0.0876 -0.0769 351 ASP A CA     
2321 C  C      . ASP A 314 ? 0.1869 0.3791 0.2113 -0.0276 -0.0963 -0.0775 351 ASP A C      
2322 O  O      . ASP A 314 ? 0.1682 0.3673 0.1953 -0.0522 -0.0971 -0.0790 351 ASP A O      
2323 C  CB     . ASP A 314 ? 0.1739 0.4452 0.2350 -0.0024 -0.0957 -0.0861 351 ASP A CB     
2324 C  CG     . ASP A 314 ? 0.2814 0.5885 0.3624 0.0014  -0.0869 -0.0877 351 ASP A CG     
2325 O  OD1    . ASP A 314 ? 0.2768 0.5717 0.3587 -0.0149 -0.0749 -0.0824 351 ASP A OD1    
2326 O  OD2    . ASP A 314 ? 0.3647 0.7118 0.4588 0.0219  -0.0922 -0.0948 351 ASP A OD2    
2327 N  N      . ASP A 315 ? 0.1700 0.3321 0.1742 -0.0094 -0.1026 -0.0762 352 ASP A N      
2328 C  CA     . ASP A 315 ? 0.1892 0.3262 0.1747 -0.0161 -0.1106 -0.0769 352 ASP A CA     
2329 C  C      . ASP A 315 ? 0.2338 0.3245 0.2007 -0.0305 -0.1019 -0.0699 352 ASP A C      
2330 O  O      . ASP A 315 ? 0.2326 0.3123 0.1901 -0.0477 -0.1059 -0.0715 352 ASP A O      
2331 C  CB     . ASP A 315 ? 0.2306 0.3521 0.1985 0.0082  -0.1202 -0.0782 352 ASP A CB     
2332 C  CG     . ASP A 315 ? 0.3363 0.5059 0.3202 0.0230  -0.1326 -0.0871 352 ASP A CG     
2333 O  OD1    . ASP A 315 ? 0.3129 0.5326 0.3227 0.0093  -0.1361 -0.0936 352 ASP A OD1    
2334 O  OD2    . ASP A 315 ? 0.3966 0.5541 0.3657 0.0478  -0.1392 -0.0877 352 ASP A OD2    
2335 N  N      . ALA A 316 ? 0.1873 0.2538 0.1494 -0.0246 -0.0903 -0.0630 353 ALA A N      
2336 C  CA     . ALA A 316 ? 0.2026 0.2307 0.1495 -0.0356 -0.0818 -0.0571 353 ALA A CA     
2337 C  C      . ALA A 316 ? 0.2623 0.2993 0.2154 -0.0603 -0.0797 -0.0581 353 ALA A C      
2338 O  O      . ALA A 316 ? 0.2729 0.2789 0.2072 -0.0717 -0.0796 -0.0566 353 ALA A O      
2339 C  CB     . ALA A 316 ? 0.1942 0.2060 0.1403 -0.0255 -0.0708 -0.0507 353 ALA A CB     
2340 N  N      . LEU A 317 ? 0.2061 0.2837 0.1824 -0.0684 -0.0780 -0.0610 354 LEU A N      
2341 C  CA     . LEU A 317 ? 0.2027 0.2915 0.1840 -0.0945 -0.0752 -0.0618 354 LEU A CA     
2342 C  C      . LEU A 317 ? 0.2879 0.3850 0.2644 -0.1131 -0.0855 -0.0675 354 LEU A C      
2343 O  O      . LEU A 317 ? 0.3116 0.3978 0.2788 -0.1377 -0.0839 -0.0670 354 LEU A O      
2344 C  CB     . LEU A 317 ? 0.1839 0.3183 0.1917 -0.0969 -0.0692 -0.0636 354 LEU A CB     
2345 C  CG     . LEU A 317 ? 0.2052 0.3251 0.2132 -0.0885 -0.0575 -0.0574 354 LEU A CG     
2346 C  CD1    . LEU A 317 ? 0.1866 0.3529 0.2192 -0.0808 -0.0538 -0.0606 354 LEU A CD1    
2347 C  CD2    . LEU A 317 ? 0.2181 0.3066 0.2106 -0.1082 -0.0503 -0.0522 354 LEU A CD2    
2348 N  N      . GLN A 318 ? 0.2539 0.3676 0.2334 -0.1021 -0.0969 -0.0730 355 GLN A N      
2349 C  CA     . GLN A 318 ? 0.2670 0.3916 0.2422 -0.1175 -0.1094 -0.0795 355 GLN A CA     
2350 C  C      . GLN A 318 ? 0.3291 0.3994 0.2707 -0.1141 -0.1143 -0.0776 355 GLN A C      
2351 O  O      . GLN A 318 ? 0.3349 0.4015 0.2651 -0.1275 -0.1248 -0.0824 355 GLN A O      
2352 C  CB     . GLN A 318 ? 0.2847 0.4609 0.2817 -0.1040 -0.1204 -0.0875 355 GLN A CB     
2353 C  CG     . GLN A 318 ? 0.4948 0.7348 0.5265 -0.1080 -0.1174 -0.0920 355 GLN A CG     
2354 C  CD     . GLN A 318 ? 0.8037 1.0772 0.8466 -0.1416 -0.1204 -0.0973 355 GLN A CD     
2355 O  OE1    . GLN A 318 ? 0.8027 1.0597 0.8384 -0.1663 -0.1115 -0.0933 355 GLN A OE1    
2356 N  NE2    . GLN A 318 ? 0.7275 1.0484 0.7865 -0.1440 -0.1334 -0.1065 355 GLN A NE2    
2357 N  N      . HIS A 319 ? 0.2790 0.3090 0.2043 -0.0960 -0.1068 -0.0710 356 HIS A N      
2358 C  CA     . HIS A 319 ? 0.2786 0.2598 0.1722 -0.0901 -0.1094 -0.0692 356 HIS A CA     
2359 C  C      . HIS A 319 ? 0.3624 0.3098 0.2331 -0.1126 -0.1091 -0.0687 356 HIS A C      
2360 O  O      . HIS A 319 ? 0.3516 0.2954 0.2254 -0.1242 -0.1009 -0.0654 356 HIS A O      
2361 C  CB     . HIS A 319 ? 0.2575 0.2112 0.1424 -0.0682 -0.0995 -0.0626 356 HIS A CB     
2362 C  CG     . HIS A 319 ? 0.3109 0.2225 0.1652 -0.0591 -0.1014 -0.0615 356 HIS A CG     
2363 N  ND1    . HIS A 319 ? 0.3410 0.2138 0.1709 -0.0668 -0.0985 -0.0599 356 HIS A ND1    
2364 C  CD2    . HIS A 319 ? 0.3267 0.2298 0.1690 -0.0431 -0.1063 -0.0625 356 HIS A CD2    
2365 C  CE1    . HIS A 319 ? 0.3437 0.1891 0.1501 -0.0545 -0.1006 -0.0602 356 HIS A CE1    
2366 N  NE2    . HIS A 319 ? 0.3434 0.2053 0.1559 -0.0415 -0.1052 -0.0615 356 HIS A NE2    
2367 N  N      . PRO A 320 ? 0.3579 0.2753 0.2011 -0.1178 -0.1182 -0.0719 357 PRO A N      
2368 C  CA     . PRO A 320 ? 0.3903 0.2680 0.2048 -0.1383 -0.1192 -0.0719 357 PRO A CA     
2369 C  C      . PRO A 320 ? 0.4559 0.2952 0.2541 -0.1339 -0.1075 -0.0652 357 PRO A C      
2370 O  O      . PRO A 320 ? 0.4826 0.3026 0.2666 -0.1535 -0.1063 -0.0644 357 PRO A O      
2371 C  CB     . PRO A 320 ? 0.4344 0.2799 0.2183 -0.1343 -0.1297 -0.0758 357 PRO A CB     
2372 C  CG     . PRO A 320 ? 0.4718 0.3562 0.2755 -0.1241 -0.1383 -0.0803 357 PRO A CG     
2373 C  CD     . PRO A 320 ? 0.3881 0.3028 0.2209 -0.1054 -0.1289 -0.0761 357 PRO A CD     
2374 N  N      . TYR A 321 ? 0.3984 0.2264 0.1967 -0.1092 -0.0994 -0.0608 358 TYR A N      
2375 C  CA     . TYR A 321 ? 0.3979 0.1960 0.1839 -0.1021 -0.0891 -0.0553 358 TYR A CA     
2376 C  C      . TYR A 321 ? 0.4199 0.2368 0.2247 -0.1138 -0.0821 -0.0521 358 TYR A C      
2377 O  O      . TYR A 321 ? 0.4077 0.1939 0.1936 -0.1187 -0.0780 -0.0492 358 TYR A O      
2378 C  CB     . TYR A 321 ? 0.3893 0.1843 0.1787 -0.0758 -0.0815 -0.0517 358 TYR A CB     
2379 C  CG     . TYR A 321 ? 0.4162 0.1791 0.1881 -0.0659 -0.0732 -0.0478 358 TYR A CG     
2380 C  CD1    . TYR A 321 ? 0.4717 0.1902 0.2070 -0.0643 -0.0762 -0.0496 358 TYR A CD1    
2381 C  CD2    . TYR A 321 ? 0.3914 0.1683 0.1818 -0.0561 -0.0633 -0.0431 358 TYR A CD2    
2382 C  CE1    . TYR A 321 ? 0.4798 0.1720 0.1988 -0.0513 -0.0695 -0.0470 358 TYR A CE1    
2383 C  CE2    . TYR A 321 ? 0.4031 0.1558 0.1793 -0.0457 -0.0569 -0.0404 358 TYR A CE2    
2384 C  CZ     . TYR A 321 ? 0.4635 0.1756 0.2049 -0.0420 -0.0600 -0.0425 358 TYR A CZ     
2385 O  OH     . TYR A 321 ? 0.3894 0.0812 0.1170 -0.0278 -0.0544 -0.0408 358 TYR A OH     
2386 N  N      . ILE A 322 ? 0.3550 0.2206 0.1937 -0.1167 -0.0812 -0.0530 359 ILE A N      
2387 C  CA     . ILE A 322 ? 0.3314 0.2234 0.1920 -0.1251 -0.0738 -0.0505 359 ILE A CA     
2388 C  C      . ILE A 322 ? 0.3926 0.3065 0.2592 -0.1538 -0.0774 -0.0540 359 ILE A C      
2389 O  O      . ILE A 322 ? 0.3759 0.2856 0.2403 -0.1682 -0.0711 -0.0511 359 ILE A O      
2390 C  CB     . ILE A 322 ? 0.3344 0.2653 0.2259 -0.1068 -0.0700 -0.0498 359 ILE A CB     
2391 C  CG1    . ILE A 322 ? 0.3363 0.2460 0.2207 -0.0826 -0.0653 -0.0459 359 ILE A CG1    
2392 C  CG2    . ILE A 322 ? 0.2957 0.2574 0.2105 -0.1128 -0.0624 -0.0481 359 ILE A CG2    
2393 C  CD1    . ILE A 322 ? 0.3782 0.2552 0.2482 -0.0780 -0.0566 -0.0405 359 ILE A CD1    
2394 N  N      . ASN A 323 ? 0.3434 0.2838 0.2184 -0.1622 -0.0874 -0.0603 360 ASN A N      
2395 C  CA     . ASN A 323 ? 0.3590 0.3345 0.2461 -0.1896 -0.0925 -0.0654 360 ASN A CA     
2396 C  C      . ASN A 323 ? 0.4396 0.3856 0.3018 -0.2203 -0.0909 -0.0640 360 ASN A C      
2397 O  O      . ASN A 323 ? 0.4365 0.4177 0.3135 -0.2452 -0.0899 -0.0665 360 ASN A O      
2398 C  CB     . ASN A 323 ? 0.4486 0.4412 0.3372 -0.1913 -0.1064 -0.0727 360 ASN A CB     
2399 C  CG     . ASN A 323 ? 0.8423 0.9022 0.7646 -0.2037 -0.1115 -0.0796 360 ASN A CG     
2400 O  OD1    . ASN A 323 ? 0.7989 0.9006 0.7486 -0.2065 -0.1038 -0.0792 360 ASN A OD1    
2401 N  ND2    . ASN A 323 ? 0.7901 0.8648 0.7115 -0.2092 -0.1251 -0.0865 360 ASN A ND2    
2402 N  N      . VAL A 324 ? 0.4382 0.3201 0.2607 -0.2189 -0.0908 -0.0604 361 VAL A N      
2403 C  CA     . VAL A 324 ? 0.4874 0.3261 0.2746 -0.2458 -0.0907 -0.0586 361 VAL A CA     
2404 C  C      . VAL A 324 ? 0.5127 0.3609 0.3078 -0.2571 -0.0793 -0.0537 361 VAL A C      
2405 O  O      . VAL A 324 ? 0.5247 0.3543 0.2984 -0.2866 -0.0788 -0.0529 361 VAL A O      
2406 C  CB     . VAL A 324 ? 0.5795 0.3440 0.3182 -0.2355 -0.0940 -0.0566 361 VAL A CB     
2407 C  CG1    . VAL A 324 ? 0.5827 0.3375 0.3116 -0.2237 -0.1044 -0.0616 361 VAL A CG1    
2408 C  CG2    . VAL A 324 ? 0.5608 0.3019 0.2951 -0.2083 -0.0846 -0.0504 361 VAL A CG2    
2409 N  N      . TRP A 325 ? 0.4453 0.3190 0.2676 -0.2345 -0.0706 -0.0504 362 TRP A N      
2410 C  CA     . TRP A 325 ? 0.4374 0.3199 0.2673 -0.2406 -0.0596 -0.0457 362 TRP A CA     
2411 C  C      . TRP A 325 ? 0.4573 0.4093 0.3280 -0.2510 -0.0553 -0.0488 362 TRP A C      
2412 O  O      . TRP A 325 ? 0.4516 0.4144 0.3268 -0.2623 -0.0462 -0.0458 362 TRP A O      
2413 C  CB     . TRP A 325 ? 0.3988 0.2651 0.2312 -0.2097 -0.0530 -0.0405 362 TRP A CB     
2414 C  CG     . TRP A 325 ? 0.4334 0.2399 0.2296 -0.1954 -0.0562 -0.0382 362 TRP A CG     
2415 C  CD1    . TRP A 325 ? 0.4558 0.2526 0.2518 -0.1697 -0.0589 -0.0389 362 TRP A CD1    
2416 C  CD2    . TRP A 325 ? 0.4866 0.2342 0.2385 -0.2057 -0.0573 -0.0355 362 TRP A CD2    
2417 N  NE1    . TRP A 325 ? 0.4829 0.2240 0.2407 -0.1619 -0.0609 -0.0373 362 TRP A NE1    
2418 C  CE2    . TRP A 325 ? 0.5450 0.2526 0.2735 -0.1825 -0.0609 -0.0354 362 TRP A CE2    
2419 C  CE3    . TRP A 325 ? 0.5484 0.2709 0.2747 -0.2319 -0.0552 -0.0331 362 TRP A CE3    
2420 C  CZ2    . TRP A 325 ? 0.5908 0.2346 0.2712 -0.1820 -0.0639 -0.0338 362 TRP A CZ2    
2421 C  CZ3    . TRP A 325 ? 0.6179 0.2714 0.2930 -0.2332 -0.0587 -0.0308 362 TRP A CZ3    
2422 C  CH2    . TRP A 325 ? 0.6341 0.2491 0.2868 -0.2070 -0.0635 -0.0316 362 TRP A CH2    
2423 N  N      . TYR A 326 ? 0.3980 0.3972 0.2970 -0.2446 -0.0620 -0.0551 363 TYR A N      
2424 C  CA     . TYR A 326 ? 0.3645 0.4360 0.3047 -0.2467 -0.0596 -0.0597 363 TYR A CA     
2425 C  C      . TYR A 326 ? 0.4384 0.5355 0.3835 -0.2788 -0.0525 -0.0600 363 TYR A C      
2426 O  O      . TYR A 326 ? 0.4629 0.5531 0.3922 -0.3100 -0.0568 -0.0623 363 TYR A O      
2427 C  CB     . TYR A 326 ? 0.3593 0.4710 0.3194 -0.2416 -0.0714 -0.0678 363 TYR A CB     
2428 C  CG     . TYR A 326 ? 0.3398 0.5219 0.3419 -0.2272 -0.0696 -0.0725 363 TYR A CG     
2429 C  CD1    . TYR A 326 ? 0.3543 0.5950 0.3811 -0.2485 -0.0660 -0.0772 363 TYR A CD1    
2430 C  CD2    . TYR A 326 ? 0.3256 0.5141 0.3399 -0.1920 -0.0709 -0.0725 363 TYR A CD2    
2431 C  CE1    . TYR A 326 ? 0.3379 0.6436 0.4015 -0.2315 -0.0641 -0.0823 363 TYR A CE1    
2432 C  CE2    . TYR A 326 ? 0.3079 0.5542 0.3547 -0.1758 -0.0700 -0.0771 363 TYR A CE2    
2433 C  CZ     . TYR A 326 ? 0.4046 0.7105 0.4766 -0.1938 -0.0668 -0.0823 363 TYR A CZ     
2434 O  OH     . TYR A 326 ? 0.4018 0.7660 0.5045 -0.1741 -0.0663 -0.0879 363 TYR A OH     
2435 N  N      . ASP A 327 ? 0.4011 0.5261 0.3657 -0.2719 -0.0413 -0.0577 364 ASP A N      
2436 C  CA     . ASP A 327 ? 0.4211 0.5773 0.3932 -0.2998 -0.0317 -0.0578 364 ASP A CA     
2437 C  C      . ASP A 327 ? 0.4620 0.6904 0.4776 -0.2830 -0.0261 -0.0622 364 ASP A C      
2438 O  O      . ASP A 327 ? 0.4366 0.6601 0.4595 -0.2540 -0.0216 -0.0593 364 ASP A O      
2439 C  CB     . ASP A 327 ? 0.4658 0.5665 0.4048 -0.3083 -0.0224 -0.0492 364 ASP A CB     
2440 C  CG     . ASP A 327 ? 0.5500 0.6686 0.4858 -0.3402 -0.0112 -0.0475 364 ASP A CG     
2441 O  OD1    . ASP A 327 ? 0.5211 0.7083 0.4887 -0.3541 -0.0079 -0.0534 364 ASP A OD1    
2442 O  OD2    . ASP A 327 ? 0.6006 0.6662 0.5018 -0.3496 -0.0055 -0.0405 364 ASP A OD2    
2443 N  N      . PRO A 328 ? 0.4271 0.7236 0.4709 -0.3001 -0.0272 -0.0700 365 PRO A N      
2444 C  CA     . PRO A 328 ? 0.3933 0.7616 0.4774 -0.2809 -0.0227 -0.0756 365 PRO A CA     
2445 C  C      . PRO A 328 ? 0.4182 0.7900 0.5049 -0.2740 -0.0077 -0.0711 365 PRO A C      
2446 O  O      . PRO A 328 ? 0.3778 0.7818 0.4867 -0.2449 -0.0053 -0.0737 365 PRO A O      
2447 C  CB     . PRO A 328 ? 0.4248 0.8631 0.5336 -0.3089 -0.0252 -0.0845 365 PRO A CB     
2448 C  CG     . PRO A 328 ? 0.5092 0.9115 0.5943 -0.3317 -0.0368 -0.0849 365 PRO A CG     
2449 C  CD     . PRO A 328 ? 0.4785 0.7917 0.5184 -0.3373 -0.0332 -0.0747 365 PRO A CD     
2450 N  N      . ALA A 329 ? 0.3999 0.7340 0.4600 -0.2997 0.0015  -0.0643 366 ALA A N      
2451 C  CA     . ALA A 329 ? 0.3969 0.7274 0.4537 -0.2957 0.0154  -0.0595 366 ALA A CA     
2452 C  C      . ALA A 329 ? 0.4352 0.7210 0.4819 -0.2595 0.0146  -0.0542 366 ALA A C      
2453 O  O      . ALA A 329 ? 0.4196 0.7202 0.4759 -0.2430 0.0229  -0.0533 366 ALA A O      
2454 C  CB     . ALA A 329 ? 0.4443 0.7355 0.4674 -0.3322 0.0234  -0.0531 366 ALA A CB     
2455 N  N      . GLU A 330 ? 0.3834 0.6173 0.4111 -0.2478 0.0047  -0.0513 367 GLU A N      
2456 C  CA     . GLU A 330 ? 0.3578 0.5497 0.3753 -0.2172 0.0032  -0.0465 367 GLU A CA     
2457 C  C      . GLU A 330 ? 0.3675 0.5851 0.4078 -0.1859 -0.0037 -0.0511 367 GLU A C      
2458 O  O      . GLU A 330 ? 0.3322 0.5419 0.3753 -0.1615 -0.0010 -0.0491 367 GLU A O      
2459 C  CB     . GLU A 330 ? 0.3944 0.5170 0.3766 -0.2212 -0.0024 -0.0409 367 GLU A CB     
2460 C  CG     . GLU A 330 ? 0.5345 0.6214 0.4855 -0.2514 0.0023  -0.0364 367 GLU A CG     
2461 C  CD     . GLU A 330 ? 0.7434 0.7627 0.6553 -0.2567 -0.0046 -0.0325 367 GLU A CD     
2462 O  OE1    . GLU A 330 ? 0.6252 0.6360 0.5353 -0.2515 -0.0144 -0.0355 367 GLU A OE1    
2463 O  OE2    . GLU A 330 ? 0.6251 0.5988 0.5051 -0.2664 -0.0005 -0.0268 367 GLU A OE2    
2464 N  N      . VAL A 331 ? 0.3355 0.5816 0.3891 -0.1874 -0.0131 -0.0575 368 VAL A N      
2465 C  CA     . VAL A 331 ? 0.3159 0.5823 0.3857 -0.1586 -0.0216 -0.0622 368 VAL A CA     
2466 C  C      . VAL A 331 ? 0.3696 0.7012 0.4698 -0.1451 -0.0188 -0.0690 368 VAL A C      
2467 O  O      . VAL A 331 ? 0.3491 0.6848 0.4554 -0.1149 -0.0216 -0.0706 368 VAL A O      
2468 C  CB     . VAL A 331 ? 0.3765 0.6402 0.4426 -0.1651 -0.0343 -0.0661 368 VAL A CB     
2469 C  CG1    . VAL A 331 ? 0.3595 0.6430 0.4387 -0.1355 -0.0439 -0.0711 368 VAL A CG1    
2470 C  CG2    . VAL A 331 ? 0.3870 0.5840 0.4199 -0.1737 -0.0371 -0.0600 368 VAL A CG2    
2471 N  N      . GLU A 332 ? 0.3504 0.7325 0.4676 -0.1674 -0.0136 -0.0735 369 GLU A N      
2472 C  CA     . GLU A 332 ? 0.3499 0.8030 0.4978 -0.1554 -0.0108 -0.0816 369 GLU A CA     
2473 C  C      . GLU A 332 ? 0.4305 0.9004 0.5816 -0.1644 0.0047  -0.0796 369 GLU A C      
2474 O  O      . GLU A 332 ? 0.4269 0.9620 0.6019 -0.1726 0.0104  -0.0862 369 GLU A O      
2475 C  CB     . GLU A 332 ? 0.3727 0.8869 0.5437 -0.1717 -0.0181 -0.0909 369 GLU A CB     
2476 C  CG     . GLU A 332 ? 0.4973 0.9986 0.6646 -0.1628 -0.0344 -0.0939 369 GLU A CG     
2477 C  CD     . GLU A 332 ? 0.7777 1.3111 0.9534 -0.1942 -0.0415 -0.0995 369 GLU A CD     
2478 O  OE1    . GLU A 332 ? 0.7074 1.3121 0.9107 -0.2082 -0.0383 -0.1069 369 GLU A OE1    
2479 O  OE2    . GLU A 332 ? 0.7060 1.1945 0.8601 -0.2053 -0.0502 -0.0969 369 GLU A OE2    
2480 N  N      . ALA A 333 ? 0.4162 0.8298 0.5433 -0.1619 0.0115  -0.0709 370 ALA A N      
2481 C  CA     . ALA A 333 ? 0.4281 0.8451 0.5513 -0.1683 0.0257  -0.0677 370 ALA A CA     
2482 C  C      . ALA A 333 ? 0.5010 0.9636 0.6446 -0.1394 0.0295  -0.0738 370 ALA A C      
2483 O  O      . ALA A 333 ? 0.4813 0.9508 0.6329 -0.1101 0.0202  -0.0780 370 ALA A O      
2484 C  CB     . ALA A 333 ? 0.4394 0.7839 0.5317 -0.1662 0.0283  -0.0578 370 ALA A CB     
2485 N  N      . PRO A 334 ? 0.4901 0.9994 0.6460 -0.1513 0.0419  -0.0768 371 PRO A N      
2486 C  CA     . PRO A 334 ? 0.4879 1.0374 0.6586 -0.1232 0.0474  -0.0827 371 PRO A CA     
2487 C  C      . PRO A 334 ? 0.5539 1.0536 0.7075 -0.0890 0.0429  -0.0792 371 PRO A C      
2488 O  O      . PRO A 334 ? 0.5540 0.9948 0.6831 -0.0938 0.0456  -0.0706 371 PRO A O      
2489 C  CB     . PRO A 334 ? 0.5210 1.0914 0.6899 -0.1458 0.0643  -0.0810 371 PRO A CB     
2490 N  N      . PRO A 335 ? 0.5143 1.0334 0.6779 -0.0553 0.0343  -0.0860 372 PRO A N      
2491 C  CA     . PRO A 335 ? 0.5091 0.9765 0.6524 -0.0261 0.0291  -0.0826 372 PRO A CA     
2492 C  C      . PRO A 335 ? 0.5789 1.0351 0.7105 -0.0138 0.0391  -0.0812 372 PRO A C      
2493 O  O      . PRO A 335 ? 0.5820 1.0870 0.7264 -0.0135 0.0486  -0.0867 372 PRO A O      
2494 C  CB     . PRO A 335 ? 0.5309 1.0227 0.6841 0.0039  0.0170  -0.0907 372 PRO A CB     
2495 C  CG     . PRO A 335 ? 0.5916 1.1631 0.7746 -0.0004 0.0191  -0.1005 372 PRO A CG     
2496 C  CD     . PRO A 335 ? 0.5365 1.1240 0.7276 -0.0425 0.0281  -0.0971 372 PRO A CD     
2497 N  N      . PRO A 336 ? 0.5499 0.9438 0.6568 -0.0034 0.0367  -0.0745 373 PRO A N      
2498 C  CA     . PRO A 336 ? 0.6082 0.9853 0.7003 0.0081  0.0445  -0.0732 373 PRO A CA     
2499 C  C      . PRO A 336 ? 0.9711 1.3836 1.0682 0.0391  0.0452  -0.0824 373 PRO A C      
2500 O  O      . PRO A 336 ? 0.5032 0.8936 0.5886 0.0665  0.0361  -0.0847 373 PRO A O      
2501 C  CB     . PRO A 336 ? 0.6228 0.9313 0.6906 0.0147  0.0379  -0.0658 373 PRO A CB     
2502 C  CG     . PRO A 336 ? 0.6556 0.9445 0.7248 -0.0029 0.0316  -0.0611 373 PRO A CG     
2503 C  CD     . PRO A 336 ? 0.5830 0.9208 0.6742 -0.0035 0.0272  -0.0680 373 PRO A CD     
2504 N  N      . HIS A 348 ? 0.9463 0.3551 0.3920 0.1170  -0.0658 -0.0581 385 HIS A N      
2505 C  CA     . HIS A 348 ? 0.9571 0.3535 0.3865 0.1185  -0.0667 -0.0621 385 HIS A CA     
2506 C  C      . HIS A 348 ? 0.9979 0.3654 0.4142 0.0844  -0.0723 -0.0582 385 HIS A C      
2507 O  O      . HIS A 348 ? 0.9646 0.3429 0.4016 0.0577  -0.0723 -0.0520 385 HIS A O      
2508 C  CB     . HIS A 348 ? 0.9138 0.3764 0.3920 0.1249  -0.0565 -0.0634 385 HIS A CB     
2509 C  CG     . HIS A 348 ? 0.9511 0.4497 0.4439 0.1568  -0.0502 -0.0686 385 HIS A CG     
2510 N  ND1    . HIS A 348 ? 1.0161 0.4961 0.4751 0.1882  -0.0512 -0.0769 385 HIS A ND1    
2511 C  CD2    . HIS A 348 ? 0.9316 0.4861 0.4696 0.1609  -0.0431 -0.0672 385 HIS A CD2    
2512 C  CE1    . HIS A 348 ? 0.9878 0.5180 0.4755 0.2101  -0.0444 -0.0804 385 HIS A CE1    
2513 N  NE2    . HIS A 348 ? 0.9411 0.5164 0.4764 0.1934  -0.0397 -0.0746 385 HIS A NE2    
2514 N  N      . THR A 349 ? 1.0008 0.3358 0.3845 0.0855  -0.0771 -0.0624 386 THR A N      
2515 C  CA     . THR A 349 ? 1.0142 0.3269 0.3868 0.0533  -0.0835 -0.0600 386 THR A CA     
2516 C  C      . THR A 349 ? 0.9838 0.3609 0.4135 0.0395  -0.0770 -0.0571 386 THR A C      
2517 O  O      . THR A 349 ? 0.9391 0.3661 0.4064 0.0554  -0.0678 -0.0573 386 THR A O      
2518 C  CB     . THR A 349 ? 1.1642 0.4180 0.4789 0.0618  -0.0917 -0.0663 386 THR A CB     
2519 O  OG1    . THR A 349 ? 1.1249 0.4037 0.4475 0.0898  -0.0857 -0.0719 386 THR A OG1    
2520 C  CG2    . THR A 349 ? 1.2272 0.4039 0.4749 0.0722  -0.1006 -0.0690 386 THR A CG2    
2521 N  N      . ILE A 350 ? 0.9140 0.2889 0.3473 0.0103  -0.0824 -0.0549 387 ILE A N      
2522 C  CA     . ILE A 350 ? 0.8457 0.2739 0.3254 -0.0016 -0.0788 -0.0527 387 ILE A CA     
2523 C  C      . ILE A 350 ? 0.8144 0.2566 0.2946 0.0219  -0.0739 -0.0571 387 ILE A C      
2524 O  O      . ILE A 350 ? 0.7261 0.2185 0.2468 0.0290  -0.0649 -0.0553 387 ILE A O      
2525 C  CB     . ILE A 350 ? 0.9013 0.3181 0.3751 -0.0337 -0.0883 -0.0516 387 ILE A CB     
2526 C  CG1    . ILE A 350 ? 0.8867 0.3075 0.3722 -0.0600 -0.0899 -0.0465 387 ILE A CG1    
2527 C  CG2    . ILE A 350 ? 0.8815 0.3431 0.3905 -0.0391 -0.0874 -0.0512 387 ILE A CG2    
2528 C  CD1    . ILE A 350 ? 0.9855 0.3867 0.4544 -0.0917 -0.1001 -0.0468 387 ILE A CD1    
2529 N  N      . GLU A 351 ? 0.7932 0.1878 0.2245 0.0336  -0.0794 -0.0629 388 GLU A N      
2530 C  CA     . GLU A 351 ? 0.7921 0.1917 0.2137 0.0559  -0.0750 -0.0680 388 GLU A CA     
2531 C  C      . GLU A 351 ? 0.8082 0.2443 0.2508 0.0844  -0.0626 -0.0697 388 GLU A C      
2532 O  O      . GLU A 351 ? 0.7803 0.2559 0.2479 0.0911  -0.0541 -0.0699 388 GLU A O      
2533 C  CB     . GLU A 351 ? 0.8788 0.2127 0.2369 0.0638  -0.0843 -0.0745 388 GLU A CB     
2534 N  N      . GLU A 352 ? 0.7773 0.2013 0.2089 0.1003  -0.0619 -0.0710 389 GLU A N      
2535 C  CA     . GLU A 352 ? 0.7518 0.2165 0.2065 0.1268  -0.0514 -0.0733 389 GLU A CA     
2536 C  C      . GLU A 352 ? 0.7334 0.2627 0.2490 0.1140  -0.0425 -0.0673 389 GLU A C      
2537 O  O      . GLU A 352 ? 0.7121 0.2853 0.2533 0.1252  -0.0323 -0.0686 389 GLU A O      
2538 C  CB     . GLU A 352 ? 0.7996 0.2348 0.2276 0.1456  -0.0554 -0.0760 389 GLU A CB     
2539 C  CG     . GLU A 352 ? 0.9535 0.3232 0.3160 0.1663  -0.0635 -0.0833 389 GLU A CG     
2540 C  CD     . GLU A 352 ? 1.1666 0.4856 0.4895 0.1759  -0.0719 -0.0841 389 GLU A CD     
2541 O  OE1    . GLU A 352 ? 1.0020 0.3301 0.3455 0.1596  -0.0727 -0.0780 389 GLU A OE1    
2542 O  OE2    . GLU A 352 ? 1.2529 0.5194 0.5203 0.2003  -0.0781 -0.0910 389 GLU A OE2    
2543 N  N      . TRP A 353 ? 0.6508 0.1847 0.1871 0.0897  -0.0461 -0.0609 390 TRP A N      
2544 C  CA     . TRP A 353 ? 0.5857 0.1732 0.1745 0.0765  -0.0392 -0.0552 390 TRP A CA     
2545 C  C      . TRP A 353 ? 0.6319 0.2461 0.2402 0.0680  -0.0352 -0.0539 390 TRP A C      
2546 O  O      . TRP A 353 ? 0.5940 0.2516 0.2346 0.0711  -0.0261 -0.0523 390 TRP A O      
2547 C  CB     . TRP A 353 ? 0.5546 0.1365 0.1546 0.0527  -0.0445 -0.0495 390 TRP A CB     
2548 C  CG     . TRP A 353 ? 0.5798 0.1506 0.1741 0.0589  -0.0454 -0.0487 390 TRP A CG     
2549 C  CD1    . TRP A 353 ? 0.6446 0.1735 0.2110 0.0475  -0.0529 -0.0471 390 TRP A CD1    
2550 C  CD2    . TRP A 353 ? 0.5525 0.1572 0.1718 0.0741  -0.0388 -0.0488 390 TRP A CD2    
2551 N  NE1    . TRP A 353 ? 0.6233 0.1554 0.1939 0.0561  -0.0513 -0.0458 390 TRP A NE1    
2552 C  CE2    . TRP A 353 ? 0.6057 0.1846 0.2089 0.0735  -0.0434 -0.0472 390 TRP A CE2    
2553 C  CE3    . TRP A 353 ? 0.5308 0.1855 0.1836 0.0861  -0.0296 -0.0500 390 TRP A CE3    
2554 C  CZ2    . TRP A 353 ? 0.5783 0.1788 0.1967 0.0879  -0.0403 -0.0475 390 TRP A CZ2    
2555 C  CZ3    . TRP A 353 ? 0.5248 0.2033 0.1943 0.0983  -0.0265 -0.0505 390 TRP A CZ3    
2556 C  CH2    . TRP A 353 ? 0.5479 0.2000 0.2010 0.1001  -0.0323 -0.0494 390 TRP A CH2    
2557 N  N      . LYS A 354 ? 0.6201 0.2055 0.2049 0.0573  -0.0425 -0.0548 391 LYS A N      
2558 C  CA     . LYS A 354 ? 0.6063 0.2089 0.2011 0.0509  -0.0407 -0.0539 391 LYS A CA     
2559 C  C      . LYS A 354 ? 0.6601 0.2833 0.2555 0.0717  -0.0298 -0.0573 391 LYS A C      
2560 O  O      . LYS A 354 ? 0.6110 0.2704 0.2337 0.0680  -0.0221 -0.0543 391 LYS A O      
2561 C  CB     . LYS A 354 ? 0.6693 0.2315 0.2299 0.0405  -0.0519 -0.0563 391 LYS A CB     
2562 C  CG     . LYS A 354 ? 0.6805 0.2597 0.2519 0.0318  -0.0526 -0.0548 391 LYS A CG     
2563 C  CD     . LYS A 354 ? 0.7778 0.3190 0.3155 0.0213  -0.0652 -0.0578 391 LYS A CD     
2564 C  CE     . LYS A 354 ? 0.8703 0.4327 0.4236 0.0116  -0.0676 -0.0556 391 LYS A CE     
2565 N  NZ     . LYS A 354 ? 0.9890 0.5178 0.5067 0.0074  -0.0783 -0.0598 391 LYS A NZ     
2566 N  N      . GLU A 355 ? 0.6508 0.2510 0.2144 0.0936  -0.0287 -0.0636 392 GLU A N      
2567 C  CA     . GLU A 355 ? 0.6614 0.2834 0.2228 0.1151  -0.0176 -0.0681 392 GLU A CA     
2568 C  C      . GLU A 355 ? 0.6846 0.3586 0.2846 0.1219  -0.0065 -0.0669 392 GLU A C      
2569 O  O      . GLU A 355 ? 0.6714 0.3820 0.2899 0.1231  0.0045  -0.0665 392 GLU A O      
2570 C  CB     . GLU A 355 ? 0.7287 0.3109 0.2427 0.1391  -0.0206 -0.0762 392 GLU A CB     
2571 C  CG     . GLU A 355 ? 0.8679 0.4631 0.3695 0.1563  -0.0109 -0.0812 392 GLU A CG     
2572 C  CD     . GLU A 355 ? 1.1514 0.7028 0.6013 0.1816  -0.0149 -0.0899 392 GLU A CD     
2573 O  OE1    . GLU A 355 ? 1.1748 0.6817 0.5880 0.1767  -0.0230 -0.0916 392 GLU A OE1    
2574 O  OE2    . GLU A 355 ? 1.0266 0.5862 0.4707 0.2072  -0.0111 -0.0954 392 GLU A OE2    
2575 N  N      . LEU A 356 ? 0.6274 0.3035 0.2379 0.1241  -0.0095 -0.0660 393 LEU A N      
2576 C  CA     . LEU A 356 ? 0.6023 0.3267 0.2494 0.1289  -0.0011 -0.0651 393 LEU A CA     
2577 C  C      . LEU A 356 ? 0.6274 0.3874 0.3130 0.1069  0.0042  -0.0583 393 LEU A C      
2578 O  O      . LEU A 356 ? 0.6076 0.4092 0.3164 0.1092  0.0147  -0.0585 393 LEU A O      
2579 C  CB     . LEU A 356 ? 0.6003 0.3137 0.2467 0.1348  -0.0072 -0.0653 393 LEU A CB     
2580 C  CG     . LEU A 356 ? 0.6999 0.3846 0.3095 0.1631  -0.0113 -0.0728 393 LEU A CG     
2581 C  CD1    . LEU A 356 ? 0.7111 0.3694 0.3106 0.1633  -0.0200 -0.0713 393 LEU A CD1    
2582 C  CD2    . LEU A 356 ? 0.7132 0.4425 0.3353 0.1884  -0.0013 -0.0795 393 LEU A CD2    
2583 N  N      . ILE A 357 ? 0.5783 0.3217 0.2683 0.0859  -0.0032 -0.0527 394 ILE A N      
2584 C  CA     . ILE A 357 ? 0.5339 0.3034 0.2546 0.0671  -0.0005 -0.0465 394 ILE A CA     
2585 C  C      . ILE A 357 ? 0.5830 0.3627 0.3004 0.0654  0.0061  -0.0463 394 ILE A C      
2586 O  O      . ILE A 357 ? 0.5572 0.3687 0.2963 0.0605  0.0148  -0.0437 394 ILE A O      
2587 C  CB     . ILE A 357 ? 0.5525 0.3046 0.2775 0.0483  -0.0106 -0.0419 394 ILE A CB     
2588 C  CG1    . ILE A 357 ? 0.5360 0.2860 0.2693 0.0476  -0.0137 -0.0409 394 ILE A CG1    
2589 C  CG2    . ILE A 357 ? 0.5269 0.3003 0.2755 0.0331  -0.0092 -0.0367 394 ILE A CG2    
2590 C  CD1    . ILE A 357 ? 0.5934 0.3194 0.3202 0.0315  -0.0234 -0.0383 394 ILE A CD1    
2591 N  N      . TYR A 358 ? 0.5647 0.3144 0.2512 0.0689  0.0018  -0.0490 395 TYR A N      
2592 C  CA     . TYR A 358 ? 0.5753 0.3273 0.2506 0.0686  0.0073  -0.0491 395 TYR A CA     
2593 C  C      . TYR A 358 ? 0.6508 0.4357 0.3327 0.0804  0.0222  -0.0518 395 TYR A C      
2594 O  O      . TYR A 358 ? 0.6345 0.4383 0.3246 0.0723  0.0303  -0.0487 395 TYR A O      
2595 C  CB     . TYR A 358 ? 0.6168 0.3278 0.2530 0.0738  -0.0004 -0.0531 395 TYR A CB     
2596 C  CG     . TYR A 358 ? 0.6415 0.3503 0.2627 0.0726  0.0038  -0.0529 395 TYR A CG     
2597 C  CD1    . TYR A 358 ? 0.6430 0.3545 0.2734 0.0566  0.0002  -0.0474 395 TYR A CD1    
2598 C  CD2    . TYR A 358 ? 0.6832 0.3864 0.2784 0.0890  0.0114  -0.0583 395 TYR A CD2    
2599 C  CE1    . TYR A 358 ? 0.6741 0.3789 0.2860 0.0560  0.0035  -0.0468 395 TYR A CE1    
2600 C  CE2    . TYR A 358 ? 0.7184 0.4171 0.2963 0.0874  0.0158  -0.0578 395 TYR A CE2    
2601 C  CZ     . TYR A 358 ? 0.7715 0.4696 0.3570 0.0703  0.0117  -0.0517 395 TYR A CZ     
2602 O  OH     . TYR A 358 ? 0.7727 0.4623 0.3369 0.0693  0.0156  -0.0509 395 TYR A OH     
2603 N  N      . LYS A 359 ? 0.6448 0.4365 0.3217 0.0995  0.0255  -0.0578 396 LYS A N      
2604 C  CA     . LYS A 359 ? 0.6500 0.4802 0.3353 0.1130  0.0393  -0.0621 396 LYS A CA     
2605 C  C      . LYS A 359 ? 0.6619 0.5365 0.3859 0.1001  0.0470  -0.0578 396 LYS A C      
2606 O  O      . LYS A 359 ? 0.6531 0.5588 0.3863 0.0954  0.0593  -0.0574 396 LYS A O      
2607 C  CB     . LYS A 359 ? 0.7015 0.5276 0.3720 0.1393  0.0379  -0.0702 396 LYS A CB     
2608 N  N      . GLU A 360 ? 0.6038 0.4782 0.3473 0.0921  0.0396  -0.0544 397 GLU A N      
2609 C  CA     . GLU A 360 ? 0.5682 0.4772 0.3454 0.0788  0.0442  -0.0503 397 GLU A CA     
2610 C  C      . GLU A 360 ? 0.6187 0.5288 0.4012 0.0581  0.0476  -0.0437 397 GLU A C      
2611 O  O      . GLU A 360 ? 0.6241 0.5653 0.4227 0.0490  0.0574  -0.0421 397 GLU A O      
2612 C  CB     . GLU A 360 ? 0.5676 0.4678 0.3577 0.0763  0.0345  -0.0483 397 GLU A CB     
2613 C  CG     . GLU A 360 ? 0.6873 0.6265 0.5081 0.0730  0.0391  -0.0479 397 GLU A CG     
2614 C  CD     . GLU A 360 ? 0.8628 0.8422 0.6919 0.0877  0.0485  -0.0544 397 GLU A CD     
2615 O  OE1    . GLU A 360 ? 0.7040 0.6779 0.5185 0.1100  0.0460  -0.0609 397 GLU A OE1    
2616 O  OE2    . GLU A 360 ? 0.6949 0.7112 0.5432 0.0767  0.0582  -0.0534 397 GLU A OE2    
2617 N  N      . VAL A 361 ? 0.5657 0.4411 0.3321 0.0507  0.0391  -0.0403 398 VAL A N      
2618 C  CA     . VAL A 361 ? 0.5490 0.4176 0.3138 0.0347  0.0394  -0.0345 398 VAL A CA     
2619 C  C      . VAL A 361 ? 0.6163 0.4926 0.3652 0.0349  0.0511  -0.0352 398 VAL A C      
2620 O  O      . VAL A 361 ? 0.5772 0.4651 0.3309 0.0217  0.0582  -0.0309 398 VAL A O      
2621 C  CB     . VAL A 361 ? 0.5840 0.4178 0.3359 0.0299  0.0256  -0.0322 398 VAL A CB     
2622 C  CG1    . VAL A 361 ? 0.5778 0.4018 0.3224 0.0184  0.0243  -0.0272 398 VAL A CG1    
2623 C  CG2    . VAL A 361 ? 0.5577 0.3904 0.3278 0.0261  0.0168  -0.0308 398 VAL A CG2    
2624 N  N      . MET A 362 ? 0.6248 0.4928 0.3518 0.0497  0.0536  -0.0408 399 MET A N      
2625 C  CA     . MET A 362 ? 0.6522 0.5273 0.3610 0.0517  0.0656  -0.0422 399 MET A CA     
2626 C  C      . MET A 362 ? 0.7123 0.6352 0.4388 0.0533  0.0815  -0.0450 399 MET A C      
2627 O  O      . MET A 362 ? 0.7310 0.6673 0.4490 0.0462  0.0939  -0.0439 399 MET A O      
2628 C  CB     . MET A 362 ? 0.7186 0.5645 0.3940 0.0679  0.0618  -0.0477 399 MET A CB     
2629 C  CG     . MET A 362 ? 0.7819 0.5840 0.4372 0.0620  0.0470  -0.0451 399 MET A CG     
2630 S  SD     . MET A 362 ? 0.8520 0.6417 0.4957 0.0447  0.0478  -0.0378 399 MET A SD     
2631 C  CE     . MET A 362 ? 0.7714 0.5655 0.4433 0.0304  0.0388  -0.0318 399 MET A CE     
2632 N  N      . ASN A 363 ? 0.6600 0.6094 0.4102 0.0620  0.0810  -0.0488 400 ASN A N      
2633 C  CA     . ASN A 363 ? 1.0104 1.0126 0.7832 0.0653  0.0935  -0.0529 400 ASN A CA     
2634 C  C      . ASN A 363 ? 1.5392 1.5624 1.2970 0.0804  0.1062  -0.0598 400 ASN A C      
2635 O  O      . ASN A 363 ? 1.1169 1.1132 0.8483 0.0991  0.1020  -0.0644 400 ASN A O      
2636 C  CB     . ASN A 363 ? 0.9944 1.0218 0.7883 0.0404  0.1007  -0.0470 400 ASN A CB     
2637 P  PG     . ANP B .   ? 0.4852 0.4175 0.4381 -0.0416 -0.0102 -0.0079 501 ANP A PG     
2638 O  O1G    . ANP B .   ? 0.5161 0.4341 0.4613 -0.0365 -0.0071 -0.0073 501 ANP A O1G    
2639 O  O2G    . ANP B .   ? 0.4825 0.4049 0.4249 -0.0509 -0.0141 -0.0088 501 ANP A O2G    
2640 O  O3G    . ANP B .   ? 0.4907 0.4266 0.4469 -0.0342 -0.0120 -0.0084 501 ANP A O3G    
2641 P  PB     . ANP B .   ? 0.3232 0.3028 0.3013 -0.0502 -0.0089 -0.0091 501 ANP A PB     
2642 O  O1B    . ANP B .   ? 0.3047 0.2968 0.2911 -0.0373 -0.0120 -0.0106 501 ANP A O1B    
2643 O  O2B    . ANP B .   ? 0.3049 0.2853 0.2797 -0.0615 -0.0130 -0.0101 501 ANP A O2B    
2644 N  N3B    . ANP B .   ? 0.4224 0.3743 0.3870 -0.0453 -0.0075 -0.0075 501 ANP A N3B    
2645 P  PA     . ANP B .   ? 0.3728 0.3714 0.3612 -0.0422 0.0013  -0.0083 501 ANP A PA     
2646 O  O1A    . ANP B .   ? 0.3924 0.3700 0.3687 -0.0449 0.0050  -0.0061 501 ANP A O1A    
2647 O  O2A    . ANP B .   ? 0.3340 0.3252 0.3216 -0.0296 -0.0021 -0.0090 501 ANP A O2A    
2648 O  O3A    . ANP B .   ? 0.3527 0.3469 0.3373 -0.0529 -0.0030 -0.0085 501 ANP A O3A    
2649 O  "O5'"  . ANP B .   ? 0.3875 0.4178 0.3887 -0.0438 0.0052  -0.0100 501 ANP A "O5'"  
2650 C  "C5'"  . ANP B .   ? 0.3953 0.4552 0.4106 -0.0389 0.0018  -0.0133 501 ANP A "C5'"  
2651 C  "C4'"  . ANP B .   ? 0.4242 0.5161 0.4510 -0.0388 0.0077  -0.0153 501 ANP A "C4'"  
2652 O  "O4'"  . ANP B .   ? 0.4101 0.4931 0.4314 -0.0255 0.0113  -0.0152 501 ANP A "O4'"  
2653 C  "C3'"  . ANP B .   ? 0.4703 0.5700 0.4962 -0.0588 0.0145  -0.0136 501 ANP A "C3'"  
2654 O  "O3'"  . ANP B .   ? 0.4871 0.6316 0.5305 -0.0645 0.0173  -0.0169 501 ANP A "O3'"  
2655 C  "C2'"  . ANP B .   ? 0.4602 0.5405 0.4742 -0.0553 0.0210  -0.0112 501 ANP A "C2'"  
2656 O  "O2'"  . ANP B .   ? 0.4809 0.5766 0.4947 -0.0677 0.0297  -0.0104 501 ANP A "O2'"  
2657 C  "C1'"  . ANP B .   ? 0.4254 0.5127 0.4442 -0.0337 0.0196  -0.0138 501 ANP A "C1'"  
2658 N  N9     . ANP B .   ? 0.4203 0.4799 0.4254 -0.0256 0.0212  -0.0121 501 ANP A N9     
2659 C  C8     . ANP B .   ? 0.4190 0.4456 0.4112 -0.0278 0.0187  -0.0094 501 ANP A C8     
2660 N  N7     . ANP B .   ? 0.4209 0.4316 0.4044 -0.0190 0.0192  -0.0092 501 ANP A N7     
2661 C  C5     . ANP B .   ? 0.4355 0.4653 0.4235 -0.0095 0.0224  -0.0119 501 ANP A C5     
2662 C  C6     . ANP B .   ? 0.4274 0.4498 0.4071 0.0029  0.0236  -0.0135 501 ANP A C6     
2663 N  N6     . ANP B .   ? 0.4257 0.4205 0.3926 0.0061  0.0206  -0.0126 501 ANP A N6     
2664 N  N1     . ANP B .   ? 0.4343 0.4804 0.4190 0.0130  0.0271  -0.0169 501 ANP A N1     
2665 C  C2     . ANP B .   ? 0.4417 0.5222 0.4424 0.0102  0.0291  -0.0187 501 ANP A C2     
2666 N  N3     . ANP B .   ? 0.4388 0.5311 0.4500 -0.0033 0.0275  -0.0175 501 ANP A N3     
2667 C  C4     . ANP B .   ? 0.4331 0.4956 0.4355 -0.0125 0.0241  -0.0139 501 ANP A C4     
2668 H  HNB1   . ANP B .   ? 0.4203 0.3689 0.3837 -0.0437 -0.0043 -0.0066 501 ANP A HNB1   
2669 H  "H5'1" . ANP B .   ? 0.3915 0.4437 0.4047 -0.0264 -0.0016 -0.0140 501 ANP A "H5'1" 
2670 H  "H5'2" . ANP B .   ? 0.3971 0.4619 0.4146 -0.0470 -0.0018 -0.0139 501 ANP A "H5'2" 
2671 H  "H4'"  . ANP B .   ? 0.4210 0.5387 0.4593 -0.0322 0.0047  -0.0186 501 ANP A "H4'"  
2672 H  "H3'"  . ANP B .   ? 0.4753 0.5586 0.4934 -0.0704 0.0120  -0.0119 501 ANP A "H3'"  
2673 H  "HO3'" . ANP B .   ? 0.4816 0.6428 0.5325 -0.0508 0.0183  -0.0194 501 ANP A "HO3'" 
2674 H  "H2'"  . ANP B .   ? 0.4621 0.5122 0.4630 -0.0573 0.0192  -0.0086 501 ANP A "H2'"  
2675 H  "HO2'" . ANP B .   ? 0.4770 0.6050 0.5047 -0.0670 0.0313  -0.0132 501 ANP A "HO2'" 
2676 H  "H1'"  . ANP B .   ? 0.4245 0.5411 0.4537 -0.0297 0.0228  -0.0166 501 ANP A "H1'"  
2677 H  H8     . ANP B .   ? 0.4189 0.4345 0.4080 -0.0355 0.0160  -0.0079 501 ANP A H8     
2678 H  HN61   . ANP B .   ? 0.4215 0.4027 0.3862 0.0003  0.0179  -0.0108 501 ANP A HN61   
2679 H  HN62   . ANP B .   ? 0.4322 0.4197 0.3912 0.0143  0.0207  -0.0140 501 ANP A HN62   
2680 H  H2     . ANP B .   ? 0.4453 0.5477 0.4504 0.0207  0.0318  -0.0222 501 ANP A H2     
2681 N  N1     . 880 C .   ? 0.2181 0.1210 0.1426 -0.0016 -0.0184 -0.0059 502 880 A N1     
2682 C  C2     . 880 C .   ? 0.1735 0.0909 0.1112 -0.0069 -0.0169 -0.0066 502 880 A C2     
2683 N  N3     . 880 C .   ? 0.1627 0.0734 0.0953 -0.0121 -0.0150 -0.0059 502 880 A N3     
2684 C  C4     . 880 C .   ? 0.1797 0.0741 0.0970 -0.0121 -0.0142 -0.0044 502 880 A C4     
2685 C  C5     . 880 C .   ? 0.2093 0.0953 0.1194 -0.0066 -0.0168 -0.0040 502 880 A C5     
2686 C  C6     . 880 C .   ? 0.2690 0.1729 0.1923 0.0075  -0.0208 -0.0071 502 880 A C6     
2687 C  C7     . 880 C .   ? 0.3367 0.2481 0.2585 0.0193  -0.0278 -0.0091 502 880 A C7     
2688 C  C10    . 880 C .   ? 0.3509 0.2705 0.2761 0.0171  -0.0316 -0.0096 502 880 A C10    
2689 C  C16    . 880 C .   ? 0.1661 0.1033 0.1191 -0.0076 -0.0170 -0.0081 502 880 A C16    
2690 C  C17    . 880 C .   ? 0.1698 0.1076 0.1280 -0.0133 -0.0116 -0.0075 502 880 A C17    
2691 C  C18    . 880 C .   ? 0.1518 0.1049 0.1204 -0.0163 -0.0106 -0.0083 502 880 A C18    
2692 N  N19    . 880 C .   ? 0.1758 0.1358 0.1468 -0.0221 -0.0137 -0.0091 502 880 A N19    
2693 C  C20    . 880 C .   ? 0.1837 0.1498 0.1544 -0.0168 -0.0195 -0.0104 502 880 A C20    
2694 C  C21    . 880 C .   ? 0.1917 0.1384 0.1491 -0.0117 -0.0206 -0.0093 502 880 A C21    
2695 C  C35    A 880 C .   ? 0.1717 0.0601 0.0816 -0.0180 -0.0102 -0.0036 502 880 A C35    
2696 C  C35    B 880 C .   ? 0.1380 0.0405 0.0464 -0.0146 -0.0105 -0.0001 502 880 A C35    
2697 C  C36    . 880 C .   ? 0.2425 0.1042 0.1308 -0.0068 -0.0170 -0.0022 502 880 A C36    
2698 C  C37    A 880 C .   ? 0.2140 0.0873 0.1062 -0.0181 -0.0113 -0.0023 502 880 A C37    
2699 C  C37    B 880 C .   ? 0.1091 0.0407 0.0382 -0.0139 -0.0041 0.0008  502 880 A C37    
2700 C  C38    A 880 C .   ? 0.2328 0.1038 0.1182 -0.0233 -0.0062 -0.0020 502 880 A C38    
2701 C  C38    B 880 C .   ? 0.1360 0.0429 0.0429 -0.0214 -0.0010 -0.0009 502 880 A C38    
2702 C  C39    A 880 C .   ? 0.2310 0.1161 0.1280 -0.0261 -0.0008 -0.0036 502 880 A C39    
2703 C  C39    B 880 C .   ? 0.1113 0.0410 0.0380 -0.0150 -0.0009 0.0002  502 880 A C39    
2704 C  C40    A 880 C .   ? 0.1690 0.0664 0.0819 -0.0248 -0.0011 -0.0049 502 880 A C40    
2705 C  C40    B 880 C .   ? 0.1218 0.0401 0.0383 -0.0132 -0.0053 0.0008  502 880 A C40    
2706 C  C41    A 880 C .   ? 0.1275 0.0421 0.0465 -0.0182 -0.0045 -0.0009 502 880 A C41    
2707 C  C41    B 880 C .   ? 0.1315 0.0394 0.0391 -0.0115 -0.0102 0.0013  502 880 A C41    
2708 CL CL45   A 880 C .   ? 0.2816 0.1316 0.1412 -0.0239 -0.0070 -0.0001 502 880 A CL45   
2709 CL CL45   B 880 C .   ? 0.1959 0.1019 0.1114 -0.0252 0.0038  -0.0068 502 880 A CL45   
2710 CL CL46   A 880 C .   ? 0.2844 0.1723 0.1736 -0.0292 0.0063  -0.0045 502 880 A CL46   
2711 CL CL46   B 880 C .   ? 0.0870 0.0407 0.0381 -0.0116 0.0022  -0.0005 502 880 A CL46   
2712 C  C47    . 880 C .   ? 0.2550 0.1060 0.1332 -0.0175 -0.0118 -0.0004 502 880 A C47    
2713 C  C48    . 880 C .   ? 0.2839 0.1080 0.1371 -0.0202 -0.0125 0.0016  502 880 A C48    
2714 N  N49    . 880 C .   ? 0.2908 0.0952 0.1269 -0.0103 -0.0188 0.0016  502 880 A N49    
2715 C  C50    . 880 C .   ? 0.2967 0.1172 0.1469 0.0028  -0.0236 -0.0009 502 880 A C50    
2716 N  N51    . 880 C .   ? 0.2793 0.1298 0.1561 0.0036  -0.0226 -0.0028 502 880 A N51    
2717 N  N54    . 880 C .   ? 0.3265 0.1313 0.1611 0.0154  -0.0295 -0.0020 502 880 A N54    
2718 C  C55    . 880 C .   ? 0.3253 0.1485 0.1719 0.0315  -0.0343 -0.0055 502 880 A C55    
2719 C  C56    . 880 C .   ? 0.3429 0.1412 0.1616 0.0489  -0.0429 -0.0066 502 880 A C56    
2720 C  C57    . 880 C .   ? 0.3303 0.1553 0.1640 0.0674  -0.0472 -0.0113 502 880 A C57    
2721 C  C58    . 880 C .   ? 0.3416 0.1802 0.1899 0.0653  -0.0414 -0.0127 502 880 A C58    
2722 C  C59    . 880 C .   ? 0.2993 0.1576 0.1724 0.0459  -0.0332 -0.0107 502 880 A C59    
2723 C  C60    . 880 C .   ? 0.2997 0.1354 0.1605 0.0299  -0.0300 -0.0068 502 880 A C60    
2724 H  H061   . 880 C .   ? 0.2570 0.1737 0.1923 0.0060  -0.0180 -0.0078 502 880 A H061   
2725 H  H062   . 880 C .   ? 0.2808 0.1673 0.1912 0.0075  -0.0200 -0.0061 502 880 A H062   
2726 H  H071   . 880 C .   ? 0.3296 0.2587 0.2629 0.0239  -0.0277 -0.0111 502 880 A H071   
2727 H  H072   . 880 C .   ? 0.3555 0.2488 0.2601 0.0268  -0.0310 -0.0089 502 880 A H072   
2728 H  H101   . 880 C .   ? 0.3596 0.2850 0.2826 0.0267  -0.0377 -0.0115 502 880 A H101   
2729 H  H102   . 880 C .   ? 0.3585 0.2617 0.2719 0.0128  -0.0311 -0.0078 502 880 A H102   
2730 H  H103   . 880 C .   ? 0.3367 0.2731 0.2765 0.0106  -0.0298 -0.0103 502 880 A H103   
2731 H  H16    . 880 C .   ? 0.1675 0.1120 0.1234 -0.0016 -0.0186 -0.0091 502 880 A H16    
2732 H  H171   . 880 C .   ? 0.1695 0.1015 0.1246 -0.0171 -0.0104 -0.0071 502 880 A H171   
2733 H  H172   . 880 C .   ? 0.1701 0.1018 0.1251 -0.0117 -0.0097 -0.0070 502 880 A H172   
2734 H  H181   . 880 C .   ? 0.1487 0.0988 0.1175 -0.0194 -0.0074 -0.0076 502 880 A H181   
2735 H  H182   . 880 C .   ? 0.1501 0.1123 0.1227 -0.0115 -0.0109 -0.0091 502 880 A H182   
2736 H  H19    . 880 C .   ? 0.1776 0.1272 0.1427 -0.0257 -0.0133 -0.0086 502 880 A H19    
2737 H  H201   . 880 C .   ? 0.1854 0.1572 0.1577 -0.0222 -0.0224 -0.0114 502 880 A H201   
2738 H  H202   . 880 C .   ? 0.1817 0.1613 0.1587 -0.0113 -0.0205 -0.0117 502 880 A H202   
2739 H  H211   . 880 C .   ? 0.1982 0.1455 0.1517 -0.0071 -0.0254 -0.0101 502 880 A H211   
2740 H  H212   . 880 C .   ? 0.1928 0.1304 0.1451 -0.0163 -0.0193 -0.0087 502 880 A H212   
2741 H  H37    A 880 C .   ? 0.2267 0.0894 0.1084 -0.0133 -0.0160 -0.0017 502 880 A H37    
2742 H  H37    B 880 C .   ? 0.0967 0.0406 0.0381 -0.0124 -0.0030 0.0006  502 880 A H37    
2743 H  H40    A 880 C .   ? 0.1636 0.0699 0.0829 -0.0249 0.0021  -0.0064 502 880 A H40    
2744 H  H40    B 880 C .   ? 0.1357 0.0400 0.0384 -0.0141 -0.0062 0.0009  502 880 A H40    
2745 H  H41    A 880 C .   ? 0.1160 0.0420 0.0454 -0.0168 -0.0039 -0.0008 502 880 A H41    
2746 H  H41    B 880 C .   ? 0.1404 0.0386 0.0401 -0.0078 -0.0145 0.0011  502 880 A H41    
2747 H  H47    . 880 C .   ? 0.2427 0.1057 0.1310 -0.0237 -0.0072 -0.0008 502 880 A H47    
2748 H  H48    . 880 C .   ? 0.2926 0.1089 0.1363 -0.0308 -0.0079 0.0032  502 880 A H48    
2749 H  H54    . 880 C .   ? 0.3512 0.1281 0.1613 0.0142  -0.0307 -0.0004 502 880 A H54    
2750 H  H55    . 880 C .   ? 0.3093 0.1551 0.1727 0.0328  -0.0355 -0.0066 502 880 A H55    
2751 H  H561   . 880 C .   ? 0.3660 0.1348 0.1617 0.0473  -0.0427 -0.0053 502 880 A H561   
2752 H  H562   . 880 C .   ? 0.3564 0.1440 0.1627 0.0509  -0.0467 -0.0056 502 880 A H562   
2753 H  H571   . 880 C .   ? 0.3579 0.1651 0.1702 0.0827  -0.0540 -0.0127 502 880 A H571   
2754 H  H572   . 880 C .   ? 0.3129 0.1656 0.1663 0.0680  -0.0485 -0.0127 502 880 A H572   
2755 H  H581   . 880 C .   ? 0.3636 0.1739 0.1901 0.0670  -0.0419 -0.0121 502 880 A H581   
2756 H  H582   . 880 C .   ? 0.3366 0.1980 0.1967 0.0776  -0.0433 -0.0161 502 880 A H582   
2757 H  H591   . 880 C .   ? 0.2919 0.1563 0.1720 0.0447  -0.0296 -0.0115 502 880 A H591   
2758 H  H592   . 880 C .   ? 0.2813 0.1660 0.1742 0.0448  -0.0330 -0.0117 502 880 A H592   
2759 H  H601   . 880 C .   ? 0.2784 0.1297 0.1564 0.0193  -0.0249 -0.0062 502 880 A H601   
2760 H  H602   . 880 C .   ? 0.3172 0.1294 0.1603 0.0272  -0.0295 -0.0059 502 880 A H602   
2761 H  H192   . 880 C .   ? 0.1728 0.1436 0.1498 -0.0263 -0.0125 -0.0095 502 880 A H192   
2762 X  UNK    . UNX D .   ? 0.9443 0.5617 0.5135 0.0941  -0.0682 -0.0080 503 UNX A UNK    
2763 X  UNK    . UNX E .   ? 0.7657 0.8135 0.6924 -0.1623 0.0583  -0.0128 504 UNX A UNK    
2764 X  UNK    . UNX F .   ? 0.6208 0.7837 0.6139 -0.2097 0.0376  -0.0324 505 UNX A UNK    
2765 O  O      . HOH G .   ? 0.4302 0.2004 0.1643 -0.0081 -0.0800 -0.0245 601 HOH A O      
2766 O  O      . HOH G .   ? 0.5322 0.3790 0.3666 0.0897  -0.0332 -0.0318 602 HOH A O      
2767 O  O      . HOH G .   ? 0.7628 0.3742 0.4137 -0.0816 -0.0095 0.0183  603 HOH A O      
2768 O  O      . HOH G .   ? 0.3795 0.3681 0.3070 -0.1757 -0.0077 -0.0277 604 HOH A O      
2769 O  O      . HOH G .   ? 0.4148 0.4798 0.3316 0.0763  -0.1293 -0.0743 605 HOH A O      
2770 O  O      . HOH G .   ? 0.3882 0.2274 0.1795 0.1252  -0.0761 -0.0358 606 HOH A O      
2771 O  O      . HOH G .   ? 0.4363 0.2711 0.2898 0.0214  -0.0178 -0.0095 607 HOH A O      
2772 O  O      . HOH G .   ? 0.3962 0.3176 0.3444 -0.0219 -0.0059 -0.0078 608 HOH A O      
2773 O  O      . HOH G .   ? 0.5093 0.3937 0.3335 -0.2723 -0.0323 -0.0335 609 HOH A O      
2774 O  O      . HOH G .   ? 0.4060 0.1284 0.0782 -0.0901 0.0367  0.0208  610 HOH A O      
2775 O  O      . HOH G .   ? 0.8112 0.2222 0.2999 -0.0170 -0.0825 -0.0514 611 HOH A O      
2776 O  O      . HOH G .   ? 0.2099 0.1790 0.1814 -0.0159 0.0100  -0.0075 612 HOH A O      
2777 O  O      . HOH G .   ? 0.4490 0.3303 0.3569 -0.0156 0.0014  -0.0039 613 HOH A O      
2778 O  O      . HOH G .   ? 0.2224 0.1712 0.1808 0.0080  -0.0138 -0.0103 614 HOH A O      
2779 O  O      . HOH G .   ? 0.4224 0.2972 0.3010 -0.0542 -0.0525 -0.0207 615 HOH A O      
2780 O  O      . HOH G .   ? 0.3289 0.2844 0.2353 -0.1176 0.0343  -0.0064 616 HOH A O      
2781 O  O      . HOH G .   ? 0.5463 0.2288 0.2514 -0.1252 -0.0844 -0.0502 617 HOH A O      
2782 O  O      . HOH G .   ? 0.6981 0.0784 0.1057 -0.0379 -0.1340 -0.0317 618 HOH A O      
2783 O  O      . HOH G .   ? 0.8210 0.4902 0.2587 -0.1890 0.1789  0.0574  619 HOH A O      
2784 O  O      . HOH G .   ? 0.3840 0.2721 0.2904 -0.0352 0.0116  0.0003  620 HOH A O      
2785 O  O      . HOH G .   ? 0.8343 0.4290 0.4534 -0.0974 -0.0001 0.0246  621 HOH A O      
2786 O  O      . HOH G .   ? 0.3691 0.2239 0.1968 -0.1027 0.0333  0.0063  622 HOH A O      
2787 O  O      . HOH G .   ? 0.4464 0.3358 0.2965 -0.2149 -0.0098 -0.0210 623 HOH A O      
2788 O  O      . HOH G .   ? 0.4053 0.3194 0.3406 -0.0176 -0.0021 -0.0104 624 HOH A O      
2789 O  O      . HOH G .   ? 0.2060 0.1079 0.1215 0.0148  -0.0150 -0.0148 625 HOH A O      
2790 O  O      . HOH G .   ? 0.3499 0.1755 0.1761 -0.0233 0.0179  0.0051  626 HOH A O      
2791 O  O      . HOH G .   ? 0.2625 0.3358 0.2351 -0.0913 0.0428  -0.0211 627 HOH A O      
2792 O  O      . HOH G .   ? 0.4727 0.3412 0.3210 -0.1795 0.0012  -0.0122 628 HOH A O      
2793 O  O      . HOH G .   ? 0.4515 0.2746 0.3013 -0.0238 -0.0231 -0.0188 629 HOH A O      
2794 O  O      . HOH G .   ? 0.3196 0.2349 0.2574 -0.0203 -0.0117 -0.0074 630 HOH A O      
2795 O  O      . HOH G .   ? 0.2557 0.1776 0.1611 0.0007  0.0258  -0.0082 631 HOH A O      
2796 O  O      . HOH G .   ? 0.5266 0.3098 0.3256 0.0626  -0.0134 -0.0296 632 HOH A O      
2797 O  O      . HOH G .   ? 0.4998 0.4211 0.4508 -0.0166 -0.0009 -0.0079 633 HOH A O      
2798 O  O      . HOH G .   ? 0.2430 0.4195 0.2658 0.0592  -0.0645 -0.0678 634 HOH A O      
2799 O  O      . HOH G .   ? 0.6618 0.3783 0.3952 0.0763  -0.0209 -0.0374 635 HOH A O      
2800 O  O      . HOH G .   ? 0.7467 0.2228 0.2899 -0.1245 -0.0924 -0.0487 636 HOH A O      
2801 O  O      . HOH G .   ? 0.8654 0.2938 0.2538 -0.0645 0.0348  0.0471  637 HOH A O      
2802 O  O      . HOH G .   ? 0.6246 0.5307 0.5168 -0.0373 -0.0636 -0.0212 638 HOH A O      
2803 O  O      . HOH G .   ? 0.7069 0.2360 0.1318 -0.0299 0.0042  0.0253  639 HOH A O      
2804 O  O      . HOH G .   ? 0.2908 0.2000 0.1790 -0.0174 0.0324  -0.0018 640 HOH A O      
2805 O  O      . HOH G .   ? 0.5546 0.2399 0.2028 0.0538  -0.0340 -0.0054 641 HOH A O      
2806 O  O      . HOH G .   ? 0.4978 0.4037 0.4092 -0.0149 0.0028  -0.0122 642 HOH A O      
2807 O  O      . HOH G .   ? 0.5609 0.2815 0.2403 0.0523  -0.0362 -0.0134 643 HOH A O      
2808 O  O      . HOH G .   ? 0.3268 0.4072 0.2927 0.0719  -0.0764 -0.0592 644 HOH A O      
2809 O  O      . HOH G .   ? 0.8416 0.3936 0.4645 -0.1064 -0.0539 -0.0169 645 HOH A O      
2810 O  O      A HOH G .   ? 0.2373 0.1385 0.1518 0.0072  -0.0032 -0.0180 646 HOH A O      
2811 O  O      . HOH G .   ? 0.8704 0.3481 0.4219 0.0548  -0.0596 -0.0356 647 HOH A O      
2812 O  O      . HOH G .   ? 0.2236 0.4661 0.2941 -0.0988 -0.0076 -0.0551 648 HOH A O      
2813 O  O      . HOH G .   ? 0.8318 0.2899 0.3316 -0.0804 -0.0196 0.0309  649 HOH A O      
2814 O  O      . HOH G .   ? 1.1978 0.1762 0.2740 -0.0339 -0.1666 -0.1000 650 HOH A O      
2815 O  O      . HOH G .   ? 0.6849 0.1012 0.1851 -0.0781 -0.0863 -0.0454 651 HOH A O      
2816 O  O      . HOH G .   ? 0.3956 0.2917 0.2694 -0.0957 0.0281  0.0001  652 HOH A O      
2817 O  O      . HOH G .   ? 0.6986 0.3502 0.2417 0.0829  -0.1700 -0.0216 653 HOH A O      
2818 O  O      . HOH G .   ? 0.3168 0.3706 0.2403 0.1227  -0.0953 -0.0647 654 HOH A O      
2819 O  O      . HOH G .   ? 0.3975 0.6073 0.4286 0.0524  -0.0841 -0.0766 655 HOH A O      
2820 O  O      . HOH G .   ? 0.6346 0.3639 0.2999 0.2277  -0.0961 -0.0517 656 HOH A O      
2821 O  O      . HOH G .   ? 0.5959 0.3870 0.2639 -0.0467 0.0616  0.0011  657 HOH A O      
2822 O  O      . HOH G .   ? 0.3946 0.4901 0.3639 0.0282  0.0578  -0.0229 658 HOH A O      
2823 O  O      . HOH G .   ? 0.4848 0.2650 0.1556 0.0005  0.0358  -0.0167 659 HOH A O      
2824 O  O      . HOH G .   ? 0.8354 0.4831 0.3739 0.1359  0.0173  -0.0588 660 HOH A O      
2825 O  O      . HOH G .   ? 0.5070 0.5118 0.4979 -0.0032 -0.0114 -0.0130 661 HOH A O      
2826 O  O      . HOH G .   ? 0.5985 0.3490 0.2145 -0.1568 0.0937  0.0267  662 HOH A O      
2827 O  O      . HOH G .   ? 0.9274 0.5013 0.5073 0.0871  -0.0887 0.0074  663 HOH A O      
2828 O  O      . HOH G .   ? 0.5680 0.7283 0.5848 -0.0482 0.0608  -0.0150 664 HOH A O      
2829 O  O      . HOH G .   ? 0.7652 0.1243 0.1491 -0.1048 -0.1583 -0.0511 665 HOH A O      
2830 O  O      . HOH G .   ? 0.6745 0.4196 0.4149 -0.1617 -0.1074 -0.0402 666 HOH A O      
2831 O  O      . HOH G .   ? 0.5998 0.3549 0.2343 -0.0233 0.0464  -0.0041 667 HOH A O      
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   38  ?   ?   ?   A . n 
A 1 2   ALA 2   39  ?   ?   ?   A . n 
A 1 3   SER 3   40  ?   ?   ?   A . n 
A 1 4   LYS 4   41  ?   ?   ?   A . n 
A 1 5   SER 5   42  ?   ?   ?   A . n 
A 1 6   LYS 6   43  ?   ?   ?   A . n 
A 1 7   VAL 7   44  ?   ?   ?   A . n 
A 1 8   ASP 8   45  45  ASP ASP A . n 
A 1 9   ASN 9   46  46  ASN ASN A . n 
A 1 10  GLN 10  47  47  GLN GLN A . n 
A 1 11  PHE 11  48  48  PHE PHE A . n 
A 1 12  TYR 12  49  49  TYR TYR A . n 
A 1 13  SER 13  50  50  SER SER A . n 
A 1 14  VAL 14  51  51  VAL VAL A . n 
A 1 15  GLU 15  52  52  GLU GLU A . n 
A 1 16  VAL 16  53  53  VAL VAL A . n 
A 1 17  GLY 17  54  54  GLY GLY A . n 
A 1 18  ASP 18  55  55  ASP ASP A . n 
A 1 19  SER 19  56  56  SER SER A . n 
A 1 20  THR 20  57  57  THR THR A . n 
A 1 21  PHE 21  58  58  PHE PHE A . n 
A 1 22  THR 22  59  59  THR THR A . n 
A 1 23  VAL 23  60  60  VAL VAL A . n 
A 1 24  LEU 24  61  61  LEU LEU A . n 
A 1 25  LYS 25  62  62  LYS LYS A . n 
A 1 26  ARG 26  63  63  ARG ARG A . n 
A 1 27  TYR 27  64  64  TYR TYR A . n 
A 1 28  GLN 28  65  65  GLN GLN A . n 
A 1 29  ASN 29  66  66  ASN ASN A . n 
A 1 30  LEU 30  67  67  LEU LEU A . n 
A 1 31  LYS 31  68  68  LYS LYS A . n 
A 1 32  PRO 32  69  69  PRO PRO A . n 
A 1 33  ILE 33  70  70  ILE ILE A . n 
A 1 34  GLY 34  71  71  GLY GLY A . n 
A 1 35  SER 35  72  72  SER SER A . n 
A 1 36  GLY 36  73  73  GLY GLY A . n 
A 1 37  ALA 37  74  74  ALA ALA A . n 
A 1 38  GLN 38  75  75  GLN GLN A . n 
A 1 39  GLY 39  76  76  GLY GLY A . n 
A 1 40  ILE 40  77  77  ILE ILE A . n 
A 1 41  VAL 41  78  78  VAL VAL A . n 
A 1 42  CYS 42  79  79  CYS CYS A . n 
A 1 43  ALA 43  80  80  ALA ALA A . n 
A 1 44  ALA 44  81  81  ALA ALA A . n 
A 1 45  TYR 45  82  82  TYR TYR A . n 
A 1 46  ASP 46  83  83  ASP ASP A . n 
A 1 47  ALA 47  84  84  ALA ALA A . n 
A 1 48  VAL 48  85  85  VAL VAL A . n 
A 1 49  LEU 49  86  86  LEU LEU A . n 
A 1 50  ASP 50  87  87  ASP ASP A . n 
A 1 51  ARG 51  88  88  ARG ARG A . n 
A 1 52  ASN 52  89  89  ASN ASN A . n 
A 1 53  VAL 53  90  90  VAL VAL A . n 
A 1 54  ALA 54  91  91  ALA ALA A . n 
A 1 55  ILE 55  92  92  ILE ILE A . n 
A 1 56  LYS 56  93  93  LYS LYS A . n 
A 1 57  LYS 57  94  94  LYS LYS A . n 
A 1 58  LEU 58  95  95  LEU LEU A . n 
A 1 59  SER 59  96  96  SER SER A . n 
A 1 60  ARG 60  97  97  ARG ARG A . n 
A 1 61  PRO 61  98  98  PRO PRO A . n 
A 1 62  PHE 62  99  99  PHE PHE A . n 
A 1 63  GLN 63  100 100 GLN GLN A . n 
A 1 64  ASN 64  101 101 ASN ASN A . n 
A 1 65  GLN 65  102 102 GLN GLN A . n 
A 1 66  THR 66  103 103 THR THR A . n 
A 1 67  HIS 67  104 104 HIS HIS A . n 
A 1 68  ALA 68  105 105 ALA ALA A . n 
A 1 69  LYS 69  106 106 LYS LYS A . n 
A 1 70  ARG 70  107 107 ARG ARG A . n 
A 1 71  ALA 71  108 108 ALA ALA A . n 
A 1 72  TYR 72  109 109 TYR TYR A . n 
A 1 73  ARG 73  110 110 ARG ARG A . n 
A 1 74  GLU 74  111 111 GLU GLU A . n 
A 1 75  LEU 75  112 112 LEU LEU A . n 
A 1 76  VAL 76  113 113 VAL VAL A . n 
A 1 77  LEU 77  114 114 LEU LEU A . n 
A 1 78  MET 78  115 115 MET MET A . n 
A 1 79  LYS 79  116 116 LYS LYS A . n 
A 1 80  CYS 80  117 117 CYS CYS A . n 
A 1 81  VAL 81  118 118 VAL VAL A . n 
A 1 82  ASN 82  119 119 ASN ASN A . n 
A 1 83  HIS 83  120 120 HIS HIS A . n 
A 1 84  LYS 84  121 121 LYS LYS A . n 
A 1 85  ASN 85  122 122 ASN ASN A . n 
A 1 86  ILE 86  123 123 ILE ILE A . n 
A 1 87  ILE 87  124 124 ILE ILE A . n 
A 1 88  SER 88  125 125 SER SER A . n 
A 1 89  LEU 89  126 126 LEU LEU A . n 
A 1 90  LEU 90  127 127 LEU LEU A . n 
A 1 91  ASN 91  128 128 ASN ASN A . n 
A 1 92  VAL 92  129 129 VAL VAL A . n 
A 1 93  PHE 93  130 130 PHE PHE A . n 
A 1 94  THR 94  131 131 THR THR A . n 
A 1 95  PRO 95  132 132 PRO PRO A . n 
A 1 96  GLN 96  133 133 GLN GLN A . n 
A 1 97  LYS 97  134 134 LYS LYS A . n 
A 1 98  THR 98  135 135 THR THR A . n 
A 1 99  LEU 99  136 136 LEU LEU A . n 
A 1 100 GLU 100 137 137 GLU GLU A . n 
A 1 101 GLU 101 138 138 GLU GLU A . n 
A 1 102 PHE 102 139 139 PHE PHE A . n 
A 1 103 GLN 103 140 140 GLN GLN A . n 
A 1 104 ASP 104 141 141 ASP ASP A . n 
A 1 105 VAL 105 142 142 VAL VAL A . n 
A 1 106 TYR 106 143 143 TYR TYR A . n 
A 1 107 LEU 107 144 144 LEU LEU A . n 
A 1 108 VAL 108 145 145 VAL VAL A . n 
A 1 109 MET 109 146 146 MET MET A . n 
A 1 110 GLU 110 147 147 GLU GLU A . n 
A 1 111 LEU 111 148 148 LEU LEU A . n 
A 1 112 MET 112 149 149 MET MET A . n 
A 1 113 ASP 113 150 150 ASP ASP A . n 
A 1 114 ALA 114 151 151 ALA ALA A . n 
A 1 115 ASN 115 152 152 ASN ASN A . n 
A 1 116 LEU 116 153 153 LEU LEU A . n 
A 1 117 CYS 117 154 154 CYS CYS A . n 
A 1 118 GLN 118 155 155 GLN GLN A . n 
A 1 119 VAL 119 156 156 VAL VAL A . n 
A 1 120 ILE 120 157 157 ILE ILE A . n 
A 1 121 GLN 121 158 158 GLN GLN A . n 
A 1 122 MET 122 159 159 MET MET A . n 
A 1 123 GLU 123 160 160 GLU GLU A . n 
A 1 124 LEU 124 161 161 LEU LEU A . n 
A 1 125 ASP 125 162 162 ASP ASP A . n 
A 1 126 HIS 126 163 163 HIS HIS A . n 
A 1 127 GLU 127 164 164 GLU GLU A . n 
A 1 128 ARG 128 165 165 ARG ARG A . n 
A 1 129 MET 129 166 166 MET MET A . n 
A 1 130 SER 130 167 167 SER SER A . n 
A 1 131 TYR 131 168 168 TYR TYR A . n 
A 1 132 LEU 132 169 169 LEU LEU A . n 
A 1 133 LEU 133 170 170 LEU LEU A . n 
A 1 134 TYR 134 171 171 TYR TYR A . n 
A 1 135 GLN 135 172 172 GLN GLN A . n 
A 1 136 MET 136 173 173 MET MET A . n 
A 1 137 LEU 137 174 174 LEU LEU A . n 
A 1 138 CYS 138 175 175 CYS CYS A . n 
A 1 139 GLY 139 176 176 GLY GLY A . n 
A 1 140 ILE 140 177 177 ILE ILE A . n 
A 1 141 LYS 141 178 178 LYS LYS A . n 
A 1 142 HIS 142 179 179 HIS HIS A . n 
A 1 143 LEU 143 180 180 LEU LEU A . n 
A 1 144 HIS 144 181 181 HIS HIS A . n 
A 1 145 SER 145 182 182 SER SER A . n 
A 1 146 ALA 146 183 183 ALA ALA A . n 
A 1 147 GLY 147 184 184 GLY GLY A . n 
A 1 148 ILE 148 185 185 ILE ILE A . n 
A 1 149 ILE 149 186 186 ILE ILE A . n 
A 1 150 HIS 150 187 187 HIS HIS A . n 
A 1 151 ARG 151 188 188 ARG ARG A . n 
A 1 152 ASP 152 189 189 ASP ASP A . n 
A 1 153 LEU 153 190 190 LEU LEU A . n 
A 1 154 LYS 154 191 191 LYS LYS A . n 
A 1 155 PRO 155 192 192 PRO PRO A . n 
A 1 156 SER 156 193 193 SER SER A . n 
A 1 157 ASN 157 194 194 ASN ASN A . n 
A 1 158 ILE 158 195 195 ILE ILE A . n 
A 1 159 VAL 159 196 196 VAL VAL A . n 
A 1 160 VAL 160 197 197 VAL VAL A . n 
A 1 161 LYS 161 198 198 LYS LYS A . n 
A 1 162 SER 162 199 199 SER SER A . n 
A 1 163 ASP 163 200 200 ASP ASP A . n 
A 1 164 CYS 164 201 201 CYS CYS A . n 
A 1 165 THR 165 202 202 THR THR A . n 
A 1 166 LEU 166 203 203 LEU LEU A . n 
A 1 167 LYS 167 204 204 LYS LYS A . n 
A 1 168 ILE 168 205 205 ILE ILE A . n 
A 1 169 LEU 169 206 206 LEU LEU A . n 
A 1 170 ASP 170 207 207 ASP ASP A . n 
A 1 171 PHE 171 208 208 PHE PHE A . n 
A 1 172 GLY 172 209 209 GLY GLY A . n 
A 1 173 LEU 173 210 210 LEU LEU A . n 
A 1 174 ALA 174 211 ?   ?   ?   A . n 
A 1 175 ARG 175 212 ?   ?   ?   A . n 
A 1 176 THR 176 213 ?   ?   ?   A . n 
A 1 177 ALA 177 214 ?   ?   ?   A . n 
A 1 178 GLY 178 215 ?   ?   ?   A . n 
A 1 179 THR 179 216 ?   ?   ?   A . n 
A 1 180 SER 180 217 217 SER SER A . n 
A 1 181 PHE 181 218 218 PHE PHE A . n 
A 1 182 MET 182 219 219 MET MET A . n 
A 1 183 MET 183 220 220 MET MET A . n 
A 1 184 THR 184 221 ?   ?   ?   A . n 
A 1 185 PRO 185 222 ?   ?   ?   A . n 
A 1 186 TYR 186 223 ?   ?   ?   A . n 
A 1 187 VAL 187 224 ?   ?   ?   A . n 
A 1 188 VAL 188 225 225 VAL VAL A . n 
A 1 189 THR 189 226 226 THR THR A . n 
A 1 190 ARG 190 227 227 ARG ARG A . n 
A 1 191 TYR 191 228 228 TYR TYR A . n 
A 1 192 TYR 192 229 229 TYR TYR A . n 
A 1 193 ARG 193 230 230 ARG ARG A . n 
A 1 194 ALA 194 231 231 ALA ALA A . n 
A 1 195 PRO 195 232 232 PRO PRO A . n 
A 1 196 GLU 196 233 233 GLU GLU A . n 
A 1 197 VAL 197 234 234 VAL VAL A . n 
A 1 198 ILE 198 235 235 ILE ILE A . n 
A 1 199 LEU 199 236 236 LEU LEU A . n 
A 1 200 GLY 200 237 237 GLY GLY A . n 
A 1 201 MET 201 238 238 MET MET A . n 
A 1 202 GLY 202 239 239 GLY GLY A . n 
A 1 203 TYR 203 240 240 TYR TYR A . n 
A 1 204 LYS 204 241 241 LYS LYS A . n 
A 1 205 GLU 205 242 242 GLU GLU A . n 
A 1 206 ASN 206 243 243 ASN ASN A . n 
A 1 207 VAL 207 244 244 VAL VAL A . n 
A 1 208 ASP 208 245 245 ASP ASP A . n 
A 1 209 ILE 209 246 246 ILE ILE A . n 
A 1 210 TRP 210 247 247 TRP TRP A . n 
A 1 211 SER 211 248 248 SER SER A . n 
A 1 212 VAL 212 249 249 VAL VAL A . n 
A 1 213 GLY 213 250 250 GLY GLY A . n 
A 1 214 CYS 214 251 251 CYS CYS A . n 
A 1 215 ILE 215 252 252 ILE ILE A . n 
A 1 216 MET 216 253 253 MET MET A . n 
A 1 217 GLY 217 254 254 GLY GLY A . n 
A 1 218 GLU 218 255 255 GLU GLU A . n 
A 1 219 MET 219 256 256 MET MET A . n 
A 1 220 VAL 220 257 257 VAL VAL A . n 
A 1 221 ARG 221 258 258 ARG ARG A . n 
A 1 222 HIS 222 259 259 HIS HIS A . n 
A 1 223 LYS 223 260 260 LYS LYS A . n 
A 1 224 ILE 224 261 261 ILE ILE A . n 
A 1 225 LEU 225 262 262 LEU LEU A . n 
A 1 226 PHE 226 263 263 PHE PHE A . n 
A 1 227 PRO 227 264 264 PRO PRO A . n 
A 1 228 GLY 228 265 265 GLY GLY A . n 
A 1 229 ARG 229 266 266 ARG ARG A . n 
A 1 230 ASP 230 267 267 ASP ASP A . n 
A 1 231 TYR 231 268 268 TYR TYR A . n 
A 1 232 ILE 232 269 269 ILE ILE A . n 
A 1 233 ASP 233 270 270 ASP ASP A . n 
A 1 234 GLN 234 271 271 GLN GLN A . n 
A 1 235 TRP 235 272 272 TRP TRP A . n 
A 1 236 ASN 236 273 273 ASN ASN A . n 
A 1 237 LYS 237 274 274 LYS LYS A . n 
A 1 238 VAL 238 275 275 VAL VAL A . n 
A 1 239 ILE 239 276 276 ILE ILE A . n 
A 1 240 GLU 240 277 277 GLU GLU A . n 
A 1 241 GLN 241 278 278 GLN GLN A . n 
A 1 242 LEU 242 279 279 LEU LEU A . n 
A 1 243 GLY 243 280 280 GLY GLY A . n 
A 1 244 THR 244 281 281 THR THR A . n 
A 1 245 PRO 245 282 282 PRO PRO A . n 
A 1 246 CYS 246 283 283 CYS CYS A . n 
A 1 247 PRO 247 284 284 PRO PRO A . n 
A 1 248 GLU 248 285 285 GLU GLU A . n 
A 1 249 PHE 249 286 286 PHE PHE A . n 
A 1 250 MET 250 287 287 MET MET A . n 
A 1 251 LYS 251 288 288 LYS LYS A . n 
A 1 252 LYS 252 289 289 LYS LYS A . n 
A 1 253 LEU 253 290 290 LEU LEU A . n 
A 1 254 GLN 254 291 291 GLN GLN A . n 
A 1 255 PRO 255 292 292 PRO PRO A . n 
A 1 256 THR 256 293 293 THR THR A . n 
A 1 257 VAL 257 294 294 VAL VAL A . n 
A 1 258 ARG 258 295 295 ARG ARG A . n 
A 1 259 ASN 259 296 296 ASN ASN A . n 
A 1 260 TYR 260 297 297 TYR TYR A . n 
A 1 261 VAL 261 298 298 VAL VAL A . n 
A 1 262 GLU 262 299 299 GLU GLU A . n 
A 1 263 ASN 263 300 300 ASN ASN A . n 
A 1 264 ARG 264 301 301 ARG ARG A . n 
A 1 265 PRO 265 302 302 PRO PRO A . n 
A 1 266 LYS 266 303 303 LYS LYS A . n 
A 1 267 TYR 267 304 304 TYR TYR A . n 
A 1 268 ALA 268 305 305 ALA ALA A . n 
A 1 269 GLY 269 306 306 GLY GLY A . n 
A 1 270 LEU 270 307 307 LEU LEU A . n 
A 1 271 THR 271 308 308 THR THR A . n 
A 1 272 PHE 272 309 309 PHE PHE A . n 
A 1 273 PRO 273 310 310 PRO PRO A . n 
A 1 274 LYS 274 311 311 LYS LYS A . n 
A 1 275 LEU 275 312 312 LEU LEU A . n 
A 1 276 PHE 276 313 313 PHE PHE A . n 
A 1 277 PRO 277 314 314 PRO PRO A . n 
A 1 278 ASP 278 315 315 ASP ASP A . n 
A 1 279 SER 279 316 316 SER SER A . n 
A 1 280 LEU 280 317 317 LEU LEU A . n 
A 1 281 PHE 281 318 318 PHE PHE A . n 
A 1 282 PRO 282 319 ?   ?   ?   A . n 
A 1 283 ALA 283 320 ?   ?   ?   A . n 
A 1 284 ASP 284 321 321 ASP ASP A . n 
A 1 285 SER 285 322 322 SER SER A . n 
A 1 286 GLU 286 323 323 GLU GLU A . n 
A 1 287 HIS 287 324 324 HIS HIS A . n 
A 1 288 ASN 288 325 325 ASN ASN A . n 
A 1 289 LYS 289 326 326 LYS LYS A . n 
A 1 290 LEU 290 327 327 LEU LEU A . n 
A 1 291 LYS 291 328 328 LYS LYS A . n 
A 1 292 ALA 292 329 329 ALA ALA A . n 
A 1 293 SER 293 330 330 SER SER A . n 
A 1 294 GLN 294 331 331 GLN GLN A . n 
A 1 295 ALA 295 332 332 ALA ALA A . n 
A 1 296 ARG 296 333 333 ARG ARG A . n 
A 1 297 ASP 297 334 334 ASP ASP A . n 
A 1 298 LEU 298 335 335 LEU LEU A . n 
A 1 299 LEU 299 336 336 LEU LEU A . n 
A 1 300 SER 300 337 337 SER SER A . n 
A 1 301 LYS 301 338 338 LYS LYS A . n 
A 1 302 MET 302 339 339 MET MET A . n 
A 1 303 LEU 303 340 340 LEU LEU A . n 
A 1 304 VAL 304 341 341 VAL VAL A . n 
A 1 305 ILE 305 342 342 ILE ILE A . n 
A 1 306 ASP 306 343 343 ASP ASP A . n 
A 1 307 PRO 307 344 344 PRO PRO A . n 
A 1 308 ALA 308 345 345 ALA ALA A . n 
A 1 309 LYS 309 346 346 LYS LYS A . n 
A 1 310 ARG 310 347 347 ARG ARG A . n 
A 1 311 ILE 311 348 348 ILE ILE A . n 
A 1 312 SER 312 349 349 SER SER A . n 
A 1 313 VAL 313 350 350 VAL VAL A . n 
A 1 314 ASP 314 351 351 ASP ASP A . n 
A 1 315 ASP 315 352 352 ASP ASP A . n 
A 1 316 ALA 316 353 353 ALA ALA A . n 
A 1 317 LEU 317 354 354 LEU LEU A . n 
A 1 318 GLN 318 355 355 GLN GLN A . n 
A 1 319 HIS 319 356 356 HIS HIS A . n 
A 1 320 PRO 320 357 357 PRO PRO A . n 
A 1 321 TYR 321 358 358 TYR TYR A . n 
A 1 322 ILE 322 359 359 ILE ILE A . n 
A 1 323 ASN 323 360 360 ASN ASN A . n 
A 1 324 VAL 324 361 361 VAL VAL A . n 
A 1 325 TRP 325 362 362 TRP TRP A . n 
A 1 326 TYR 326 363 363 TYR TYR A . n 
A 1 327 ASP 327 364 364 ASP ASP A . n 
A 1 328 PRO 328 365 365 PRO PRO A . n 
A 1 329 ALA 329 366 366 ALA ALA A . n 
A 1 330 GLU 330 367 367 GLU GLU A . n 
A 1 331 VAL 331 368 368 VAL VAL A . n 
A 1 332 GLU 332 369 369 GLU GLU A . n 
A 1 333 ALA 333 370 370 ALA ALA A . n 
A 1 334 PRO 334 371 371 PRO PRO A . n 
A 1 335 PRO 335 372 372 PRO PRO A . n 
A 1 336 PRO 336 373 373 PRO PRO A . n 
A 1 337 GLN 337 374 ?   ?   ?   A . n 
A 1 338 ILE 338 375 ?   ?   ?   A . n 
A 1 339 TYR 339 376 ?   ?   ?   A . n 
A 1 340 ASP 340 377 ?   ?   ?   A . n 
A 1 341 LYS 341 378 ?   ?   ?   A . n 
A 1 342 GLN 342 379 ?   ?   ?   A . n 
A 1 343 LEU 343 380 ?   ?   ?   A . n 
A 1 344 ASP 344 381 ?   ?   ?   A . n 
A 1 345 GLU 345 382 ?   ?   ?   A . n 
A 1 346 ARG 346 383 ?   ?   ?   A . n 
A 1 347 GLU 347 384 ?   ?   ?   A . n 
A 1 348 HIS 348 385 385 HIS HIS A . n 
A 1 349 THR 349 386 386 THR THR A . n 
A 1 350 ILE 350 387 387 ILE ILE A . n 
A 1 351 GLU 351 388 388 GLU GLU A . n 
A 1 352 GLU 352 389 389 GLU GLU A . n 
A 1 353 TRP 353 390 390 TRP TRP A . n 
A 1 354 LYS 354 391 391 LYS LYS A . n 
A 1 355 GLU 355 392 392 GLU GLU A . n 
A 1 356 LEU 356 393 393 LEU LEU A . n 
A 1 357 ILE 357 394 394 ILE ILE A . n 
A 1 358 TYR 358 395 395 TYR TYR A . n 
A 1 359 LYS 359 396 396 LYS LYS A . n 
A 1 360 GLU 360 397 397 GLU GLU A . n 
A 1 361 VAL 361 398 398 VAL VAL A . n 
A 1 362 MET 362 399 399 MET MET A . n 
A 1 363 ASN 363 400 400 ASN ASN A . n 
A 1 364 SER 364 401 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ANP 1  501 502  ANP ANP A . 
C 3 880 1  502 501  880 880 A . 
D 4 UNX 1  503 2001 UNX UNX A . 
E 4 UNX 1  504 2002 UNX UNX A . 
F 4 UNX 1  505 2003 UNX UNX A . 
G 5 HOH 1  601 604  HOH HOH A . 
G 5 HOH 2  602 623  HOH HOH A . 
G 5 HOH 3  603 624  HOH HOH A . 
G 5 HOH 4  604 651  HOH HOH A . 
G 5 HOH 5  605 1012 HOH HOH A . 
G 5 HOH 6  606 611  HOH HOH A . 
G 5 HOH 7  607 614  HOH HOH A . 
G 5 HOH 8  608 665  HOH HOH A . 
G 5 HOH 9  609 1005 HOH HOH A . 
G 5 HOH 10 610 625  HOH HOH A . 
G 5 HOH 11 611 1006 HOH HOH A . 
G 5 HOH 12 612 613  HOH HOH A . 
G 5 HOH 13 613 1002 HOH HOH A . 
G 5 HOH 14 614 606  HOH HOH A . 
G 5 HOH 15 615 1004 HOH HOH A . 
G 5 HOH 16 616 629  HOH HOH A . 
G 5 HOH 17 617 631  HOH HOH A . 
G 5 HOH 18 618 609  HOH HOH A . 
G 5 HOH 19 619 633  HOH HOH A . 
G 5 HOH 20 620 603  HOH HOH A . 
G 5 HOH 21 621 664  HOH HOH A . 
G 5 HOH 22 622 608  HOH HOH A . 
G 5 HOH 23 623 634  HOH HOH A . 
G 5 HOH 24 624 656  HOH HOH A . 
G 5 HOH 25 625 602  HOH HOH A . 
G 5 HOH 26 626 607  HOH HOH A . 
G 5 HOH 27 627 610  HOH HOH A . 
G 5 HOH 28 628 654  HOH HOH A . 
G 5 HOH 29 629 655  HOH HOH A . 
G 5 HOH 30 630 616  HOH HOH A . 
G 5 HOH 31 631 601  HOH HOH A . 
G 5 HOH 32 632 1013 HOH HOH A . 
G 5 HOH 33 633 617  HOH HOH A . 
G 5 HOH 34 634 619  HOH HOH A . 
G 5 HOH 35 635 1014 HOH HOH A . 
G 5 HOH 36 636 640  HOH HOH A . 
G 5 HOH 37 637 658  HOH HOH A . 
G 5 HOH 38 638 628  HOH HOH A . 
G 5 HOH 39 639 612  HOH HOH A . 
G 5 HOH 40 640 615  HOH HOH A . 
G 5 HOH 41 641 627  HOH HOH A . 
G 5 HOH 42 642 1001 HOH HOH A . 
G 5 HOH 43 643 1016 HOH HOH A . 
G 5 HOH 44 644 671  HOH HOH A . 
G 5 HOH 45 645 1009 HOH HOH A . 
G 5 HOH 46 646 639  HOH HOH A . 
G 5 HOH 47 647 1015 HOH HOH A . 
G 5 HOH 48 648 677  HOH HOH A . 
G 5 HOH 49 649 663  HOH HOH A . 
G 5 HOH 50 650 626  HOH HOH A . 
G 5 HOH 51 651 605  HOH HOH A . 
G 5 HOH 52 652 1003 HOH HOH A . 
G 5 HOH 53 653 1011 HOH HOH A . 
G 5 HOH 54 654 632  HOH HOH A . 
G 5 HOH 55 655 1007 HOH HOH A . 
G 5 HOH 56 656 1008 HOH HOH A . 
G 5 HOH 57 657 680  HOH HOH A . 
G 5 HOH 58 658 1010 HOH HOH A . 
G 5 HOH 59 659 647  HOH HOH A . 
G 5 HOH 60 660 669  HOH HOH A . 
G 5 HOH 61 661 649  HOH HOH A . 
G 5 HOH 62 662 646  HOH HOH A . 
G 5 HOH 63 663 682  HOH HOH A . 
G 5 HOH 64 664 659  HOH HOH A . 
G 5 HOH 65 665 641  HOH HOH A . 
G 5 HOH 66 666 642  HOH HOH A . 
G 5 HOH 67 667 648  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-05-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         16.4640 
_pdbx_refine_tls.origin_y         15.1023 
_pdbx_refine_tls.origin_z         23.1047 
_pdbx_refine_tls.T[1][1]          -0.0929 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          -0.0159 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          -0.0011 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          -0.1595 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          -0.0099 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          -0.1329 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          0.4800 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          -0.1745 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          0.4235 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          1.5444 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          0.4799 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          4.0401 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          0.0236 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          -0.0045 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          -0.0112 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          -0.0301 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          -0.0509 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          0.0300 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tls.S[3][1]          -0.0191 
_pdbx_refine_tls.S[3][1]_esd      ? 
_pdbx_refine_tls.S[3][2]          -0.1145 
_pdbx_refine_tls.S[3][2]_esd      ? 
_pdbx_refine_tls.S[3][3]          0.0272 
_pdbx_refine_tls.S[3][3]_esd      ? 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   '{ A|* }' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER    ? ? ? 2.11.6 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000  ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? .      3 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot      ? ? ? .      4 
? phasing          ? ? ? ? ? ? ? ? ? ? ? CNX       ? ? ? .      5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 117 ? ? -90.47  51.00  
2 1 GLN A 140 ? ? -132.64 -53.40 
3 1 ARG A 188 ? ? 75.49   -7.30  
4 1 ASN A 243 ? ? -68.91  4.44   
5 1 PRO A 371 ? ? -35.12  119.44 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             ALA 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              370 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   11.69 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 55  ? CG  ? A ASP 18  CG  
2  1 Y 1 A ASP 55  ? OD1 ? A ASP 18  OD1 
3  1 Y 1 A ASP 55  ? OD2 ? A ASP 18  OD2 
4  1 Y 1 A LYS 116 ? CG  ? A LYS 79  CG  
5  1 Y 1 A LYS 116 ? CD  ? A LYS 79  CD  
6  1 Y 1 A LYS 116 ? CE  ? A LYS 79  CE  
7  1 Y 1 A LYS 116 ? NZ  ? A LYS 79  NZ  
8  1 Y 1 A CYS 117 ? SG  ? A CYS 80  SG  
9  1 Y 1 A VAL 118 ? CG1 ? A VAL 81  CG1 
10 1 Y 1 A VAL 118 ? CG2 ? A VAL 81  CG2 
11 1 Y 1 A GLU 137 ? CG  ? A GLU 100 CG  
12 1 Y 1 A GLU 137 ? CD  ? A GLU 100 CD  
13 1 Y 1 A GLU 137 ? OE1 ? A GLU 100 OE1 
14 1 Y 1 A GLU 137 ? OE2 ? A GLU 100 OE2 
15 1 Y 1 A MET 219 ? CG  ? A MET 182 CG  
16 1 Y 1 A MET 219 ? SD  ? A MET 182 SD  
17 1 Y 1 A MET 219 ? CE  ? A MET 182 CE  
18 1 Y 1 A VAL 225 ? CG1 ? A VAL 188 CG1 
19 1 Y 1 A VAL 225 ? CG2 ? A VAL 188 CG2 
20 1 Y 1 A ARG 266 ? CG  ? A ARG 229 CG  
21 1 Y 1 A ARG 266 ? CD  ? A ARG 229 CD  
22 1 Y 1 A ARG 266 ? NE  ? A ARG 229 NE  
23 1 Y 1 A ARG 266 ? CZ  ? A ARG 229 CZ  
24 1 Y 1 A ARG 266 ? NH1 ? A ARG 229 NH1 
25 1 Y 1 A ARG 266 ? NH2 ? A ARG 229 NH2 
26 1 Y 1 A GLU 285 ? CG  ? A GLU 248 CG  
27 1 Y 1 A GLU 285 ? CD  ? A GLU 248 CD  
28 1 Y 1 A GLU 285 ? OE1 ? A GLU 248 OE1 
29 1 Y 1 A GLU 285 ? OE2 ? A GLU 248 OE2 
30 1 Y 1 A LYS 288 ? CG  ? A LYS 251 CG  
31 1 Y 1 A LYS 288 ? CD  ? A LYS 251 CD  
32 1 Y 1 A LYS 288 ? CE  ? A LYS 251 CE  
33 1 Y 1 A LYS 288 ? NZ  ? A LYS 251 NZ  
34 1 Y 1 A GLN 291 ? CG  ? A GLN 254 CG  
35 1 Y 1 A GLN 291 ? CD  ? A GLN 254 CD  
36 1 Y 1 A GLN 291 ? OE1 ? A GLN 254 OE1 
37 1 Y 1 A GLN 291 ? NE2 ? A GLN 254 NE2 
38 1 Y 1 A ARG 295 ? CG  ? A ARG 258 CG  
39 1 Y 1 A ARG 295 ? CD  ? A ARG 258 CD  
40 1 Y 1 A ARG 295 ? NE  ? A ARG 258 NE  
41 1 Y 1 A ARG 295 ? CZ  ? A ARG 258 CZ  
42 1 Y 1 A ARG 295 ? NH1 ? A ARG 258 NH1 
43 1 Y 1 A ARG 295 ? NH2 ? A ARG 258 NH2 
44 1 Y 1 A ASN 300 ? CG  ? A ASN 263 CG  
45 1 Y 1 A ASN 300 ? OD1 ? A ASN 263 OD1 
46 1 Y 1 A ASN 300 ? ND2 ? A ASN 263 ND2 
47 1 Y 1 A ARG 301 ? CG  ? A ARG 264 CG  
48 1 Y 1 A ARG 301 ? CD  ? A ARG 264 CD  
49 1 Y 1 A ARG 301 ? NE  ? A ARG 264 NE  
50 1 Y 1 A ARG 301 ? CZ  ? A ARG 264 CZ  
51 1 Y 1 A ARG 301 ? NH1 ? A ARG 264 NH1 
52 1 Y 1 A ARG 301 ? NH2 ? A ARG 264 NH2 
53 1 Y 1 A LYS 303 ? CG  ? A LYS 266 CG  
54 1 Y 1 A LYS 303 ? CD  ? A LYS 266 CD  
55 1 Y 1 A LYS 303 ? CE  ? A LYS 266 CE  
56 1 Y 1 A LYS 303 ? NZ  ? A LYS 266 NZ  
57 1 Y 1 A SER 316 ? OG  ? A SER 279 OG  
58 1 Y 1 A ASP 321 ? CG  ? A ASP 284 CG  
59 1 Y 1 A ASP 321 ? OD1 ? A ASP 284 OD1 
60 1 Y 1 A ASP 321 ? OD2 ? A ASP 284 OD2 
61 1 Y 1 A PRO 371 ? CG  ? A PRO 334 CG  
62 1 Y 1 A PRO 371 ? CD  ? A PRO 334 CD  
63 1 Y 1 A GLU 388 ? CG  ? A GLU 351 CG  
64 1 Y 1 A GLU 388 ? CD  ? A GLU 351 CD  
65 1 Y 1 A GLU 388 ? OE1 ? A GLU 351 OE1 
66 1 Y 1 A GLU 388 ? OE2 ? A GLU 351 OE2 
67 1 Y 1 A LYS 396 ? CG  ? A LYS 359 CG  
68 1 Y 1 A LYS 396 ? CD  ? A LYS 359 CD  
69 1 Y 1 A LYS 396 ? CE  ? A LYS 359 CE  
70 1 Y 1 A LYS 396 ? NZ  ? A LYS 359 NZ  
71 1 Y 1 A ASN 400 ? CG  ? A ASN 363 CG  
72 1 Y 1 A ASN 400 ? OD1 ? A ASN 363 OD1 
73 1 Y 1 A ASN 400 ? ND2 ? A ASN 363 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 38  ? A MET 1   
2  1 Y 1 A ALA 39  ? A ALA 2   
3  1 Y 1 A SER 40  ? A SER 3   
4  1 Y 1 A LYS 41  ? A LYS 4   
5  1 Y 1 A SER 42  ? A SER 5   
6  1 Y 1 A LYS 43  ? A LYS 6   
7  1 Y 1 A VAL 44  ? A VAL 7   
8  1 Y 1 A ALA 211 ? A ALA 174 
9  1 Y 1 A ARG 212 ? A ARG 175 
10 1 Y 1 A THR 213 ? A THR 176 
11 1 Y 1 A ALA 214 ? A ALA 177 
12 1 Y 1 A GLY 215 ? A GLY 178 
13 1 Y 1 A THR 216 ? A THR 179 
14 1 Y 1 A THR 221 ? A THR 184 
15 1 Y 1 A PRO 222 ? A PRO 185 
16 1 Y 1 A TYR 223 ? A TYR 186 
17 1 Y 1 A VAL 224 ? A VAL 187 
18 1 Y 1 A PRO 319 ? A PRO 282 
19 1 Y 1 A ALA 320 ? A ALA 283 
20 1 Y 1 A GLN 374 ? A GLN 337 
21 1 Y 1 A ILE 375 ? A ILE 338 
22 1 Y 1 A TYR 376 ? A TYR 339 
23 1 Y 1 A ASP 377 ? A ASP 340 
24 1 Y 1 A LYS 378 ? A LYS 341 
25 1 Y 1 A GLN 379 ? A GLN 342 
26 1 Y 1 A LEU 380 ? A LEU 343 
27 1 Y 1 A ASP 381 ? A ASP 344 
28 1 Y 1 A GLU 382 ? A GLU 345 
29 1 Y 1 A ARG 383 ? A ARG 346 
30 1 Y 1 A GLU 384 ? A GLU 347 
31 1 Y 1 A SER 401 ? A SER 364 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER'                                                            ANP 
3 'CYCLOHEXYL-{4-[5-(3,4-DICHLOROPHENYL)-2-PIPERIDIN-4-YL-3-PROPYL-3H-IMIDAZOL-4-YL]-PYRIMIDIN-2-YL}AMINE' 880 
4 'UNKNOWN ATOM OR ION'                                                                                    UNX 
5 water                                                                                                    HOH 
#