data_4ZDR
# 
_entry.id   4ZDR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ZDR         
WWPDB D_1000208886 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4ZDR 
_pdbx_database_status.recvd_initial_deposition_date   2015-04-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ding, S.'  1 
'Shi, Z.B.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.F' 
_citation.journal_id_ASTM           ACSFEN 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2053-230X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            71 
_citation.language                  ? 
_citation.page_first                1114 
_citation.page_last                 1119 
_citation.title                     
'Structure of the 14-3-3 zeta-LKB1 fusion protein provides insight into a novel ligand-binding mode of 14-3-3.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S2053230X15012595 
_citation.pdbx_database_id_PubMed   26323294 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ding, S.' 1 ? 
primary 'Zhou, R.' 2 ? 
primary 'Zhu, Y.'  3 ? 
# 
_cell.entry_id           4ZDR 
_cell.length_a           130.262 
_cell.length_b           130.262 
_cell.length_c           264.960 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              36 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4ZDR 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '14-3-3 protein zeta/delta,GGSGGS linker,Serine/threonine-protein kinase STK11' 30349.270 2 ? T240E 
'UNP residues 1-230,UNP residues 333-340' ? 
2 non-polymer syn GLYCEROL                                                                        92.094    3 ? ?     ? ? 
3 non-polymer syn 'SULFATE ION'                                                                   96.063    2 ? ?     ? ? 
4 non-polymer syn PROPANE                                                                         44.096    6 ? ?     ? ? 
5 water       nat water                                                                           18.015    8 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein kinase C inhibitor protein 1,KCIP-1,Liver kinase B1,hLKB1,Renal carcinoma antigen NY-REN-19' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSYYHHHHHHLESTSLYKKAGLMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSS
WRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDK
KGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIM
QLLRDNLTLWTSGGSGGSRSMEVVPY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSYYHHHHHHLESTSLYKKAGLMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSS
WRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDK
KGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIM
QLLRDNLTLWTSGGSGGSRSMEVVPY
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   TYR n 
1 4   TYR n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  LEU n 
1 12  GLU n 
1 13  SER n 
1 14  THR n 
1 15  SER n 
1 16  LEU n 
1 17  TYR n 
1 18  LYS n 
1 19  LYS n 
1 20  ALA n 
1 21  GLY n 
1 22  LEU n 
1 23  MET n 
1 24  ASP n 
1 25  LYS n 
1 26  ASN n 
1 27  GLU n 
1 28  LEU n 
1 29  VAL n 
1 30  GLN n 
1 31  LYS n 
1 32  ALA n 
1 33  LYS n 
1 34  LEU n 
1 35  ALA n 
1 36  GLU n 
1 37  GLN n 
1 38  ALA n 
1 39  GLU n 
1 40  ARG n 
1 41  TYR n 
1 42  ASP n 
1 43  ASP n 
1 44  MET n 
1 45  ALA n 
1 46  ALA n 
1 47  CYS n 
1 48  MET n 
1 49  LYS n 
1 50  SER n 
1 51  VAL n 
1 52  THR n 
1 53  GLU n 
1 54  GLN n 
1 55  GLY n 
1 56  ALA n 
1 57  GLU n 
1 58  LEU n 
1 59  SER n 
1 60  ASN n 
1 61  GLU n 
1 62  GLU n 
1 63  ARG n 
1 64  ASN n 
1 65  LEU n 
1 66  LEU n 
1 67  SER n 
1 68  VAL n 
1 69  ALA n 
1 70  TYR n 
1 71  LYS n 
1 72  ASN n 
1 73  VAL n 
1 74  VAL n 
1 75  GLY n 
1 76  ALA n 
1 77  ARG n 
1 78  ARG n 
1 79  SER n 
1 80  SER n 
1 81  TRP n 
1 82  ARG n 
1 83  VAL n 
1 84  VAL n 
1 85  SER n 
1 86  SER n 
1 87  ILE n 
1 88  GLU n 
1 89  GLN n 
1 90  LYS n 
1 91  THR n 
1 92  GLU n 
1 93  GLY n 
1 94  ALA n 
1 95  GLU n 
1 96  LYS n 
1 97  LYS n 
1 98  GLN n 
1 99  GLN n 
1 100 MET n 
1 101 ALA n 
1 102 ARG n 
1 103 GLU n 
1 104 TYR n 
1 105 ARG n 
1 106 GLU n 
1 107 LYS n 
1 108 ILE n 
1 109 GLU n 
1 110 THR n 
1 111 GLU n 
1 112 LEU n 
1 113 ARG n 
1 114 ASP n 
1 115 ILE n 
1 116 CYS n 
1 117 ASN n 
1 118 ASP n 
1 119 VAL n 
1 120 LEU n 
1 121 SER n 
1 122 LEU n 
1 123 LEU n 
1 124 GLU n 
1 125 LYS n 
1 126 PHE n 
1 127 LEU n 
1 128 ILE n 
1 129 PRO n 
1 130 ASN n 
1 131 ALA n 
1 132 SER n 
1 133 GLN n 
1 134 ALA n 
1 135 GLU n 
1 136 SER n 
1 137 LYS n 
1 138 VAL n 
1 139 PHE n 
1 140 TYR n 
1 141 LEU n 
1 142 LYS n 
1 143 MET n 
1 144 LYS n 
1 145 GLY n 
1 146 ASP n 
1 147 TYR n 
1 148 TYR n 
1 149 ARG n 
1 150 TYR n 
1 151 LEU n 
1 152 ALA n 
1 153 GLU n 
1 154 VAL n 
1 155 ALA n 
1 156 ALA n 
1 157 GLY n 
1 158 ASP n 
1 159 ASP n 
1 160 LYS n 
1 161 LYS n 
1 162 GLY n 
1 163 ILE n 
1 164 VAL n 
1 165 ASP n 
1 166 GLN n 
1 167 SER n 
1 168 GLN n 
1 169 GLN n 
1 170 ALA n 
1 171 TYR n 
1 172 GLN n 
1 173 GLU n 
1 174 ALA n 
1 175 PHE n 
1 176 GLU n 
1 177 ILE n 
1 178 SER n 
1 179 LYS n 
1 180 LYS n 
1 181 GLU n 
1 182 MET n 
1 183 GLN n 
1 184 PRO n 
1 185 THR n 
1 186 HIS n 
1 187 PRO n 
1 188 ILE n 
1 189 ARG n 
1 190 LEU n 
1 191 GLY n 
1 192 LEU n 
1 193 ALA n 
1 194 LEU n 
1 195 ASN n 
1 196 PHE n 
1 197 SER n 
1 198 VAL n 
1 199 PHE n 
1 200 TYR n 
1 201 TYR n 
1 202 GLU n 
1 203 ILE n 
1 204 LEU n 
1 205 ASN n 
1 206 SER n 
1 207 PRO n 
1 208 GLU n 
1 209 LYS n 
1 210 ALA n 
1 211 CYS n 
1 212 SER n 
1 213 LEU n 
1 214 ALA n 
1 215 LYS n 
1 216 THR n 
1 217 ALA n 
1 218 PHE n 
1 219 ASP n 
1 220 GLU n 
1 221 ALA n 
1 222 ILE n 
1 223 ALA n 
1 224 GLU n 
1 225 LEU n 
1 226 ASP n 
1 227 THR n 
1 228 LEU n 
1 229 SER n 
1 230 GLU n 
1 231 GLU n 
1 232 SER n 
1 233 TYR n 
1 234 LYS n 
1 235 ASP n 
1 236 SER n 
1 237 THR n 
1 238 LEU n 
1 239 ILE n 
1 240 MET n 
1 241 GLN n 
1 242 LEU n 
1 243 LEU n 
1 244 ARG n 
1 245 ASP n 
1 246 ASN n 
1 247 LEU n 
1 248 THR n 
1 249 LEU n 
1 250 TRP n 
1 251 THR n 
1 252 SER n 
1 253 GLY n 
1 254 GLY n 
1 255 SER n 
1 256 GLY n 
1 257 GLY n 
1 258 SER n 
1 259 ARG n 
1 260 SER n 
1 261 MET n 
1 262 GLU n 
1 263 VAL n 
1 264 VAL n 
1 265 PRO n 
1 266 TYR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   252 Human ? YWHAZ              ? ? ? ? ? ? 'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' Codonplus ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 253 258 ?     ? ?                  ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' ?         ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 3 sample 'Biological sequence' 259 266 Human ? 'STK11, LKB1, PJS' ? ? ? ? ? ? 'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? 'BL21(DE3)' Codonplus ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.details 
_struct_ref.entity_id 
_struct_ref.id 
_struct_ref.seq_align 
_struct_ref.seq_dif 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_align_end 
1433Z_HUMAN UNP ? 1 1 ? ? P63104 ? 
;MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAR
EYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEM
QPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS
;
1   ? 
4ZDR        PDB ? 1 2 ? ? 4ZDR   ? ? 253 ? 
STK11_HUMAN UNP ? 1 3 ? ? Q15831 ? RSMTVVPY 333 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ZDR A 23  ? 252 ? P63104 1   ? 230 ? 1   230 
2 2 4ZDR A 253 ? 258 ? 4ZDR   231 ? 236 ? 231 236 
3 3 4ZDR A 259 ? 266 ? Q15831 333 ? 340 ? 237 244 
4 1 4ZDR B 23  ? 252 ? P63104 1   ? 230 ? 1   230 
5 2 4ZDR B 253 ? 258 ? 4ZDR   231 ? 236 ? 231 236 
6 3 4ZDR B 259 ? 266 ? Q15831 333 ? 340 ? 237 244 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ZDR MET A 1   ? UNP P63104 ?   ?   'expression tag'      -21 1  
1 4ZDR SER A 2   ? UNP P63104 ?   ?   'expression tag'      -20 2  
1 4ZDR TYR A 3   ? UNP P63104 ?   ?   'expression tag'      -19 3  
1 4ZDR TYR A 4   ? UNP P63104 ?   ?   'expression tag'      -18 4  
1 4ZDR HIS A 5   ? UNP P63104 ?   ?   'expression tag'      -17 5  
1 4ZDR HIS A 6   ? UNP P63104 ?   ?   'expression tag'      -16 6  
1 4ZDR HIS A 7   ? UNP P63104 ?   ?   'expression tag'      -15 7  
1 4ZDR HIS A 8   ? UNP P63104 ?   ?   'expression tag'      -14 8  
1 4ZDR HIS A 9   ? UNP P63104 ?   ?   'expression tag'      -13 9  
1 4ZDR HIS A 10  ? UNP P63104 ?   ?   'expression tag'      -12 10 
1 4ZDR LEU A 11  ? UNP P63104 ?   ?   'expression tag'      -11 11 
1 4ZDR GLU A 12  ? UNP P63104 ?   ?   'expression tag'      -10 12 
1 4ZDR SER A 13  ? UNP P63104 ?   ?   'expression tag'      -9  13 
1 4ZDR THR A 14  ? UNP P63104 ?   ?   'expression tag'      -8  14 
1 4ZDR SER A 15  ? UNP P63104 ?   ?   'expression tag'      -7  15 
1 4ZDR LEU A 16  ? UNP P63104 ?   ?   'expression tag'      -6  16 
1 4ZDR TYR A 17  ? UNP P63104 ?   ?   'expression tag'      -5  17 
1 4ZDR LYS A 18  ? UNP P63104 ?   ?   'expression tag'      -4  18 
1 4ZDR LYS A 19  ? UNP P63104 ?   ?   'expression tag'      -3  19 
1 4ZDR ALA A 20  ? UNP P63104 ?   ?   'expression tag'      -2  20 
1 4ZDR GLY A 21  ? UNP P63104 ?   ?   'expression tag'      -1  21 
1 4ZDR LEU A 22  ? UNP P63104 ?   ?   'expression tag'      0   22 
3 4ZDR GLU A 262 ? UNP Q15831 THR 336 'engineered mutation' 240 23 
4 4ZDR MET B 1   ? UNP P63104 ?   ?   'expression tag'      -21 24 
4 4ZDR SER B 2   ? UNP P63104 ?   ?   'expression tag'      -20 25 
4 4ZDR TYR B 3   ? UNP P63104 ?   ?   'expression tag'      -19 26 
4 4ZDR TYR B 4   ? UNP P63104 ?   ?   'expression tag'      -18 27 
4 4ZDR HIS B 5   ? UNP P63104 ?   ?   'expression tag'      -17 28 
4 4ZDR HIS B 6   ? UNP P63104 ?   ?   'expression tag'      -16 29 
4 4ZDR HIS B 7   ? UNP P63104 ?   ?   'expression tag'      -15 30 
4 4ZDR HIS B 8   ? UNP P63104 ?   ?   'expression tag'      -14 31 
4 4ZDR HIS B 9   ? UNP P63104 ?   ?   'expression tag'      -13 32 
4 4ZDR HIS B 10  ? UNP P63104 ?   ?   'expression tag'      -12 33 
4 4ZDR LEU B 11  ? UNP P63104 ?   ?   'expression tag'      -11 34 
4 4ZDR GLU B 12  ? UNP P63104 ?   ?   'expression tag'      -10 35 
4 4ZDR SER B 13  ? UNP P63104 ?   ?   'expression tag'      -9  36 
4 4ZDR THR B 14  ? UNP P63104 ?   ?   'expression tag'      -8  37 
4 4ZDR SER B 15  ? UNP P63104 ?   ?   'expression tag'      -7  38 
4 4ZDR LEU B 16  ? UNP P63104 ?   ?   'expression tag'      -6  39 
4 4ZDR TYR B 17  ? UNP P63104 ?   ?   'expression tag'      -5  40 
4 4ZDR LYS B 18  ? UNP P63104 ?   ?   'expression tag'      -4  41 
4 4ZDR LYS B 19  ? UNP P63104 ?   ?   'expression tag'      -3  42 
4 4ZDR ALA B 20  ? UNP P63104 ?   ?   'expression tag'      -2  43 
4 4ZDR GLY B 21  ? UNP P63104 ?   ?   'expression tag'      -1  44 
4 4ZDR LEU B 22  ? UNP P63104 ?   ?   'expression tag'      0   45 
6 4ZDR GLU B 262 ? UNP Q15831 THR 336 'engineered mutation' 240 46 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TME non-polymer         . PROPANE         ?                               'C3 H8'          44.096  
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4ZDR 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.90 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.47 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1.4 M Li2SO4, 0.1 M BIS-TRIS propane' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX-225' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-04-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9793 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9793 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4ZDR 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.899 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       19507 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  10.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            43 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.899 
_reflns_shell.d_res_low                   2.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             11.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4ZDR 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     19496 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.964 
_refine.ls_d_res_high                            2.899 
_refine.ls_percent_reflns_obs                    99.86 
_refine.ls_R_factor_obs                          0.1962 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1907 
_refine.ls_R_factor_R_free                       0.2453 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.01 
_refine.ls_number_reflns_R_free                  1951 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4FJ3 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.38 
_refine.pdbx_overall_phase_error                 27.84 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3700 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         46 
_refine_hist.number_atoms_solvent             8 
_refine_hist.number_atoms_total               3754 
_refine_hist.d_res_high                       2.899 
_refine_hist.d_res_low                        47.964 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 3782 'X-RAY DIFFRACTION' ? 
f_angle_d          1.190  ? ? 5102 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.236 ? ? 1365 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.044  ? ? 584  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 660  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.8989 2.9713  1216 0.2991 99.00  0.3709 . . 136 . . 
'X-RAY DIFFRACTION' . 2.9713 3.0517  1247 0.2641 100.00 0.2856 . . 137 . . 
'X-RAY DIFFRACTION' . 3.0517 3.1414  1218 0.2598 100.00 0.3324 . . 136 . . 
'X-RAY DIFFRACTION' . 3.1414 3.2428  1253 0.2500 100.00 0.3364 . . 139 . . 
'X-RAY DIFFRACTION' . 3.2428 3.3587  1234 0.2432 100.00 0.3219 . . 138 . . 
'X-RAY DIFFRACTION' . 3.3587 3.4931  1235 0.2160 100.00 0.2709 . . 137 . . 
'X-RAY DIFFRACTION' . 3.4931 3.6521  1244 0.2014 100.00 0.2830 . . 139 . . 
'X-RAY DIFFRACTION' . 3.6521 3.8445  1262 0.1859 100.00 0.2478 . . 140 . . 
'X-RAY DIFFRACTION' . 3.8445 4.0853  1244 0.1850 100.00 0.2446 . . 139 . . 
'X-RAY DIFFRACTION' . 4.0853 4.4005  1243 0.1651 100.00 0.2236 . . 138 . . 
'X-RAY DIFFRACTION' . 4.4005 4.8430  1277 0.1588 100.00 0.2286 . . 140 . . 
'X-RAY DIFFRACTION' . 4.8430 5.5429  1255 0.1900 100.00 0.2509 . . 140 . . 
'X-RAY DIFFRACTION' . 5.5429 6.9800  1283 0.2162 100.00 0.2333 . . 143 . . 
'X-RAY DIFFRACTION' . 6.9800 47.9703 1334 0.1618 99.00  0.2027 . . 149 . . 
# 
_struct.entry_id                     4ZDR 
_struct.title                        'Crystal structure of 14-3-3[zeta]-LKB1 fusion protein' 
_struct.pdbx_descriptor              '14-3-3 protein zeta/delta,GGSGGS linker,Serine/threonine-protein kinase STK11' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4ZDR 
_struct_keywords.text            
'chimeric protein, regulatory protein, tumor suppressor, serine/threonine-protein kinase, PROTEIN BINDING' 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 4 ? 
N N N 5 ? 
O N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 24  ? ALA A 38  ? ASP A 2   ALA A 16  1 ? 15 
HELX_P HELX_P2  AA2 ARG A 40  ? GLN A 54  ? ARG A 18  GLN A 32  1 ? 15 
HELX_P HELX_P3  AA3 SER A 59  ? LYS A 90  ? SER A 37  LYS A 68  1 ? 32 
HELX_P HELX_P4  AA4 LYS A 96  ? PHE A 126 ? LYS A 74  PHE A 104 1 ? 31 
HELX_P HELX_P5  AA5 GLN A 133 ? ALA A 155 ? GLN A 111 ALA A 133 1 ? 23 
HELX_P HELX_P6  AA6 ALA A 156 ? MET A 182 ? ALA A 134 MET A 160 1 ? 27 
HELX_P HELX_P7  AA7 HIS A 186 ? ILE A 203 ? HIS A 164 ILE A 181 1 ? 18 
HELX_P HELX_P8  AA8 SER A 206 ? ALA A 223 ? SER A 184 ALA A 201 1 ? 18 
HELX_P HELX_P9  AA9 SER A 229 ? TRP A 250 ? SER A 207 TRP A 228 1 ? 22 
HELX_P HELX_P10 AB1 ARG A 259 ? VAL A 263 ? ARG A 237 VAL A 241 5 ? 5  
HELX_P HELX_P11 AB2 ASP B 24  ? ALA B 38  ? ASP B 2   ALA B 16  1 ? 15 
HELX_P HELX_P12 AB3 ARG B 40  ? GLN B 54  ? ARG B 18  GLN B 32  1 ? 15 
HELX_P HELX_P13 AB4 SER B 59  ? LYS B 90  ? SER B 37  LYS B 68  1 ? 32 
HELX_P HELX_P14 AB5 LYS B 96  ? PHE B 126 ? LYS B 74  PHE B 104 1 ? 31 
HELX_P HELX_P15 AB6 PHE B 126 ? ALA B 131 ? PHE B 104 ALA B 109 1 ? 6  
HELX_P HELX_P16 AB7 GLN B 133 ? GLU B 153 ? GLN B 111 GLU B 131 1 ? 21 
HELX_P HELX_P17 AB8 ALA B 156 ? MET B 182 ? ALA B 134 MET B 160 1 ? 27 
HELX_P HELX_P18 AB9 HIS B 186 ? ILE B 203 ? HIS B 164 ILE B 181 1 ? 18 
HELX_P HELX_P19 AC1 SER B 206 ? GLU B 224 ? SER B 184 GLU B 202 1 ? 19 
HELX_P HELX_P20 AC2 TYR B 233 ? SER B 252 ? TYR B 211 SER B 230 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           228 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            206 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    229 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     207 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.21 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GOL 301 ? 4 'binding site for residue GOL A 301' 
AC2 Software A GOL 302 ? 3 'binding site for residue GOL A 302' 
AC3 Software A SO4 303 ? 3 'binding site for residue SO4 A 303' 
AC4 Software A TME 304 ? 1 'binding site for residue TME A 304' 
AC5 Software A TME 305 ? 1 'binding site for residue TME A 305' 
AC6 Software A TME 306 ? 2 'binding site for residue TME A 306' 
AC7 Software A TME 307 ? 2 'binding site for residue TME A 307' 
AC8 Software B GOL 301 ? 3 'binding site for residue GOL B 301' 
AC9 Software B SO4 302 ? 4 'binding site for residue SO4 B 302' 
AD1 Software B TME 303 ? 2 'binding site for residue TME B 303' 
AD2 Software B TME 304 ? 1 'binding site for residue TME B 304' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 SER A 59  ? SER A 37  . ? 1_555 ? 
2  AC1 4 ASN A 60  ? ASN A 38  . ? 1_555 ? 
3  AC1 4 GLU A 61  ? GLU A 39  . ? 1_555 ? 
4  AC1 4 ASN B 205 ? ASN B 183 . ? 3_545 ? 
5  AC2 3 GLN A 241 ? GLN A 219 . ? 6_555 ? 
6  AC2 3 ARG A 244 ? ARG A 222 . ? 1_555 ? 
7  AC2 3 TME H .   ? TME A 306 . ? 1_555 ? 
8  AC3 3 ARG A 78  ? ARG A 56  . ? 1_555 ? 
9  AC3 3 ARG A 149 ? ARG A 127 . ? 1_555 ? 
10 AC3 3 TYR A 150 ? TYR A 128 . ? 1_555 ? 
11 AC4 1 GLU A 36  ? GLU A 14  . ? 1_555 ? 
12 AC5 1 ASN A 64  ? ASN A 42  . ? 1_555 ? 
13 AC6 2 TYR A 233 ? TYR A 211 . ? 6_555 ? 
14 AC6 2 GOL D .   ? GOL A 302 . ? 1_555 ? 
15 AC7 2 LYS A 25  ? LYS A 3   . ? 1_555 ? 
16 AC7 2 GLN A 54  ? GLN A 32  . ? 1_555 ? 
17 AC8 3 SER B 59  ? SER B 37  . ? 1_555 ? 
18 AC8 3 ASN B 60  ? ASN B 38  . ? 1_555 ? 
19 AC8 3 GLU B 61  ? GLU B 39  . ? 1_555 ? 
20 AC9 4 ARG B 78  ? ARG B 56  . ? 1_555 ? 
21 AC9 4 ARG B 149 ? ARG B 127 . ? 1_555 ? 
22 AC9 4 TYR B 150 ? TYR B 128 . ? 1_555 ? 
23 AC9 4 ARG B 259 ? ARG B 237 . ? 1_555 ? 
24 AD1 2 ILE B 115 ? ILE B 93  . ? 1_555 ? 
25 AD1 2 ASP B 118 ? ASP B 96  . ? 1_555 ? 
26 AD2 1 ARG B 82  ? ARG B 60  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4ZDR 
_atom_sites.fract_transf_matrix[1][1]   0.007677 
_atom_sites.fract_transf_matrix[1][2]   0.004432 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008864 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003774 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 16  ? 5.747   -48.344 50.211 1.00 98.01  ? -6  LEU A N   1 
ATOM   2    C CA  . LEU A 1 16  ? 4.440   -47.869 50.665 1.00 104.97 ? -6  LEU A CA  1 
ATOM   3    C C   . LEU A 1 16  ? 3.898   -48.594 51.893 1.00 97.02  ? -6  LEU A C   1 
ATOM   4    O O   . LEU A 1 16  ? 4.262   -48.294 53.023 1.00 96.54  ? -6  LEU A O   1 
ATOM   5    C CB  . LEU A 1 16  ? 3.409   -47.993 49.537 1.00 104.20 ? -6  LEU A CB  1 
ATOM   6    C CG  . LEU A 1 16  ? 2.997   -46.710 48.825 1.00 104.80 ? -6  LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 16  ? 4.085   -46.223 47.858 1.00 102.90 ? -6  LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 16  ? 1.633   -46.888 48.159 1.00 92.74  ? -6  LEU A CD2 1 
ATOM   9    N N   . TYR A 1 17  ? 2.954   -49.496 51.631 1.00 102.08 ? -5  TYR A N   1 
ATOM   10   C CA  . TYR A 1 17  ? 2.462   -50.498 52.585 1.00 100.20 ? -5  TYR A CA  1 
ATOM   11   C C   . TYR A 1 17  ? 2.300   -51.852 51.852 1.00 98.11  ? -5  TYR A C   1 
ATOM   12   O O   . TYR A 1 17  ? 1.208   -52.438 51.763 1.00 86.58  ? -5  TYR A O   1 
ATOM   13   C CB  . TYR A 1 17  ? 1.153   -50.050 53.262 1.00 99.68  ? -5  TYR A CB  1 
ATOM   14   C CG  . TYR A 1 17  ? 0.046   -49.567 52.336 1.00 94.09  ? -5  TYR A CG  1 
ATOM   15   C CD1 . TYR A 1 17  ? -1.046  -50.362 52.045 1.00 92.33  ? -5  TYR A CD1 1 
ATOM   16   C CD2 . TYR A 1 17  ? 0.091   -48.301 51.773 1.00 100.99 ? -5  TYR A CD2 1 
ATOM   17   N N   . LYS A 1 18  ? 3.427   -52.305 51.304 1.00 95.14  ? -4  LYS A N   1 
ATOM   18   C CA  . LYS A 1 18  ? 3.589   -53.632 50.745 1.00 89.83  ? -4  LYS A CA  1 
ATOM   19   C C   . LYS A 1 18  ? 4.619   -54.335 51.620 1.00 93.37  ? -4  LYS A C   1 
ATOM   20   O O   . LYS A 1 18  ? 5.377   -53.672 52.321 1.00 91.04  ? -4  LYS A O   1 
ATOM   21   C CB  . LYS A 1 18  ? 4.041   -53.569 49.279 1.00 89.14  ? -4  LYS A CB  1 
ATOM   22   C CG  . LYS A 1 18  ? 3.223   -52.639 48.400 1.00 80.48  ? -4  LYS A CG  1 
ATOM   23   C CD  . LYS A 1 18  ? 2.662   -53.389 47.211 1.00 77.12  ? -4  LYS A CD  1 
ATOM   24   C CE  . LYS A 1 18  ? 1.524   -52.606 46.588 1.00 77.27  ? -4  LYS A CE  1 
ATOM   25   N NZ  . LYS A 1 18  ? 1.177   -53.097 45.208 1.00 87.08  ? -4  LYS A NZ  1 
ATOM   26   N N   . LYS A 1 19  ? 4.668   -55.664 51.584 1.00 99.09  ? -3  LYS A N   1 
ATOM   27   C CA  . LYS A 1 19  ? 5.387   -56.377 52.633 1.00 98.38  ? -3  LYS A CA  1 
ATOM   28   C C   . LYS A 1 19  ? 6.827   -56.747 52.292 1.00 97.79  ? -3  LYS A C   1 
ATOM   29   O O   . LYS A 1 19  ? 7.411   -57.548 53.019 1.00 111.78 ? -3  LYS A O   1 
ATOM   30   C CB  . LYS A 1 19  ? 4.619   -57.652 53.034 1.00 91.09  ? -3  LYS A CB  1 
ATOM   31   N N   . ALA A 1 20  ? 7.396   -56.153 51.242 1.00 80.98  ? -2  ALA A N   1 
ATOM   32   C CA  . ALA A 1 20  ? 8.734   -56.510 50.692 1.00 93.99  ? -2  ALA A CA  1 
ATOM   33   C C   . ALA A 1 20  ? 8.679   -57.801 49.856 1.00 95.26  ? -2  ALA A C   1 
ATOM   34   O O   . ALA A 1 20  ? 9.587   -58.635 49.898 1.00 87.97  ? -2  ALA A O   1 
ATOM   35   C CB  . ALA A 1 20  ? 9.837   -56.619 51.801 1.00 78.83  ? -2  ALA A CB  1 
ATOM   36   N N   . GLY A 1 21  ? 7.579   -57.951 49.117 1.00 98.30  ? -1  GLY A N   1 
ATOM   37   C CA  . GLY A 1 21  ? 7.519   -58.797 47.938 1.00 74.62  ? -1  GLY A CA  1 
ATOM   38   C C   . GLY A 1 21  ? 7.878   -57.868 46.777 1.00 90.70  ? -1  GLY A C   1 
ATOM   39   O O   . GLY A 1 21  ? 7.040   -57.520 45.927 1.00 83.44  ? -1  GLY A O   1 
ATOM   40   N N   . LEU A 1 22  ? 9.132   -57.414 46.777 1.00 91.55  ? 0   LEU A N   1 
ATOM   41   C CA  . LEU A 1 22  ? 9.684   -56.662 45.663 1.00 81.25  ? 0   LEU A CA  1 
ATOM   42   C C   . LEU A 1 22  ? 9.849   -57.574 44.470 1.00 85.49  ? 0   LEU A C   1 
ATOM   43   O O   . LEU A 1 22  ? 9.760   -58.794 44.600 1.00 81.82  ? 0   LEU A O   1 
ATOM   44   C CB  . LEU A 1 22  ? 11.032  -56.042 46.017 1.00 79.36  ? 0   LEU A CB  1 
ATOM   45   C CG  . LEU A 1 22  ? 11.001  -54.672 46.689 1.00 89.76  ? 0   LEU A CG  1 
ATOM   46   C CD1 . LEU A 1 22  ? 10.717  -54.829 48.168 1.00 100.36 ? 0   LEU A CD1 1 
ATOM   47   C CD2 . LEU A 1 22  ? 12.296  -53.908 46.468 1.00 83.82  ? 0   LEU A CD2 1 
ATOM   48   N N   . MET A 1 23  ? 10.098  -56.985 43.303 1.00 87.54  ? 1   MET A N   1 
ATOM   49   C CA  . MET A 1 23  ? 10.322  -57.785 42.120 1.00 73.96  ? 1   MET A CA  1 
ATOM   50   C C   . MET A 1 23  ? 11.775  -58.248 42.074 1.00 77.20  ? 1   MET A C   1 
ATOM   51   O O   . MET A 1 23  ? 12.724  -57.475 42.233 1.00 75.66  ? 1   MET A O   1 
ATOM   52   C CB  . MET A 1 23  ? 9.942   -57.011 40.863 1.00 80.29  ? 1   MET A CB  1 
ATOM   53   C CG  . MET A 1 23  ? 8.443   -56.756 40.708 1.00 84.88  ? 1   MET A CG  1 
ATOM   54   S SD  . MET A 1 23  ? 7.963   -55.892 39.178 1.00 87.58  ? 1   MET A SD  1 
ATOM   55   C CE  . MET A 1 23  ? 6.178   -55.880 39.344 1.00 85.94  ? 1   MET A CE  1 
ATOM   56   N N   . ASP A 1 24  ? 11.912  -59.554 41.933 1.00 79.53  ? 2   ASP A N   1 
ATOM   57   C CA  . ASP A 1 24  ? 13.137  -60.230 41.542 1.00 80.06  ? 2   ASP A CA  1 
ATOM   58   C C   . ASP A 1 24  ? 13.648  -59.637 40.187 1.00 88.32  ? 2   ASP A C   1 
ATOM   59   O O   . ASP A 1 24  ? 12.869  -59.083 39.389 1.00 82.59  ? 2   ASP A O   1 
ATOM   60   C CB  . ASP A 1 24  ? 12.790  -61.731 41.520 1.00 77.01  ? 2   ASP A CB  1 
ATOM   61   C CG  . ASP A 1 24  ? 13.508  -62.543 40.454 1.00 95.88  ? 2   ASP A CG  1 
ATOM   62   O OD1 . ASP A 1 24  ? 14.680  -62.272 40.073 1.00 100.47 ? 2   ASP A OD1 1 
ATOM   63   O OD2 . ASP A 1 24  ? 12.824  -63.483 39.967 1.00 94.63  ? 2   ASP A OD2 1 
ATOM   64   N N   . LYS A 1 25  ? 14.960  -59.699 39.955 1.00 88.78  ? 3   LYS A N   1 
ATOM   65   C CA  . LYS A 1 25  ? 15.571  -59.196 38.720 1.00 77.79  ? 3   LYS A CA  1 
ATOM   66   C C   . LYS A 1 25  ? 14.934  -59.771 37.464 1.00 81.45  ? 3   LYS A C   1 
ATOM   67   O O   . LYS A 1 25  ? 14.591  -59.034 36.543 1.00 82.83  ? 3   LYS A O   1 
ATOM   68   C CB  . LYS A 1 25  ? 17.067  -59.497 38.715 1.00 79.36  ? 3   LYS A CB  1 
ATOM   69   C CG  . LYS A 1 25  ? 17.745  -59.353 37.367 1.00 78.98  ? 3   LYS A CG  1 
ATOM   70   C CD  . LYS A 1 25  ? 19.242  -59.203 37.556 1.00 85.89  ? 3   LYS A CD  1 
ATOM   71   C CE  . LYS A 1 25  ? 20.027  -60.183 36.688 1.00 93.54  ? 3   LYS A CE  1 
ATOM   72   N NZ  . LYS A 1 25  ? 21.509  -60.013 36.864 1.00 98.00  ? 3   LYS A NZ  1 
ATOM   73   N N   . ASN A 1 26  ? 14.776  -61.086 37.418 1.00 82.34  ? 4   ASN A N   1 
ATOM   74   C CA  . ASN A 1 26  ? 14.113  -61.710 36.281 1.00 81.05  ? 4   ASN A CA  1 
ATOM   75   C C   . ASN A 1 26  ? 12.740  -61.105 36.028 1.00 81.17  ? 4   ASN A C   1 
ATOM   76   O O   . ASN A 1 26  ? 12.380  -60.855 34.882 1.00 82.92  ? 4   ASN A O   1 
ATOM   77   C CB  . ASN A 1 26  ? 13.990  -63.218 36.484 1.00 80.39  ? 4   ASN A CB  1 
ATOM   78   C CG  . ASN A 1 26  ? 15.332  -63.922 36.416 1.00 89.69  ? 4   ASN A CG  1 
ATOM   79   O OD1 . ASN A 1 26  ? 16.199  -63.550 35.624 1.00 90.23  ? 4   ASN A OD1 1 
ATOM   80   N ND2 . ASN A 1 26  ? 15.515  -64.940 37.253 1.00 99.52  ? 4   ASN A ND2 1 
ATOM   81   N N   . GLU A 1 27  ? 11.986  -60.853 37.095 1.00 85.25  ? 5   GLU A N   1 
ATOM   82   C CA  . GLU A 1 27  ? 10.649  -60.265 36.984 1.00 80.07  ? 5   GLU A CA  1 
ATOM   83   C C   . GLU A 1 27  ? 10.696  -58.819 36.514 1.00 76.41  ? 5   GLU A C   1 
ATOM   84   O O   . GLU A 1 27  ? 9.854   -58.395 35.722 1.00 70.64  ? 5   GLU A O   1 
ATOM   85   C CB  . GLU A 1 27  ? 9.922   -60.336 38.319 1.00 81.54  ? 5   GLU A CB  1 
ATOM   86   C CG  . GLU A 1 27  ? 10.049  -61.681 38.984 1.00 89.51  ? 5   GLU A CG  1 
ATOM   87   C CD  . GLU A 1 27  ? 9.145   -61.829 40.181 1.00 86.35  ? 5   GLU A CD  1 
ATOM   88   O OE1 . GLU A 1 27  ? 9.377   -61.148 41.203 1.00 83.78  ? 5   GLU A OE1 1 
ATOM   89   O OE2 . GLU A 1 27  ? 8.181   -62.614 40.077 1.00 89.77  ? 5   GLU A OE2 1 
ATOM   90   N N   . LEU A 1 28  ? 11.669  -58.064 37.017 1.00 75.36  ? 6   LEU A N   1 
ATOM   91   C CA  . LEU A 1 28  ? 11.847  -56.682 36.598 1.00 72.18  ? 6   LEU A CA  1 
ATOM   92   C C   . LEU A 1 28  ? 12.072  -56.623 35.097 1.00 73.19  ? 6   LEU A C   1 
ATOM   93   O O   . LEU A 1 28  ? 11.538  -55.749 34.414 1.00 75.94  ? 6   LEU A O   1 
ATOM   94   C CB  . LEU A 1 28  ? 13.016  -56.027 37.338 1.00 73.35  ? 6   LEU A CB  1 
ATOM   95   C CG  . LEU A 1 28  ? 12.757  -55.529 38.770 1.00 75.22  ? 6   LEU A CG  1 
ATOM   96   C CD1 . LEU A 1 28  ? 13.962  -54.780 39.286 1.00 68.69  ? 6   LEU A CD1 1 
ATOM   97   C CD2 . LEU A 1 28  ? 11.510  -54.648 38.864 1.00 71.27  ? 6   LEU A CD2 1 
ATOM   98   N N   . VAL A 1 29  ? 12.846  -57.572 34.578 1.00 72.01  ? 7   VAL A N   1 
ATOM   99   C CA  . VAL A 1 29  ? 13.152  -57.620 33.149 1.00 68.68  ? 7   VAL A CA  1 
ATOM   100  C C   . VAL A 1 29  ? 11.931  -58.061 32.306 1.00 70.47  ? 7   VAL A C   1 
ATOM   101  O O   . VAL A 1 29  ? 11.708  -57.555 31.204 1.00 69.10  ? 7   VAL A O   1 
ATOM   102  C CB  . VAL A 1 29  ? 14.364  -58.548 32.887 1.00 65.46  ? 7   VAL A CB  1 
ATOM   103  C CG1 . VAL A 1 29  ? 14.324  -59.142 31.495 1.00 67.18  ? 7   VAL A CG1 1 
ATOM   104  C CG2 . VAL A 1 29  ? 15.652  -57.787 33.093 1.00 65.08  ? 7   VAL A CG2 1 
ATOM   105  N N   . GLN A 1 30  ? 11.132  -58.987 32.825 1.00 68.96  ? 8   GLN A N   1 
ATOM   106  C CA  . GLN A 1 30  ? 9.893   -59.341 32.161 1.00 67.99  ? 8   GLN A CA  1 
ATOM   107  C C   . GLN A 1 30  ? 8.980   -58.105 32.069 1.00 69.57  ? 8   GLN A C   1 
ATOM   108  O O   . GLN A 1 30  ? 8.215   -57.958 31.118 1.00 70.98  ? 8   GLN A O   1 
ATOM   109  C CB  . GLN A 1 30  ? 9.195   -60.499 32.886 1.00 66.43  ? 8   GLN A CB  1 
ATOM   110  N N   . LYS A 1 31  ? 9.066   -57.206 33.041 1.00 69.69  ? 9   LYS A N   1 
ATOM   111  C CA  . LYS A 1 31  ? 8.213   -56.028 33.015 1.00 69.37  ? 9   LYS A CA  1 
ATOM   112  C C   . LYS A 1 31  ? 8.734   -54.989 32.027 1.00 71.14  ? 9   LYS A C   1 
ATOM   113  O O   . LYS A 1 31  ? 7.955   -54.344 31.319 1.00 69.01  ? 9   LYS A O   1 
ATOM   114  C CB  . LYS A 1 31  ? 8.091   -55.407 34.407 1.00 72.51  ? 9   LYS A CB  1 
ATOM   115  C CG  . LYS A 1 31  ? 7.040   -54.316 34.466 1.00 73.29  ? 9   LYS A CG  1 
ATOM   116  C CD  . LYS A 1 31  ? 6.796   -53.824 35.879 1.00 81.10  ? 9   LYS A CD  1 
ATOM   117  C CE  . LYS A 1 31  ? 5.599   -52.872 35.913 1.00 88.75  ? 9   LYS A CE  1 
ATOM   118  N NZ  . LYS A 1 31  ? 5.722   -51.761 36.910 1.00 95.86  ? 9   LYS A NZ  1 
ATOM   119  N N   . ALA A 1 32  ? 10.052  -54.819 31.983 1.00 68.34  ? 10  ALA A N   1 
ATOM   120  C CA  . ALA A 1 32  ? 10.634  -53.846 31.071 1.00 69.85  ? 10  ALA A CA  1 
ATOM   121  C C   . ALA A 1 32  ? 10.269  -54.228 29.633 1.00 69.44  ? 10  ALA A C   1 
ATOM   122  O O   . ALA A 1 32  ? 10.004  -53.359 28.799 1.00 71.09  ? 10  ALA A O   1 
ATOM   123  C CB  . ALA A 1 32  ? 12.131  -53.770 31.257 1.00 67.74  ? 10  ALA A CB  1 
ATOM   124  N N   . LYS A 1 33  ? 10.223  -55.533 29.363 1.00 65.58  ? 11  LYS A N   1 
ATOM   125  C CA  . LYS A 1 33  ? 9.777   -56.044 28.071 1.00 64.52  ? 11  LYS A CA  1 
ATOM   126  C C   . LYS A 1 33  ? 8.310   -55.705 27.825 1.00 70.65  ? 11  LYS A C   1 
ATOM   127  O O   . LYS A 1 33  ? 7.961   -55.126 26.790 1.00 70.86  ? 11  LYS A O   1 
ATOM   128  C CB  . LYS A 1 33  ? 9.986   -57.551 27.988 1.00 57.90  ? 11  LYS A CB  1 
ATOM   129  C CG  . LYS A 1 33  ? 11.431  -57.970 27.805 1.00 56.53  ? 11  LYS A CG  1 
ATOM   130  C CD  . LYS A 1 33  ? 11.551  -59.482 27.814 1.00 53.68  ? 11  LYS A CD  1 
ATOM   131  C CE  . LYS A 1 33  ? 13.005  -59.916 27.714 1.00 66.74  ? 11  LYS A CE  1 
ATOM   132  N NZ  . LYS A 1 33  ? 13.224  -61.243 28.358 1.00 77.11  ? 11  LYS A NZ  1 
ATOM   133  N N   . LEU A 1 34  ? 7.452   -56.071 28.772 1.00 68.95  ? 12  LEU A N   1 
ATOM   134  C CA  . LEU A 1 34  ? 6.052   -55.672 28.716 1.00 69.68  ? 12  LEU A CA  1 
ATOM   135  C C   . LEU A 1 34  ? 5.929   -54.166 28.514 1.00 73.97  ? 12  LEU A C   1 
ATOM   136  O O   . LEU A 1 34  ? 5.183   -53.712 27.637 1.00 73.07  ? 12  LEU A O   1 
ATOM   137  C CB  . LEU A 1 34  ? 5.314   -56.080 29.986 1.00 67.94  ? 12  LEU A CB  1 
ATOM   138  C CG  . LEU A 1 34  ? 4.939   -57.548 30.091 1.00 64.08  ? 12  LEU A CG  1 
ATOM   139  C CD1 . LEU A 1 34  ? 4.110   -57.741 31.315 1.00 72.82  ? 12  LEU A CD1 1 
ATOM   140  C CD2 . LEU A 1 34  ? 4.160   -57.957 28.881 1.00 69.82  ? 12  LEU A CD2 1 
ATOM   141  N N   . ALA A 1 35  ? 6.676   -53.401 29.313 1.00 70.70  ? 13  ALA A N   1 
ATOM   142  C CA  . ALA A 1 35  ? 6.674   -51.942 29.196 1.00 71.57  ? 13  ALA A CA  1 
ATOM   143  C C   . ALA A 1 35  ? 7.075   -51.483 27.791 1.00 68.74  ? 13  ALA A C   1 
ATOM   144  O O   . ALA A 1 35  ? 6.514   -50.527 27.271 1.00 68.17  ? 13  ALA A O   1 
ATOM   145  C CB  . ALA A 1 35  ? 7.596   -51.318 30.237 1.00 69.69  ? 13  ALA A CB  1 
ATOM   146  N N   . GLU A 1 36  ? 8.036   -52.169 27.177 1.00 68.68  ? 14  GLU A N   1 
ATOM   147  C CA  . GLU A 1 36  ? 8.447   -51.846 25.807 1.00 72.67  ? 14  GLU A CA  1 
ATOM   148  C C   . GLU A 1 36  ? 7.346   -52.092 24.765 1.00 73.13  ? 14  GLU A C   1 
ATOM   149  O O   . GLU A 1 36  ? 7.055   -51.226 23.936 1.00 72.23  ? 14  GLU A O   1 
ATOM   150  C CB  . GLU A 1 36  ? 9.675   -52.651 25.427 1.00 68.68  ? 14  GLU A CB  1 
ATOM   151  C CG  . GLU A 1 36  ? 10.199  -52.388 24.040 1.00 63.92  ? 14  GLU A CG  1 
ATOM   152  C CD  . GLU A 1 36  ? 11.373  -53.300 23.731 1.00 75.38  ? 14  GLU A CD  1 
ATOM   153  O OE1 . GLU A 1 36  ? 11.255  -54.520 24.028 1.00 74.67  ? 14  GLU A OE1 1 
ATOM   154  O OE2 . GLU A 1 36  ? 12.420  -52.802 23.243 1.00 72.86  ? 14  GLU A OE2 1 
ATOM   155  N N   . GLN A 1 37  ? 6.724   -53.266 24.807 1.00 69.44  ? 15  GLN A N   1 
ATOM   156  C CA  . GLN A 1 37  ? 5.711   -53.575 23.812 1.00 67.97  ? 15  GLN A CA  1 
ATOM   157  C C   . GLN A 1 37  ? 4.530   -52.637 24.010 1.00 68.70  ? 15  GLN A C   1 
ATOM   158  O O   . GLN A 1 37  ? 3.753   -52.389 23.091 1.00 70.33  ? 15  GLN A O   1 
ATOM   159  C CB  . GLN A 1 37  ? 5.277   -55.045 23.891 1.00 65.81  ? 15  GLN A CB  1 
ATOM   160  N N   . ALA A 1 38  ? 4.416   -52.084 25.210 1.00 71.85  ? 16  ALA A N   1 
ATOM   161  C CA  . ALA A 1 38  ? 3.286   -51.229 25.533 1.00 66.86  ? 16  ALA A CA  1 
ATOM   162  C C   . ALA A 1 38  ? 3.650   -49.743 25.345 1.00 68.69  ? 16  ALA A C   1 
ATOM   163  O O   . ALA A 1 38  ? 2.859   -48.838 25.643 1.00 64.28  ? 16  ALA A O   1 
ATOM   164  C CB  . ALA A 1 38  ? 2.823   -51.515 26.925 1.00 60.74  ? 16  ALA A CB  1 
ATOM   165  N N   . GLU A 1 39  ? 4.846   -49.510 24.813 1.00 66.46  ? 17  GLU A N   1 
ATOM   166  C CA  . GLU A 1 39  ? 5.317   -48.159 24.516 1.00 70.47  ? 17  GLU A CA  1 
ATOM   167  C C   . GLU A 1 39  ? 5.319   -47.270 25.745 1.00 71.34  ? 17  GLU A C   1 
ATOM   168  O O   . GLU A 1 39  ? 5.043   -46.078 25.655 1.00 76.97  ? 17  GLU A O   1 
ATOM   169  C CB  . GLU A 1 39  ? 4.463   -47.514 23.424 1.00 75.72  ? 17  GLU A CB  1 
ATOM   170  C CG  . GLU A 1 39  ? 4.362   -48.350 22.151 1.00 83.36  ? 17  GLU A CG  1 
ATOM   171  C CD  . GLU A 1 39  ? 4.901   -47.646 20.928 1.00 83.39  ? 17  GLU A CD  1 
ATOM   172  O OE1 . GLU A 1 39  ? 5.856   -46.842 21.053 1.00 84.67  ? 17  GLU A OE1 1 
ATOM   173  O OE2 . GLU A 1 39  ? 4.354   -47.900 19.835 1.00 89.73  ? 17  GLU A OE2 1 
ATOM   174  N N   . ARG A 1 40  ? 5.624   -47.865 26.894 1.00 69.41  ? 18  ARG A N   1 
ATOM   175  C CA  . ARG A 1 40  ? 5.804   -47.130 28.135 1.00 64.84  ? 18  ARG A CA  1 
ATOM   176  C C   . ARG A 1 40  ? 7.283   -47.177 28.565 1.00 65.62  ? 18  ARG A C   1 
ATOM   177  O O   . ARG A 1 40  ? 7.680   -47.968 29.420 1.00 66.41  ? 18  ARG A O   1 
ATOM   178  C CB  . ARG A 1 40  ? 4.877   -47.691 29.213 1.00 64.27  ? 18  ARG A CB  1 
ATOM   179  C CG  . ARG A 1 40  ? 3.396   -47.546 28.887 1.00 64.46  ? 18  ARG A CG  1 
ATOM   180  C CD  . ARG A 1 40  ? 2.489   -48.243 29.905 1.00 70.70  ? 18  ARG A CD  1 
ATOM   181  N NE  . ARG A 1 40  ? 2.791   -47.869 31.289 1.00 75.90  ? 18  ARG A NE  1 
ATOM   182  C CZ  . ARG A 1 40  ? 2.012   -47.124 32.074 1.00 77.33  ? 18  ARG A CZ  1 
ATOM   183  N NH1 . ARG A 1 40  ? 0.848   -46.659 31.649 1.00 69.84  ? 18  ARG A NH1 1 
ATOM   184  N NH2 . ARG A 1 40  ? 2.401   -46.850 33.309 1.00 82.92  ? 18  ARG A NH2 1 
ATOM   185  N N   . TYR A 1 41  ? 8.089   -46.310 27.960 1.00 65.67  ? 19  TYR A N   1 
ATOM   186  C CA  . TYR A 1 41  ? 9.531   -46.322 28.163 1.00 66.89  ? 19  TYR A CA  1 
ATOM   187  C C   . TYR A 1 41  ? 9.996   -45.787 29.528 1.00 70.24  ? 19  TYR A C   1 
ATOM   188  O O   . TYR A 1 41  ? 11.079  -46.136 29.990 1.00 73.42  ? 19  TYR A O   1 
ATOM   189  C CB  . TYR A 1 41  ? 10.206  -45.549 27.021 1.00 68.25  ? 19  TYR A CB  1 
ATOM   190  C CG  . TYR A 1 41  ? 9.969   -46.224 25.684 1.00 71.99  ? 19  TYR A CG  1 
ATOM   191  C CD1 . TYR A 1 41  ? 10.674  -47.371 25.326 1.00 71.97  ? 19  TYR A CD1 1 
ATOM   192  C CD2 . TYR A 1 41  ? 9.021   -45.746 24.795 1.00 74.00  ? 19  TYR A CD2 1 
ATOM   193  C CE1 . TYR A 1 41  ? 10.442  -48.008 24.116 1.00 70.23  ? 19  TYR A CE1 1 
ATOM   194  C CE2 . TYR A 1 41  ? 8.795   -46.380 23.579 1.00 73.36  ? 19  TYR A CE2 1 
ATOM   195  C CZ  . TYR A 1 41  ? 9.504   -47.507 23.251 1.00 71.16  ? 19  TYR A CZ  1 
ATOM   196  O OH  . TYR A 1 41  ? 9.275   -48.140 22.054 1.00 79.99  ? 19  TYR A OH  1 
ATOM   197  N N   . ASP A 1 42  ? 9.184   -44.952 30.174 1.00 77.28  ? 20  ASP A N   1 
ATOM   198  C CA  . ASP A 1 42  ? 9.462   -44.483 31.534 1.00 70.36  ? 20  ASP A CA  1 
ATOM   199  C C   . ASP A 1 42  ? 9.478   -45.685 32.471 1.00 70.33  ? 20  ASP A C   1 
ATOM   200  O O   . ASP A 1 42  ? 10.408  -45.867 33.258 1.00 66.17  ? 20  ASP A O   1 
ATOM   201  C CB  . ASP A 1 42  ? 8.415   -43.460 31.981 1.00 72.37  ? 20  ASP A CB  1 
ATOM   202  C CG  . ASP A 1 42  ? 8.609   -42.075 31.341 1.00 85.00  ? 20  ASP A CG  1 
ATOM   203  O OD1 . ASP A 1 42  ? 9.470   -41.908 30.441 1.00 83.05  ? 20  ASP A OD1 1 
ATOM   204  O OD2 . ASP A 1 42  ? 7.863   -41.143 31.724 1.00 92.89  ? 20  ASP A OD2 1 
ATOM   205  N N   . ASP A 1 43  ? 8.448   -46.517 32.360 1.00 69.66  ? 21  ASP A N   1 
ATOM   206  C CA  . ASP A 1 43  ? 8.382   -47.762 33.122 1.00 70.87  ? 21  ASP A CA  1 
ATOM   207  C C   . ASP A 1 43  ? 9.616   -48.611 32.846 1.00 72.62  ? 21  ASP A C   1 
ATOM   208  O O   . ASP A 1 43  ? 10.228  -49.158 33.781 1.00 68.85  ? 21  ASP A O   1 
ATOM   209  C CB  . ASP A 1 43  ? 7.126   -48.572 32.772 1.00 67.83  ? 21  ASP A CB  1 
ATOM   210  C CG  . ASP A 1 43  ? 5.854   -47.969 33.328 1.00 71.11  ? 21  ASP A CG  1 
ATOM   211  O OD1 . ASP A 1 43  ? 5.780   -46.732 33.476 1.00 80.81  ? 21  ASP A OD1 1 
ATOM   212  O OD2 . ASP A 1 43  ? 4.898   -48.728 33.555 1.00 71.01  ? 21  ASP A OD2 1 
ATOM   213  N N   . MET A 1 44  ? 9.964   -48.721 31.559 1.00 69.03  ? 22  MET A N   1 
ATOM   214  C CA  . MET A 1 44  ? 11.042  -49.602 31.113 1.00 66.98  ? 22  MET A CA  1 
ATOM   215  C C   . MET A 1 44  ? 12.386  -49.130 31.670 1.00 66.59  ? 22  MET A C   1 
ATOM   216  O O   . MET A 1 44  ? 13.146  -49.912 32.262 1.00 64.01  ? 22  MET A O   1 
ATOM   217  C CB  . MET A 1 44  ? 11.076  -49.660 29.588 1.00 66.30  ? 22  MET A CB  1 
ATOM   218  C CG  . MET A 1 44  ? 12.027  -50.685 28.994 1.00 66.18  ? 22  MET A CG  1 
ATOM   219  S SD  . MET A 1 44  ? 12.013  -50.528 27.202 1.00 71.67  ? 22  MET A SD  1 
ATOM   220  C CE  . MET A 1 44  ? 13.417  -51.495 26.682 1.00 65.33  ? 22  MET A CE  1 
ATOM   221  N N   . ALA A 1 45  ? 12.666  -47.845 31.485 1.00 66.09  ? 23  ALA A N   1 
ATOM   222  C CA  . ALA A 1 45  ? 13.848  -47.237 32.076 1.00 69.71  ? 23  ALA A CA  1 
ATOM   223  C C   . ALA A 1 45  ? 13.884  -47.516 33.584 1.00 68.62  ? 23  ALA A C   1 
ATOM   224  O O   . ALA A 1 45  ? 14.901  -47.976 34.104 1.00 67.52  ? 23  ALA A O   1 
ATOM   225  C CB  . ALA A 1 45  ? 13.885  -45.738 31.792 1.00 66.64  ? 23  ALA A CB  1 
ATOM   226  N N   . ALA A 1 46  ? 12.768  -47.277 34.274 1.00 67.90  ? 24  ALA A N   1 
ATOM   227  C CA  . ALA A 1 46  ? 12.710  -47.538 35.715 1.00 65.16  ? 24  ALA A CA  1 
ATOM   228  C C   . ALA A 1 46  ? 13.057  -48.996 36.021 1.00 66.49  ? 24  ALA A C   1 
ATOM   229  O O   . ALA A 1 46  ? 13.947  -49.254 36.831 1.00 71.78  ? 24  ALA A O   1 
ATOM   230  C CB  . ALA A 1 46  ? 11.341  -47.186 36.284 1.00 59.74  ? 24  ALA A CB  1 
ATOM   231  N N   . CYS A 1 47  ? 12.383  -49.944 35.375 1.00 60.00  ? 25  CYS A N   1 
ATOM   232  C CA  . CYS A 1 47  ? 12.701  -51.349 35.601 1.00 63.41  ? 25  CYS A CA  1 
ATOM   233  C C   . CYS A 1 47  ? 14.191  -51.628 35.377 1.00 69.70  ? 25  CYS A C   1 
ATOM   234  O O   . CYS A 1 47  ? 14.844  -52.279 36.191 1.00 70.03  ? 25  CYS A O   1 
ATOM   235  C CB  . CYS A 1 47  ? 11.864  -52.246 34.705 1.00 63.86  ? 25  CYS A CB  1 
ATOM   236  S SG  . CYS A 1 47  ? 10.125  -52.335 35.155 1.00 75.93  ? 25  CYS A SG  1 
ATOM   237  N N   . MET A 1 48  ? 14.753  -51.111 34.297 1.00 70.23  ? 26  MET A N   1 
ATOM   238  C CA  . MET A 1 48  ? 16.155  -51.409 34.041 1.00 71.82  ? 26  MET A CA  1 
ATOM   239  C C   . MET A 1 48  ? 17.139  -50.658 34.958 1.00 70.31  ? 26  MET A C   1 
ATOM   240  O O   . MET A 1 48  ? 18.253  -51.138 35.195 1.00 67.88  ? 26  MET A O   1 
ATOM   241  C CB  . MET A 1 48  ? 16.477  -51.141 32.574 1.00 67.10  ? 26  MET A CB  1 
ATOM   242  C CG  . MET A 1 48  ? 15.688  -52.037 31.645 1.00 66.08  ? 26  MET A CG  1 
ATOM   243  S SD  . MET A 1 48  ? 15.635  -53.775 32.167 1.00 71.49  ? 26  MET A SD  1 
ATOM   244  C CE  . MET A 1 48  ? 17.384  -54.207 32.353 1.00 63.95  ? 26  MET A CE  1 
ATOM   245  N N   . LYS A 1 49  ? 16.735  -49.497 35.470 1.00 68.40  ? 27  LYS A N   1 
ATOM   246  C CA  . LYS A 1 49  ? 17.563  -48.765 36.427 1.00 70.87  ? 27  LYS A CA  1 
ATOM   247  C C   . LYS A 1 49  ? 17.669  -49.540 37.729 1.00 70.16  ? 27  LYS A C   1 
ATOM   248  O O   . LYS A 1 49  ? 18.740  -49.636 38.345 1.00 66.18  ? 27  LYS A O   1 
ATOM   249  C CB  . LYS A 1 49  ? 16.991  -47.388 36.703 1.00 68.60  ? 27  LYS A CB  1 
ATOM   250  C CG  . LYS A 1 49  ? 17.861  -46.560 37.596 1.00 69.71  ? 27  LYS A CG  1 
ATOM   251  C CD  . LYS A 1 49  ? 17.201  -45.245 37.872 1.00 69.60  ? 27  LYS A CD  1 
ATOM   252  C CE  . LYS A 1 49  ? 18.068  -44.390 38.724 1.00 70.01  ? 27  LYS A CE  1 
ATOM   253  N NZ  . LYS A 1 49  ? 17.195  -43.472 39.475 1.00 78.66  ? 27  LYS A NZ  1 
ATOM   254  N N   . SER A 1 50  ? 16.544  -50.110 38.128 1.00 65.42  ? 28  SER A N   1 
ATOM   255  C CA  . SER A 1 50  ? 16.518  -50.965 39.289 1.00 69.18  ? 28  SER A CA  1 
ATOM   256  C C   . SER A 1 50  ? 17.501  -52.119 39.091 1.00 71.43  ? 28  SER A C   1 
ATOM   257  O O   . SER A 1 50  ? 18.467  -52.222 39.834 1.00 80.85  ? 28  SER A O   1 
ATOM   258  C CB  . SER A 1 50  ? 15.100  -51.472 39.556 1.00 74.19  ? 28  SER A CB  1 
ATOM   259  O OG  . SER A 1 50  ? 15.015  -52.060 40.842 1.00 76.78  ? 28  SER A OG  1 
ATOM   260  N N   . VAL A 1 51  ? 17.280  -52.956 38.077 1.00 72.22  ? 29  VAL A N   1 
ATOM   261  C CA  . VAL A 1 51  ? 18.173  -54.082 37.773 1.00 72.54  ? 29  VAL A CA  1 
ATOM   262  C C   . VAL A 1 51  ? 19.653  -53.657 37.789 1.00 70.16  ? 29  VAL A C   1 
ATOM   263  O O   . VAL A 1 51  ? 20.525  -54.388 38.252 1.00 74.49  ? 29  VAL A O   1 
ATOM   264  C CB  . VAL A 1 51  ? 17.824  -54.714 36.394 1.00 70.24  ? 29  VAL A CB  1 
ATOM   265  C CG1 . VAL A 1 51  ? 18.822  -55.790 36.027 1.00 68.32  ? 29  VAL A CG1 1 
ATOM   266  C CG2 . VAL A 1 51  ? 16.410  -55.288 36.395 1.00 67.51  ? 29  VAL A CG2 1 
ATOM   267  N N   . THR A 1 52  ? 19.920  -52.450 37.315 1.00 69.08  ? 30  THR A N   1 
ATOM   268  C CA  . THR A 1 52  ? 21.279  -51.950 37.228 1.00 73.45  ? 30  THR A CA  1 
ATOM   269  C C   . THR A 1 52  ? 21.832  -51.767 38.619 1.00 78.37  ? 30  THR A C   1 
ATOM   270  O O   . THR A 1 52  ? 22.987  -52.119 38.907 1.00 79.13  ? 30  THR A O   1 
ATOM   271  C CB  . THR A 1 52  ? 21.341  -50.613 36.465 1.00 73.28  ? 30  THR A CB  1 
ATOM   272  O OG1 . THR A 1 52  ? 21.012  -50.839 35.090 1.00 74.40  ? 30  THR A OG1 1 
ATOM   273  C CG2 . THR A 1 52  ? 22.724  -49.992 36.557 1.00 70.79  ? 30  THR A CG2 1 
ATOM   274  N N   . GLU A 1 53  ? 20.977  -51.228 39.483 1.00 81.30  ? 31  GLU A N   1 
ATOM   275  C CA  . GLU A 1 53  ? 21.369  -50.836 40.838 1.00 79.63  ? 31  GLU A CA  1 
ATOM   276  C C   . GLU A 1 53  ? 21.680  -52.025 41.736 1.00 77.20  ? 31  GLU A C   1 
ATOM   277  O O   . GLU A 1 53  ? 22.522  -51.921 42.617 1.00 81.31  ? 31  GLU A O   1 
ATOM   278  C CB  . GLU A 1 53  ? 20.292  -49.943 41.445 1.00 65.30  ? 31  GLU A CB  1 
ATOM   279  C CG  . GLU A 1 53  ? 20.409  -48.555 40.840 1.00 75.30  ? 31  GLU A CG  1 
ATOM   280  C CD  . GLU A 1 53  ? 19.254  -47.634 41.157 1.00 81.25  ? 31  GLU A CD  1 
ATOM   281  O OE1 . GLU A 1 53  ? 18.219  -48.115 41.689 1.00 78.71  ? 31  GLU A OE1 1 
ATOM   282  O OE2 . GLU A 1 53  ? 19.393  -46.422 40.859 1.00 76.66  ? 31  GLU A OE2 1 
ATOM   283  N N   . GLN A 1 54  ? 21.046  -53.162 41.483 1.00 74.75  ? 32  GLN A N   1 
ATOM   284  C CA  . GLN A 1 54  ? 21.431  -54.407 42.129 1.00 77.18  ? 32  GLN A CA  1 
ATOM   285  C C   . GLN A 1 54  ? 22.946  -54.692 42.060 1.00 78.91  ? 32  GLN A C   1 
ATOM   286  O O   . GLN A 1 54  ? 23.465  -55.495 42.830 1.00 86.27  ? 32  GLN A O   1 
ATOM   287  C CB  . GLN A 1 54  ? 20.648  -55.565 41.513 1.00 79.16  ? 32  GLN A CB  1 
ATOM   288  C CG  . GLN A 1 54  ? 19.152  -55.523 41.822 1.00 83.08  ? 32  GLN A CG  1 
ATOM   289  C CD  . GLN A 1 54  ? 18.466  -56.851 41.509 1.00 94.54  ? 32  GLN A CD  1 
ATOM   290  O OE1 . GLN A 1 54  ? 19.001  -57.673 40.754 1.00 96.68  ? 32  GLN A OE1 1 
ATOM   291  N NE2 . GLN A 1 54  ? 17.290  -57.076 42.107 1.00 89.75  ? 32  GLN A NE2 1 
ATOM   292  N N   . GLY A 1 55  ? 23.659  -54.040 41.147 1.00 81.85  ? 33  GLY A N   1 
ATOM   293  C CA  . GLY A 1 55  ? 25.109  -54.159 41.100 1.00 82.27  ? 33  GLY A CA  1 
ATOM   294  C C   . GLY A 1 55  ? 25.663  -55.332 40.298 1.00 90.13  ? 33  GLY A C   1 
ATOM   295  O O   . GLY A 1 55  ? 26.869  -55.400 40.050 1.00 89.13  ? 33  GLY A O   1 
ATOM   296  N N   . ALA A 1 56  ? 24.797  -56.265 39.903 1.00 94.16  ? 34  ALA A N   1 
ATOM   297  C CA  . ALA A 1 56  ? 25.193  -57.336 38.987 1.00 93.16  ? 34  ALA A CA  1 
ATOM   298  C C   . ALA A 1 56  ? 25.488  -56.753 37.605 1.00 97.47  ? 34  ALA A C   1 
ATOM   299  O O   . ALA A 1 56  ? 24.745  -55.884 37.119 1.00 91.38  ? 34  ALA A O   1 
ATOM   300  C CB  . ALA A 1 56  ? 24.103  -58.404 38.889 1.00 93.77  ? 34  ALA A CB  1 
ATOM   301  N N   . GLU A 1 57  ? 26.582  -57.213 36.997 1.00 93.02  ? 35  GLU A N   1 
ATOM   302  C CA  . GLU A 1 57  ? 26.883  -56.898 35.609 1.00 88.40  ? 35  GLU A CA  1 
ATOM   303  C C   . GLU A 1 57  ? 25.731  -57.368 34.736 1.00 89.11  ? 35  GLU A C   1 
ATOM   304  O O   . GLU A 1 57  ? 25.319  -58.531 34.836 1.00 87.63  ? 35  GLU A O   1 
ATOM   305  C CB  . GLU A 1 57  ? 28.184  -57.561 35.150 1.00 86.00  ? 35  GLU A CB  1 
ATOM   306  C CG  . GLU A 1 57  ? 28.548  -57.213 33.714 1.00 86.15  ? 35  GLU A CG  1 
ATOM   307  C CD  . GLU A 1 57  ? 29.816  -57.885 33.222 1.00 89.58  ? 35  GLU A CD  1 
ATOM   308  O OE1 . GLU A 1 57  ? 30.401  -58.678 33.981 1.00 87.02  ? 35  GLU A OE1 1 
ATOM   309  O OE2 . GLU A 1 57  ? 30.232  -57.612 32.070 1.00 94.62  ? 35  GLU A OE2 1 
ATOM   310  N N   . LEU A 1 58  ? 25.210  -56.470 33.896 1.00 81.65  ? 36  LEU A N   1 
ATOM   311  C CA  . LEU A 1 58  ? 24.044  -56.778 33.080 1.00 74.97  ? 36  LEU A CA  1 
ATOM   312  C C   . LEU A 1 58  ? 24.427  -57.703 31.942 1.00 73.84  ? 36  LEU A C   1 
ATOM   313  O O   . LEU A 1 58  ? 25.492  -57.573 31.348 1.00 78.87  ? 36  LEU A O   1 
ATOM   314  C CB  . LEU A 1 58  ? 23.413  -55.500 32.530 1.00 74.45  ? 36  LEU A CB  1 
ATOM   315  C CG  . LEU A 1 58  ? 23.130  -54.422 33.573 1.00 73.62  ? 36  LEU A CG  1 
ATOM   316  C CD1 . LEU A 1 58  ? 22.564  -53.178 32.918 1.00 70.14  ? 36  LEU A CD1 1 
ATOM   317  C CD2 . LEU A 1 58  ? 22.162  -54.970 34.561 1.00 70.73  ? 36  LEU A CD2 1 
ATOM   318  N N   . SER A 1 59  ? 23.554  -58.652 31.646 1.00 72.93  ? 37  SER A N   1 
ATOM   319  C CA  . SER A 1 59  ? 23.690  -59.459 30.449 1.00 69.82  ? 37  SER A CA  1 
ATOM   320  C C   . SER A 1 59  ? 23.508  -58.610 29.209 1.00 76.92  ? 37  SER A C   1 
ATOM   321  O O   . SER A 1 59  ? 22.998  -57.486 29.285 1.00 76.34  ? 37  SER A O   1 
ATOM   322  C CB  . SER A 1 59  ? 22.663  -60.567 30.448 1.00 69.32  ? 37  SER A CB  1 
ATOM   323  O OG  . SER A 1 59  ? 21.369  -60.011 30.440 1.00 69.60  ? 37  SER A OG  1 
ATOM   324  N N   . ASN A 1 60  ? 23.895  -59.156 28.059 1.00 80.71  ? 38  ASN A N   1 
ATOM   325  C CA  . ASN A 1 60  ? 23.727  -58.443 26.801 1.00 76.38  ? 38  ASN A CA  1 
ATOM   326  C C   . ASN A 1 60  ? 22.265  -58.075 26.593 1.00 75.15  ? 38  ASN A C   1 
ATOM   327  O O   . ASN A 1 60  ? 21.970  -56.976 26.128 1.00 73.30  ? 38  ASN A O   1 
ATOM   328  C CB  . ASN A 1 60  ? 24.264  -59.265 25.636 1.00 70.80  ? 38  ASN A CB  1 
ATOM   329  C CG  . ASN A 1 60  ? 25.773  -59.171 25.507 1.00 79.42  ? 38  ASN A CG  1 
ATOM   330  O OD1 . ASN A 1 60  ? 26.445  -58.569 26.340 1.00 82.28  ? 38  ASN A OD1 1 
ATOM   331  N ND2 . ASN A 1 60  ? 26.316  -59.791 24.468 1.00 92.69  ? 38  ASN A ND2 1 
ATOM   332  N N   . GLU A 1 61  ? 21.353  -58.961 26.988 1.00 69.72  ? 39  GLU A N   1 
ATOM   333  C CA  . GLU A 1 61  ? 19.929  -58.630 26.930 1.00 72.45  ? 39  GLU A CA  1 
ATOM   334  C C   . GLU A 1 61  ? 19.562  -57.427 27.816 1.00 67.77  ? 39  GLU A C   1 
ATOM   335  O O   . GLU A 1 61  ? 18.906  -56.479 27.380 1.00 65.17  ? 39  GLU A O   1 
ATOM   336  C CB  . GLU A 1 61  ? 19.085  -59.837 27.328 1.00 70.26  ? 39  GLU A CB  1 
ATOM   337  C CG  . GLU A 1 61  ? 17.595  -59.577 27.275 1.00 73.39  ? 39  GLU A CG  1 
ATOM   338  C CD  . GLU A 1 61  ? 16.756  -60.797 27.639 1.00 85.52  ? 39  GLU A CD  1 
ATOM   339  O OE1 . GLU A 1 61  ? 16.857  -61.291 28.792 1.00 91.66  ? 39  GLU A OE1 1 
ATOM   340  O OE2 . GLU A 1 61  ? 15.989  -61.263 26.769 1.00 82.63  ? 39  GLU A OE2 1 
ATOM   341  N N   . GLU A 1 62  ? 19.996  -57.457 29.061 1.00 67.54  ? 40  GLU A N   1 
ATOM   342  C CA  . GLU A 1 62  ? 19.629  -56.400 29.978 1.00 69.22  ? 40  GLU A CA  1 
ATOM   343  C C   . GLU A 1 62  ? 20.240  -55.079 29.532 1.00 66.36  ? 40  GLU A C   1 
ATOM   344  O O   . GLU A 1 62  ? 19.557  -54.058 29.464 1.00 63.63  ? 40  GLU A O   1 
ATOM   345  C CB  . GLU A 1 62  ? 20.055  -56.771 31.401 1.00 69.91  ? 40  GLU A CB  1 
ATOM   346  C CG  . GLU A 1 62  ? 19.293  -57.960 31.954 1.00 66.45  ? 40  GLU A CG  1 
ATOM   347  C CD  . GLU A 1 62  ? 20.083  -58.737 32.999 1.00 78.49  ? 40  GLU A CD  1 
ATOM   348  O OE1 . GLU A 1 62  ? 21.214  -58.321 33.331 1.00 80.72  ? 40  GLU A OE1 1 
ATOM   349  O OE2 . GLU A 1 62  ? 19.574  -59.773 33.483 1.00 84.19  ? 40  GLU A OE2 1 
ATOM   350  N N   . ARG A 1 63  ? 21.531  -55.116 29.231 1.00 71.39  ? 41  ARG A N   1 
ATOM   351  C CA  . ARG A 1 63  ? 22.251  -53.965 28.706 1.00 67.19  ? 41  ARG A CA  1 
ATOM   352  C C   . ARG A 1 63  ? 21.513  -53.385 27.514 1.00 67.91  ? 41  ARG A C   1 
ATOM   353  O O   . ARG A 1 63  ? 21.242  -52.191 27.469 1.00 67.90  ? 41  ARG A O   1 
ATOM   354  C CB  . ARG A 1 63  ? 23.662  -54.381 28.307 1.00 73.73  ? 41  ARG A CB  1 
ATOM   355  C CG  . ARG A 1 63  ? 24.487  -53.324 27.602 1.00 69.79  ? 41  ARG A CG  1 
ATOM   356  C CD  . ARG A 1 63  ? 25.573  -53.974 26.740 1.00 69.95  ? 41  ARG A CD  1 
ATOM   357  N NE  . ARG A 1 63  ? 25.018  -54.571 25.523 1.00 73.21  ? 41  ARG A NE  1 
ATOM   358  C CZ  . ARG A 1 63  ? 25.701  -55.351 24.693 1.00 75.85  ? 41  ARG A CZ  1 
ATOM   359  N NH1 . ARG A 1 63  ? 26.969  -55.646 24.953 1.00 82.94  ? 41  ARG A NH1 1 
ATOM   360  N NH2 . ARG A 1 63  ? 25.115  -55.849 23.614 1.00 77.43  ? 41  ARG A NH2 1 
ATOM   361  N N   . ASN A 1 64  ? 21.173  -54.249 26.557 1.00 72.08  ? 42  ASN A N   1 
ATOM   362  C CA  . ASN A 1 64  ? 20.442  -53.833 25.366 1.00 68.31  ? 42  ASN A CA  1 
ATOM   363  C C   . ASN A 1 64  ? 19.137  -53.175 25.773 1.00 70.24  ? 42  ASN A C   1 
ATOM   364  O O   . ASN A 1 64  ? 18.838  -52.053 25.343 1.00 73.13  ? 42  ASN A O   1 
ATOM   365  C CB  . ASN A 1 64  ? 20.167  -55.021 24.428 1.00 75.46  ? 42  ASN A CB  1 
ATOM   366  C CG  . ASN A 1 64  ? 21.410  -55.469 23.629 1.00 75.42  ? 42  ASN A CG  1 
ATOM   367  O OD1 . ASN A 1 64  ? 22.442  -54.783 23.586 1.00 73.95  ? 42  ASN A OD1 1 
ATOM   368  N ND2 . ASN A 1 64  ? 21.297  -56.627 22.987 1.00 72.32  ? 42  ASN A ND2 1 
ATOM   369  N N   . LEU A 1 65  ? 18.375  -53.861 26.626 1.00 68.00  ? 43  LEU A N   1 
ATOM   370  C CA  . LEU A 1 65  ? 17.110  -53.327 27.134 1.00 61.93  ? 43  LEU A CA  1 
ATOM   371  C C   . LEU A 1 65  ? 17.255  -51.959 27.780 1.00 66.06  ? 43  LEU A C   1 
ATOM   372  O O   . LEU A 1 65  ? 16.512  -51.036 27.439 1.00 70.00  ? 43  LEU A O   1 
ATOM   373  C CB  . LEU A 1 65  ? 16.505  -54.290 28.122 1.00 56.07  ? 43  LEU A CB  1 
ATOM   374  C CG  . LEU A 1 65  ? 15.686  -55.367 27.448 1.00 59.49  ? 43  LEU A CG  1 
ATOM   375  C CD1 . LEU A 1 65  ? 15.469  -56.506 28.410 1.00 61.45  ? 43  LEU A CD1 1 
ATOM   376  C CD2 . LEU A 1 65  ? 14.356  -54.804 26.965 1.00 55.60  ? 43  LEU A CD2 1 
ATOM   377  N N   . LEU A 1 66  ? 18.216  -51.828 28.695 1.00 64.59  ? 44  LEU A N   1 
ATOM   378  C CA  . LEU A 1 66  ? 18.506  -50.552 29.343 1.00 62.58  ? 44  LEU A CA  1 
ATOM   379  C C   . LEU A 1 66  ? 18.742  -49.400 28.349 1.00 65.53  ? 44  LEU A C   1 
ATOM   380  O O   . LEU A 1 66  ? 18.100  -48.333 28.429 1.00 59.91  ? 44  LEU A O   1 
ATOM   381  C CB  . LEU A 1 66  ? 19.724  -50.700 30.248 1.00 63.77  ? 44  LEU A CB  1 
ATOM   382  C CG  . LEU A 1 66  ? 20.214  -49.381 30.860 1.00 69.09  ? 44  LEU A CG  1 
ATOM   383  C CD1 . LEU A 1 66  ? 19.246  -48.881 31.932 1.00 64.76  ? 44  LEU A CD1 1 
ATOM   384  C CD2 . LEU A 1 66  ? 21.626  -49.485 31.403 1.00 65.45  ? 44  LEU A CD2 1 
ATOM   385  N N   . SER A 1 67  ? 19.664  -49.633 27.416 1.00 64.64  ? 45  SER A N   1 
ATOM   386  C CA  . SER A 1 67  ? 19.980  -48.685 26.347 1.00 66.11  ? 45  SER A CA  1 
ATOM   387  C C   . SER A 1 67  ? 18.777  -48.215 25.525 1.00 62.54  ? 45  SER A C   1 
ATOM   388  O O   . SER A 1 67  ? 18.615  -47.009 25.275 1.00 58.41  ? 45  SER A O   1 
ATOM   389  C CB  . SER A 1 67  ? 21.009  -49.295 25.401 1.00 67.98  ? 45  SER A CB  1 
ATOM   390  O OG  . SER A 1 67  ? 21.198  -48.461 24.276 1.00 70.88  ? 45  SER A OG  1 
ATOM   391  N N   . VAL A 1 68  ? 17.943  -49.155 25.100 1.00 57.82  ? 46  VAL A N   1 
ATOM   392  C CA  . VAL A 1 68  ? 16.790  -48.784 24.286 1.00 65.67  ? 46  VAL A CA  1 
ATOM   393  C C   . VAL A 1 68  ? 15.868  -47.916 25.099 1.00 68.80  ? 46  VAL A C   1 
ATOM   394  O O   . VAL A 1 68  ? 15.406  -46.870 24.638 1.00 67.56  ? 46  VAL A O   1 
ATOM   395  C CB  . VAL A 1 68  ? 16.010  -50.016 23.777 1.00 66.35  ? 46  VAL A CB  1 
ATOM   396  C CG1 . VAL A 1 68  ? 14.572  -49.663 23.499 1.00 59.51  ? 46  VAL A CG1 1 
ATOM   397  C CG2 . VAL A 1 68  ? 16.674  -50.594 22.542 1.00 70.28  ? 46  VAL A CG2 1 
ATOM   398  N N   . ALA A 1 69  ? 15.627  -48.379 26.327 1.00 70.95  ? 47  ALA A N   1 
ATOM   399  C CA  . ALA A 1 69  ? 14.739  -47.739 27.285 1.00 66.36  ? 47  ALA A CA  1 
ATOM   400  C C   . ALA A 1 69  ? 15.038  -46.254 27.429 1.00 68.48  ? 47  ALA A C   1 
ATOM   401  O O   . ALA A 1 69  ? 14.167  -45.419 27.212 1.00 71.10  ? 47  ALA A O   1 
ATOM   402  C CB  . ALA A 1 69  ? 14.854  -48.429 28.612 1.00 68.09  ? 47  ALA A CB  1 
ATOM   403  N N   . TYR A 1 70  ? 16.281  -45.928 27.772 1.00 68.16  ? 48  TYR A N   1 
ATOM   404  C CA  . TYR A 1 70  ? 16.703  -44.531 27.847 1.00 70.07  ? 48  TYR A CA  1 
ATOM   405  C C   . TYR A 1 70  ? 16.889  -43.838 26.480 1.00 75.84  ? 48  TYR A C   1 
ATOM   406  O O   . TYR A 1 70  ? 16.899  -42.604 26.429 1.00 74.58  ? 48  TYR A O   1 
ATOM   407  C CB  . TYR A 1 70  ? 17.999  -44.417 28.651 1.00 66.36  ? 48  TYR A CB  1 
ATOM   408  C CG  . TYR A 1 70  ? 17.768  -44.475 30.136 1.00 75.84  ? 48  TYR A CG  1 
ATOM   409  C CD1 . TYR A 1 70  ? 17.218  -43.387 30.810 1.00 76.93  ? 48  TYR A CD1 1 
ATOM   410  C CD2 . TYR A 1 70  ? 18.062  -45.629 30.867 1.00 77.59  ? 48  TYR A CD2 1 
ATOM   411  C CE1 . TYR A 1 70  ? 16.993  -43.431 32.171 1.00 77.07  ? 48  TYR A CE1 1 
ATOM   412  C CE2 . TYR A 1 70  ? 17.828  -45.693 32.232 1.00 73.27  ? 48  TYR A CE2 1 
ATOM   413  C CZ  . TYR A 1 70  ? 17.294  -44.584 32.879 1.00 80.71  ? 48  TYR A CZ  1 
ATOM   414  O OH  . TYR A 1 70  ? 17.056  -44.614 34.237 1.00 84.63  ? 48  TYR A OH  1 
ATOM   415  N N   . LYS A 1 71  ? 17.057  -44.595 25.387 1.00 71.31  ? 49  LYS A N   1 
ATOM   416  C CA  . LYS A 1 71  ? 17.116  -43.958 24.070 1.00 71.22  ? 49  LYS A CA  1 
ATOM   417  C C   . LYS A 1 71  ? 15.795  -43.291 23.800 1.00 73.24  ? 49  LYS A C   1 
ATOM   418  O O   . LYS A 1 71  ? 15.746  -42.142 23.349 1.00 74.36  ? 49  LYS A O   1 
ATOM   419  C CB  . LYS A 1 71  ? 17.436  -44.952 22.955 1.00 71.91  ? 49  LYS A CB  1 
ATOM   420  C CG  . LYS A 1 71  ? 18.920  -45.078 22.645 1.00 74.74  ? 49  LYS A CG  1 
ATOM   421  C CD  . LYS A 1 71  ? 19.194  -45.977 21.434 1.00 75.83  ? 49  LYS A CD  1 
ATOM   422  C CE  . LYS A 1 71  ? 20.684  -46.005 21.127 1.00 76.21  ? 49  LYS A CE  1 
ATOM   423  N NZ  . LYS A 1 71  ? 20.986  -46.505 19.779 1.00 80.49  ? 49  LYS A NZ  1 
ATOM   424  N N   . ASN A 1 72  ? 14.726  -44.017 24.108 1.00 70.22  ? 50  ASN A N   1 
ATOM   425  C CA  . ASN A 1 72  ? 13.376  -43.521 23.906 1.00 71.81  ? 50  ASN A CA  1 
ATOM   426  C C   . ASN A 1 72  ? 12.969  -42.438 24.888 1.00 72.25  ? 50  ASN A C   1 
ATOM   427  O O   . ASN A 1 72  ? 12.234  -41.519 24.530 1.00 65.72  ? 50  ASN A O   1 
ATOM   428  C CB  . ASN A 1 72  ? 12.381  -44.660 23.997 1.00 72.26  ? 50  ASN A CB  1 
ATOM   429  C CG  . ASN A 1 72  ? 12.525  -45.644 22.868 1.00 76.83  ? 50  ASN A CG  1 
ATOM   430  O OD1 . ASN A 1 72  ? 11.922  -45.486 21.808 1.00 75.34  ? 50  ASN A OD1 1 
ATOM   431  N ND2 . ASN A 1 72  ? 13.315  -46.687 23.099 1.00 74.72  ? 50  ASN A ND2 1 
ATOM   432  N N   . VAL A 1 73  ? 13.439  -42.550 26.127 1.00 70.95  ? 51  VAL A N   1 
ATOM   433  C CA  . VAL A 1 73  ? 13.052  -41.586 27.144 1.00 70.35  ? 51  VAL A CA  1 
ATOM   434  C C   . VAL A 1 73  ? 13.698  -40.237 26.872 1.00 70.78  ? 51  VAL A C   1 
ATOM   435  O O   . VAL A 1 73  ? 13.009  -39.220 26.782 1.00 69.64  ? 51  VAL A O   1 
ATOM   436  C CB  . VAL A 1 73  ? 13.417  -42.064 28.557 1.00 75.85  ? 51  VAL A CB  1 
ATOM   437  C CG1 . VAL A 1 73  ? 13.175  -40.956 29.570 1.00 72.51  ? 51  VAL A CG1 1 
ATOM   438  C CG2 . VAL A 1 73  ? 12.596  -43.282 28.920 1.00 75.35  ? 51  VAL A CG2 1 
ATOM   439  N N   . VAL A 1 74  ? 15.019  -40.225 26.737 1.00 72.43  ? 52  VAL A N   1 
ATOM   440  C CA  . VAL A 1 74  ? 15.724  -38.987 26.432 1.00 71.21  ? 52  VAL A CA  1 
ATOM   441  C C   . VAL A 1 74  ? 15.267  -38.486 25.071 1.00 73.97  ? 52  VAL A C   1 
ATOM   442  O O   . VAL A 1 74  ? 15.141  -37.276 24.865 1.00 76.97  ? 52  VAL A O   1 
ATOM   443  C CB  . VAL A 1 74  ? 17.264  -39.164 26.449 1.00 69.29  ? 52  VAL A CB  1 
ATOM   444  C CG1 . VAL A 1 74  ? 17.747  -39.869 25.193 1.00 71.43  ? 52  VAL A CG1 1 
ATOM   445  C CG2 . VAL A 1 74  ? 17.945  -37.826 26.586 1.00 69.12  ? 52  VAL A CG2 1 
ATOM   446  N N   . GLY A 1 75  ? 14.964  -39.422 24.171 1.00 70.45  ? 53  GLY A N   1 
ATOM   447  C CA  . GLY A 1 75  ? 14.612  -39.088 22.811 1.00 68.44  ? 53  GLY A CA  1 
ATOM   448  C C   . GLY A 1 75  ? 13.376  -38.226 22.724 1.00 66.48  ? 53  GLY A C   1 
ATOM   449  O O   . GLY A 1 75  ? 13.341  -37.267 21.967 1.00 67.66  ? 53  GLY A O   1 
ATOM   450  N N   . ALA A 1 76  ? 12.363  -38.565 23.509 1.00 66.62  ? 54  ALA A N   1 
ATOM   451  C CA  . ALA A 1 76  ? 11.095  -37.851 23.460 1.00 60.11  ? 54  ALA A CA  1 
ATOM   452  C C   . ALA A 1 76  ? 11.251  -36.387 23.821 1.00 64.77  ? 54  ALA A C   1 
ATOM   453  O O   . ALA A 1 76  ? 10.575  -35.529 23.243 1.00 64.06  ? 54  ALA A O   1 
ATOM   454  C CB  . ALA A 1 76  ? 10.118  -38.493 24.357 1.00 56.99  ? 54  ALA A CB  1 
ATOM   455  N N   . ARG A 1 77  ? 12.157  -36.117 24.762 1.00 64.66  ? 55  ARG A N   1 
ATOM   456  C CA  . ARG A 1 77  ? 12.353  -34.777 25.309 1.00 67.17  ? 55  ARG A CA  1 
ATOM   457  C C   . ARG A 1 77  ? 13.107  -33.957 24.306 1.00 72.73  ? 55  ARG A C   1 
ATOM   458  O O   . ARG A 1 77  ? 12.762  -32.797 24.043 1.00 74.31  ? 55  ARG A O   1 
ATOM   459  C CB  . ARG A 1 77  ? 13.127  -34.801 26.640 1.00 75.45  ? 55  ARG A CB  1 
ATOM   460  C CG  . ARG A 1 77  ? 12.284  -35.035 27.926 1.00 70.47  ? 55  ARG A CG  1 
ATOM   461  C CD  . ARG A 1 77  ? 11.712  -36.430 27.932 1.00 69.61  ? 55  ARG A CD  1 
ATOM   462  N NE  . ARG A 1 77  ? 11.029  -36.790 29.165 1.00 75.10  ? 55  ARG A NE  1 
ATOM   463  C CZ  . ARG A 1 77  ? 10.519  -38.000 29.383 1.00 81.46  ? 55  ARG A CZ  1 
ATOM   464  N NH1 . ARG A 1 77  ? 9.904   -38.281 30.523 1.00 77.90  ? 55  ARG A NH1 1 
ATOM   465  N NH2 . ARG A 1 77  ? 10.625  -38.940 28.446 1.00 81.77  ? 55  ARG A NH2 1 
ATOM   466  N N   . ARG A 1 78  ? 14.143  -34.582 23.746 1.00 72.92  ? 56  ARG A N   1 
ATOM   467  C CA  . ARG A 1 78  ? 14.969  -33.970 22.716 1.00 65.24  ? 56  ARG A CA  1 
ATOM   468  C C   . ARG A 1 78  ? 14.080  -33.510 21.564 1.00 71.13  ? 56  ARG A C   1 
ATOM   469  O O   . ARG A 1 78  ? 14.241  -32.409 21.037 1.00 75.86  ? 56  ARG A O   1 
ATOM   470  C CB  . ARG A 1 78  ? 16.037  -34.950 22.247 1.00 60.24  ? 56  ARG A CB  1 
ATOM   471  C CG  . ARG A 1 78  ? 17.019  -35.321 23.330 1.00 66.89  ? 56  ARG A CG  1 
ATOM   472  C CD  . ARG A 1 78  ? 18.169  -36.174 22.837 1.00 71.47  ? 56  ARG A CD  1 
ATOM   473  N NE  . ARG A 1 78  ? 18.962  -35.464 21.840 1.00 79.33  ? 56  ARG A NE  1 
ATOM   474  C CZ  . ARG A 1 78  ? 19.318  -35.973 20.664 1.00 78.91  ? 56  ARG A CZ  1 
ATOM   475  N NH1 . ARG A 1 78  ? 18.962  -37.212 20.343 1.00 75.34  ? 56  ARG A NH1 1 
ATOM   476  N NH2 . ARG A 1 78  ? 20.031  -35.240 19.816 1.00 73.96  ? 56  ARG A NH2 1 
ATOM   477  N N   . SER A 1 79  ? 13.113  -34.334 21.187 1.00 69.63  ? 57  SER A N   1 
ATOM   478  C CA  . SER A 1 79  ? 12.168  -33.902 20.180 1.00 71.99  ? 57  SER A CA  1 
ATOM   479  C C   . SER A 1 79  ? 11.386  -32.687 20.679 1.00 75.66  ? 57  SER A C   1 
ATOM   480  O O   . SER A 1 79  ? 11.276  -31.689 19.961 1.00 75.57  ? 57  SER A O   1 
ATOM   481  C CB  . SER A 1 79  ? 11.218  -35.029 19.802 1.00 64.46  ? 57  SER A CB  1 
ATOM   482  O OG  . SER A 1 79  ? 9.994   -34.475 19.345 1.00 71.90  ? 57  SER A OG  1 
ATOM   483  N N   . SER A 1 80  ? 10.859  -32.766 21.904 1.00 71.43  ? 58  SER A N   1 
ATOM   484  C CA  . SER A 1 80  ? 10.061  -31.668 22.466 1.00 72.49  ? 58  SER A CA  1 
ATOM   485  C C   . SER A 1 80  ? 10.873  -30.409 22.633 1.00 74.05  ? 58  SER A C   1 
ATOM   486  O O   . SER A 1 80  ? 10.377  -29.304 22.438 1.00 72.91  ? 58  SER A O   1 
ATOM   487  C CB  . SER A 1 80  ? 9.465   -32.041 23.817 1.00 71.38  ? 58  SER A CB  1 
ATOM   488  O OG  . SER A 1 80  ? 8.349   -32.893 23.673 1.00 74.33  ? 58  SER A OG  1 
ATOM   489  N N   . TRP A 1 81  ? 12.129  -30.583 23.009 1.00 74.13  ? 59  TRP A N   1 
ATOM   490  C CA  . TRP A 1 81  ? 13.010  -29.450 23.181 1.00 72.99  ? 59  TRP A CA  1 
ATOM   491  C C   . TRP A 1 81  ? 13.246  -28.752 21.870 1.00 77.50  ? 59  TRP A C   1 
ATOM   492  O O   . TRP A 1 81  ? 13.374  -27.538 21.834 1.00 79.68  ? 59  TRP A O   1 
ATOM   493  C CB  . TRP A 1 81  ? 14.337  -29.893 23.766 1.00 77.64  ? 59  TRP A CB  1 
ATOM   494  C CG  . TRP A 1 81  ? 15.311  -28.777 23.965 1.00 83.08  ? 59  TRP A CG  1 
ATOM   495  C CD1 . TRP A 1 81  ? 15.491  -28.033 25.097 1.00 77.21  ? 59  TRP A CD1 1 
ATOM   496  C CD2 . TRP A 1 81  ? 16.260  -28.291 23.010 1.00 85.89  ? 59  TRP A CD2 1 
ATOM   497  N NE1 . TRP A 1 81  ? 16.483  -27.109 24.900 1.00 79.41  ? 59  TRP A NE1 1 
ATOM   498  C CE2 . TRP A 1 81  ? 16.979  -27.251 23.630 1.00 86.94  ? 59  TRP A CE2 1 
ATOM   499  C CE3 . TRP A 1 81  ? 16.572  -28.633 21.689 1.00 82.82  ? 59  TRP A CE3 1 
ATOM   500  C CZ2 . TRP A 1 81  ? 17.994  -26.549 22.973 1.00 87.30  ? 59  TRP A CZ2 1 
ATOM   501  C CZ3 . TRP A 1 81  ? 17.579  -27.930 21.040 1.00 82.62  ? 59  TRP A CZ3 1 
ATOM   502  C CH2 . TRP A 1 81  ? 18.276  -26.899 21.686 1.00 78.51  ? 59  TRP A CH2 1 
ATOM   503  N N   . ARG A 1 82  ? 13.328  -29.533 20.792 1.00 80.66  ? 60  ARG A N   1 
ATOM   504  C CA  . ARG A 1 82  ? 13.628  -28.981 19.474 1.00 75.00  ? 60  ARG A CA  1 
ATOM   505  C C   . ARG A 1 82  ? 12.403  -28.315 18.874 1.00 74.73  ? 60  ARG A C   1 
ATOM   506  O O   . ARG A 1 82  ? 12.521  -27.287 18.227 1.00 80.29  ? 60  ARG A O   1 
ATOM   507  C CB  . ARG A 1 82  ? 14.153  -30.060 18.538 1.00 77.07  ? 60  ARG A CB  1 
ATOM   508  C CG  . ARG A 1 82  ? 15.596  -30.500 18.824 1.00 83.15  ? 60  ARG A CG  1 
ATOM   509  C CD  . ARG A 1 82  ? 16.167  -31.329 17.674 1.00 78.77  ? 60  ARG A CD  1 
ATOM   510  N NE  . ARG A 1 82  ? 15.269  -32.435 17.327 1.00 84.97  ? 60  ARG A NE  1 
ATOM   511  C CZ  . ARG A 1 82  ? 15.420  -33.685 17.761 1.00 83.39  ? 60  ARG A CZ  1 
ATOM   512  N NH1 . ARG A 1 82  ? 16.452  -33.998 18.547 1.00 80.74  ? 60  ARG A NH1 1 
ATOM   513  N NH2 . ARG A 1 82  ? 14.544  -34.620 17.407 1.00 75.57  ? 60  ARG A NH2 1 
ATOM   514  N N   . VAL A 1 83  ? 11.227  -28.891 19.100 1.00 71.25  ? 61  VAL A N   1 
ATOM   515  C CA  . VAL A 1 83  ? 9.992   -28.259 18.675 1.00 63.33  ? 61  VAL A CA  1 
ATOM   516  C C   . VAL A 1 83  ? 9.808   -26.916 19.358 1.00 70.51  ? 61  VAL A C   1 
ATOM   517  O O   . VAL A 1 83  ? 9.441   -25.932 18.730 1.00 75.92  ? 61  VAL A O   1 
ATOM   518  C CB  . VAL A 1 83  ? 8.784   -29.138 18.968 1.00 63.44  ? 61  VAL A CB  1 
ATOM   519  C CG1 . VAL A 1 83  ? 7.530   -28.310 19.102 1.00 63.33  ? 61  VAL A CG1 1 
ATOM   520  C CG2 . VAL A 1 83  ? 8.621   -30.175 17.892 1.00 64.93  ? 61  VAL A CG2 1 
ATOM   521  N N   . VAL A 1 84  ? 10.082  -26.864 20.651 1.00 75.06  ? 62  VAL A N   1 
ATOM   522  C CA  . VAL A 1 84  ? 9.785   -25.658 21.415 1.00 78.30  ? 62  VAL A CA  1 
ATOM   523  C C   . VAL A 1 84  ? 10.861  -24.613 21.198 1.00 77.62  ? 62  VAL A C   1 
ATOM   524  O O   . VAL A 1 84  ? 10.580  -23.435 21.047 1.00 81.83  ? 62  VAL A O   1 
ATOM   525  C CB  . VAL A 1 84  ? 9.620   -25.977 22.928 1.00 76.74  ? 62  VAL A CB  1 
ATOM   526  C CG1 . VAL A 1 84  ? 9.951   -24.773 23.789 1.00 78.57  ? 62  VAL A CG1 1 
ATOM   527  C CG2 . VAL A 1 84  ? 8.192   -26.459 23.215 1.00 66.76  ? 62  VAL A CG2 1 
ATOM   528  N N   . SER A 1 85  ? 12.101  -25.060 21.144 1.00 82.56  ? 63  SER A N   1 
ATOM   529  C CA  . SER A 1 85  ? 13.214  -24.148 20.976 1.00 84.74  ? 63  SER A CA  1 
ATOM   530  C C   . SER A 1 85  ? 13.082  -23.493 19.591 1.00 88.04  ? 63  SER A C   1 
ATOM   531  O O   . SER A 1 85  ? 13.467  -22.338 19.402 1.00 90.48  ? 63  SER A O   1 
ATOM   532  C CB  . SER A 1 85  ? 14.539  -24.896 21.151 1.00 80.05  ? 63  SER A CB  1 
ATOM   533  O OG  . SER A 1 85  ? 15.656  -24.103 20.806 1.00 96.23  ? 63  SER A OG  1 
ATOM   534  N N   . SER A 1 86  ? 12.488  -24.220 18.645 1.00 85.06  ? 64  SER A N   1 
ATOM   535  C CA  . SER A 1 86  ? 12.205  -23.675 17.324 1.00 85.77  ? 64  SER A CA  1 
ATOM   536  C C   . SER A 1 86  ? 11.147  -22.589 17.408 1.00 89.57  ? 64  SER A C   1 
ATOM   537  O O   . SER A 1 86  ? 11.367  -21.455 16.976 1.00 96.64  ? 64  SER A O   1 
ATOM   538  C CB  . SER A 1 86  ? 11.743  -24.777 16.371 1.00 82.04  ? 64  SER A CB  1 
ATOM   539  O OG  . SER A 1 86  ? 11.084  -24.230 15.240 1.00 82.84  ? 64  SER A OG  1 
ATOM   540  N N   . ILE A 1 87  ? 9.995   -22.957 17.963 1.00 88.27  ? 65  ILE A N   1 
ATOM   541  C CA  . ILE A 1 87  ? 8.876   -22.038 18.145 1.00 88.40  ? 65  ILE A CA  1 
ATOM   542  C C   . ILE A 1 87  ? 9.318   -20.827 18.952 1.00 92.00  ? 65  ILE A C   1 
ATOM   543  O O   . ILE A 1 87  ? 8.855   -19.712 18.726 1.00 100.24 ? 65  ILE A O   1 
ATOM   544  C CB  . ILE A 1 87  ? 7.684   -22.721 18.851 1.00 81.21  ? 65  ILE A CB  1 
ATOM   545  C CG1 . ILE A 1 87  ? 7.110   -23.843 17.982 1.00 78.00  ? 65  ILE A CG1 1 
ATOM   546  C CG2 . ILE A 1 87  ? 6.607   -21.706 19.179 1.00 79.37  ? 65  ILE A CG2 1 
ATOM   547  C CD1 . ILE A 1 87  ? 5.770   -24.369 18.439 1.00 75.19  ? 65  ILE A CD1 1 
ATOM   548  N N   . GLU A 1 88  ? 10.245  -21.047 19.875 1.00 91.48  ? 66  GLU A N   1 
ATOM   549  C CA  . GLU A 1 88  ? 10.818  -19.958 20.651 1.00 94.31  ? 66  GLU A CA  1 
ATOM   550  C C   . GLU A 1 88  ? 11.332  -18.869 19.730 1.00 98.10  ? 66  GLU A C   1 
ATOM   551  O O   . GLU A 1 88  ? 11.293  -17.693 20.069 1.00 107.35 ? 66  GLU A O   1 
ATOM   552  C CB  . GLU A 1 88  ? 11.953  -20.462 21.549 1.00 92.38  ? 66  GLU A CB  1 
ATOM   553  C CG  . GLU A 1 88  ? 12.641  -19.375 22.359 1.00 89.65  ? 66  GLU A CG  1 
ATOM   554  C CD  . GLU A 1 88  ? 13.630  -19.916 23.392 1.00 91.61  ? 66  GLU A CD  1 
ATOM   555  O OE1 . GLU A 1 88  ? 14.073  -21.081 23.265 1.00 92.21  ? 66  GLU A OE1 1 
ATOM   556  O OE2 . GLU A 1 88  ? 13.973  -19.164 24.333 1.00 86.14  ? 66  GLU A OE2 1 
ATOM   557  N N   . GLN A 1 89  ? 11.777  -19.262 18.543 1.00 98.35  ? 67  GLN A N   1 
ATOM   558  C CA  . GLN A 1 89  ? 12.524  -18.352 17.690 1.00 100.17 ? 67  GLN A CA  1 
ATOM   559  C C   . GLN A 1 89  ? 11.769  -17.910 16.453 1.00 102.54 ? 67  GLN A C   1 
ATOM   560  O O   . GLN A 1 89  ? 12.220  -17.027 15.740 1.00 109.77 ? 67  GLN A O   1 
ATOM   561  C CB  . GLN A 1 89  ? 13.845  -19.002 17.297 1.00 97.47  ? 67  GLN A CB  1 
ATOM   562  C CG  . GLN A 1 89  ? 14.695  -19.327 18.508 1.00 106.94 ? 67  GLN A CG  1 
ATOM   563  C CD  . GLN A 1 89  ? 15.694  -20.444 18.262 1.00 110.74 ? 67  GLN A CD  1 
ATOM   564  O OE1 . GLN A 1 89  ? 15.840  -20.935 17.134 1.00 105.61 ? 67  GLN A OE1 1 
ATOM   565  N NE2 . GLN A 1 89  ? 16.373  -20.873 19.334 1.00 104.95 ? 67  GLN A NE2 1 
ATOM   566  N N   . LYS A 1 90  ? 10.616  -18.506 16.194 1.00 102.68 ? 68  LYS A N   1 
ATOM   567  C CA  . LYS A 1 90  ? 9.776   -18.015 15.109 1.00 108.10 ? 68  LYS A CA  1 
ATOM   568  C C   . LYS A 1 90  ? 8.915   -16.837 15.594 1.00 117.46 ? 68  LYS A C   1 
ATOM   569  O O   . LYS A 1 90  ? 7.867   -16.551 15.008 1.00 121.06 ? 68  LYS A O   1 
ATOM   570  C CB  . LYS A 1 90  ? 8.890   -19.138 14.551 1.00 98.49  ? 68  LYS A CB  1 
ATOM   571  N N   . THR A 1 91  ? 9.362   -16.150 16.650 1.00 116.95 ? 69  THR A N   1 
ATOM   572  C CA  . THR A 1 91  ? 8.561   -15.089 17.279 1.00 121.88 ? 69  THR A CA  1 
ATOM   573  C C   . THR A 1 91  ? 8.943   -13.655 16.868 1.00 127.50 ? 69  THR A C   1 
ATOM   574  O O   . THR A 1 91  ? 10.123  -13.269 16.916 1.00 120.50 ? 69  THR A O   1 
ATOM   575  C CB  . THR A 1 91  ? 8.637   -15.167 18.825 1.00 116.95 ? 69  THR A CB  1 
ATOM   576  O OG1 . THR A 1 91  ? 8.123   -16.428 19.276 1.00 112.60 ? 69  THR A OG1 1 
ATOM   577  C CG2 . THR A 1 91  ? 7.821   -14.040 19.459 1.00 117.12 ? 69  THR A CG2 1 
ATOM   578  N N   . GLU A 1 92  ? 7.922   -12.884 16.476 1.00 127.48 ? 70  GLU A N   1 
ATOM   579  C CA  . GLU A 1 92  ? 8.037   -11.447 16.210 1.00 126.15 ? 70  GLU A CA  1 
ATOM   580  C C   . GLU A 1 92  ? 8.895   -10.707 17.243 1.00 125.89 ? 70  GLU A C   1 
ATOM   581  O O   . GLU A 1 92  ? 8.459   -10.460 18.374 1.00 127.87 ? 70  GLU A O   1 
ATOM   582  C CB  . GLU A 1 92  ? 6.640   -10.816 16.163 1.00 121.40 ? 70  GLU A CB  1 
ATOM   583  N N   . GLU A 1 95  ? 6.123   -11.507 20.827 1.00 116.27 ? 73  GLU A N   1 
ATOM   584  C CA  . GLU A 1 95  ? 6.831   -10.675 21.800 1.00 124.41 ? 73  GLU A CA  1 
ATOM   585  C C   . GLU A 1 95  ? 6.763   -11.277 23.197 1.00 122.01 ? 73  GLU A C   1 
ATOM   586  O O   . GLU A 1 95  ? 7.776   -11.712 23.747 1.00 117.52 ? 73  GLU A O   1 
ATOM   587  C CB  . GLU A 1 95  ? 6.259   -9.251  21.826 1.00 124.79 ? 73  GLU A CB  1 
ATOM   588  N N   . LYS A 1 96  ? 5.561   -11.286 23.771 1.00 127.52 ? 74  LYS A N   1 
ATOM   589  C CA  . LYS A 1 96  ? 5.339   -11.850 25.106 1.00 128.68 ? 74  LYS A CA  1 
ATOM   590  C C   . LYS A 1 96  ? 5.280   -13.378 25.046 1.00 124.45 ? 74  LYS A C   1 
ATOM   591  O O   . LYS A 1 96  ? 5.738   -14.073 25.965 1.00 116.46 ? 74  LYS A O   1 
ATOM   592  C CB  . LYS A 1 96  ? 4.050   -11.293 25.723 1.00 124.20 ? 74  LYS A CB  1 
ATOM   593  N N   . LYS A 1 97  ? 4.712   -13.886 23.951 1.00 120.81 ? 75  LYS A N   1 
ATOM   594  C CA  . LYS A 1 97  ? 4.620   -15.319 23.708 1.00 109.95 ? 75  LYS A CA  1 
ATOM   595  C C   . LYS A 1 97  ? 6.008   -15.956 23.631 1.00 112.41 ? 75  LYS A C   1 
ATOM   596  O O   . LYS A 1 97  ? 6.170   -17.135 23.948 1.00 107.63 ? 75  LYS A O   1 
ATOM   597  C CB  . LYS A 1 97  ? 3.839   -15.594 22.419 1.00 103.06 ? 75  LYS A CB  1 
ATOM   598  N N   . GLN A 1 98  ? 7.004   -15.171 23.212 1.00 117.79 ? 76  GLN A N   1 
ATOM   599  C CA  . GLN A 1 98  ? 8.380   -15.654 23.093 1.00 107.31 ? 76  GLN A CA  1 
ATOM   600  C C   . GLN A 1 98  ? 8.868   -16.273 24.398 1.00 103.79 ? 76  GLN A C   1 
ATOM   601  O O   . GLN A 1 98  ? 9.374   -17.390 24.396 1.00 101.83 ? 76  GLN A O   1 
ATOM   602  C CB  . GLN A 1 98  ? 9.329   -14.527 22.667 1.00 105.48 ? 76  GLN A CB  1 
ATOM   603  N N   . GLN A 1 99  ? 8.709   -15.574 25.517 1.00 105.84 ? 77  GLN A N   1 
ATOM   604  C CA  . GLN A 1 99  ? 9.253   -16.101 26.770 1.00 104.07 ? 77  GLN A CA  1 
ATOM   605  C C   . GLN A 1 99  ? 8.327   -17.089 27.480 1.00 99.94  ? 77  GLN A C   1 
ATOM   606  O O   . GLN A 1 99  ? 8.770   -17.829 28.355 1.00 98.47  ? 77  GLN A O   1 
ATOM   607  C CB  . GLN A 1 99  ? 9.653   -14.955 27.708 1.00 110.74 ? 77  GLN A CB  1 
ATOM   608  C CG  . GLN A 1 99  ? 11.016  -14.353 27.321 1.00 118.08 ? 77  GLN A CG  1 
ATOM   609  C CD  . GLN A 1 99  ? 10.911  -13.018 26.595 1.00 117.95 ? 77  GLN A CD  1 
ATOM   610  O OE1 . GLN A 1 99  ? 9.830   -12.435 26.491 1.00 123.87 ? 77  GLN A OE1 1 
ATOM   611  N NE2 . GLN A 1 99  ? 12.034  -12.546 26.061 1.00 106.46 ? 77  GLN A NE2 1 
ATOM   612  N N   . MET A 1 100 ? 7.059   -17.135 27.096 1.00 99.37  ? 78  MET A N   1 
ATOM   613  C CA  . MET A 1 100 ? 6.262   -18.307 27.423 1.00 93.52  ? 78  MET A CA  1 
ATOM   614  C C   . MET A 1 100 ? 7.022   -19.556 26.976 1.00 92.82  ? 78  MET A C   1 
ATOM   615  O O   . MET A 1 100 ? 7.284   -20.462 27.770 1.00 92.36  ? 78  MET A O   1 
ATOM   616  C CB  . MET A 1 100 ? 4.894   -18.242 26.757 1.00 92.85  ? 78  MET A CB  1 
ATOM   617  C CG  . MET A 1 100 ? 3.893   -17.463 27.556 1.00 102.58 ? 78  MET A CG  1 
ATOM   618  S SD  . MET A 1 100 ? 3.478   -18.351 29.072 1.00 117.71 ? 78  MET A SD  1 
ATOM   619  C CE  . MET A 1 100 ? 2.894   -19.873 28.328 1.00 104.31 ? 78  MET A CE  1 
ATOM   620  N N   . ALA A 1 101 ? 7.405   -19.571 25.703 1.00 93.34  ? 79  ALA A N   1 
ATOM   621  C CA  . ALA A 1 101 ? 8.175   -20.665 25.124 1.00 91.82  ? 79  ALA A CA  1 
ATOM   622  C C   . ALA A 1 101 ? 9.554   -20.833 25.772 1.00 88.98  ? 79  ALA A C   1 
ATOM   623  O O   . ALA A 1 101 ? 10.018  -21.954 25.970 1.00 88.96  ? 79  ALA A O   1 
ATOM   624  C CB  . ALA A 1 101 ? 8.328   -20.454 23.631 1.00 89.83  ? 79  ALA A CB  1 
ATOM   625  N N   . ARG A 1 102 ? 10.210  -19.723 26.086 1.00 86.21  ? 80  ARG A N   1 
ATOM   626  C CA  . ARG A 1 102 ? 11.549  -19.782 26.637 1.00 83.58  ? 80  ARG A CA  1 
ATOM   627  C C   . ARG A 1 102 ? 11.548  -20.562 27.952 1.00 88.28  ? 80  ARG A C   1 
ATOM   628  O O   . ARG A 1 102 ? 12.433  -21.376 28.217 1.00 86.55  ? 80  ARG A O   1 
ATOM   629  C CB  . ARG A 1 102 ? 12.103  -18.372 26.847 1.00 90.74  ? 80  ARG A CB  1 
ATOM   630  C CG  . ARG A 1 102 ? 13.450  -18.340 27.557 1.00 92.69  ? 80  ARG A CG  1 
ATOM   631  C CD  . ARG A 1 102 ? 13.905  -16.925 27.863 1.00 94.33  ? 80  ARG A CD  1 
ATOM   632  N NE  . ARG A 1 102 ? 15.261  -16.922 28.402 1.00 100.19 ? 80  ARG A NE  1 
ATOM   633  N N   . GLU A 1 103 ? 10.541  -20.325 28.776 1.00 86.90  ? 81  GLU A N   1 
ATOM   634  C CA  . GLU A 1 103 ? 10.491  -21.001 30.052 1.00 86.66  ? 81  GLU A CA  1 
ATOM   635  C C   . GLU A 1 103 ? 10.189  -22.472 29.847 1.00 84.79  ? 81  GLU A C   1 
ATOM   636  O O   . GLU A 1 103 ? 10.863  -23.326 30.426 1.00 81.97  ? 81  GLU A O   1 
ATOM   637  C CB  . GLU A 1 103 ? 9.460   -20.350 30.966 1.00 94.79  ? 81  GLU A CB  1 
ATOM   638  C CG  . GLU A 1 103 ? 9.967   -19.071 31.615 1.00 97.98  ? 81  GLU A CG  1 
ATOM   639  C CD  . GLU A 1 103 ? 8.911   -18.384 32.454 1.00 100.36 ? 81  GLU A CD  1 
ATOM   640  O OE1 . GLU A 1 103 ? 7.709   -18.643 32.220 1.00 104.50 ? 81  GLU A OE1 1 
ATOM   641  O OE2 . GLU A 1 103 ? 9.282   -17.571 33.325 1.00 95.58  ? 81  GLU A OE2 1 
ATOM   642  N N   . TYR A 1 104 ? 9.197   -22.767 29.008 1.00 84.29  ? 82  TYR A N   1 
ATOM   643  C CA  . TYR A 1 104 ? 8.856   -24.154 28.688 1.00 79.54  ? 82  TYR A CA  1 
ATOM   644  C C   . TYR A 1 104 ? 10.077  -24.942 28.227 1.00 83.69  ? 82  TYR A C   1 
ATOM   645  O O   . TYR A 1 104 ? 10.317  -26.077 28.669 1.00 80.05  ? 82  TYR A O   1 
ATOM   646  C CB  . TYR A 1 104 ? 7.785   -24.201 27.621 1.00 71.31  ? 82  TYR A CB  1 
ATOM   647  C CG  . TYR A 1 104 ? 7.061   -25.516 27.550 1.00 71.53  ? 82  TYR A CG  1 
ATOM   648  C CD1 . TYR A 1 104 ? 6.979   -26.350 28.654 1.00 77.23  ? 82  TYR A CD1 1 
ATOM   649  C CD2 . TYR A 1 104 ? 6.398   -25.891 26.406 1.00 78.43  ? 82  TYR A CD2 1 
ATOM   650  C CE1 . TYR A 1 104 ? 6.290   -27.546 28.595 1.00 72.59  ? 82  TYR A CE1 1 
ATOM   651  C CE2 . TYR A 1 104 ? 5.707   -27.080 26.338 1.00 79.06  ? 82  TYR A CE2 1 
ATOM   652  C CZ  . TYR A 1 104 ? 5.654   -27.900 27.431 1.00 77.92  ? 82  TYR A CZ  1 
ATOM   653  O OH  . TYR A 1 104 ? 4.952   -29.077 27.340 1.00 83.22  ? 82  TYR A OH  1 
ATOM   654  N N   . ARG A 1 105 ? 10.859  -24.321 27.352 1.00 78.95  ? 83  ARG A N   1 
ATOM   655  C CA  . ARG A 1 105 ? 12.120  -24.903 26.946 1.00 79.53  ? 83  ARG A CA  1 
ATOM   656  C C   . ARG A 1 105 ? 12.975  -25.225 28.178 1.00 83.05  ? 83  ARG A C   1 
ATOM   657  O O   . ARG A 1 105 ? 13.465  -26.348 28.326 1.00 82.36  ? 83  ARG A O   1 
ATOM   658  C CB  . ARG A 1 105 ? 12.870  -23.969 25.996 1.00 79.94  ? 83  ARG A CB  1 
ATOM   659  C CG  . ARG A 1 105 ? 13.818  -24.699 25.067 1.00 79.62  ? 83  ARG A CG  1 
ATOM   660  C CD  . ARG A 1 105 ? 15.211  -24.132 25.132 1.00 81.88  ? 83  ARG A CD  1 
ATOM   661  N NE  . ARG A 1 105 ? 15.207  -22.681 25.040 1.00 79.97  ? 83  ARG A NE  1 
ATOM   662  C CZ  . ARG A 1 105 ? 15.963  -21.887 25.789 1.00 84.70  ? 83  ARG A CZ  1 
ATOM   663  N NH1 . ARG A 1 105 ? 16.790  -22.396 26.692 1.00 86.74  ? 83  ARG A NH1 1 
ATOM   664  N NH2 . ARG A 1 105 ? 15.895  -20.577 25.634 1.00 89.18  ? 83  ARG A NH2 1 
ATOM   665  N N   . GLU A 1 106 ? 13.124  -24.259 29.079 1.00 82.39  ? 84  GLU A N   1 
ATOM   666  C CA  . GLU A 1 106 ? 13.977  -24.459 30.244 1.00 81.44  ? 84  GLU A CA  1 
ATOM   667  C C   . GLU A 1 106 ? 13.490  -25.611 31.130 1.00 80.17  ? 84  GLU A C   1 
ATOM   668  O O   . GLU A 1 106 ? 14.301  -26.368 31.684 1.00 77.19  ? 84  GLU A O   1 
ATOM   669  C CB  . GLU A 1 106 ? 14.078  -23.165 31.050 1.00 86.61  ? 84  GLU A CB  1 
ATOM   670  C CG  . GLU A 1 106 ? 14.915  -22.084 30.372 1.00 92.44  ? 84  GLU A CG  1 
ATOM   671  C CD  . GLU A 1 106 ? 14.812  -20.734 31.065 1.00 102.01 ? 84  GLU A CD  1 
ATOM   672  O OE1 . GLU A 1 106 ? 13.858  -20.547 31.854 1.00 99.60  ? 84  GLU A OE1 1 
ATOM   673  O OE2 . GLU A 1 106 ? 15.683  -19.864 30.819 1.00 105.77 ? 84  GLU A OE2 1 
ATOM   674  N N   . LYS A 1 107 ? 12.172  -25.755 31.253 1.00 79.33  ? 85  LYS A N   1 
ATOM   675  C CA  . LYS A 1 107 ? 11.614  -26.856 32.031 1.00 76.96  ? 85  LYS A CA  1 
ATOM   676  C C   . LYS A 1 107 ? 11.983  -28.173 31.351 1.00 80.41  ? 85  LYS A C   1 
ATOM   677  O O   . LYS A 1 107 ? 12.398  -29.121 32.021 1.00 85.44  ? 85  LYS A O   1 
ATOM   678  C CB  . LYS A 1 107 ? 10.095  -26.720 32.199 1.00 65.56  ? 85  LYS A CB  1 
ATOM   679  N N   . ILE A 1 108 ? 11.866  -28.220 30.024 1.00 71.55  ? 86  ILE A N   1 
ATOM   680  C CA  . ILE A 1 108 ? 12.274  -29.397 29.263 1.00 71.10  ? 86  ILE A CA  1 
ATOM   681  C C   . ILE A 1 108 ? 13.783  -29.644 29.393 1.00 72.49  ? 86  ILE A C   1 
ATOM   682  O O   . ILE A 1 108 ? 14.211  -30.783 29.602 1.00 72.53  ? 86  ILE A O   1 
ATOM   683  C CB  . ILE A 1 108 ? 11.879  -29.263 27.766 1.00 78.72  ? 86  ILE A CB  1 
ATOM   684  C CG1 . ILE A 1 108 ? 10.357  -29.164 27.627 1.00 78.72  ? 86  ILE A CG1 1 
ATOM   685  C CG2 . ILE A 1 108 ? 12.373  -30.439 26.957 1.00 68.57  ? 86  ILE A CG2 1 
ATOM   686  C CD1 . ILE A 1 108 ? 9.890   -28.793 26.254 1.00 69.45  ? 86  ILE A CD1 1 
ATOM   687  N N   . GLU A 1 109 ? 14.595  -28.594 29.297 1.00 67.64  ? 87  GLU A N   1 
ATOM   688  C CA  . GLU A 1 109 ? 16.028  -28.779 29.485 1.00 71.45  ? 87  GLU A CA  1 
ATOM   689  C C   . GLU A 1 109 ? 16.266  -29.475 30.847 1.00 82.10  ? 87  GLU A C   1 
ATOM   690  O O   . GLU A 1 109 ? 17.138  -30.352 30.976 1.00 80.24  ? 87  GLU A O   1 
ATOM   691  C CB  . GLU A 1 109 ? 16.789  -27.445 29.420 1.00 75.27  ? 87  GLU A CB  1 
ATOM   692  C CG  . GLU A 1 109 ? 16.567  -26.625 28.151 1.00 81.97  ? 87  GLU A CG  1 
ATOM   693  C CD  . GLU A 1 109 ? 17.615  -25.517 27.911 1.00 90.46  ? 87  GLU A CD  1 
ATOM   694  O OE1 . GLU A 1 109 ? 18.252  -25.037 28.886 1.00 89.26  ? 87  GLU A OE1 1 
ATOM   695  O OE2 . GLU A 1 109 ? 17.807  -25.137 26.722 1.00 88.34  ? 87  GLU A OE2 1 
ATOM   696  N N   . THR A 1 110 ? 15.476  -29.108 31.859 1.00 76.40  ? 88  THR A N   1 
ATOM   697  C CA  . THR A 1 110 ? 15.683  -29.684 33.179 1.00 79.51  ? 88  THR A CA  1 
ATOM   698  C C   . THR A 1 110 ? 15.336  -31.166 33.193 1.00 79.62  ? 88  THR A C   1 
ATOM   699  O O   . THR A 1 110 ? 16.138  -31.971 33.680 1.00 78.67  ? 88  THR A O   1 
ATOM   700  C CB  . THR A 1 110 ? 14.875  -28.959 34.284 1.00 86.64  ? 88  THR A CB  1 
ATOM   701  O OG1 . THR A 1 110 ? 15.425  -27.653 34.499 1.00 91.52  ? 88  THR A OG1 1 
ATOM   702  C CG2 . THR A 1 110 ? 14.982  -29.726 35.591 1.00 79.53  ? 88  THR A CG2 1 
ATOM   703  N N   . GLU A 1 111 ? 14.161  -31.532 32.672 1.00 74.28  ? 89  GLU A N   1 
ATOM   704  C CA  . GLU A 1 111 ? 13.825  -32.952 32.539 1.00 74.43  ? 89  GLU A CA  1 
ATOM   705  C C   . GLU A 1 111 ? 14.988  -33.688 31.890 1.00 77.97  ? 89  GLU A C   1 
ATOM   706  O O   . GLU A 1 111 ? 15.454  -34.694 32.419 1.00 75.24  ? 89  GLU A O   1 
ATOM   707  C CB  . GLU A 1 111 ? 12.570  -33.160 31.711 1.00 70.44  ? 89  GLU A CB  1 
ATOM   708  C CG  . GLU A 1 111 ? 11.295  -33.286 32.479 1.00 66.59  ? 89  GLU A CG  1 
ATOM   709  C CD  . GLU A 1 111 ? 10.127  -33.655 31.580 1.00 81.31  ? 89  GLU A CD  1 
ATOM   710  O OE1 . GLU A 1 111 ? 10.116  -34.752 30.967 1.00 78.92  ? 89  GLU A OE1 1 
ATOM   711  O OE2 . GLU A 1 111 ? 9.220   -32.817 31.454 1.00 88.95  ? 89  GLU A OE2 1 
ATOM   712  N N   . LEU A 1 112 ? 15.463  -33.142 30.764 1.00 75.03  ? 90  LEU A N   1 
ATOM   713  C CA  . LEU A 1 112 ? 16.608  -33.668 30.022 1.00 71.01  ? 90  LEU A CA  1 
ATOM   714  C C   . LEU A 1 112 ? 17.841  -33.917 30.860 1.00 75.19  ? 90  LEU A C   1 
ATOM   715  O O   . LEU A 1 112 ? 18.430  -35.004 30.813 1.00 73.97  ? 90  LEU A O   1 
ATOM   716  C CB  . LEU A 1 112 ? 17.009  -32.706 28.918 1.00 74.79  ? 90  LEU A CB  1 
ATOM   717  C CG  . LEU A 1 112 ? 16.498  -32.890 27.500 1.00 75.67  ? 90  LEU A CG  1 
ATOM   718  C CD1 . LEU A 1 112 ? 17.125  -31.800 26.660 1.00 72.29  ? 90  LEU A CD1 1 
ATOM   719  C CD2 . LEU A 1 112 ? 16.844  -34.269 26.978 1.00 70.78  ? 90  LEU A CD2 1 
ATOM   720  N N   . ARG A 1 113 ? 18.259  -32.886 31.589 1.00 74.33  ? 91  ARG A N   1 
ATOM   721  C CA  . ARG A 1 113 ? 19.482  -32.978 32.367 1.00 77.11  ? 91  ARG A CA  1 
ATOM   722  C C   . ARG A 1 113 ? 19.348  -34.049 33.449 1.00 78.13  ? 91  ARG A C   1 
ATOM   723  O O   . ARG A 1 113 ? 20.321  -34.731 33.787 1.00 76.66  ? 91  ARG A O   1 
ATOM   724  C CB  . ARG A 1 113 ? 19.836  -31.627 32.978 1.00 79.14  ? 91  ARG A CB  1 
ATOM   725  C CG  . ARG A 1 113 ? 20.141  -30.564 31.950 1.00 77.16  ? 91  ARG A CG  1 
ATOM   726  C CD  . ARG A 1 113 ? 20.993  -29.456 32.533 1.00 76.23  ? 91  ARG A CD  1 
ATOM   727  N NE  . ARG A 1 113 ? 21.352  -28.473 31.512 1.00 80.67  ? 91  ARG A NE  1 
ATOM   728  C CZ  . ARG A 1 113 ? 20.588  -27.439 31.166 1.00 88.52  ? 91  ARG A CZ  1 
ATOM   729  N NH1 . ARG A 1 113 ? 19.410  -27.249 31.753 1.00 85.69  ? 91  ARG A NH1 1 
ATOM   730  N NH2 . ARG A 1 113 ? 20.994  -26.594 30.221 1.00 94.69  ? 91  ARG A NH2 1 
ATOM   731  N N   . ASP A 1 114 ? 18.138  -34.221 33.970 1.00 73.34  ? 92  ASP A N   1 
ATOM   732  C CA  . ASP A 1 114 ? 17.913  -35.268 34.950 1.00 74.40  ? 92  ASP A CA  1 
ATOM   733  C C   . ASP A 1 114 ? 18.183  -36.628 34.322 1.00 76.12  ? 92  ASP A C   1 
ATOM   734  O O   . ASP A 1 114 ? 19.076  -37.358 34.749 1.00 78.40  ? 92  ASP A O   1 
ATOM   735  C CB  . ASP A 1 114 ? 16.490  -35.209 35.498 1.00 83.17  ? 92  ASP A CB  1 
ATOM   736  C CG  . ASP A 1 114 ? 16.279  -34.060 36.478 1.00 91.20  ? 92  ASP A CG  1 
ATOM   737  O OD1 . ASP A 1 114 ? 17.201  -33.210 36.634 1.00 89.43  ? 92  ASP A OD1 1 
ATOM   738  O OD2 . ASP A 1 114 ? 15.171  -34.004 37.071 1.00 89.93  ? 92  ASP A OD2 1 
ATOM   739  N N   . ILE A 1 115 ? 17.409  -36.952 33.293 1.00 75.89  ? 93  ILE A N   1 
ATOM   740  C CA  . ILE A 1 115 ? 17.556  -38.207 32.577 1.00 74.44  ? 93  ILE A CA  1 
ATOM   741  C C   . ILE A 1 115 ? 19.000  -38.447 32.166 1.00 77.84  ? 93  ILE A C   1 
ATOM   742  O O   . ILE A 1 115 ? 19.533  -39.545 32.326 1.00 77.26  ? 93  ILE A O   1 
ATOM   743  C CB  . ILE A 1 115 ? 16.677  -38.244 31.323 1.00 73.68  ? 93  ILE A CB  1 
ATOM   744  C CG1 . ILE A 1 115 ? 15.296  -37.666 31.626 1.00 70.09  ? 93  ILE A CG1 1 
ATOM   745  C CG2 . ILE A 1 115 ? 16.578  -39.671 30.792 1.00 74.05  ? 93  ILE A CG2 1 
ATOM   746  C CD1 . ILE A 1 115 ? 14.375  -37.636 30.453 1.00 68.21  ? 93  ILE A CD1 1 
ATOM   747  N N   . CYS A 1 116 ? 19.640  -37.412 31.646 1.00 72.79  ? 94  CYS A N   1 
ATOM   748  C CA  . CYS A 1 116 ? 21.029  -37.542 31.277 1.00 71.43  ? 94  CYS A CA  1 
ATOM   749  C C   . CYS A 1 116 ? 21.901  -37.879 32.461 1.00 71.65  ? 94  CYS A C   1 
ATOM   750  O O   . CYS A 1 116 ? 22.734  -38.777 32.392 1.00 72.01  ? 94  CYS A O   1 
ATOM   751  C CB  . CYS A 1 116 ? 21.515  -36.265 30.621 1.00 77.76  ? 94  CYS A CB  1 
ATOM   752  S SG  . CYS A 1 116 ? 21.176  -36.236 28.874 1.00 79.00  ? 94  CYS A SG  1 
ATOM   753  N N   . ASN A 1 117 ? 21.708  -37.161 33.557 1.00 74.84  ? 95  ASN A N   1 
ATOM   754  C CA  . ASN A 1 117 ? 22.569  -37.358 34.716 1.00 75.74  ? 95  ASN A CA  1 
ATOM   755  C C   . ASN A 1 117 ? 22.278  -38.685 35.422 1.00 73.05  ? 95  ASN A C   1 
ATOM   756  O O   . ASN A 1 117 ? 23.185  -39.371 35.879 1.00 71.83  ? 95  ASN A O   1 
ATOM   757  C CB  . ASN A 1 117 ? 22.428  -36.182 35.669 1.00 72.51  ? 95  ASN A CB  1 
ATOM   758  C CG  . ASN A 1 117 ? 23.013  -34.915 35.101 1.00 74.70  ? 95  ASN A CG  1 
ATOM   759  O OD1 . ASN A 1 117 ? 24.029  -34.954 34.411 1.00 77.23  ? 95  ASN A OD1 1 
ATOM   760  N ND2 . ASN A 1 117 ? 22.380  -33.781 35.387 1.00 78.18  ? 95  ASN A ND2 1 
ATOM   761  N N   . ASP A 1 118 ? 21.002  -39.036 35.485 1.00 73.12  ? 96  ASP A N   1 
ATOM   762  C CA  . ASP A 1 118 ? 20.580  -40.348 35.929 1.00 74.60  ? 96  ASP A CA  1 
ATOM   763  C C   . ASP A 1 118 ? 21.375  -41.454 35.241 1.00 76.46  ? 96  ASP A C   1 
ATOM   764  O O   . ASP A 1 118 ? 22.003  -42.288 35.910 1.00 72.95  ? 96  ASP A O   1 
ATOM   765  C CB  . ASP A 1 118 ? 19.095  -40.538 35.653 1.00 81.26  ? 96  ASP A CB  1 
ATOM   766  C CG  . ASP A 1 118 ? 18.391  -41.263 36.769 1.00 91.32  ? 96  ASP A CG  1 
ATOM   767  O OD1 . ASP A 1 118 ? 19.059  -41.557 37.789 1.00 96.82  ? 96  ASP A OD1 1 
ATOM   768  O OD2 . ASP A 1 118 ? 17.187  -41.566 36.613 1.00 91.47  ? 96  ASP A OD2 1 
ATOM   769  N N   . VAL A 1 119 ? 21.350  -41.444 33.906 1.00 75.07  ? 97  VAL A N   1 
ATOM   770  C CA  . VAL A 1 119 ? 22.058  -42.438 33.115 1.00 70.49  ? 97  VAL A CA  1 
ATOM   771  C C   . VAL A 1 119 ? 23.553  -42.331 33.355 1.00 76.88  ? 97  VAL A C   1 
ATOM   772  O O   . VAL A 1 119 ? 24.225  -43.341 33.608 1.00 79.05  ? 97  VAL A O   1 
ATOM   773  C CB  . VAL A 1 119 ? 21.780  -42.289 31.624 1.00 68.58  ? 97  VAL A CB  1 
ATOM   774  C CG1 . VAL A 1 119 ? 22.597  -43.271 30.854 1.00 73.01  ? 97  VAL A CG1 1 
ATOM   775  C CG2 . VAL A 1 119 ? 20.348  -42.551 31.338 1.00 73.61  ? 97  VAL A CG2 1 
ATOM   776  N N   . LEU A 1 120 ? 24.071  -41.109 33.293 1.00 72.04  ? 98  LEU A N   1 
ATOM   777  C CA  . LEU A 1 120 ? 25.496  -40.899 33.508 1.00 72.52  ? 98  LEU A CA  1 
ATOM   778  C C   . LEU A 1 120 ? 25.952  -41.502 34.837 1.00 77.19  ? 98  LEU A C   1 
ATOM   779  O O   . LEU A 1 120 ? 27.011  -42.137 34.906 1.00 80.40  ? 98  LEU A O   1 
ATOM   780  C CB  . LEU A 1 120 ? 25.836  -39.412 33.431 1.00 72.41  ? 98  LEU A CB  1 
ATOM   781  C CG  . LEU A 1 120 ? 25.916  -38.938 31.969 1.00 80.87  ? 98  LEU A CG  1 
ATOM   782  C CD1 . LEU A 1 120 ? 26.346  -37.489 31.806 1.00 78.64  ? 98  LEU A CD1 1 
ATOM   783  C CD2 . LEU A 1 120 ? 26.856  -39.844 31.196 1.00 79.20  ? 98  LEU A CD2 1 
ATOM   784  N N   . SER A 1 121 ? 25.130  -41.344 35.873 1.00 76.47  ? 99  SER A N   1 
ATOM   785  C CA  . SER A 1 121 ? 25.401  -41.956 37.174 1.00 78.79  ? 99  SER A CA  1 
ATOM   786  C C   . SER A 1 121 ? 25.548  -43.457 37.036 1.00 80.41  ? 99  SER A C   1 
ATOM   787  O O   . SER A 1 121 ? 26.561  -44.027 37.447 1.00 80.50  ? 99  SER A O   1 
ATOM   788  C CB  . SER A 1 121 ? 24.289  -41.649 38.180 1.00 74.95  ? 99  SER A CB  1 
ATOM   789  O OG  . SER A 1 121 ? 24.430  -40.351 38.722 1.00 79.82  ? 99  SER A OG  1 
ATOM   790  N N   . LEU A 1 122 ? 24.528  -44.083 36.453 1.00 77.99  ? 100 LEU A N   1 
ATOM   791  C CA  . LEU A 1 122 ? 24.500  -45.527 36.295 1.00 75.60  ? 100 LEU A CA  1 
ATOM   792  C C   . LEU A 1 122 ? 25.755  -46.008 35.599 1.00 76.26  ? 100 LEU A C   1 
ATOM   793  O O   . LEU A 1 122 ? 26.309  -47.043 35.940 1.00 74.60  ? 100 LEU A O   1 
ATOM   794  C CB  . LEU A 1 122 ? 23.263  -45.957 35.511 1.00 77.87  ? 100 LEU A CB  1 
ATOM   795  C CG  . LEU A 1 122 ? 21.942  -45.864 36.255 1.00 71.24  ? 100 LEU A CG  1 
ATOM   796  C CD1 . LEU A 1 122 ? 20.834  -46.522 35.465 1.00 66.56  ? 100 LEU A CD1 1 
ATOM   797  C CD2 . LEU A 1 122 ? 22.114  -46.540 37.578 1.00 77.35  ? 100 LEU A CD2 1 
ATOM   798  N N   . LEU A 1 123 ? 26.207  -45.225 34.633 1.00 75.53  ? 101 LEU A N   1 
ATOM   799  C CA  . LEU A 1 123 ? 27.378  -45.582 33.863 1.00 78.00  ? 101 LEU A CA  1 
ATOM   800  C C   . LEU A 1 123 ? 28.648  -45.491 34.725 1.00 82.62  ? 101 LEU A C   1 
ATOM   801  O O   . LEU A 1 123 ? 29.535  -46.342 34.635 1.00 79.48  ? 101 LEU A O   1 
ATOM   802  C CB  . LEU A 1 123 ? 27.470  -44.687 32.620 1.00 80.38  ? 101 LEU A CB  1 
ATOM   803  C CG  . LEU A 1 123 ? 26.429  -44.866 31.489 1.00 75.62  ? 101 LEU A CG  1 
ATOM   804  C CD1 . LEU A 1 123 ? 26.476  -43.707 30.519 1.00 71.90  ? 101 LEU A CD1 1 
ATOM   805  C CD2 . LEU A 1 123 ? 26.621  -46.167 30.722 1.00 71.96  ? 101 LEU A CD2 1 
ATOM   806  N N   . GLU A 1 124 ? 28.722  -44.476 35.583 1.00 87.32  ? 102 GLU A N   1 
ATOM   807  C CA  . GLU A 1 124 ? 29.869  -44.333 36.488 1.00 87.06  ? 102 GLU A CA  1 
ATOM   808  C C   . GLU A 1 124 ? 29.851  -45.294 37.664 1.00 87.51  ? 102 GLU A C   1 
ATOM   809  O O   . GLU A 1 124 ? 30.844  -45.970 37.919 1.00 93.30  ? 102 GLU A O   1 
ATOM   810  C CB  . GLU A 1 124 ? 29.968  -42.905 37.023 1.00 87.41  ? 102 GLU A CB  1 
ATOM   811  C CG  . GLU A 1 124 ? 30.634  -41.975 36.027 1.00 104.79 ? 102 GLU A CG  1 
ATOM   812  C CD  . GLU A 1 124 ? 31.955  -42.544 35.519 1.00 108.96 ? 102 GLU A CD  1 
ATOM   813  O OE1 . GLU A 1 124 ? 32.771  -42.980 36.374 1.00 104.50 ? 102 GLU A OE1 1 
ATOM   814  O OE2 . GLU A 1 124 ? 32.160  -42.577 34.273 1.00 98.89  ? 102 GLU A OE2 1 
ATOM   815  N N   . LYS A 1 125 ? 28.734  -45.362 38.382 1.00 85.24  ? 103 LYS A N   1 
ATOM   816  C CA  . LYS A 1 125 ? 28.688  -46.160 39.610 1.00 86.96  ? 103 LYS A CA  1 
ATOM   817  C C   . LYS A 1 125 ? 28.534  -47.670 39.353 1.00 86.67  ? 103 LYS A C   1 
ATOM   818  O O   . LYS A 1 125 ? 28.860  -48.476 40.221 1.00 87.79  ? 103 LYS A O   1 
ATOM   819  C CB  . LYS A 1 125 ? 27.559  -45.670 40.535 1.00 73.09  ? 103 LYS A CB  1 
ATOM   820  N N   . PHE A 1 126 ? 28.058  -48.066 38.174 1.00 85.12  ? 104 PHE A N   1 
ATOM   821  C CA  . PHE A 1 126 ? 27.768  -49.484 37.951 1.00 80.93  ? 104 PHE A CA  1 
ATOM   822  C C   . PHE A 1 126 ? 28.326  -50.086 36.670 1.00 81.15  ? 104 PHE A C   1 
ATOM   823  O O   . PHE A 1 126 ? 29.117  -51.028 36.710 1.00 80.79  ? 104 PHE A O   1 
ATOM   824  C CB  . PHE A 1 126 ? 26.261  -49.718 37.956 1.00 76.02  ? 104 PHE A CB  1 
ATOM   825  C CG  . PHE A 1 126 ? 25.620  -49.538 39.289 1.00 80.11  ? 104 PHE A CG  1 
ATOM   826  C CD1 . PHE A 1 126 ? 24.827  -48.433 39.543 1.00 83.92  ? 104 PHE A CD1 1 
ATOM   827  C CD2 . PHE A 1 126 ? 25.791  -50.480 40.289 1.00 82.41  ? 104 PHE A CD2 1 
ATOM   828  C CE1 . PHE A 1 126 ? 24.216  -48.265 40.776 1.00 83.52  ? 104 PHE A CE1 1 
ATOM   829  C CE2 . PHE A 1 126 ? 25.190  -50.319 41.528 1.00 79.54  ? 104 PHE A CE2 1 
ATOM   830  C CZ  . PHE A 1 126 ? 24.401  -49.212 41.772 1.00 80.91  ? 104 PHE A CZ  1 
ATOM   831  N N   . LEU A 1 127 ? 27.880  -49.550 35.539 1.00 83.02  ? 105 LEU A N   1 
ATOM   832  C CA  . LEU A 1 127 ? 28.063  -50.193 34.237 1.00 80.91  ? 105 LEU A CA  1 
ATOM   833  C C   . LEU A 1 127 ? 29.510  -50.184 33.762 1.00 82.19  ? 105 LEU A C   1 
ATOM   834  O O   . LEU A 1 127 ? 30.068  -51.237 33.469 1.00 87.75  ? 105 LEU A O   1 
ATOM   835  C CB  . LEU A 1 127 ? 27.164  -49.526 33.198 1.00 76.40  ? 105 LEU A CB  1 
ATOM   836  C CG  . LEU A 1 127 ? 25.697  -49.460 33.637 1.00 75.72  ? 105 LEU A CG  1 
ATOM   837  C CD1 . LEU A 1 127 ? 24.859  -48.703 32.635 1.00 70.85  ? 105 LEU A CD1 1 
ATOM   838  C CD2 . LEU A 1 127 ? 25.134  -50.847 33.865 1.00 69.77  ? 105 LEU A CD2 1 
ATOM   839  N N   . ILE A 1 128 ? 30.129  -49.014 33.699 1.00 79.07  ? 106 ILE A N   1 
ATOM   840  C CA  . ILE A 1 128 ? 31.511  -48.963 33.242 1.00 82.44  ? 106 ILE A CA  1 
ATOM   841  C C   . ILE A 1 128 ? 32.514  -49.697 34.158 1.00 85.71  ? 106 ILE A C   1 
ATOM   842  O O   . ILE A 1 128 ? 33.367  -50.419 33.648 1.00 91.50  ? 106 ILE A O   1 
ATOM   843  C CB  . ILE A 1 128 ? 31.969  -47.512 33.029 1.00 83.73  ? 106 ILE A CB  1 
ATOM   844  C CG1 . ILE A 1 128 ? 31.062  -46.841 31.992 1.00 82.86  ? 106 ILE A CG1 1 
ATOM   845  C CG2 . ILE A 1 128 ? 33.420  -47.477 32.577 1.00 75.75  ? 106 ILE A CG2 1 
ATOM   846  C CD1 . ILE A 1 128 ? 31.600  -45.549 31.434 1.00 81.72  ? 106 ILE A CD1 1 
ATOM   847  N N   . PRO A 1 129 ? 32.427  -49.532 35.495 1.00 88.09  ? 107 PRO A N   1 
ATOM   848  C CA  . PRO A 1 129 ? 33.365  -50.334 36.301 1.00 89.72  ? 107 PRO A CA  1 
ATOM   849  C C   . PRO A 1 129 ? 33.155  -51.842 36.193 1.00 90.48  ? 107 PRO A C   1 
ATOM   850  O O   . PRO A 1 129 ? 34.140  -52.571 36.203 1.00 97.68  ? 107 PRO A O   1 
ATOM   851  C CB  . PRO A 1 129 ? 33.109  -49.858 37.746 1.00 81.91  ? 107 PRO A CB  1 
ATOM   852  C CG  . PRO A 1 129 ? 31.832  -49.087 37.705 1.00 88.52  ? 107 PRO A CG  1 
ATOM   853  C CD  . PRO A 1 129 ? 31.745  -48.513 36.314 1.00 90.17  ? 107 PRO A CD  1 
ATOM   854  N N   . ASN A 1 130 ? 31.913  -52.300 36.082 1.00 89.12  ? 108 ASN A N   1 
ATOM   855  C CA  . ASN A 1 130 ? 31.619  -53.740 36.025 1.00 90.69  ? 108 ASN A CA  1 
ATOM   856  C C   . ASN A 1 130 ? 31.931  -54.410 34.698 1.00 93.88  ? 108 ASN A C   1 
ATOM   857  O O   . ASN A 1 130 ? 31.706  -55.615 34.542 1.00 90.67  ? 108 ASN A O   1 
ATOM   858  C CB  . ASN A 1 130 ? 30.143  -53.993 36.319 1.00 97.24  ? 108 ASN A CB  1 
ATOM   859  C CG  . ASN A 1 130 ? 29.871  -54.173 37.770 1.00 92.86  ? 108 ASN A CG  1 
ATOM   860  O OD1 . ASN A 1 130 ? 30.713  -53.862 38.609 1.00 93.81  ? 108 ASN A OD1 1 
ATOM   861  N ND2 . ASN A 1 130 ? 28.691  -54.695 38.088 1.00 93.44  ? 108 ASN A ND2 1 
ATOM   862  N N   . ALA A 1 131 ? 32.409  -53.620 33.742 1.00 93.68  ? 109 ALA A N   1 
ATOM   863  C CA  . ALA A 1 131 ? 32.613  -54.072 32.376 1.00 86.96  ? 109 ALA A CA  1 
ATOM   864  C C   . ALA A 1 131 ? 33.693  -55.159 32.261 1.00 90.12  ? 109 ALA A C   1 
ATOM   865  O O   . ALA A 1 131 ? 34.882  -54.887 32.413 1.00 86.34  ? 109 ALA A O   1 
ATOM   866  C CB  . ALA A 1 131 ? 32.959  -52.890 31.509 1.00 85.90  ? 109 ALA A CB  1 
ATOM   867  N N   . SER A 1 132 ? 33.263  -56.388 31.984 1.00 93.41  ? 110 SER A N   1 
ATOM   868  C CA  . SER A 1 132 ? 34.175  -57.521 31.821 1.00 95.27  ? 110 SER A CA  1 
ATOM   869  C C   . SER A 1 132 ? 35.031  -57.398 30.556 1.00 95.19  ? 110 SER A C   1 
ATOM   870  O O   . SER A 1 132 ? 36.163  -56.908 30.621 1.00 94.20  ? 110 SER A O   1 
ATOM   871  C CB  . SER A 1 132 ? 33.390  -58.840 31.793 1.00 100.88 ? 110 SER A CB  1 
ATOM   872  O OG  . SER A 1 132 ? 32.885  -59.181 33.077 1.00 98.45  ? 110 SER A OG  1 
ATOM   873  N N   . GLN A 1 133 ? 34.498  -57.848 29.414 1.00 90.93  ? 111 GLN A N   1 
ATOM   874  C CA  . GLN A 1 133 ? 35.234  -57.777 28.152 1.00 91.64  ? 111 GLN A CA  1 
ATOM   875  C C   . GLN A 1 133 ? 35.126  -56.378 27.544 1.00 93.21  ? 111 GLN A C   1 
ATOM   876  O O   . GLN A 1 133 ? 34.186  -55.627 27.830 1.00 87.53  ? 111 GLN A O   1 
ATOM   877  C CB  . GLN A 1 133 ? 34.744  -58.845 27.146 1.00 98.57  ? 111 GLN A CB  1 
ATOM   878  C CG  . GLN A 1 133 ? 35.408  -58.818 25.687 1.00 105.64 ? 111 GLN A CG  1 
ATOM   879  C CD  . GLN A 1 133 ? 36.891  -59.317 25.596 1.00 101.19 ? 111 GLN A CD  1 
ATOM   880  O OE1 . GLN A 1 133 ? 37.787  -58.842 26.315 1.00 93.88  ? 111 GLN A OE1 1 
ATOM   881  N NE2 . GLN A 1 133 ? 37.133  -60.272 24.692 1.00 84.65  ? 111 GLN A NE2 1 
ATOM   882  N N   . ALA A 1 134 ? 36.122  -56.048 26.722 1.00 92.70  ? 112 ALA A N   1 
ATOM   883  C CA  . ALA A 1 134 ? 36.248  -54.776 26.032 1.00 85.05  ? 112 ALA A CA  1 
ATOM   884  C C   . ALA A 1 134 ? 34.983  -54.362 25.273 1.00 88.28  ? 112 ALA A C   1 
ATOM   885  O O   . ALA A 1 134 ? 34.624  -53.178 25.239 1.00 87.13  ? 112 ALA A O   1 
ATOM   886  C CB  . ALA A 1 134 ? 37.424  -54.843 25.086 1.00 85.31  ? 112 ALA A CB  1 
ATOM   887  N N   . GLU A 1 135 ? 34.318  -55.337 24.660 1.00 89.35  ? 113 GLU A N   1 
ATOM   888  C CA  . GLU A 1 135 ? 33.075  -55.089 23.933 1.00 85.04  ? 113 GLU A CA  1 
ATOM   889  C C   . GLU A 1 135 ? 32.088  -54.297 24.785 1.00 81.48  ? 113 GLU A C   1 
ATOM   890  O O   . GLU A 1 135 ? 31.444  -53.373 24.304 1.00 80.74  ? 113 GLU A O   1 
ATOM   891  C CB  . GLU A 1 135 ? 32.458  -56.421 23.478 1.00 88.37  ? 113 GLU A CB  1 
ATOM   892  C CG  . GLU A 1 135 ? 30.932  -56.436 23.419 1.00 89.05  ? 113 GLU A CG  1 
ATOM   893  C CD  . GLU A 1 135 ? 30.357  -57.694 22.760 1.00 94.24  ? 113 GLU A CD  1 
ATOM   894  O OE1 . GLU A 1 135 ? 31.026  -58.296 21.872 1.00 86.73  ? 113 GLU A OE1 1 
ATOM   895  O OE2 . GLU A 1 135 ? 29.222  -58.073 23.142 1.00 92.37  ? 113 GLU A OE2 1 
ATOM   896  N N   . SER A 1 136 ? 32.002  -54.654 26.065 1.00 88.92  ? 114 SER A N   1 
ATOM   897  C CA  . SER A 1 136 ? 31.096  -53.999 27.011 1.00 83.50  ? 114 SER A CA  1 
ATOM   898  C C   . SER A 1 136 ? 31.598  -52.615 27.394 1.00 78.37  ? 114 SER A C   1 
ATOM   899  O O   . SER A 1 136 ? 30.822  -51.668 27.404 1.00 76.62  ? 114 SER A O   1 
ATOM   900  C CB  . SER A 1 136 ? 30.915  -54.859 28.260 1.00 86.06  ? 114 SER A CB  1 
ATOM   901  O OG  . SER A 1 136 ? 30.362  -56.118 27.908 1.00 93.48  ? 114 SER A OG  1 
ATOM   902  N N   . LYS A 1 137 ? 32.889  -52.494 27.703 1.00 78.43  ? 115 LYS A N   1 
ATOM   903  C CA  . LYS A 1 137 ? 33.456  -51.182 27.985 1.00 73.31  ? 115 LYS A CA  1 
ATOM   904  C C   . LYS A 1 137 ? 33.149  -50.243 26.819 1.00 77.89  ? 115 LYS A C   1 
ATOM   905  O O   . LYS A 1 137 ? 32.633  -49.145 27.028 1.00 76.64  ? 115 LYS A O   1 
ATOM   906  C CB  . LYS A 1 137 ? 34.958  -51.270 28.240 1.00 69.65  ? 115 LYS A CB  1 
ATOM   907  N N   . VAL A 1 138 ? 33.410  -50.695 25.591 1.00 77.80  ? 116 VAL A N   1 
ATOM   908  C CA  . VAL A 1 138 ? 33.117  -49.884 24.412 1.00 75.14  ? 116 VAL A CA  1 
ATOM   909  C C   . VAL A 1 138 ? 31.651  -49.476 24.369 1.00 75.57  ? 116 VAL A C   1 
ATOM   910  O O   . VAL A 1 138 ? 31.317  -48.320 24.084 1.00 72.64  ? 116 VAL A O   1 
ATOM   911  C CB  . VAL A 1 138 ? 33.462  -50.624 23.124 1.00 75.13  ? 116 VAL A CB  1 
ATOM   912  C CG1 . VAL A 1 138 ? 33.075  -49.782 21.892 1.00 65.42  ? 116 VAL A CG1 1 
ATOM   913  C CG2 . VAL A 1 138 ? 34.929  -50.950 23.113 1.00 79.79  ? 116 VAL A CG2 1 
ATOM   914  N N   . PHE A 1 139 ? 30.784  -50.436 24.667 1.00 74.89  ? 117 PHE A N   1 
ATOM   915  C CA  . PHE A 1 139 ? 29.360  -50.187 24.707 1.00 72.16  ? 117 PHE A CA  1 
ATOM   916  C C   . PHE A 1 139 ? 29.054  -49.016 25.616 1.00 72.94  ? 117 PHE A C   1 
ATOM   917  O O   . PHE A 1 139 ? 28.424  -48.049 25.203 1.00 74.67  ? 117 PHE A O   1 
ATOM   918  C CB  . PHE A 1 139 ? 28.608  -51.421 25.189 1.00 72.95  ? 117 PHE A CB  1 
ATOM   919  C CG  . PHE A 1 139 ? 27.141  -51.406 24.855 1.00 74.01  ? 117 PHE A CG  1 
ATOM   920  C CD1 . PHE A 1 139 ? 26.231  -50.764 25.661 1.00 70.61  ? 117 PHE A CD1 1 
ATOM   921  C CD2 . PHE A 1 139 ? 26.673  -52.049 23.724 1.00 74.13  ? 117 PHE A CD2 1 
ATOM   922  C CE1 . PHE A 1 139 ? 24.884  -50.778 25.332 1.00 73.23  ? 117 PHE A CE1 1 
ATOM   923  C CE2 . PHE A 1 139 ? 25.332  -52.052 23.403 1.00 70.52  ? 117 PHE A CE2 1 
ATOM   924  C CZ  . PHE A 1 139 ? 24.441  -51.416 24.199 1.00 71.78  ? 117 PHE A CZ  1 
ATOM   925  N N   . TYR A 1 140 ? 29.521  -49.089 26.852 1.00 72.09  ? 118 TYR A N   1 
ATOM   926  C CA  . TYR A 1 140 ? 29.084  -48.116 27.836 1.00 73.66  ? 118 TYR A CA  1 
ATOM   927  C C   . TYR A 1 140 ? 29.793  -46.780 27.645 1.00 77.45  ? 118 TYR A C   1 
ATOM   928  O O   . TYR A 1 140 ? 29.208  -45.734 27.931 1.00 78.67  ? 118 TYR A O   1 
ATOM   929  C CB  . TYR A 1 140 ? 29.280  -48.650 29.260 1.00 69.53  ? 118 TYR A CB  1 
ATOM   930  C CG  . TYR A 1 140 ? 28.381  -49.828 29.578 1.00 72.65  ? 118 TYR A CG  1 
ATOM   931  C CD1 . TYR A 1 140 ? 26.990  -49.707 29.529 1.00 70.94  ? 118 TYR A CD1 1 
ATOM   932  C CD2 . TYR A 1 140 ? 28.920  -51.065 29.928 1.00 70.06  ? 118 TYR A CD2 1 
ATOM   933  C CE1 . TYR A 1 140 ? 26.158  -50.790 29.820 1.00 66.22  ? 118 TYR A CE1 1 
ATOM   934  C CE2 . TYR A 1 140 ? 28.102  -52.147 30.212 1.00 67.69  ? 118 TYR A CE2 1 
ATOM   935  C CZ  . TYR A 1 140 ? 26.725  -52.004 30.157 1.00 70.29  ? 118 TYR A CZ  1 
ATOM   936  O OH  . TYR A 1 140 ? 25.924  -53.086 30.436 1.00 70.94  ? 118 TYR A OH  1 
ATOM   937  N N   . LEU A 1 141 ? 31.028  -46.796 27.144 1.00 74.33  ? 119 LEU A N   1 
ATOM   938  C CA  . LEU A 1 141 ? 31.708  -45.539 26.839 1.00 74.55  ? 119 LEU A CA  1 
ATOM   939  C C   . LEU A 1 141 ? 30.952  -44.777 25.737 1.00 77.86  ? 119 LEU A C   1 
ATOM   940  O O   . LEU A 1 141 ? 30.775  -43.554 25.822 1.00 75.38  ? 119 LEU A O   1 
ATOM   941  C CB  . LEU A 1 141 ? 33.155  -45.784 26.417 1.00 74.26  ? 119 LEU A CB  1 
ATOM   942  C CG  . LEU A 1 141 ? 34.120  -46.272 27.496 1.00 76.46  ? 119 LEU A CG  1 
ATOM   943  C CD1 . LEU A 1 141 ? 35.497  -46.478 26.908 1.00 73.56  ? 119 LEU A CD1 1 
ATOM   944  C CD2 . LEU A 1 141 ? 34.164  -45.305 28.664 1.00 74.22  ? 119 LEU A CD2 1 
ATOM   945  N N   . LYS A 1 142 ? 30.499  -45.508 24.716 1.00 70.58  ? 120 LYS A N   1 
ATOM   946  C CA  . LYS A 1 142 ? 29.733  -44.907 23.641 1.00 71.71  ? 120 LYS A CA  1 
ATOM   947  C C   . LYS A 1 142 ? 28.486  -44.261 24.227 1.00 73.74  ? 120 LYS A C   1 
ATOM   948  O O   . LYS A 1 142 ? 28.152  -43.114 23.933 1.00 76.92  ? 120 LYS A O   1 
ATOM   949  C CB  . LYS A 1 142 ? 29.363  -45.950 22.577 1.00 73.08  ? 120 LYS A CB  1 
ATOM   950  C CG  . LYS A 1 142 ? 28.590  -45.387 21.363 1.00 72.68  ? 120 LYS A CG  1 
ATOM   951  C CD  . LYS A 1 142 ? 27.147  -45.881 21.318 1.00 74.12  ? 120 LYS A CD  1 
ATOM   952  C CE  . LYS A 1 142 ? 26.280  -45.043 20.394 1.00 72.89  ? 120 LYS A CE  1 
ATOM   953  N NZ  . LYS A 1 142 ? 24.834  -45.341 20.601 1.00 72.64  ? 120 LYS A NZ  1 
ATOM   954  N N   . MET A 1 143 ? 27.814  -45.007 25.087 1.00 75.76  ? 121 MET A N   1 
ATOM   955  C CA  . MET A 1 143 ? 26.607  -44.534 25.733 1.00 72.82  ? 121 MET A CA  1 
ATOM   956  C C   . MET A 1 143 ? 26.899  -43.223 26.456 1.00 77.25  ? 121 MET A C   1 
ATOM   957  O O   . MET A 1 143 ? 26.139  -42.252 26.347 1.00 74.82  ? 121 MET A O   1 
ATOM   958  C CB  . MET A 1 143 ? 26.101  -45.601 26.688 1.00 70.61  ? 121 MET A CB  1 
ATOM   959  C CG  . MET A 1 143 ? 24.661  -45.453 27.107 1.00 82.28  ? 121 MET A CG  1 
ATOM   960  S SD  . MET A 1 143 ? 24.153  -46.920 28.034 1.00 78.68  ? 121 MET A SD  1 
ATOM   961  C CE  . MET A 1 143 ? 24.173  -48.043 26.672 1.00 57.90  ? 121 MET A CE  1 
ATOM   962  N N   . LYS A 1 144 ? 28.041  -43.203 27.148 1.00 79.51  ? 122 LYS A N   1 
ATOM   963  C CA  . LYS A 1 144 ? 28.506  -42.054 27.927 1.00 75.93  ? 122 LYS A CA  1 
ATOM   964  C C   . LYS A 1 144 ? 28.680  -40.818 27.051 1.00 77.41  ? 122 LYS A C   1 
ATOM   965  O O   . LYS A 1 144 ? 28.195  -39.726 27.386 1.00 77.11  ? 122 LYS A O   1 
ATOM   966  C CB  . LYS A 1 144 ? 29.823  -42.394 28.623 1.00 77.36  ? 122 LYS A CB  1 
ATOM   967  C CG  . LYS A 1 144 ? 30.302  -41.365 29.619 1.00 78.20  ? 122 LYS A CG  1 
ATOM   968  C CD  . LYS A 1 144 ? 31.673  -41.721 30.167 1.00 81.13  ? 122 LYS A CD  1 
ATOM   969  C CE  . LYS A 1 144 ? 32.145  -40.676 31.176 1.00 90.01  ? 122 LYS A CE  1 
ATOM   970  N NZ  . LYS A 1 144 ? 33.510  -40.950 31.714 1.00 89.14  ? 122 LYS A NZ  1 
ATOM   971  N N   . GLY A 1 145 ? 29.370  -40.999 25.928 1.00 73.90  ? 123 GLY A N   1 
ATOM   972  C CA  . GLY A 1 145 ? 29.532  -39.937 24.959 1.00 73.34  ? 123 GLY A CA  1 
ATOM   973  C C   . GLY A 1 145 ? 28.190  -39.433 24.469 1.00 74.92  ? 123 GLY A C   1 
ATOM   974  O O   . GLY A 1 145 ? 28.008  -38.230 24.313 1.00 74.29  ? 123 GLY A O   1 
ATOM   975  N N   . ASP A 1 146 ? 27.246  -40.344 24.236 1.00 73.69  ? 124 ASP A N   1 
ATOM   976  C CA  . ASP A 1 146 ? 25.914  -39.945 23.774 1.00 76.40  ? 124 ASP A CA  1 
ATOM   977  C C   . ASP A 1 146 ? 25.262  -38.955 24.720 1.00 79.53  ? 124 ASP A C   1 
ATOM   978  O O   . ASP A 1 146 ? 24.823  -37.876 24.305 1.00 75.27  ? 124 ASP A O   1 
ATOM   979  C CB  . ASP A 1 146 ? 24.971  -41.145 23.632 1.00 75.19  ? 124 ASP A CB  1 
ATOM   980  C CG  . ASP A 1 146 ? 25.289  -42.020 22.449 1.00 75.98  ? 124 ASP A CG  1 
ATOM   981  O OD1 . ASP A 1 146 ? 25.798  -41.516 21.418 1.00 77.27  ? 124 ASP A OD1 1 
ATOM   982  O OD2 . ASP A 1 146 ? 25.008  -43.229 22.561 1.00 73.62  ? 124 ASP A OD2 1 
ATOM   983  N N   . TYR A 1 147 ? 25.181  -39.348 25.996 1.00 79.36  ? 125 TYR A N   1 
ATOM   984  C CA  . TYR A 1 147 ? 24.373  -38.610 26.959 1.00 75.51  ? 125 TYR A CA  1 
ATOM   985  C C   . TYR A 1 147 ? 25.117  -37.375 27.476 1.00 79.60  ? 125 TYR A C   1 
ATOM   986  O O   . TYR A 1 147 ? 24.489  -36.391 27.877 1.00 80.81  ? 125 TYR A O   1 
ATOM   987  C CB  . TYR A 1 147 ? 23.921  -39.533 28.093 1.00 73.36  ? 125 TYR A CB  1 
ATOM   988  C CG  . TYR A 1 147 ? 22.840  -40.501 27.648 1.00 76.89  ? 125 TYR A CG  1 
ATOM   989  C CD1 . TYR A 1 147 ? 21.512  -40.092 27.544 1.00 72.12  ? 125 TYR A CD1 1 
ATOM   990  C CD2 . TYR A 1 147 ? 23.149  -41.825 27.308 1.00 72.41  ? 125 TYR A CD2 1 
ATOM   991  C CE1 . TYR A 1 147 ? 20.518  -40.982 27.117 1.00 70.95  ? 125 TYR A CE1 1 
ATOM   992  C CE2 . TYR A 1 147 ? 22.163  -42.718 26.887 1.00 59.65  ? 125 TYR A CE2 1 
ATOM   993  C CZ  . TYR A 1 147 ? 20.854  -42.290 26.792 1.00 65.36  ? 125 TYR A CZ  1 
ATOM   994  O OH  . TYR A 1 147 ? 19.874  -43.166 26.375 1.00 62.64  ? 125 TYR A OH  1 
ATOM   995  N N   . TYR A 1 148 ? 26.444  -37.400 27.432 1.00 77.01  ? 126 TYR A N   1 
ATOM   996  C CA  . TYR A 1 148 ? 27.175  -36.149 27.578 1.00 78.41  ? 126 TYR A CA  1 
ATOM   997  C C   . TYR A 1 148 ? 26.875  -35.252 26.388 1.00 77.12  ? 126 TYR A C   1 
ATOM   998  O O   . TYR A 1 148 ? 26.706  -34.049 26.540 1.00 82.50  ? 126 TYR A O   1 
ATOM   999  C CB  . TYR A 1 148 ? 28.676  -36.387 27.715 1.00 79.73  ? 126 TYR A CB  1 
ATOM   1000 C CG  . TYR A 1 148 ? 29.115  -36.412 29.153 1.00 88.58  ? 126 TYR A CG  1 
ATOM   1001 C CD1 . TYR A 1 148 ? 28.829  -35.343 30.011 1.00 89.75  ? 126 TYR A CD1 1 
ATOM   1002 C CD2 . TYR A 1 148 ? 29.765  -37.521 29.676 1.00 87.20  ? 126 TYR A CD2 1 
ATOM   1003 C CE1 . TYR A 1 148 ? 29.206  -35.374 31.339 1.00 84.27  ? 126 TYR A CE1 1 
ATOM   1004 C CE2 . TYR A 1 148 ? 30.144  -37.564 31.006 1.00 92.55  ? 126 TYR A CE2 1 
ATOM   1005 C CZ  . TYR A 1 148 ? 29.863  -36.491 31.833 1.00 92.31  ? 126 TYR A CZ  1 
ATOM   1006 O OH  . TYR A 1 148 ? 30.254  -36.556 33.152 1.00 94.55  ? 126 TYR A OH  1 
ATOM   1007 N N   . ARG A 1 149 ? 26.783  -35.841 25.206 1.00 74.50  ? 127 ARG A N   1 
ATOM   1008 C CA  . ARG A 1 149 ? 26.479  -35.064 24.017 1.00 79.16  ? 127 ARG A CA  1 
ATOM   1009 C C   . ARG A 1 149 ? 25.126  -34.374 24.137 1.00 80.58  ? 127 ARG A C   1 
ATOM   1010 O O   . ARG A 1 149 ? 24.972  -33.230 23.701 1.00 76.29  ? 127 ARG A O   1 
ATOM   1011 C CB  . ARG A 1 149 ? 26.506  -35.944 22.767 1.00 74.83  ? 127 ARG A CB  1 
ATOM   1012 C CG  . ARG A 1 149 ? 25.889  -35.300 21.549 1.00 75.55  ? 127 ARG A CG  1 
ATOM   1013 C CD  . ARG A 1 149 ? 26.439  -35.937 20.283 1.00 87.68  ? 127 ARG A CD  1 
ATOM   1014 N NE  . ARG A 1 149 ? 25.913  -37.283 20.104 1.00 84.24  ? 127 ARG A NE  1 
ATOM   1015 C CZ  . ARG A 1 149 ? 24.886  -37.567 19.313 1.00 90.14  ? 127 ARG A CZ  1 
ATOM   1016 N NH1 . ARG A 1 149 ? 24.300  -36.591 18.604 1.00 86.83  ? 127 ARG A NH1 1 
ATOM   1017 N NH2 . ARG A 1 149 ? 24.457  -38.825 19.227 1.00 85.23  ? 127 ARG A NH2 1 
ATOM   1018 N N   . TYR A 1 150 ? 24.146  -35.058 24.725 1.00 77.72  ? 128 TYR A N   1 
ATOM   1019 C CA  . TYR A 1 150 ? 22.817  -34.471 24.801 1.00 77.90  ? 128 TYR A CA  1 
ATOM   1020 C C   . TYR A 1 150 ? 22.816  -33.289 25.751 1.00 79.96  ? 128 TYR A C   1 
ATOM   1021 O O   . TYR A 1 150 ? 22.172  -32.282 25.479 1.00 79.44  ? 128 TYR A O   1 
ATOM   1022 C CB  . TYR A 1 150 ? 21.788  -35.495 25.232 1.00 73.75  ? 128 TYR A CB  1 
ATOM   1023 C CG  . TYR A 1 150 ? 21.734  -36.677 24.317 1.00 77.93  ? 128 TYR A CG  1 
ATOM   1024 C CD1 . TYR A 1 150 ? 21.983  -36.540 22.960 1.00 80.09  ? 128 TYR A CD1 1 
ATOM   1025 C CD2 . TYR A 1 150 ? 21.444  -37.936 24.807 1.00 79.40  ? 128 TYR A CD2 1 
ATOM   1026 C CE1 . TYR A 1 150 ? 21.942  -37.625 22.122 1.00 79.54  ? 128 TYR A CE1 1 
ATOM   1027 C CE2 . TYR A 1 150 ? 21.408  -39.026 23.979 1.00 79.69  ? 128 TYR A CE2 1 
ATOM   1028 C CZ  . TYR A 1 150 ? 21.655  -38.866 22.642 1.00 82.00  ? 128 TYR A CZ  1 
ATOM   1029 O OH  . TYR A 1 150 ? 21.604  -39.970 21.836 1.00 87.67  ? 128 TYR A OH  1 
ATOM   1030 N N   . LEU A 1 151 ? 23.548  -33.417 26.853 1.00 76.62  ? 129 LEU A N   1 
ATOM   1031 C CA  . LEU A 1 151 ? 23.753  -32.302 27.763 1.00 82.58  ? 129 LEU A CA  1 
ATOM   1032 C C   . LEU A 1 151 ? 24.342  -31.115 27.001 1.00 87.28  ? 129 LEU A C   1 
ATOM   1033 O O   . LEU A 1 151 ? 23.829  -29.997 27.071 1.00 88.08  ? 129 LEU A O   1 
ATOM   1034 C CB  . LEU A 1 151 ? 24.664  -32.713 28.924 1.00 78.95  ? 129 LEU A CB  1 
ATOM   1035 C CG  . LEU A 1 151 ? 24.016  -33.716 29.882 1.00 78.78  ? 129 LEU A CG  1 
ATOM   1036 C CD1 . LEU A 1 151 ? 25.043  -34.350 30.777 1.00 76.54  ? 129 LEU A CD1 1 
ATOM   1037 C CD2 . LEU A 1 151 ? 22.917  -33.074 30.709 1.00 72.30  ? 129 LEU A CD2 1 
ATOM   1038 N N   . ALA A 1 152 ? 25.412  -31.383 26.262 1.00 88.16  ? 130 ALA A N   1 
ATOM   1039 C CA  . ALA A 1 152 ? 26.048  -30.393 25.399 1.00 90.07  ? 130 ALA A CA  1 
ATOM   1040 C C   . ALA A 1 152 ? 25.063  -29.676 24.466 1.00 87.25  ? 130 ALA A C   1 
ATOM   1041 O O   . ALA A 1 152 ? 25.085  -28.450 24.380 1.00 91.65  ? 130 ALA A O   1 
ATOM   1042 C CB  . ALA A 1 152 ? 27.149  -31.051 24.582 1.00 87.89  ? 130 ALA A CB  1 
ATOM   1043 N N   . GLU A 1 153 ? 24.202  -30.428 23.781 1.00 86.47  ? 131 GLU A N   1 
ATOM   1044 C CA  . GLU A 1 153 ? 23.221  -29.837 22.856 1.00 88.40  ? 131 GLU A CA  1 
ATOM   1045 C C   . GLU A 1 153 ? 22.385  -28.736 23.495 1.00 93.64  ? 131 GLU A C   1 
ATOM   1046 O O   . GLU A 1 153 ? 21.803  -27.900 22.796 1.00 97.60  ? 131 GLU A O   1 
ATOM   1047 C CB  . GLU A 1 153 ? 22.252  -30.887 22.331 1.00 82.10  ? 131 GLU A CB  1 
ATOM   1048 C CG  . GLU A 1 153 ? 22.819  -31.944 21.452 1.00 76.59  ? 131 GLU A CG  1 
ATOM   1049 C CD  . GLU A 1 153 ? 21.738  -32.895 21.030 1.00 78.35  ? 131 GLU A CD  1 
ATOM   1050 O OE1 . GLU A 1 153 ? 20.714  -32.962 21.744 1.00 79.73  ? 131 GLU A OE1 1 
ATOM   1051 O OE2 . GLU A 1 153 ? 21.896  -33.562 19.989 1.00 81.84  ? 131 GLU A OE2 1 
ATOM   1052 N N   . VAL A 1 154 ? 22.324  -28.761 24.823 1.00 89.36  ? 132 VAL A N   1 
ATOM   1053 C CA  . VAL A 1 154 ? 21.358  -27.985 25.575 1.00 92.06  ? 132 VAL A CA  1 
ATOM   1054 C C   . VAL A 1 154 ? 22.083  -27.168 26.654 1.00 99.13  ? 132 VAL A C   1 
ATOM   1055 O O   . VAL A 1 154 ? 21.463  -26.450 27.447 1.00 101.02 ? 132 VAL A O   1 
ATOM   1056 C CB  . VAL A 1 154 ? 20.296  -28.923 26.203 1.00 88.40  ? 132 VAL A CB  1 
ATOM   1057 C CG1 . VAL A 1 154 ? 20.679  -29.364 27.639 1.00 83.11  ? 132 VAL A CG1 1 
ATOM   1058 C CG2 . VAL A 1 154 ? 18.946  -28.304 26.143 1.00 88.76  ? 132 VAL A CG2 1 
ATOM   1059 N N   . ALA A 1 155 ? 23.410  -27.262 26.654 1.00 100.26 ? 133 ALA A N   1 
ATOM   1060 C CA  . ALA A 1 155 ? 24.227  -26.650 27.696 1.00 103.40 ? 133 ALA A CA  1 
ATOM   1061 C C   . ALA A 1 155 ? 24.425  -25.155 27.490 1.00 110.38 ? 133 ALA A C   1 
ATOM   1062 O O   . ALA A 1 155 ? 24.323  -24.645 26.362 1.00 105.44 ? 133 ALA A O   1 
ATOM   1063 C CB  . ALA A 1 155 ? 25.579  -27.344 27.779 1.00 106.08 ? 133 ALA A CB  1 
ATOM   1064 N N   . ALA A 1 156 ? 24.723  -24.477 28.603 1.00 116.08 ? 134 ALA A N   1 
ATOM   1065 C CA  . ALA A 1 156 ? 24.933  -23.031 28.650 1.00 115.83 ? 134 ALA A CA  1 
ATOM   1066 C C   . ALA A 1 156 ? 26.283  -22.645 28.048 1.00 117.25 ? 134 ALA A C   1 
ATOM   1067 O O   . ALA A 1 156 ? 27.176  -23.486 27.940 1.00 116.17 ? 134 ALA A O   1 
ATOM   1068 C CB  . ALA A 1 156 ? 24.831  -22.537 30.090 1.00 106.58 ? 134 ALA A CB  1 
ATOM   1069 N N   . GLY A 1 157 ? 26.419  -21.374 27.669 1.00 116.71 ? 135 GLY A N   1 
ATOM   1070 C CA  . GLY A 1 157 ? 27.636  -20.846 27.068 1.00 117.36 ? 135 GLY A CA  1 
ATOM   1071 C C   . GLY A 1 157 ? 28.976  -21.322 27.618 1.00 120.95 ? 135 GLY A C   1 
ATOM   1072 O O   . GLY A 1 157 ? 29.773  -21.911 26.886 1.00 123.70 ? 135 GLY A O   1 
ATOM   1073 N N   . ASP A 1 158 ? 29.241  -21.073 28.898 1.00 121.02 ? 136 ASP A N   1 
ATOM   1074 C CA  . ASP A 1 158 ? 30.537  -21.424 29.463 1.00 125.16 ? 136 ASP A CA  1 
ATOM   1075 C C   . ASP A 1 158 ? 30.658  -22.931 29.699 1.00 128.32 ? 136 ASP A C   1 
ATOM   1076 O O   . ASP A 1 158 ? 31.703  -23.529 29.424 1.00 129.75 ? 136 ASP A O   1 
ATOM   1077 C CB  . ASP A 1 158 ? 30.782  -20.661 30.764 1.00 134.80 ? 136 ASP A CB  1 
ATOM   1078 C CG  . ASP A 1 158 ? 32.139  -20.974 31.375 1.00 144.49 ? 136 ASP A CG  1 
ATOM   1079 O OD1 . ASP A 1 158 ? 33.111  -21.164 30.606 1.00 143.81 ? 136 ASP A OD1 1 
ATOM   1080 O OD2 . ASP A 1 158 ? 32.231  -21.032 32.624 1.00 144.12 ? 136 ASP A OD2 1 
ATOM   1081 N N   . ASP A 1 159 ? 29.584  -23.540 30.196 1.00 126.42 ? 137 ASP A N   1 
ATOM   1082 C CA  . ASP A 1 159 ? 29.545  -24.984 30.449 1.00 122.03 ? 137 ASP A CA  1 
ATOM   1083 C C   . ASP A 1 159 ? 29.759  -25.863 29.211 1.00 113.07 ? 137 ASP A C   1 
ATOM   1084 O O   . ASP A 1 159 ? 30.400  -26.911 29.311 1.00 105.51 ? 137 ASP A O   1 
ATOM   1085 C CB  . ASP A 1 159 ? 28.208  -25.361 31.093 1.00 122.01 ? 137 ASP A CB  1 
ATOM   1086 C CG  . ASP A 1 159 ? 28.280  -25.385 32.596 1.00 122.36 ? 137 ASP A CG  1 
ATOM   1087 O OD1 . ASP A 1 159 ? 29.103  -24.629 33.153 1.00 126.42 ? 137 ASP A OD1 1 
ATOM   1088 O OD2 . ASP A 1 159 ? 27.521  -26.162 33.215 1.00 119.78 ? 137 ASP A OD2 1 
ATOM   1089 N N   . LYS A 1 160 ? 29.212  -25.436 28.067 1.00 111.79 ? 138 LYS A N   1 
ATOM   1090 C CA  . LYS A 1 160 ? 29.195  -26.245 26.845 1.00 107.07 ? 138 LYS A CA  1 
ATOM   1091 C C   . LYS A 1 160 ? 30.576  -26.793 26.539 1.00 105.36 ? 138 LYS A C   1 
ATOM   1092 O O   . LYS A 1 160 ? 30.770  -28.006 26.595 1.00 102.36 ? 138 LYS A O   1 
ATOM   1093 C CB  . LYS A 1 160 ? 28.663  -25.445 25.649 1.00 93.76  ? 138 LYS A CB  1 
ATOM   1094 N N   . LYS A 1 161 ? 31.535  -25.903 26.277 1.00 108.53 ? 139 LYS A N   1 
ATOM   1095 C CA  . LYS A 1 161 ? 32.905  -26.294 25.920 1.00 103.19 ? 139 LYS A CA  1 
ATOM   1096 C C   . LYS A 1 161 ? 33.424  -27.403 26.826 1.00 101.26 ? 139 LYS A C   1 
ATOM   1097 O O   . LYS A 1 161 ? 34.144  -28.292 26.383 1.00 101.91 ? 139 LYS A O   1 
ATOM   1098 C CB  . LYS A 1 161 ? 33.853  -25.085 25.981 1.00 99.72  ? 139 LYS A CB  1 
ATOM   1099 N N   . GLY A 1 162 ? 33.024  -27.363 28.090 1.00 102.41 ? 140 GLY A N   1 
ATOM   1100 C CA  . GLY A 1 162 ? 33.468  -28.347 29.050 1.00 95.92  ? 140 GLY A CA  1 
ATOM   1101 C C   . GLY A 1 162 ? 32.709  -29.646 28.924 1.00 100.74 ? 140 GLY A C   1 
ATOM   1102 O O   . GLY A 1 162 ? 33.290  -30.717 29.055 1.00 99.91  ? 140 GLY A O   1 
ATOM   1103 N N   . ILE A 1 163 ? 31.404  -29.548 28.678 1.00 104.83 ? 141 ILE A N   1 
ATOM   1104 C CA  . ILE A 1 163 ? 30.557  -30.729 28.513 1.00 99.39  ? 141 ILE A CA  1 
ATOM   1105 C C   . ILE A 1 163 ? 30.883  -31.438 27.209 1.00 96.71  ? 141 ILE A C   1 
ATOM   1106 O O   . ILE A 1 163 ? 30.962  -32.669 27.166 1.00 94.67  ? 141 ILE A O   1 
ATOM   1107 C CB  . ILE A 1 163 ? 29.046  -30.375 28.516 1.00 98.97  ? 141 ILE A CB  1 
ATOM   1108 C CG1 . ILE A 1 163 ? 28.637  -29.660 29.811 1.00 97.93  ? 141 ILE A CG1 1 
ATOM   1109 C CG2 . ILE A 1 163 ? 28.200  -31.628 28.303 1.00 91.30  ? 141 ILE A CG2 1 
ATOM   1110 C CD1 . ILE A 1 163 ? 28.674  -30.539 31.059 1.00 104.81 ? 141 ILE A CD1 1 
ATOM   1111 N N   . VAL A 1 164 ? 31.092  -30.662 26.149 1.00 95.84  ? 142 VAL A N   1 
ATOM   1112 C CA  . VAL A 1 164 ? 31.211  -31.246 24.816 1.00 95.95  ? 142 VAL A CA  1 
ATOM   1113 C C   . VAL A 1 164 ? 32.441  -32.104 24.646 1.00 97.44  ? 142 VAL A C   1 
ATOM   1114 O O   . VAL A 1 164 ? 32.519  -32.870 23.689 1.00 102.87 ? 142 VAL A O   1 
ATOM   1115 C CB  . VAL A 1 164 ? 31.250  -30.190 23.678 1.00 93.21  ? 142 VAL A CB  1 
ATOM   1116 C CG1 . VAL A 1 164 ? 30.162  -29.136 23.852 1.00 94.32  ? 142 VAL A CG1 1 
ATOM   1117 C CG2 . VAL A 1 164 ? 32.640  -29.567 23.561 1.00 95.12  ? 142 VAL A CG2 1 
ATOM   1118 N N   . ASP A 1 165 ? 33.412  -31.999 25.541 1.00 94.22  ? 143 ASP A N   1 
ATOM   1119 C CA  . ASP A 1 165 ? 34.603  -32.811 25.332 1.00 99.62  ? 143 ASP A CA  1 
ATOM   1120 C C   . ASP A 1 165 ? 34.782  -33.840 26.438 1.00 97.23  ? 143 ASP A C   1 
ATOM   1121 O O   . ASP A 1 165 ? 35.661  -34.699 26.357 1.00 99.09  ? 143 ASP A O   1 
ATOM   1122 C CB  . ASP A 1 165 ? 35.849  -31.932 25.183 1.00 106.36 ? 143 ASP A CB  1 
ATOM   1123 C CG  . ASP A 1 165 ? 36.205  -31.221 26.449 1.00 105.17 ? 143 ASP A CG  1 
ATOM   1124 O OD1 . ASP A 1 165 ? 35.278  -30.957 27.248 1.00 104.21 ? 143 ASP A OD1 1 
ATOM   1125 O OD2 . ASP A 1 165 ? 37.404  -30.921 26.632 1.00 106.78 ? 143 ASP A OD2 1 
ATOM   1126 N N   . GLN A 1 166 ? 33.941  -33.768 27.464 1.00 98.10  ? 144 GLN A N   1 
ATOM   1127 C CA  . GLN A 1 166 ? 33.721  -34.945 28.292 1.00 95.87  ? 144 GLN A CA  1 
ATOM   1128 C C   . GLN A 1 166 ? 33.107  -35.950 27.344 1.00 92.19  ? 144 GLN A C   1 
ATOM   1129 O O   . GLN A 1 166 ? 33.458  -37.130 27.331 1.00 91.10  ? 144 GLN A O   1 
ATOM   1130 C CB  . GLN A 1 166 ? 32.791  -34.664 29.469 1.00 97.23  ? 144 GLN A CB  1 
ATOM   1131 C CG  . GLN A 1 166 ? 33.235  -33.523 30.355 1.00 101.99 ? 144 GLN A CG  1 
ATOM   1132 C CD  . GLN A 1 166 ? 32.434  -33.453 31.630 1.00 106.06 ? 144 GLN A CD  1 
ATOM   1133 O OE1 . GLN A 1 166 ? 32.370  -34.431 32.384 1.00 103.68 ? 144 GLN A OE1 1 
ATOM   1134 N NE2 . GLN A 1 166 ? 31.809  -32.296 31.885 1.00 103.10 ? 144 GLN A NE2 1 
ATOM   1135 N N   . SER A 1 167 ? 32.189  -35.437 26.533 1.00 90.27  ? 145 SER A N   1 
ATOM   1136 C CA  . SER A 1 167 ? 31.572  -36.199 25.471 1.00 86.57  ? 145 SER A CA  1 
ATOM   1137 C C   . SER A 1 167 ? 32.632  -36.788 24.555 1.00 89.06  ? 145 SER A C   1 
ATOM   1138 O O   . SER A 1 167 ? 32.638  -37.988 24.286 1.00 88.60  ? 145 SER A O   1 
ATOM   1139 C CB  . SER A 1 167 ? 30.614  -35.312 24.680 1.00 82.14  ? 145 SER A CB  1 
ATOM   1140 O OG  . SER A 1 167 ? 30.144  -35.990 23.541 1.00 80.17  ? 145 SER A OG  1 
ATOM   1141 N N   . GLN A 1 168 ? 33.543  -35.942 24.090 1.00 94.60  ? 146 GLN A N   1 
ATOM   1142 C CA  . GLN A 1 168 ? 34.547  -36.386 23.133 1.00 91.39  ? 146 GLN A CA  1 
ATOM   1143 C C   . GLN A 1 168 ? 35.527  -37.392 23.747 1.00 87.36  ? 146 GLN A C   1 
ATOM   1144 O O   . GLN A 1 168 ? 35.859  -38.382 23.105 1.00 85.38  ? 146 GLN A O   1 
ATOM   1145 C CB  . GLN A 1 168 ? 35.306  -35.193 22.550 1.00 89.20  ? 146 GLN A CB  1 
ATOM   1146 C CG  . GLN A 1 168 ? 36.606  -35.605 21.876 1.00 94.65  ? 146 GLN A CG  1 
ATOM   1147 C CD  . GLN A 1 168 ? 36.945  -34.791 20.637 1.00 102.83 ? 146 GLN A CD  1 
ATOM   1148 O OE1 . GLN A 1 168 ? 36.479  -33.656 20.464 1.00 103.76 ? 146 GLN A OE1 1 
ATOM   1149 N NE2 . GLN A 1 168 ? 37.763  -35.376 19.758 1.00 97.80  ? 146 GLN A NE2 1 
ATOM   1150 N N   . GLN A 1 169 ? 35.976  -37.159 24.979 1.00 82.90  ? 147 GLN A N   1 
ATOM   1151 C CA  . GLN A 1 169 ? 36.916  -38.085 25.616 1.00 84.83  ? 147 GLN A CA  1 
ATOM   1152 C C   . GLN A 1 169 ? 36.334  -39.488 25.636 1.00 84.16  ? 147 GLN A C   1 
ATOM   1153 O O   . GLN A 1 169 ? 37.035  -40.466 25.372 1.00 84.11  ? 147 GLN A O   1 
ATOM   1154 C CB  . GLN A 1 169 ? 37.258  -37.650 27.046 1.00 80.41  ? 147 GLN A CB  1 
ATOM   1155 N N   . ALA A 1 170 ? 35.039  -39.571 25.932 1.00 86.38  ? 148 ALA A N   1 
ATOM   1156 C CA  . ALA A 1 170 ? 34.345  -40.850 26.060 1.00 83.04  ? 148 ALA A CA  1 
ATOM   1157 C C   . ALA A 1 170 ? 34.342  -41.593 24.737 1.00 81.28  ? 148 ALA A C   1 
ATOM   1158 O O   . ALA A 1 170 ? 34.946  -42.667 24.608 1.00 79.80  ? 148 ALA A O   1 
ATOM   1159 C CB  . ALA A 1 170 ? 32.917  -40.630 26.560 1.00 77.47  ? 148 ALA A CB  1 
ATOM   1160 N N   . TYR A 1 171 ? 33.651  -40.994 23.769 1.00 76.89  ? 149 TYR A N   1 
ATOM   1161 C CA  . TYR A 1 171 ? 33.621  -41.446 22.382 1.00 74.83  ? 149 TYR A CA  1 
ATOM   1162 C C   . TYR A 1 171 ? 35.005  -41.883 21.912 1.00 76.98  ? 149 TYR A C   1 
ATOM   1163 O O   . TYR A 1 171 ? 35.173  -42.934 21.280 1.00 74.91  ? 149 TYR A O   1 
ATOM   1164 C CB  . TYR A 1 171 ? 33.094  -40.329 21.477 1.00 78.06  ? 149 TYR A CB  1 
ATOM   1165 C CG  . TYR A 1 171 ? 31.584  -40.197 21.363 1.00 73.60  ? 149 TYR A CG  1 
ATOM   1166 C CD1 . TYR A 1 171 ? 30.763  -41.313 21.286 1.00 72.63  ? 149 TYR A CD1 1 
ATOM   1167 C CD2 . TYR A 1 171 ? 30.986  -38.945 21.341 1.00 74.14  ? 149 TYR A CD2 1 
ATOM   1168 C CE1 . TYR A 1 171 ? 29.379  -41.180 21.185 1.00 73.65  ? 149 TYR A CE1 1 
ATOM   1169 C CE2 . TYR A 1 171 ? 29.616  -38.803 21.235 1.00 76.70  ? 149 TYR A CE2 1 
ATOM   1170 C CZ  . TYR A 1 171 ? 28.816  -39.916 21.155 1.00 76.22  ? 149 TYR A CZ  1 
ATOM   1171 O OH  . TYR A 1 171 ? 27.456  -39.733 21.040 1.00 76.10  ? 149 TYR A OH  1 
ATOM   1172 N N   . GLN A 1 172 ? 36.001  -41.076 22.258 1.00 81.53  ? 150 GLN A N   1 
ATOM   1173 C CA  . GLN A 1 172 ? 37.383  -41.349 21.879 1.00 85.70  ? 150 GLN A CA  1 
ATOM   1174 C C   . GLN A 1 172 ? 37.928  -42.635 22.494 1.00 82.24  ? 150 GLN A C   1 
ATOM   1175 O O   . GLN A 1 172 ? 38.442  -43.493 21.774 1.00 82.55  ? 150 GLN A O   1 
ATOM   1176 C CB  . GLN A 1 172 ? 38.295  -40.186 22.277 1.00 88.05  ? 150 GLN A CB  1 
ATOM   1177 C CG  . GLN A 1 172 ? 39.652  -40.181 21.560 1.00 83.75  ? 150 GLN A CG  1 
ATOM   1178 C CD  . GLN A 1 172 ? 39.507  -39.908 20.083 1.00 89.00  ? 150 GLN A CD  1 
ATOM   1179 O OE1 . GLN A 1 172 ? 39.142  -38.799 19.683 1.00 94.85  ? 150 GLN A OE1 1 
ATOM   1180 N NE2 . GLN A 1 172 ? 39.784  -40.915 19.261 1.00 88.03  ? 150 GLN A NE2 1 
ATOM   1181 N N   . GLU A 1 173 ? 37.844  -42.765 23.813 1.00 74.60  ? 151 GLU A N   1 
ATOM   1182 C CA  . GLU A 1 173 ? 38.371  -43.964 24.446 1.00 81.37  ? 151 GLU A CA  1 
ATOM   1183 C C   . GLU A 1 173 ? 37.663  -45.185 23.877 1.00 81.61  ? 151 GLU A C   1 
ATOM   1184 O O   . GLU A 1 173 ? 38.294  -46.207 23.595 1.00 78.28  ? 151 GLU A O   1 
ATOM   1185 C CB  . GLU A 1 173 ? 38.211  -43.915 25.964 1.00 79.70  ? 151 GLU A CB  1 
ATOM   1186 C CG  . GLU A 1 173 ? 38.958  -45.029 26.673 1.00 78.74  ? 151 GLU A CG  1 
ATOM   1187 C CD  . GLU A 1 173 ? 38.749  -45.009 28.176 1.00 90.61  ? 151 GLU A CD  1 
ATOM   1188 O OE1 . GLU A 1 173 ? 38.096  -44.058 28.666 1.00 88.14  ? 151 GLU A OE1 1 
ATOM   1189 O OE2 . GLU A 1 173 ? 39.246  -45.937 28.866 1.00 94.80  ? 151 GLU A OE2 1 
ATOM   1190 N N   . ALA A 1 174 ? 36.351  -45.049 23.694 1.00 80.94  ? 152 ALA A N   1 
ATOM   1191 C CA  . ALA A 1 174 ? 35.529  -46.065 23.046 1.00 77.79  ? 152 ALA A CA  1 
ATOM   1192 C C   . ALA A 1 174 ? 36.104  -46.472 21.704 1.00 78.72  ? 152 ALA A C   1 
ATOM   1193 O O   . ALA A 1 174 ? 36.324  -47.663 21.434 1.00 78.36  ? 152 ALA A O   1 
ATOM   1194 C CB  . ALA A 1 174 ? 34.116  -45.548 22.859 1.00 77.01  ? 152 ALA A CB  1 
ATOM   1195 N N   . PHE A 1 175 ? 36.323  -45.461 20.869 1.00 75.55  ? 153 PHE A N   1 
ATOM   1196 C CA  . PHE A 1 175 ? 36.872  -45.644 19.539 1.00 78.43  ? 153 PHE A CA  1 
ATOM   1197 C C   . PHE A 1 175 ? 38.178  -46.434 19.574 1.00 79.29  ? 153 PHE A C   1 
ATOM   1198 O O   . PHE A 1 175 ? 38.350  -47.406 18.842 1.00 80.04  ? 153 PHE A O   1 
ATOM   1199 C CB  . PHE A 1 175 ? 37.094  -44.281 18.893 1.00 80.36  ? 153 PHE A CB  1 
ATOM   1200 C CG  . PHE A 1 175 ? 37.229  -44.328 17.404 1.00 84.53  ? 153 PHE A CG  1 
ATOM   1201 C CD1 . PHE A 1 175 ? 36.183  -44.803 16.614 1.00 86.67  ? 153 PHE A CD1 1 
ATOM   1202 C CD2 . PHE A 1 175 ? 38.394  -43.874 16.783 1.00 86.78  ? 153 PHE A CD2 1 
ATOM   1203 C CE1 . PHE A 1 175 ? 36.291  -44.835 15.235 1.00 83.90  ? 153 PHE A CE1 1 
ATOM   1204 C CE2 . PHE A 1 175 ? 38.519  -43.895 15.404 1.00 82.34  ? 153 PHE A CE2 1 
ATOM   1205 C CZ  . PHE A 1 175 ? 37.466  -44.381 14.628 1.00 90.48  ? 153 PHE A CZ  1 
ATOM   1206 N N   . GLU A 1 176 ? 39.092  -46.025 20.445 1.00 78.14  ? 154 GLU A N   1 
ATOM   1207 C CA  . GLU A 1 176 ? 40.400  -46.652 20.493 1.00 75.36  ? 154 GLU A CA  1 
ATOM   1208 C C   . GLU A 1 176 ? 40.320  -48.113 20.883 1.00 78.39  ? 154 GLU A C   1 
ATOM   1209 O O   . GLU A 1 176 ? 40.854  -48.969 20.177 1.00 83.83  ? 154 GLU A O   1 
ATOM   1210 C CB  . GLU A 1 176 ? 41.314  -45.897 21.441 1.00 80.43  ? 154 GLU A CB  1 
ATOM   1211 C CG  . GLU A 1 176 ? 41.915  -44.667 20.783 1.00 86.47  ? 154 GLU A CG  1 
ATOM   1212 C CD  . GLU A 1 176 ? 42.175  -43.540 21.765 1.00 99.93  ? 154 GLU A CD  1 
ATOM   1213 O OE1 . GLU A 1 176 ? 42.572  -43.826 22.929 1.00 93.96  ? 154 GLU A OE1 1 
ATOM   1214 O OE2 . GLU A 1 176 ? 41.961  -42.366 21.366 1.00 98.72  ? 154 GLU A OE2 1 
ATOM   1215 N N   . ILE A 1 177 ? 39.647  -48.408 21.987 1.00 78.00  ? 155 ILE A N   1 
ATOM   1216 C CA  . ILE A 1 177 ? 39.452  -49.794 22.389 1.00 74.58  ? 155 ILE A CA  1 
ATOM   1217 C C   . ILE A 1 177 ? 38.830  -50.614 21.267 1.00 75.20  ? 155 ILE A C   1 
ATOM   1218 O O   . ILE A 1 177 ? 39.312  -51.695 20.947 1.00 74.10  ? 155 ILE A O   1 
ATOM   1219 C CB  . ILE A 1 177 ? 38.563  -49.898 23.635 1.00 73.44  ? 155 ILE A CB  1 
ATOM   1220 C CG1 . ILE A 1 177 ? 39.143  -49.049 24.755 1.00 67.26  ? 155 ILE A CG1 1 
ATOM   1221 C CG2 . ILE A 1 177 ? 38.434  -51.346 24.081 1.00 71.86  ? 155 ILE A CG2 1 
ATOM   1222 C CD1 . ILE A 1 177 ? 38.483  -49.261 26.069 1.00 75.29  ? 155 ILE A CD1 1 
ATOM   1223 N N   . SER A 1 178 ? 37.777  -50.093 20.650 1.00 73.78  ? 156 SER A N   1 
ATOM   1224 C CA  . SER A 1 178 ? 37.074  -50.873 19.648 1.00 74.25  ? 156 SER A CA  1 
ATOM   1225 C C   . SER A 1 178 ? 37.914  -51.111 18.402 1.00 75.89  ? 156 SER A C   1 
ATOM   1226 O O   . SER A 1 178 ? 37.709  -52.104 17.715 1.00 78.76  ? 156 SER A O   1 
ATOM   1227 C CB  . SER A 1 178 ? 35.762  -50.202 19.261 1.00 74.03  ? 156 SER A CB  1 
ATOM   1228 O OG  . SER A 1 178 ? 35.980  -49.208 18.292 1.00 77.95  ? 156 SER A OG  1 
ATOM   1229 N N   . LYS A 1 179 ? 38.853  -50.218 18.096 1.00 74.88  ? 157 LYS A N   1 
ATOM   1230 C CA  . LYS A 1 179 ? 39.710  -50.424 16.922 1.00 78.28  ? 157 LYS A CA  1 
ATOM   1231 C C   . LYS A 1 179 ? 40.738  -51.527 17.206 1.00 76.44  ? 157 LYS A C   1 
ATOM   1232 O O   . LYS A 1 179 ? 40.956  -52.425 16.390 1.00 69.98  ? 157 LYS A O   1 
ATOM   1233 C CB  . LYS A 1 179 ? 40.401  -49.123 16.514 1.00 71.55  ? 157 LYS A CB  1 
ATOM   1234 N N   . LYS A 1 180 ? 41.343  -51.463 18.389 1.00 81.84  ? 158 LYS A N   1 
ATOM   1235 C CA  . LYS A 1 180 ? 42.282  -52.486 18.847 1.00 79.19  ? 158 LYS A CA  1 
ATOM   1236 C C   . LYS A 1 180 ? 41.636  -53.865 19.022 1.00 83.79  ? 158 LYS A C   1 
ATOM   1237 O O   . LYS A 1 180 ? 42.305  -54.880 18.843 1.00 89.83  ? 158 LYS A O   1 
ATOM   1238 C CB  . LYS A 1 180 ? 42.929  -52.068 20.173 1.00 66.37  ? 158 LYS A CB  1 
ATOM   1239 N N   . GLU A 1 181 ? 40.343  -53.906 19.354 1.00 81.86  ? 159 GLU A N   1 
ATOM   1240 C CA  . GLU A 1 181 ? 39.754  -55.121 19.918 1.00 75.19  ? 159 GLU A CA  1 
ATOM   1241 C C   . GLU A 1 181 ? 38.509  -55.689 19.248 1.00 76.54  ? 159 GLU A C   1 
ATOM   1242 O O   . GLU A 1 181 ? 38.120  -56.814 19.543 1.00 80.07  ? 159 GLU A O   1 
ATOM   1243 C CB  . GLU A 1 181 ? 39.421  -54.876 21.382 1.00 75.66  ? 159 GLU A CB  1 
ATOM   1244 C CG  . GLU A 1 181 ? 40.612  -54.507 22.219 1.00 80.33  ? 159 GLU A CG  1 
ATOM   1245 C CD  . GLU A 1 181 ? 41.371  -55.728 22.682 1.00 92.58  ? 159 GLU A CD  1 
ATOM   1246 O OE1 . GLU A 1 181 ? 41.202  -56.806 22.066 1.00 87.82  ? 159 GLU A OE1 1 
ATOM   1247 O OE2 . GLU A 1 181 ? 42.125  -55.612 23.674 1.00 101.53 ? 159 GLU A OE2 1 
ATOM   1248 N N   . MET A 1 182 ? 37.873  -54.934 18.366 1.00 77.47  ? 160 MET A N   1 
ATOM   1249 C CA  . MET A 1 182 ? 36.624  -55.399 17.776 1.00 73.75  ? 160 MET A CA  1 
ATOM   1250 C C   . MET A 1 182 ? 36.642  -55.353 16.260 1.00 74.72  ? 160 MET A C   1 
ATOM   1251 O O   . MET A 1 182 ? 37.303  -54.522 15.661 1.00 78.33  ? 160 MET A O   1 
ATOM   1252 C CB  . MET A 1 182 ? 35.448  -54.571 18.289 1.00 74.98  ? 160 MET A CB  1 
ATOM   1253 C CG  . MET A 1 182 ? 35.255  -54.629 19.786 1.00 72.85  ? 160 MET A CG  1 
ATOM   1254 S SD  . MET A 1 182 ? 33.933  -53.556 20.358 1.00 83.18  ? 160 MET A SD  1 
ATOM   1255 C CE  . MET A 1 182 ? 32.544  -54.190 19.430 1.00 70.61  ? 160 MET A CE  1 
ATOM   1256 N N   . GLN A 1 183 ? 35.898  -56.264 15.654 1.00 74.17  ? 161 GLN A N   1 
ATOM   1257 C CA  . GLN A 1 183 ? 35.764  -56.349 14.221 1.00 68.79  ? 161 GLN A CA  1 
ATOM   1258 C C   . GLN A 1 183 ? 34.984  -55.144 13.724 1.00 79.86  ? 161 GLN A C   1 
ATOM   1259 O O   . GLN A 1 183 ? 34.035  -54.722 14.378 1.00 80.61  ? 161 GLN A O   1 
ATOM   1260 C CB  . GLN A 1 183 ? 35.048  -57.649 13.856 1.00 78.36  ? 161 GLN A CB  1 
ATOM   1261 C CG  . GLN A 1 183 ? 35.515  -58.304 12.569 1.00 91.53  ? 161 GLN A CG  1 
ATOM   1262 C CD  . GLN A 1 183 ? 36.989  -58.703 12.589 1.00 94.38  ? 161 GLN A CD  1 
ATOM   1263 O OE1 . GLN A 1 183 ? 37.623  -58.819 13.659 1.00 83.51  ? 161 GLN A OE1 1 
ATOM   1264 N NE2 . GLN A 1 183 ? 37.544  -58.924 11.391 1.00 90.57  ? 161 GLN A NE2 1 
ATOM   1265 N N   . PRO A 1 184 ? 35.377  -54.575 12.569 1.00 80.47  ? 162 PRO A N   1 
ATOM   1266 C CA  . PRO A 1 184 ? 34.648  -53.436 11.990 1.00 75.81  ? 162 PRO A CA  1 
ATOM   1267 C C   . PRO A 1 184 ? 33.189  -53.737 11.585 1.00 71.21  ? 162 PRO A C   1 
ATOM   1268 O O   . PRO A 1 184 ? 32.416  -52.802 11.368 1.00 72.18  ? 162 PRO A O   1 
ATOM   1269 C CB  . PRO A 1 184 ? 35.489  -53.089 10.753 1.00 79.26  ? 162 PRO A CB  1 
ATOM   1270 C CG  . PRO A 1 184 ? 36.175  -54.375 10.403 1.00 77.27  ? 162 PRO A CG  1 
ATOM   1271 C CD  . PRO A 1 184 ? 36.522  -54.972 11.730 1.00 77.52  ? 162 PRO A CD  1 
ATOM   1272 N N   . THR A 1 185 ? 32.826  -55.011 11.472 1.00 68.84  ? 163 THR A N   1 
ATOM   1273 C CA  . THR A 1 185 ? 31.458  -55.397 11.122 1.00 71.46  ? 163 THR A CA  1 
ATOM   1274 C C   . THR A 1 185 ? 30.560  -55.459 12.346 1.00 73.93  ? 163 THR A C   1 
ATOM   1275 O O   . THR A 1 185 ? 29.360  -55.691 12.230 1.00 70.99  ? 163 THR A O   1 
ATOM   1276 C CB  . THR A 1 185 ? 31.406  -56.775 10.440 1.00 73.03  ? 163 THR A CB  1 
ATOM   1277 O OG1 . THR A 1 185 ? 32.437  -57.626 10.975 1.00 76.63  ? 163 THR A OG1 1 
ATOM   1278 C CG2 . THR A 1 185 ? 31.611  -56.630 8.962  1.00 76.66  ? 163 THR A CG2 1 
ATOM   1279 N N   . HIS A 1 186 ? 31.169  -55.286 13.517 1.00 71.71  ? 164 HIS A N   1 
ATOM   1280 C CA  . HIS A 1 186 ? 30.486  -55.392 14.797 1.00 69.12  ? 164 HIS A CA  1 
ATOM   1281 C C   . HIS A 1 186 ? 29.584  -54.199 15.101 1.00 70.60  ? 164 HIS A C   1 
ATOM   1282 O O   . HIS A 1 186 ? 30.049  -53.065 15.147 1.00 70.96  ? 164 HIS A O   1 
ATOM   1283 C CB  . HIS A 1 186 ? 31.508  -55.535 15.908 1.00 70.19  ? 164 HIS A CB  1 
ATOM   1284 C CG  . HIS A 1 186 ? 30.926  -56.019 17.187 1.00 72.95  ? 164 HIS A CG  1 
ATOM   1285 N ND1 . HIS A 1 186 ? 29.887  -55.369 17.824 1.00 72.30  ? 164 HIS A ND1 1 
ATOM   1286 C CD2 . HIS A 1 186 ? 31.218  -57.092 17.957 1.00 75.92  ? 164 HIS A CD2 1 
ATOM   1287 C CE1 . HIS A 1 186 ? 29.573  -56.021 18.923 1.00 77.79  ? 164 HIS A CE1 1 
ATOM   1288 N NE2 . HIS A 1 186 ? 30.371  -57.073 19.033 1.00 75.62  ? 164 HIS A NE2 1 
ATOM   1289 N N   . PRO A 1 187 ? 28.296  -54.458 15.353 1.00 69.59  ? 165 PRO A N   1 
ATOM   1290 C CA  . PRO A 1 187 ? 27.270  -53.417 15.478 1.00 65.38  ? 165 PRO A CA  1 
ATOM   1291 C C   . PRO A 1 187 ? 27.627  -52.336 16.488 1.00 70.36  ? 165 PRO A C   1 
ATOM   1292 O O   . PRO A 1 187 ? 27.225  -51.192 16.316 1.00 72.20  ? 165 PRO A O   1 
ATOM   1293 C CB  . PRO A 1 187 ? 26.046  -54.197 15.949 1.00 66.20  ? 165 PRO A CB  1 
ATOM   1294 C CG  . PRO A 1 187 ? 26.268  -55.569 15.433 1.00 68.14  ? 165 PRO A CG  1 
ATOM   1295 C CD  . PRO A 1 187 ? 27.737  -55.802 15.552 1.00 68.46  ? 165 PRO A CD  1 
ATOM   1296 N N   . ILE A 1 188 ? 28.365  -52.695 17.530 1.00 65.61  ? 166 ILE A N   1 
ATOM   1297 C CA  . ILE A 1 188 ? 28.736  -51.734 18.551 1.00 65.74  ? 166 ILE A CA  1 
ATOM   1298 C C   . ILE A 1 188 ? 29.750  -50.740 18.008 1.00 68.78  ? 166 ILE A C   1 
ATOM   1299 O O   . ILE A 1 188 ? 29.653  -49.544 18.250 1.00 69.95  ? 166 ILE A O   1 
ATOM   1300 C CB  . ILE A 1 188 ? 29.311  -52.449 19.784 1.00 74.16  ? 166 ILE A CB  1 
ATOM   1301 C CG1 . ILE A 1 188 ? 28.205  -53.221 20.504 1.00 67.76  ? 166 ILE A CG1 1 
ATOM   1302 C CG2 . ILE A 1 188 ? 30.035  -51.470 20.722 1.00 67.81  ? 166 ILE A CG2 1 
ATOM   1303 C CD1 . ILE A 1 188 ? 28.731  -54.183 21.521 1.00 73.45  ? 166 ILE A CD1 1 
ATOM   1304 N N   . ARG A 1 189 ? 30.727  -51.249 17.268 1.00 72.62  ? 167 ARG A N   1 
ATOM   1305 C CA  . ARG A 1 189 ? 31.769  -50.412 16.690 1.00 70.28  ? 167 ARG A CA  1 
ATOM   1306 C C   . ARG A 1 189 ? 31.167  -49.537 15.608 1.00 70.38  ? 167 ARG A C   1 
ATOM   1307 O O   . ARG A 1 189 ? 31.495  -48.351 15.505 1.00 70.41  ? 167 ARG A O   1 
ATOM   1308 C CB  . ARG A 1 189 ? 32.902  -51.264 16.121 1.00 70.80  ? 167 ARG A CB  1 
ATOM   1309 C CG  . ARG A 1 189 ? 34.082  -50.461 15.684 1.00 72.31  ? 167 ARG A CG  1 
ATOM   1310 C CD  . ARG A 1 189 ? 35.217  -51.337 15.212 1.00 78.54  ? 167 ARG A CD  1 
ATOM   1311 N NE  . ARG A 1 189 ? 35.950  -50.649 14.151 1.00 84.44  ? 167 ARG A NE  1 
ATOM   1312 C CZ  . ARG A 1 189 ? 36.993  -51.143 13.497 1.00 79.69  ? 167 ARG A CZ  1 
ATOM   1313 N NH1 . ARG A 1 189 ? 37.454  -52.353 13.775 1.00 74.24  ? 167 ARG A NH1 1 
ATOM   1314 N NH2 . ARG A 1 189 ? 37.557  -50.419 12.542 1.00 89.63  ? 167 ARG A NH2 1 
ATOM   1315 N N   . LEU A 1 190 ? 30.269  -50.122 14.819 1.00 66.14  ? 168 LEU A N   1 
ATOM   1316 C CA  . LEU A 1 190 ? 29.561  -49.373 13.792 1.00 64.67  ? 168 LEU A CA  1 
ATOM   1317 C C   . LEU A 1 190 ? 28.633  -48.294 14.359 1.00 70.35  ? 168 LEU A C   1 
ATOM   1318 O O   . LEU A 1 190 ? 28.591  -47.183 13.832 1.00 72.84  ? 168 LEU A O   1 
ATOM   1319 C CB  . LEU A 1 190 ? 28.757  -50.313 12.909 1.00 67.26  ? 168 LEU A CB  1 
ATOM   1320 C CG  . LEU A 1 190 ? 29.537  -51.128 11.874 1.00 70.93  ? 168 LEU A CG  1 
ATOM   1321 C CD1 . LEU A 1 190 ? 28.578  -52.056 11.083 1.00 67.79  ? 168 LEU A CD1 1 
ATOM   1322 C CD2 . LEU A 1 190 ? 30.304  -50.180 10.957 1.00 69.43  ? 168 LEU A CD2 1 
ATOM   1323 N N   . GLY A 1 191 ? 27.890  -48.608 15.418 1.00 65.94  ? 169 GLY A N   1 
ATOM   1324 C CA  . GLY A 1 191 ? 26.974  -47.649 15.996 1.00 59.10  ? 169 GLY A CA  1 
ATOM   1325 C C   . GLY A 1 191 ? 27.749  -46.515 16.630 1.00 67.42  ? 169 GLY A C   1 
ATOM   1326 O O   . GLY A 1 191 ? 27.286  -45.366 16.666 1.00 66.13  ? 169 GLY A O   1 
ATOM   1327 N N   . LEU A 1 192 ? 28.935  -46.852 17.140 1.00 68.35  ? 170 LEU A N   1 
ATOM   1328 C CA  . LEU A 1 192 ? 29.832  -45.880 17.760 1.00 70.96  ? 170 LEU A CA  1 
ATOM   1329 C C   . LEU A 1 192 ? 30.326  -44.912 16.721 1.00 74.17  ? 170 LEU A C   1 
ATOM   1330 O O   . LEU A 1 192 ? 30.356  -43.695 16.934 1.00 74.63  ? 170 LEU A O   1 
ATOM   1331 C CB  . LEU A 1 192 ? 31.030  -46.564 18.406 1.00 72.36  ? 170 LEU A CB  1 
ATOM   1332 C CG  . LEU A 1 192 ? 32.198  -45.641 18.782 1.00 73.13  ? 170 LEU A CG  1 
ATOM   1333 C CD1 . LEU A 1 192 ? 31.783  -44.640 19.839 1.00 74.69  ? 170 LEU A CD1 1 
ATOM   1334 C CD2 . LEU A 1 192 ? 33.396  -46.449 19.262 1.00 76.15  ? 170 LEU A CD2 1 
ATOM   1335 N N   . ALA A 1 193 ? 30.732  -45.490 15.596 1.00 72.13  ? 171 ALA A N   1 
ATOM   1336 C CA  . ALA A 1 193 ? 31.180  -44.738 14.456 1.00 65.97  ? 171 ALA A CA  1 
ATOM   1337 C C   . ALA A 1 193 ? 30.096  -43.770 14.057 1.00 70.12  ? 171 ALA A C   1 
ATOM   1338 O O   . ALA A 1 193 ? 30.331  -42.569 13.911 1.00 73.82  ? 171 ALA A O   1 
ATOM   1339 C CB  . ALA A 1 193 ? 31.513  -45.666 13.326 1.00 68.39  ? 171 ALA A CB  1 
ATOM   1340 N N   . LEU A 1 194 ? 28.898  -44.310 13.894 1.00 70.33  ? 172 LEU A N   1 
ATOM   1341 C CA  . LEU A 1 194 ? 27.757  -43.518 13.471 1.00 71.43  ? 172 LEU A CA  1 
ATOM   1342 C C   . LEU A 1 194 ? 27.616  -42.295 14.350 1.00 75.18  ? 172 LEU A C   1 
ATOM   1343 O O   . LEU A 1 194 ? 27.634  -41.165 13.855 1.00 74.46  ? 172 LEU A O   1 
ATOM   1344 C CB  . LEU A 1 194 ? 26.480  -44.353 13.495 1.00 65.03  ? 172 LEU A CB  1 
ATOM   1345 C CG  . LEU A 1 194 ? 25.175  -43.645 13.176 1.00 60.50  ? 172 LEU A CG  1 
ATOM   1346 C CD1 . LEU A 1 194 ? 25.319  -42.726 11.978 1.00 73.19  ? 172 LEU A CD1 1 
ATOM   1347 C CD2 . LEU A 1 194 ? 24.127  -44.691 12.901 1.00 61.56  ? 172 LEU A CD2 1 
ATOM   1348 N N   . ASN A 1 195 ? 27.522  -42.513 15.655 1.00 74.90  ? 173 ASN A N   1 
ATOM   1349 C CA  . ASN A 1 195 ? 27.274  -41.399 16.560 1.00 73.98  ? 173 ASN A CA  1 
ATOM   1350 C C   . ASN A 1 195 ? 28.478  -40.510 16.784 1.00 76.49  ? 173 ASN A C   1 
ATOM   1351 O O   . ASN A 1 195 ? 28.314  -39.334 17.111 1.00 78.56  ? 173 ASN A O   1 
ATOM   1352 C CB  . ASN A 1 195 ? 26.748  -41.910 17.899 1.00 76.16  ? 173 ASN A CB  1 
ATOM   1353 C CG  . ASN A 1 195 ? 25.282  -42.234 17.851 1.00 75.66  ? 173 ASN A CG  1 
ATOM   1354 O OD1 . ASN A 1 195 ? 24.683  -42.295 16.772 1.00 72.83  ? 173 ASN A OD1 1 
ATOM   1355 N ND2 . ASN A 1 195 ? 24.679  -42.422 19.026 1.00 76.29  ? 173 ASN A ND2 1 
ATOM   1356 N N   . PHE A 1 196 ? 29.686  -41.036 16.605 1.00 75.77  ? 174 PHE A N   1 
ATOM   1357 C CA  . PHE A 1 196 ? 30.846  -40.168 16.768 1.00 77.15  ? 174 PHE A CA  1 
ATOM   1358 C C   . PHE A 1 196 ? 30.905  -39.241 15.550 1.00 78.81  ? 174 PHE A C   1 
ATOM   1359 O O   . PHE A 1 196 ? 31.101  -38.029 15.695 1.00 79.89  ? 174 PHE A O   1 
ATOM   1360 C CB  . PHE A 1 196 ? 32.146  -40.962 16.892 1.00 77.50  ? 174 PHE A CB  1 
ATOM   1361 C CG  . PHE A 1 196 ? 33.324  -40.152 17.406 1.00 85.20  ? 174 PHE A CG  1 
ATOM   1362 C CD1 . PHE A 1 196 ? 34.224  -40.684 18.313 1.00 75.08  ? 174 PHE A CD1 1 
ATOM   1363 C CD2 . PHE A 1 196 ? 33.486  -38.832 17.023 1.00 93.74  ? 174 PHE A CD2 1 
ATOM   1364 C CE1 . PHE A 1 196 ? 35.283  -39.920 18.777 1.00 80.11  ? 174 PHE A CE1 1 
ATOM   1365 C CE2 . PHE A 1 196 ? 34.519  -38.067 17.483 1.00 92.41  ? 174 PHE A CE2 1 
ATOM   1366 C CZ  . PHE A 1 196 ? 35.428  -38.611 18.362 1.00 88.01  ? 174 PHE A CZ  1 
ATOM   1367 N N   . SER A 1 197 ? 30.743  -39.796 14.353 1.00 78.21  ? 175 SER A N   1 
ATOM   1368 C CA  . SER A 1 197 ? 30.864  -38.958 13.174 1.00 79.30  ? 175 SER A CA  1 
ATOM   1369 C C   . SER A 1 197 ? 29.819  -37.839 13.246 1.00 79.42  ? 175 SER A C   1 
ATOM   1370 O O   . SER A 1 197 ? 30.097  -36.712 12.856 1.00 82.30  ? 175 SER A O   1 
ATOM   1371 C CB  . SER A 1 197 ? 30.736  -39.793 11.908 1.00 78.38  ? 175 SER A CB  1 
ATOM   1372 O OG  . SER A 1 197 ? 29.432  -40.320 11.765 1.00 83.84  ? 175 SER A OG  1 
ATOM   1373 N N   . VAL A 1 198 ? 28.642  -38.145 13.795 1.00 80.41  ? 176 VAL A N   1 
ATOM   1374 C CA  . VAL A 1 198 ? 27.606  -37.130 14.009 1.00 80.91  ? 176 VAL A CA  1 
ATOM   1375 C C   . VAL A 1 198 ? 28.068  -36.130 15.068 1.00 78.50  ? 176 VAL A C   1 
ATOM   1376 O O   . VAL A 1 198 ? 27.802  -34.932 14.974 1.00 77.97  ? 176 VAL A O   1 
ATOM   1377 C CB  . VAL A 1 198 ? 26.241  -37.766 14.413 1.00 76.51  ? 176 VAL A CB  1 
ATOM   1378 C CG1 . VAL A 1 198 ? 25.413  -36.809 15.212 1.00 74.25  ? 176 VAL A CG1 1 
ATOM   1379 C CG2 . VAL A 1 198 ? 25.461  -38.184 13.170 1.00 68.40  ? 176 VAL A CG2 1 
ATOM   1380 N N   . PHE A 1 199 ? 28.792  -36.614 16.065 1.00 79.02  ? 177 PHE A N   1 
ATOM   1381 C CA  . PHE A 1 199 ? 29.323  -35.711 17.069 1.00 79.02  ? 177 PHE A CA  1 
ATOM   1382 C C   . PHE A 1 199 ? 30.241  -34.683 16.417 1.00 86.02  ? 177 PHE A C   1 
ATOM   1383 O O   . PHE A 1 199 ? 30.073  -33.484 16.639 1.00 86.19  ? 177 PHE A O   1 
ATOM   1384 C CB  . PHE A 1 199 ? 30.059  -36.478 18.152 1.00 76.31  ? 177 PHE A CB  1 
ATOM   1385 C CG  . PHE A 1 199 ? 30.807  -35.606 19.109 1.00 80.57  ? 177 PHE A CG  1 
ATOM   1386 C CD1 . PHE A 1 199 ? 30.182  -35.083 20.227 1.00 82.20  ? 177 PHE A CD1 1 
ATOM   1387 C CD2 . PHE A 1 199 ? 32.151  -35.325 18.905 1.00 82.23  ? 177 PHE A CD2 1 
ATOM   1388 C CE1 . PHE A 1 199 ? 30.888  -34.283 21.126 1.00 86.60  ? 177 PHE A CE1 1 
ATOM   1389 C CE2 . PHE A 1 199 ? 32.856  -34.533 19.792 1.00 86.96  ? 177 PHE A CE2 1 
ATOM   1390 C CZ  . PHE A 1 199 ? 32.225  -34.011 20.906 1.00 87.29  ? 177 PHE A CZ  1 
ATOM   1391 N N   . TYR A 1 200 ? 31.195  -35.148 15.605 1.00 88.62  ? 178 TYR A N   1 
ATOM   1392 C CA  . TYR A 1 200 ? 32.139  -34.252 14.935 1.00 85.90  ? 178 TYR A CA  1 
ATOM   1393 C C   . TYR A 1 200 ? 31.395  -33.262 14.058 1.00 84.55  ? 178 TYR A C   1 
ATOM   1394 O O   . TYR A 1 200 ? 31.776  -32.097 13.953 1.00 89.42  ? 178 TYR A O   1 
ATOM   1395 C CB  . TYR A 1 200 ? 33.150  -35.036 14.099 1.00 84.84  ? 178 TYR A CB  1 
ATOM   1396 C CG  . TYR A 1 200 ? 34.415  -35.428 14.836 1.00 84.37  ? 178 TYR A CG  1 
ATOM   1397 C CD1 . TYR A 1 200 ? 34.885  -34.695 15.907 1.00 89.19  ? 178 TYR A CD1 1 
ATOM   1398 C CD2 . TYR A 1 200 ? 35.134  -36.540 14.457 1.00 92.32  ? 178 TYR A CD2 1 
ATOM   1399 C CE1 . TYR A 1 200 ? 36.047  -35.065 16.582 1.00 89.10  ? 178 TYR A CE1 1 
ATOM   1400 C CE2 . TYR A 1 200 ? 36.292  -36.912 15.116 1.00 94.15  ? 178 TYR A CE2 1 
ATOM   1401 C CZ  . TYR A 1 200 ? 36.742  -36.178 16.180 1.00 88.36  ? 178 TYR A CZ  1 
ATOM   1402 O OH  . TYR A 1 200 ? 37.893  -36.577 16.820 1.00 91.61  ? 178 TYR A OH  1 
ATOM   1403 N N   . TYR A 1 201 ? 30.305  -33.723 13.463 1.00 79.88  ? 179 TYR A N   1 
ATOM   1404 C CA  . TYR A 1 201 ? 29.570  -32.912 12.507 1.00 86.07  ? 179 TYR A CA  1 
ATOM   1405 C C   . TYR A 1 201 ? 28.657  -31.890 13.176 1.00 87.99  ? 179 TYR A C   1 
ATOM   1406 O O   . TYR A 1 201 ? 28.770  -30.694 12.916 1.00 92.37  ? 179 TYR A O   1 
ATOM   1407 C CB  . TYR A 1 201 ? 28.753  -33.808 11.573 1.00 83.83  ? 179 TYR A CB  1 
ATOM   1408 C CG  . TYR A 1 201 ? 28.099  -33.059 10.436 1.00 89.30  ? 179 TYR A CG  1 
ATOM   1409 C CD1 . TYR A 1 201 ? 28.804  -32.763 9.267  1.00 89.45  ? 179 TYR A CD1 1 
ATOM   1410 C CD2 . TYR A 1 201 ? 26.777  -32.653 10.520 1.00 92.01  ? 179 TYR A CD2 1 
ATOM   1411 C CE1 . TYR A 1 201 ? 28.207  -32.076 8.218  1.00 82.90  ? 179 TYR A CE1 1 
ATOM   1412 C CE2 . TYR A 1 201 ? 26.167  -31.974 9.467  1.00 91.80  ? 179 TYR A CE2 1 
ATOM   1413 C CZ  . TYR A 1 201 ? 26.888  -31.689 8.326  1.00 84.68  ? 179 TYR A CZ  1 
ATOM   1414 O OH  . TYR A 1 201 ? 26.274  -31.014 7.302  1.00 84.23  ? 179 TYR A OH  1 
ATOM   1415 N N   . GLU A 1 202 ? 27.757  -32.362 14.033 1.00 89.55  ? 180 GLU A N   1 
ATOM   1416 C CA  . GLU A 1 202 ? 26.750  -31.501 14.651 1.00 86.47  ? 180 GLU A CA  1 
ATOM   1417 C C   . GLU A 1 202 ? 27.243  -30.740 15.884 1.00 83.26  ? 180 GLU A C   1 
ATOM   1418 O O   . GLU A 1 202 ? 26.753  -29.661 16.167 1.00 87.38  ? 180 GLU A O   1 
ATOM   1419 C CB  . GLU A 1 202 ? 25.516  -32.326 15.020 1.00 84.55  ? 180 GLU A CB  1 
ATOM   1420 C CG  . GLU A 1 202 ? 24.690  -32.781 13.818 1.00 86.91  ? 180 GLU A CG  1 
ATOM   1421 C CD  . GLU A 1 202 ? 23.596  -33.775 14.195 1.00 91.21  ? 180 GLU A CD  1 
ATOM   1422 O OE1 . GLU A 1 202 ? 23.532  -34.196 15.376 1.00 87.24  ? 180 GLU A OE1 1 
ATOM   1423 O OE2 . GLU A 1 202 ? 22.790  -34.131 13.307 1.00 90.17  ? 180 GLU A OE2 1 
ATOM   1424 N N   . ILE A 1 203 ? 28.217  -31.281 16.606 1.00 85.67  ? 181 ILE A N   1 
ATOM   1425 C CA  . ILE A 1 203 ? 28.692  -30.638 17.834 1.00 88.74  ? 181 ILE A CA  1 
ATOM   1426 C C   . ILE A 1 203 ? 29.971  -29.800 17.659 1.00 91.72  ? 181 ILE A C   1 
ATOM   1427 O O   . ILE A 1 203 ? 30.143  -28.775 18.333 1.00 90.35  ? 181 ILE A O   1 
ATOM   1428 C CB  . ILE A 1 203 ? 28.931  -31.692 18.950 1.00 83.89  ? 181 ILE A CB  1 
ATOM   1429 C CG1 . ILE A 1 203 ? 27.608  -32.331 19.339 1.00 74.62  ? 181 ILE A CG1 1 
ATOM   1430 C CG2 . ILE A 1 203 ? 29.540  -31.058 20.178 1.00 83.06  ? 181 ILE A CG2 1 
ATOM   1431 C CD1 . ILE A 1 203 ? 26.582  -31.328 19.740 1.00 67.68  ? 181 ILE A CD1 1 
ATOM   1432 N N   . LEU A 1 204 ? 30.857  -30.216 16.756 1.00 92.43  ? 182 LEU A N   1 
ATOM   1433 C CA  . LEU A 1 204 ? 32.146  -29.541 16.594 1.00 91.30  ? 182 LEU A CA  1 
ATOM   1434 C C   . LEU A 1 204 ? 32.262  -28.776 15.288 1.00 91.65  ? 182 LEU A C   1 
ATOM   1435 O O   . LEU A 1 204 ? 33.240  -28.064 15.067 1.00 97.84  ? 182 LEU A O   1 
ATOM   1436 C CB  . LEU A 1 204 ? 33.285  -30.554 16.686 1.00 88.79  ? 182 LEU A CB  1 
ATOM   1437 C CG  . LEU A 1 204 ? 33.354  -31.244 18.041 1.00 88.95  ? 182 LEU A CG  1 
ATOM   1438 C CD1 . LEU A 1 204 ? 34.637  -32.059 18.182 1.00 90.26  ? 182 LEU A CD1 1 
ATOM   1439 C CD2 . LEU A 1 204 ? 33.235  -30.204 19.138 1.00 87.78  ? 182 LEU A CD2 1 
ATOM   1440 N N   . ASN A 1 205 ? 31.256  -28.921 14.437 1.00 93.12  ? 183 ASN A N   1 
ATOM   1441 C CA  . ASN A 1 205 ? 31.297  -28.424 13.056 1.00 101.18 ? 183 ASN A CA  1 
ATOM   1442 C C   . ASN A 1 205 ? 32.608  -28.687 12.351 1.00 99.18  ? 183 ASN A C   1 
ATOM   1443 O O   . ASN A 1 205 ? 33.225  -27.781 11.790 1.00 100.70 ? 183 ASN A O   1 
ATOM   1444 C CB  . ASN A 1 205 ? 30.975  -26.939 13.004 1.00 99.08  ? 183 ASN A CB  1 
ATOM   1445 C CG  . ASN A 1 205 ? 29.503  -26.699 12.808 1.00 111.33 ? 183 ASN A CG  1 
ATOM   1446 O OD1 . ASN A 1 205 ? 29.051  -26.406 11.695 1.00 115.37 ? 183 ASN A OD1 1 
ATOM   1447 N ND2 . ASN A 1 205 ? 28.727  -26.891 13.880 1.00 105.45 ? 183 ASN A ND2 1 
ATOM   1448 N N   . SER A 1 206 ? 33.017  -29.948 12.405 1.00 95.09  ? 184 SER A N   1 
ATOM   1449 C CA  . SER A 1 206 ? 34.121  -30.457 11.617 1.00 92.62  ? 184 SER A CA  1 
ATOM   1450 C C   . SER A 1 206 ? 33.558  -31.467 10.644 1.00 90.65  ? 184 SER A C   1 
ATOM   1451 O O   . SER A 1 206 ? 33.715  -32.663 10.865 1.00 91.68  ? 184 SER A O   1 
ATOM   1452 C CB  . SER A 1 206 ? 35.185  -31.132 12.494 1.00 91.79  ? 184 SER A CB  1 
ATOM   1453 O OG  . SER A 1 206 ? 35.528  -30.346 13.618 1.00 95.48  ? 184 SER A OG  1 
ATOM   1454 N N   . PRO A 1 207 ? 32.889  -31.004 9.574  1.00 89.49  ? 185 PRO A N   1 
ATOM   1455 C CA  . PRO A 1 207 ? 32.337  -31.973 8.621  1.00 88.49  ? 185 PRO A CA  1 
ATOM   1456 C C   . PRO A 1 207 ? 33.449  -32.744 7.903  1.00 89.72  ? 185 PRO A C   1 
ATOM   1457 O O   . PRO A 1 207 ? 33.206  -33.809 7.342  1.00 85.84  ? 185 PRO A O   1 
ATOM   1458 C CB  . PRO A 1 207 ? 31.533  -31.102 7.657  1.00 81.23  ? 185 PRO A CB  1 
ATOM   1459 C CG  . PRO A 1 207 ? 32.144  -29.769 7.756  1.00 84.66  ? 185 PRO A CG  1 
ATOM   1460 C CD  . PRO A 1 207 ? 32.627  -29.617 9.159  1.00 90.67  ? 185 PRO A CD  1 
ATOM   1461 N N   . GLU A 1 208 ? 34.666  -32.213 7.955  1.00 95.90  ? 186 GLU A N   1 
ATOM   1462 C CA  . GLU A 1 208 ? 35.840  -32.928 7.474  1.00 96.90  ? 186 GLU A CA  1 
ATOM   1463 C C   . GLU A 1 208 ? 36.145  -34.149 8.376  1.00 95.29  ? 186 GLU A C   1 
ATOM   1464 O O   . GLU A 1 208 ? 36.149  -35.282 7.884  1.00 95.74  ? 186 GLU A O   1 
ATOM   1465 C CB  . GLU A 1 208 ? 37.055  -31.966 7.363  1.00 104.98 ? 186 GLU A CB  1 
ATOM   1466 C CG  . GLU A 1 208 ? 37.808  -31.567 8.685  1.00 104.84 ? 186 GLU A CG  1 
ATOM   1467 C CD  . GLU A 1 208 ? 37.178  -30.405 9.468  1.00 97.07  ? 186 GLU A CD  1 
ATOM   1468 O OE1 . GLU A 1 208 ? 36.169  -29.821 9.009  1.00 94.31  ? 186 GLU A OE1 1 
ATOM   1469 O OE2 . GLU A 1 208 ? 37.721  -30.063 10.543 1.00 94.54  ? 186 GLU A OE2 1 
ATOM   1470 N N   . LYS A 1 209 ? 36.367  -33.935 9.678  1.00 86.90  ? 187 LYS A N   1 
ATOM   1471 C CA  . LYS A 1 209 ? 36.682  -35.036 10.589 1.00 91.66  ? 187 LYS A CA  1 
ATOM   1472 C C   . LYS A 1 209 ? 35.536  -36.044 10.598 1.00 91.60  ? 187 LYS A C   1 
ATOM   1473 O O   . LYS A 1 209 ? 35.765  -37.246 10.702 1.00 93.65  ? 187 LYS A O   1 
ATOM   1474 C CB  . LYS A 1 209 ? 36.961  -34.527 12.013 1.00 86.04  ? 187 LYS A CB  1 
ATOM   1475 N N   . ALA A 1 210 ? 34.310  -35.541 10.465 1.00 87.99  ? 188 ALA A N   1 
ATOM   1476 C CA  . ALA A 1 210 ? 33.115  -36.370 10.454 1.00 81.03  ? 188 ALA A CA  1 
ATOM   1477 C C   . ALA A 1 210 ? 33.143  -37.318 9.277  1.00 83.83  ? 188 ALA A C   1 
ATOM   1478 O O   . ALA A 1 210 ? 32.976  -38.531 9.436  1.00 84.33  ? 188 ALA A O   1 
ATOM   1479 C CB  . ALA A 1 210 ? 31.869  -35.514 10.400 1.00 79.82  ? 188 ALA A CB  1 
ATOM   1480 N N   . CYS A 1 211 ? 33.355  -36.764 8.090  1.00 86.01  ? 189 CYS A N   1 
ATOM   1481 C CA  . CYS A 1 211 ? 33.308  -37.558 6.865  1.00 84.04  ? 189 CYS A CA  1 
ATOM   1482 C C   . CYS A 1 211 ? 34.416  -38.606 6.825  1.00 85.66  ? 189 CYS A C   1 
ATOM   1483 O O   . CYS A 1 211 ? 34.249  -39.691 6.263  1.00 78.33  ? 189 CYS A O   1 
ATOM   1484 C CB  . CYS A 1 211 ? 33.392  -36.650 5.651  1.00 75.30  ? 189 CYS A CB  1 
ATOM   1485 S SG  . CYS A 1 211 ? 31.823  -35.883 5.238  1.00 83.58  ? 189 CYS A SG  1 
ATOM   1486 N N   . SER A 1 212 ? 35.542  -38.277 7.444  1.00 91.01  ? 190 SER A N   1 
ATOM   1487 C CA  . SER A 1 212 ? 36.657  -39.198 7.521  1.00 86.06  ? 190 SER A CA  1 
ATOM   1488 C C   . SER A 1 212 ? 36.235  -40.419 8.306  1.00 82.24  ? 190 SER A C   1 
ATOM   1489 O O   . SER A 1 212 ? 36.342  -41.544 7.826  1.00 83.58  ? 190 SER A O   1 
ATOM   1490 C CB  . SER A 1 212 ? 37.866  -38.536 8.176  1.00 92.20  ? 190 SER A CB  1 
ATOM   1491 O OG  . SER A 1 212 ? 39.028  -39.326 7.995  1.00 102.65 ? 190 SER A OG  1 
ATOM   1492 N N   . LEU A 1 213 ? 35.727  -40.176 9.508  1.00 82.99  ? 191 LEU A N   1 
ATOM   1493 C CA  . LEU A 1 213 ? 35.312  -41.241 10.413 1.00 80.05  ? 191 LEU A CA  1 
ATOM   1494 C C   . LEU A 1 213 ? 34.299  -42.159 9.733  1.00 79.56  ? 191 LEU A C   1 
ATOM   1495 O O   . LEU A 1 213 ? 34.487  -43.383 9.670  1.00 74.55  ? 191 LEU A O   1 
ATOM   1496 C CB  . LEU A 1 213 ? 34.732  -40.635 11.687 1.00 75.07  ? 191 LEU A CB  1 
ATOM   1497 C CG  . LEU A 1 213 ? 34.745  -41.484 12.955 1.00 83.57  ? 191 LEU A CG  1 
ATOM   1498 C CD1 . LEU A 1 213 ? 35.035  -40.607 14.194 1.00 80.79  ? 191 LEU A CD1 1 
ATOM   1499 C CD2 . LEU A 1 213 ? 33.432  -42.220 13.117 1.00 82.16  ? 191 LEU A CD2 1 
ATOM   1500 N N   . ALA A 1 214 ? 33.250  -41.554 9.186  1.00 75.13  ? 192 ALA A N   1 
ATOM   1501 C CA  . ALA A 1 214 ? 32.196  -42.320 8.548  1.00 73.95  ? 192 ALA A CA  1 
ATOM   1502 C C   . ALA A 1 214 ? 32.741  -43.203 7.430  1.00 78.72  ? 192 ALA A C   1 
ATOM   1503 O O   . ALA A 1 214 ? 32.585  -44.420 7.502  1.00 76.92  ? 192 ALA A O   1 
ATOM   1504 C CB  . ALA A 1 214 ? 31.110  -41.403 8.023  1.00 71.90  ? 192 ALA A CB  1 
ATOM   1505 N N   . LYS A 1 215 ? 33.396  -42.605 6.425  1.00 82.12  ? 193 LYS A N   1 
ATOM   1506 C CA  . LYS A 1 215 ? 33.865  -43.361 5.251  1.00 78.17  ? 193 LYS A CA  1 
ATOM   1507 C C   . LYS A 1 215 ? 34.782  -44.504 5.651  1.00 77.16  ? 193 LYS A C   1 
ATOM   1508 O O   . LYS A 1 215 ? 34.572  -45.640 5.219  1.00 74.48  ? 193 LYS A O   1 
ATOM   1509 C CB  . LYS A 1 215 ? 34.585  -42.460 4.245  1.00 73.24  ? 193 LYS A CB  1 
ATOM   1510 N N   . THR A 1 216 ? 35.775  -44.205 6.489  1.00 73.30  ? 194 THR A N   1 
ATOM   1511 C CA  . THR A 1 216 ? 36.706  -45.222 6.980  1.00 68.23  ? 194 THR A CA  1 
ATOM   1512 C C   . THR A 1 216 ? 35.970  -46.388 7.619  1.00 75.89  ? 194 THR A C   1 
ATOM   1513 O O   . THR A 1 216 ? 36.227  -47.555 7.291  1.00 73.72  ? 194 THR A O   1 
ATOM   1514 C CB  . THR A 1 216 ? 37.664  -44.655 8.016  1.00 69.61  ? 194 THR A CB  1 
ATOM   1515 O OG1 . THR A 1 216 ? 38.283  -43.476 7.501  1.00 73.92  ? 194 THR A OG1 1 
ATOM   1516 C CG2 . THR A 1 216 ? 38.718  -45.677 8.377  1.00 69.73  ? 194 THR A CG2 1 
ATOM   1517 N N   . ALA A 1 217 ? 35.057  -46.049 8.536  1.00 74.40  ? 195 ALA A N   1 
ATOM   1518 C CA  . ALA A 1 217 ? 34.265  -47.024 9.271  1.00 67.91  ? 195 ALA A CA  1 
ATOM   1519 C C   . ALA A 1 217 ? 33.443  -47.876 8.331  1.00 73.04  ? 195 ALA A C   1 
ATOM   1520 O O   . ALA A 1 217 ? 33.357  -49.096 8.487  1.00 77.82  ? 195 ALA A O   1 
ATOM   1521 C CB  . ALA A 1 217 ? 33.367  -46.328 10.244 1.00 72.69  ? 195 ALA A CB  1 
ATOM   1522 N N   . PHE A 1 218 ? 32.835  -47.206 7.361  1.00 69.86  ? 196 PHE A N   1 
ATOM   1523 C CA  . PHE A 1 218 ? 31.984  -47.835 6.373  1.00 69.84  ? 196 PHE A CA  1 
ATOM   1524 C C   . PHE A 1 218 ? 32.799  -48.743 5.473  1.00 79.16  ? 196 PHE A C   1 
ATOM   1525 O O   . PHE A 1 218 ? 32.395  -49.873 5.186  1.00 81.81  ? 196 PHE A O   1 
ATOM   1526 C CB  . PHE A 1 218 ? 31.269  -46.765 5.535  1.00 72.33  ? 196 PHE A CB  1 
ATOM   1527 C CG  . PHE A 1 218 ? 30.418  -47.324 4.427  1.00 70.76  ? 196 PHE A CG  1 
ATOM   1528 C CD1 . PHE A 1 218 ? 29.113  -47.701 4.661  1.00 71.25  ? 196 PHE A CD1 1 
ATOM   1529 C CD2 . PHE A 1 218 ? 30.923  -47.472 3.157  1.00 68.25  ? 196 PHE A CD2 1 
ATOM   1530 C CE1 . PHE A 1 218 ? 28.332  -48.224 3.643  1.00 76.20  ? 196 PHE A CE1 1 
ATOM   1531 C CE2 . PHE A 1 218 ? 30.141  -47.980 2.141  1.00 72.89  ? 196 PHE A CE2 1 
ATOM   1532 C CZ  . PHE A 1 218 ? 28.847  -48.356 2.383  1.00 71.83  ? 196 PHE A CZ  1 
ATOM   1533 N N   . ASP A 1 219 ? 33.939  -48.238 5.006  1.00 80.34  ? 197 ASP A N   1 
ATOM   1534 C CA  . ASP A 1 219 ? 34.780  -48.998 4.087  1.00 76.58  ? 197 ASP A CA  1 
ATOM   1535 C C   . ASP A 1 219 ? 35.341  -50.238 4.765  1.00 75.40  ? 197 ASP A C   1 
ATOM   1536 O O   . ASP A 1 219 ? 35.329  -51.324 4.179  1.00 73.62  ? 197 ASP A O   1 
ATOM   1537 C CB  . ASP A 1 219 ? 35.931  -48.144 3.548  1.00 72.18  ? 197 ASP A CB  1 
ATOM   1538 C CG  . ASP A 1 219 ? 35.491  -47.184 2.473  1.00 78.80  ? 197 ASP A CG  1 
ATOM   1539 O OD1 . ASP A 1 219 ? 34.533  -47.497 1.739  1.00 83.38  ? 197 ASP A OD1 1 
ATOM   1540 O OD2 . ASP A 1 219 ? 36.126  -46.124 2.344  1.00 81.05  ? 197 ASP A OD2 1 
ATOM   1541 N N   . GLU A 1 220 ? 35.827  -50.073 5.995  1.00 68.79  ? 198 GLU A N   1 
ATOM   1542 C CA  . GLU A 1 220 ? 36.472  -51.174 6.687  1.00 73.03  ? 198 GLU A CA  1 
ATOM   1543 C C   . GLU A 1 220 ? 35.456  -52.268 6.980  1.00 75.59  ? 198 GLU A C   1 
ATOM   1544 O O   . GLU A 1 220 ? 35.784  -53.451 7.049  1.00 75.28  ? 198 GLU A O   1 
ATOM   1545 C CB  . GLU A 1 220 ? 37.127  -50.703 7.974  1.00 74.71  ? 198 GLU A CB  1 
ATOM   1546 C CG  . GLU A 1 220 ? 38.328  -49.821 7.791  1.00 76.69  ? 198 GLU A CG  1 
ATOM   1547 C CD  . GLU A 1 220 ? 39.080  -49.600 9.105  1.00 96.73  ? 198 GLU A CD  1 
ATOM   1548 O OE1 . GLU A 1 220 ? 38.782  -50.306 10.113 1.00 87.90  ? 198 GLU A OE1 1 
ATOM   1549 O OE2 . GLU A 1 220 ? 39.975  -48.720 9.123  1.00 98.28  ? 198 GLU A OE2 1 
ATOM   1550 N N   . ALA A 1 221 ? 34.212  -51.860 7.158  1.00 73.31  ? 199 ALA A N   1 
ATOM   1551 C CA  . ALA A 1 221 ? 33.155  -52.819 7.331  1.00 71.83  ? 199 ALA A CA  1 
ATOM   1552 C C   . ALA A 1 221 ? 32.903  -53.502 5.996  1.00 72.08  ? 199 ALA A C   1 
ATOM   1553 O O   . ALA A 1 221 ? 32.905  -54.724 5.929  1.00 76.39  ? 199 ALA A O   1 
ATOM   1554 C CB  . ALA A 1 221 ? 31.905  -52.154 7.856  1.00 71.28  ? 199 ALA A CB  1 
ATOM   1555 N N   . ILE A 1 222 ? 32.707  -52.714 4.936  1.00 75.61  ? 200 ILE A N   1 
ATOM   1556 C CA  . ILE A 1 222 ? 32.491  -53.251 3.578  1.00 76.89  ? 200 ILE A CA  1 
ATOM   1557 C C   . ILE A 1 222 ? 33.586  -54.257 3.197  1.00 71.44  ? 200 ILE A C   1 
ATOM   1558 O O   . ILE A 1 222 ? 33.315  -55.338 2.676  1.00 67.44  ? 200 ILE A O   1 
ATOM   1559 C CB  . ILE A 1 222 ? 32.443  -52.124 2.512  1.00 72.09  ? 200 ILE A CB  1 
ATOM   1560 C CG1 . ILE A 1 222 ? 31.100  -51.414 2.551  1.00 73.89  ? 200 ILE A CG1 1 
ATOM   1561 C CG2 . ILE A 1 222 ? 32.580  -52.699 1.110  1.00 71.76  ? 200 ILE A CG2 1 
ATOM   1562 C CD1 . ILE A 1 222 ? 29.962  -52.254 1.976  1.00 77.01  ? 200 ILE A CD1 1 
ATOM   1563 N N   . ALA A 1 223 ? 34.821  -53.883 3.492  1.00 68.61  ? 201 ALA A N   1 
ATOM   1564 C CA  . ALA A 1 223 ? 35.959  -54.768 3.371  1.00 69.55  ? 201 ALA A CA  1 
ATOM   1565 C C   . ALA A 1 223 ? 35.710  -56.177 3.925  1.00 79.38  ? 201 ALA A C   1 
ATOM   1566 O O   . ALA A 1 223 ? 36.275  -57.142 3.421  1.00 85.51  ? 201 ALA A O   1 
ATOM   1567 C CB  . ALA A 1 223 ? 37.158  -54.146 4.074  1.00 69.65  ? 201 ALA A CB  1 
ATOM   1568 N N   . GLU A 1 224 ? 34.882  -56.305 4.961  1.00 76.68  ? 202 GLU A N   1 
ATOM   1569 C CA  . GLU A 1 224 ? 34.781  -57.575 5.666  1.00 75.32  ? 202 GLU A CA  1 
ATOM   1570 C C   . GLU A 1 224 ? 33.356  -58.098 5.843  1.00 76.06  ? 202 GLU A C   1 
ATOM   1571 O O   . GLU A 1 224 ? 33.048  -58.771 6.823  1.00 76.95  ? 202 GLU A O   1 
ATOM   1572 C CB  . GLU A 1 224 ? 35.447  -57.450 7.033  1.00 76.26  ? 202 GLU A CB  1 
ATOM   1573 C CG  . GLU A 1 224 ? 36.839  -56.882 6.985  1.00 76.52  ? 202 GLU A CG  1 
ATOM   1574 C CD  . GLU A 1 224 ? 37.701  -57.394 8.122  1.00 97.12  ? 202 GLU A CD  1 
ATOM   1575 O OE1 . GLU A 1 224 ? 37.313  -58.413 8.746  1.00 106.08 ? 202 GLU A OE1 1 
ATOM   1576 O OE2 . GLU A 1 224 ? 38.762  -56.784 8.400  1.00 98.29  ? 202 GLU A OE2 1 
ATOM   1577 N N   . LEU A 1 225 ? 32.494  -57.802 4.888  1.00 70.52  ? 203 LEU A N   1 
ATOM   1578 C CA  . LEU A 1 225 ? 31.135  -58.310 4.903  1.00 70.31  ? 203 LEU A CA  1 
ATOM   1579 C C   . LEU A 1 225 ? 31.091  -59.844 4.897  1.00 76.63  ? 203 LEU A C   1 
ATOM   1580 O O   . LEU A 1 225 ? 30.076  -60.445 5.234  1.00 81.73  ? 203 LEU A O   1 
ATOM   1581 C CB  . LEU A 1 225 ? 30.381  -57.745 3.708  1.00 73.62  ? 203 LEU A CB  1 
ATOM   1582 C CG  . LEU A 1 225 ? 29.024  -57.112 3.967  1.00 81.14  ? 203 LEU A CG  1 
ATOM   1583 C CD1 . LEU A 1 225 ? 29.150  -56.106 5.100  1.00 82.75  ? 203 LEU A CD1 1 
ATOM   1584 C CD2 . LEU A 1 225 ? 28.523  -56.439 2.694  1.00 77.95  ? 203 LEU A CD2 1 
ATOM   1585 N N   . ASP A 1 226 ? 32.201  -60.471 4.511  1.00 83.84  ? 204 ASP A N   1 
ATOM   1586 C CA  . ASP A 1 226 ? 32.363  -61.931 4.557  1.00 85.60  ? 204 ASP A CA  1 
ATOM   1587 C C   . ASP A 1 226 ? 32.242  -62.444 5.982  1.00 84.79  ? 204 ASP A C   1 
ATOM   1588 O O   . ASP A 1 226 ? 31.954  -63.611 6.230  1.00 84.69  ? 204 ASP A O   1 
ATOM   1589 C CB  . ASP A 1 226 ? 33.734  -62.347 3.998  1.00 82.73  ? 204 ASP A CB  1 
ATOM   1590 C CG  . ASP A 1 226 ? 33.868  -62.107 2.499  1.00 104.10 ? 204 ASP A CG  1 
ATOM   1591 O OD1 . ASP A 1 226 ? 32.835  -61.949 1.801  1.00 101.36 ? 204 ASP A OD1 1 
ATOM   1592 O OD2 . ASP A 1 226 ? 35.023  -62.092 2.013  1.00 113.57 ? 204 ASP A OD2 1 
ATOM   1593 N N   . THR A 1 227 ? 32.492  -61.532 6.908  1.00 84.09  ? 205 THR A N   1 
ATOM   1594 C CA  . THR A 1 227 ? 32.703  -61.820 8.310  1.00 80.51  ? 205 THR A CA  1 
ATOM   1595 C C   . THR A 1 227 ? 31.433  -61.533 9.109  1.00 82.31  ? 205 THR A C   1 
ATOM   1596 O O   . THR A 1 227 ? 31.225  -62.079 10.194 1.00 81.39  ? 205 THR A O   1 
ATOM   1597 C CB  . THR A 1 227 ? 33.898  -60.974 8.813  1.00 85.26  ? 205 THR A CB  1 
ATOM   1598 O OG1 . THR A 1 227 ? 35.118  -61.641 8.461  1.00 87.64  ? 205 THR A OG1 1 
ATOM   1599 C CG2 . THR A 1 227 ? 33.838  -60.670 10.329 1.00 82.55  ? 205 THR A CG2 1 
ATOM   1600 N N   . LEU A 1 228 ? 30.573  -60.682 8.554  1.00 78.61  ? 206 LEU A N   1 
ATOM   1601 C CA  . LEU A 1 228 ? 29.354  -60.297 9.234  1.00 73.22  ? 206 LEU A CA  1 
ATOM   1602 C C   . LEU A 1 228 ? 28.475  -61.517 9.356  1.00 69.87  ? 206 LEU A C   1 
ATOM   1603 O O   . LEU A 1 228 ? 28.245  -62.199 8.377  1.00 75.66  ? 206 LEU A O   1 
ATOM   1604 C CB  . LEU A 1 228 ? 28.641  -59.178 8.487  1.00 71.50  ? 206 LEU A CB  1 
ATOM   1605 C CG  . LEU A 1 228 ? 27.442  -58.621 9.244  1.00 69.63  ? 206 LEU A CG  1 
ATOM   1606 C CD1 . LEU A 1 228 ? 27.924  -58.058 10.556 1.00 71.32  ? 206 LEU A CD1 1 
ATOM   1607 C CD2 . LEU A 1 228 ? 26.710  -57.569 8.428  1.00 67.63  ? 206 LEU A CD2 1 
ATOM   1608 N N   . SER A 1 229 ? 28.010  -61.798 10.567 1.00 71.01  ? 207 SER A N   1 
ATOM   1609 C CA  . SER A 1 229 ? 27.269  -63.021 10.853 1.00 69.35  ? 207 SER A CA  1 
ATOM   1610 C C   . SER A 1 229 ? 25.795  -62.790 10.665 1.00 68.56  ? 207 SER A C   1 
ATOM   1611 O O   . SER A 1 229 ? 25.331  -61.667 10.850 1.00 67.74  ? 207 SER A O   1 
ATOM   1612 C CB  . SER A 1 229 ? 27.510  -63.469 12.279 1.00 69.65  ? 207 SER A CB  1 
ATOM   1613 O OG  . SER A 1 229 ? 26.882  -62.556 13.155 1.00 67.74  ? 207 SER A OG  1 
ATOM   1614 N N   . GLU A 1 230 ? 25.056  -63.849 10.333 1.00 70.20  ? 208 GLU A N   1 
ATOM   1615 C CA  . GLU A 1 230 ? 23.608  -63.743 10.138 1.00 73.39  ? 208 GLU A CA  1 
ATOM   1616 C C   . GLU A 1 230 ? 22.949  -63.090 11.360 1.00 69.32  ? 208 GLU A C   1 
ATOM   1617 O O   . GLU A 1 230 ? 21.992  -62.311 11.235 1.00 67.39  ? 208 GLU A O   1 
ATOM   1618 C CB  . GLU A 1 230 ? 22.983  -65.120 9.857  1.00 68.81  ? 208 GLU A CB  1 
ATOM   1619 N N   . GLU A 1 231 ? 23.496  -63.380 12.535 1.00 69.08  ? 209 GLU A N   1 
ATOM   1620 C CA  . GLU A 1 231 ? 22.926  -62.888 13.775 1.00 67.17  ? 209 GLU A CA  1 
ATOM   1621 C C   . GLU A 1 231 ? 23.095  -61.371 13.929 1.00 69.81  ? 209 GLU A C   1 
ATOM   1622 O O   . GLU A 1 231 ? 22.212  -60.722 14.478 1.00 68.57  ? 209 GLU A O   1 
ATOM   1623 C CB  . GLU A 1 231 ? 23.544  -63.619 14.959 1.00 71.57  ? 209 GLU A CB  1 
ATOM   1624 C CG  . GLU A 1 231 ? 23.187  -63.003 16.283 1.00 83.85  ? 209 GLU A CG  1 
ATOM   1625 C CD  . GLU A 1 231 ? 23.683  -63.807 17.457 1.00 102.17 ? 209 GLU A CD  1 
ATOM   1626 O OE1 . GLU A 1 231 ? 23.638  -65.060 17.385 1.00 112.10 ? 209 GLU A OE1 1 
ATOM   1627 O OE2 . GLU A 1 231 ? 24.128  -63.180 18.448 1.00 103.56 ? 209 GLU A OE2 1 
ATOM   1628 N N   . SER A 1 232 ? 24.200  -60.803 13.432 1.00 68.40  ? 210 SER A N   1 
ATOM   1629 C CA  . SER A 1 232 ? 24.423  -59.351 13.502 1.00 64.27  ? 210 SER A CA  1 
ATOM   1630 C C   . SER A 1 232 ? 23.980  -58.629 12.247 1.00 66.87  ? 210 SER A C   1 
ATOM   1631 O O   . SER A 1 232 ? 24.040  -57.405 12.181 1.00 73.10  ? 210 SER A O   1 
ATOM   1632 C CB  . SER A 1 232 ? 25.897  -59.010 13.708 1.00 63.59  ? 210 SER A CB  1 
ATOM   1633 O OG  . SER A 1 232 ? 26.425  -59.567 14.881 1.00 68.14  ? 210 SER A OG  1 
ATOM   1634 N N   . TYR A 1 233 ? 23.575  -59.379 11.235 1.00 67.30  ? 211 TYR A N   1 
ATOM   1635 C CA  . TYR A 1 233 ? 23.455  -58.822 9.890  1.00 68.09  ? 211 TYR A CA  1 
ATOM   1636 C C   . TYR A 1 233 ? 22.475  -57.647 9.762  1.00 66.46  ? 211 TYR A C   1 
ATOM   1637 O O   . TYR A 1 233 ? 22.872  -56.595 9.297  1.00 67.65  ? 211 TYR A O   1 
ATOM   1638 C CB  . TYR A 1 233 ? 23.076  -59.928 8.911  1.00 67.34  ? 211 TYR A CB  1 
ATOM   1639 C CG  . TYR A 1 233 ? 22.954  -59.467 7.485  1.00 73.35  ? 211 TYR A CG  1 
ATOM   1640 C CD1 . TYR A 1 233 ? 24.068  -59.403 6.654  1.00 72.74  ? 211 TYR A CD1 1 
ATOM   1641 C CD2 . TYR A 1 233 ? 21.719  -59.103 6.961  1.00 73.75  ? 211 TYR A CD2 1 
ATOM   1642 C CE1 . TYR A 1 233 ? 23.946  -58.989 5.341  1.00 77.44  ? 211 TYR A CE1 1 
ATOM   1643 C CE2 . TYR A 1 233 ? 21.592  -58.684 5.657  1.00 77.52  ? 211 TYR A CE2 1 
ATOM   1644 C CZ  . TYR A 1 233 ? 22.702  -58.627 4.847  1.00 77.37  ? 211 TYR A CZ  1 
ATOM   1645 O OH  . TYR A 1 233 ? 22.558  -58.202 3.541  1.00 82.18  ? 211 TYR A OH  1 
ATOM   1646 N N   . LYS A 1 234 ? 21.216  -57.813 10.169 1.00 68.07  ? 212 LYS A N   1 
ATOM   1647 C CA  . LYS A 1 234 ? 20.230  -56.742 10.001 1.00 63.24  ? 212 LYS A CA  1 
ATOM   1648 C C   . LYS A 1 234 ? 20.711  -55.467 10.694 1.00 64.30  ? 212 LYS A C   1 
ATOM   1649 O O   . LYS A 1 234 ? 20.716  -54.396 10.095 1.00 66.47  ? 212 LYS A O   1 
ATOM   1650 C CB  . LYS A 1 234 ? 18.839  -57.163 10.514 1.00 44.29  ? 212 LYS A CB  1 
ATOM   1651 N N   . ASP A 1 235 ? 21.155  -55.600 11.937 1.00 67.70  ? 213 ASP A N   1 
ATOM   1652 C CA  . ASP A 1 235 ? 21.633  -54.465 12.734 1.00 73.73  ? 213 ASP A CA  1 
ATOM   1653 C C   . ASP A 1 235 ? 22.831  -53.725 12.139 1.00 73.02  ? 213 ASP A C   1 
ATOM   1654 O O   . ASP A 1 235 ? 22.855  -52.492 12.100 1.00 70.92  ? 213 ASP A O   1 
ATOM   1655 C CB  . ASP A 1 235 ? 22.017  -54.938 14.140 1.00 77.12  ? 213 ASP A CB  1 
ATOM   1656 C CG  . ASP A 1 235 ? 20.847  -54.933 15.105 1.00 87.68  ? 213 ASP A CG  1 
ATOM   1657 O OD1 . ASP A 1 235 ? 19.873  -54.184 14.858 1.00 87.21  ? 213 ASP A OD1 1 
ATOM   1658 O OD2 . ASP A 1 235 ? 20.911  -55.677 16.117 1.00 95.98  ? 213 ASP A OD2 1 
ATOM   1659 N N   . SER A 1 236 ? 23.842  -54.482 11.719 1.00 70.07  ? 214 SER A N   1 
ATOM   1660 C CA  . SER A 1 236 ? 25.072  -53.892 11.213 1.00 70.10  ? 214 SER A CA  1 
ATOM   1661 C C   . SER A 1 236 ? 24.863  -53.192 9.879  1.00 69.32  ? 214 SER A C   1 
ATOM   1662 O O   . SER A 1 236 ? 25.399  -52.113 9.643  1.00 69.10  ? 214 SER A O   1 
ATOM   1663 C CB  . SER A 1 236 ? 26.159  -54.957 11.076 1.00 64.70  ? 214 SER A CB  1 
ATOM   1664 O OG  . SER A 1 236 ? 26.890  -55.078 12.276 1.00 66.15  ? 214 SER A OG  1 
ATOM   1665 N N   . THR A 1 237 ? 24.082  -53.816 9.010  1.00 63.07  ? 215 THR A N   1 
ATOM   1666 C CA  . THR A 1 237 ? 23.888  -53.284 7.686  1.00 65.13  ? 215 THR A CA  1 
ATOM   1667 C C   . THR A 1 237 ? 22.997  -52.056 7.758  1.00 69.50  ? 215 THR A C   1 
ATOM   1668 O O   . THR A 1 237 ? 23.104  -51.160 6.928  1.00 73.61  ? 215 THR A O   1 
ATOM   1669 C CB  . THR A 1 237 ? 23.287  -54.327 6.724  1.00 63.65  ? 215 THR A CB  1 
ATOM   1670 O OG1 . THR A 1 237 ? 22.054  -54.817 7.240  1.00 72.11  ? 215 THR A OG1 1 
ATOM   1671 C CG2 . THR A 1 237 ? 24.224  -55.496 6.559  1.00 67.29  ? 215 THR A CG2 1 
ATOM   1672 N N   . LEU A 1 238 ? 22.127  -51.997 8.758  1.00 70.72  ? 216 LEU A N   1 
ATOM   1673 C CA  . LEU A 1 238 ? 21.276  -50.822 8.930  1.00 69.02  ? 216 LEU A CA  1 
ATOM   1674 C C   . LEU A 1 238 ? 22.113  -49.627 9.351  1.00 71.08  ? 216 LEU A C   1 
ATOM   1675 O O   . LEU A 1 238 ? 21.879  -48.510 8.898  1.00 77.14  ? 216 LEU A O   1 
ATOM   1676 C CB  . LEU A 1 238 ? 20.181  -51.080 9.955  1.00 72.27  ? 216 LEU A CB  1 
ATOM   1677 C CG  . LEU A 1 238 ? 19.564  -49.822 10.567 1.00 73.89  ? 216 LEU A CG  1 
ATOM   1678 C CD1 . LEU A 1 238 ? 18.744  -49.071 9.558  1.00 64.66  ? 216 LEU A CD1 1 
ATOM   1679 C CD2 . LEU A 1 238 ? 18.746  -50.151 11.804 1.00 71.62  ? 216 LEU A CD2 1 
ATOM   1680 N N   . ILE A 1 239 ? 23.088  -49.871 10.219 1.00 69.17  ? 217 ILE A N   1 
ATOM   1681 C CA  . ILE A 1 239 ? 23.993  -48.833 10.698 1.00 66.34  ? 217 ILE A CA  1 
ATOM   1682 C C   . ILE A 1 239 ? 24.924  -48.417 9.577  1.00 69.01  ? 217 ILE A C   1 
ATOM   1683 O O   . ILE A 1 239 ? 25.220  -47.236 9.401  1.00 71.97  ? 217 ILE A O   1 
ATOM   1684 C CB  . ILE A 1 239 ? 24.812  -49.324 11.929 1.00 71.57  ? 217 ILE A CB  1 
ATOM   1685 C CG1 . ILE A 1 239 ? 23.857  -49.677 13.080 1.00 63.99  ? 217 ILE A CG1 1 
ATOM   1686 C CG2 . ILE A 1 239 ? 25.863  -48.291 12.351 1.00 67.55  ? 217 ILE A CG2 1 
ATOM   1687 C CD1 . ILE A 1 239 ? 24.527  -50.062 14.341 1.00 60.54  ? 217 ILE A CD1 1 
ATOM   1688 N N   . MET A 1 240 ? 25.382  -49.393 8.804  1.00 70.84  ? 218 MET A N   1 
ATOM   1689 C CA  . MET A 1 240 ? 26.236  -49.091 7.671  1.00 68.37  ? 218 MET A CA  1 
ATOM   1690 C C   . MET A 1 240 ? 25.467  -48.213 6.710  1.00 71.68  ? 218 MET A C   1 
ATOM   1691 O O   . MET A 1 240 ? 25.990  -47.237 6.190  1.00 74.23  ? 218 MET A O   1 
ATOM   1692 C CB  . MET A 1 240 ? 26.706  -50.366 6.988  1.00 66.19  ? 218 MET A CB  1 
ATOM   1693 C CG  . MET A 1 240 ? 27.815  -51.054 7.735  1.00 72.46  ? 218 MET A CG  1 
ATOM   1694 S SD  . MET A 1 240 ? 28.257  -52.648 7.023  1.00 75.75  ? 218 MET A SD  1 
ATOM   1695 C CE  . MET A 1 240 ? 28.866  -52.120 5.426  1.00 81.58  ? 218 MET A CE  1 
ATOM   1696 N N   . GLN A 1 241 ? 24.205  -48.553 6.495  1.00 71.40  ? 219 GLN A N   1 
ATOM   1697 C CA  . GLN A 1 241 ? 23.388  -47.787 5.583  1.00 72.09  ? 219 GLN A CA  1 
ATOM   1698 C C   . GLN A 1 241 ? 23.223  -46.342 6.043  1.00 74.06  ? 219 GLN A C   1 
ATOM   1699 O O   . GLN A 1 241 ? 23.197  -45.424 5.230  1.00 76.03  ? 219 GLN A O   1 
ATOM   1700 C CB  . GLN A 1 241 ? 22.027  -48.435 5.421  1.00 73.39  ? 219 GLN A CB  1 
ATOM   1701 C CG  . GLN A 1 241 ? 21.090  -47.587 4.611  1.00 76.40  ? 219 GLN A CG  1 
ATOM   1702 C CD  . GLN A 1 241 ? 19.780  -48.259 4.372  1.00 77.13  ? 219 GLN A CD  1 
ATOM   1703 O OE1 . GLN A 1 241 ? 18.745  -47.727 4.735  1.00 84.85  ? 219 GLN A OE1 1 
ATOM   1704 N NE2 . GLN A 1 241 ? 19.809  -49.438 3.747  1.00 80.11  ? 219 GLN A NE2 1 
ATOM   1705 N N   . LEU A 1 242 ? 23.119  -46.131 7.345  1.00 70.07  ? 220 LEU A N   1 
ATOM   1706 C CA  . LEU A 1 242 ? 22.987  -44.776 7.850  1.00 71.29  ? 220 LEU A CA  1 
ATOM   1707 C C   . LEU A 1 242 ? 24.299  -44.022 7.670  1.00 71.64  ? 220 LEU A C   1 
ATOM   1708 O O   . LEU A 1 242 ? 24.288  -42.865 7.246  1.00 71.49  ? 220 LEU A O   1 
ATOM   1709 C CB  . LEU A 1 242 ? 22.554  -44.780 9.322  1.00 68.59  ? 220 LEU A CB  1 
ATOM   1710 C CG  . LEU A 1 242 ? 21.163  -45.363 9.575  1.00 66.69  ? 220 LEU A CG  1 
ATOM   1711 C CD1 . LEU A 1 242 ? 21.014  -45.604 11.051 1.00 77.87  ? 220 LEU A CD1 1 
ATOM   1712 C CD2 . LEU A 1 242 ? 20.042  -44.472 9.068  1.00 54.17  ? 220 LEU A CD2 1 
ATOM   1713 N N   . LEU A 1 243 ? 25.418  -44.669 8.005  1.00 68.29  ? 221 LEU A N   1 
ATOM   1714 C CA  . LEU A 1 243 ? 26.733  -44.065 7.790  1.00 71.11  ? 221 LEU A CA  1 
ATOM   1715 C C   . LEU A 1 243 ? 26.847  -43.564 6.339  1.00 78.70  ? 221 LEU A C   1 
ATOM   1716 O O   . LEU A 1 243 ? 27.198  -42.409 6.088  1.00 79.71  ? 221 LEU A O   1 
ATOM   1717 C CB  . LEU A 1 243 ? 27.852  -45.059 8.086  1.00 63.57  ? 221 LEU A CB  1 
ATOM   1718 C CG  . LEU A 1 243 ? 28.199  -45.383 9.526  1.00 71.03  ? 221 LEU A CG  1 
ATOM   1719 C CD1 . LEU A 1 243 ? 29.029  -46.661 9.595  1.00 69.63  ? 221 LEU A CD1 1 
ATOM   1720 C CD2 . LEU A 1 243 ? 28.947  -44.230 10.164 1.00 70.12  ? 221 LEU A CD2 1 
ATOM   1721 N N   . ARG A 1 244 ? 26.518  -44.436 5.392  1.00 72.56  ? 222 ARG A N   1 
ATOM   1722 C CA  . ARG A 1 244 ? 26.616  -44.111 3.986  1.00 73.86  ? 222 ARG A CA  1 
ATOM   1723 C C   . ARG A 1 244 ? 25.586  -43.064 3.538  1.00 79.07  ? 222 ARG A C   1 
ATOM   1724 O O   . ARG A 1 244 ? 25.918  -42.176 2.746  1.00 81.92  ? 222 ARG A O   1 
ATOM   1725 C CB  . ARG A 1 244 ? 26.470  -45.382 3.155  1.00 77.19  ? 222 ARG A CB  1 
ATOM   1726 C CG  . ARG A 1 244 ? 26.701  -45.178 1.682  1.00 75.13  ? 222 ARG A CG  1 
ATOM   1727 C CD  . ARG A 1 244 ? 28.117  -44.684 1.404  1.00 75.62  ? 222 ARG A CD  1 
ATOM   1728 N NE  . ARG A 1 244 ? 28.312  -44.427 -0.019 1.00 79.66  ? 222 ARG A NE  1 
ATOM   1729 C CZ  . ARG A 1 244 ? 28.039  -43.273 -0.614 1.00 77.06  ? 222 ARG A CZ  1 
ATOM   1730 N NH1 . ARG A 1 244 ? 27.589  -42.255 0.095  1.00 80.42  ? 222 ARG A NH1 1 
ATOM   1731 N NH2 . ARG A 1 244 ? 28.238  -43.128 -1.913 1.00 77.21  ? 222 ARG A NH2 1 
ATOM   1732 N N   . ASP A 1 245 ? 24.348  -43.164 4.030  1.00 79.84  ? 223 ASP A N   1 
ATOM   1733 C CA  . ASP A 1 245 ? 23.322  -42.152 3.743  1.00 75.07  ? 223 ASP A CA  1 
ATOM   1734 C C   . ASP A 1 245 ? 23.797  -40.792 4.254  1.00 77.47  ? 223 ASP A C   1 
ATOM   1735 O O   . ASP A 1 245 ? 23.591  -39.768 3.610  1.00 84.05  ? 223 ASP A O   1 
ATOM   1736 C CB  . ASP A 1 245 ? 21.979  -42.525 4.369  1.00 62.29  ? 223 ASP A CB  1 
ATOM   1737 C CG  . ASP A 1 245 ? 21.166  -43.469 3.504  1.00 76.46  ? 223 ASP A CG  1 
ATOM   1738 O OD1 . ASP A 1 245 ? 21.663  -43.927 2.454  1.00 78.00  ? 223 ASP A OD1 1 
ATOM   1739 O OD2 . ASP A 1 245 ? 20.021  -43.789 3.887  1.00 85.63  ? 223 ASP A OD2 1 
ATOM   1740 N N   . ASN A 1 246 ? 24.470  -40.787 5.395  1.00 72.14  ? 224 ASN A N   1 
ATOM   1741 C CA  . ASN A 1 246 ? 25.006  -39.546 5.920  1.00 79.17  ? 224 ASN A CA  1 
ATOM   1742 C C   . ASN A 1 246 ? 26.059  -38.953 4.992  1.00 83.92  ? 224 ASN A C   1 
ATOM   1743 O O   . ASN A 1 246 ? 26.022  -37.755 4.704  1.00 84.92  ? 224 ASN A O   1 
ATOM   1744 C CB  . ASN A 1 246 ? 25.590  -39.753 7.318  1.00 79.96  ? 224 ASN A CB  1 
ATOM   1745 C CG  . ASN A 1 246 ? 24.543  -39.610 8.413  1.00 78.59  ? 224 ASN A CG  1 
ATOM   1746 O OD1 . ASN A 1 246 ? 23.341  -39.599 8.146  1.00 79.68  ? 224 ASN A OD1 1 
ATOM   1747 N ND2 . ASN A 1 246 ? 24.998  -39.497 9.652  1.00 80.93  ? 224 ASN A ND2 1 
ATOM   1748 N N   . LEU A 1 247 ? 26.980  -39.793 4.513  1.00 83.85  ? 225 LEU A N   1 
ATOM   1749 C CA  . LEU A 1 247 ? 28.083  -39.329 3.672  1.00 80.16  ? 225 LEU A CA  1 
ATOM   1750 C C   . LEU A 1 247 ? 27.578  -38.648 2.402  1.00 84.50  ? 225 LEU A C   1 
ATOM   1751 O O   . LEU A 1 247 ? 28.096  -37.595 2.033  1.00 87.79  ? 225 LEU A O   1 
ATOM   1752 C CB  . LEU A 1 247 ? 29.023  -40.478 3.322  1.00 72.34  ? 225 LEU A CB  1 
ATOM   1753 C CG  . LEU A 1 247 ? 29.946  -40.876 4.481  1.00 82.53  ? 225 LEU A CG  1 
ATOM   1754 C CD1 . LEU A 1 247 ? 30.822  -42.067 4.124  1.00 76.77  ? 225 LEU A CD1 1 
ATOM   1755 C CD2 . LEU A 1 247 ? 30.808  -39.709 4.955  1.00 80.25  ? 225 LEU A CD2 1 
ATOM   1756 N N   . THR A 1 248 ? 26.568  -39.219 1.747  1.00 76.31  ? 226 THR A N   1 
ATOM   1757 C CA  . THR A 1 248 ? 25.963  -38.537 0.615  1.00 75.00  ? 226 THR A CA  1 
ATOM   1758 C C   . THR A 1 248 ? 25.572  -37.124 1.005  1.00 86.57  ? 226 THR A C   1 
ATOM   1759 O O   . THR A 1 248 ? 25.988  -36.167 0.365  1.00 92.89  ? 226 THR A O   1 
ATOM   1760 C CB  . THR A 1 248 ? 24.718  -39.233 0.103  1.00 78.59  ? 226 THR A CB  1 
ATOM   1761 O OG1 . THR A 1 248 ? 25.032  -40.565 -0.311 1.00 81.20  ? 226 THR A OG1 1 
ATOM   1762 C CG2 . THR A 1 248 ? 24.151  -38.471 -1.070 1.00 77.92  ? 226 THR A CG2 1 
ATOM   1763 N N   . LEU A 1 249 ? 24.788  -36.997 2.072  1.00 91.66  ? 227 LEU A N   1 
ATOM   1764 C CA  . LEU A 1 249 ? 24.312  -35.688 2.528  1.00 95.40  ? 227 LEU A CA  1 
ATOM   1765 C C   . LEU A 1 249 ? 25.474  -34.757 2.848  1.00 92.42  ? 227 LEU A C   1 
ATOM   1766 O O   . LEU A 1 249 ? 25.539  -33.656 2.322  1.00 99.27  ? 227 LEU A O   1 
ATOM   1767 C CB  . LEU A 1 249 ? 23.385  -35.838 3.743  1.00 90.07  ? 227 LEU A CB  1 
ATOM   1768 C CG  . LEU A 1 249 ? 22.186  -36.737 3.394  1.00 98.43  ? 227 LEU A CG  1 
ATOM   1769 C CD1 . LEU A 1 249 ? 21.326  -37.078 4.613  1.00 97.63  ? 227 LEU A CD1 1 
ATOM   1770 C CD2 . LEU A 1 249 ? 21.334  -36.137 2.258  1.00 97.28  ? 227 LEU A CD2 1 
ATOM   1771 N N   . TRP A 1 250 ? 26.417  -35.215 3.661  1.00 89.76  ? 228 TRP A N   1 
ATOM   1772 C CA  . TRP A 1 250 ? 27.555  -34.389 4.063  1.00 89.48  ? 228 TRP A CA  1 
ATOM   1773 C C   . TRP A 1 250 ? 28.510  -34.052 2.907  1.00 96.35  ? 228 TRP A C   1 
ATOM   1774 O O   . TRP A 1 250 ? 29.605  -33.534 3.135  1.00 97.27  ? 228 TRP A O   1 
ATOM   1775 C CB  . TRP A 1 250 ? 28.338  -35.091 5.181  1.00 89.43  ? 228 TRP A CB  1 
ATOM   1776 C CG  . TRP A 1 250 ? 27.553  -35.322 6.465  1.00 89.99  ? 228 TRP A CG  1 
ATOM   1777 C CD1 . TRP A 1 250 ? 26.395  -34.706 6.847  1.00 87.85  ? 228 TRP A CD1 1 
ATOM   1778 C CD2 . TRP A 1 250 ? 27.883  -36.239 7.519  1.00 86.20  ? 228 TRP A CD2 1 
ATOM   1779 N NE1 . TRP A 1 250 ? 25.994  -35.174 8.070  1.00 81.86  ? 228 TRP A NE1 1 
ATOM   1780 C CE2 . TRP A 1 250 ? 26.888  -36.117 8.502  1.00 85.11  ? 228 TRP A CE2 1 
ATOM   1781 C CE3 . TRP A 1 250 ? 28.926  -37.148 7.724  1.00 86.34  ? 228 TRP A CE3 1 
ATOM   1782 C CZ2 . TRP A 1 250 ? 26.904  -36.875 9.673  1.00 87.17  ? 228 TRP A CZ2 1 
ATOM   1783 C CZ3 . TRP A 1 250 ? 28.939  -37.895 8.883  1.00 86.01  ? 228 TRP A CZ3 1 
ATOM   1784 C CH2 . TRP A 1 250 ? 27.934  -37.758 9.842  1.00 85.82  ? 228 TRP A CH2 1 
ATOM   1785 N N   . THR A 1 251 ? 28.086  -34.339 1.676  1.00 100.46 ? 229 THR A N   1 
ATOM   1786 C CA  . THR A 1 251 ? 28.913  -34.152 0.479  1.00 102.82 ? 229 THR A CA  1 
ATOM   1787 C C   . THR A 1 251 ? 28.186  -33.360 -0.624 1.00 109.15 ? 229 THR A C   1 
ATOM   1788 O O   . THR A 1 251 ? 28.582  -32.236 -0.959 1.00 111.10 ? 229 THR A O   1 
ATOM   1789 C CB  . THR A 1 251 ? 29.357  -35.513 -0.093 1.00 96.13  ? 229 THR A CB  1 
ATOM   1790 O OG1 . THR A 1 251 ? 30.357  -36.083 0.760  1.00 84.30  ? 229 THR A OG1 1 
ATOM   1791 C CG2 . THR A 1 251 ? 29.912  -35.354 -1.499 1.00 102.89 ? 229 THR A CG2 1 
ATOM   1792 N N   . SER A 1 252 ? 27.126  -33.955 -1.176 1.00 109.13 ? 230 SER A N   1 
ATOM   1793 C CA  . SER A 1 252 ? 26.328  -33.327 -2.232 1.00 115.64 ? 230 SER A CA  1 
ATOM   1794 C C   . SER A 1 252 ? 25.580  -32.091 -1.726 1.00 116.97 ? 230 SER A C   1 
ATOM   1795 O O   . SER A 1 252 ? 26.175  -31.180 -1.146 1.00 116.80 ? 230 SER A O   1 
ATOM   1796 C CB  . SER A 1 252 ? 25.332  -34.338 -2.818 1.00 108.58 ? 230 SER A CB  1 
ATOM   1797 N N   . ARG A 1 259 ? 14.264  -41.979 12.378 1.00 122.77 ? 237 ARG A N   1 
ATOM   1798 C CA  . ARG A 1 259 ? 15.105  -42.432 13.485 1.00 118.90 ? 237 ARG A CA  1 
ATOM   1799 C C   . ARG A 1 259 ? 14.647  -43.789 14.030 1.00 115.37 ? 237 ARG A C   1 
ATOM   1800 O O   . ARG A 1 259 ? 14.280  -43.904 15.203 1.00 115.12 ? 237 ARG A O   1 
ATOM   1801 C CB  . ARG A 1 259 ? 15.120  -41.393 14.613 1.00 108.25 ? 237 ARG A CB  1 
ATOM   1802 N N   . SER A 1 260 ? 14.682  -44.816 13.177 1.00 115.93 ? 238 SER A N   1 
ATOM   1803 C CA  . SER A 1 260 ? 14.421  -46.198 13.602 1.00 116.43 ? 238 SER A CA  1 
ATOM   1804 C C   . SER A 1 260 ? 15.662  -46.784 14.291 1.00 110.41 ? 238 SER A C   1 
ATOM   1805 O O   . SER A 1 260 ? 15.830  -48.004 14.414 1.00 105.37 ? 238 SER A O   1 
ATOM   1806 C CB  . SER A 1 260 ? 13.996  -47.067 12.409 1.00 112.35 ? 238 SER A CB  1 
ATOM   1807 O OG  . SER A 1 260 ? 15.036  -47.199 11.457 1.00 105.30 ? 238 SER A OG  1 
ATOM   1808 N N   . MET A 1 261 ? 16.523  -45.877 14.733 1.00 101.24 ? 239 MET A N   1 
ATOM   1809 C CA  . MET A 1 261 ? 17.697  -46.192 15.513 1.00 98.93  ? 239 MET A CA  1 
ATOM   1810 C C   . MET A 1 261 ? 17.334  -46.293 17.019 1.00 101.88 ? 239 MET A C   1 
ATOM   1811 O O   . MET A 1 261 ? 18.152  -46.698 17.866 1.00 92.11  ? 239 MET A O   1 
ATOM   1812 C CB  . MET A 1 261 ? 18.755  -45.117 15.256 1.00 96.06  ? 239 MET A CB  1 
ATOM   1813 C CG  . MET A 1 261 ? 20.173  -45.596 15.411 1.00 94.06  ? 239 MET A CG  1 
ATOM   1814 S SD  . MET A 1 261 ? 20.513  -47.035 14.379 1.00 89.64  ? 239 MET A SD  1 
ATOM   1815 C CE  . MET A 1 261 ? 22.101  -47.452 15.085 1.00 82.03  ? 239 MET A CE  1 
ATOM   1816 N N   . GLU A 1 262 ? 16.089  -45.934 17.330 1.00 101.69 ? 240 GLU A N   1 
ATOM   1817 C CA  . GLU A 1 262 ? 15.589  -45.946 18.697 1.00 98.01  ? 240 GLU A CA  1 
ATOM   1818 C C   . GLU A 1 262 ? 15.162  -47.345 19.172 1.00 90.94  ? 240 GLU A C   1 
ATOM   1819 O O   . GLU A 1 262 ? 14.831  -47.531 20.331 1.00 84.83  ? 240 GLU A O   1 
ATOM   1820 C CB  . GLU A 1 262 ? 14.410  -44.970 18.833 1.00 102.57 ? 240 GLU A CB  1 
ATOM   1821 C CG  . GLU A 1 262 ? 14.795  -43.490 18.960 1.00 102.05 ? 240 GLU A CG  1 
ATOM   1822 C CD  . GLU A 1 262 ? 13.668  -42.628 19.555 1.00 102.40 ? 240 GLU A CD  1 
ATOM   1823 O OE1 . GLU A 1 262 ? 12.485  -43.027 19.455 1.00 109.12 ? 240 GLU A OE1 1 
ATOM   1824 O OE2 . GLU A 1 262 ? 13.964  -41.556 20.131 1.00 101.21 ? 240 GLU A OE2 1 
ATOM   1825 N N   . VAL A 1 263 ? 15.167  -48.324 18.280 1.00 89.85  ? 241 VAL A N   1 
ATOM   1826 C CA  . VAL A 1 263 ? 14.784  -49.685 18.647 1.00 90.59  ? 241 VAL A CA  1 
ATOM   1827 C C   . VAL A 1 263 ? 16.017  -50.594 18.704 1.00 88.85  ? 241 VAL A C   1 
ATOM   1828 O O   . VAL A 1 263 ? 15.951  -51.752 19.149 1.00 81.29  ? 241 VAL A O   1 
ATOM   1829 C CB  . VAL A 1 263 ? 13.746  -50.250 17.647 1.00 98.81  ? 241 VAL A CB  1 
ATOM   1830 C CG1 . VAL A 1 263 ? 13.105  -51.538 18.170 1.00 99.55  ? 241 VAL A CG1 1 
ATOM   1831 C CG2 . VAL A 1 263 ? 12.675  -49.205 17.376 1.00 96.82  ? 241 VAL A CG2 1 
ATOM   1832 N N   . VAL A 1 264 ? 17.148  -50.060 18.247 1.00 87.72  ? 242 VAL A N   1 
ATOM   1833 C CA  . VAL A 1 264 ? 18.403  -50.791 18.333 1.00 85.90  ? 242 VAL A CA  1 
ATOM   1834 C C   . VAL A 1 264 ? 19.252  -50.194 19.459 1.00 83.63  ? 242 VAL A C   1 
ATOM   1835 O O   . VAL A 1 264 ? 19.267  -48.975 19.659 1.00 89.00  ? 242 VAL A O   1 
ATOM   1836 C CB  . VAL A 1 264 ? 19.181  -50.785 16.982 1.00 81.00  ? 242 VAL A CB  1 
ATOM   1837 C CG1 . VAL A 1 264 ? 18.280  -51.203 15.852 1.00 76.19  ? 242 VAL A CG1 1 
ATOM   1838 C CG2 . VAL A 1 264 ? 19.721  -49.440 16.699 1.00 87.72  ? 242 VAL A CG2 1 
ATOM   1839 N N   . PRO A 1 265 ? 19.925  -51.063 20.228 1.00 76.65  ? 243 PRO A N   1 
ATOM   1840 C CA  . PRO A 1 265 ? 20.739  -50.660 21.381 1.00 78.25  ? 243 PRO A CA  1 
ATOM   1841 C C   . PRO A 1 265 ? 22.029  -49.930 21.012 1.00 75.90  ? 243 PRO A C   1 
ATOM   1842 O O   . PRO A 1 265 ? 22.565  -49.161 21.819 1.00 76.08  ? 243 PRO A O   1 
ATOM   1843 C CB  . PRO A 1 265 ? 21.059  -51.999 22.064 1.00 78.47  ? 243 PRO A CB  1 
ATOM   1844 C CG  . PRO A 1 265 ? 20.871  -53.029 21.011 1.00 73.55  ? 243 PRO A CG  1 
ATOM   1845 C CD  . PRO A 1 265 ? 19.768  -52.524 20.148 1.00 76.72  ? 243 PRO A CD  1 
ATOM   1846 N N   . TYR A 1 266 ? 22.508  -50.169 19.797 1.00 77.46  ? 244 TYR A N   1 
ATOM   1847 C CA  . TYR A 1 266 ? 23.808  -49.670 19.346 1.00 75.91  ? 244 TYR A CA  1 
ATOM   1848 C C   . TYR A 1 266 ? 23.746  -48.250 18.801 1.00 76.92  ? 244 TYR A C   1 
ATOM   1849 O O   . TYR A 1 266 ? 24.626  -47.442 19.091 1.00 79.61  ? 244 TYR A O   1 
ATOM   1850 C CB  . TYR A 1 266 ? 24.372  -50.610 18.288 1.00 73.96  ? 244 TYR A CB  1 
ATOM   1851 C CG  . TYR A 1 266 ? 24.183  -52.061 18.660 1.00 73.74  ? 244 TYR A CG  1 
ATOM   1852 C CD1 . TYR A 1 266 ? 24.864  -52.597 19.741 1.00 73.11  ? 244 TYR A CD1 1 
ATOM   1853 C CD2 . TYR A 1 266 ? 23.317  -52.891 17.947 1.00 69.64  ? 244 TYR A CD2 1 
ATOM   1854 C CE1 . TYR A 1 266 ? 24.702  -53.909 20.109 1.00 73.14  ? 244 TYR A CE1 1 
ATOM   1855 C CE2 . TYR A 1 266 ? 23.151  -54.217 18.308 1.00 70.82  ? 244 TYR A CE2 1 
ATOM   1856 C CZ  . TYR A 1 266 ? 23.853  -54.714 19.396 1.00 75.28  ? 244 TYR A CZ  1 
ATOM   1857 O OH  . TYR A 1 266 ? 23.722  -56.016 19.799 1.00 80.37  ? 244 TYR A OH  1 
ATOM   1858 N N   . SER B 1 15  ? 8.108   -26.785 44.064 1.00 115.75 ? -7  SER B N   1 
ATOM   1859 C CA  . SER B 1 15  ? 6.954   -27.470 44.633 1.00 120.41 ? -7  SER B CA  1 
ATOM   1860 C C   . SER B 1 15  ? 6.118   -26.518 45.499 1.00 118.18 ? -7  SER B C   1 
ATOM   1861 O O   . SER B 1 15  ? 5.185   -25.859 45.020 1.00 108.19 ? -7  SER B O   1 
ATOM   1862 C CB  . SER B 1 15  ? 7.409   -28.692 45.450 1.00 115.17 ? -7  SER B CB  1 
ATOM   1863 N N   . LEU B 1 16  ? 6.454   -26.459 46.783 1.00 117.48 ? -6  LEU B N   1 
ATOM   1864 C CA  . LEU B 1 16  ? 5.759   -25.580 47.705 1.00 105.22 ? -6  LEU B CA  1 
ATOM   1865 C C   . LEU B 1 16  ? 6.491   -24.238 47.766 1.00 105.75 ? -6  LEU B C   1 
ATOM   1866 O O   . LEU B 1 16  ? 6.060   -23.317 48.454 1.00 103.63 ? -6  LEU B O   1 
ATOM   1867 C CB  . LEU B 1 16  ? 5.653   -26.235 49.095 1.00 102.06 ? -6  LEU B CB  1 
ATOM   1868 C CG  . LEU B 1 16  ? 6.893   -26.975 49.625 1.00 108.36 ? -6  LEU B CG  1 
ATOM   1869 C CD1 . LEU B 1 16  ? 7.795   -26.026 50.405 1.00 106.18 ? -6  LEU B CD1 1 
ATOM   1870 C CD2 . LEU B 1 16  ? 6.541   -28.209 50.471 1.00 106.16 ? -6  LEU B CD2 1 
ATOM   1871 N N   . TYR B 1 17  ? 7.580   -24.118 47.008 1.00 105.11 ? -5  TYR B N   1 
ATOM   1872 C CA  . TYR B 1 17  ? 8.474   -22.969 47.127 1.00 95.48  ? -5  TYR B CA  1 
ATOM   1873 C C   . TYR B 1 17  ? 8.139   -21.850 46.127 1.00 95.26  ? -5  TYR B C   1 
ATOM   1874 O O   . TYR B 1 17  ? 9.025   -21.076 45.730 1.00 91.29  ? -5  TYR B O   1 
ATOM   1875 C CB  . TYR B 1 17  ? 9.926   -23.428 46.949 1.00 91.05  ? -5  TYR B CB  1 
ATOM   1876 N N   . LYS B 1 18  ? 6.858   -21.768 45.742 1.00 98.68  ? -4  LYS B N   1 
ATOM   1877 C CA  . LYS B 1 18  ? 6.359   -20.820 44.724 1.00 85.72  ? -4  LYS B CA  1 
ATOM   1878 C C   . LYS B 1 18  ? 5.227   -19.940 45.231 1.00 79.72  ? -4  LYS B C   1 
ATOM   1879 O O   . LYS B 1 18  ? 4.314   -20.417 45.894 1.00 86.76  ? -4  LYS B O   1 
ATOM   1880 C CB  . LYS B 1 18  ? 5.877   -21.570 43.472 1.00 83.55  ? -4  LYS B CB  1 
ATOM   1881 C CG  . LYS B 1 18  ? 6.989   -22.230 42.689 1.00 89.04  ? -4  LYS B CG  1 
ATOM   1882 C CD  . LYS B 1 18  ? 6.579   -22.480 41.278 1.00 86.37  ? -4  LYS B CD  1 
ATOM   1883 C CE  . LYS B 1 18  ? 7.714   -22.165 40.326 1.00 89.04  ? -4  LYS B CE  1 
ATOM   1884 N NZ  . LYS B 1 18  ? 8.488   -23.385 39.971 1.00 93.02  ? -4  LYS B NZ  1 
ATOM   1885 N N   . LYS B 1 19  ? 5.283   -18.653 44.910 1.00 83.92  ? -3  LYS B N   1 
ATOM   1886 C CA  . LYS B 1 19  ? 4.248   -17.708 45.339 1.00 80.92  ? -3  LYS B CA  1 
ATOM   1887 C C   . LYS B 1 19  ? 3.117   -17.722 44.305 1.00 80.60  ? -3  LYS B C   1 
ATOM   1888 O O   . LYS B 1 19  ? 3.347   -18.078 43.152 1.00 83.11  ? -3  LYS B O   1 
ATOM   1889 C CB  . LYS B 1 19  ? 4.840   -16.294 45.519 1.00 66.04  ? -3  LYS B CB  1 
ATOM   1890 N N   . ALA B 1 20  ? 1.910   -17.321 44.695 1.00 78.32  ? -2  ALA B N   1 
ATOM   1891 C CA  . ALA B 1 20  ? 0.748   -17.399 43.802 1.00 79.31  ? -2  ALA B CA  1 
ATOM   1892 C C   . ALA B 1 20  ? 0.825   -16.495 42.549 1.00 80.31  ? -2  ALA B C   1 
ATOM   1893 O O   . ALA B 1 20  ? -0.198  -16.167 41.970 1.00 79.82  ? -2  ALA B O   1 
ATOM   1894 C CB  . ALA B 1 20  ? -0.542  -17.094 44.593 1.00 76.63  ? -2  ALA B CB  1 
ATOM   1895 N N   . GLY B 1 21  ? 2.023   -16.091 42.135 1.00 84.13  ? -1  GLY B N   1 
ATOM   1896 C CA  . GLY B 1 21  ? 2.228   -15.552 40.801 1.00 80.89  ? -1  GLY B CA  1 
ATOM   1897 C C   . GLY B 1 21  ? 2.329   -16.709 39.799 1.00 93.36  ? -1  GLY B C   1 
ATOM   1898 O O   . GLY B 1 21  ? 3.399   -16.984 39.253 1.00 93.51  ? -1  GLY B O   1 
ATOM   1899 N N   . LEU B 1 22  ? 1.217   -17.413 39.575 1.00 94.04  ? 0   LEU B N   1 
ATOM   1900 C CA  . LEU B 1 22  ? 1.153   -18.475 38.567 1.00 85.52  ? 0   LEU B CA  1 
ATOM   1901 C C   . LEU B 1 22  ? 0.444   -17.990 37.299 1.00 92.93  ? 0   LEU B C   1 
ATOM   1902 O O   . LEU B 1 22  ? 0.215   -16.790 37.143 1.00 99.04  ? 0   LEU B O   1 
ATOM   1903 C CB  . LEU B 1 22  ? 0.464   -19.729 39.131 1.00 92.53  ? 0   LEU B CB  1 
ATOM   1904 C CG  . LEU B 1 22  ? -0.974  -19.892 39.672 1.00 87.46  ? 0   LEU B CG  1 
ATOM   1905 C CD1 . LEU B 1 22  ? -1.331  -18.969 40.827 1.00 87.52  ? 0   LEU B CD1 1 
ATOM   1906 C CD2 . LEU B 1 22  ? -2.023  -19.803 38.568 1.00 96.78  ? 0   LEU B CD2 1 
ATOM   1907 N N   . MET B 1 23  ? 0.098   -18.907 36.390 1.00 96.16  ? 1   MET B N   1 
ATOM   1908 C CA  . MET B 1 23  ? -0.326  -18.499 35.040 1.00 89.95  ? 1   MET B CA  1 
ATOM   1909 C C   . MET B 1 23  ? -1.824  -18.286 34.881 1.00 88.15  ? 1   MET B C   1 
ATOM   1910 O O   . MET B 1 23  ? -2.632  -19.082 35.356 1.00 89.93  ? 1   MET B O   1 
ATOM   1911 C CB  . MET B 1 23  ? 0.146   -19.520 34.003 1.00 86.62  ? 1   MET B CB  1 
ATOM   1912 C CG  . MET B 1 23  ? 1.453   -20.206 34.357 1.00 95.44  ? 1   MET B CG  1 
ATOM   1913 S SD  . MET B 1 23  ? 2.119   -21.308 33.075 1.00 97.90  ? 1   MET B SD  1 
ATOM   1914 C CE  . MET B 1 23  ? 2.540   -20.107 31.825 1.00 92.62  ? 1   MET B CE  1 
ATOM   1915 N N   . ASP B 1 24  ? -2.182  -17.205 34.195 1.00 85.26  ? 2   ASP B N   1 
ATOM   1916 C CA  . ASP B 1 24  ? -3.582  -16.896 33.930 1.00 89.35  ? 2   ASP B CA  1 
ATOM   1917 C C   . ASP B 1 24  ? -4.108  -17.676 32.721 1.00 92.96  ? 2   ASP B C   1 
ATOM   1918 O O   . ASP B 1 24  ? -3.316  -18.286 31.997 1.00 90.39  ? 2   ASP B O   1 
ATOM   1919 C CB  . ASP B 1 24  ? -3.757  -15.398 33.704 1.00 93.89  ? 2   ASP B CB  1 
ATOM   1920 C CG  . ASP B 1 24  ? -2.919  -14.883 32.551 1.00 99.52  ? 2   ASP B CG  1 
ATOM   1921 O OD1 . ASP B 1 24  ? -3.321  -15.062 31.378 1.00 103.53 ? 2   ASP B OD1 1 
ATOM   1922 O OD2 . ASP B 1 24  ? -1.863  -14.278 32.817 1.00 106.02 ? 2   ASP B OD2 1 
ATOM   1923 N N   . LYS B 1 25  ? -5.428  -17.632 32.498 1.00 92.83  ? 3   LYS B N   1 
ATOM   1924 C CA  . LYS B 1 25  ? -6.088  -18.439 31.462 1.00 86.81  ? 3   LYS B CA  1 
ATOM   1925 C C   . LYS B 1 25  ? -5.366  -18.359 30.125 1.00 88.01  ? 3   LYS B C   1 
ATOM   1926 O O   . LYS B 1 25  ? -5.181  -19.373 29.441 1.00 84.13  ? 3   LYS B O   1 
ATOM   1927 C CB  . LYS B 1 25  ? -7.549  -18.015 31.274 1.00 72.45  ? 3   LYS B CB  1 
ATOM   1928 N N   . ASN B 1 26  ? -4.931  -17.157 29.768 1.00 88.28  ? 4   ASN B N   1 
ATOM   1929 C CA  . ASN B 1 26  ? -4.300  -16.951 28.475 1.00 88.89  ? 4   ASN B CA  1 
ATOM   1930 C C   . ASN B 1 26  ? -2.932  -17.610 28.405 1.00 90.09  ? 4   ASN B C   1 
ATOM   1931 O O   . ASN B 1 26  ? -2.610  -18.266 27.412 1.00 90.60  ? 4   ASN B O   1 
ATOM   1932 C CB  . ASN B 1 26  ? -4.199  -15.456 28.156 1.00 96.43  ? 4   ASN B CB  1 
ATOM   1933 C CG  . ASN B 1 26  ? -5.557  -14.831 27.797 1.00 101.33 ? 4   ASN B CG  1 
ATOM   1934 O OD1 . ASN B 1 26  ? -6.480  -15.515 27.336 1.00 96.70  ? 4   ASN B OD1 1 
ATOM   1935 N ND2 . ASN B 1 26  ? -5.675  -13.524 28.010 1.00 101.12 ? 4   ASN B ND2 1 
ATOM   1936 N N   . GLU B 1 27  ? -2.133  -17.464 29.457 1.00 92.88  ? 5   GLU B N   1 
ATOM   1937 C CA  . GLU B 1 27  ? -0.803  -18.066 29.466 1.00 89.47  ? 5   GLU B CA  1 
ATOM   1938 C C   . GLU B 1 27  ? -0.918  -19.582 29.558 1.00 87.02  ? 5   GLU B C   1 
ATOM   1939 O O   . GLU B 1 27  ? -0.102  -20.305 28.991 1.00 86.04  ? 5   GLU B O   1 
ATOM   1940 C CB  . GLU B 1 27  ? 0.034   -17.517 30.613 1.00 89.87  ? 5   GLU B CB  1 
ATOM   1941 C CG  . GLU B 1 27  ? 0.144   -16.008 30.615 1.00 93.02  ? 5   GLU B CG  1 
ATOM   1942 C CD  . GLU B 1 27  ? 0.955   -15.485 31.784 1.00 99.04  ? 5   GLU B CD  1 
ATOM   1943 O OE1 . GLU B 1 27  ? 0.694   -15.927 32.931 1.00 99.99  ? 5   GLU B OE1 1 
ATOM   1944 O OE2 . GLU B 1 27  ? 1.850   -14.639 31.552 1.00 91.81  ? 5   GLU B OE2 1 
ATOM   1945 N N   . LEU B 1 28  ? -1.946  -20.059 30.259 1.00 84.85  ? 6   LEU B N   1 
ATOM   1946 C CA  . LEU B 1 28  ? -2.211  -21.493 30.328 1.00 83.99  ? 6   LEU B CA  1 
ATOM   1947 C C   . LEU B 1 28  ? -2.561  -22.032 28.948 1.00 83.19  ? 6   LEU B C   1 
ATOM   1948 O O   . LEU B 1 28  ? -1.938  -22.980 28.482 1.00 82.42  ? 6   LEU B O   1 
ATOM   1949 C CB  . LEU B 1 28  ? -3.335  -21.813 31.317 1.00 83.12  ? 6   LEU B CB  1 
ATOM   1950 C CG  . LEU B 1 28  ? -3.059  -21.740 32.825 1.00 79.38  ? 6   LEU B CG  1 
ATOM   1951 C CD1 . LEU B 1 28  ? -4.370  -21.854 33.574 1.00 83.88  ? 6   LEU B CD1 1 
ATOM   1952 C CD2 . LEU B 1 28  ? -2.082  -22.803 33.300 1.00 73.56  ? 6   LEU B CD2 1 
ATOM   1953 N N   . VAL B 1 29  ? -3.548  -21.426 28.293 1.00 81.89  ? 7   VAL B N   1 
ATOM   1954 C CA  . VAL B 1 29  ? -3.918  -21.836 26.943 1.00 76.18  ? 7   VAL B CA  1 
ATOM   1955 C C   . VAL B 1 29  ? -2.734  -21.728 25.989 1.00 81.03  ? 7   VAL B C   1 
ATOM   1956 O O   . VAL B 1 29  ? -2.458  -22.653 25.217 1.00 80.45  ? 7   VAL B O   1 
ATOM   1957 C CB  . VAL B 1 29  ? -5.086  -21.001 26.391 1.00 76.95  ? 7   VAL B CB  1 
ATOM   1958 C CG1 . VAL B 1 29  ? -5.137  -21.085 24.866 1.00 68.87  ? 7   VAL B CG1 1 
ATOM   1959 C CG2 . VAL B 1 29  ? -6.408  -21.449 27.018 1.00 73.85  ? 7   VAL B CG2 1 
ATOM   1960 N N   . GLN B 1 30  ? -2.019  -20.613 26.056 1.00 82.82  ? 8   GLN B N   1 
ATOM   1961 C CA  . GLN B 1 30  ? -0.864  -20.426 25.188 1.00 82.22  ? 8   GLN B CA  1 
ATOM   1962 C C   . GLN B 1 30  ? 0.171   -21.551 25.390 1.00 83.81  ? 8   GLN B C   1 
ATOM   1963 O O   . GLN B 1 30  ? 0.848   -21.949 24.450 1.00 83.96  ? 8   GLN B O   1 
ATOM   1964 C CB  . GLN B 1 30  ? -0.242  -19.036 25.415 1.00 84.65  ? 8   GLN B CB  1 
ATOM   1965 C CG  . GLN B 1 30  ? 0.638   -18.546 24.272 1.00 90.06  ? 8   GLN B CG  1 
ATOM   1966 C CD  . GLN B 1 30  ? 0.157   -19.040 22.890 1.00 106.13 ? 8   GLN B CD  1 
ATOM   1967 O OE1 . GLN B 1 30  ? 0.889   -19.757 22.190 1.00 100.26 ? 8   GLN B OE1 1 
ATOM   1968 N NE2 . GLN B 1 30  ? -1.072  -18.655 22.493 1.00 99.25  ? 8   GLN B NE2 1 
ATOM   1969 N N   . LYS B 1 31  ? 0.271   -22.092 26.602 1.00 84.54  ? 9   LYS B N   1 
ATOM   1970 C CA  . LYS B 1 31  ? 1.205   -23.192 26.846 1.00 81.16  ? 9   LYS B CA  1 
ATOM   1971 C C   . LYS B 1 31  ? 0.579   -24.556 26.497 1.00 81.40  ? 9   LYS B C   1 
ATOM   1972 O O   . LYS B 1 31  ? 1.297   -25.508 26.168 1.00 78.96  ? 9   LYS B O   1 
ATOM   1973 C CB  . LYS B 1 31  ? 1.685   -23.181 28.295 1.00 80.23  ? 9   LYS B CB  1 
ATOM   1974 C CG  . LYS B 1 31  ? 2.525   -24.382 28.698 1.00 80.26  ? 9   LYS B CG  1 
ATOM   1975 C CD  . LYS B 1 31  ? 3.110   -24.240 30.087 1.00 84.02  ? 9   LYS B CD  1 
ATOM   1976 C CE  . LYS B 1 31  ? 3.755   -25.538 30.565 1.00 85.45  ? 9   LYS B CE  1 
ATOM   1977 N NZ  . LYS B 1 31  ? 4.504   -25.410 31.861 1.00 89.48  ? 9   LYS B NZ  1 
ATOM   1978 N N   . ALA B 1 32  ? -0.750  -24.650 26.552 1.00 77.18  ? 10  ALA B N   1 
ATOM   1979 C CA  . ALA B 1 32  ? -1.435  -25.831 26.049 1.00 71.30  ? 10  ALA B CA  1 
ATOM   1980 C C   . ALA B 1 32  ? -1.015  -26.061 24.607 1.00 75.25  ? 10  ALA B C   1 
ATOM   1981 O O   . ALA B 1 32  ? -0.643  -27.175 24.221 1.00 75.11  ? 10  ALA B O   1 
ATOM   1982 C CB  . ALA B 1 32  ? -2.937  -25.671 26.149 1.00 69.06  ? 10  ALA B CB  1 
ATOM   1983 N N   . LYS B 1 33  ? -1.062  -24.992 23.816 1.00 73.50  ? 11  LYS B N   1 
ATOM   1984 C CA  . LYS B 1 33  ? -0.749  -25.094 22.399 1.00 76.33  ? 11  LYS B CA  1 
ATOM   1985 C C   . LYS B 1 33  ? 0.707   -25.498 22.190 1.00 78.80  ? 11  LYS B C   1 
ATOM   1986 O O   . LYS B 1 33  ? 1.009   -26.325 21.336 1.00 82.67  ? 11  LYS B O   1 
ATOM   1987 C CB  . LYS B 1 33  ? -1.048  -23.785 21.686 1.00 68.26  ? 11  LYS B CB  1 
ATOM   1988 C CG  . LYS B 1 33  ? -2.501  -23.384 21.738 1.00 70.03  ? 11  LYS B CG  1 
ATOM   1989 C CD  . LYS B 1 33  ? -2.640  -21.974 21.175 1.00 83.73  ? 11  LYS B CD  1 
ATOM   1990 C CE  . LYS B 1 33  ? -4.082  -21.581 20.873 1.00 85.41  ? 11  LYS B CE  1 
ATOM   1991 N NZ  . LYS B 1 33  ? -4.154  -20.394 19.946 1.00 89.25  ? 11  LYS B NZ  1 
ATOM   1992 N N   . LEU B 1 34  ? 1.609   -24.933 22.975 1.00 74.32  ? 12  LEU B N   1 
ATOM   1993 C CA  . LEU B 1 34  ? 2.999   -25.353 22.904 1.00 78.53  ? 12  LEU B CA  1 
ATOM   1994 C C   . LEU B 1 34  ? 3.144   -26.854 23.219 1.00 83.21  ? 12  LEU B C   1 
ATOM   1995 O O   . LEU B 1 34  ? 3.828   -27.580 22.489 1.00 76.07  ? 12  LEU B O   1 
ATOM   1996 C CB  . LEU B 1 34  ? 3.854   -24.522 23.859 1.00 82.24  ? 12  LEU B CB  1 
ATOM   1997 C CG  . LEU B 1 34  ? 4.481   -23.217 23.352 1.00 89.13  ? 12  LEU B CG  1 
ATOM   1998 C CD1 . LEU B 1 34  ? 3.494   -22.371 22.551 1.00 88.62  ? 12  LEU B CD1 1 
ATOM   1999 C CD2 . LEU B 1 34  ? 5.047   -22.413 24.535 1.00 87.97  ? 12  LEU B CD2 1 
ATOM   2000 N N   . ALA B 1 35  ? 2.498   -27.303 24.303 1.00 83.57  ? 13  ALA B N   1 
ATOM   2001 C CA  . ALA B 1 35  ? 2.500   -28.713 24.700 1.00 78.80  ? 13  ALA B CA  1 
ATOM   2002 C C   . ALA B 1 35  ? 2.117   -29.611 23.532 1.00 81.86  ? 13  ALA B C   1 
ATOM   2003 O O   . ALA B 1 35  ? 2.824   -30.578 23.207 1.00 79.57  ? 13  ALA B O   1 
ATOM   2004 C CB  . ALA B 1 35  ? 1.557   -28.945 25.847 1.00 73.37  ? 13  ALA B CB  1 
ATOM   2005 N N   . GLU B 1 36  ? 0.997   -29.277 22.900 1.00 79.98  ? 14  GLU B N   1 
ATOM   2006 C CA  . GLU B 1 36  ? 0.528   -30.012 21.731 1.00 78.76  ? 14  GLU B CA  1 
ATOM   2007 C C   . GLU B 1 36  ? 1.574   -30.091 20.628 1.00 78.04  ? 14  GLU B C   1 
ATOM   2008 O O   . GLU B 1 36  ? 1.756   -31.132 19.999 1.00 83.39  ? 14  GLU B O   1 
ATOM   2009 C CB  . GLU B 1 36  ? -0.731  -29.368 21.181 1.00 78.31  ? 14  GLU B CB  1 
ATOM   2010 C CG  . GLU B 1 36  ? -1.246  -30.037 19.948 1.00 78.24  ? 14  GLU B CG  1 
ATOM   2011 C CD  . GLU B 1 36  ? -2.376  -29.263 19.334 1.00 85.00  ? 14  GLU B CD  1 
ATOM   2012 O OE1 . GLU B 1 36  ? -2.232  -28.011 19.233 1.00 81.13  ? 14  GLU B OE1 1 
ATOM   2013 O OE2 . GLU B 1 36  ? -3.394  -29.909 18.969 1.00 79.72  ? 14  GLU B OE2 1 
ATOM   2014 N N   . GLN B 1 37  ? 2.264   -28.987 20.393 1.00 75.52  ? 15  GLN B N   1 
ATOM   2015 C CA  . GLN B 1 37  ? 3.280   -28.967 19.362 1.00 72.40  ? 15  GLN B CA  1 
ATOM   2016 C C   . GLN B 1 37  ? 4.426   -29.873 19.762 1.00 76.70  ? 15  GLN B C   1 
ATOM   2017 O O   . GLN B 1 37  ? 5.107   -30.433 18.909 1.00 78.91  ? 15  GLN B O   1 
ATOM   2018 C CB  . GLN B 1 37  ? 3.790   -27.541 19.112 1.00 79.21  ? 15  GLN B CB  1 
ATOM   2019 C CG  . GLN B 1 37  ? 2.852   -26.656 18.291 1.00 76.44  ? 15  GLN B CG  1 
ATOM   2020 C CD  . GLN B 1 37  ? 2.464   -27.319 16.983 1.00 97.61  ? 15  GLN B CD  1 
ATOM   2021 O OE1 . GLN B 1 37  ? 1.351   -27.852 16.849 1.00 94.92  ? 15  GLN B OE1 1 
ATOM   2022 N NE2 . GLN B 1 37  ? 3.387   -27.308 16.007 1.00 100.07 ? 15  GLN B NE2 1 
ATOM   2023 N N   . ALA B 1 38  ? 4.653   -30.018 21.065 1.00 76.99  ? 16  ALA B N   1 
ATOM   2024 C CA  . ALA B 1 38  ? 5.765   -30.841 21.512 1.00 72.59  ? 16  ALA B CA  1 
ATOM   2025 C C   . ALA B 1 38  ? 5.291   -32.207 21.989 1.00 72.96  ? 16  ALA B C   1 
ATOM   2026 O O   . ALA B 1 38  ? 6.066   -32.983 22.540 1.00 68.06  ? 16  ALA B O   1 
ATOM   2027 C CB  . ALA B 1 38  ? 6.538   -30.147 22.578 1.00 69.39  ? 16  ALA B CB  1 
ATOM   2028 N N   . GLU B 1 39  ? 4.025   -32.510 21.721 1.00 76.62  ? 17  GLU B N   1 
ATOM   2029 C CA  . GLU B 1 39  ? 3.465   -33.826 22.014 1.00 78.60  ? 17  GLU B CA  1 
ATOM   2030 C C   . GLU B 1 39  ? 3.696   -34.192 23.478 1.00 80.49  ? 17  GLU B C   1 
ATOM   2031 O O   . GLU B 1 39  ? 4.248   -35.248 23.802 1.00 80.61  ? 17  GLU B O   1 
ATOM   2032 C CB  . GLU B 1 39  ? 4.076   -34.874 21.090 1.00 80.83  ? 17  GLU B CB  1 
ATOM   2033 C CG  . GLU B 1 39  ? 4.342   -34.343 19.692 1.00 84.51  ? 17  GLU B CG  1 
ATOM   2034 C CD  . GLU B 1 39  ? 4.078   -35.369 18.610 1.00 89.72  ? 17  GLU B CD  1 
ATOM   2035 O OE1 . GLU B 1 39  ? 3.104   -36.159 18.749 1.00 85.01  ? 17  GLU B OE1 1 
ATOM   2036 O OE2 . GLU B 1 39  ? 4.831   -35.354 17.608 1.00 86.32  ? 17  GLU B OE2 1 
ATOM   2037 N N   . ARG B 1 40  ? 3.316   -33.276 24.356 1.00 73.37  ? 18  ARG B N   1 
ATOM   2038 C CA  . ARG B 1 40  ? 3.350   -33.527 25.774 1.00 68.19  ? 18  ARG B CA  1 
ATOM   2039 C C   . ARG B 1 40  ? 1.943   -33.355 26.257 1.00 71.12  ? 18  ARG B C   1 
ATOM   2040 O O   . ARG B 1 40  ? 1.621   -32.385 26.937 1.00 73.11  ? 18  ARG B O   1 
ATOM   2041 C CB  . ARG B 1 40  ? 4.310   -32.584 26.480 1.00 69.19  ? 18  ARG B CB  1 
ATOM   2042 C CG  . ARG B 1 40  ? 5.715   -32.751 25.986 1.00 68.47  ? 18  ARG B CG  1 
ATOM   2043 C CD  . ARG B 1 40  ? 6.558   -31.608 26.402 1.00 67.41  ? 18  ARG B CD  1 
ATOM   2044 N NE  . ARG B 1 40  ? 6.699   -31.589 27.843 1.00 76.44  ? 18  ARG B NE  1 
ATOM   2045 C CZ  . ARG B 1 40  ? 7.704   -32.165 28.486 1.00 78.14  ? 18  ARG B CZ  1 
ATOM   2046 N NH1 . ARG B 1 40  ? 8.650   -32.802 27.798 1.00 82.76  ? 18  ARG B NH1 1 
ATOM   2047 N NH2 . ARG B 1 40  ? 7.763   -32.104 29.805 1.00 65.64  ? 18  ARG B NH2 1 
ATOM   2048 N N   . TYR B 1 41  ? 1.101   -34.309 25.881 1.00 68.44  ? 19  TYR B N   1 
ATOM   2049 C CA  . TYR B 1 41  ? -0.323  -34.208 26.127 1.00 71.99  ? 19  TYR B CA  1 
ATOM   2050 C C   . TYR B 1 41  ? -0.674  -34.243 27.616 1.00 74.10  ? 19  TYR B C   1 
ATOM   2051 O O   . TYR B 1 41  ? -1.786  -33.891 27.998 1.00 75.95  ? 19  TYR B O   1 
ATOM   2052 C CB  . TYR B 1 41  ? -1.051  -35.318 25.364 1.00 72.56  ? 19  TYR B CB  1 
ATOM   2053 C CG  . TYR B 1 41  ? -0.839  -35.188 23.890 1.00 74.39  ? 19  TYR B CG  1 
ATOM   2054 C CD1 . TYR B 1 41  ? -1.596  -34.302 23.141 1.00 78.89  ? 19  TYR B CD1 1 
ATOM   2055 C CD2 . TYR B 1 41  ? 0.157   -35.907 23.242 1.00 81.37  ? 19  TYR B CD2 1 
ATOM   2056 C CE1 . TYR B 1 41  ? -1.391  -34.157 21.762 1.00 78.62  ? 19  TYR B CE1 1 
ATOM   2057 C CE2 . TYR B 1 41  ? 0.373   -35.764 21.872 1.00 81.65  ? 19  TYR B CE2 1 
ATOM   2058 C CZ  . TYR B 1 41  ? -0.410  -34.888 21.139 1.00 78.61  ? 19  TYR B CZ  1 
ATOM   2059 O OH  . TYR B 1 41  ? -0.202  -34.729 19.789 1.00 86.16  ? 19  TYR B OH  1 
ATOM   2060 N N   . ASP B 1 42  ? 0.264   -34.658 28.460 1.00 72.63  ? 20  ASP B N   1 
ATOM   2061 C CA  . ASP B 1 42  ? 0.014   -34.612 29.886 1.00 71.36  ? 20  ASP B CA  1 
ATOM   2062 C C   . ASP B 1 42  ? 0.037   -33.154 30.334 1.00 74.99  ? 20  ASP B C   1 
ATOM   2063 O O   . ASP B 1 42  ? -0.952  -32.671 30.883 1.00 73.52  ? 20  ASP B O   1 
ATOM   2064 C CB  . ASP B 1 42  ? 1.023   -35.471 30.654 1.00 74.75  ? 20  ASP B CB  1 
ATOM   2065 C CG  . ASP B 1 42  ? 0.724   -36.984 30.540 1.00 90.57  ? 20  ASP B CG  1 
ATOM   2066 O OD1 . ASP B 1 42  ? -0.355  -37.367 30.024 1.00 88.56  ? 20  ASP B OD1 1 
ATOM   2067 O OD2 . ASP B 1 42  ? 1.559   -37.804 30.984 1.00 94.70  ? 20  ASP B OD2 1 
ATOM   2068 N N   . ASP B 1 43  ? 1.145   -32.455 30.071 1.00 75.76  ? 21  ASP B N   1 
ATOM   2069 C CA  . ASP B 1 43  ? 1.234   -31.011 30.286 1.00 66.27  ? 21  ASP B CA  1 
ATOM   2070 C C   . ASP B 1 43  ? -0.016  -30.297 29.794 1.00 75.34  ? 21  ASP B C   1 
ATOM   2071 O O   . ASP B 1 43  ? -0.581  -29.451 30.486 1.00 74.88  ? 21  ASP B O   1 
ATOM   2072 C CB  . ASP B 1 43  ? 2.433   -30.422 29.555 1.00 68.92  ? 21  ASP B CB  1 
ATOM   2073 C CG  . ASP B 1 43  ? 3.722   -30.653 30.270 1.00 72.85  ? 21  ASP B CG  1 
ATOM   2074 O OD1 . ASP B 1 43  ? 3.685   -31.208 31.378 1.00 81.37  ? 21  ASP B OD1 1 
ATOM   2075 O OD2 . ASP B 1 43  ? 4.778   -30.255 29.738 1.00 73.74  ? 21  ASP B OD2 1 
ATOM   2076 N N   . MET B 1 44  ? -0.432  -30.650 28.580 1.00 74.57  ? 22  MET B N   1 
ATOM   2077 C CA  . MET B 1 44  ? -1.542  -29.991 27.909 1.00 74.07  ? 22  MET B CA  1 
ATOM   2078 C C   . MET B 1 44  ? -2.863  -30.201 28.636 1.00 75.53  ? 22  MET B C   1 
ATOM   2079 O O   . MET B 1 44  ? -3.688  -29.299 28.707 1.00 77.69  ? 22  MET B O   1 
ATOM   2080 C CB  . MET B 1 44  ? -1.654  -30.506 26.482 1.00 76.63  ? 22  MET B CB  1 
ATOM   2081 C CG  . MET B 1 44  ? -2.614  -29.739 25.597 1.00 78.10  ? 22  MET B CG  1 
ATOM   2082 S SD  . MET B 1 44  ? -2.744  -30.553 24.005 1.00 79.32  ? 22  MET B SD  1 
ATOM   2083 C CE  . MET B 1 44  ? -4.228  -29.834 23.361 1.00 78.36  ? 22  MET B CE  1 
ATOM   2084 N N   . ALA B 1 45  ? -3.064  -31.399 29.166 1.00 70.43  ? 23  ALA B N   1 
ATOM   2085 C CA  . ALA B 1 45  ? -4.284  -31.703 29.887 1.00 71.43  ? 23  ALA B CA  1 
ATOM   2086 C C   . ALA B 1 45  ? -4.276  -30.978 31.228 1.00 77.62  ? 23  ALA B C   1 
ATOM   2087 O O   . ALA B 1 45  ? -5.321  -30.567 31.750 1.00 74.43  ? 23  ALA B O   1 
ATOM   2088 C CB  . ALA B 1 45  ? -4.425  -33.201 30.080 1.00 69.92  ? 23  ALA B CB  1 
ATOM   2089 N N   . ALA B 1 46  ? -3.081  -30.833 31.790 1.00 76.85  ? 24  ALA B N   1 
ATOM   2090 C CA  . ALA B 1 46  ? -2.921  -30.096 33.026 1.00 69.10  ? 24  ALA B CA  1 
ATOM   2091 C C   . ALA B 1 46  ? -3.335  -28.642 32.804 1.00 76.22  ? 24  ALA B C   1 
ATOM   2092 O O   . ALA B 1 46  ? -4.088  -28.077 33.600 1.00 78.13  ? 24  ALA B O   1 
ATOM   2093 C CB  . ALA B 1 46  ? -1.503  -30.183 33.508 1.00 66.85  ? 24  ALA B CB  1 
ATOM   2094 N N   . CYS B 1 47  ? -2.864  -28.052 31.705 1.00 76.17  ? 25  CYS B N   1 
ATOM   2095 C CA  . CYS B 1 47  ? -3.163  -26.656 31.401 1.00 73.24  ? 25  CYS B CA  1 
ATOM   2096 C C   . CYS B 1 47  ? -4.648  -26.431 31.210 1.00 77.49  ? 25  CYS B C   1 
ATOM   2097 O O   . CYS B 1 47  ? -5.221  -25.493 31.768 1.00 77.90  ? 25  CYS B O   1 
ATOM   2098 C CB  . CYS B 1 47  ? -2.421  -26.198 30.158 1.00 65.76  ? 25  CYS B CB  1 
ATOM   2099 S SG  . CYS B 1 47  ? -0.650  -26.103 30.379 1.00 77.13  ? 25  CYS B SG  1 
ATOM   2100 N N   . MET B 1 48  ? -5.274  -27.297 30.425 1.00 75.22  ? 26  MET B N   1 
ATOM   2101 C CA  . MET B 1 48  ? -6.667  -27.098 30.092 1.00 71.74  ? 26  MET B CA  1 
ATOM   2102 C C   . MET B 1 48  ? -7.564  -27.426 31.259 1.00 73.21  ? 26  MET B C   1 
ATOM   2103 O O   . MET B 1 48  ? -8.624  -26.821 31.399 1.00 75.83  ? 26  MET B O   1 
ATOM   2104 C CB  . MET B 1 48  ? -7.048  -27.925 28.873 1.00 73.61  ? 26  MET B CB  1 
ATOM   2105 C CG  . MET B 1 48  ? -6.352  -27.453 27.625 1.00 73.71  ? 26  MET B CG  1 
ATOM   2106 S SD  . MET B 1 48  ? -6.429  -25.662 27.433 1.00 77.02  ? 26  MET B SD  1 
ATOM   2107 C CE  . MET B 1 48  ? -8.189  -25.369 27.267 1.00 70.78  ? 26  MET B CE  1 
ATOM   2108 N N   . LYS B 1 49  ? -7.143  -28.369 32.102 1.00 75.10  ? 27  LYS B N   1 
ATOM   2109 C CA  . LYS B 1 49  ? -7.906  -28.691 33.311 1.00 74.10  ? 27  LYS B CA  1 
ATOM   2110 C C   . LYS B 1 49  ? -7.947  -27.464 34.211 1.00 78.84  ? 27  LYS B C   1 
ATOM   2111 O O   . LYS B 1 49  ? -9.006  -27.041 34.675 1.00 77.53  ? 27  LYS B O   1 
ATOM   2112 C CB  . LYS B 1 49  ? -7.299  -29.870 34.057 1.00 68.28  ? 27  LYS B CB  1 
ATOM   2113 C CG  . LYS B 1 49  ? -8.058  -30.237 35.329 1.00 75.51  ? 27  LYS B CG  1 
ATOM   2114 C CD  . LYS B 1 49  ? -7.311  -31.285 36.161 1.00 72.29  ? 27  LYS B CD  1 
ATOM   2115 C CE  . LYS B 1 49  ? -8.072  -31.635 37.430 1.00 78.33  ? 27  LYS B CE  1 
ATOM   2116 N NZ  . LYS B 1 49  ? -7.315  -32.620 38.262 1.00 84.14  ? 27  LYS B NZ  1 
ATOM   2117 N N   . SER B 1 50  ? -6.771  -26.887 34.424 1.00 78.52  ? 28  SER B N   1 
ATOM   2118 C CA  . SER B 1 50  ? -6.631  -25.634 35.138 1.00 75.29  ? 28  SER B CA  1 
ATOM   2119 C C   . SER B 1 50  ? -7.534  -24.549 34.525 1.00 78.42  ? 28  SER B C   1 
ATOM   2120 O O   . SER B 1 50  ? -8.292  -23.903 35.228 1.00 83.45  ? 28  SER B O   1 
ATOM   2121 C CB  . SER B 1 50  ? -5.165  -25.207 35.121 1.00 77.67  ? 28  SER B CB  1 
ATOM   2122 O OG  . SER B 1 50  ? -4.808  -24.506 36.295 1.00 82.27  ? 28  SER B OG  1 
ATOM   2123 N N   . VAL B 1 51  ? -7.474  -24.362 33.215 1.00 80.03  ? 29  VAL B N   1 
ATOM   2124 C CA  . VAL B 1 51  ? -8.326  -23.369 32.569 1.00 81.50  ? 29  VAL B CA  1 
ATOM   2125 C C   . VAL B 1 51  ? -9.807  -23.658 32.827 1.00 80.87  ? 29  VAL B C   1 
ATOM   2126 O O   . VAL B 1 51  ? -10.578 -22.765 33.171 1.00 80.20  ? 29  VAL B O   1 
ATOM   2127 C CB  . VAL B 1 51  ? -8.079  -23.307 31.045 1.00 78.49  ? 29  VAL B CB  1 
ATOM   2128 C CG1 . VAL B 1 51  ? -9.160  -22.476 30.362 1.00 76.01  ? 29  VAL B CG1 1 
ATOM   2129 C CG2 . VAL B 1 51  ? -6.702  -22.738 30.745 1.00 76.58  ? 29  VAL B CG2 1 
ATOM   2130 N N   . THR B 1 52  ? -10.196 -24.916 32.673 1.00 80.43  ? 30  THR B N   1 
ATOM   2131 C CA  . THR B 1 52  ? -11.589 -25.296 32.847 1.00 80.81  ? 30  THR B CA  1 
ATOM   2132 C C   . THR B 1 52  ? -12.042 -24.958 34.253 1.00 80.11  ? 30  THR B C   1 
ATOM   2133 O O   . THR B 1 52  ? -13.142 -24.442 34.443 1.00 78.97  ? 30  THR B O   1 
ATOM   2134 C CB  . THR B 1 52  ? -11.800 -26.804 32.574 1.00 79.46  ? 30  THR B CB  1 
ATOM   2135 O OG1 . THR B 1 52  ? -11.340 -27.106 31.255 1.00 81.73  ? 30  THR B OG1 1 
ATOM   2136 C CG2 . THR B 1 52  ? -13.275 -27.204 32.700 1.00 74.59  ? 30  THR B CG2 1 
ATOM   2137 N N   . GLU B 1 53  ? -11.160 -25.235 35.216 1.00 84.22  ? 31  GLU B N   1 
ATOM   2138 C CA  . GLU B 1 53  ? -11.447 -25.134 36.654 1.00 79.70  ? 31  GLU B CA  1 
ATOM   2139 C C   . GLU B 1 53  ? -11.695 -23.707 37.108 1.00 82.11  ? 31  GLU B C   1 
ATOM   2140 O O   . GLU B 1 53  ? -12.327 -23.489 38.130 1.00 89.77  ? 31  GLU B O   1 
ATOM   2141 C CB  . GLU B 1 53  ? -10.299 -25.735 37.479 1.00 69.92  ? 31  GLU B CB  1 
ATOM   2142 C CG  . GLU B 1 53  ? -10.418 -27.222 37.713 1.00 65.63  ? 31  GLU B CG  1 
ATOM   2143 C CD  . GLU B 1 53  ? -9.176  -27.832 38.335 1.00 78.54  ? 31  GLU B CD  1 
ATOM   2144 O OE1 . GLU B 1 53  ? -8.126  -27.151 38.368 1.00 86.74  ? 31  GLU B OE1 1 
ATOM   2145 O OE2 . GLU B 1 53  ? -9.243  -29.002 38.783 1.00 78.03  ? 31  GLU B OE2 1 
ATOM   2146 N N   . GLN B 1 54  ? -11.214 -22.732 36.349 1.00 83.17  ? 32  GLN B N   1 
ATOM   2147 C CA  . GLN B 1 54  ? -11.422 -21.340 36.710 1.00 80.19  ? 32  GLN B CA  1 
ATOM   2148 C C   . GLN B 1 54  ? -12.845 -20.881 36.462 1.00 86.09  ? 32  GLN B C   1 
ATOM   2149 O O   . GLN B 1 54  ? -13.150 -19.702 36.603 1.00 97.88  ? 32  GLN B O   1 
ATOM   2150 C CB  . GLN B 1 54  ? -10.444 -20.457 35.962 1.00 78.83  ? 32  GLN B CB  1 
ATOM   2151 C CG  . GLN B 1 54  ? -9.042  -20.741 36.415 1.00 88.24  ? 32  GLN B CG  1 
ATOM   2152 C CD  . GLN B 1 54  ? -8.020  -20.033 35.578 1.00 101.99 ? 32  GLN B CD  1 
ATOM   2153 O OE1 . GLN B 1 54  ? -8.364  -19.350 34.602 1.00 100.63 ? 32  GLN B OE1 1 
ATOM   2154 N NE2 . GLN B 1 54  ? -6.741  -20.196 35.941 1.00 102.78 ? 32  GLN B NE2 1 
ATOM   2155 N N   . GLY B 1 55  ? -13.710 -21.815 36.083 1.00 90.54  ? 33  GLY B N   1 
ATOM   2156 C CA  . GLY B 1 55  ? -15.147 -21.614 36.162 1.00 93.77  ? 33  GLY B CA  1 
ATOM   2157 C C   . GLY B 1 55  ? -15.887 -21.033 34.969 1.00 93.79  ? 33  GLY B C   1 
ATOM   2158 O O   . GLY B 1 55  ? -17.106 -21.173 34.893 1.00 95.91  ? 33  GLY B O   1 
ATOM   2159 N N   . ALA B 1 56  ? -15.179 -20.371 34.056 1.00 91.29  ? 34  ALA B N   1 
ATOM   2160 C CA  . ALA B 1 56  ? -15.831 -19.777 32.886 1.00 93.23  ? 34  ALA B CA  1 
ATOM   2161 C C   . ALA B 1 56  ? -16.197 -20.838 31.851 1.00 98.74  ? 34  ALA B C   1 
ATOM   2162 O O   . ALA B 1 56  ? -15.634 -21.943 31.838 1.00 95.13  ? 34  ALA B O   1 
ATOM   2163 C CB  . ALA B 1 56  ? -14.941 -18.716 32.253 1.00 90.50  ? 34  ALA B CB  1 
ATOM   2164 N N   . GLU B 1 57  ? -17.150 -20.501 30.989 1.00 97.97  ? 35  GLU B N   1 
ATOM   2165 C CA  . GLU B 1 57  ? -17.480 -21.371 29.876 1.00 95.76  ? 35  GLU B CA  1 
ATOM   2166 C C   . GLU B 1 57  ? -16.322 -21.318 28.889 1.00 93.16  ? 35  GLU B C   1 
ATOM   2167 O O   . GLU B 1 57  ? -15.806 -20.244 28.574 1.00 91.30  ? 35  GLU B O   1 
ATOM   2168 C CB  . GLU B 1 57  ? -18.796 -20.961 29.210 1.00 97.61  ? 35  GLU B CB  1 
ATOM   2169 C CG  . GLU B 1 57  ? -19.298 -21.971 28.180 1.00 111.25 ? 35  GLU B CG  1 
ATOM   2170 C CD  . GLU B 1 57  ? -20.559 -21.523 27.462 1.00 115.91 ? 35  GLU B CD  1 
ATOM   2171 O OE1 . GLU B 1 57  ? -20.916 -20.327 27.583 1.00 117.63 ? 35  GLU B OE1 1 
ATOM   2172 O OE2 . GLU B 1 57  ? -21.184 -22.369 26.775 1.00 114.83 ? 35  GLU B OE2 1 
ATOM   2173 N N   . LEU B 1 58  ? -15.892 -22.486 28.426 1.00 95.78  ? 36  LEU B N   1 
ATOM   2174 C CA  . LEU B 1 58  ? -14.758 -22.553 27.516 1.00 95.91  ? 36  LEU B CA  1 
ATOM   2175 C C   . LEU B 1 58  ? -15.158 -22.016 26.146 1.00 93.74  ? 36  LEU B C   1 
ATOM   2176 O O   . LEU B 1 58  ? -16.298 -22.193 25.687 1.00 89.17  ? 36  LEU B O   1 
ATOM   2177 C CB  . LEU B 1 58  ? -14.222 -23.991 27.404 1.00 92.45  ? 36  LEU B CB  1 
ATOM   2178 C CG  . LEU B 1 58  ? -13.686 -24.654 28.681 1.00 84.42  ? 36  LEU B CG  1 
ATOM   2179 C CD1 . LEU B 1 58  ? -13.202 -26.049 28.386 1.00 82.63  ? 36  LEU B CD1 1 
ATOM   2180 C CD2 . LEU B 1 58  ? -12.558 -23.837 29.271 1.00 85.10  ? 36  LEU B CD2 1 
ATOM   2181 N N   . SER B 1 59  ? -14.211 -21.338 25.509 1.00 86.76  ? 37  SER B N   1 
ATOM   2182 C CA  . SER B 1 59  ? -14.388 -20.889 24.147 1.00 85.90  ? 37  SER B CA  1 
ATOM   2183 C C   . SER B 1 59  ? -14.272 -22.102 23.241 1.00 95.83  ? 37  SER B C   1 
ATOM   2184 O O   . SER B 1 59  ? -13.980 -23.197 23.712 1.00 98.03  ? 37  SER B O   1 
ATOM   2185 C CB  . SER B 1 59  ? -13.344 -19.848 23.797 1.00 85.53  ? 37  SER B CB  1 
ATOM   2186 O OG  . SER B 1 59  ? -12.085 -20.462 23.603 1.00 90.80  ? 37  SER B OG  1 
ATOM   2187 N N   . ASN B 1 60  ? -14.480 -21.935 21.943 1.00 98.60  ? 38  ASN B N   1 
ATOM   2188 C CA  . ASN B 1 60  ? -14.350 -23.094 21.075 1.00 97.68  ? 38  ASN B CA  1 
ATOM   2189 C C   . ASN B 1 60  ? -12.915 -23.533 20.969 1.00 90.38  ? 38  ASN B C   1 
ATOM   2190 O O   . ASN B 1 60  ? -12.632 -24.724 21.048 1.00 89.68  ? 38  ASN B O   1 
ATOM   2191 C CB  . ASN B 1 60  ? -14.927 -22.829 19.689 1.00 99.27  ? 38  ASN B CB  1 
ATOM   2192 C CG  . ASN B 1 60  ? -16.409 -23.109 19.634 1.00 105.62 ? 38  ASN B CG  1 
ATOM   2193 O OD1 . ASN B 1 60  ? -16.956 -23.785 20.516 1.00 110.33 ? 38  ASN B OD1 1 
ATOM   2194 N ND2 . ASN B 1 60  ? -17.073 -22.599 18.607 1.00 109.66 ? 38  ASN B ND2 1 
ATOM   2195 N N   . GLU B 1 61  ? -12.011 -22.573 20.812 1.00 87.32  ? 39  GLU B N   1 
ATOM   2196 C CA  . GLU B 1 61  ? -10.604 -22.911 20.741 1.00 85.48  ? 39  GLU B CA  1 
ATOM   2197 C C   . GLU B 1 61  ? -10.223 -23.712 21.971 1.00 85.29  ? 39  GLU B C   1 
ATOM   2198 O O   . GLU B 1 61  ? -9.510  -24.710 21.884 1.00 84.15  ? 39  GLU B O   1 
ATOM   2199 C CB  . GLU B 1 61  ? -9.729  -21.666 20.639 1.00 82.88  ? 39  GLU B CB  1 
ATOM   2200 C CG  . GLU B 1 61  ? -8.272  -22.015 20.365 1.00 86.59  ? 39  GLU B CG  1 
ATOM   2201 C CD  . GLU B 1 61  ? -7.370  -20.802 20.240 1.00 89.02  ? 39  GLU B CD  1 
ATOM   2202 O OE1 . GLU B 1 61  ? -7.471  -19.891 21.088 1.00 86.66  ? 39  GLU B OE1 1 
ATOM   2203 O OE2 . GLU B 1 61  ? -6.563  -20.758 19.281 1.00 92.20  ? 39  GLU B OE2 1 
ATOM   2204 N N   . GLU B 1 62  ? -10.739 -23.286 23.116 1.00 84.73  ? 40  GLU B N   1 
ATOM   2205 C CA  . GLU B 1 62  ? -10.364 -23.892 24.378 1.00 85.24  ? 40  GLU B CA  1 
ATOM   2206 C C   . GLU B 1 62  ? -10.936 -25.301 24.464 1.00 84.50  ? 40  GLU B C   1 
ATOM   2207 O O   . GLU B 1 62  ? -10.193 -26.262 24.665 1.00 82.85  ? 40  GLU B O   1 
ATOM   2208 C CB  . GLU B 1 62  ? -10.824 -23.009 25.542 1.00 88.51  ? 40  GLU B CB  1 
ATOM   2209 C CG  . GLU B 1 62  ? -9.989  -21.719 25.678 1.00 84.50  ? 40  GLU B CG  1 
ATOM   2210 C CD  . GLU B 1 62  ? -10.705 -20.599 26.433 1.00 90.21  ? 40  GLU B CD  1 
ATOM   2211 O OE1 . GLU B 1 62  ? -11.649 -20.890 27.209 1.00 87.94  ? 40  GLU B OE1 1 
ATOM   2212 O OE2 . GLU B 1 62  ? -10.319 -19.420 26.244 1.00 86.55  ? 40  GLU B OE2 1 
ATOM   2213 N N   . ARG B 1 63  ? -12.248 -25.407 24.288 1.00 85.53  ? 41  ARG B N   1 
ATOM   2214 C CA  . ARG B 1 63  ? -12.952 -26.683 24.184 1.00 82.98  ? 41  ARG B CA  1 
ATOM   2215 C C   . ARG B 1 63  ? -12.166 -27.736 23.419 1.00 80.86  ? 41  ARG B C   1 
ATOM   2216 O O   . ARG B 1 63  ? -11.996 -28.863 23.879 1.00 78.48  ? 41  ARG B O   1 
ATOM   2217 C CB  . ARG B 1 63  ? -14.295 -26.467 23.495 1.00 88.90  ? 41  ARG B CB  1 
ATOM   2218 C CG  . ARG B 1 63  ? -15.322 -27.549 23.715 1.00 84.48  ? 41  ARG B CG  1 
ATOM   2219 C CD  . ARG B 1 63  ? -16.543 -27.294 22.842 1.00 90.03  ? 41  ARG B CD  1 
ATOM   2220 N NE  . ARG B 1 63  ? -16.245 -27.510 21.429 1.00 99.21  ? 41  ARG B NE  1 
ATOM   2221 C CZ  . ARG B 1 63  ? -17.118 -27.343 20.440 1.00 101.42 ? 41  ARG B CZ  1 
ATOM   2222 N NH1 . ARG B 1 63  ? -18.352 -26.938 20.712 1.00 103.13 ? 41  ARG B NH1 1 
ATOM   2223 N NH2 . ARG B 1 63  ? -16.753 -27.577 19.181 1.00 100.02 ? 41  ARG B NH2 1 
ATOM   2224 N N   . ASN B 1 64  ? -11.676 -27.357 22.249 1.00 78.96  ? 42  ASN B N   1 
ATOM   2225 C CA  . ASN B 1 64  ? -10.957 -28.295 21.410 1.00 81.42  ? 42  ASN B CA  1 
ATOM   2226 C C   . ASN B 1 64  ? -9.656  -28.749 22.018 1.00 78.40  ? 42  ASN B C   1 
ATOM   2227 O O   . ASN B 1 64  ? -9.361  -29.944 22.035 1.00 74.74  ? 42  ASN B O   1 
ATOM   2228 C CB  . ASN B 1 64  ? -10.680 -27.686 20.044 1.00 88.28  ? 42  ASN B CB  1 
ATOM   2229 C CG  . ASN B 1 64  ? -11.860 -27.793 19.124 1.00 90.90  ? 42  ASN B CG  1 
ATOM   2230 O OD1 . ASN B 1 64  ? -13.017 -27.607 19.530 1.00 90.59  ? 42  ASN B OD1 1 
ATOM   2231 N ND2 . ASN B 1 64  ? -11.583 -28.102 17.870 1.00 97.28  ? 42  ASN B ND2 1 
ATOM   2232 N N   . LEU B 1 65  ? -8.866  -27.785 22.484 1.00 77.76  ? 43  LEU B N   1 
ATOM   2233 C CA  . LEU B 1 65  ? -7.616  -28.085 23.167 1.00 75.70  ? 43  LEU B CA  1 
ATOM   2234 C C   . LEU B 1 65  ? -7.862  -29.084 24.300 1.00 78.01  ? 43  LEU B C   1 
ATOM   2235 O O   . LEU B 1 65  ? -7.109  -30.041 24.477 1.00 75.69  ? 43  LEU B O   1 
ATOM   2236 C CB  . LEU B 1 65  ? -6.991  -26.811 23.714 1.00 71.64  ? 43  LEU B CB  1 
ATOM   2237 C CG  . LEU B 1 65  ? -6.419  -25.900 22.651 1.00 65.73  ? 43  LEU B CG  1 
ATOM   2238 C CD1 . LEU B 1 65  ? -6.215  -24.517 23.216 1.00 73.27  ? 43  LEU B CD1 1 
ATOM   2239 C CD2 . LEU B 1 65  ? -5.114  -26.473 22.191 1.00 69.49  ? 43  LEU B CD2 1 
ATOM   2240 N N   . LEU B 1 66  ? -8.936  -28.863 25.052 1.00 74.20  ? 44  LEU B N   1 
ATOM   2241 C CA  . LEU B 1 66  ? -9.296  -29.756 26.131 1.00 72.57  ? 44  LEU B CA  1 
ATOM   2242 C C   . LEU B 1 66  ? -9.552  -31.174 25.630 1.00 70.50  ? 44  LEU B C   1 
ATOM   2243 O O   . LEU B 1 66  ? -9.001  -32.131 26.158 1.00 73.03  ? 44  LEU B O   1 
ATOM   2244 C CB  . LEU B 1 66  ? -10.529 -29.232 26.870 1.00 73.29  ? 44  LEU B CB  1 
ATOM   2245 C CG  . LEU B 1 66  ? -10.923 -30.127 28.044 1.00 72.32  ? 44  LEU B CG  1 
ATOM   2246 C CD1 . LEU B 1 66  ? -9.791  -30.174 29.064 1.00 70.00  ? 44  LEU B CD1 1 
ATOM   2247 C CD2 . LEU B 1 66  ? -12.199 -29.658 28.682 1.00 72.19  ? 44  LEU B CD2 1 
ATOM   2248 N N   . SER B 1 67  ? -10.396 -31.300 24.617 1.00 72.42  ? 45  SER B N   1 
ATOM   2249 C CA  . SER B 1 67  ? -10.774 -32.603 24.091 1.00 71.84  ? 45  SER B CA  1 
ATOM   2250 C C   . SER B 1 67  ? -9.592  -33.348 23.476 1.00 71.83  ? 45  SER B C   1 
ATOM   2251 O O   . SER B 1 67  ? -9.427  -34.549 23.670 1.00 75.81  ? 45  SER B O   1 
ATOM   2252 C CB  . SER B 1 67  ? -11.874 -32.437 23.048 1.00 80.10  ? 45  SER B CB  1 
ATOM   2253 O OG  . SER B 1 67  ? -12.624 -33.631 22.893 1.00 90.71  ? 45  SER B OG  1 
ATOM   2254 N N   . VAL B 1 68  ? -8.780  -32.626 22.721 1.00 71.15  ? 46  VAL B N   1 
ATOM   2255 C CA  . VAL B 1 68  ? -7.574  -33.183 22.137 1.00 69.09  ? 46  VAL B CA  1 
ATOM   2256 C C   . VAL B 1 68  ? -6.658  -33.748 23.192 1.00 70.64  ? 46  VAL B C   1 
ATOM   2257 O O   . VAL B 1 68  ? -6.256  -34.906 23.115 1.00 75.25  ? 46  VAL B O   1 
ATOM   2258 C CB  . VAL B 1 68  ? -6.793  -32.122 21.333 1.00 66.51  ? 46  VAL B CB  1 
ATOM   2259 C CG1 . VAL B 1 68  ? -5.347  -32.558 21.124 1.00 62.69  ? 46  VAL B CG1 1 
ATOM   2260 C CG2 . VAL B 1 68  ? -7.472  -31.885 20.024 1.00 63.62  ? 46  VAL B CG2 1 
ATOM   2261 N N   . ALA B 1 69  ? -6.326  -32.911 24.170 1.00 72.22  ? 47  ALA B N   1 
ATOM   2262 C CA  . ALA B 1 69  ? -5.367  -33.258 25.205 1.00 73.06  ? 47  ALA B CA  1 
ATOM   2263 C C   . ALA B 1 69  ? -5.777  -34.535 25.923 1.00 71.40  ? 47  ALA B C   1 
ATOM   2264 O O   . ALA B 1 69  ? -4.959  -35.410 26.162 1.00 73.81  ? 47  ALA B O   1 
ATOM   2265 C CB  . ALA B 1 69  ? -5.222  -32.116 26.191 1.00 74.23  ? 47  ALA B CB  1 
ATOM   2266 N N   . TYR B 1 70  ? -7.052  -34.661 26.241 1.00 67.42  ? 48  TYR B N   1 
ATOM   2267 C CA  . TYR B 1 70  ? -7.489  -35.829 26.971 1.00 68.09  ? 48  TYR B CA  1 
ATOM   2268 C C   . TYR B 1 70  ? -7.745  -37.062 26.101 1.00 69.53  ? 48  TYR B C   1 
ATOM   2269 O O   . TYR B 1 70  ? -7.623  -38.184 26.596 1.00 67.80  ? 48  TYR B O   1 
ATOM   2270 C CB  . TYR B 1 70  ? -8.725  -35.478 27.788 1.00 70.12  ? 48  TYR B CB  1 
ATOM   2271 C CG  . TYR B 1 70  ? -8.369  -34.931 29.169 1.00 81.98  ? 48  TYR B CG  1 
ATOM   2272 C CD1 . TYR B 1 70  ? -7.724  -35.729 30.101 1.00 75.51  ? 48  TYR B CD1 1 
ATOM   2273 C CD2 . TYR B 1 70  ? -8.648  -33.613 29.525 1.00 80.51  ? 48  TYR B CD2 1 
ATOM   2274 C CE1 . TYR B 1 70  ? -7.403  -35.255 31.343 1.00 78.63  ? 48  TYR B CE1 1 
ATOM   2275 C CE2 . TYR B 1 70  ? -8.309  -33.126 30.780 1.00 75.00  ? 48  TYR B CE2 1 
ATOM   2276 C CZ  . TYR B 1 70  ? -7.692  -33.955 31.685 1.00 80.17  ? 48  TYR B CZ  1 
ATOM   2277 O OH  . TYR B 1 70  ? -7.353  -33.507 32.950 1.00 84.68  ? 48  TYR B OH  1 
ATOM   2278 N N   . LYS B 1 71  ? -8.091  -36.880 24.821 1.00 73.37  ? 49  LYS B N   1 
ATOM   2279 C CA  . LYS B 1 71  ? -8.197  -38.034 23.905 1.00 72.26  ? 49  LYS B CA  1 
ATOM   2280 C C   . LYS B 1 71  ? -6.813  -38.662 23.807 1.00 69.41  ? 49  LYS B C   1 
ATOM   2281 O O   . LYS B 1 71  ? -6.648  -39.878 23.850 1.00 66.86  ? 49  LYS B O   1 
ATOM   2282 C CB  . LYS B 1 71  ? -8.709  -37.639 22.511 1.00 57.52  ? 49  LYS B CB  1 
ATOM   2283 N N   . ASN B 1 72  ? -5.814  -37.803 23.710 1.00 66.49  ? 50  ASN B N   1 
ATOM   2284 C CA  . ASN B 1 72  ? -4.454  -38.253 23.610 1.00 66.95  ? 50  ASN B CA  1 
ATOM   2285 C C   . ASN B 1 72  ? -3.954  -38.906 24.872 1.00 70.69  ? 50  ASN B C   1 
ATOM   2286 O O   . ASN B 1 72  ? -3.290  -39.938 24.832 1.00 73.52  ? 50  ASN B O   1 
ATOM   2287 C CB  . ASN B 1 72  ? -3.551  -37.089 23.268 1.00 70.24  ? 50  ASN B CB  1 
ATOM   2288 C CG  . ASN B 1 72  ? -3.336  -36.964 21.803 1.00 75.31  ? 50  ASN B CG  1 
ATOM   2289 O OD1 . ASN B 1 72  ? -2.559  -37.718 21.221 1.00 73.83  ? 50  ASN B OD1 1 
ATOM   2290 N ND2 . ASN B 1 72  ? -4.030  -36.016 21.181 1.00 74.76  ? 50  ASN B ND2 1 
ATOM   2291 N N   . VAL B 1 73  ? -4.251  -38.277 25.995 1.00 70.94  ? 51  VAL B N   1 
ATOM   2292 C CA  . VAL B 1 73  ? -3.767  -38.756 27.264 1.00 67.10  ? 51  VAL B CA  1 
ATOM   2293 C C   . VAL B 1 73  ? -4.376  -40.114 27.549 1.00 64.77  ? 51  VAL B C   1 
ATOM   2294 O O   . VAL B 1 73  ? -3.650  -41.048 27.878 1.00 64.72  ? 51  VAL B O   1 
ATOM   2295 C CB  . VAL B 1 73  ? -4.075  -37.747 28.381 1.00 72.59  ? 51  VAL B CB  1 
ATOM   2296 C CG1 . VAL B 1 73  ? -4.126  -38.418 29.737 1.00 72.16  ? 51  VAL B CG1 1 
ATOM   2297 C CG2 . VAL B 1 73  ? -3.028  -36.633 28.365 1.00 68.01  ? 51  VAL B CG2 1 
ATOM   2298 N N   . VAL B 1 74  ? -5.687  -40.243 27.376 1.00 61.47  ? 52  VAL B N   1 
ATOM   2299 C CA  . VAL B 1 74  ? -6.342  -41.506 27.664 1.00 63.53  ? 52  VAL B CA  1 
ATOM   2300 C C   . VAL B 1 74  ? -6.119  -42.517 26.536 1.00 71.10  ? 52  VAL B C   1 
ATOM   2301 O O   . VAL B 1 74  ? -6.123  -43.741 26.771 1.00 69.68  ? 52  VAL B O   1 
ATOM   2302 C CB  . VAL B 1 74  ? -7.844  -41.318 27.906 1.00 64.66  ? 52  VAL B CB  1 
ATOM   2303 C CG1 . VAL B 1 74  ? -8.620  -41.347 26.614 1.00 61.55  ? 52  VAL B CG1 1 
ATOM   2304 C CG2 . VAL B 1 74  ? -8.356  -42.393 28.824 1.00 63.93  ? 52  VAL B CG2 1 
ATOM   2305 N N   . GLY B 1 75  ? -5.904  -42.005 25.321 1.00 67.06  ? 53  GLY B N   1 
ATOM   2306 C CA  . GLY B 1 75  ? -5.699  -42.848 24.167 1.00 63.28  ? 53  GLY B CA  1 
ATOM   2307 C C   . GLY B 1 75  ? -4.463  -43.697 24.362 1.00 69.28  ? 53  GLY B C   1 
ATOM   2308 O O   . GLY B 1 75  ? -4.493  -44.921 24.163 1.00 70.89  ? 53  GLY B O   1 
ATOM   2309 N N   . ALA B 1 76  ? -3.379  -43.040 24.767 1.00 68.75  ? 54  ALA B N   1 
ATOM   2310 C CA  . ALA B 1 76  ? -2.113  -43.705 25.051 1.00 63.23  ? 54  ALA B CA  1 
ATOM   2311 C C   . ALA B 1 76  ? -2.295  -44.865 26.004 1.00 68.54  ? 54  ALA B C   1 
ATOM   2312 O O   . ALA B 1 76  ? -1.786  -45.958 25.752 1.00 70.53  ? 54  ALA B O   1 
ATOM   2313 C CB  . ALA B 1 76  ? -1.127  -42.730 25.612 1.00 60.61  ? 54  ALA B CB  1 
ATOM   2314 N N   . ARG B 1 77  ? -3.024  -44.637 27.095 1.00 69.58  ? 55  ARG B N   1 
ATOM   2315 C CA  . ARG B 1 77  ? -3.203  -45.682 28.101 1.00 69.34  ? 55  ARG B CA  1 
ATOM   2316 C C   . ARG B 1 77  ? -4.064  -46.820 27.562 1.00 72.27  ? 55  ARG B C   1 
ATOM   2317 O O   . ARG B 1 77  ? -3.843  -47.991 27.895 1.00 72.34  ? 55  ARG B O   1 
ATOM   2318 C CB  . ARG B 1 77  ? -3.826  -45.127 29.384 1.00 67.85  ? 55  ARG B CB  1 
ATOM   2319 C CG  . ARG B 1 77  ? -2.848  -44.554 30.388 1.00 66.51  ? 55  ARG B CG  1 
ATOM   2320 C CD  . ARG B 1 77  ? -2.337  -43.240 29.910 1.00 70.74  ? 55  ARG B CD  1 
ATOM   2321 N NE  . ARG B 1 77  ? -1.410  -42.609 30.837 1.00 74.36  ? 55  ARG B NE  1 
ATOM   2322 C CZ  . ARG B 1 77  ? -0.869  -41.416 30.611 1.00 79.85  ? 55  ARG B CZ  1 
ATOM   2323 N NH1 . ARG B 1 77  ? -0.014  -40.898 31.479 1.00 79.01  ? 55  ARG B NH1 1 
ATOM   2324 N NH2 . ARG B 1 77  ? -1.182  -40.745 29.502 1.00 75.80  ? 55  ARG B NH2 1 
ATOM   2325 N N   . ARG B 1 78  ? -5.044  -46.480 26.731 1.00 69.91  ? 56  ARG B N   1 
ATOM   2326 C CA  . ARG B 1 78  ? -5.901  -47.492 26.127 1.00 68.65  ? 56  ARG B CA  1 
ATOM   2327 C C   . ARG B 1 78  ? -5.132  -48.424 25.176 1.00 68.90  ? 56  ARG B C   1 
ATOM   2328 O O   . ARG B 1 78  ? -5.253  -49.651 25.250 1.00 67.64  ? 56  ARG B O   1 
ATOM   2329 C CB  . ARG B 1 78  ? -7.049  -46.819 25.398 1.00 69.48  ? 56  ARG B CB  1 
ATOM   2330 C CG  . ARG B 1 78  ? -8.055  -46.207 26.329 1.00 66.02  ? 56  ARG B CG  1 
ATOM   2331 C CD  . ARG B 1 78  ? -9.068  -45.414 25.561 1.00 68.15  ? 56  ARG B CD  1 
ATOM   2332 N NE  . ARG B 1 78  ? -9.979  -46.275 24.816 1.00 73.16  ? 56  ARG B NE  1 
ATOM   2333 C CZ  . ARG B 1 78  ? -10.502 -45.968 23.632 1.00 73.95  ? 56  ARG B CZ  1 
ATOM   2334 N NH1 . ARG B 1 78  ? -10.197 -44.821 23.033 1.00 64.38  ? 56  ARG B NH1 1 
ATOM   2335 N NH2 . ARG B 1 78  ? -11.329 -46.819 23.049 1.00 75.59  ? 56  ARG B NH2 1 
ATOM   2336 N N   . SER B 1 79  ? -4.335  -47.846 24.292 1.00 62.42  ? 57  SER B N   1 
ATOM   2337 C CA  . SER B 1 79  ? -3.433  -48.654 23.499 1.00 68.51  ? 57  SER B CA  1 
ATOM   2338 C C   . SER B 1 79  ? -2.569  -49.593 24.366 1.00 72.28  ? 57  SER B C   1 
ATOM   2339 O O   . SER B 1 79  ? -2.510  -50.806 24.110 1.00 71.27  ? 57  SER B O   1 
ATOM   2340 C CB  . SER B 1 79  ? -2.536  -47.764 22.646 1.00 68.46  ? 57  SER B CB  1 
ATOM   2341 O OG  . SER B 1 79  ? -1.465  -48.522 22.116 1.00 77.46  ? 57  SER B OG  1 
ATOM   2342 N N   . SER B 1 80  ? -1.907  -49.033 25.382 1.00 71.36  ? 58  SER B N   1 
ATOM   2343 C CA  . SER B 1 80  ? -1.078  -49.825 26.300 1.00 69.38  ? 58  SER B CA  1 
ATOM   2344 C C   . SER B 1 80  ? -1.856  -50.964 26.923 1.00 67.56  ? 58  SER B C   1 
ATOM   2345 O O   . SER B 1 80  ? -1.359  -52.079 27.017 1.00 67.87  ? 58  SER B O   1 
ATOM   2346 C CB  . SER B 1 80  ? -0.497  -48.957 27.417 1.00 67.16  ? 58  SER B CB  1 
ATOM   2347 O OG  . SER B 1 80  ? 0.631   -48.228 26.983 1.00 65.40  ? 58  SER B OG  1 
ATOM   2348 N N   . TRP B 1 81  ? -3.076  -50.677 27.353 1.00 65.56  ? 59  TRP B N   1 
ATOM   2349 C CA  . TRP B 1 81  ? -3.908  -51.697 27.953 1.00 68.79  ? 59  TRP B CA  1 
ATOM   2350 C C   . TRP B 1 81  ? -4.178  -52.818 26.961 1.00 72.58  ? 59  TRP B C   1 
ATOM   2351 O O   . TRP B 1 81  ? -4.026  -53.991 27.292 1.00 73.89  ? 59  TRP B O   1 
ATOM   2352 C CB  . TRP B 1 81  ? -5.213  -51.090 28.448 1.00 69.26  ? 59  TRP B CB  1 
ATOM   2353 C CG  . TRP B 1 81  ? -6.119  -52.051 29.144 1.00 71.17  ? 59  TRP B CG  1 
ATOM   2354 C CD1 . TRP B 1 81  ? -6.142  -52.334 30.470 1.00 77.00  ? 59  TRP B CD1 1 
ATOM   2355 C CD2 . TRP B 1 81  ? -7.155  -52.844 28.548 1.00 76.28  ? 59  TRP B CD2 1 
ATOM   2356 N NE1 . TRP B 1 81  ? -7.124  -53.257 30.745 1.00 76.52  ? 59  TRP B NE1 1 
ATOM   2357 C CE2 . TRP B 1 81  ? -7.757  -53.587 29.580 1.00 75.49  ? 59  TRP B CE2 1 
ATOM   2358 C CE3 . TRP B 1 81  ? -7.629  -52.999 27.242 1.00 79.76  ? 59  TRP B CE3 1 
ATOM   2359 C CZ2 . TRP B 1 81  ? -8.809  -54.465 29.351 1.00 73.51  ? 59  TRP B CZ2 1 
ATOM   2360 C CZ3 . TRP B 1 81  ? -8.682  -53.879 27.019 1.00 73.78  ? 59  TRP B CZ3 1 
ATOM   2361 C CH2 . TRP B 1 81  ? -9.253  -54.598 28.068 1.00 71.42  ? 59  TRP B CH2 1 
ATOM   2362 N N   . ARG B 1 82  ? -4.560  -52.455 25.739 1.00 74.55  ? 60  ARG B N   1 
ATOM   2363 C CA  . ARG B 1 82  ? -4.877  -53.449 24.719 1.00 69.84  ? 60  ARG B CA  1 
ATOM   2364 C C   . ARG B 1 82  ? -3.653  -54.305 24.425 1.00 68.12  ? 60  ARG B C   1 
ATOM   2365 O O   . ARG B 1 82  ? -3.757  -55.523 24.315 1.00 73.64  ? 60  ARG B O   1 
ATOM   2366 C CB  . ARG B 1 82  ? -5.382  -52.773 23.442 1.00 74.61  ? 60  ARG B CB  1 
ATOM   2367 C CG  . ARG B 1 82  ? -6.741  -52.052 23.596 1.00 78.76  ? 60  ARG B CG  1 
ATOM   2368 C CD  . ARG B 1 82  ? -7.348  -51.633 22.257 1.00 70.01  ? 60  ARG B CD  1 
ATOM   2369 N NE  . ARG B 1 82  ? -6.483  -50.748 21.474 1.00 78.84  ? 60  ARG B NE  1 
ATOM   2370 C CZ  . ARG B 1 82  ? -6.609  -49.420 21.414 1.00 83.39  ? 60  ARG B CZ  1 
ATOM   2371 N NH1 . ARG B 1 82  ? -7.576  -48.807 22.091 1.00 74.35  ? 60  ARG B NH1 1 
ATOM   2372 N NH2 . ARG B 1 82  ? -5.776  -48.703 20.659 1.00 80.97  ? 60  ARG B NH2 1 
ATOM   2373 N N   . VAL B 1 83  ? -2.488  -53.671 24.322 1.00 66.30  ? 61  VAL B N   1 
ATOM   2374 C CA  . VAL B 1 83  ? -1.256  -54.405 24.018 1.00 68.14  ? 61  VAL B CA  1 
ATOM   2375 C C   . VAL B 1 83  ? -0.933  -55.419 25.100 1.00 72.52  ? 61  VAL B C   1 
ATOM   2376 O O   . VAL B 1 83  ? -0.768  -56.597 24.806 1.00 75.03  ? 61  VAL B O   1 
ATOM   2377 C CB  . VAL B 1 83  ? -0.046  -53.464 23.830 1.00 64.14  ? 61  VAL B CB  1 
ATOM   2378 C CG1 . VAL B 1 83  ? 1.264   -54.230 23.929 1.00 56.80  ? 61  VAL B CG1 1 
ATOM   2379 C CG2 . VAL B 1 83  ? -0.141  -52.751 22.504 1.00 63.93  ? 61  VAL B CG2 1 
ATOM   2380 N N   . VAL B 1 84  ? -0.855  -54.955 26.348 1.00 75.37  ? 62  VAL B N   1 
ATOM   2381 C CA  . VAL B 1 84  ? -0.582  -55.818 27.497 1.00 71.94  ? 62  VAL B CA  1 
ATOM   2382 C C   . VAL B 1 84  ? -1.686  -56.857 27.647 1.00 77.12  ? 62  VAL B C   1 
ATOM   2383 O O   . VAL B 1 84  ? -1.392  -58.031 27.867 1.00 80.04  ? 62  VAL B O   1 
ATOM   2384 C CB  . VAL B 1 84  ? -0.425  -54.992 28.815 1.00 71.44  ? 62  VAL B CB  1 
ATOM   2385 C CG1 . VAL B 1 84  ? -0.600  -55.856 30.039 1.00 71.74  ? 62  VAL B CG1 1 
ATOM   2386 C CG2 . VAL B 1 84  ? 0.936   -54.327 28.868 1.00 67.61  ? 62  VAL B CG2 1 
ATOM   2387 N N   . SER B 1 85  ? -2.946  -56.443 27.480 1.00 78.50  ? 63  SER B N   1 
ATOM   2388 C CA  . SER B 1 85  ? -4.083  -57.365 27.610 1.00 79.03  ? 63  SER B CA  1 
ATOM   2389 C C   . SER B 1 85  ? -4.010  -58.556 26.640 1.00 78.90  ? 63  SER B C   1 
ATOM   2390 O O   . SER B 1 85  ? -4.460  -59.650 26.955 1.00 84.52  ? 63  SER B O   1 
ATOM   2391 C CB  . SER B 1 85  ? -5.408  -56.626 27.415 1.00 73.53  ? 63  SER B CB  1 
ATOM   2392 O OG  . SER B 1 85  ? -6.458  -57.254 28.144 1.00 81.85  ? 63  SER B OG  1 
ATOM   2393 N N   . SER B 1 86  ? -3.416  -58.363 25.472 1.00 81.31  ? 64  SER B N   1 
ATOM   2394 C CA  . SER B 1 86  ? -3.322  -59.466 24.521 1.00 88.25  ? 64  SER B CA  1 
ATOM   2395 C C   . SER B 1 86  ? -2.220  -60.446 24.925 1.00 89.56  ? 64  SER B C   1 
ATOM   2396 O O   . SER B 1 86  ? -2.402  -61.662 24.841 1.00 96.24  ? 64  SER B O   1 
ATOM   2397 C CB  . SER B 1 86  ? -3.080  -58.947 23.097 1.00 86.39  ? 64  SER B CB  1 
ATOM   2398 O OG  . SER B 1 86  ? -1.697  -58.770 22.830 1.00 92.79  ? 64  SER B OG  1 
ATOM   2399 N N   . ILE B 1 87  ? -1.081  -59.911 25.359 1.00 85.32  ? 65  ILE B N   1 
ATOM   2400 C CA  . ILE B 1 87  ? 0.031   -60.722 25.851 1.00 87.88  ? 65  ILE B CA  1 
ATOM   2401 C C   . ILE B 1 87  ? -0.400  -61.619 27.010 1.00 93.38  ? 65  ILE B C   1 
ATOM   2402 O O   . ILE B 1 87  ? 0.102   -62.733 27.189 1.00 95.89  ? 65  ILE B O   1 
ATOM   2403 C CB  . ILE B 1 87  ? 1.179   -59.841 26.317 1.00 80.40  ? 65  ILE B CB  1 
ATOM   2404 C CG1 . ILE B 1 87  ? 1.569   -58.880 25.204 1.00 74.81  ? 65  ILE B CG1 1 
ATOM   2405 C CG2 . ILE B 1 87  ? 2.354   -60.686 26.769 1.00 79.78  ? 65  ILE B CG2 1 
ATOM   2406 C CD1 . ILE B 1 87  ? 2.743   -58.007 25.541 1.00 76.95  ? 65  ILE B CD1 1 
ATOM   2407 N N   . GLU B 1 88  ? -1.338  -61.112 27.794 1.00 88.23  ? 66  GLU B N   1 
ATOM   2408 C CA  . GLU B 1 88  ? -1.907  -61.865 28.879 1.00 90.76  ? 66  GLU B CA  1 
ATOM   2409 C C   . GLU B 1 88  ? -2.543  -63.143 28.345 1.00 98.13  ? 66  GLU B C   1 
ATOM   2410 O O   . GLU B 1 88  ? -2.287  -64.227 28.868 1.00 104.15 ? 66  GLU B O   1 
ATOM   2411 C CB  . GLU B 1 88  ? -2.926  -61.005 29.615 1.00 93.04  ? 66  GLU B CB  1 
ATOM   2412 C CG  . GLU B 1 88  ? -3.315  -61.511 30.976 1.00 89.30  ? 66  GLU B CG  1 
ATOM   2413 C CD  . GLU B 1 88  ? -4.408  -60.673 31.585 1.00 90.38  ? 66  GLU B CD  1 
ATOM   2414 O OE1 . GLU B 1 88  ? -4.932  -59.774 30.890 1.00 91.01  ? 66  GLU B OE1 1 
ATOM   2415 O OE2 . GLU B 1 88  ? -4.759  -60.923 32.749 1.00 93.03  ? 66  GLU B OE2 1 
ATOM   2416 N N   . GLN B 1 89  ? -3.337  -63.020 27.279 1.00 100.69 ? 67  GLN B N   1 
ATOM   2417 C CA  . GLN B 1 89  ? -4.073  -64.166 26.717 1.00 104.06 ? 67  GLN B CA  1 
ATOM   2418 C C   . GLN B 1 89  ? -3.278  -65.055 25.772 1.00 100.27 ? 67  GLN B C   1 
ATOM   2419 O O   . GLN B 1 89  ? -3.533  -66.257 25.705 1.00 101.69 ? 67  GLN B O   1 
ATOM   2420 C CB  . GLN B 1 89  ? -5.322  -63.691 25.986 1.00 102.87 ? 67  GLN B CB  1 
ATOM   2421 C CG  . GLN B 1 89  ? -6.429  -63.282 26.927 1.00 105.95 ? 67  GLN B CG  1 
ATOM   2422 C CD  . GLN B 1 89  ? -6.816  -61.837 26.736 1.00 107.11 ? 67  GLN B CD  1 
ATOM   2423 O OE1 . GLN B 1 89  ? -7.076  -61.397 25.610 1.00 105.12 ? 67  GLN B OE1 1 
ATOM   2424 N NE2 . GLN B 1 89  ? -6.828  -61.074 27.831 1.00 102.21 ? 67  GLN B NE2 1 
ATOM   2425 N N   . LYS B 1 90  ? -2.326  -64.478 25.043 1.00 95.44  ? 68  LYS B N   1 
ATOM   2426 C CA  . LYS B 1 90  ? -1.438  -65.279 24.202 1.00 101.13 ? 68  LYS B CA  1 
ATOM   2427 C C   . LYS B 1 90  ? -0.422  -66.046 25.067 1.00 108.19 ? 68  LYS B C   1 
ATOM   2428 O O   . LYS B 1 90  ? 0.606   -66.507 24.574 1.00 109.27 ? 68  LYS B O   1 
ATOM   2429 C CB  . LYS B 1 90  ? -0.723  -64.396 23.175 1.00 92.01  ? 68  LYS B CB  1 
ATOM   2430 N N   . THR B 1 91  ? -0.733  -66.173 26.358 1.00 110.99 ? 69  THR B N   1 
ATOM   2431 C CA  . THR B 1 91  ? 0.081   -66.900 27.333 1.00 115.81 ? 69  THR B CA  1 
ATOM   2432 C C   . THR B 1 91  ? -0.789  -67.922 28.086 1.00 122.19 ? 69  THR B C   1 
ATOM   2433 O O   . THR B 1 91  ? -0.910  -67.862 29.314 1.00 122.96 ? 69  THR B O   1 
ATOM   2434 C CB  . THR B 1 91  ? 0.756   -65.927 28.347 1.00 106.28 ? 69  THR B CB  1 
ATOM   2435 O OG1 . THR B 1 91  ? 1.264   -64.787 27.644 1.00 103.99 ? 69  THR B OG1 1 
ATOM   2436 C CG2 . THR B 1 91  ? 1.901   -66.603 29.104 1.00 103.24 ? 69  THR B CG2 1 
ATOM   2437 N N   . GLU B 1 92  ? -1.397  -68.853 27.348 1.00 123.69 ? 70  GLU B N   1 
ATOM   2438 C CA  . GLU B 1 92  ? -2.259  -69.878 27.946 1.00 121.09 ? 70  GLU B CA  1 
ATOM   2439 C C   . GLU B 1 92  ? -1.448  -70.946 28.691 1.00 123.24 ? 70  GLU B C   1 
ATOM   2440 O O   . GLU B 1 92  ? -0.880  -70.694 29.762 1.00 119.57 ? 70  GLU B O   1 
ATOM   2441 C CB  . GLU B 1 92  ? -3.132  -70.539 26.870 1.00 114.73 ? 70  GLU B CB  1 
ATOM   2442 N N   . GLU B 1 95  ? 3.775   -69.130 31.816 1.00 98.63  ? 73  GLU B N   1 
ATOM   2443 C CA  . GLU B 1 95  ? 2.467   -68.911 32.429 1.00 102.54 ? 73  GLU B CA  1 
ATOM   2444 C C   . GLU B 1 95  ? 2.553   -68.426 33.883 1.00 103.43 ? 73  GLU B C   1 
ATOM   2445 O O   . GLU B 1 95  ? 1.533   -68.280 34.559 1.00 101.26 ? 73  GLU B O   1 
ATOM   2446 C CB  . GLU B 1 95  ? 1.632   -70.191 32.357 1.00 109.39 ? 73  GLU B CB  1 
ATOM   2447 N N   . LYS B 1 96  ? 3.768   -68.201 34.376 1.00 106.75 ? 74  LYS B N   1 
ATOM   2448 C CA  . LYS B 1 96  ? 3.956   -67.390 35.587 1.00 106.37 ? 74  LYS B CA  1 
ATOM   2449 C C   . LYS B 1 96  ? 4.145   -65.952 35.117 1.00 105.72 ? 74  LYS B C   1 
ATOM   2450 O O   . LYS B 1 96  ? 4.006   -64.994 35.885 1.00 98.02  ? 74  LYS B O   1 
ATOM   2451 C CB  . LYS B 1 96  ? 5.160   -67.856 36.415 1.00 98.76  ? 74  LYS B CB  1 
ATOM   2452 N N   . LYS B 1 97  ? 4.472   -65.839 33.828 1.00 103.25 ? 75  LYS B N   1 
ATOM   2453 C CA  . LYS B 1 97  ? 4.655   -64.573 33.140 1.00 92.83  ? 75  LYS B CA  1 
ATOM   2454 C C   . LYS B 1 97  ? 3.296   -63.922 32.893 1.00 98.01  ? 75  LYS B C   1 
ATOM   2455 O O   . LYS B 1 97  ? 3.182   -62.697 32.784 1.00 94.41  ? 75  LYS B O   1 
ATOM   2456 C CB  . LYS B 1 97  ? 5.409   -64.784 31.817 1.00 81.10  ? 75  LYS B CB  1 
ATOM   2457 N N   . GLN B 1 98  ? 2.257   -64.745 32.810 1.00 101.83 ? 76  GLN B N   1 
ATOM   2458 C CA  . GLN B 1 98  ? 0.920   -64.205 32.614 1.00 98.02  ? 76  GLN B CA  1 
ATOM   2459 C C   . GLN B 1 98  ? 0.532   -63.332 33.797 1.00 92.71  ? 76  GLN B C   1 
ATOM   2460 O O   . GLN B 1 98  ? -0.130  -62.312 33.622 1.00 90.06  ? 76  GLN B O   1 
ATOM   2461 C CB  . GLN B 1 98  ? -0.108  -65.318 32.420 1.00 102.82 ? 76  GLN B CB  1 
ATOM   2462 C CG  . GLN B 1 98  ? -1.503  -64.790 32.137 1.00 103.12 ? 76  GLN B CG  1 
ATOM   2463 C CD  . GLN B 1 98  ? -2.492  -65.875 31.769 1.00 104.22 ? 76  GLN B CD  1 
ATOM   2464 O OE1 . GLN B 1 98  ? -2.130  -67.043 31.630 1.00 110.92 ? 76  GLN B OE1 1 
ATOM   2465 N NE2 . GLN B 1 98  ? -3.754  -65.493 31.612 1.00 99.08  ? 76  GLN B NE2 1 
ATOM   2466 N N   . GLN B 1 99  ? 0.959   -63.727 34.995 1.00 95.14  ? 77  GLN B N   1 
ATOM   2467 C CA  . GLN B 1 99  ? 0.630   -62.979 36.202 1.00 90.52  ? 77  GLN B CA  1 
ATOM   2468 C C   . GLN B 1 99  ? 1.215   -61.576 36.131 1.00 92.40  ? 77  GLN B C   1 
ATOM   2469 O O   . GLN B 1 99  ? 0.590   -60.600 36.566 1.00 90.92  ? 77  GLN B O   1 
ATOM   2470 C CB  . GLN B 1 99  ? 1.140   -63.701 37.451 1.00 91.62  ? 77  GLN B CB  1 
ATOM   2471 C CG  . GLN B 1 99  ? 0.818   -62.987 38.779 1.00 92.35  ? 77  GLN B CG  1 
ATOM   2472 C CD  . GLN B 1 99  ? -0.684  -62.842 39.048 1.00 96.01  ? 77  GLN B CD  1 
ATOM   2473 O OE1 . GLN B 1 99  ? -1.505  -63.600 38.529 1.00 102.17 ? 77  GLN B OE1 1 
ATOM   2474 N NE2 . GLN B 1 99  ? -1.042  -61.855 39.854 1.00 94.02  ? 77  GLN B NE2 1 
ATOM   2475 N N   . MET B 1 100 ? 2.412   -61.468 35.569 1.00 86.66  ? 78  MET B N   1 
ATOM   2476 C CA  . MET B 1 100 ? 3.033   -60.167 35.468 1.00 83.72  ? 78  MET B CA  1 
ATOM   2477 C C   . MET B 1 100 ? 2.323   -59.314 34.446 1.00 88.24  ? 78  MET B C   1 
ATOM   2478 O O   . MET B 1 100 ? 2.153   -58.114 34.648 1.00 88.55  ? 78  MET B O   1 
ATOM   2479 C CB  . MET B 1 100 ? 4.495   -60.289 35.114 1.00 83.31  ? 78  MET B CB  1 
ATOM   2480 C CG  . MET B 1 100 ? 5.262   -60.969 36.189 1.00 86.80  ? 78  MET B CG  1 
ATOM   2481 S SD  . MET B 1 100 ? 6.957   -60.484 36.022 1.00 109.65 ? 78  MET B SD  1 
ATOM   2482 C CE  . MET B 1 100 ? 6.728   -58.732 36.294 1.00 92.44  ? 78  MET B CE  1 
ATOM   2483 N N   . ALA B 1 101 ? 1.907   -59.935 33.347 1.00 88.10  ? 79  ALA B N   1 
ATOM   2484 C CA  . ALA B 1 101 ? 1.154   -59.221 32.337 1.00 80.84  ? 79  ALA B CA  1 
ATOM   2485 C C   . ALA B 1 101 ? -0.147  -58.744 32.947 1.00 82.40  ? 79  ALA B C   1 
ATOM   2486 O O   . ALA B 1 101 ? -0.539  -57.592 32.773 1.00 85.28  ? 79  ALA B O   1 
ATOM   2487 C CB  . ALA B 1 101 ? 0.902   -60.095 31.129 1.00 84.54  ? 79  ALA B CB  1 
ATOM   2488 N N   . ARG B 1 102 ? -0.802  -59.627 33.684 1.00 82.24  ? 80  ARG B N   1 
ATOM   2489 C CA  . ARG B 1 102 ? -2.059  -59.280 34.327 1.00 84.82  ? 80  ARG B CA  1 
ATOM   2490 C C   . ARG B 1 102 ? -1.901  -58.084 35.284 1.00 82.16  ? 80  ARG B C   1 
ATOM   2491 O O   . ARG B 1 102 ? -2.706  -57.150 35.262 1.00 80.38  ? 80  ARG B O   1 
ATOM   2492 C CB  . ARG B 1 102 ? -2.621  -60.502 35.061 1.00 87.47  ? 80  ARG B CB  1 
ATOM   2493 C CG  . ARG B 1 102 ? -3.574  -60.166 36.175 1.00 91.03  ? 80  ARG B CG  1 
ATOM   2494 C CD  . ARG B 1 102 ? -4.350  -61.373 36.645 1.00 94.98  ? 80  ARG B CD  1 
ATOM   2495 N NE  . ARG B 1 102 ? -5.204  -61.008 37.771 1.00 101.76 ? 80  ARG B NE  1 
ATOM   2496 C CZ  . ARG B 1 102 ? -6.450  -61.441 37.937 1.00 103.65 ? 80  ARG B CZ  1 
ATOM   2497 N NH1 . ARG B 1 102 ? -7.001  -62.255 37.040 1.00 100.80 ? 80  ARG B NH1 1 
ATOM   2498 N NH2 . ARG B 1 102 ? -7.149  -61.047 38.994 1.00 97.24  ? 80  ARG B NH2 1 
ATOM   2499 N N   . GLU B 1 103 ? -0.857  -58.093 36.104 1.00 78.00  ? 81  GLU B N   1 
ATOM   2500 C CA  . GLU B 1 103 ? -0.703  -57.034 37.087 1.00 80.33  ? 81  GLU B CA  1 
ATOM   2501 C C   . GLU B 1 103 ? -0.349  -55.710 36.456 1.00 76.64  ? 81  GLU B C   1 
ATOM   2502 O O   . GLU B 1 103 ? -0.851  -54.668 36.873 1.00 75.19  ? 81  GLU B O   1 
ATOM   2503 C CB  . GLU B 1 103 ? 0.347   -57.404 38.117 1.00 89.15  ? 81  GLU B CB  1 
ATOM   2504 C CG  . GLU B 1 103 ? -0.216  -58.144 39.324 1.00 88.82  ? 81  GLU B CG  1 
ATOM   2505 C CD  . GLU B 1 103 ? 0.876   -58.584 40.262 1.00 85.37  ? 81  GLU B CD  1 
ATOM   2506 O OE1 . GLU B 1 103 ? 1.826   -57.798 40.478 1.00 86.47  ? 81  GLU B OE1 1 
ATOM   2507 O OE2 . GLU B 1 103 ? 0.806   -59.732 40.746 1.00 89.30  ? 81  GLU B OE2 1 
ATOM   2508 N N   . TYR B 1 104 ? 0.517   -55.754 35.451 1.00 77.90  ? 82  TYR B N   1 
ATOM   2509 C CA  . TYR B 1 104 ? 0.830   -54.568 34.670 1.00 69.51  ? 82  TYR B CA  1 
ATOM   2510 C C   . TYR B 1 104 ? -0.452  -54.018 34.064 1.00 73.21  ? 82  TYR B C   1 
ATOM   2511 O O   . TYR B 1 104 ? -0.698  -52.818 34.100 1.00 73.75  ? 82  TYR B O   1 
ATOM   2512 C CB  . TYR B 1 104 ? 1.841   -54.885 33.579 1.00 62.85  ? 82  TYR B CB  1 
ATOM   2513 C CG  . TYR B 1 104 ? 2.530   -53.663 33.039 1.00 64.97  ? 82  TYR B CG  1 
ATOM   2514 C CD1 . TYR B 1 104 ? 2.766   -52.580 33.846 1.00 69.53  ? 82  TYR B CD1 1 
ATOM   2515 C CD2 . TYR B 1 104 ? 2.941   -53.589 31.720 1.00 72.96  ? 82  TYR B CD2 1 
ATOM   2516 C CE1 . TYR B 1 104 ? 3.407   -51.463 33.379 1.00 67.91  ? 82  TYR B CE1 1 
ATOM   2517 C CE2 . TYR B 1 104 ? 3.580   -52.464 31.234 1.00 71.64  ? 82  TYR B CE2 1 
ATOM   2518 C CZ  . TYR B 1 104 ? 3.803   -51.399 32.077 1.00 70.24  ? 82  TYR B CZ  1 
ATOM   2519 O OH  . TYR B 1 104 ? 4.429   -50.260 31.622 1.00 69.55  ? 82  TYR B OH  1 
ATOM   2520 N N   . ARG B 1 105 ? -1.278  -54.910 33.527 1.00 72.61  ? 83  ARG B N   1 
ATOM   2521 C CA  . ARG B 1 105 ? -2.571  -54.529 32.978 1.00 72.97  ? 83  ARG B CA  1 
ATOM   2522 C C   . ARG B 1 105 ? -3.447  -53.821 34.005 1.00 78.18  ? 83  ARG B C   1 
ATOM   2523 O O   . ARG B 1 105 ? -4.148  -52.852 33.685 1.00 78.36  ? 83  ARG B O   1 
ATOM   2524 C CB  . ARG B 1 105 ? -3.304  -55.756 32.442 1.00 79.75  ? 83  ARG B CB  1 
ATOM   2525 C CG  . ARG B 1 105 ? -4.508  -55.428 31.552 1.00 80.32  ? 83  ARG B CG  1 
ATOM   2526 C CD  . ARG B 1 105 ? -5.797  -55.894 32.184 1.00 79.41  ? 83  ARG B CD  1 
ATOM   2527 N NE  . ARG B 1 105 ? -5.778  -57.326 32.443 1.00 74.91  ? 83  ARG B NE  1 
ATOM   2528 C CZ  . ARG B 1 105 ? -6.429  -57.901 33.442 1.00 81.21  ? 83  ARG B CZ  1 
ATOM   2529 N NH1 . ARG B 1 105 ? -7.152  -57.169 34.285 1.00 82.56  ? 83  ARG B NH1 1 
ATOM   2530 N NH2 . ARG B 1 105 ? -6.352  -59.210 33.601 1.00 90.58  ? 83  ARG B NH2 1 
ATOM   2531 N N   . GLU B 1 106 ? -3.405  -54.301 35.243 1.00 79.95  ? 84  GLU B N   1 
ATOM   2532 C CA  . GLU B 1 106 ? -4.212  -53.711 36.302 1.00 76.82  ? 84  GLU B CA  1 
ATOM   2533 C C   . GLU B 1 106 ? -3.680  -52.337 36.710 1.00 72.70  ? 84  GLU B C   1 
ATOM   2534 O O   . GLU B 1 106 ? -4.456  -51.408 36.963 1.00 73.16  ? 84  GLU B O   1 
ATOM   2535 C CB  . GLU B 1 106 ? -4.268  -54.656 37.492 1.00 79.75  ? 84  GLU B CB  1 
ATOM   2536 C CG  . GLU B 1 106 ? -5.099  -55.903 37.209 1.00 86.50  ? 84  GLU B CG  1 
ATOM   2537 C CD  . GLU B 1 106 ? -5.011  -56.953 38.303 1.00 92.54  ? 84  GLU B CD  1 
ATOM   2538 O OE1 . GLU B 1 106 ? -4.459  -56.653 39.395 1.00 93.90  ? 84  GLU B OE1 1 
ATOM   2539 O OE2 . GLU B 1 106 ? -5.492  -58.082 38.052 1.00 90.03  ? 84  GLU B OE2 1 
ATOM   2540 N N   . LYS B 1 107 ? -2.359  -52.205 36.755 1.00 67.68  ? 85  LYS B N   1 
ATOM   2541 C CA  . LYS B 1 107 ? -1.752  -50.920 37.053 1.00 67.17  ? 85  LYS B CA  1 
ATOM   2542 C C   . LYS B 1 107 ? -2.197  -49.915 36.004 1.00 75.95  ? 85  LYS B C   1 
ATOM   2543 O O   . LYS B 1 107 ? -2.512  -48.757 36.312 1.00 75.39  ? 85  LYS B O   1 
ATOM   2544 C CB  . LYS B 1 107 ? -0.232  -51.028 37.086 1.00 64.99  ? 85  LYS B CB  1 
ATOM   2545 N N   . ILE B 1 108 ? -2.253  -50.379 34.759 1.00 73.52  ? 86  ILE B N   1 
ATOM   2546 C CA  . ILE B 1 108 ? -2.659  -49.525 33.657 1.00 71.52  ? 86  ILE B CA  1 
ATOM   2547 C C   . ILE B 1 108 ? -4.132  -49.155 33.793 1.00 75.74  ? 86  ILE B C   1 
ATOM   2548 O O   . ILE B 1 108 ? -4.484  -47.985 33.640 1.00 74.65  ? 86  ILE B O   1 
ATOM   2549 C CB  . ILE B 1 108 ? -2.390  -50.192 32.308 1.00 68.62  ? 86  ILE B CB  1 
ATOM   2550 C CG1 . ILE B 1 108 ? -0.890  -50.237 32.055 1.00 69.99  ? 86  ILE B CG1 1 
ATOM   2551 C CG2 . ILE B 1 108 ? -3.015  -49.403 31.210 1.00 71.51  ? 86  ILE B CG2 1 
ATOM   2552 C CD1 . ILE B 1 108 ? -0.502  -50.863 30.773 1.00 66.06  ? 86  ILE B CD1 1 
ATOM   2553 N N   . GLU B 1 109 ? -4.985  -50.128 34.122 1.00 75.00  ? 87  GLU B N   1 
ATOM   2554 C CA  . GLU B 1 109 ? -6.412  -49.838 34.305 1.00 75.06  ? 87  GLU B CA  1 
ATOM   2555 C C   . GLU B 1 109 ? -6.599  -48.731 35.344 1.00 76.88  ? 87  GLU B C   1 
ATOM   2556 O O   . GLU B 1 109 ? -7.533  -47.922 35.257 1.00 74.66  ? 87  GLU B O   1 
ATOM   2557 C CB  . GLU B 1 109 ? -7.192  -51.089 34.728 1.00 74.53  ? 87  GLU B CB  1 
ATOM   2558 C CG  . GLU B 1 109 ? -7.193  -52.213 33.711 1.00 78.55  ? 87  GLU B CG  1 
ATOM   2559 C CD  . GLU B 1 109 ? -8.151  -53.349 34.062 1.00 85.98  ? 87  GLU B CD  1 
ATOM   2560 O OE1 . GLU B 1 109 ? -8.711  -53.342 35.183 1.00 91.94  ? 87  GLU B OE1 1 
ATOM   2561 O OE2 . GLU B 1 109 ? -8.348  -54.251 33.212 1.00 84.10  ? 87  GLU B OE2 1 
ATOM   2562 N N   . THR B 1 110 ? -5.693  -48.688 36.318 1.00 75.34  ? 88  THR B N   1 
ATOM   2563 C CA  . THR B 1 110 ? -5.754  -47.657 37.345 1.00 78.03  ? 88  THR B CA  1 
ATOM   2564 C C   . THR B 1 110 ? -5.486  -46.273 36.772 1.00 76.84  ? 88  THR B C   1 
ATOM   2565 O O   . THR B 1 110 ? -6.259  -45.348 37.008 1.00 71.44  ? 88  THR B O   1 
ATOM   2566 C CB  . THR B 1 110 ? -4.758  -47.920 38.469 1.00 78.05  ? 88  THR B CB  1 
ATOM   2567 O OG1 . THR B 1 110 ? -5.131  -49.115 39.160 1.00 77.48  ? 88  THR B OG1 1 
ATOM   2568 C CG2 . THR B 1 110 ? -4.766  -46.766 39.434 1.00 71.71  ? 88  THR B CG2 1 
ATOM   2569 N N   . GLU B 1 111 ? -4.393  -46.136 36.021 1.00 73.93  ? 89  GLU B N   1 
ATOM   2570 C CA  . GLU B 1 111 ? -4.094  -44.870 35.363 1.00 73.10  ? 89  GLU B CA  1 
ATOM   2571 C C   . GLU B 1 111 ? -5.287  -44.477 34.528 1.00 73.34  ? 89  GLU B C   1 
ATOM   2572 O O   . GLU B 1 111 ? -5.687  -43.321 34.491 1.00 76.93  ? 89  GLU B O   1 
ATOM   2573 C CB  . GLU B 1 111 ? -2.845  -44.962 34.485 1.00 68.38  ? 89  GLU B CB  1 
ATOM   2574 C CG  . GLU B 1 111 ? -1.557  -45.079 35.247 1.00 70.44  ? 89  GLU B CG  1 
ATOM   2575 C CD  . GLU B 1 111 ? -0.332  -44.779 34.413 1.00 82.05  ? 89  GLU B CD  1 
ATOM   2576 O OE1 . GLU B 1 111 ? -0.424  -44.740 33.165 1.00 82.14  ? 89  GLU B OE1 1 
ATOM   2577 O OE2 . GLU B 1 111 ? 0.743   -44.575 35.018 1.00 96.62  ? 89  GLU B OE2 1 
ATOM   2578 N N   . LEU B 1 112 ? -5.874  -45.469 33.881 1.00 74.03  ? 90  LEU B N   1 
ATOM   2579 C CA  . LEU B 1 112 ? -6.988  -45.232 32.992 1.00 75.53  ? 90  LEU B CA  1 
ATOM   2580 C C   . LEU B 1 112 ? -8.170  -44.615 33.728 1.00 73.77  ? 90  LEU B C   1 
ATOM   2581 O O   . LEU B 1 112 ? -8.673  -43.547 33.352 1.00 71.27  ? 90  LEU B O   1 
ATOM   2582 C CB  . LEU B 1 112 ? -7.412  -46.538 32.333 1.00 79.97  ? 90  LEU B CB  1 
ATOM   2583 C CG  . LEU B 1 112 ? -8.135  -46.354 31.007 1.00 69.49  ? 90  LEU B CG  1 
ATOM   2584 C CD1 . LEU B 1 112 ? -7.258  -45.515 30.151 1.00 73.10  ? 90  LEU B CD1 1 
ATOM   2585 C CD2 . LEU B 1 112 ? -8.399  -47.683 30.363 1.00 75.55  ? 90  LEU B CD2 1 
ATOM   2586 N N   . ARG B 1 113 ? -8.603  -45.294 34.781 1.00 70.64  ? 91  ARG B N   1 
ATOM   2587 C CA  . ARG B 1 113 ? -9.751  -44.839 35.554 1.00 76.10  ? 91  ARG B CA  1 
ATOM   2588 C C   . ARG B 1 113 ? -9.551  -43.452 36.171 1.00 74.20  ? 91  ARG B C   1 
ATOM   2589 O O   . ARG B 1 113 ? -10.492 -42.672 36.218 1.00 73.28  ? 91  ARG B O   1 
ATOM   2590 C CB  . ARG B 1 113 ? -10.079 -45.847 36.656 1.00 75.87  ? 91  ARG B CB  1 
ATOM   2591 C CG  . ARG B 1 113 ? -10.440 -47.215 36.132 1.00 73.59  ? 91  ARG B CG  1 
ATOM   2592 C CD  . ARG B 1 113 ? -11.044 -48.081 37.212 1.00 75.45  ? 91  ARG B CD  1 
ATOM   2593 N NE  . ARG B 1 113 ? -11.277 -49.441 36.743 1.00 78.45  ? 91  ARG B NE  1 
ATOM   2594 C CZ  . ARG B 1 113 ? -10.342 -50.384 36.726 1.00 82.10  ? 91  ARG B CZ  1 
ATOM   2595 N NH1 . ARG B 1 113 ? -9.118  -50.104 37.154 1.00 82.38  ? 91  ARG B NH1 1 
ATOM   2596 N NH2 . ARG B 1 113 ? -10.625 -51.603 36.283 1.00 84.25  ? 91  ARG B NH2 1 
ATOM   2597 N N   . ASP B 1 114 ? -8.343  -43.146 36.640 1.00 69.92  ? 92  ASP B N   1 
ATOM   2598 C CA  . ASP B 1 114 ? -8.091  -41.836 37.214 1.00 73.55  ? 92  ASP B CA  1 
ATOM   2599 C C   . ASP B 1 114 ? -8.359  -40.791 36.154 1.00 78.01  ? 92  ASP B C   1 
ATOM   2600 O O   . ASP B 1 114 ? -9.122  -39.838 36.371 1.00 78.96  ? 92  ASP B O   1 
ATOM   2601 C CB  . ASP B 1 114 ? -6.650  -41.684 37.731 1.00 81.58  ? 92  ASP B CB  1 
ATOM   2602 C CG  . ASP B 1 114 ? -6.280  -42.710 38.805 1.00 91.61  ? 92  ASP B CG  1 
ATOM   2603 O OD1 . ASP B 1 114 ? -7.163  -43.130 39.600 1.00 88.37  ? 92  ASP B OD1 1 
ATOM   2604 O OD2 . ASP B 1 114 ? -5.081  -43.091 38.850 1.00 93.83  ? 92  ASP B OD2 1 
ATOM   2605 N N   . ILE B 1 115 ? -7.738  -40.989 34.994 1.00 78.62  ? 93  ILE B N   1 
ATOM   2606 C CA  . ILE B 1 115 ? -7.853  -40.037 33.898 1.00 75.57  ? 93  ILE B CA  1 
ATOM   2607 C C   . ILE B 1 115 ? -9.302  -39.847 33.469 1.00 74.75  ? 93  ILE B C   1 
ATOM   2608 O O   . ILE B 1 115 ? -9.771  -38.722 33.340 1.00 74.53  ? 93  ILE B O   1 
ATOM   2609 C CB  . ILE B 1 115 ? -7.028  -40.472 32.703 1.00 70.88  ? 93  ILE B CB  1 
ATOM   2610 C CG1 . ILE B 1 115 ? -5.576  -40.647 33.122 1.00 67.08  ? 93  ILE B CG1 1 
ATOM   2611 C CG2 . ILE B 1 115 ? -7.157  -39.444 31.556 1.00 73.34  ? 93  ILE B CG2 1 
ATOM   2612 C CD1 . ILE B 1 115 ? -4.674  -41.109 32.007 1.00 68.67  ? 93  ILE B CD1 1 
ATOM   2613 N N   . CYS B 1 116 ? -10.015 -40.943 33.258 1.00 68.38  ? 94  CYS B N   1 
ATOM   2614 C CA  . CYS B 1 116 ? -11.393 -40.821 32.838 1.00 72.82  ? 94  CYS B CA  1 
ATOM   2615 C C   . CYS B 1 116 ? -12.181 -40.048 33.883 1.00 75.14  ? 94  CYS B C   1 
ATOM   2616 O O   . CYS B 1 116 ? -12.921 -39.120 33.557 1.00 74.19  ? 94  CYS B O   1 
ATOM   2617 C CB  . CYS B 1 116 ? -12.015 -42.196 32.593 1.00 74.26  ? 94  CYS B CB  1 
ATOM   2618 S SG  . CYS B 1 116 ? -11.423 -43.015 31.098 1.00 71.62  ? 94  CYS B SG  1 
ATOM   2619 N N   . ASN B 1 117 ? -11.989 -40.406 35.147 1.00 77.43  ? 95  ASN B N   1 
ATOM   2620 C CA  . ASN B 1 117 ? -12.765 -39.793 36.221 1.00 79.21  ? 95  ASN B CA  1 
ATOM   2621 C C   . ASN B 1 117 ? -12.459 -38.310 36.411 1.00 82.16  ? 95  ASN B C   1 
ATOM   2622 O O   . ASN B 1 117 ? -13.383 -37.532 36.626 1.00 87.19  ? 95  ASN B O   1 
ATOM   2623 C CB  . ASN B 1 117 ? -12.559 -40.541 37.539 1.00 76.46  ? 95  ASN B CB  1 
ATOM   2624 C CG  . ASN B 1 117 ? -13.363 -41.837 37.600 1.00 85.37  ? 95  ASN B CG  1 
ATOM   2625 O OD1 . ASN B 1 117 ? -12.814 -42.902 37.898 1.00 86.71  ? 95  ASN B OD1 1 
ATOM   2626 N ND2 . ASN B 1 117 ? -14.670 -41.754 37.313 1.00 77.68  ? 95  ASN B ND2 1 
ATOM   2627 N N   . ASP B 1 118 ? -11.210 -37.868 36.301 1.00 74.29  ? 96  ASP B N   1 
ATOM   2628 C CA  . ASP B 1 118 ? -11.047 -36.451 36.557 1.00 77.15  ? 96  ASP B CA  1 
ATOM   2629 C C   . ASP B 1 118 ? -11.395 -35.666 35.311 1.00 74.40  ? 96  ASP B C   1 
ATOM   2630 O O   . ASP B 1 118 ? -11.339 -34.454 35.313 1.00 85.80  ? 96  ASP B O   1 
ATOM   2631 C CB  . ASP B 1 118 ? -9.646  -36.116 37.112 1.00 86.05  ? 96  ASP B CB  1 
ATOM   2632 C CG  . ASP B 1 118 ? -8.581  -36.153 36.082 1.00 89.61  ? 96  ASP B CG  1 
ATOM   2633 O OD1 . ASP B 1 118 ? -8.791  -36.857 35.080 1.00 95.01  ? 96  ASP B OD1 1 
ATOM   2634 O OD2 . ASP B 1 118 ? -7.522  -35.511 36.287 1.00 90.16  ? 96  ASP B OD2 1 
ATOM   2635 N N   . VAL B 1 119 ? -11.813 -36.355 34.260 1.00 81.07  ? 97  VAL B N   1 
ATOM   2636 C CA  . VAL B 1 119 ? -12.392 -35.688 33.090 1.00 80.86  ? 97  VAL B CA  1 
ATOM   2637 C C   . VAL B 1 119 ? -13.891 -35.649 33.247 1.00 81.05  ? 97  VAL B C   1 
ATOM   2638 O O   . VAL B 1 119 ? -14.547 -34.626 33.034 1.00 80.11  ? 97  VAL B O   1 
ATOM   2639 C CB  . VAL B 1 119 ? -12.069 -36.409 31.781 1.00 76.90  ? 97  VAL B CB  1 
ATOM   2640 C CG1 . VAL B 1 119 ? -12.919 -35.864 30.652 1.00 78.52  ? 97  VAL B CG1 1 
ATOM   2641 C CG2 . VAL B 1 119 ? -10.636 -36.250 31.450 1.00 81.23  ? 97  VAL B CG2 1 
ATOM   2642 N N   . LEU B 1 120 ? -14.429 -36.799 33.621 1.00 79.25  ? 98  LEU B N   1 
ATOM   2643 C CA  . LEU B 1 120 ? -15.842 -36.920 33.887 1.00 82.56  ? 98  LEU B CA  1 
ATOM   2644 C C   . LEU B 1 120 ? -16.217 -35.909 34.954 1.00 85.33  ? 98  LEU B C   1 
ATOM   2645 O O   . LEU B 1 120 ? -17.324 -35.366 34.965 1.00 86.70  ? 98  LEU B O   1 
ATOM   2646 C CB  . LEU B 1 120 ? -16.178 -38.342 34.324 1.00 80.08  ? 98  LEU B CB  1 
ATOM   2647 C CG  . LEU B 1 120 ? -16.278 -39.348 33.183 1.00 73.61  ? 98  LEU B CG  1 
ATOM   2648 C CD1 . LEU B 1 120 ? -16.320 -40.759 33.720 1.00 75.48  ? 98  LEU B CD1 1 
ATOM   2649 C CD2 . LEU B 1 120 ? -17.512 -39.053 32.361 1.00 76.46  ? 98  LEU B CD2 1 
ATOM   2650 N N   . SER B 1 121 ? -15.258 -35.644 35.834 1.00 86.86  ? 99  SER B N   1 
ATOM   2651 C CA  . SER B 1 121 ? -15.418 -34.663 36.896 1.00 85.10  ? 99  SER B CA  1 
ATOM   2652 C C   . SER B 1 121 ? -15.558 -33.244 36.340 1.00 81.16  ? 99  SER B C   1 
ATOM   2653 O O   . SER B 1 121 ? -16.499 -32.540 36.685 1.00 79.98  ? 99  SER B O   1 
ATOM   2654 C CB  . SER B 1 121 ? -14.237 -34.748 37.860 1.00 81.16  ? 99  SER B CB  1 
ATOM   2655 O OG  . SER B 1 121 ? -14.519 -34.048 39.046 1.00 91.80  ? 99  SER B OG  1 
ATOM   2656 N N   . LEU B 1 122 ? -14.632 -32.838 35.472 1.00 76.98  ? 100 LEU B N   1 
ATOM   2657 C CA  . LEU B 1 122 ? -14.711 -31.534 34.819 1.00 77.64  ? 100 LEU B CA  1 
ATOM   2658 C C   . LEU B 1 122 ? -16.005 -31.327 34.026 1.00 83.16  ? 100 LEU B C   1 
ATOM   2659 O O   . LEU B 1 122 ? -16.447 -30.204 33.841 1.00 86.35  ? 100 LEU B O   1 
ATOM   2660 C CB  . LEU B 1 122 ? -13.524 -31.341 33.884 1.00 76.43  ? 100 LEU B CB  1 
ATOM   2661 C CG  . LEU B 1 122 ? -12.118 -31.334 34.476 1.00 76.75  ? 100 LEU B CG  1 
ATOM   2662 C CD1 . LEU B 1 122 ? -11.119 -31.747 33.416 1.00 81.49  ? 100 LEU B CD1 1 
ATOM   2663 C CD2 . LEU B 1 122 ? -11.756 -29.953 34.976 1.00 79.43  ? 100 LEU B CD2 1 
ATOM   2664 N N   . LEU B 1 123 ? -16.611 -32.407 33.549 1.00 84.33  ? 101 LEU B N   1 
ATOM   2665 C CA  . LEU B 1 123 ? -17.849 -32.296 32.787 1.00 85.32  ? 101 LEU B CA  1 
ATOM   2666 C C   . LEU B 1 123 ? -19.079 -32.003 33.678 1.00 88.06  ? 101 LEU B C   1 
ATOM   2667 O O   . LEU B 1 123 ? -19.937 -31.196 33.305 1.00 89.29  ? 101 LEU B O   1 
ATOM   2668 C CB  . LEU B 1 123 ? -18.057 -33.578 31.965 1.00 85.02  ? 101 LEU B CB  1 
ATOM   2669 C CG  . LEU B 1 123 ? -17.141 -33.713 30.734 1.00 80.86  ? 101 LEU B CG  1 
ATOM   2670 C CD1 . LEU B 1 123 ? -17.121 -35.114 30.142 1.00 77.99  ? 101 LEU B CD1 1 
ATOM   2671 C CD2 . LEU B 1 123 ? -17.520 -32.724 29.660 1.00 77.48  ? 101 LEU B CD2 1 
ATOM   2672 N N   . GLU B 1 124 ? -19.158 -32.642 34.848 1.00 86.10  ? 102 GLU B N   1 
ATOM   2673 C CA  . GLU B 1 124 ? -20.279 -32.425 35.777 1.00 91.19  ? 102 GLU B CA  1 
ATOM   2674 C C   . GLU B 1 124 ? -20.166 -31.106 36.524 1.00 91.17  ? 102 GLU B C   1 
ATOM   2675 O O   . GLU B 1 124 ? -21.132 -30.358 36.642 1.00 95.77  ? 102 GLU B O   1 
ATOM   2676 C CB  . GLU B 1 124 ? -20.386 -33.557 36.812 1.00 91.04  ? 102 GLU B CB  1 
ATOM   2677 C CG  . GLU B 1 124 ? -20.124 -34.949 36.265 1.00 96.76  ? 102 GLU B CG  1 
ATOM   2678 C CD  . GLU B 1 124 ? -20.984 -35.286 35.051 1.00 99.56  ? 102 GLU B CD  1 
ATOM   2679 O OE1 . GLU B 1 124 ? -22.160 -34.834 34.985 1.00 96.59  ? 102 GLU B OE1 1 
ATOM   2680 O OE2 . GLU B 1 124 ? -20.464 -35.999 34.159 1.00 93.14  ? 102 GLU B OE2 1 
ATOM   2681 N N   . LYS B 1 125 ? -18.982 -30.827 37.043 1.00 85.26  ? 103 LYS B N   1 
ATOM   2682 C CA  . LYS B 1 125 ? -18.805 -29.655 37.868 1.00 87.25  ? 103 LYS B CA  1 
ATOM   2683 C C   . LYS B 1 125 ? -18.608 -28.363 37.079 1.00 89.82  ? 103 LYS B C   1 
ATOM   2684 O O   . LYS B 1 125 ? -18.519 -27.300 37.679 1.00 97.64  ? 103 LYS B O   1 
ATOM   2685 C CB  . LYS B 1 125 ? -17.620 -29.856 38.812 1.00 84.38  ? 103 LYS B CB  1 
ATOM   2686 N N   . PHE B 1 126 ? -18.513 -28.428 35.755 1.00 84.46  ? 104 PHE B N   1 
ATOM   2687 C CA  . PHE B 1 126 ? -18.213 -27.217 34.988 1.00 83.39  ? 104 PHE B CA  1 
ATOM   2688 C C   . PHE B 1 126 ? -18.806 -27.204 33.597 1.00 89.23  ? 104 PHE B C   1 
ATOM   2689 O O   . PHE B 1 126 ? -19.637 -26.367 33.267 1.00 94.10  ? 104 PHE B O   1 
ATOM   2690 C CB  . PHE B 1 126 ? -16.704 -27.016 34.836 1.00 81.57  ? 104 PHE B CB  1 
ATOM   2691 C CG  . PHE B 1 126 ? -15.962 -26.905 36.131 1.00 85.82  ? 104 PHE B CG  1 
ATOM   2692 C CD1 . PHE B 1 126 ? -15.462 -28.031 36.760 1.00 85.15  ? 104 PHE B CD1 1 
ATOM   2693 C CD2 . PHE B 1 126 ? -15.743 -25.671 36.712 1.00 89.41  ? 104 PHE B CD2 1 
ATOM   2694 C CE1 . PHE B 1 126 ? -14.775 -27.929 37.952 1.00 88.37  ? 104 PHE B CE1 1 
ATOM   2695 C CE2 . PHE B 1 126 ? -15.055 -25.563 37.904 1.00 84.61  ? 104 PHE B CE2 1 
ATOM   2696 C CZ  . PHE B 1 126 ? -14.569 -26.695 38.524 1.00 86.45  ? 104 PHE B CZ  1 
ATOM   2697 N N   . LEU B 1 127 ? -18.353 -28.132 32.773 1.00 88.30  ? 105 LEU B N   1 
ATOM   2698 C CA  . LEU B 1 127 ? -18.565 -28.037 31.342 1.00 88.45  ? 105 LEU B CA  1 
ATOM   2699 C C   . LEU B 1 127 ? -20.014 -28.192 30.922 1.00 90.24  ? 105 LEU B C   1 
ATOM   2700 O O   . LEU B 1 127 ? -20.526 -27.389 30.137 1.00 89.79  ? 105 LEU B O   1 
ATOM   2701 C CB  . LEU B 1 127 ? -17.698 -29.072 30.636 1.00 84.36  ? 105 LEU B CB  1 
ATOM   2702 C CG  . LEU B 1 127 ? -16.223 -28.751 30.851 1.00 80.80  ? 105 LEU B CG  1 
ATOM   2703 C CD1 . LEU B 1 127 ? -15.360 -29.807 30.221 1.00 78.77  ? 105 LEU B CD1 1 
ATOM   2704 C CD2 . LEU B 1 127 ? -15.908 -27.377 30.294 1.00 83.02  ? 105 LEU B CD2 1 
ATOM   2705 N N   . ILE B 1 128 ? -20.670 -29.226 31.431 1.00 89.66  ? 106 ILE B N   1 
ATOM   2706 C CA  . ILE B 1 128 ? -22.064 -29.457 31.087 1.00 90.15  ? 106 ILE B CA  1 
ATOM   2707 C C   . ILE B 1 128 ? -22.969 -28.355 31.666 1.00 95.35  ? 106 ILE B C   1 
ATOM   2708 O O   . ILE B 1 128 ? -23.822 -27.842 30.938 1.00 95.56  ? 106 ILE B O   1 
ATOM   2709 C CB  . ILE B 1 128 ? -22.526 -30.854 31.546 1.00 85.87  ? 106 ILE B CB  1 
ATOM   2710 C CG1 . ILE B 1 128 ? -21.760 -31.920 30.773 1.00 85.02  ? 106 ILE B CG1 1 
ATOM   2711 C CG2 . ILE B 1 128 ? -24.003 -31.043 31.305 1.00 84.01  ? 106 ILE B CG2 1 
ATOM   2712 C CD1 . ILE B 1 128 ? -22.089 -33.320 31.204 1.00 84.81  ? 106 ILE B CD1 1 
ATOM   2713 N N   . PRO B 1 129 ? -22.783 -27.968 32.955 1.00 95.12  ? 107 PRO B N   1 
ATOM   2714 C CA  . PRO B 1 129 ? -23.593 -26.852 33.473 1.00 88.59  ? 107 PRO B CA  1 
ATOM   2715 C C   . PRO B 1 129 ? -23.370 -25.548 32.724 1.00 93.19  ? 107 PRO B C   1 
ATOM   2716 O O   . PRO B 1 129 ? -24.334 -24.933 32.291 1.00 98.46  ? 107 PRO B O   1 
ATOM   2717 C CB  . PRO B 1 129 ? -23.120 -26.717 34.916 1.00 91.98  ? 107 PRO B CB  1 
ATOM   2718 C CG  . PRO B 1 129 ? -22.658 -28.073 35.281 1.00 94.26  ? 107 PRO B CG  1 
ATOM   2719 C CD  . PRO B 1 129 ? -21.995 -28.592 34.037 1.00 93.66  ? 107 PRO B CD  1 
ATOM   2720 N N   . ASN B 1 130 ? -22.118 -25.137 32.563 1.00 92.48  ? 108 ASN B N   1 
ATOM   2721 C CA  . ASN B 1 130 ? -21.796 -23.949 31.772 1.00 97.48  ? 108 ASN B CA  1 
ATOM   2722 C C   . ASN B 1 130 ? -22.348 -23.941 30.345 1.00 102.95 ? 108 ASN B C   1 
ATOM   2723 O O   . ASN B 1 130 ? -22.426 -22.883 29.710 1.00 103.90 ? 108 ASN B O   1 
ATOM   2724 C CB  . ASN B 1 130 ? -20.286 -23.769 31.687 1.00 97.74  ? 108 ASN B CB  1 
ATOM   2725 C CG  . ASN B 1 130 ? -19.700 -23.240 32.956 1.00 98.06  ? 108 ASN B CG  1 
ATOM   2726 O OD1 . ASN B 1 130 ? -20.414 -23.034 33.948 1.00 92.78  ? 108 ASN B OD1 1 
ATOM   2727 N ND2 . ASN B 1 130 ? -18.389 -23.002 32.943 1.00 95.36  ? 108 ASN B ND2 1 
ATOM   2728 N N   . ALA B 1 131 ? -22.696 -25.121 29.836 1.00 103.57 ? 109 ALA B N   1 
ATOM   2729 C CA  . ALA B 1 131 ? -23.170 -25.258 28.467 1.00 107.63 ? 109 ALA B CA  1 
ATOM   2730 C C   . ALA B 1 131 ? -24.435 -24.427 28.225 1.00 116.11 ? 109 ALA B C   1 
ATOM   2731 O O   . ALA B 1 131 ? -25.482 -24.643 28.852 1.00 111.36 ? 109 ALA B O   1 
ATOM   2732 C CB  . ALA B 1 131 ? -23.422 -26.710 28.144 1.00 103.74 ? 109 ALA B CB  1 
ATOM   2733 N N   . SER B 1 132 ? -24.315 -23.475 27.307 1.00 114.98 ? 110 SER B N   1 
ATOM   2734 C CA  . SER B 1 132 ? -25.381 -22.538 27.016 1.00 111.28 ? 110 SER B CA  1 
ATOM   2735 C C   . SER B 1 132 ? -26.145 -22.989 25.778 1.00 112.08 ? 110 SER B C   1 
ATOM   2736 O O   . SER B 1 132 ? -27.290 -23.437 25.869 1.00 110.06 ? 110 SER B O   1 
ATOM   2737 C CB  . SER B 1 132 ? -24.800 -21.140 26.822 1.00 112.94 ? 110 SER B CB  1 
ATOM   2738 O OG  . SER B 1 132 ? -23.642 -21.203 26.000 1.00 115.62 ? 110 SER B OG  1 
ATOM   2739 N N   . GLN B 1 133 ? -25.502 -22.882 24.621 1.00 113.34 ? 111 GLN B N   1 
ATOM   2740 C CA  . GLN B 1 133 ? -26.124 -23.311 23.374 1.00 112.97 ? 111 GLN B CA  1 
ATOM   2741 C C   . GLN B 1 133 ? -26.304 -24.820 23.334 1.00 109.64 ? 111 GLN B C   1 
ATOM   2742 O O   . GLN B 1 133 ? -25.604 -25.557 24.035 1.00 111.84 ? 111 GLN B O   1 
ATOM   2743 C CB  . GLN B 1 133 ? -25.298 -22.852 22.182 1.00 111.91 ? 111 GLN B CB  1 
ATOM   2744 C CG  . GLN B 1 133 ? -24.611 -21.525 22.395 1.00 112.92 ? 111 GLN B CG  1 
ATOM   2745 C CD  . GLN B 1 133 ? -23.989 -21.015 21.121 1.00 126.22 ? 111 GLN B CD  1 
ATOM   2746 O OE1 . GLN B 1 133 ? -23.477 -21.799 20.317 1.00 132.86 ? 111 GLN B OE1 1 
ATOM   2747 N NE2 . GLN B 1 133 ? -24.041 -19.701 20.914 1.00 129.91 ? 111 GLN B NE2 1 
ATOM   2748 N N   . ALA B 1 134 ? -27.248 -25.275 22.516 1.00 105.96 ? 112 ALA B N   1 
ATOM   2749 C CA  . ALA B 1 134 ? -27.535 -26.700 22.410 1.00 105.73 ? 112 ALA B CA  1 
ATOM   2750 C C   . ALA B 1 134 ? -26.293 -27.439 21.931 1.00 102.25 ? 112 ALA B C   1 
ATOM   2751 O O   . ALA B 1 134 ? -25.947 -28.500 22.454 1.00 94.51  ? 112 ALA B O   1 
ATOM   2752 C CB  . ALA B 1 134 ? -28.711 -26.944 21.465 1.00 102.14 ? 112 ALA B CB  1 
ATOM   2753 N N   . GLU B 1 135 ? -25.623 -26.842 20.948 1.00 103.57 ? 113 GLU B N   1 
ATOM   2754 C CA  . GLU B 1 135 ? -24.435 -27.418 20.332 1.00 103.27 ? 113 GLU B CA  1 
ATOM   2755 C C   . GLU B 1 135 ? -23.376 -27.792 21.368 1.00 107.81 ? 113 GLU B C   1 
ATOM   2756 O O   . GLU B 1 135 ? -22.796 -28.874 21.298 1.00 110.34 ? 113 GLU B O   1 
ATOM   2757 C CB  . GLU B 1 135 ? -23.850 -26.454 19.292 1.00 103.84 ? 113 GLU B CB  1 
ATOM   2758 C CG  . GLU B 1 135 ? -22.355 -26.626 19.052 1.00 105.22 ? 113 GLU B CG  1 
ATOM   2759 C CD  . GLU B 1 135 ? -21.896 -26.096 17.684 1.00 119.35 ? 113 GLU B CD  1 
ATOM   2760 O OE1 . GLU B 1 135 ? -22.755 -25.661 16.869 1.00 111.87 ? 113 GLU B OE1 1 
ATOM   2761 O OE2 . GLU B 1 135 ? -20.664 -26.118 17.425 1.00 118.60 ? 113 GLU B OE2 1 
ATOM   2762 N N   . SER B 1 136 ? -23.142 -26.912 22.339 1.00 104.71 ? 114 SER B N   1 
ATOM   2763 C CA  . SER B 1 136 ? -22.134 -27.164 23.361 1.00 96.29  ? 114 SER B CA  1 
ATOM   2764 C C   . SER B 1 136 ? -22.537 -28.299 24.292 1.00 97.19  ? 114 SER B C   1 
ATOM   2765 O O   . SER B 1 136 ? -21.704 -29.134 24.649 1.00 96.14  ? 114 SER B O   1 
ATOM   2766 C CB  . SER B 1 136 ? -21.858 -25.901 24.180 1.00 103.65 ? 114 SER B CB  1 
ATOM   2767 O OG  . SER B 1 136 ? -21.787 -24.750 23.353 1.00 115.53 ? 114 SER B OG  1 
ATOM   2768 N N   . LYS B 1 137 ? -23.804 -28.335 24.695 1.00 97.81  ? 115 LYS B N   1 
ATOM   2769 C CA  . LYS B 1 137 ? -24.264 -29.396 25.590 1.00 90.39  ? 115 LYS B CA  1 
ATOM   2770 C C   . LYS B 1 137 ? -24.118 -30.767 24.910 1.00 91.22  ? 115 LYS B C   1 
ATOM   2771 O O   . LYS B 1 137 ? -23.897 -31.776 25.565 1.00 87.95  ? 115 LYS B O   1 
ATOM   2772 C CB  . LYS B 1 137 ? -25.715 -29.159 26.031 1.00 83.12  ? 115 LYS B CB  1 
ATOM   2773 N N   . VAL B 1 138 ? -24.220 -30.800 23.588 1.00 94.98  ? 116 VAL B N   1 
ATOM   2774 C CA  . VAL B 1 138 ? -24.091 -32.057 22.865 1.00 92.28  ? 116 VAL B CA  1 
ATOM   2775 C C   . VAL B 1 138 ? -22.653 -32.568 22.909 1.00 89.53  ? 116 VAL B C   1 
ATOM   2776 O O   . VAL B 1 138 ? -22.411 -33.751 23.204 1.00 83.70  ? 116 VAL B O   1 
ATOM   2777 C CB  . VAL B 1 138 ? -24.547 -31.902 21.409 1.00 92.42  ? 116 VAL B CB  1 
ATOM   2778 C CG1 . VAL B 1 138 ? -24.364 -33.202 20.645 1.00 88.96  ? 116 VAL B CG1 1 
ATOM   2779 C CG2 . VAL B 1 138 ? -25.993 -31.480 21.378 1.00 92.79  ? 116 VAL B CG2 1 
ATOM   2780 N N   . PHE B 1 139 ? -21.717 -31.664 22.609 1.00 87.28  ? 117 PHE B N   1 
ATOM   2781 C CA  . PHE B 1 139 ? -20.285 -31.941 22.652 1.00 81.29  ? 117 PHE B CA  1 
ATOM   2782 C C   . PHE B 1 139 ? -19.880 -32.599 23.946 1.00 83.49  ? 117 PHE B C   1 
ATOM   2783 O O   . PHE B 1 139 ? -19.275 -33.675 23.934 1.00 84.09  ? 117 PHE B O   1 
ATOM   2784 C CB  . PHE B 1 139 ? -19.487 -30.659 22.488 1.00 83.24  ? 117 PHE B CB  1 
ATOM   2785 C CG  . PHE B 1 139 ? -18.027 -30.877 22.210 1.00 84.55  ? 117 PHE B CG  1 
ATOM   2786 C CD1 . PHE B 1 139 ? -17.127 -31.039 23.237 1.00 80.16  ? 117 PHE B CD1 1 
ATOM   2787 C CD2 . PHE B 1 139 ? -17.549 -30.881 20.908 1.00 89.61  ? 117 PHE B CD2 1 
ATOM   2788 C CE1 . PHE B 1 139 ? -15.786 -31.221 22.976 1.00 81.21  ? 117 PHE B CE1 1 
ATOM   2789 C CE2 . PHE B 1 139 ? -16.204 -31.068 20.643 1.00 86.66  ? 117 PHE B CE2 1 
ATOM   2790 C CZ  . PHE B 1 139 ? -15.324 -31.239 21.676 1.00 82.14  ? 117 PHE B CZ  1 
ATOM   2791 N N   . TYR B 1 140 ? -20.217 -31.947 25.057 1.00 79.35  ? 118 TYR B N   1 
ATOM   2792 C CA  . TYR B 1 140 ? -19.766 -32.391 26.370 1.00 78.45  ? 118 TYR B CA  1 
ATOM   2793 C C   . TYR B 1 140 ? -20.558 -33.595 26.833 1.00 77.87  ? 118 TYR B C   1 
ATOM   2794 O O   . TYR B 1 140 ? -20.060 -34.396 27.625 1.00 79.18  ? 118 TYR B O   1 
ATOM   2795 C CB  . TYR B 1 140 ? -19.868 -31.266 27.418 1.00 83.79  ? 118 TYR B CB  1 
ATOM   2796 C CG  . TYR B 1 140 ? -18.994 -30.042 27.162 1.00 82.04  ? 118 TYR B CG  1 
ATOM   2797 C CD1 . TYR B 1 140 ? -17.609 -30.117 27.227 1.00 78.48  ? 118 TYR B CD1 1 
ATOM   2798 C CD2 . TYR B 1 140 ? -19.562 -28.808 26.889 1.00 84.80  ? 118 TYR B CD2 1 
ATOM   2799 C CE1 . TYR B 1 140 ? -16.816 -29.001 27.002 1.00 79.73  ? 118 TYR B CE1 1 
ATOM   2800 C CE2 . TYR B 1 140 ? -18.777 -27.689 26.663 1.00 88.14  ? 118 TYR B CE2 1 
ATOM   2801 C CZ  . TYR B 1 140 ? -17.406 -27.786 26.722 1.00 83.42  ? 118 TYR B CZ  1 
ATOM   2802 O OH  . TYR B 1 140 ? -16.638 -26.660 26.493 1.00 82.83  ? 118 TYR B OH  1 
ATOM   2803 N N   . LEU B 1 141 ? -21.790 -33.729 26.348 1.00 78.23  ? 119 LEU B N   1 
ATOM   2804 C CA  . LEU B 1 141 ? -22.593 -34.912 26.660 1.00 76.00  ? 119 LEU B CA  1 
ATOM   2805 C C   . LEU B 1 141 ? -22.065 -36.151 25.942 1.00 75.42  ? 119 LEU B C   1 
ATOM   2806 O O   . LEU B 1 141 ? -22.166 -37.261 26.454 1.00 71.10  ? 119 LEU B O   1 
ATOM   2807 C CB  . LEU B 1 141 ? -24.044 -34.692 26.281 1.00 78.50  ? 119 LEU B CB  1 
ATOM   2808 C CG  . LEU B 1 141 ? -25.008 -34.145 27.319 1.00 77.51  ? 119 LEU B CG  1 
ATOM   2809 C CD1 . LEU B 1 141 ? -26.387 -34.078 26.691 1.00 79.70  ? 119 LEU B CD1 1 
ATOM   2810 C CD2 . LEU B 1 141 ? -25.007 -35.034 28.534 1.00 79.23  ? 119 LEU B CD2 1 
ATOM   2811 N N   . LYS B 1 142 ? -21.515 -35.959 24.745 1.00 73.01  ? 120 LYS B N   1 
ATOM   2812 C CA  . LYS B 1 142 ? -20.904 -37.063 24.036 1.00 72.94  ? 120 LYS B CA  1 
ATOM   2813 C C   . LYS B 1 142 ? -19.626 -37.443 24.763 1.00 73.66  ? 120 LYS B C   1 
ATOM   2814 O O   . LYS B 1 142 ? -19.444 -38.583 25.198 1.00 72.18  ? 120 LYS B O   1 
ATOM   2815 C CB  . LYS B 1 142 ? -20.617 -36.695 22.588 1.00 78.05  ? 120 LYS B CB  1 
ATOM   2816 C CG  . LYS B 1 142 ? -19.633 -37.647 21.914 1.00 76.83  ? 120 LYS B CG  1 
ATOM   2817 C CD  . LYS B 1 142 ? -19.131 -37.073 20.619 1.00 72.61  ? 120 LYS B CD  1 
ATOM   2818 C CE  . LYS B 1 142 ? -17.677 -37.406 20.434 1.00 74.53  ? 120 LYS B CE  1 
ATOM   2819 N NZ  . LYS B 1 142 ? -17.175 -36.829 19.160 1.00 79.46  ? 120 LYS B NZ  1 
ATOM   2820 N N   . MET B 1 143 ? -18.749 -36.456 24.886 1.00 76.78  ? 121 MET B N   1 
ATOM   2821 C CA  . MET B 1 143 ? -17.555 -36.520 25.733 1.00 74.27  ? 121 MET B CA  1 
ATOM   2822 C C   . MET B 1 143 ? -17.785 -37.318 27.019 1.00 71.93  ? 121 MET B C   1 
ATOM   2823 O O   . MET B 1 143 ? -16.975 -38.171 27.388 1.00 68.99  ? 121 MET B O   1 
ATOM   2824 C CB  . MET B 1 143 ? -17.103 -35.096 26.065 1.00 68.51  ? 121 MET B CB  1 
ATOM   2825 C CG  . MET B 1 143 ? -15.694 -34.977 26.547 1.00 73.77  ? 121 MET B CG  1 
ATOM   2826 S SD  . MET B 1 143 ? -14.954 -33.447 25.965 1.00 80.59  ? 121 MET B SD  1 
ATOM   2827 C CE  . MET B 1 143 ? -13.341 -33.535 26.728 1.00 73.26  ? 121 MET B CE  1 
ATOM   2828 N N   . LYS B 1 144 ? -18.905 -37.055 27.682 1.00 67.92  ? 122 LYS B N   1 
ATOM   2829 C CA  . LYS B 1 144 ? -19.277 -37.814 28.859 1.00 71.12  ? 122 LYS B CA  1 
ATOM   2830 C C   . LYS B 1 144 ? -19.528 -39.280 28.497 1.00 74.70  ? 122 LYS B C   1 
ATOM   2831 O O   . LYS B 1 144 ? -18.981 -40.188 29.131 1.00 76.00  ? 122 LYS B O   1 
ATOM   2832 C CB  . LYS B 1 144 ? -20.506 -37.197 29.504 1.00 73.32  ? 122 LYS B CB  1 
ATOM   2833 C CG  . LYS B 1 144 ? -20.954 -37.849 30.795 1.00 75.30  ? 122 LYS B CG  1 
ATOM   2834 C CD  . LYS B 1 144 ? -22.096 -37.026 31.374 1.00 78.87  ? 122 LYS B CD  1 
ATOM   2835 C CE  . LYS B 1 144 ? -22.703 -37.634 32.611 1.00 77.99  ? 122 LYS B CE  1 
ATOM   2836 N NZ  . LYS B 1 144 ? -23.727 -36.696 33.163 1.00 81.70  ? 122 LYS B NZ  1 
ATOM   2837 N N   . GLY B 1 145 ? -20.338 -39.514 27.469 1.00 70.24  ? 123 GLY B N   1 
ATOM   2838 C CA  . GLY B 1 145 ? -20.582 -40.868 27.011 1.00 69.11  ? 123 GLY B CA  1 
ATOM   2839 C C   . GLY B 1 145 ? -19.288 -41.546 26.599 1.00 72.51  ? 123 GLY B C   1 
ATOM   2840 O O   . GLY B 1 145 ? -19.080 -42.712 26.917 1.00 73.59  ? 123 GLY B O   1 
ATOM   2841 N N   . ASP B 1 146 ? -18.423 -40.813 25.893 1.00 68.32  ? 124 ASP B N   1 
ATOM   2842 C CA  . ASP B 1 146 ? -17.113 -41.314 25.494 1.00 63.49  ? 124 ASP B CA  1 
ATOM   2843 C C   . ASP B 1 146 ? -16.301 -41.858 26.683 1.00 74.78  ? 124 ASP B C   1 
ATOM   2844 O O   . ASP B 1 146 ? -15.789 -42.972 26.636 1.00 73.91  ? 124 ASP B O   1 
ATOM   2845 C CB  . ASP B 1 146 ? -16.295 -40.216 24.816 1.00 69.97  ? 124 ASP B CB  1 
ATOM   2846 C CG  . ASP B 1 146 ? -16.586 -40.062 23.320 1.00 78.77  ? 124 ASP B CG  1 
ATOM   2847 O OD1 . ASP B 1 146 ? -17.394 -40.847 22.758 1.00 81.06  ? 124 ASP B OD1 1 
ATOM   2848 O OD2 . ASP B 1 146 ? -15.964 -39.154 22.701 1.00 70.33  ? 124 ASP B OD2 1 
ATOM   2849 N N   . TYR B 1 147 ? -16.170 -41.072 27.753 1.00 76.49  ? 125 TYR B N   1 
ATOM   2850 C CA  . TYR B 1 147 ? -15.256 -41.452 28.830 1.00 71.70  ? 125 TYR B CA  1 
ATOM   2851 C C   . TYR B 1 147 ? -15.885 -42.463 29.784 1.00 74.91  ? 125 TYR B C   1 
ATOM   2852 O O   . TYR B 1 147 ? -15.179 -43.271 30.389 1.00 79.90  ? 125 TYR B O   1 
ATOM   2853 C CB  . TYR B 1 147 ? -14.744 -40.207 29.571 1.00 66.87  ? 125 TYR B CB  1 
ATOM   2854 C CG  . TYR B 1 147 ? -13.695 -39.478 28.752 1.00 70.79  ? 125 TYR B CG  1 
ATOM   2855 C CD1 . TYR B 1 147 ? -12.340 -39.760 28.902 1.00 68.61  ? 125 TYR B CD1 1 
ATOM   2856 C CD2 . TYR B 1 147 ? -14.063 -38.558 27.766 1.00 68.48  ? 125 TYR B CD2 1 
ATOM   2857 C CE1 . TYR B 1 147 ? -11.376 -39.110 28.111 1.00 66.33  ? 125 TYR B CE1 1 
ATOM   2858 C CE2 . TYR B 1 147 ? -13.110 -37.909 26.985 1.00 61.86  ? 125 TYR B CE2 1 
ATOM   2859 C CZ  . TYR B 1 147 ? -11.776 -38.192 27.161 1.00 63.06  ? 125 TYR B CZ  1 
ATOM   2860 O OH  . TYR B 1 147 ? -10.847 -37.553 26.383 1.00 68.20  ? 125 TYR B OH  1 
ATOM   2861 N N   . TYR B 1 148 ? -17.205 -42.463 29.899 1.00 74.67  ? 126 TYR B N   1 
ATOM   2862 C CA  . TYR B 1 148 ? -17.858 -43.565 30.595 1.00 75.03  ? 126 TYR B CA  1 
ATOM   2863 C C   . TYR B 1 148 ? -17.638 -44.858 29.805 1.00 79.31  ? 126 TYR B C   1 
ATOM   2864 O O   . TYR B 1 148 ? -17.487 -45.939 30.388 1.00 80.75  ? 126 TYR B O   1 
ATOM   2865 C CB  . TYR B 1 148 ? -19.346 -43.284 30.790 1.00 74.93  ? 126 TYR B CB  1 
ATOM   2866 C CG  . TYR B 1 148 ? -19.645 -42.637 32.121 1.00 79.68  ? 126 TYR B CG  1 
ATOM   2867 C CD1 . TYR B 1 148 ? -19.355 -43.307 33.302 1.00 78.69  ? 126 TYR B CD1 1 
ATOM   2868 C CD2 . TYR B 1 148 ? -20.202 -41.356 32.204 1.00 77.36  ? 126 TYR B CD2 1 
ATOM   2869 C CE1 . TYR B 1 148 ? -19.605 -42.741 34.524 1.00 79.45  ? 126 TYR B CE1 1 
ATOM   2870 C CE2 . TYR B 1 148 ? -20.462 -40.773 33.434 1.00 81.20  ? 126 TYR B CE2 1 
ATOM   2871 C CZ  . TYR B 1 148 ? -20.159 -41.479 34.599 1.00 85.22  ? 126 TYR B CZ  1 
ATOM   2872 O OH  . TYR B 1 148 ? -20.401 -40.944 35.850 1.00 77.78  ? 126 TYR B OH  1 
ATOM   2873 N N   . ARG B 1 149 ? -17.585 -44.725 28.477 1.00 76.47  ? 127 ARG B N   1 
ATOM   2874 C CA  . ARG B 1 149 ? -17.372 -45.855 27.576 1.00 75.63  ? 127 ARG B CA  1 
ATOM   2875 C C   . ARG B 1 149 ? -15.973 -46.434 27.720 1.00 77.17  ? 127 ARG B C   1 
ATOM   2876 O O   . ARG B 1 149 ? -15.795 -47.636 27.569 1.00 77.96  ? 127 ARG B O   1 
ATOM   2877 C CB  . ARG B 1 149 ? -17.617 -45.444 26.120 1.00 71.50  ? 127 ARG B CB  1 
ATOM   2878 C CG  . ARG B 1 149 ? -17.485 -46.574 25.109 1.00 69.71  ? 127 ARG B CG  1 
ATOM   2879 C CD  . ARG B 1 149 ? -18.096 -46.202 23.737 1.00 69.15  ? 127 ARG B CD  1 
ATOM   2880 N NE  . ARG B 1 149 ? -17.438 -45.067 23.081 1.00 62.29  ? 127 ARG B NE  1 
ATOM   2881 C CZ  . ARG B 1 149 ? -16.303 -45.168 22.391 1.00 66.12  ? 127 ARG B CZ  1 
ATOM   2882 N NH1 . ARG B 1 149 ? -15.695 -46.355 22.282 1.00 68.11  ? 127 ARG B NH1 1 
ATOM   2883 N NH2 . ARG B 1 149 ? -15.763 -44.090 21.827 1.00 62.50  ? 127 ARG B NH2 1 
ATOM   2884 N N   . TYR B 1 150 ? -14.979 -45.594 28.010 1.00 75.99  ? 128 TYR B N   1 
ATOM   2885 C CA  . TYR B 1 150 ? -13.633 -46.109 28.228 1.00 71.87  ? 128 TYR B CA  1 
ATOM   2886 C C   . TYR B 1 150 ? -13.574 -46.790 29.589 1.00 76.96  ? 128 TYR B C   1 
ATOM   2887 O O   . TYR B 1 150 ? -12.872 -47.794 29.778 1.00 74.31  ? 128 TYR B O   1 
ATOM   2888 C CB  . TYR B 1 150 ? -12.589 -45.010 28.156 1.00 69.73  ? 128 TYR B CB  1 
ATOM   2889 C CG  . TYR B 1 150 ? -12.629 -44.162 26.908 1.00 74.12  ? 128 TYR B CG  1 
ATOM   2890 C CD1 . TYR B 1 150 ? -13.107 -44.665 25.697 1.00 72.94  ? 128 TYR B CD1 1 
ATOM   2891 C CD2 . TYR B 1 150 ? -12.178 -42.853 26.943 1.00 71.20  ? 128 TYR B CD2 1 
ATOM   2892 C CE1 . TYR B 1 150 ? -13.147 -43.872 24.568 1.00 69.20  ? 128 TYR B CE1 1 
ATOM   2893 C CE2 . TYR B 1 150 ? -12.219 -42.061 25.836 1.00 70.79  ? 128 TYR B CE2 1 
ATOM   2894 C CZ  . TYR B 1 150 ? -12.704 -42.564 24.650 1.00 73.33  ? 128 TYR B CZ  1 
ATOM   2895 O OH  . TYR B 1 150 ? -12.728 -41.735 23.557 1.00 72.61  ? 128 TYR B OH  1 
ATOM   2896 N N   . LEU B 1 151 ? -14.306 -46.231 30.544 1.00 75.95  ? 129 LEU B N   1 
ATOM   2897 C CA  . LEU B 1 151 ? -14.451 -46.890 31.828 1.00 77.40  ? 129 LEU B CA  1 
ATOM   2898 C C   . LEU B 1 151 ? -15.047 -48.255 31.579 1.00 79.92  ? 129 LEU B C   1 
ATOM   2899 O O   . LEU B 1 151 ? -14.482 -49.259 32.008 1.00 82.17  ? 129 LEU B O   1 
ATOM   2900 C CB  . LEU B 1 151 ? -15.325 -46.084 32.788 1.00 80.41  ? 129 LEU B CB  1 
ATOM   2901 C CG  . LEU B 1 151 ? -14.655 -44.913 33.523 1.00 75.59  ? 129 LEU B CG  1 
ATOM   2902 C CD1 . LEU B 1 151 ? -15.652 -44.232 34.431 1.00 67.04  ? 129 LEU B CD1 1 
ATOM   2903 C CD2 . LEU B 1 151 ? -13.436 -45.368 34.292 1.00 69.28  ? 129 LEU B CD2 1 
ATOM   2904 N N   . ALA B 1 152 ? -16.162 -48.285 30.845 1.00 79.53  ? 130 ALA B N   1 
ATOM   2905 C CA  . ALA B 1 152 ? -16.862 -49.531 30.532 1.00 77.05  ? 130 ALA B CA  1 
ATOM   2906 C C   . ALA B 1 152 ? -15.938 -50.571 29.873 1.00 77.94  ? 130 ALA B C   1 
ATOM   2907 O O   . ALA B 1 152 ? -16.126 -51.777 30.051 1.00 79.15  ? 130 ALA B O   1 
ATOM   2908 C CB  . ALA B 1 152 ? -18.063 -49.247 29.647 1.00 67.82  ? 130 ALA B CB  1 
ATOM   2909 N N   . GLU B 1 153 ? -14.928 -50.093 29.148 1.00 73.89  ? 131 GLU B N   1 
ATOM   2910 C CA  . GLU B 1 153 ? -14.017 -50.955 28.398 1.00 73.08  ? 131 GLU B CA  1 
ATOM   2911 C C   . GLU B 1 153 ? -13.143 -51.816 29.311 1.00 77.95  ? 131 GLU B C   1 
ATOM   2912 O O   . GLU B 1 153 ? -12.609 -52.845 28.880 1.00 76.42  ? 131 GLU B O   1 
ATOM   2913 C CB  . GLU B 1 153 ? -13.132 -50.109 27.456 1.00 70.95  ? 131 GLU B CB  1 
ATOM   2914 C CG  . GLU B 1 153 ? -13.867 -49.646 26.196 1.00 72.48  ? 131 GLU B CG  1 
ATOM   2915 C CD  . GLU B 1 153 ? -12.979 -48.989 25.140 1.00 80.81  ? 131 GLU B CD  1 
ATOM   2916 O OE1 . GLU B 1 153 ? -11.856 -48.542 25.458 1.00 77.50  ? 131 GLU B OE1 1 
ATOM   2917 O OE2 . GLU B 1 153 ? -13.422 -48.928 23.966 1.00 90.56  ? 131 GLU B OE2 1 
ATOM   2918 N N   . VAL B 1 154 ? -13.010 -51.412 30.573 1.00 77.59  ? 132 VAL B N   1 
ATOM   2919 C CA  . VAL B 1 154 ? -12.089 -52.085 31.484 1.00 76.49  ? 132 VAL B CA  1 
ATOM   2920 C C   . VAL B 1 154 ? -12.714 -52.501 32.810 1.00 83.16  ? 132 VAL B C   1 
ATOM   2921 O O   . VAL B 1 154 ? -12.022 -53.041 33.676 1.00 85.19  ? 132 VAL B O   1 
ATOM   2922 C CB  . VAL B 1 154 ? -10.866 -51.198 31.783 1.00 73.35  ? 132 VAL B CB  1 
ATOM   2923 C CG1 . VAL B 1 154 ? -9.837  -51.341 30.709 1.00 74.06  ? 132 VAL B CG1 1 
ATOM   2924 C CG2 . VAL B 1 154 ? -11.273 -49.761 31.872 1.00 77.59  ? 132 VAL B CG2 1 
ATOM   2925 N N   . ALA B 1 155 ? -14.017 -52.267 32.960 1.00 87.86  ? 133 ALA B N   1 
ATOM   2926 C CA  . ALA B 1 155 ? -14.716 -52.525 34.224 1.00 90.19  ? 133 ALA B CA  1 
ATOM   2927 C C   . ALA B 1 155 ? -14.921 -54.010 34.474 1.00 95.66  ? 133 ALA B C   1 
ATOM   2928 O O   . ALA B 1 155 ? -15.018 -54.795 33.531 1.00 95.71  ? 133 ALA B O   1 
ATOM   2929 C CB  . ALA B 1 155 ? -16.061 -51.809 34.246 1.00 86.74  ? 133 ALA B CB  1 
ATOM   2930 N N   . ALA B 1 156 ? -14.985 -54.380 35.752 1.00 100.34 ? 134 ALA B N   1 
ATOM   2931 C CA  . ALA B 1 156 ? -15.283 -55.747 36.173 1.00 101.36 ? 134 ALA B CA  1 
ATOM   2932 C C   . ALA B 1 156 ? -16.790 -55.911 36.343 1.00 106.03 ? 134 ALA B C   1 
ATOM   2933 O O   . ALA B 1 156 ? -17.519 -54.922 36.299 1.00 111.20 ? 134 ALA B O   1 
ATOM   2934 C CB  . ALA B 1 156 ? -14.557 -56.075 37.477 1.00 109.00 ? 134 ALA B CB  1 
ATOM   2935 N N   . GLY B 1 157 ? -17.246 -57.145 36.556 1.00 100.03 ? 135 GLY B N   1 
ATOM   2936 C CA  . GLY B 1 157 ? -18.660 -57.456 36.700 1.00 96.56  ? 135 GLY B CA  1 
ATOM   2937 C C   . GLY B 1 157 ? -19.581 -56.476 37.421 1.00 99.22  ? 135 GLY B C   1 
ATOM   2938 O O   . GLY B 1 157 ? -20.504 -55.925 36.818 1.00 103.35 ? 135 GLY B O   1 
ATOM   2939 N N   . ASP B 1 158 ? -19.339 -56.253 38.707 1.00 103.82 ? 136 ASP B N   1 
ATOM   2940 C CA  . ASP B 1 158 ? -20.291 -55.534 39.558 1.00 105.43 ? 136 ASP B CA  1 
ATOM   2941 C C   . ASP B 1 158 ? -20.557 -54.086 39.108 1.00 106.65 ? 136 ASP B C   1 
ATOM   2942 O O   . ASP B 1 158 ? -21.714 -53.674 38.941 1.00 100.94 ? 136 ASP B O   1 
ATOM   2943 C CB  . ASP B 1 158 ? -19.793 -55.546 41.006 1.00 102.09 ? 136 ASP B CB  1 
ATOM   2944 N N   . ASP B 1 159 ? -19.479 -53.328 38.909 1.00 108.70 ? 137 ASP B N   1 
ATOM   2945 C CA  . ASP B 1 159 ? -19.554 -51.907 38.551 1.00 103.55 ? 137 ASP B CA  1 
ATOM   2946 C C   . ASP B 1 159 ? -19.977 -51.671 37.113 1.00 101.31 ? 137 ASP B C   1 
ATOM   2947 O O   . ASP B 1 159 ? -20.400 -50.565 36.761 1.00 99.32  ? 137 ASP B O   1 
ATOM   2948 C CB  . ASP B 1 159 ? -18.202 -51.224 38.768 1.00 101.45 ? 137 ASP B CB  1 
ATOM   2949 C CG  . ASP B 1 159 ? -17.684 -51.395 40.177 1.00 117.59 ? 137 ASP B CG  1 
ATOM   2950 O OD1 . ASP B 1 159 ? -17.998 -52.431 40.814 1.00 116.19 ? 137 ASP B OD1 1 
ATOM   2951 O OD2 . ASP B 1 159 ? -16.952 -50.494 40.643 1.00 124.14 ? 137 ASP B OD2 1 
ATOM   2952 N N   . LYS B 1 160 ? -19.840 -52.700 36.279 1.00 98.20  ? 138 LYS B N   1 
ATOM   2953 C CA  . LYS B 1 160 ? -20.014 -52.534 34.846 1.00 89.17  ? 138 LYS B CA  1 
ATOM   2954 C C   . LYS B 1 160 ? -21.407 -52.084 34.423 1.00 87.26  ? 138 LYS B C   1 
ATOM   2955 O O   . LYS B 1 160 ? -21.531 -51.087 33.706 1.00 83.27  ? 138 LYS B O   1 
ATOM   2956 C CB  . LYS B 1 160 ? -19.677 -53.816 34.116 1.00 85.51  ? 138 LYS B CB  1 
ATOM   2957 C CG  . LYS B 1 160 ? -19.651 -53.606 32.618 1.00 90.42  ? 138 LYS B CG  1 
ATOM   2958 C CD  . LYS B 1 160 ? -19.133 -54.814 31.890 1.00 88.09  ? 138 LYS B CD  1 
ATOM   2959 C CE  . LYS B 1 160 ? -18.990 -54.548 30.421 1.00 75.57  ? 138 LYS B CE  1 
ATOM   2960 N NZ  . LYS B 1 160 ? -18.424 -55.759 29.795 1.00 83.40  ? 138 LYS B NZ  1 
ATOM   2961 N N   . LYS B 1 161 ? -22.441 -52.810 34.853 1.00 88.17  ? 139 LYS B N   1 
ATOM   2962 C CA  . LYS B 1 161 ? -23.817 -52.527 34.416 1.00 87.36  ? 139 LYS B CA  1 
ATOM   2963 C C   . LYS B 1 161 ? -24.151 -51.034 34.476 1.00 89.51  ? 139 LYS B C   1 
ATOM   2964 O O   . LYS B 1 161 ? -24.760 -50.484 33.541 1.00 89.88  ? 139 LYS B O   1 
ATOM   2965 C CB  . LYS B 1 161 ? -24.831 -53.311 35.253 1.00 81.32  ? 139 LYS B CB  1 
ATOM   2966 N N   . GLY B 1 162 ? -23.713 -50.381 35.553 1.00 81.79  ? 140 GLY B N   1 
ATOM   2967 C CA  . GLY B 1 162 ? -24.020 -48.983 35.792 1.00 75.58  ? 140 GLY B CA  1 
ATOM   2968 C C   . GLY B 1 162 ? -23.114 -48.014 35.060 1.00 82.79  ? 140 GLY B C   1 
ATOM   2969 O O   . GLY B 1 162 ? -23.556 -46.939 34.643 1.00 85.48  ? 140 GLY B O   1 
ATOM   2970 N N   . ILE B 1 163 ? -21.840 -48.370 34.919 1.00 81.50  ? 141 ILE B N   1 
ATOM   2971 C CA  . ILE B 1 163 ? -20.937 -47.588 34.078 1.00 81.73  ? 141 ILE B CA  1 
ATOM   2972 C C   . ILE B 1 163 ? -21.462 -47.544 32.636 1.00 82.87  ? 141 ILE B C   1 
ATOM   2973 O O   . ILE B 1 163 ? -21.515 -46.489 31.993 1.00 78.30  ? 141 ILE B O   1 
ATOM   2974 C CB  . ILE B 1 163 ? -19.536 -48.176 34.067 1.00 79.71  ? 141 ILE B CB  1 
ATOM   2975 C CG1 . ILE B 1 163 ? -18.930 -48.100 35.456 1.00 81.78  ? 141 ILE B CG1 1 
ATOM   2976 C CG2 . ILE B 1 163 ? -18.658 -47.452 33.046 1.00 80.01  ? 141 ILE B CG2 1 
ATOM   2977 C CD1 . ILE B 1 163 ? -17.531 -48.644 35.524 1.00 85.30  ? 141 ILE B CD1 1 
ATOM   2978 N N   . VAL B 1 164 ? -21.851 -48.714 32.146 1.00 80.42  ? 142 VAL B N   1 
ATOM   2979 C CA  . VAL B 1 164 ? -22.422 -48.830 30.831 1.00 76.57  ? 142 VAL B CA  1 
ATOM   2980 C C   . VAL B 1 164 ? -23.648 -47.935 30.742 1.00 80.06  ? 142 VAL B C   1 
ATOM   2981 O O   . VAL B 1 164 ? -23.827 -47.209 29.765 1.00 81.43  ? 142 VAL B O   1 
ATOM   2982 C CB  . VAL B 1 164 ? -22.764 -50.298 30.504 1.00 74.78  ? 142 VAL B CB  1 
ATOM   2983 C CG1 . VAL B 1 164 ? -23.655 -50.393 29.288 1.00 73.37  ? 142 VAL B CG1 1 
ATOM   2984 C CG2 . VAL B 1 164 ? -21.495 -51.102 30.285 1.00 74.39  ? 142 VAL B CG2 1 
ATOM   2985 N N   . ASP B 1 165 ? -24.482 -47.918 31.766 1.00 83.10  ? 143 ASP B N   1 
ATOM   2986 C CA  . ASP B 1 165 ? -25.690 -47.136 31.594 1.00 87.61  ? 143 ASP B CA  1 
ATOM   2987 C C   . ASP B 1 165 ? -25.411 -45.646 31.712 1.00 84.54  ? 143 ASP B C   1 
ATOM   2988 O O   . ASP B 1 165 ? -26.132 -44.834 31.124 1.00 84.05  ? 143 ASP B O   1 
ATOM   2989 C CB  . ASP B 1 165 ? -26.767 -47.554 32.581 1.00 88.27  ? 143 ASP B CB  1 
ATOM   2990 C CG  . ASP B 1 165 ? -28.160 -47.350 32.004 1.00 108.93 ? 143 ASP B CG  1 
ATOM   2991 O OD1 . ASP B 1 165 ? -28.689 -46.232 32.157 1.00 116.75 ? 143 ASP B OD1 1 
ATOM   2992 O OD2 . ASP B 1 165 ? -28.676 -48.267 31.310 1.00 118.09 ? 143 ASP B OD2 1 
ATOM   2993 N N   . GLN B 1 166 ? -24.360 -45.287 32.445 1.00 83.12  ? 144 GLN B N   1 
ATOM   2994 C CA  . GLN B 1 166 ? -23.960 -43.895 32.514 1.00 82.08  ? 144 GLN B CA  1 
ATOM   2995 C C   . GLN B 1 166 ? -23.525 -43.445 31.120 1.00 81.92  ? 144 GLN B C   1 
ATOM   2996 O O   . GLN B 1 166 ? -23.845 -42.334 30.664 1.00 75.94  ? 144 GLN B O   1 
ATOM   2997 C CB  . GLN B 1 166 ? -22.851 -43.711 33.540 1.00 77.99  ? 144 GLN B CB  1 
ATOM   2998 C CG  . GLN B 1 166 ? -23.353 -43.578 34.975 1.00 81.65  ? 144 GLN B CG  1 
ATOM   2999 C CD  . GLN B 1 166 ? -24.260 -42.367 35.181 1.00 86.48  ? 144 GLN B CD  1 
ATOM   3000 O OE1 . GLN B 1 166 ? -23.807 -41.228 35.117 1.00 87.05  ? 144 GLN B OE1 1 
ATOM   3001 N NE2 . GLN B 1 166 ? -25.547 -42.612 35.434 1.00 90.00  ? 144 GLN B NE2 1 
ATOM   3002 N N   . SER B 1 167 ? -22.817 -44.340 30.439 1.00 80.07  ? 145 SER B N   1 
ATOM   3003 C CA  . SER B 1 167 ? -22.350 -44.068 29.086 1.00 78.75  ? 145 SER B CA  1 
ATOM   3004 C C   . SER B 1 167 ? -23.517 -43.888 28.132 1.00 78.07  ? 145 SER B C   1 
ATOM   3005 O O   . SER B 1 167 ? -23.521 -42.976 27.311 1.00 76.51  ? 145 SER B O   1 
ATOM   3006 C CB  . SER B 1 167 ? -21.449 -45.193 28.594 1.00 72.94  ? 145 SER B CB  1 
ATOM   3007 O OG  . SER B 1 167 ? -20.732 -44.777 27.461 1.00 71.05  ? 145 SER B OG  1 
ATOM   3008 N N   . GLN B 1 168 ? -24.511 -44.761 28.254 1.00 82.69  ? 146 GLN B N   1 
ATOM   3009 C CA  . GLN B 1 168 ? -25.649 -44.765 27.341 1.00 78.85  ? 146 GLN B CA  1 
ATOM   3010 C C   . GLN B 1 168 ? -26.542 -43.564 27.547 1.00 77.13  ? 146 GLN B C   1 
ATOM   3011 O O   . GLN B 1 168 ? -26.922 -42.901 26.590 1.00 76.17  ? 146 GLN B O   1 
ATOM   3012 C CB  . GLN B 1 168 ? -26.465 -46.043 27.507 1.00 76.41  ? 146 GLN B CB  1 
ATOM   3013 C CG  . GLN B 1 168 ? -27.543 -46.197 26.459 1.00 84.66  ? 146 GLN B CG  1 
ATOM   3014 C CD  . GLN B 1 168 ? -28.218 -47.559 26.498 1.00 87.11  ? 146 GLN B CD  1 
ATOM   3015 O OE1 . GLN B 1 168 ? -28.019 -48.340 27.428 1.00 93.32  ? 146 GLN B OE1 1 
ATOM   3016 N NE2 . GLN B 1 168 ? -29.017 -47.851 25.480 1.00 86.86  ? 146 GLN B NE2 1 
ATOM   3017 N N   . GLN B 1 169 ? -26.871 -43.287 28.803 1.00 79.58  ? 147 GLN B N   1 
ATOM   3018 C CA  . GLN B 1 169 ? -27.809 -42.224 29.115 1.00 79.03  ? 147 GLN B CA  1 
ATOM   3019 C C   . GLN B 1 169 ? -27.230 -40.888 28.668 1.00 80.42  ? 147 GLN B C   1 
ATOM   3020 O O   . GLN B 1 169 ? -27.970 -39.978 28.292 1.00 81.03  ? 147 GLN B O   1 
ATOM   3021 C CB  . GLN B 1 169 ? -28.143 -42.212 30.607 1.00 75.26  ? 147 GLN B CB  1 
ATOM   3022 N N   . ALA B 1 170 ? -25.902 -40.788 28.682 1.00 81.90  ? 148 ALA B N   1 
ATOM   3023 C CA  . ALA B 1 170 ? -25.220 -39.578 28.236 1.00 74.23  ? 148 ALA B CA  1 
ATOM   3024 C C   . ALA B 1 170 ? -25.296 -39.490 26.720 1.00 80.40  ? 148 ALA B C   1 
ATOM   3025 O O   . ALA B 1 170 ? -25.822 -38.512 26.173 1.00 82.22  ? 148 ALA B O   1 
ATOM   3026 C CB  . ALA B 1 170 ? -23.764 -39.559 28.718 1.00 69.42  ? 148 ALA B CB  1 
ATOM   3027 N N   . TYR B 1 171 ? -24.770 -40.517 26.051 1.00 76.56  ? 149 TYR B N   1 
ATOM   3028 C CA  . TYR B 1 171 ? -24.867 -40.652 24.601 1.00 74.83  ? 149 TYR B CA  1 
ATOM   3029 C C   . TYR B 1 171 ? -26.303 -40.377 24.134 1.00 80.03  ? 149 TYR B C   1 
ATOM   3030 O O   . TYR B 1 171 ? -26.533 -39.650 23.166 1.00 79.12  ? 149 TYR B O   1 
ATOM   3031 C CB  . TYR B 1 171 ? -24.428 -42.055 24.167 1.00 76.27  ? 149 TYR B CB  1 
ATOM   3032 C CG  . TYR B 1 171 ? -22.934 -42.257 23.941 1.00 73.02  ? 149 TYR B CG  1 
ATOM   3033 C CD1 . TYR B 1 171 ? -22.157 -41.291 23.311 1.00 71.19  ? 149 TYR B CD1 1 
ATOM   3034 C CD2 . TYR B 1 171 ? -22.304 -43.417 24.372 1.00 69.19  ? 149 TYR B CD2 1 
ATOM   3035 C CE1 . TYR B 1 171 ? -20.795 -41.482 23.107 1.00 67.10  ? 149 TYR B CE1 1 
ATOM   3036 C CE2 . TYR B 1 171 ? -20.954 -43.613 24.176 1.00 67.67  ? 149 TYR B CE2 1 
ATOM   3037 C CZ  . TYR B 1 171 ? -20.199 -42.646 23.539 1.00 67.17  ? 149 TYR B CZ  1 
ATOM   3038 O OH  . TYR B 1 171 ? -18.848 -42.852 23.333 1.00 67.13  ? 149 TYR B OH  1 
ATOM   3039 N N   . GLN B 1 172 ? -27.274 -40.934 24.850 1.00 81.81  ? 150 GLN B N   1 
ATOM   3040 C CA  . GLN B 1 172 ? -28.678 -40.767 24.482 1.00 83.84  ? 150 GLN B CA  1 
ATOM   3041 C C   . GLN B 1 172 ? -29.128 -39.306 24.487 1.00 87.15  ? 150 GLN B C   1 
ATOM   3042 O O   . GLN B 1 172 ? -29.557 -38.788 23.456 1.00 86.26  ? 150 GLN B O   1 
ATOM   3043 C CB  . GLN B 1 172 ? -29.578 -41.573 25.420 1.00 84.09  ? 150 GLN B CB  1 
ATOM   3044 C CG  . GLN B 1 172 ? -31.031 -41.642 24.954 1.00 88.53  ? 150 GLN B CG  1 
ATOM   3045 C CD  . GLN B 1 172 ? -31.189 -42.393 23.650 1.00 84.78  ? 150 GLN B CD  1 
ATOM   3046 O OE1 . GLN B 1 172 ? -30.608 -43.461 23.475 1.00 89.92  ? 150 GLN B OE1 1 
ATOM   3047 N NE2 . GLN B 1 172 ? -31.968 -41.837 22.726 1.00 80.42  ? 150 GLN B NE2 1 
ATOM   3048 N N   . GLU B 1 173 ? -29.043 -38.656 25.649 1.00 86.26  ? 151 GLU B N   1 
ATOM   3049 C CA  . GLU B 1 173 ? -29.488 -37.270 25.794 1.00 85.68  ? 151 GLU B CA  1 
ATOM   3050 C C   . GLU B 1 173 ? -28.813 -36.378 24.751 1.00 87.22  ? 151 GLU B C   1 
ATOM   3051 O O   . GLU B 1 173 ? -29.459 -35.525 24.139 1.00 83.55  ? 151 GLU B O   1 
ATOM   3052 C CB  . GLU B 1 173 ? -29.200 -36.762 27.208 1.00 82.51  ? 151 GLU B CB  1 
ATOM   3053 C CG  . GLU B 1 173 ? -29.744 -35.370 27.530 1.00 85.09  ? 151 GLU B CG  1 
ATOM   3054 C CD  . GLU B 1 173 ? -29.382 -34.913 28.947 1.00 100.43 ? 151 GLU B CD  1 
ATOM   3055 O OE1 . GLU B 1 173 ? -28.709 -35.678 29.690 1.00 98.97  ? 151 GLU B OE1 1 
ATOM   3056 O OE2 . GLU B 1 173 ? -29.769 -33.783 29.319 1.00 101.88 ? 151 GLU B OE2 1 
ATOM   3057 N N   . ALA B 1 174 ? -27.518 -36.603 24.537 1.00 85.66  ? 152 ALA B N   1 
ATOM   3058 C CA  . ALA B 1 174 ? -26.777 -35.885 23.507 1.00 84.83  ? 152 ALA B CA  1 
ATOM   3059 C C   . ALA B 1 174 ? -27.385 -36.150 22.162 1.00 83.65  ? 152 ALA B C   1 
ATOM   3060 O O   . ALA B 1 174 ? -27.370 -35.286 21.286 1.00 87.46  ? 152 ALA B O   1 
ATOM   3061 C CB  . ALA B 1 174 ? -25.308 -36.294 23.497 1.00 84.32  ? 152 ALA B CB  1 
ATOM   3062 N N   . PHE B 1 175 ? -27.910 -37.360 21.994 1.00 84.70  ? 153 PHE B N   1 
ATOM   3063 C CA  . PHE B 1 175 ? -28.413 -37.761 20.687 1.00 89.44  ? 153 PHE B CA  1 
ATOM   3064 C C   . PHE B 1 175 ? -29.629 -36.929 20.298 1.00 89.06  ? 153 PHE B C   1 
ATOM   3065 O O   . PHE B 1 175 ? -29.652 -36.289 19.254 1.00 91.38  ? 153 PHE B O   1 
ATOM   3066 C CB  . PHE B 1 175 ? -28.749 -39.251 20.658 1.00 84.84  ? 153 PHE B CB  1 
ATOM   3067 C CG  . PHE B 1 175 ? -28.923 -39.779 19.281 1.00 87.37  ? 153 PHE B CG  1 
ATOM   3068 C CD1 . PHE B 1 175 ? -27.923 -39.594 18.335 1.00 89.12  ? 153 PHE B CD1 1 
ATOM   3069 C CD2 . PHE B 1 175 ? -30.089 -40.432 18.910 1.00 89.11  ? 153 PHE B CD2 1 
ATOM   3070 C CE1 . PHE B 1 175 ? -28.077 -40.061 17.039 1.00 83.49  ? 153 PHE B CE1 1 
ATOM   3071 C CE2 . PHE B 1 175 ? -30.252 -40.897 17.617 1.00 83.05  ? 153 PHE B CE2 1 
ATOM   3072 C CZ  . PHE B 1 175 ? -29.239 -40.713 16.682 1.00 77.33  ? 153 PHE B CZ  1 
ATOM   3073 N N   . GLU B 1 176 ? -30.621 -36.915 21.174 1.00 88.37  ? 154 GLU B N   1 
ATOM   3074 C CA  . GLU B 1 176 ? -31.876 -36.238 20.898 1.00 91.15  ? 154 GLU B CA  1 
ATOM   3075 C C   . GLU B 1 176 ? -31.730 -34.724 20.729 1.00 91.66  ? 154 GLU B C   1 
ATOM   3076 O O   . GLU B 1 176 ? -32.364 -34.135 19.846 1.00 97.70  ? 154 GLU B O   1 
ATOM   3077 C CB  . GLU B 1 176 ? -32.871 -36.569 21.997 1.00 88.16  ? 154 GLU B CB  1 
ATOM   3078 C CG  . GLU B 1 176 ? -32.522 -37.869 22.676 1.00 88.88  ? 154 GLU B CG  1 
ATOM   3079 C CD  . GLU B 1 176 ? -33.577 -38.320 23.650 1.00 97.85  ? 154 GLU B CD  1 
ATOM   3080 O OE1 . GLU B 1 176 ? -34.775 -38.152 23.336 1.00 108.48 ? 154 GLU B OE1 1 
ATOM   3081 O OE2 . GLU B 1 176 ? -33.217 -38.839 24.729 1.00 99.74  ? 154 GLU B OE2 1 
ATOM   3082 N N   . ILE B 1 177 ? -30.894 -34.096 21.543 1.00 85.60  ? 155 ILE B N   1 
ATOM   3083 C CA  . ILE B 1 177 ? -30.605 -32.688 21.339 1.00 87.87  ? 155 ILE B CA  1 
ATOM   3084 C C   . ILE B 1 177 ? -30.009 -32.452 19.953 1.00 89.84  ? 155 ILE B C   1 
ATOM   3085 O O   . ILE B 1 177 ? -30.409 -31.532 19.247 1.00 93.39  ? 155 ILE B O   1 
ATOM   3086 C CB  . ILE B 1 177 ? -29.649 -32.157 22.407 1.00 85.56  ? 155 ILE B CB  1 
ATOM   3087 C CG1 . ILE B 1 177 ? -30.245 -32.364 23.800 1.00 78.07  ? 155 ILE B CG1 1 
ATOM   3088 C CG2 . ILE B 1 177 ? -29.344 -30.691 22.179 1.00 84.07  ? 155 ILE B CG2 1 
ATOM   3089 C CD1 . ILE B 1 177 ? -29.394 -31.821 24.891 1.00 74.30  ? 155 ILE B CD1 1 
ATOM   3090 N N   . SER B 1 178 ? -29.070 -33.298 19.553 1.00 90.12  ? 156 SER B N   1 
ATOM   3091 C CA  . SER B 1 178 ? -28.380 -33.082 18.287 1.00 95.17  ? 156 SER B CA  1 
ATOM   3092 C C   . SER B 1 178 ? -29.321 -33.258 17.086 1.00 98.50  ? 156 SER B C   1 
ATOM   3093 O O   . SER B 1 178 ? -29.222 -32.523 16.097 1.00 98.57  ? 156 SER B O   1 
ATOM   3094 C CB  . SER B 1 178 ? -27.176 -34.020 18.166 1.00 92.54  ? 156 SER B CB  1 
ATOM   3095 O OG  . SER B 1 178 ? -27.512 -35.238 17.528 1.00 92.12  ? 156 SER B OG  1 
ATOM   3096 N N   . LYS B 1 179 ? -30.237 -34.220 17.168 1.00 96.44  ? 157 LYS B N   1 
ATOM   3097 C CA  . LYS B 1 179 ? -31.150 -34.467 16.058 1.00 95.92  ? 157 LYS B CA  1 
ATOM   3098 C C   . LYS B 1 179 ? -32.181 -33.342 16.004 1.00 97.16  ? 157 LYS B C   1 
ATOM   3099 O O   . LYS B 1 179 ? -32.582 -32.900 14.929 1.00 92.05  ? 157 LYS B O   1 
ATOM   3100 C CB  . LYS B 1 179 ? -31.825 -35.836 16.196 1.00 90.40  ? 157 LYS B CB  1 
ATOM   3101 N N   . LYS B 1 180 ? -32.571 -32.859 17.183 1.00 102.08 ? 158 LYS B N   1 
ATOM   3102 C CA  . LYS B 1 180 ? -33.599 -31.824 17.313 1.00 98.20  ? 158 LYS B CA  1 
ATOM   3103 C C   . LYS B 1 180 ? -33.069 -30.409 17.066 1.00 101.38 ? 158 LYS B C   1 
ATOM   3104 O O   . LYS B 1 180 ? -33.843 -29.515 16.731 1.00 105.89 ? 158 LYS B O   1 
ATOM   3105 C CB  . LYS B 1 180 ? -34.230 -31.903 18.702 1.00 93.69  ? 158 LYS B CB  1 
ATOM   3106 C CG  . LYS B 1 180 ? -35.412 -30.986 18.948 1.00 102.66 ? 158 LYS B CG  1 
ATOM   3107 C CD  . LYS B 1 180 ? -35.755 -30.956 20.443 1.00 108.27 ? 158 LYS B CD  1 
ATOM   3108 C CE  . LYS B 1 180 ? -36.924 -30.027 20.744 1.00 104.91 ? 158 LYS B CE  1 
ATOM   3109 N NZ  . LYS B 1 180 ? -37.179 -29.945 22.213 1.00 103.89 ? 158 LYS B NZ  1 
ATOM   3110 N N   . GLU B 1 181 ? -31.756 -30.207 17.210 1.00 101.62 ? 159 GLU B N   1 
ATOM   3111 C CA  . GLU B 1 181 ? -31.179 -28.860 17.132 1.00 95.94  ? 159 GLU B CA  1 
ATOM   3112 C C   . GLU B 1 181 ? -30.154 -28.668 16.001 1.00 95.30  ? 159 GLU B C   1 
ATOM   3113 O O   . GLU B 1 181 ? -29.946 -27.541 15.561 1.00 100.52 ? 159 GLU B O   1 
ATOM   3114 C CB  . GLU B 1 181 ? -30.517 -28.474 18.470 1.00 100.50 ? 159 GLU B CB  1 
ATOM   3115 C CG  . GLU B 1 181 ? -31.419 -28.429 19.748 1.00 100.35 ? 159 GLU B CG  1 
ATOM   3116 C CD  . GLU B 1 181 ? -32.333 -27.201 19.886 1.00 103.44 ? 159 GLU B CD  1 
ATOM   3117 O OE1 . GLU B 1 181 ? -32.426 -26.387 18.936 1.00 110.88 ? 159 GLU B OE1 1 
ATOM   3118 O OE2 . GLU B 1 181 ? -32.934 -27.047 20.978 1.00 90.59  ? 159 GLU B OE2 1 
ATOM   3119 N N   . MET B 1 182 ? -29.503 -29.728 15.523 1.00 96.62  ? 160 MET B N   1 
ATOM   3120 C CA  . MET B 1 182 ? -28.519 -29.542 14.440 1.00 94.63  ? 160 MET B CA  1 
ATOM   3121 C C   . MET B 1 182 ? -28.822 -30.285 13.131 1.00 95.25  ? 160 MET B C   1 
ATOM   3122 O O   . MET B 1 182 ? -29.707 -31.145 13.064 1.00 91.21  ? 160 MET B O   1 
ATOM   3123 C CB  . MET B 1 182 ? -27.121 -29.969 14.885 1.00 96.70  ? 160 MET B CB  1 
ATOM   3124 C CG  . MET B 1 182 ? -26.807 -29.856 16.364 1.00 102.53 ? 160 MET B CG  1 
ATOM   3125 S SD  . MET B 1 182 ? -25.099 -30.410 16.616 1.00 107.36 ? 160 MET B SD  1 
ATOM   3126 C CE  . MET B 1 182 ? -24.953 -30.197 18.366 1.00 99.17  ? 160 MET B CE  1 
ATOM   3127 N N   . GLN B 1 183 ? -28.038 -29.948 12.106 1.00 95.51  ? 161 GLN B N   1 
ATOM   3128 C CA  . GLN B 1 183 ? -28.119 -30.556 10.782 1.00 95.70  ? 161 GLN B CA  1 
ATOM   3129 C C   . GLN B 1 183 ? -27.421 -31.910 10.715 1.00 92.20  ? 161 GLN B C   1 
ATOM   3130 O O   . GLN B 1 183 ? -26.409 -32.120 11.369 1.00 95.80  ? 161 GLN B O   1 
ATOM   3131 C CB  . GLN B 1 183 ? -27.494 -29.625 9.743  1.00 100.55 ? 161 GLN B CB  1 
ATOM   3132 C CG  . GLN B 1 183 ? -28.240 -28.309 9.581  1.00 102.65 ? 161 GLN B CG  1 
ATOM   3133 C CD  . GLN B 1 183 ? -29.479 -28.344 8.687  1.00 114.20 ? 161 GLN B CD  1 
ATOM   3134 O OE1 . GLN B 1 183 ? -30.170 -29.359 8.574  1.00 115.63 ? 161 GLN B OE1 1 
ATOM   3135 N NE2 . GLN B 1 183 ? -29.791 -27.197 8.082  1.00 121.44 ? 161 GLN B NE2 1 
ATOM   3136 N N   . PRO B 1 184 ? -27.941 -32.823 9.890  1.00 91.40  ? 162 PRO B N   1 
ATOM   3137 C CA  . PRO B 1 184 ? -27.349 -34.148 9.724  1.00 89.64  ? 162 PRO B CA  1 
ATOM   3138 C C   . PRO B 1 184 ? -25.875 -34.115 9.321  1.00 89.43  ? 162 PRO B C   1 
ATOM   3139 O O   . PRO B 1 184 ? -25.192 -35.111 9.557  1.00 92.37  ? 162 PRO B O   1 
ATOM   3140 C CB  . PRO B 1 184 ? -28.203 -34.767 8.613  1.00 91.14  ? 162 PRO B CB  1 
ATOM   3141 C CG  . PRO B 1 184 ? -29.493 -34.060 8.697  1.00 91.68  ? 162 PRO B CG  1 
ATOM   3142 C CD  . PRO B 1 184 ? -29.124 -32.652 9.035  1.00 96.73  ? 162 PRO B CD  1 
ATOM   3143 N N   . THR B 1 185 ? -25.388 -33.023 8.739  1.00 85.03  ? 163 THR B N   1 
ATOM   3144 C CA  . THR B 1 185 ? -23.994 -32.992 8.287  1.00 86.15  ? 163 THR B CA  1 
ATOM   3145 C C   . THR B 1 185 ? -23.097 -32.228 9.243  1.00 87.82  ? 163 THR B C   1 
ATOM   3146 O O   . THR B 1 185 ? -21.900 -32.069 9.004  1.00 83.35  ? 163 THR B O   1 
ATOM   3147 C CB  . THR B 1 185 ? -23.858 -32.357 6.923  1.00 86.17  ? 163 THR B CB  1 
ATOM   3148 O OG1 . THR B 1 185 ? -24.245 -30.987 7.022  1.00 98.75  ? 163 THR B OG1 1 
ATOM   3149 C CG2 . THR B 1 185 ? -24.754 -33.051 5.940  1.00 92.36  ? 163 THR B CG2 1 
ATOM   3150 N N   . HIS B 1 186 ? -23.697 -31.734 10.315 1.00 86.95  ? 164 HIS B N   1 
ATOM   3151 C CA  . HIS B 1 186 ? -22.958 -31.123 11.396 1.00 81.10  ? 164 HIS B CA  1 
ATOM   3152 C C   . HIS B 1 186 ? -22.026 -32.174 11.993 1.00 89.98  ? 164 HIS B C   1 
ATOM   3153 O O   . HIS B 1 186 ? -22.481 -33.220 12.492 1.00 87.12  ? 164 HIS B O   1 
ATOM   3154 C CB  . HIS B 1 186 ? -23.923 -30.577 12.440 1.00 90.64  ? 164 HIS B CB  1 
ATOM   3155 C CG  . HIS B 1 186 ? -23.307 -29.606 13.398 1.00 99.29  ? 164 HIS B CG  1 
ATOM   3156 N ND1 . HIS B 1 186 ? -22.012 -29.728 13.860 1.00 96.99  ? 164 HIS B ND1 1 
ATOM   3157 C CD2 . HIS B 1 186 ? -23.820 -28.509 14.003 1.00 96.27  ? 164 HIS B CD2 1 
ATOM   3158 C CE1 . HIS B 1 186 ? -21.752 -28.741 14.697 1.00 96.43  ? 164 HIS B CE1 1 
ATOM   3159 N NE2 . HIS B 1 186 ? -22.832 -27.988 14.801 1.00 101.85 ? 164 HIS B NE2 1 
ATOM   3160 N N   . PRO B 1 187 ? -20.711 -31.908 11.930 1.00 90.56  ? 165 PRO B N   1 
ATOM   3161 C CA  . PRO B 1 187 ? -19.689 -32.871 12.354 1.00 84.58  ? 165 PRO B CA  1 
ATOM   3162 C C   . PRO B 1 187 ? -19.863 -33.322 13.799 1.00 86.18  ? 165 PRO B C   1 
ATOM   3163 O O   . PRO B 1 187 ? -19.534 -34.459 14.128 1.00 89.04  ? 165 PRO B O   1 
ATOM   3164 C CB  . PRO B 1 187 ? -18.386 -32.094 12.170 1.00 80.09  ? 165 PRO B CB  1 
ATOM   3165 C CG  . PRO B 1 187 ? -18.689 -31.121 11.088 1.00 87.28  ? 165 PRO B CG  1 
ATOM   3166 C CD  . PRO B 1 187 ? -20.114 -30.702 11.333 1.00 86.08  ? 165 PRO B CD  1 
ATOM   3167 N N   . ILE B 1 188 ? -20.381 -32.457 14.659 1.00 84.03  ? 166 ILE B N   1 
ATOM   3168 C CA  . ILE B 1 188 ? -20.591 -32.876 16.033 1.00 85.84  ? 166 ILE B CA  1 
ATOM   3169 C C   . ILE B 1 188 ? -21.700 -33.924 16.067 1.00 88.02  ? 166 ILE B C   1 
ATOM   3170 O O   . ILE B 1 188 ? -21.540 -34.986 16.672 1.00 85.83  ? 166 ILE B O   1 
ATOM   3171 C CB  . ILE B 1 188 ? -20.926 -31.696 16.951 1.00 87.37  ? 166 ILE B CB  1 
ATOM   3172 C CG1 . ILE B 1 188 ? -19.689 -30.819 17.142 1.00 86.57  ? 166 ILE B CG1 1 
ATOM   3173 C CG2 . ILE B 1 188 ? -21.386 -32.193 18.300 1.00 86.53  ? 166 ILE B CG2 1 
ATOM   3174 C CD1 . ILE B 1 188 ? -19.885 -29.689 18.137 1.00 93.92  ? 166 ILE B CD1 1 
ATOM   3175 N N   . ARG B 1 189 ? -22.811 -33.636 15.390 1.00 92.21  ? 167 ARG B N   1 
ATOM   3176 C CA  . ARG B 1 189 ? -23.903 -34.596 15.256 1.00 85.99  ? 167 ARG B CA  1 
ATOM   3177 C C   . ARG B 1 189 ? -23.421 -35.858 14.566 1.00 82.95  ? 167 ARG B C   1 
ATOM   3178 O O   . ARG B 1 189 ? -23.751 -36.970 14.981 1.00 77.93  ? 167 ARG B O   1 
ATOM   3179 C CB  . ARG B 1 189 ? -25.053 -33.999 14.469 1.00 86.69  ? 167 ARG B CB  1 
ATOM   3180 C CG  . ARG B 1 189 ? -26.149 -34.984 14.242 1.00 87.84  ? 167 ARG B CG  1 
ATOM   3181 C CD  . ARG B 1 189 ? -27.232 -34.383 13.419 1.00 89.04  ? 167 ARG B CD  1 
ATOM   3182 N NE  . ARG B 1 189 ? -28.329 -35.317 13.249 1.00 90.64  ? 167 ARG B NE  1 
ATOM   3183 C CZ  . ARG B 1 189 ? -29.451 -35.039 12.603 1.00 90.19  ? 167 ARG B CZ  1 
ATOM   3184 N NH1 . ARG B 1 189 ? -29.625 -33.840 12.062 1.00 95.07  ? 167 ARG B NH1 1 
ATOM   3185 N NH2 . ARG B 1 189 ? -30.394 -35.962 12.501 1.00 88.46  ? 167 ARG B NH2 1 
ATOM   3186 N N   . LEU B 1 190 ? -22.630 -35.667 13.512 1.00 82.59  ? 168 LEU B N   1 
ATOM   3187 C CA  . LEU B 1 190 ? -21.997 -36.777 12.807 1.00 82.96  ? 168 LEU B CA  1 
ATOM   3188 C C   . LEU B 1 190 ? -21.058 -37.598 13.696 1.00 85.73  ? 168 LEU B C   1 
ATOM   3189 O O   . LEU B 1 190 ? -21.094 -38.836 13.684 1.00 81.22  ? 168 LEU B O   1 
ATOM   3190 C CB  . LEU B 1 190 ? -21.233 -36.261 11.593 1.00 79.96  ? 168 LEU B CB  1 
ATOM   3191 C CG  . LEU B 1 190 ? -22.078 -36.241 10.318 1.00 83.64  ? 168 LEU B CG  1 
ATOM   3192 C CD1 . LEU B 1 190 ? -21.219 -36.058 9.068  1.00 81.38  ? 168 LEU B CD1 1 
ATOM   3193 C CD2 . LEU B 1 190 ? -22.874 -37.524 10.236 1.00 79.35  ? 168 LEU B CD2 1 
ATOM   3194 N N   . GLY B 1 191 ? -20.222 -36.903 14.467 1.00 86.02  ? 169 GLY B N   1 
ATOM   3195 C CA  . GLY B 1 191 ? -19.263 -37.551 15.341 1.00 79.53  ? 169 GLY B CA  1 
ATOM   3196 C C   . GLY B 1 191 ? -19.930 -38.224 16.523 1.00 78.92  ? 169 GLY B C   1 
ATOM   3197 O O   . GLY B 1 191 ? -19.427 -39.213 17.063 1.00 81.06  ? 169 GLY B O   1 
ATOM   3198 N N   . LEU B 1 192 ? -21.065 -37.686 16.938 1.00 74.58  ? 170 LEU B N   1 
ATOM   3199 C CA  . LEU B 1 192 ? -21.827 -38.317 17.997 1.00 74.82  ? 170 LEU B CA  1 
ATOM   3200 C C   . LEU B 1 192 ? -22.380 -39.638 17.503 1.00 78.20  ? 170 LEU B C   1 
ATOM   3201 O O   . LEU B 1 192 ? -22.413 -40.629 18.231 1.00 79.62  ? 170 LEU B O   1 
ATOM   3202 C CB  . LEU B 1 192 ? -22.961 -37.417 18.459 1.00 75.40  ? 170 LEU B CB  1 
ATOM   3203 C CG  . LEU B 1 192 ? -24.009 -38.126 19.306 1.00 80.21  ? 170 LEU B CG  1 
ATOM   3204 C CD1 . LEU B 1 192 ? -23.404 -38.646 20.607 1.00 78.93  ? 170 LEU B CD1 1 
ATOM   3205 C CD2 . LEU B 1 192 ? -25.145 -37.163 19.579 1.00 86.87  ? 170 LEU B CD2 1 
ATOM   3206 N N   . ALA B 1 193 ? -22.824 -39.640 16.254 1.00 78.87  ? 171 ALA B N   1 
ATOM   3207 C CA  . ALA B 1 193 ? -23.384 -40.837 15.663 1.00 78.22  ? 171 ALA B CA  1 
ATOM   3208 C C   . ALA B 1 193 ? -22.329 -41.920 15.646 1.00 78.77  ? 171 ALA B C   1 
ATOM   3209 O O   . ALA B 1 193 ? -22.574 -43.052 16.077 1.00 79.95  ? 171 ALA B O   1 
ATOM   3210 C CB  . ALA B 1 193 ? -23.886 -40.561 14.264 1.00 77.19  ? 171 ALA B CB  1 
ATOM   3211 N N   . LEU B 1 194 ? -21.153 -41.560 15.145 1.00 77.60  ? 172 LEU B N   1 
ATOM   3212 C CA  . LEU B 1 194 ? -20.035 -42.486 15.083 1.00 75.78  ? 172 LEU B CA  1 
ATOM   3213 C C   . LEU B 1 194 ? -19.830 -43.189 16.427 1.00 77.75  ? 172 LEU B C   1 
ATOM   3214 O O   . LEU B 1 194 ? -19.838 -44.421 16.510 1.00 80.69  ? 172 LEU B O   1 
ATOM   3215 C CB  . LEU B 1 194 ? -18.761 -41.751 14.667 1.00 69.88  ? 172 LEU B CB  1 
ATOM   3216 C CG  . LEU B 1 194 ? -17.591 -42.675 14.365 1.00 68.43  ? 172 LEU B CG  1 
ATOM   3217 C CD1 . LEU B 1 194 ? -18.041 -43.755 13.407 1.00 71.39  ? 172 LEU B CD1 1 
ATOM   3218 C CD2 . LEU B 1 194 ? -16.401 -41.923 13.789 1.00 66.50  ? 172 LEU B CD2 1 
ATOM   3219 N N   . ASN B 1 195 ? -19.687 -42.408 17.490 1.00 77.06  ? 173 ASN B N   1 
ATOM   3220 C CA  . ASN B 1 195 ? -19.300 -42.982 18.774 1.00 76.51  ? 173 ASN B CA  1 
ATOM   3221 C C   . ASN B 1 195 ? -20.455 -43.680 19.481 1.00 75.85  ? 173 ASN B C   1 
ATOM   3222 O O   . ASN B 1 195 ? -20.241 -44.621 20.253 1.00 75.47  ? 173 ASN B O   1 
ATOM   3223 C CB  . ASN B 1 195 ? -18.691 -41.901 19.662 1.00 74.64  ? 173 ASN B CB  1 
ATOM   3224 C CG  . ASN B 1 195 ? -17.350 -41.438 19.148 1.00 72.19  ? 173 ASN B CG  1 
ATOM   3225 O OD1 . ASN B 1 195 ? -16.875 -41.921 18.124 1.00 74.66  ? 173 ASN B OD1 1 
ATOM   3226 N ND2 . ASN B 1 195 ? -16.733 -40.504 19.848 1.00 79.48  ? 173 ASN B ND2 1 
ATOM   3227 N N   . PHE B 1 196 ? -21.679 -43.240 19.212 1.00 75.46  ? 174 PHE B N   1 
ATOM   3228 C CA  . PHE B 1 196 ? -22.834 -43.937 19.753 1.00 74.14  ? 174 PHE B CA  1 
ATOM   3229 C C   . PHE B 1 196 ? -22.931 -45.343 19.125 1.00 76.14  ? 174 PHE B C   1 
ATOM   3230 O O   . PHE B 1 196 ? -23.224 -46.312 19.817 1.00 74.72  ? 174 PHE B O   1 
ATOM   3231 C CB  . PHE B 1 196 ? -24.121 -43.159 19.492 1.00 77.88  ? 174 PHE B CB  1 
ATOM   3232 C CG  . PHE B 1 196 ? -25.206 -43.435 20.497 1.00 78.53  ? 174 PHE B CG  1 
ATOM   3233 C CD1 . PHE B 1 196 ? -26.087 -42.441 20.880 1.00 82.09  ? 174 PHE B CD1 1 
ATOM   3234 C CD2 . PHE B 1 196 ? -25.287 -44.670 21.132 1.00 88.19  ? 174 PHE B CD2 1 
ATOM   3235 C CE1 . PHE B 1 196 ? -27.064 -42.704 21.824 1.00 86.51  ? 174 PHE B CE1 1 
ATOM   3236 C CE2 . PHE B 1 196 ? -26.257 -44.924 22.088 1.00 90.76  ? 174 PHE B CE2 1 
ATOM   3237 C CZ  . PHE B 1 196 ? -27.158 -43.953 22.435 1.00 85.91  ? 174 PHE B CZ  1 
ATOM   3238 N N   . SER B 1 197 ? -22.687 -45.471 17.821 1.00 75.11  ? 175 SER B N   1 
ATOM   3239 C CA  . SER B 1 197 ? -22.800 -46.796 17.216 1.00 75.65  ? 175 SER B CA  1 
ATOM   3240 C C   . SER B 1 197 ? -21.693 -47.690 17.777 1.00 74.20  ? 175 SER B C   1 
ATOM   3241 O O   . SER B 1 197 ? -21.949 -48.841 18.138 1.00 75.31  ? 175 SER B O   1 
ATOM   3242 C CB  . SER B 1 197 ? -22.770 -46.740 15.676 1.00 65.03  ? 175 SER B CB  1 
ATOM   3243 O OG  . SER B 1 197 ? -21.476 -46.494 15.162 1.00 74.62  ? 175 SER B OG  1 
ATOM   3244 N N   . VAL B 1 198 ? -20.484 -47.149 17.900 1.00 72.81  ? 176 VAL B N   1 
ATOM   3245 C CA  . VAL B 1 198 ? -19.389 -47.882 18.538 1.00 75.13  ? 176 VAL B CA  1 
ATOM   3246 C C   . VAL B 1 198 ? -19.772 -48.341 19.955 1.00 72.25  ? 176 VAL B C   1 
ATOM   3247 O O   . VAL B 1 198 ? -19.435 -49.449 20.376 1.00 69.37  ? 176 VAL B O   1 
ATOM   3248 C CB  . VAL B 1 198 ? -18.113 -47.040 18.596 1.00 71.68  ? 176 VAL B CB  1 
ATOM   3249 C CG1 . VAL B 1 198 ? -17.092 -47.705 19.453 1.00 65.66  ? 176 VAL B CG1 1 
ATOM   3250 C CG2 . VAL B 1 198 ? -17.565 -46.855 17.198 1.00 75.11  ? 176 VAL B CG2 1 
ATOM   3251 N N   . PHE B 1 199 ? -20.504 -47.504 20.677 1.00 69.65  ? 177 PHE B N   1 
ATOM   3252 C CA  . PHE B 1 199 ? -20.990 -47.913 21.979 1.00 71.35  ? 177 PHE B CA  1 
ATOM   3253 C C   . PHE B 1 199 ? -21.789 -49.194 21.830 1.00 75.01  ? 177 PHE B C   1 
ATOM   3254 O O   . PHE B 1 199 ? -21.484 -50.229 22.436 1.00 76.03  ? 177 PHE B O   1 
ATOM   3255 C CB  . PHE B 1 199 ? -21.853 -46.825 22.623 1.00 75.57  ? 177 PHE B CB  1 
ATOM   3256 C CG  . PHE B 1 199 ? -22.472 -47.245 23.931 1.00 72.27  ? 177 PHE B CG  1 
ATOM   3257 C CD1 . PHE B 1 199 ? -21.693 -47.348 25.075 1.00 73.14  ? 177 PHE B CD1 1 
ATOM   3258 C CD2 . PHE B 1 199 ? -23.822 -47.552 24.015 1.00 72.14  ? 177 PHE B CD2 1 
ATOM   3259 C CE1 . PHE B 1 199 ? -22.248 -47.749 26.288 1.00 73.68  ? 177 PHE B CE1 1 
ATOM   3260 C CE2 . PHE B 1 199 ? -24.382 -47.959 25.225 1.00 76.76  ? 177 PHE B CE2 1 
ATOM   3261 C CZ  . PHE B 1 199 ? -23.590 -48.054 26.360 1.00 75.24  ? 177 PHE B CZ  1 
ATOM   3262 N N   . TYR B 1 200 ? -22.809 -49.111 20.993 1.00 74.88  ? 178 TYR B N   1 
ATOM   3263 C CA  . TYR B 1 200 ? -23.724 -50.205 20.789 1.00 69.91  ? 178 TYR B CA  1 
ATOM   3264 C C   . TYR B 1 200 ? -23.017 -51.464 20.367 1.00 73.81  ? 178 TYR B C   1 
ATOM   3265 O O   . TYR B 1 200 ? -23.256 -52.523 20.918 1.00 77.96  ? 178 TYR B O   1 
ATOM   3266 C CB  . TYR B 1 200 ? -24.743 -49.808 19.752 1.00 73.11  ? 178 TYR B CB  1 
ATOM   3267 C CG  . TYR B 1 200 ? -25.927 -49.126 20.343 1.00 75.16  ? 178 TYR B CG  1 
ATOM   3268 C CD1 . TYR B 1 200 ? -26.608 -49.693 21.413 1.00 76.93  ? 178 TYR B CD1 1 
ATOM   3269 C CD2 . TYR B 1 200 ? -26.342 -47.894 19.874 1.00 73.20  ? 178 TYR B CD2 1 
ATOM   3270 C CE1 . TYR B 1 200 ? -27.696 -49.064 21.974 1.00 76.33  ? 178 TYR B CE1 1 
ATOM   3271 C CE2 . TYR B 1 200 ? -27.437 -47.267 20.416 1.00 71.97  ? 178 TYR B CE2 1 
ATOM   3272 C CZ  . TYR B 1 200 ? -28.100 -47.842 21.473 1.00 75.07  ? 178 TYR B CZ  1 
ATOM   3273 O OH  . TYR B 1 200 ? -29.185 -47.202 22.026 1.00 81.40  ? 178 TYR B OH  1 
ATOM   3274 N N   . TYR B 1 201 ? -22.130 -51.346 19.395 1.00 72.15  ? 179 TYR B N   1 
ATOM   3275 C CA  . TYR B 1 201 ? -21.459 -52.522 18.892 1.00 70.75  ? 179 TYR B CA  1 
ATOM   3276 C C   . TYR B 1 201 ? -20.549 -53.099 19.952 1.00 73.88  ? 179 TYR B C   1 
ATOM   3277 O O   . TYR B 1 201 ? -20.716 -54.244 20.375 1.00 74.74  ? 179 TYR B O   1 
ATOM   3278 C CB  . TYR B 1 201 ? -20.660 -52.194 17.640 1.00 71.52  ? 179 TYR B CB  1 
ATOM   3279 C CG  . TYR B 1 201 ? -20.195 -53.420 16.918 1.00 74.17  ? 179 TYR B CG  1 
ATOM   3280 C CD1 . TYR B 1 201 ? -20.967 -53.995 15.911 1.00 77.53  ? 179 TYR B CD1 1 
ATOM   3281 C CD2 . TYR B 1 201 ? -18.999 -54.025 17.255 1.00 73.20  ? 179 TYR B CD2 1 
ATOM   3282 C CE1 . TYR B 1 201 ? -20.538 -55.132 15.248 1.00 78.95  ? 179 TYR B CE1 1 
ATOM   3283 C CE2 . TYR B 1 201 ? -18.566 -55.159 16.602 1.00 76.34  ? 179 TYR B CE2 1 
ATOM   3284 C CZ  . TYR B 1 201 ? -19.331 -55.708 15.607 1.00 77.66  ? 179 TYR B CZ  1 
ATOM   3285 O OH  . TYR B 1 201 ? -18.869 -56.831 14.975 1.00 81.90  ? 179 TYR B OH  1 
ATOM   3286 N N   . GLU B 1 202 ? -19.597 -52.293 20.404 1.00 74.21  ? 180 GLU B N   1 
ATOM   3287 C CA  . GLU B 1 202 ? -18.531 -52.817 21.244 1.00 73.59  ? 180 GLU B CA  1 
ATOM   3288 C C   . GLU B 1 202 ? -18.894 -52.977 22.704 1.00 71.87  ? 180 GLU B C   1 
ATOM   3289 O O   . GLU B 1 202 ? -18.366 -53.875 23.341 1.00 76.83  ? 180 GLU B O   1 
ATOM   3290 C CB  . GLU B 1 202 ? -17.289 -51.943 21.138 1.00 71.04  ? 180 GLU B CB  1 
ATOM   3291 C CG  . GLU B 1 202 ? -16.631 -51.982 19.777 1.00 69.55  ? 180 GLU B CG  1 
ATOM   3292 C CD  . GLU B 1 202 ? -15.440 -51.071 19.699 1.00 77.23  ? 180 GLU B CD  1 
ATOM   3293 O OE1 . GLU B 1 202 ? -15.181 -50.373 20.703 1.00 89.39  ? 180 GLU B OE1 1 
ATOM   3294 O OE2 . GLU B 1 202 ? -14.759 -51.050 18.652 1.00 80.35  ? 180 GLU B OE2 1 
ATOM   3295 N N   . ILE B 1 203 ? -19.777 -52.133 23.239 1.00 72.86  ? 181 ILE B N   1 
ATOM   3296 C CA  . ILE B 1 203 ? -20.067 -52.176 24.681 1.00 75.07  ? 181 ILE B CA  1 
ATOM   3297 C C   . ILE B 1 203 ? -21.362 -52.927 25.004 1.00 79.51  ? 181 ILE B C   1 
ATOM   3298 O O   . ILE B 1 203 ? -21.444 -53.647 26.006 1.00 75.92  ? 181 ILE B O   1 
ATOM   3299 C CB  . ILE B 1 203 ? -20.160 -50.754 25.307 1.00 70.08  ? 181 ILE B CB  1 
ATOM   3300 C CG1 . ILE B 1 203 ? -18.871 -49.979 25.106 1.00 67.18  ? 181 ILE B CG1 1 
ATOM   3301 C CG2 . ILE B 1 203 ? -20.384 -50.844 26.767 1.00 69.25  ? 181 ILE B CG2 1 
ATOM   3302 C CD1 . ILE B 1 203 ? -17.741 -50.592 25.810 1.00 65.52  ? 181 ILE B CD1 1 
ATOM   3303 N N   . LEU B 1 204 ? -22.382 -52.762 24.168 1.00 81.70  ? 182 LEU B N   1 
ATOM   3304 C CA  . LEU B 1 204 ? -23.660 -53.427 24.436 1.00 79.49  ? 182 LEU B CA  1 
ATOM   3305 C C   . LEU B 1 204 ? -23.817 -54.723 23.670 1.00 81.50  ? 182 LEU B C   1 
ATOM   3306 O O   . LEU B 1 204 ? -24.779 -55.457 23.897 1.00 90.50  ? 182 LEU B O   1 
ATOM   3307 C CB  . LEU B 1 204 ? -24.842 -52.519 24.104 1.00 76.18  ? 182 LEU B CB  1 
ATOM   3308 C CG  . LEU B 1 204 ? -25.261 -51.493 25.152 1.00 80.85  ? 182 LEU B CG  1 
ATOM   3309 C CD1 . LEU B 1 204 ? -26.621 -50.941 24.766 1.00 82.22  ? 182 LEU B CD1 1 
ATOM   3310 C CD2 . LEU B 1 204 ? -25.294 -52.109 26.549 1.00 77.69  ? 182 LEU B CD2 1 
ATOM   3311 N N   . ASN B 1 205 ? -22.870 -55.011 22.783 1.00 79.23  ? 183 ASN B N   1 
ATOM   3312 C CA  . ASN B 1 205 ? -23.008 -56.132 21.858 1.00 82.05  ? 183 ASN B CA  1 
ATOM   3313 C C   . ASN B 1 205 ? -24.415 -56.092 21.250 1.00 82.55  ? 183 ASN B C   1 
ATOM   3314 O O   . ASN B 1 205 ? -25.174 -57.064 21.291 1.00 86.94  ? 183 ASN B O   1 
ATOM   3315 C CB  . ASN B 1 205 ? -22.732 -57.463 22.561 1.00 88.31  ? 183 ASN B CB  1 
ATOM   3316 C CG  . ASN B 1 205 ? -21.631 -57.354 23.625 1.00 86.68  ? 183 ASN B CG  1 
ATOM   3317 O OD1 . ASN B 1 205 ? -20.568 -56.765 23.400 1.00 83.60  ? 183 ASN B OD1 1 
ATOM   3318 N ND2 . ASN B 1 205 ? -21.894 -57.925 24.796 1.00 93.01  ? 183 ASN B ND2 1 
ATOM   3319 N N   . SER B 1 206 ? -24.758 -54.913 20.746 1.00 78.29  ? 184 SER B N   1 
ATOM   3320 C CA  . SER B 1 206 ? -25.972 -54.665 20.002 1.00 73.38  ? 184 SER B CA  1 
ATOM   3321 C C   . SER B 1 206 ? -25.612 -54.318 18.572 1.00 78.23  ? 184 SER B C   1 
ATOM   3322 O O   . SER B 1 206 ? -25.721 -53.153 18.174 1.00 79.70  ? 184 SER B O   1 
ATOM   3323 C CB  . SER B 1 206 ? -26.763 -53.516 20.622 1.00 75.87  ? 184 SER B CB  1 
ATOM   3324 O OG  . SER B 1 206 ? -27.744 -53.989 21.525 1.00 86.25  ? 184 SER B OG  1 
ATOM   3325 N N   . PRO B 1 207 ? -25.181 -55.318 17.790 1.00 76.92  ? 185 PRO B N   1 
ATOM   3326 C CA  . PRO B 1 207 ? -24.648 -55.040 16.447 1.00 76.51  ? 185 PRO B CA  1 
ATOM   3327 C C   . PRO B 1 207 ? -25.685 -54.517 15.439 1.00 73.03  ? 185 PRO B C   1 
ATOM   3328 O O   . PRO B 1 207 ? -25.338 -53.728 14.561 1.00 74.06  ? 185 PRO B O   1 
ATOM   3329 C CB  . PRO B 1 207 ? -24.089 -56.397 16.010 1.00 77.59  ? 185 PRO B CB  1 
ATOM   3330 C CG  . PRO B 1 207 ? -24.815 -57.405 16.837 1.00 73.64  ? 185 PRO B CG  1 
ATOM   3331 C CD  . PRO B 1 207 ? -25.185 -56.753 18.116 1.00 69.98  ? 185 PRO B CD  1 
ATOM   3332 N N   . GLU B 1 208 ? -26.941 -54.924 15.564 1.00 71.84  ? 186 GLU B N   1 
ATOM   3333 C CA  . GLU B 1 208 ? -27.950 -54.414 14.648 1.00 71.57  ? 186 GLU B CA  1 
ATOM   3334 C C   . GLU B 1 208 ? -28.299 -52.952 14.934 1.00 75.30  ? 186 GLU B C   1 
ATOM   3335 O O   . GLU B 1 208 ? -28.536 -52.196 14.000 1.00 80.72  ? 186 GLU B O   1 
ATOM   3336 C CB  . GLU B 1 208 ? -29.206 -55.283 14.691 1.00 72.68  ? 186 GLU B CB  1 
ATOM   3337 C CG  . GLU B 1 208 ? -29.194 -56.427 13.687 1.00 72.68  ? 186 GLU B CG  1 
ATOM   3338 C CD  . GLU B 1 208 ? -28.041 -57.403 13.886 1.00 69.87  ? 186 GLU B CD  1 
ATOM   3339 O OE1 . GLU B 1 208 ? -27.134 -57.456 13.028 1.00 66.25  ? 186 GLU B OE1 1 
ATOM   3340 O OE2 . GLU B 1 208 ? -28.056 -58.137 14.889 1.00 72.47  ? 186 GLU B OE2 1 
ATOM   3341 N N   . LYS B 1 209 ? -28.330 -52.545 16.205 1.00 77.50  ? 187 LYS B N   1 
ATOM   3342 C CA  . LYS B 1 209 ? -28.593 -51.139 16.526 1.00 71.26  ? 187 LYS B CA  1 
ATOM   3343 C C   . LYS B 1 209 ? -27.400 -50.313 16.094 1.00 75.03  ? 187 LYS B C   1 
ATOM   3344 O O   . LYS B 1 209 ? -27.560 -49.218 15.571 1.00 77.78  ? 187 LYS B O   1 
ATOM   3345 C CB  . LYS B 1 209 ? -28.876 -50.925 18.012 1.00 67.95  ? 187 LYS B CB  1 
ATOM   3346 N N   . ALA B 1 210 ? -26.206 -50.860 16.299 1.00 73.40  ? 188 ALA B N   1 
ATOM   3347 C CA  . ALA B 1 210 ? -24.974 -50.195 15.910 1.00 71.26  ? 188 ALA B CA  1 
ATOM   3348 C C   . ALA B 1 210 ? -24.951 -49.918 14.407 1.00 75.66  ? 188 ALA B C   1 
ATOM   3349 O O   . ALA B 1 210 ? -24.683 -48.793 13.968 1.00 72.50  ? 188 ALA B O   1 
ATOM   3350 C CB  . ALA B 1 210 ? -23.782 -51.034 16.312 1.00 70.36  ? 188 ALA B CB  1 
ATOM   3351 N N   . CYS B 1 211 ? -25.248 -50.953 13.626 1.00 76.65  ? 189 CYS B N   1 
ATOM   3352 C CA  . CYS B 1 211 ? -25.211 -50.867 12.164 1.00 78.32  ? 189 CYS B CA  1 
ATOM   3353 C C   . CYS B 1 211 ? -26.326 -49.981 11.609 1.00 76.57  ? 189 CYS B C   1 
ATOM   3354 O O   . CYS B 1 211 ? -26.111 -49.165 10.698 1.00 70.87  ? 189 CYS B O   1 
ATOM   3355 C CB  . CYS B 1 211 ? -25.315 -52.262 11.550 1.00 72.83  ? 189 CYS B CB  1 
ATOM   3356 S SG  . CYS B 1 211 ? -23.825 -53.282 11.707 1.00 68.76  ? 189 CYS B SG  1 
ATOM   3357 N N   . SER B 1 212 ? -27.521 -50.173 12.154 1.00 76.87  ? 190 SER B N   1 
ATOM   3358 C CA  . SER B 1 212 ? -28.655 -49.318 11.857 1.00 74.38  ? 190 SER B CA  1 
ATOM   3359 C C   . SER B 1 212 ? -28.412 -47.844 12.178 1.00 77.46  ? 190 SER B C   1 
ATOM   3360 O O   . SER B 1 212 ? -28.813 -46.961 11.424 1.00 76.26  ? 190 SER B O   1 
ATOM   3361 C CB  . SER B 1 212 ? -29.862 -49.795 12.626 1.00 70.46  ? 190 SER B CB  1 
ATOM   3362 O OG  . SER B 1 212 ? -30.705 -48.695 12.831 1.00 81.52  ? 190 SER B OG  1 
ATOM   3363 N N   . LEU B 1 213 ? -27.756 -47.575 13.302 1.00 76.35  ? 191 LEU B N   1 
ATOM   3364 C CA  . LEU B 1 213 ? -27.475 -46.196 13.680 1.00 74.58  ? 191 LEU B CA  1 
ATOM   3365 C C   . LEU B 1 213 ? -26.409 -45.599 12.777 1.00 77.19  ? 191 LEU B C   1 
ATOM   3366 O O   . LEU B 1 213 ? -26.560 -44.479 12.301 1.00 78.52  ? 191 LEU B O   1 
ATOM   3367 C CB  . LEU B 1 213 ? -27.039 -46.107 15.134 1.00 76.98  ? 191 LEU B CB  1 
ATOM   3368 C CG  . LEU B 1 213 ? -27.124 -44.747 15.826 1.00 76.86  ? 191 LEU B CG  1 
ATOM   3369 C CD1 . LEU B 1 213 ? -27.324 -44.962 17.323 1.00 71.39  ? 191 LEU B CD1 1 
ATOM   3370 C CD2 . LEU B 1 213 ? -25.876 -43.917 15.568 1.00 78.00  ? 191 LEU B CD2 1 
ATOM   3371 N N   . ALA B 1 214 ? -25.334 -46.343 12.541 1.00 77.56  ? 192 ALA B N   1 
ATOM   3372 C CA  . ALA B 1 214 ? -24.288 -45.866 11.644 1.00 72.74  ? 192 ALA B CA  1 
ATOM   3373 C C   . ALA B 1 214 ? -24.898 -45.511 10.305 1.00 75.94  ? 192 ALA B C   1 
ATOM   3374 O O   . ALA B 1 214 ? -24.722 -44.396 9.822  1.00 80.72  ? 192 ALA B O   1 
ATOM   3375 C CB  . ALA B 1 214 ? -23.191 -46.906 11.470 1.00 66.45  ? 192 ALA B CB  1 
ATOM   3376 N N   . LYS B 1 215 ? -25.634 -46.453 9.720  1.00 78.19  ? 193 LYS B N   1 
ATOM   3377 C CA  . LYS B 1 215 ? -26.181 -46.258 8.379  1.00 81.25  ? 193 LYS B CA  1 
ATOM   3378 C C   . LYS B 1 215 ? -27.137 -45.067 8.289  1.00 81.33  ? 193 LYS B C   1 
ATOM   3379 O O   . LYS B 1 215 ? -26.992 -44.223 7.388  1.00 73.71  ? 193 LYS B O   1 
ATOM   3380 C CB  . LYS B 1 215 ? -26.891 -47.519 7.894  1.00 80.21  ? 193 LYS B CB  1 
ATOM   3381 C CG  . LYS B 1 215 ? -27.750 -47.254 6.683  1.00 83.14  ? 193 LYS B CG  1 
ATOM   3382 C CD  . LYS B 1 215 ? -27.812 -48.418 5.722  1.00 90.23  ? 193 LYS B CD  1 
ATOM   3383 C CE  . LYS B 1 215 ? -28.656 -48.060 4.507  1.00 90.69  ? 193 LYS B CE  1 
ATOM   3384 N NZ  . LYS B 1 215 ? -28.627 -49.155 3.502  1.00 102.23 ? 193 LYS B NZ  1 
ATOM   3385 N N   . THR B 1 216 ? -28.090 -44.987 9.221  1.00 72.23  ? 194 THR B N   1 
ATOM   3386 C CA  . THR B 1 216 ? -29.030 -43.873 9.207  1.00 71.41  ? 194 THR B CA  1 
ATOM   3387 C C   . THR B 1 216 ? -28.304 -42.538 9.180  1.00 79.15  ? 194 THR B C   1 
ATOM   3388 O O   . THR B 1 216 ? -28.508 -41.726 8.281  1.00 79.56  ? 194 THR B O   1 
ATOM   3389 C CB  . THR B 1 216 ? -29.946 -43.870 10.412 1.00 72.77  ? 194 THR B CB  1 
ATOM   3390 O OG1 . THR B 1 216 ? -30.636 -45.117 10.490 1.00 83.78  ? 194 THR B OG1 1 
ATOM   3391 C CG2 . THR B 1 216 ? -30.953 -42.732 10.295 1.00 67.36  ? 194 THR B CG2 1 
ATOM   3392 N N   . ALA B 1 217 ? -27.449 -42.331 10.178 1.00 82.60  ? 195 ALA B N   1 
ATOM   3393 C CA  . ALA B 1 217 ? -26.644 -41.124 10.297 1.00 78.37  ? 195 ALA B CA  1 
ATOM   3394 C C   . ALA B 1 217 ? -25.971 -40.775 8.984  1.00 80.14  ? 195 ALA B C   1 
ATOM   3395 O O   . ALA B 1 217 ? -25.950 -39.609 8.576  1.00 82.27  ? 195 ALA B O   1 
ATOM   3396 C CB  . ALA B 1 217 ? -25.608 -41.299 11.376 1.00 76.28  ? 195 ALA B CB  1 
ATOM   3397 N N   . PHE B 1 218 ? -25.438 -41.798 8.324  1.00 75.75  ? 196 PHE B N   1 
ATOM   3398 C CA  . PHE B 1 218 ? -24.742 -41.631 7.059  1.00 80.18  ? 196 PHE B CA  1 
ATOM   3399 C C   . PHE B 1 218 ? -25.705 -41.236 5.935  1.00 86.03  ? 196 PHE B C   1 
ATOM   3400 O O   . PHE B 1 218 ? -25.393 -40.373 5.109  1.00 84.52  ? 196 PHE B O   1 
ATOM   3401 C CB  . PHE B 1 218 ? -24.007 -42.919 6.709  1.00 79.07  ? 196 PHE B CB  1 
ATOM   3402 C CG  . PHE B 1 218 ? -23.181 -42.845 5.447  1.00 81.37  ? 196 PHE B CG  1 
ATOM   3403 C CD1 . PHE B 1 218 ? -21.920 -42.279 5.460  1.00 84.05  ? 196 PHE B CD1 1 
ATOM   3404 C CD2 . PHE B 1 218 ? -23.642 -43.396 4.270  1.00 77.67  ? 196 PHE B CD2 1 
ATOM   3405 C CE1 . PHE B 1 218 ? -21.152 -42.238 4.317  1.00 83.00  ? 196 PHE B CE1 1 
ATOM   3406 C CE2 . PHE B 1 218 ? -22.880 -43.357 3.134  1.00 79.89  ? 196 PHE B CE2 1 
ATOM   3407 C CZ  . PHE B 1 218 ? -21.635 -42.779 3.155  1.00 84.35  ? 196 PHE B CZ  1 
ATOM   3408 N N   . ASP B 1 219 ? -26.880 -41.861 5.920  1.00 85.16  ? 197 ASP B N   1 
ATOM   3409 C CA  . ASP B 1 219 ? -27.861 -41.625 4.861  1.00 83.71  ? 197 ASP B CA  1 
ATOM   3410 C C   . ASP B 1 219 ? -28.419 -40.212 4.912  1.00 85.14  ? 197 ASP B C   1 
ATOM   3411 O O   . ASP B 1 219 ? -28.592 -39.572 3.874  1.00 88.36  ? 197 ASP B O   1 
ATOM   3412 C CB  . ASP B 1 219 ? -29.020 -42.624 4.952  1.00 77.63  ? 197 ASP B CB  1 
ATOM   3413 C CG  . ASP B 1 219 ? -28.636 -44.015 4.495  1.00 80.69  ? 197 ASP B CG  1 
ATOM   3414 O OD1 . ASP B 1 219 ? -27.600 -44.166 3.790  1.00 74.75  ? 197 ASP B OD1 1 
ATOM   3415 O OD2 . ASP B 1 219 ? -29.398 -44.953 4.839  1.00 76.63  ? 197 ASP B OD2 1 
ATOM   3416 N N   . GLU B 1 220 ? -28.723 -39.738 6.117  1.00 81.34  ? 198 GLU B N   1 
ATOM   3417 C CA  . GLU B 1 220 ? -29.353 -38.438 6.265  1.00 82.70  ? 198 GLU B CA  1 
ATOM   3418 C C   . GLU B 1 220 ? -28.345 -37.343 5.992  1.00 85.94  ? 198 GLU B C   1 
ATOM   3419 O O   . GLU B 1 220 ? -28.708 -36.229 5.636  1.00 93.37  ? 198 GLU B O   1 
ATOM   3420 C CB  . GLU B 1 220 ? -29.964 -38.287 7.646  1.00 74.38  ? 198 GLU B CB  1 
ATOM   3421 C CG  . GLU B 1 220 ? -31.049 -39.301 7.912  1.00 78.67  ? 198 GLU B CG  1 
ATOM   3422 C CD  . GLU B 1 220 ? -31.556 -39.274 9.345  1.00 87.44  ? 198 GLU B CD  1 
ATOM   3423 O OE1 . GLU B 1 220 ? -30.879 -38.681 10.214 1.00 92.67  ? 198 GLU B OE1 1 
ATOM   3424 O OE2 . GLU B 1 220 ? -32.643 -39.842 9.606  1.00 91.36  ? 198 GLU B OE2 1 
ATOM   3425 N N   . ALA B 1 221 ? -27.071 -37.669 6.135  1.00 86.68  ? 199 ALA B N   1 
ATOM   3426 C CA  . ALA B 1 221 ? -26.029 -36.720 5.800  1.00 90.63  ? 199 ALA B CA  1 
ATOM   3427 C C   . ALA B 1 221 ? -25.786 -36.766 4.291  1.00 94.33  ? 199 ALA B C   1 
ATOM   3428 O O   . ALA B 1 221 ? -25.412 -35.768 3.677  1.00 94.64  ? 199 ALA B O   1 
ATOM   3429 C CB  . ALA B 1 221 ? -24.752 -37.023 6.580  1.00 88.43  ? 199 ALA B CB  1 
ATOM   3430 N N   . ILE B 1 222 ? -26.001 -37.935 3.695  1.00 93.76  ? 200 ILE B N   1 
ATOM   3431 C CA  . ILE B 1 222 ? -25.969 -38.059 2.238  1.00 94.02  ? 200 ILE B CA  1 
ATOM   3432 C C   . ILE B 1 222 ? -27.033 -37.150 1.621  1.00 98.04  ? 200 ILE B C   1 
ATOM   3433 O O   . ILE B 1 222 ? -26.724 -36.351 0.740  1.00 102.94 ? 200 ILE B O   1 
ATOM   3434 C CB  . ILE B 1 222 ? -26.191 -39.527 1.770  1.00 91.33  ? 200 ILE B CB  1 
ATOM   3435 C CG1 . ILE B 1 222 ? -24.883 -40.310 1.842  1.00 90.85  ? 200 ILE B CG1 1 
ATOM   3436 C CG2 . ILE B 1 222 ? -26.726 -39.574 0.371  1.00 99.17  ? 200 ILE B CG2 1 
ATOM   3437 C CD1 . ILE B 1 222 ? -23.682 -39.486 1.507  1.00 88.04  ? 200 ILE B CD1 1 
ATOM   3438 N N   . ALA B 1 223 ? -28.271 -37.266 2.105  1.00 96.43  ? 201 ALA B N   1 
ATOM   3439 C CA  . ALA B 1 223 ? -29.386 -36.439 1.649  1.00 92.22  ? 201 ALA B CA  1 
ATOM   3440 C C   . ALA B 1 223 ? -29.010 -34.962 1.509  1.00 99.86  ? 201 ALA B C   1 
ATOM   3441 O O   . ALA B 1 223 ? -29.125 -34.382 0.425  1.00 110.28 ? 201 ALA B O   1 
ATOM   3442 C CB  . ALA B 1 223 ? -30.574 -36.587 2.601  1.00 87.04  ? 201 ALA B CB  1 
ATOM   3443 N N   . GLU B 1 224 ? -28.532 -34.357 2.588  1.00 94.44  ? 202 GLU B N   1 
ATOM   3444 C CA  . GLU B 1 224 ? -28.391 -32.913 2.611  1.00 97.80  ? 202 GLU B CA  1 
ATOM   3445 C C   . GLU B 1 224 ? -26.979 -32.418 2.299  1.00 96.02  ? 202 GLU B C   1 
ATOM   3446 O O   . GLU B 1 224 ? -26.503 -31.466 2.918  1.00 100.46 ? 202 GLU B O   1 
ATOM   3447 C CB  . GLU B 1 224 ? -28.865 -32.379 3.970  1.00 97.29  ? 202 GLU B CB  1 
ATOM   3448 C CG  . GLU B 1 224 ? -30.231 -32.939 4.387  1.00 98.79  ? 202 GLU B CG  1 
ATOM   3449 C CD  . GLU B 1 224 ? -30.826 -32.256 5.629  1.00 112.62 ? 202 GLU B CD  1 
ATOM   3450 O OE1 . GLU B 1 224 ? -30.250 -31.250 6.108  1.00 116.58 ? 202 GLU B OE1 1 
ATOM   3451 O OE2 . GLU B 1 224 ? -31.877 -32.727 6.130  1.00 103.88 ? 202 GLU B OE2 1 
ATOM   3452 N N   . LEU B 1 225 ? -26.332 -33.016 1.303  1.00 89.22  ? 203 LEU B N   1 
ATOM   3453 C CA  . LEU B 1 225 ? -25.041 -32.516 0.817  1.00 92.07  ? 203 LEU B CA  1 
ATOM   3454 C C   . LEU B 1 225 ? -25.071 -31.047 0.362  1.00 103.66 ? 203 LEU B C   1 
ATOM   3455 O O   . LEU B 1 225 ? -24.076 -30.543 -0.160 1.00 103.84 ? 203 LEU B O   1 
ATOM   3456 C CB  . LEU B 1 225 ? -24.549 -33.372 -0.345 1.00 97.50  ? 203 LEU B CB  1 
ATOM   3457 C CG  . LEU B 1 225 ? -24.185 -34.841 -0.126 1.00 98.75  ? 203 LEU B CG  1 
ATOM   3458 C CD1 . LEU B 1 225 ? -24.338 -35.601 -1.441 1.00 96.05  ? 203 LEU B CD1 1 
ATOM   3459 C CD2 . LEU B 1 225 ? -22.764 -34.989 0.418  1.00 90.11  ? 203 LEU B CD2 1 
ATOM   3460 N N   . ASP B 1 226 ? -26.229 -30.398 0.511  1.00 110.89 ? 204 ASP B N   1 
ATOM   3461 C CA  . ASP B 1 226 ? -26.406 -28.959 0.327  1.00 107.86 ? 204 ASP B CA  1 
ATOM   3462 C C   . ASP B 1 226 ? -25.519 -28.258 1.334  1.00 110.30 ? 204 ASP B C   1 
ATOM   3463 O O   . ASP B 1 226 ? -24.715 -27.383 1.017  1.00 111.94 ? 204 ASP B O   1 
ATOM   3464 C CB  . ASP B 1 226 ? -27.857 -28.549 0.592  1.00 107.56 ? 204 ASP B CB  1 
ATOM   3465 C CG  . ASP B 1 226 ? -28.864 -29.567 0.097  1.00 110.01 ? 204 ASP B CG  1 
ATOM   3466 O OD1 . ASP B 1 226 ? -28.552 -30.351 -0.835 1.00 115.33 ? 204 ASP B OD1 1 
ATOM   3467 O OD2 . ASP B 1 226 ? -29.950 -29.626 0.718  1.00 104.78 ? 204 ASP B OD2 1 
ATOM   3468 N N   . THR B 1 227 ? -25.703 -28.675 2.577  1.00 107.93 ? 205 THR B N   1 
ATOM   3469 C CA  . THR B 1 227 ? -25.036 -28.092 3.729  1.00 114.46 ? 205 THR B CA  1 
ATOM   3470 C C   . THR B 1 227 ? -23.503 -28.319 3.770  1.00 113.77 ? 205 THR B C   1 
ATOM   3471 O O   . THR B 1 227 ? -23.029 -29.372 4.211  1.00 102.25 ? 205 THR B O   1 
ATOM   3472 C CB  . THR B 1 227 ? -25.668 -28.660 4.990  1.00 109.23 ? 205 THR B CB  1 
ATOM   3473 O OG1 . THR B 1 227 ? -25.004 -29.880 5.327  1.00 109.80 ? 205 THR B OG1 1 
ATOM   3474 C CG2 . THR B 1 227 ? -27.153 -28.954 4.737  1.00 102.28 ? 205 THR B CG2 1 
ATOM   3475 N N   . LEU B 1 228 ? -22.741 -27.314 3.331  1.00 117.23 ? 206 LEU B N   1 
ATOM   3476 C CA  . LEU B 1 228 ? -21.271 -27.400 3.268  1.00 118.19 ? 206 LEU B CA  1 
ATOM   3477 C C   . LEU B 1 228 ? -20.602 -26.428 4.344  1.00 113.40 ? 206 LEU B C   1 
ATOM   3478 O O   . LEU B 1 228 ? -20.971 -26.578 5.509  1.00 108.03 ? 206 LEU B O   1 
ATOM   3479 C CB  . LEU B 1 228 ? -20.856 -27.201 1.800  1.00 117.49 ? 206 LEU B CB  1 
ATOM   3480 C CG  . LEU B 1 228 ? -21.540 -26.111 1.213  1.00 117.87 ? 206 LEU B CG  1 
ATOM   3481 N N   . SER B 1 229 ? -19.673 -25.479 4.104  1.00 115.26 ? 207 SER B N   1 
ATOM   3482 C CA  . SER B 1 229 ? -19.014 -25.047 2.864  1.00 127.73 ? 207 SER B CA  1 
ATOM   3483 C C   . SER B 1 229 ? -17.514 -24.851 3.086  1.00 129.01 ? 207 SER B C   1 
ATOM   3484 O O   . SER B 1 229 ? -16.984 -23.764 2.824  1.00 126.26 ? 207 SER B O   1 
ATOM   3485 C CB  . SER B 1 229 ? -19.646 -23.749 2.339  1.00 120.98 ? 207 SER B CB  1 
ATOM   3486 N N   . GLU B 1 230 ? -16.842 -25.906 3.549  1.00 124.73 ? 208 GLU B N   1 
ATOM   3487 C CA  . GLU B 1 230 ? -15.432 -25.858 3.945  1.00 122.83 ? 208 GLU B CA  1 
ATOM   3488 C C   . GLU B 1 230 ? -15.343 -25.093 5.269  1.00 116.64 ? 208 GLU B C   1 
ATOM   3489 O O   . GLU B 1 230 ? -16.204 -25.235 6.143  1.00 105.99 ? 208 GLU B O   1 
ATOM   3490 C CB  . GLU B 1 230 ? -14.536 -25.213 2.858  1.00 121.37 ? 208 GLU B CB  1 
ATOM   3491 C CG  . GLU B 1 230 ? -13.193 -25.923 2.589  1.00 117.66 ? 208 GLU B CG  1 
ATOM   3492 C CD  . GLU B 1 230 ? -13.249 -26.972 1.471  1.00 123.31 ? 208 GLU B CD  1 
ATOM   3493 O OE1 . GLU B 1 230 ? -14.227 -26.993 0.690  1.00 125.20 ? 208 GLU B OE1 1 
ATOM   3494 O OE2 . GLU B 1 230 ? -12.292 -27.772 1.361  1.00 121.81 ? 208 GLU B OE2 1 
ATOM   3495 N N   . SER B 1 232 ? -18.150 -27.617 9.525  1.00 108.34 ? 210 SER B N   1 
ATOM   3496 C CA  . SER B 1 232 ? -17.390 -27.445 8.281  1.00 117.96 ? 210 SER B CA  1 
ATOM   3497 C C   . SER B 1 232 ? -17.815 -28.440 7.182  1.00 110.59 ? 210 SER B C   1 
ATOM   3498 O O   . SER B 1 232 ? -18.945 -28.955 7.192  1.00 99.05  ? 210 SER B O   1 
ATOM   3499 C CB  . SER B 1 232 ? -15.884 -27.575 8.556  1.00 111.83 ? 210 SER B CB  1 
ATOM   3500 N N   . TYR B 1 233 ? -16.911 -28.687 6.231  1.00 109.98 ? 211 TYR B N   1 
ATOM   3501 C CA  . TYR B 1 233 ? -17.167 -29.643 5.149  1.00 107.95 ? 211 TYR B CA  1 
ATOM   3502 C C   . TYR B 1 233 ? -16.252 -30.866 5.205  1.00 105.80 ? 211 TYR B C   1 
ATOM   3503 O O   . TYR B 1 233 ? -16.724 -31.989 5.407  1.00 103.39 ? 211 TYR B O   1 
ATOM   3504 C CB  . TYR B 1 233 ? -17.021 -28.986 3.779  1.00 102.82 ? 211 TYR B CB  1 
ATOM   3505 C CG  . TYR B 1 233 ? -16.638 -29.977 2.714  1.00 103.83 ? 211 TYR B CG  1 
ATOM   3506 C CD1 . TYR B 1 233 ? -17.537 -30.931 2.275  1.00 102.74 ? 211 TYR B CD1 1 
ATOM   3507 C CD2 . TYR B 1 233 ? -15.362 -29.977 2.160  1.00 116.84 ? 211 TYR B CD2 1 
ATOM   3508 C CE1 . TYR B 1 233 ? -17.177 -31.855 1.309  1.00 102.48 ? 211 TYR B CE1 1 
ATOM   3509 C CE2 . TYR B 1 233 ? -14.995 -30.901 1.189  1.00 112.88 ? 211 TYR B CE2 1 
ATOM   3510 C CZ  . TYR B 1 233 ? -15.907 -31.833 0.772  1.00 102.92 ? 211 TYR B CZ  1 
ATOM   3511 O OH  . TYR B 1 233 ? -15.550 -32.747 -0.183 1.00 106.83 ? 211 TYR B OH  1 
ATOM   3512 N N   . LYS B 1 234 ? -14.949 -30.649 5.015  1.00 106.46 ? 212 LYS B N   1 
ATOM   3513 C CA  . LYS B 1 234 ? -13.981 -31.741 5.032  1.00 102.29 ? 212 LYS B CA  1 
ATOM   3514 C C   . LYS B 1 234 ? -14.008 -32.383 6.412  1.00 98.19  ? 212 LYS B C   1 
ATOM   3515 O O   . LYS B 1 234 ? -13.578 -33.519 6.592  1.00 97.13  ? 212 LYS B O   1 
ATOM   3516 C CB  . LYS B 1 234 ? -12.574 -31.245 4.675  1.00 99.60  ? 212 LYS B CB  1 
ATOM   3517 N N   . ASP B 1 235 ? -14.542 -31.643 7.379  1.00 97.42  ? 213 ASP B N   1 
ATOM   3518 C CA  . ASP B 1 235 ? -14.783 -32.173 8.709  1.00 103.14 ? 213 ASP B CA  1 
ATOM   3519 C C   . ASP B 1 235 ? -16.019 -33.070 8.717  1.00 99.05  ? 213 ASP B C   1 
ATOM   3520 O O   . ASP B 1 235 ? -16.080 -34.038 9.482  1.00 98.26  ? 213 ASP B O   1 
ATOM   3521 C CB  . ASP B 1 235 ? -14.946 -31.036 9.722  1.00 108.65 ? 213 ASP B CB  1 
ATOM   3522 N N   . SER B 1 236 ? -16.996 -32.753 7.868  1.00 95.59  ? 214 SER B N   1 
ATOM   3523 C CA  . SER B 1 236 ? -18.209 -33.560 7.774  1.00 87.60  ? 214 SER B CA  1 
ATOM   3524 C C   . SER B 1 236 ? -17.982 -34.875 7.035  1.00 88.77  ? 214 SER B C   1 
ATOM   3525 O O   . SER B 1 236 ? -18.441 -35.929 7.474  1.00 91.27  ? 214 SER B O   1 
ATOM   3526 C CB  . SER B 1 236 ? -19.317 -32.775 7.087  1.00 87.59  ? 214 SER B CB  1 
ATOM   3527 O OG  . SER B 1 236 ? -20.017 -31.980 8.018  1.00 87.62  ? 214 SER B OG  1 
ATOM   3528 N N   . THR B 1 237 ? -17.280 -34.823 5.912  1.00 82.41  ? 215 THR B N   1 
ATOM   3529 C CA  . THR B 1 237 ? -17.129 -36.011 5.095  1.00 87.15  ? 215 THR B CA  1 
ATOM   3530 C C   . THR B 1 237 ? -16.079 -36.956 5.657  1.00 88.74  ? 215 THR B C   1 
ATOM   3531 O O   . THR B 1 237 ? -16.005 -38.128 5.269  1.00 86.95  ? 215 THR B O   1 
ATOM   3532 C CB  . THR B 1 237 ? -16.764 -35.647 3.645  1.00 93.30  ? 215 THR B CB  1 
ATOM   3533 O OG1 . THR B 1 237 ? -15.495 -34.976 3.613  1.00 94.81  ? 215 THR B OG1 1 
ATOM   3534 C CG2 . THR B 1 237 ? -17.836 -34.761 3.049  1.00 90.02  ? 215 THR B CG2 1 
ATOM   3535 N N   . LEU B 1 238 ? -15.259 -36.440 6.563  1.00 87.37  ? 216 LEU B N   1 
ATOM   3536 C CA  . LEU B 1 238 ? -14.271 -37.272 7.227  1.00 90.63  ? 216 LEU B CA  1 
ATOM   3537 C C   . LEU B 1 238 ? -14.969 -38.250 8.161  1.00 85.18  ? 216 LEU B C   1 
ATOM   3538 O O   . LEU B 1 238 ? -14.660 -39.453 8.181  1.00 76.78  ? 216 LEU B O   1 
ATOM   3539 C CB  . LEU B 1 238 ? -13.265 -36.416 7.996  1.00 97.12  ? 216 LEU B CB  1 
ATOM   3540 C CG  . LEU B 1 238 ? -11.828 -36.420 7.451  1.00 104.37 ? 216 LEU B CG  1 
ATOM   3541 C CD1 . LEU B 1 238 ? -11.774 -36.136 5.931  1.00 98.62  ? 216 LEU B CD1 1 
ATOM   3542 C CD2 . LEU B 1 238 ? -10.966 -35.419 8.224  1.00 94.83  ? 216 LEU B CD2 1 
ATOM   3543 N N   . ILE B 1 239 ? -15.922 -37.727 8.922  1.00 79.29  ? 217 ILE B N   1 
ATOM   3544 C CA  . ILE B 1 239 ? -16.714 -38.568 9.801  1.00 83.38  ? 217 ILE B CA  1 
ATOM   3545 C C   . ILE B 1 239 ? -17.627 -39.463 8.981  1.00 87.65  ? 217 ILE B C   1 
ATOM   3546 O O   . ILE B 1 239 ? -17.882 -40.622 9.346  1.00 89.23  ? 217 ILE B O   1 
ATOM   3547 C CB  . ILE B 1 239 ? -17.555 -37.743 10.770 1.00 84.25  ? 217 ILE B CB  1 
ATOM   3548 C CG1 . ILE B 1 239 ? -16.653 -36.807 11.565 1.00 83.56  ? 217 ILE B CG1 1 
ATOM   3549 C CG2 . ILE B 1 239 ? -18.349 -38.654 11.705 1.00 80.96  ? 217 ILE B CG2 1 
ATOM   3550 C CD1 . ILE B 1 239 ? -17.372 -36.076 12.644 1.00 85.01  ? 217 ILE B CD1 1 
ATOM   3551 N N   . MET B 1 240 ? -18.126 -38.929 7.875  1.00 82.03  ? 218 MET B N   1 
ATOM   3552 C CA  . MET B 1 240 ? -18.974 -39.725 7.021  1.00 82.21  ? 218 MET B CA  1 
ATOM   3553 C C   . MET B 1 240 ? -18.187 -40.926 6.538  1.00 81.46  ? 218 MET B C   1 
ATOM   3554 O O   . MET B 1 240 ? -18.688 -42.051 6.568  1.00 83.74  ? 218 MET B O   1 
ATOM   3555 C CB  . MET B 1 240 ? -19.515 -38.893 5.862  1.00 80.13  ? 218 MET B CB  1 
ATOM   3556 C CG  . MET B 1 240 ? -20.658 -38.023 6.303  1.00 82.66  ? 218 MET B CG  1 
ATOM   3557 S SD  . MET B 1 240 ? -21.200 -36.784 5.126  1.00 84.92  ? 218 MET B SD  1 
ATOM   3558 C CE  . MET B 1 240 ? -21.428 -37.786 3.664  1.00 94.80  ? 218 MET B CE  1 
ATOM   3559 N N   . GLN B 1 241 ? -16.943 -40.705 6.133  1.00 75.41  ? 219 GLN B N   1 
ATOM   3560 C CA  . GLN B 1 241 ? -16.139 -41.818 5.662  1.00 79.32  ? 219 GLN B CA  1 
ATOM   3561 C C   . GLN B 1 241 ? -15.958 -42.856 6.781  1.00 84.98  ? 219 GLN B C   1 
ATOM   3562 O O   . GLN B 1 241 ? -15.959 -44.061 6.526  1.00 83.50  ? 219 GLN B O   1 
ATOM   3563 C CB  . GLN B 1 241 ? -14.791 -41.331 5.157  1.00 80.61  ? 219 GLN B CB  1 
ATOM   3564 C CG  . GLN B 1 241 ? -13.921 -42.430 4.591  1.00 87.33  ? 219 GLN B CG  1 
ATOM   3565 C CD  . GLN B 1 241 ? -14.494 -43.046 3.329  1.00 102.52 ? 219 GLN B CD  1 
ATOM   3566 O OE1 . GLN B 1 241 ? -14.539 -44.273 3.193  1.00 103.88 ? 219 GLN B OE1 1 
ATOM   3567 N NE2 . GLN B 1 241 ? -14.913 -42.197 2.382  1.00 99.56  ? 219 GLN B NE2 1 
ATOM   3568 N N   . LEU B 1 242 ? -15.836 -42.380 8.020  1.00 80.18  ? 220 LEU B N   1 
ATOM   3569 C CA  . LEU B 1 242 ? -15.597 -43.250 9.165  1.00 73.63  ? 220 LEU B CA  1 
ATOM   3570 C C   . LEU B 1 242 ? -16.794 -44.115 9.497  1.00 78.43  ? 220 LEU B C   1 
ATOM   3571 O O   . LEU B 1 242 ? -16.643 -45.307 9.764  1.00 78.49  ? 220 LEU B O   1 
ATOM   3572 C CB  . LEU B 1 242 ? -15.220 -42.423 10.387 1.00 79.84  ? 220 LEU B CB  1 
ATOM   3573 C CG  . LEU B 1 242 ? -13.833 -41.783 10.374 1.00 75.08  ? 220 LEU B CG  1 
ATOM   3574 C CD1 . LEU B 1 242 ? -13.626 -41.040 11.660 1.00 59.36  ? 220 LEU B CD1 1 
ATOM   3575 C CD2 . LEU B 1 242 ? -12.756 -42.835 10.173 1.00 67.72  ? 220 LEU B CD2 1 
ATOM   3576 N N   . LEU B 1 243 ? -17.975 -43.500 9.509  1.00 79.50  ? 221 LEU B N   1 
ATOM   3577 C CA  . LEU B 1 243 ? -19.240 -44.224 9.615  1.00 73.63  ? 221 LEU B CA  1 
ATOM   3578 C C   . LEU B 1 243 ? -19.354 -45.340 8.594  1.00 77.54  ? 221 LEU B C   1 
ATOM   3579 O O   . LEU B 1 243 ? -19.850 -46.415 8.906  1.00 80.28  ? 221 LEU B O   1 
ATOM   3580 C CB  . LEU B 1 243 ? -20.411 -43.270 9.437  1.00 76.27  ? 221 LEU B CB  1 
ATOM   3581 C CG  . LEU B 1 243 ? -20.633 -42.297 10.589 1.00 76.51  ? 221 LEU B CG  1 
ATOM   3582 C CD1 . LEU B 1 243 ? -21.467 -41.123 10.134 1.00 78.82  ? 221 LEU B CD1 1 
ATOM   3583 C CD2 . LEU B 1 243 ? -21.326 -43.014 11.714 1.00 69.75  ? 221 LEU B CD2 1 
ATOM   3584 N N   . ARG B 1 244 ? -18.897 -45.084 7.370  1.00 80.87  ? 222 ARG B N   1 
ATOM   3585 C CA  . ARG B 1 244 ? -18.964 -46.088 6.312  1.00 81.93  ? 222 ARG B CA  1 
ATOM   3586 C C   . ARG B 1 244 ? -18.004 -47.242 6.609  1.00 81.00  ? 222 ARG B C   1 
ATOM   3587 O O   . ARG B 1 244 ? -18.381 -48.412 6.501  1.00 78.07  ? 222 ARG B O   1 
ATOM   3588 C CB  . ARG B 1 244 ? -18.655 -45.460 4.949  1.00 86.21  ? 222 ARG B CB  1 
ATOM   3589 C CG  . ARG B 1 244 ? -18.905 -46.376 3.738  1.00 93.96  ? 222 ARG B CG  1 
ATOM   3590 C CD  . ARG B 1 244 ? -17.741 -46.332 2.703  1.00 108.32 ? 222 ARG B CD  1 
ATOM   3591 N NE  . ARG B 1 244 ? -16.624 -47.204 3.103  1.00 118.39 ? 222 ARG B NE  1 
ATOM   3592 C CZ  . ARG B 1 244 ? -15.464 -47.333 2.450  1.00 121.33 ? 222 ARG B CZ  1 
ATOM   3593 N NH1 . ARG B 1 244 ? -15.238 -46.652 1.321  1.00 109.26 ? 222 ARG B NH1 1 
ATOM   3594 N NH2 . ARG B 1 244 ? -14.533 -48.166 2.929  1.00 113.85 ? 222 ARG B NH2 1 
ATOM   3595 N N   . ASP B 1 245 ? -16.774 -46.911 6.998  1.00 80.90  ? 223 ASP B N   1 
ATOM   3596 C CA  . ASP B 1 245 ? -15.777 -47.925 7.350  1.00 79.83  ? 223 ASP B CA  1 
ATOM   3597 C C   . ASP B 1 245 ? -16.296 -48.867 8.438  1.00 78.91  ? 223 ASP B C   1 
ATOM   3598 O O   . ASP B 1 245 ? -16.207 -50.091 8.325  1.00 76.78  ? 223 ASP B O   1 
ATOM   3599 C CB  . ASP B 1 245 ? -14.485 -47.270 7.823  1.00 70.75  ? 223 ASP B CB  1 
ATOM   3600 C CG  . ASP B 1 245 ? -13.840 -46.421 6.759  1.00 86.04  ? 223 ASP B CG  1 
ATOM   3601 O OD1 . ASP B 1 245 ? -14.139 -46.630 5.556  1.00 93.11  ? 223 ASP B OD1 1 
ATOM   3602 O OD2 . ASP B 1 245 ? -13.030 -45.539 7.128  1.00 83.50  ? 223 ASP B OD2 1 
ATOM   3603 N N   . ASN B 1 246 ? -16.830 -48.287 9.503  1.00 75.85  ? 224 ASN B N   1 
ATOM   3604 C CA  . ASN B 1 246 ? -17.356 -49.085 10.584 1.00 71.84  ? 224 ASN B CA  1 
ATOM   3605 C C   . ASN B 1 246 ? -18.481 -49.964 10.094 1.00 74.07  ? 224 ASN B C   1 
ATOM   3606 O O   . ASN B 1 246 ? -18.474 -51.171 10.317 1.00 73.14  ? 224 ASN B O   1 
ATOM   3607 C CB  . ASN B 1 246 ? -17.819 -48.191 11.722 1.00 76.07  ? 224 ASN B CB  1 
ATOM   3608 C CG  . ASN B 1 246 ? -16.669 -47.743 12.598 1.00 79.08  ? 224 ASN B CG  1 
ATOM   3609 O OD1 . ASN B 1 246 ? -15.520 -48.160 12.391 1.00 77.38  ? 224 ASN B OD1 1 
ATOM   3610 N ND2 . ASN B 1 246 ? -16.958 -46.869 13.559 1.00 77.28  ? 224 ASN B ND2 1 
ATOM   3611 N N   . LEU B 1 247 ? -19.430 -49.354 9.395  1.00 78.43  ? 225 LEU B N   1 
ATOM   3612 C CA  . LEU B 1 247 ? -20.531 -50.090 8.784  1.00 77.21  ? 225 LEU B CA  1 
ATOM   3613 C C   . LEU B 1 247 ? -20.054 -51.241 7.892  1.00 73.91  ? 225 LEU B C   1 
ATOM   3614 O O   . LEU B 1 247 ? -20.631 -52.330 7.916  1.00 69.86  ? 225 LEU B O   1 
ATOM   3615 C CB  . LEU B 1 247 ? -21.416 -49.147 7.973  1.00 71.90  ? 225 LEU B CB  1 
ATOM   3616 C CG  . LEU B 1 247 ? -22.704 -49.861 7.574  1.00 73.51  ? 225 LEU B CG  1 
ATOM   3617 C CD1 . LEU B 1 247 ? -23.394 -50.399 8.819  1.00 72.99  ? 225 LEU B CD1 1 
ATOM   3618 C CD2 . LEU B 1 247 ? -23.632 -48.938 6.805  1.00 78.39  ? 225 LEU B CD2 1 
ATOM   3619 N N   . THR B 1 248 ? -19.003 -51.000 7.111  1.00 74.95  ? 226 THR B N   1 
ATOM   3620 C CA  . THR B 1 248 ? -18.450 -52.056 6.261  1.00 78.38  ? 226 THR B CA  1 
ATOM   3621 C C   . THR B 1 248 ? -17.897 -53.171 7.128  1.00 76.17  ? 226 THR B C   1 
ATOM   3622 O O   . THR B 1 248 ? -18.253 -54.325 6.966  1.00 78.62  ? 226 THR B O   1 
ATOM   3623 C CB  . THR B 1 248 ? -17.319 -51.558 5.321  1.00 78.79  ? 226 THR B CB  1 
ATOM   3624 O OG1 . THR B 1 248 ? -17.827 -50.580 4.405  1.00 81.60  ? 226 THR B OG1 1 
ATOM   3625 C CG2 . THR B 1 248 ? -16.770 -52.715 4.529  1.00 70.91  ? 226 THR B CG2 1 
ATOM   3626 N N   . LEU B 1 249 ? -17.018 -52.794 8.049  1.00 81.83  ? 227 LEU B N   1 
ATOM   3627 C CA  . LEU B 1 249 ? -16.371 -53.707 8.979  1.00 76.05  ? 227 LEU B CA  1 
ATOM   3628 C C   . LEU B 1 249 ? -17.372 -54.644 9.664  1.00 79.40  ? 227 LEU B C   1 
ATOM   3629 O O   . LEU B 1 249 ? -17.165 -55.852 9.726  1.00 82.30  ? 227 LEU B O   1 
ATOM   3630 C CB  . LEU B 1 249 ? -15.606 -52.887 10.018 1.00 77.25  ? 227 LEU B CB  1 
ATOM   3631 C CG  . LEU B 1 249 ? -14.833 -53.593 11.133 1.00 82.93  ? 227 LEU B CG  1 
ATOM   3632 C CD1 . LEU B 1 249 ? -13.617 -54.285 10.564 1.00 84.51  ? 227 LEU B CD1 1 
ATOM   3633 C CD2 . LEU B 1 249 ? -14.433 -52.605 12.215 1.00 80.34  ? 227 LEU B CD2 1 
ATOM   3634 N N   . TRP B 1 250 ? -18.470 -54.075 10.152 1.00 78.87  ? 228 TRP B N   1 
ATOM   3635 C CA  . TRP B 1 250 ? -19.458 -54.810 10.940 1.00 77.58  ? 228 TRP B CA  1 
ATOM   3636 C C   . TRP B 1 250 ? -20.346 -55.743 10.112 1.00 78.07  ? 228 TRP B C   1 
ATOM   3637 O O   . TRP B 1 250 ? -20.885 -56.725 10.628 1.00 79.69  ? 228 TRP B O   1 
ATOM   3638 C CB  . TRP B 1 250 ? -20.340 -53.821 11.713 1.00 75.94  ? 228 TRP B CB  1 
ATOM   3639 C CG  . TRP B 1 250 ? -19.588 -53.036 12.748 1.00 73.36  ? 228 TRP B CG  1 
ATOM   3640 C CD1 . TRP B 1 250 ? -18.407 -53.374 13.322 1.00 73.64  ? 228 TRP B CD1 1 
ATOM   3641 C CD2 . TRP B 1 250 ? -19.964 -51.774 13.315 1.00 73.43  ? 228 TRP B CD2 1 
ATOM   3642 N NE1 . TRP B 1 250 ? -18.023 -52.408 14.218 1.00 75.30  ? 228 TRP B NE1 1 
ATOM   3643 C CE2 . TRP B 1 250 ? -18.964 -51.414 14.229 1.00 74.43  ? 228 TRP B CE2 1 
ATOM   3644 C CE3 . TRP B 1 250 ? -21.053 -50.913 13.136 1.00 75.11  ? 228 TRP B CE3 1 
ATOM   3645 C CZ2 . TRP B 1 250 ? -19.018 -50.234 14.965 1.00 78.94  ? 228 TRP B CZ2 1 
ATOM   3646 C CZ3 . TRP B 1 250 ? -21.102 -49.737 13.865 1.00 72.39  ? 228 TRP B CZ3 1 
ATOM   3647 C CH2 . TRP B 1 250 ? -20.092 -49.408 14.765 1.00 77.69  ? 228 TRP B CH2 1 
ATOM   3648 N N   . THR B 1 251 ? -20.505 -55.445 8.829  1.00 80.08  ? 229 THR B N   1 
ATOM   3649 C CA  . THR B 1 251 ? -21.399 -56.237 7.992  1.00 77.29  ? 229 THR B CA  1 
ATOM   3650 C C   . THR B 1 251 ? -20.643 -57.260 7.128  1.00 81.45  ? 229 THR B C   1 
ATOM   3651 O O   . THR B 1 251 ? -21.188 -58.308 6.780  1.00 86.60  ? 229 THR B O   1 
ATOM   3652 C CB  . THR B 1 251 ? -22.247 -55.320 7.125  1.00 71.62  ? 229 THR B CB  1 
ATOM   3653 O OG1 . THR B 1 251 ? -21.397 -54.375 6.482  1.00 81.80  ? 229 THR B OG1 1 
ATOM   3654 C CG2 . THR B 1 251 ? -23.209 -54.551 7.987  1.00 70.28  ? 229 THR B CG2 1 
ATOM   3655 N N   . SER B 1 252 ? -19.386 -56.962 6.810  1.00 83.09  ? 230 SER B N   1 
ATOM   3656 C CA  . SER B 1 252 ? -18.507 -57.889 6.101  1.00 84.03  ? 230 SER B CA  1 
ATOM   3657 C C   . SER B 1 252 ? -17.804 -58.866 7.054  1.00 98.72  ? 230 SER B C   1 
ATOM   3658 O O   . SER B 1 252 ? -17.920 -58.716 8.286  1.00 100.86 ? 230 SER B O   1 
ATOM   3659 C CB  . SER B 1 252 ? -17.469 -57.120 5.294  1.00 83.67  ? 230 SER B CB  1 
ATOM   3660 O OG  . SER B 1 252 ? -16.430 -57.993 4.896  1.00 96.78  ? 230 SER B OG  1 
ATOM   3661 N N   . GLY B 1 253 ? -17.082 -59.841 6.471  1.00 95.05  ? 231 GLY B N   1 
ATOM   3662 C CA  . GLY B 1 253 ? -16.462 -60.977 7.166  1.00 97.84  ? 231 GLY B CA  1 
ATOM   3663 C C   . GLY B 1 253 ? -16.171 -60.863 8.663  1.00 107.16 ? 231 GLY B C   1 
ATOM   3664 O O   . GLY B 1 253 ? -15.154 -61.351 9.181  1.00 105.21 ? 231 GLY B O   1 
ATOM   3665 N N   . SER B 1 258 ? -10.797 -55.004 14.416 1.00 113.73 ? 236 SER B N   1 
ATOM   3666 C CA  . SER B 1 258 ? -9.959  -54.387 13.394 1.00 112.17 ? 236 SER B CA  1 
ATOM   3667 C C   . SER B 1 258 ? -10.376 -52.920 13.113 1.00 112.32 ? 236 SER B C   1 
ATOM   3668 O O   . SER B 1 258 ? -9.844  -52.285 12.187 1.00 101.50 ? 236 SER B O   1 
ATOM   3669 C CB  . SER B 1 258 ? -9.989  -55.210 12.100 1.00 112.32 ? 236 SER B CB  1 
ATOM   3670 O OG  . SER B 1 258 ? -11.248 -55.865 11.903 1.00 110.13 ? 236 SER B OG  1 
ATOM   3671 N N   . ARG B 1 259 ? -11.286 -52.371 13.930 1.00 111.45 ? 237 ARG B N   1 
ATOM   3672 C CA  . ARG B 1 259 ? -11.584 -50.934 13.909 1.00 101.64 ? 237 ARG B CA  1 
ATOM   3673 C C   . ARG B 1 259 ? -10.352 -50.096 14.323 1.00 112.44 ? 237 ARG B C   1 
ATOM   3674 O O   . ARG B 1 259 ? -9.473  -50.566 15.060 1.00 113.89 ? 237 ARG B O   1 
ATOM   3675 C CB  . ARG B 1 259 ? -12.780 -50.631 14.820 1.00 94.76  ? 237 ARG B CB  1 
ATOM   3676 C CG  . ARG B 1 259 ? -13.296 -49.189 14.738 1.00 90.16  ? 237 ARG B CG  1 
ATOM   3677 C CD  . ARG B 1 259 ? -14.470 -48.908 15.669 1.00 85.21  ? 237 ARG B CD  1 
ATOM   3678 N NE  . ARG B 1 259 ? -14.145 -48.984 17.099 1.00 100.95 ? 237 ARG B NE  1 
ATOM   3679 C CZ  . ARG B 1 259 ? -13.883 -47.934 17.886 1.00 97.41  ? 237 ARG B CZ  1 
ATOM   3680 N NH1 . ARG B 1 259 ? -13.874 -46.703 17.383 1.00 95.96  ? 237 ARG B NH1 1 
ATOM   3681 N NH2 . ARG B 1 259 ? -13.611 -48.115 19.177 1.00 83.56  ? 237 ARG B NH2 1 
ATOM   3682 N N   . SER B 1 260 ? -10.302 -48.851 13.849 1.00 116.82 ? 238 SER B N   1 
ATOM   3683 C CA  . SER B 1 260 ? -9.140  -47.968 14.024 1.00 115.76 ? 238 SER B CA  1 
ATOM   3684 C C   . SER B 1 260 ? -9.219  -46.999 15.215 1.00 115.52 ? 238 SER B C   1 
ATOM   3685 O O   . SER B 1 260 ? -10.304 -46.598 15.655 1.00 110.01 ? 238 SER B O   1 
ATOM   3686 C CB  . SER B 1 260 ? -8.922  -47.159 12.744 1.00 119.66 ? 238 SER B CB  1 
ATOM   3687 O OG  . SER B 1 260 ? -10.150 -46.618 12.287 1.00 119.75 ? 238 SER B OG  1 
ATOM   3688 N N   . MET B 1 261 ? -8.048  -46.610 15.714 1.00 117.08 ? 239 MET B N   1 
ATOM   3689 C CA  . MET B 1 261 ? -7.961  -45.787 16.914 1.00 117.76 ? 239 MET B CA  1 
ATOM   3690 C C   . MET B 1 261 ? -7.053  -44.555 16.723 1.00 117.46 ? 239 MET B C   1 
ATOM   3691 O O   . MET B 1 261 ? -5.838  -44.625 16.927 1.00 114.99 ? 239 MET B O   1 
ATOM   3692 C CB  . MET B 1 261 ? -7.471  -46.648 18.089 1.00 110.20 ? 239 MET B CB  1 
ATOM   3693 C CG  . MET B 1 261 ? -8.098  -48.062 18.164 1.00 104.70 ? 239 MET B CG  1 
ATOM   3694 S SD  . MET B 1 261 ? -9.818  -48.090 18.761 1.00 106.18 ? 239 MET B SD  1 
ATOM   3695 C CE  . MET B 1 261 ? -10.164 -49.854 18.867 1.00 93.55  ? 239 MET B CE  1 
ATOM   3696 N N   . GLU B 1 262 ? -7.654  -43.429 16.335 1.00 119.68 ? 240 GLU B N   1 
ATOM   3697 C CA  . GLU B 1 262 ? -6.917  -42.174 16.144 1.00 123.55 ? 240 GLU B CA  1 
ATOM   3698 C C   . GLU B 1 262 ? -7.839  -40.958 16.283 1.00 117.52 ? 240 GLU B C   1 
ATOM   3699 O O   . GLU B 1 262 ? -7.430  -39.901 16.772 1.00 115.81 ? 240 GLU B O   1 
ATOM   3700 C CB  . GLU B 1 262 ? -6.222  -42.154 14.774 1.00 119.26 ? 240 GLU B CB  1 
HETATM 3701 C C1  . GOL C 2 .   ? 26.240  -62.245 26.918 1.00 92.40  ? 301 GOL A C1  1 
HETATM 3702 O O1  . GOL C 2 .   ? 27.125  -63.312 27.203 1.00 95.06  ? 301 GOL A O1  1 
HETATM 3703 C C2  . GOL C 2 .   ? 24.944  -62.300 27.745 1.00 93.09  ? 301 GOL A C2  1 
HETATM 3704 O O2  . GOL C 2 .   ? 25.086  -63.094 28.916 1.00 93.58  ? 301 GOL A O2  1 
HETATM 3705 C C3  . GOL C 2 .   ? 23.773  -62.783 26.876 1.00 89.52  ? 301 GOL A C3  1 
HETATM 3706 O O3  . GOL C 2 .   ? 22.524  -62.335 27.381 1.00 86.79  ? 301 GOL A O3  1 
HETATM 3707 C C1  . GOL D 2 .   ? 31.015  -46.535 -1.530 1.00 81.89  ? 302 GOL A C1  1 
HETATM 3708 O O1  . GOL D 2 .   ? 30.278  -45.630 -2.317 1.00 71.93  ? 302 GOL A O1  1 
HETATM 3709 C C2  . GOL D 2 .   ? 31.517  -47.701 -2.394 1.00 93.46  ? 302 GOL A C2  1 
HETATM 3710 O O2  . GOL D 2 .   ? 32.081  -47.282 -3.635 1.00 82.24  ? 302 GOL A O2  1 
HETATM 3711 C C3  . GOL D 2 .   ? 32.508  -48.580 -1.618 1.00 88.24  ? 302 GOL A C3  1 
HETATM 3712 O O3  . GOL D 2 .   ? 33.033  -49.532 -2.526 1.00 92.37  ? 302 GOL A O3  1 
HETATM 3713 S S   . SO4 E 3 .   ? 20.912  -39.121 17.935 1.00 116.49 ? 303 SO4 A S   1 
HETATM 3714 O O1  . SO4 E 3 .   ? 20.621  -39.482 16.546 1.00 116.64 ? 303 SO4 A O1  1 
HETATM 3715 O O2  . SO4 E 3 .   ? 21.659  -37.863 17.933 1.00 101.60 ? 303 SO4 A O2  1 
HETATM 3716 O O3  . SO4 E 3 .   ? 19.649  -38.978 18.654 1.00 105.45 ? 303 SO4 A O3  1 
HETATM 3717 O O4  . SO4 E 3 .   ? 21.707  -40.151 18.609 1.00 96.64  ? 303 SO4 A O4  1 
HETATM 3718 C C1  . TME F 4 .   ? 14.671  -54.990 23.260 1.00 73.30  ? 304 TME A C1  1 
HETATM 3719 C C2  . TME F 4 .   ? 15.425  -54.790 21.956 1.00 93.10  ? 304 TME A C2  1 
HETATM 3720 C C3  . TME F 4 .   ? 16.927  -54.894 22.164 1.00 81.28  ? 304 TME A C3  1 
HETATM 3721 C C1  . TME G 4 .   ? 17.798  -58.859 21.662 1.00 78.76  ? 305 TME A C1  1 
HETATM 3722 C C2  . TME G 4 .   ? 18.749  -58.508 22.797 1.00 77.03  ? 305 TME A C2  1 
HETATM 3723 C C3  . TME G 4 .   ? 19.735  -59.638 23.029 1.00 66.04  ? 305 TME A C3  1 
HETATM 3724 C C1  . TME H 4 .   ? 36.414  -47.739 -1.817 1.00 82.93  ? 306 TME A C1  1 
HETATM 3725 C C2  . TME H 4 .   ? 36.360  -46.227 -1.935 1.00 80.64  ? 306 TME A C2  1 
HETATM 3726 C C3  . TME H 4 .   ? 35.025  -45.812 -2.515 1.00 74.37  ? 306 TME A C3  1 
HETATM 3727 C C1  . TME I 4 .   ? 17.135  -60.423 42.329 1.00 80.53  ? 307 TME A C1  1 
HETATM 3728 C C2  . TME I 4 .   ? 17.905  -61.692 42.005 1.00 88.15  ? 307 TME A C2  1 
HETATM 3729 C C3  . TME I 4 .   ? 19.156  -61.387 41.194 1.00 81.38  ? 307 TME A C3  1 
HETATM 3730 C C1  . GOL J 2 .   ? -16.384 -19.632 20.004 1.00 99.39  ? 301 GOL B C1  1 
HETATM 3731 O O1  . GOL J 2 .   ? -16.596 -19.624 18.606 1.00 113.79 ? 301 GOL B O1  1 
HETATM 3732 C C2  . GOL J 2 .   ? -15.373 -18.541 20.318 1.00 101.89 ? 301 GOL B C2  1 
HETATM 3733 O O2  . GOL J 2 .   ? -15.811 -17.841 21.462 1.00 100.64 ? 301 GOL B O2  1 
HETATM 3734 C C3  . GOL J 2 .   ? -13.977 -19.134 20.531 1.00 101.59 ? 301 GOL B C3  1 
HETATM 3735 O O3  . GOL J 2 .   ? -13.390 -19.622 19.344 1.00 101.45 ? 301 GOL B O3  1 
HETATM 3736 S S   . SO4 K 3 .   ? -12.732 -44.260 20.125 1.00 83.83  ? 302 SO4 B S   1 
HETATM 3737 O O1  . SO4 K 3 .   ? -13.015 -44.326 18.688 1.00 87.26  ? 302 SO4 B O1  1 
HETATM 3738 O O2  . SO4 K 3 .   ? -13.234 -42.994 20.662 1.00 74.90  ? 302 SO4 B O2  1 
HETATM 3739 O O3  . SO4 K 3 .   ? -13.376 -45.393 20.797 1.00 69.82  ? 302 SO4 B O3  1 
HETATM 3740 O O4  . SO4 K 3 .   ? -11.280 -44.306 20.291 1.00 83.87  ? 302 SO4 B O4  1 
HETATM 3741 C C1  . TME L 4 .   ? -4.505  -37.875 35.231 1.00 78.27  ? 303 TME B C1  1 
HETATM 3742 C C2  . TME L 4 .   ? -4.759  -36.688 34.307 1.00 81.11  ? 303 TME B C2  1 
HETATM 3743 C C3  . TME L 4 .   ? -3.590  -36.505 33.351 1.00 69.11  ? 303 TME B C3  1 
HETATM 3744 C C1  . TME M 4 .   ? -4.304  -50.813 18.488 1.00 84.38  ? 304 TME B C1  1 
HETATM 3745 C C2  . TME M 4 .   ? -5.595  -51.010 17.713 1.00 94.83  ? 304 TME B C2  1 
HETATM 3746 C C3  . TME M 4 .   ? -6.357  -52.211 18.246 1.00 87.44  ? 304 TME B C3  1 
HETATM 3747 O O   . HOH N 5 .   ? 12.940  -33.208 15.393 1.00 86.47  ? 401 HOH A O   1 
HETATM 3748 O O   . HOH N 5 .   ? 38.906  -39.495 15.259 1.00 90.11  ? 402 HOH A O   1 
HETATM 3749 O O   . HOH N 5 .   ? 20.946  -62.581 5.141  1.00 84.32  ? 403 HOH A O   1 
HETATM 3750 O O   . HOH O 5 .   ? -28.596 -22.423 21.329 1.00 84.86  ? 401 HOH B O   1 
HETATM 3751 O O   . HOH O 5 .   ? 11.330  -25.516 40.685 1.00 90.36  ? 402 HOH B O   1 
HETATM 3752 O O   . HOH O 5 .   ? 10.963  -27.624 41.721 1.00 92.56  ? 403 HOH B O   1 
HETATM 3753 O O   . HOH O 5 .   ? -7.145  -57.047 16.332 1.00 89.28  ? 404 HOH B O   1 
HETATM 3754 O O   . HOH O 5 .   ? -32.607 -44.296 18.687 1.00 85.12  ? 405 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -21 ?   ?   ?   A . n 
A 1 2   SER 2   -20 ?   ?   ?   A . n 
A 1 3   TYR 3   -19 ?   ?   ?   A . n 
A 1 4   TYR 4   -18 ?   ?   ?   A . n 
A 1 5   HIS 5   -17 ?   ?   ?   A . n 
A 1 6   HIS 6   -16 ?   ?   ?   A . n 
A 1 7   HIS 7   -15 ?   ?   ?   A . n 
A 1 8   HIS 8   -14 ?   ?   ?   A . n 
A 1 9   HIS 9   -13 ?   ?   ?   A . n 
A 1 10  HIS 10  -12 ?   ?   ?   A . n 
A 1 11  LEU 11  -11 ?   ?   ?   A . n 
A 1 12  GLU 12  -10 ?   ?   ?   A . n 
A 1 13  SER 13  -9  ?   ?   ?   A . n 
A 1 14  THR 14  -8  ?   ?   ?   A . n 
A 1 15  SER 15  -7  ?   ?   ?   A . n 
A 1 16  LEU 16  -6  -6  LEU LEU A . n 
A 1 17  TYR 17  -5  -5  TYR TYR A . n 
A 1 18  LYS 18  -4  -4  LYS LYS A . n 
A 1 19  LYS 19  -3  -3  LYS LYS A . n 
A 1 20  ALA 20  -2  -2  ALA ALA A . n 
A 1 21  GLY 21  -1  -1  GLY GLY A . n 
A 1 22  LEU 22  0   0   LEU LEU A . n 
A 1 23  MET 23  1   1   MET MET A . n 
A 1 24  ASP 24  2   2   ASP ASP A . n 
A 1 25  LYS 25  3   3   LYS LYS A . n 
A 1 26  ASN 26  4   4   ASN ASN A . n 
A 1 27  GLU 27  5   5   GLU GLU A . n 
A 1 28  LEU 28  6   6   LEU LEU A . n 
A 1 29  VAL 29  7   7   VAL VAL A . n 
A 1 30  GLN 30  8   8   GLN GLN A . n 
A 1 31  LYS 31  9   9   LYS LYS A . n 
A 1 32  ALA 32  10  10  ALA ALA A . n 
A 1 33  LYS 33  11  11  LYS LYS A . n 
A 1 34  LEU 34  12  12  LEU LEU A . n 
A 1 35  ALA 35  13  13  ALA ALA A . n 
A 1 36  GLU 36  14  14  GLU GLU A . n 
A 1 37  GLN 37  15  15  GLN GLN A . n 
A 1 38  ALA 38  16  16  ALA ALA A . n 
A 1 39  GLU 39  17  17  GLU GLU A . n 
A 1 40  ARG 40  18  18  ARG ARG A . n 
A 1 41  TYR 41  19  19  TYR TYR A . n 
A 1 42  ASP 42  20  20  ASP ASP A . n 
A 1 43  ASP 43  21  21  ASP ASP A . n 
A 1 44  MET 44  22  22  MET MET A . n 
A 1 45  ALA 45  23  23  ALA ALA A . n 
A 1 46  ALA 46  24  24  ALA ALA A . n 
A 1 47  CYS 47  25  25  CYS CYS A . n 
A 1 48  MET 48  26  26  MET MET A . n 
A 1 49  LYS 49  27  27  LYS LYS A . n 
A 1 50  SER 50  28  28  SER SER A . n 
A 1 51  VAL 51  29  29  VAL VAL A . n 
A 1 52  THR 52  30  30  THR THR A . n 
A 1 53  GLU 53  31  31  GLU GLU A . n 
A 1 54  GLN 54  32  32  GLN GLN A . n 
A 1 55  GLY 55  33  33  GLY GLY A . n 
A 1 56  ALA 56  34  34  ALA ALA A . n 
A 1 57  GLU 57  35  35  GLU GLU A . n 
A 1 58  LEU 58  36  36  LEU LEU A . n 
A 1 59  SER 59  37  37  SER SER A . n 
A 1 60  ASN 60  38  38  ASN ASN A . n 
A 1 61  GLU 61  39  39  GLU GLU A . n 
A 1 62  GLU 62  40  40  GLU GLU A . n 
A 1 63  ARG 63  41  41  ARG ARG A . n 
A 1 64  ASN 64  42  42  ASN ASN A . n 
A 1 65  LEU 65  43  43  LEU LEU A . n 
A 1 66  LEU 66  44  44  LEU LEU A . n 
A 1 67  SER 67  45  45  SER SER A . n 
A 1 68  VAL 68  46  46  VAL VAL A . n 
A 1 69  ALA 69  47  47  ALA ALA A . n 
A 1 70  TYR 70  48  48  TYR TYR A . n 
A 1 71  LYS 71  49  49  LYS LYS A . n 
A 1 72  ASN 72  50  50  ASN ASN A . n 
A 1 73  VAL 73  51  51  VAL VAL A . n 
A 1 74  VAL 74  52  52  VAL VAL A . n 
A 1 75  GLY 75  53  53  GLY GLY A . n 
A 1 76  ALA 76  54  54  ALA ALA A . n 
A 1 77  ARG 77  55  55  ARG ARG A . n 
A 1 78  ARG 78  56  56  ARG ARG A . n 
A 1 79  SER 79  57  57  SER SER A . n 
A 1 80  SER 80  58  58  SER SER A . n 
A 1 81  TRP 81  59  59  TRP TRP A . n 
A 1 82  ARG 82  60  60  ARG ARG A . n 
A 1 83  VAL 83  61  61  VAL VAL A . n 
A 1 84  VAL 84  62  62  VAL VAL A . n 
A 1 85  SER 85  63  63  SER SER A . n 
A 1 86  SER 86  64  64  SER SER A . n 
A 1 87  ILE 87  65  65  ILE ILE A . n 
A 1 88  GLU 88  66  66  GLU GLU A . n 
A 1 89  GLN 89  67  67  GLN GLN A . n 
A 1 90  LYS 90  68  68  LYS LYS A . n 
A 1 91  THR 91  69  69  THR THR A . n 
A 1 92  GLU 92  70  70  GLU GLU A . n 
A 1 93  GLY 93  71  ?   ?   ?   A . n 
A 1 94  ALA 94  72  ?   ?   ?   A . n 
A 1 95  GLU 95  73  73  GLU GLU A . n 
A 1 96  LYS 96  74  74  LYS LYS A . n 
A 1 97  LYS 97  75  75  LYS LYS A . n 
A 1 98  GLN 98  76  76  GLN GLN A . n 
A 1 99  GLN 99  77  77  GLN GLN A . n 
A 1 100 MET 100 78  78  MET MET A . n 
A 1 101 ALA 101 79  79  ALA ALA A . n 
A 1 102 ARG 102 80  80  ARG ARG A . n 
A 1 103 GLU 103 81  81  GLU GLU A . n 
A 1 104 TYR 104 82  82  TYR TYR A . n 
A 1 105 ARG 105 83  83  ARG ARG A . n 
A 1 106 GLU 106 84  84  GLU GLU A . n 
A 1 107 LYS 107 85  85  LYS LYS A . n 
A 1 108 ILE 108 86  86  ILE ILE A . n 
A 1 109 GLU 109 87  87  GLU GLU A . n 
A 1 110 THR 110 88  88  THR THR A . n 
A 1 111 GLU 111 89  89  GLU GLU A . n 
A 1 112 LEU 112 90  90  LEU LEU A . n 
A 1 113 ARG 113 91  91  ARG ARG A . n 
A 1 114 ASP 114 92  92  ASP ASP A . n 
A 1 115 ILE 115 93  93  ILE ILE A . n 
A 1 116 CYS 116 94  94  CYS CYS A . n 
A 1 117 ASN 117 95  95  ASN ASN A . n 
A 1 118 ASP 118 96  96  ASP ASP A . n 
A 1 119 VAL 119 97  97  VAL VAL A . n 
A 1 120 LEU 120 98  98  LEU LEU A . n 
A 1 121 SER 121 99  99  SER SER A . n 
A 1 122 LEU 122 100 100 LEU LEU A . n 
A 1 123 LEU 123 101 101 LEU LEU A . n 
A 1 124 GLU 124 102 102 GLU GLU A . n 
A 1 125 LYS 125 103 103 LYS LYS A . n 
A 1 126 PHE 126 104 104 PHE PHE A . n 
A 1 127 LEU 127 105 105 LEU LEU A . n 
A 1 128 ILE 128 106 106 ILE ILE A . n 
A 1 129 PRO 129 107 107 PRO PRO A . n 
A 1 130 ASN 130 108 108 ASN ASN A . n 
A 1 131 ALA 131 109 109 ALA ALA A . n 
A 1 132 SER 132 110 110 SER SER A . n 
A 1 133 GLN 133 111 111 GLN GLN A . n 
A 1 134 ALA 134 112 112 ALA ALA A . n 
A 1 135 GLU 135 113 113 GLU GLU A . n 
A 1 136 SER 136 114 114 SER SER A . n 
A 1 137 LYS 137 115 115 LYS LYS A . n 
A 1 138 VAL 138 116 116 VAL VAL A . n 
A 1 139 PHE 139 117 117 PHE PHE A . n 
A 1 140 TYR 140 118 118 TYR TYR A . n 
A 1 141 LEU 141 119 119 LEU LEU A . n 
A 1 142 LYS 142 120 120 LYS LYS A . n 
A 1 143 MET 143 121 121 MET MET A . n 
A 1 144 LYS 144 122 122 LYS LYS A . n 
A 1 145 GLY 145 123 123 GLY GLY A . n 
A 1 146 ASP 146 124 124 ASP ASP A . n 
A 1 147 TYR 147 125 125 TYR TYR A . n 
A 1 148 TYR 148 126 126 TYR TYR A . n 
A 1 149 ARG 149 127 127 ARG ARG A . n 
A 1 150 TYR 150 128 128 TYR TYR A . n 
A 1 151 LEU 151 129 129 LEU LEU A . n 
A 1 152 ALA 152 130 130 ALA ALA A . n 
A 1 153 GLU 153 131 131 GLU GLU A . n 
A 1 154 VAL 154 132 132 VAL VAL A . n 
A 1 155 ALA 155 133 133 ALA ALA A . n 
A 1 156 ALA 156 134 134 ALA ALA A . n 
A 1 157 GLY 157 135 135 GLY GLY A . n 
A 1 158 ASP 158 136 136 ASP ASP A . n 
A 1 159 ASP 159 137 137 ASP ASP A . n 
A 1 160 LYS 160 138 138 LYS LYS A . n 
A 1 161 LYS 161 139 139 LYS LYS A . n 
A 1 162 GLY 162 140 140 GLY GLY A . n 
A 1 163 ILE 163 141 141 ILE ILE A . n 
A 1 164 VAL 164 142 142 VAL VAL A . n 
A 1 165 ASP 165 143 143 ASP ASP A . n 
A 1 166 GLN 166 144 144 GLN GLN A . n 
A 1 167 SER 167 145 145 SER SER A . n 
A 1 168 GLN 168 146 146 GLN GLN A . n 
A 1 169 GLN 169 147 147 GLN GLN A . n 
A 1 170 ALA 170 148 148 ALA ALA A . n 
A 1 171 TYR 171 149 149 TYR TYR A . n 
A 1 172 GLN 172 150 150 GLN GLN A . n 
A 1 173 GLU 173 151 151 GLU GLU A . n 
A 1 174 ALA 174 152 152 ALA ALA A . n 
A 1 175 PHE 175 153 153 PHE PHE A . n 
A 1 176 GLU 176 154 154 GLU GLU A . n 
A 1 177 ILE 177 155 155 ILE ILE A . n 
A 1 178 SER 178 156 156 SER SER A . n 
A 1 179 LYS 179 157 157 LYS LYS A . n 
A 1 180 LYS 180 158 158 LYS LYS A . n 
A 1 181 GLU 181 159 159 GLU GLU A . n 
A 1 182 MET 182 160 160 MET MET A . n 
A 1 183 GLN 183 161 161 GLN GLN A . n 
A 1 184 PRO 184 162 162 PRO PRO A . n 
A 1 185 THR 185 163 163 THR THR A . n 
A 1 186 HIS 186 164 164 HIS HIS A . n 
A 1 187 PRO 187 165 165 PRO PRO A . n 
A 1 188 ILE 188 166 166 ILE ILE A . n 
A 1 189 ARG 189 167 167 ARG ARG A . n 
A 1 190 LEU 190 168 168 LEU LEU A . n 
A 1 191 GLY 191 169 169 GLY GLY A . n 
A 1 192 LEU 192 170 170 LEU LEU A . n 
A 1 193 ALA 193 171 171 ALA ALA A . n 
A 1 194 LEU 194 172 172 LEU LEU A . n 
A 1 195 ASN 195 173 173 ASN ASN A . n 
A 1 196 PHE 196 174 174 PHE PHE A . n 
A 1 197 SER 197 175 175 SER SER A . n 
A 1 198 VAL 198 176 176 VAL VAL A . n 
A 1 199 PHE 199 177 177 PHE PHE A . n 
A 1 200 TYR 200 178 178 TYR TYR A . n 
A 1 201 TYR 201 179 179 TYR TYR A . n 
A 1 202 GLU 202 180 180 GLU GLU A . n 
A 1 203 ILE 203 181 181 ILE ILE A . n 
A 1 204 LEU 204 182 182 LEU LEU A . n 
A 1 205 ASN 205 183 183 ASN ASN A . n 
A 1 206 SER 206 184 184 SER SER A . n 
A 1 207 PRO 207 185 185 PRO PRO A . n 
A 1 208 GLU 208 186 186 GLU GLU A . n 
A 1 209 LYS 209 187 187 LYS LYS A . n 
A 1 210 ALA 210 188 188 ALA ALA A . n 
A 1 211 CYS 211 189 189 CYS CYS A . n 
A 1 212 SER 212 190 190 SER SER A . n 
A 1 213 LEU 213 191 191 LEU LEU A . n 
A 1 214 ALA 214 192 192 ALA ALA A . n 
A 1 215 LYS 215 193 193 LYS LYS A . n 
A 1 216 THR 216 194 194 THR THR A . n 
A 1 217 ALA 217 195 195 ALA ALA A . n 
A 1 218 PHE 218 196 196 PHE PHE A . n 
A 1 219 ASP 219 197 197 ASP ASP A . n 
A 1 220 GLU 220 198 198 GLU GLU A . n 
A 1 221 ALA 221 199 199 ALA ALA A . n 
A 1 222 ILE 222 200 200 ILE ILE A . n 
A 1 223 ALA 223 201 201 ALA ALA A . n 
A 1 224 GLU 224 202 202 GLU GLU A . n 
A 1 225 LEU 225 203 203 LEU LEU A . n 
A 1 226 ASP 226 204 204 ASP ASP A . n 
A 1 227 THR 227 205 205 THR THR A . n 
A 1 228 LEU 228 206 206 LEU LEU A . n 
A 1 229 SER 229 207 207 SER SER A . n 
A 1 230 GLU 230 208 208 GLU GLU A . n 
A 1 231 GLU 231 209 209 GLU GLU A . n 
A 1 232 SER 232 210 210 SER SER A . n 
A 1 233 TYR 233 211 211 TYR TYR A . n 
A 1 234 LYS 234 212 212 LYS LYS A . n 
A 1 235 ASP 235 213 213 ASP ASP A . n 
A 1 236 SER 236 214 214 SER SER A . n 
A 1 237 THR 237 215 215 THR THR A . n 
A 1 238 LEU 238 216 216 LEU LEU A . n 
A 1 239 ILE 239 217 217 ILE ILE A . n 
A 1 240 MET 240 218 218 MET MET A . n 
A 1 241 GLN 241 219 219 GLN GLN A . n 
A 1 242 LEU 242 220 220 LEU LEU A . n 
A 1 243 LEU 243 221 221 LEU LEU A . n 
A 1 244 ARG 244 222 222 ARG ARG A . n 
A 1 245 ASP 245 223 223 ASP ASP A . n 
A 1 246 ASN 246 224 224 ASN ASN A . n 
A 1 247 LEU 247 225 225 LEU LEU A . n 
A 1 248 THR 248 226 226 THR THR A . n 
A 1 249 LEU 249 227 227 LEU LEU A . n 
A 1 250 TRP 250 228 228 TRP TRP A . n 
A 1 251 THR 251 229 229 THR THR A . n 
A 1 252 SER 252 230 230 SER SER A . n 
A 1 253 GLY 253 231 ?   ?   ?   A . n 
A 1 254 GLY 254 232 ?   ?   ?   A . n 
A 1 255 SER 255 233 ?   ?   ?   A . n 
A 1 256 GLY 256 234 ?   ?   ?   A . n 
A 1 257 GLY 257 235 ?   ?   ?   A . n 
A 1 258 SER 258 236 ?   ?   ?   A . n 
A 1 259 ARG 259 237 237 ARG ARG A . n 
A 1 260 SER 260 238 238 SER SER A . n 
A 1 261 MET 261 239 239 MET MET A . n 
A 1 262 GLU 262 240 240 GLU GLU A . n 
A 1 263 VAL 263 241 241 VAL VAL A . n 
A 1 264 VAL 264 242 242 VAL VAL A . n 
A 1 265 PRO 265 243 243 PRO PRO A . n 
A 1 266 TYR 266 244 244 TYR TYR A . n 
B 1 1   MET 1   -21 ?   ?   ?   B . n 
B 1 2   SER 2   -20 ?   ?   ?   B . n 
B 1 3   TYR 3   -19 ?   ?   ?   B . n 
B 1 4   TYR 4   -18 ?   ?   ?   B . n 
B 1 5   HIS 5   -17 ?   ?   ?   B . n 
B 1 6   HIS 6   -16 ?   ?   ?   B . n 
B 1 7   HIS 7   -15 ?   ?   ?   B . n 
B 1 8   HIS 8   -14 ?   ?   ?   B . n 
B 1 9   HIS 9   -13 ?   ?   ?   B . n 
B 1 10  HIS 10  -12 ?   ?   ?   B . n 
B 1 11  LEU 11  -11 ?   ?   ?   B . n 
B 1 12  GLU 12  -10 ?   ?   ?   B . n 
B 1 13  SER 13  -9  ?   ?   ?   B . n 
B 1 14  THR 14  -8  ?   ?   ?   B . n 
B 1 15  SER 15  -7  -7  SER SER B . n 
B 1 16  LEU 16  -6  -6  LEU LEU B . n 
B 1 17  TYR 17  -5  -5  TYR TYR B . n 
B 1 18  LYS 18  -4  -4  LYS LYS B . n 
B 1 19  LYS 19  -3  -3  LYS LYS B . n 
B 1 20  ALA 20  -2  -2  ALA ALA B . n 
B 1 21  GLY 21  -1  -1  GLY GLY B . n 
B 1 22  LEU 22  0   0   LEU LEU B . n 
B 1 23  MET 23  1   1   MET MET B . n 
B 1 24  ASP 24  2   2   ASP ASP B . n 
B 1 25  LYS 25  3   3   LYS LYS B . n 
B 1 26  ASN 26  4   4   ASN ASN B . n 
B 1 27  GLU 27  5   5   GLU GLU B . n 
B 1 28  LEU 28  6   6   LEU LEU B . n 
B 1 29  VAL 29  7   7   VAL VAL B . n 
B 1 30  GLN 30  8   8   GLN GLN B . n 
B 1 31  LYS 31  9   9   LYS LYS B . n 
B 1 32  ALA 32  10  10  ALA ALA B . n 
B 1 33  LYS 33  11  11  LYS LYS B . n 
B 1 34  LEU 34  12  12  LEU LEU B . n 
B 1 35  ALA 35  13  13  ALA ALA B . n 
B 1 36  GLU 36  14  14  GLU GLU B . n 
B 1 37  GLN 37  15  15  GLN GLN B . n 
B 1 38  ALA 38  16  16  ALA ALA B . n 
B 1 39  GLU 39  17  17  GLU GLU B . n 
B 1 40  ARG 40  18  18  ARG ARG B . n 
B 1 41  TYR 41  19  19  TYR TYR B . n 
B 1 42  ASP 42  20  20  ASP ASP B . n 
B 1 43  ASP 43  21  21  ASP ASP B . n 
B 1 44  MET 44  22  22  MET MET B . n 
B 1 45  ALA 45  23  23  ALA ALA B . n 
B 1 46  ALA 46  24  24  ALA ALA B . n 
B 1 47  CYS 47  25  25  CYS CYS B . n 
B 1 48  MET 48  26  26  MET MET B . n 
B 1 49  LYS 49  27  27  LYS LYS B . n 
B 1 50  SER 50  28  28  SER SER B . n 
B 1 51  VAL 51  29  29  VAL VAL B . n 
B 1 52  THR 52  30  30  THR THR B . n 
B 1 53  GLU 53  31  31  GLU GLU B . n 
B 1 54  GLN 54  32  32  GLN GLN B . n 
B 1 55  GLY 55  33  33  GLY GLY B . n 
B 1 56  ALA 56  34  34  ALA ALA B . n 
B 1 57  GLU 57  35  35  GLU GLU B . n 
B 1 58  LEU 58  36  36  LEU LEU B . n 
B 1 59  SER 59  37  37  SER SER B . n 
B 1 60  ASN 60  38  38  ASN ASN B . n 
B 1 61  GLU 61  39  39  GLU GLU B . n 
B 1 62  GLU 62  40  40  GLU GLU B . n 
B 1 63  ARG 63  41  41  ARG ARG B . n 
B 1 64  ASN 64  42  42  ASN ASN B . n 
B 1 65  LEU 65  43  43  LEU LEU B . n 
B 1 66  LEU 66  44  44  LEU LEU B . n 
B 1 67  SER 67  45  45  SER SER B . n 
B 1 68  VAL 68  46  46  VAL VAL B . n 
B 1 69  ALA 69  47  47  ALA ALA B . n 
B 1 70  TYR 70  48  48  TYR TYR B . n 
B 1 71  LYS 71  49  49  LYS LYS B . n 
B 1 72  ASN 72  50  50  ASN ASN B . n 
B 1 73  VAL 73  51  51  VAL VAL B . n 
B 1 74  VAL 74  52  52  VAL VAL B . n 
B 1 75  GLY 75  53  53  GLY GLY B . n 
B 1 76  ALA 76  54  54  ALA ALA B . n 
B 1 77  ARG 77  55  55  ARG ARG B . n 
B 1 78  ARG 78  56  56  ARG ARG B . n 
B 1 79  SER 79  57  57  SER SER B . n 
B 1 80  SER 80  58  58  SER SER B . n 
B 1 81  TRP 81  59  59  TRP TRP B . n 
B 1 82  ARG 82  60  60  ARG ARG B . n 
B 1 83  VAL 83  61  61  VAL VAL B . n 
B 1 84  VAL 84  62  62  VAL VAL B . n 
B 1 85  SER 85  63  63  SER SER B . n 
B 1 86  SER 86  64  64  SER SER B . n 
B 1 87  ILE 87  65  65  ILE ILE B . n 
B 1 88  GLU 88  66  66  GLU GLU B . n 
B 1 89  GLN 89  67  67  GLN GLN B . n 
B 1 90  LYS 90  68  68  LYS LYS B . n 
B 1 91  THR 91  69  69  THR THR B . n 
B 1 92  GLU 92  70  70  GLU GLU B . n 
B 1 93  GLY 93  71  ?   ?   ?   B . n 
B 1 94  ALA 94  72  ?   ?   ?   B . n 
B 1 95  GLU 95  73  73  GLU GLU B . n 
B 1 96  LYS 96  74  74  LYS LYS B . n 
B 1 97  LYS 97  75  75  LYS LYS B . n 
B 1 98  GLN 98  76  76  GLN GLN B . n 
B 1 99  GLN 99  77  77  GLN GLN B . n 
B 1 100 MET 100 78  78  MET MET B . n 
B 1 101 ALA 101 79  79  ALA ALA B . n 
B 1 102 ARG 102 80  80  ARG ARG B . n 
B 1 103 GLU 103 81  81  GLU GLU B . n 
B 1 104 TYR 104 82  82  TYR TYR B . n 
B 1 105 ARG 105 83  83  ARG ARG B . n 
B 1 106 GLU 106 84  84  GLU GLU B . n 
B 1 107 LYS 107 85  85  LYS LYS B . n 
B 1 108 ILE 108 86  86  ILE ILE B . n 
B 1 109 GLU 109 87  87  GLU GLU B . n 
B 1 110 THR 110 88  88  THR THR B . n 
B 1 111 GLU 111 89  89  GLU GLU B . n 
B 1 112 LEU 112 90  90  LEU LEU B . n 
B 1 113 ARG 113 91  91  ARG ARG B . n 
B 1 114 ASP 114 92  92  ASP ASP B . n 
B 1 115 ILE 115 93  93  ILE ILE B . n 
B 1 116 CYS 116 94  94  CYS CYS B . n 
B 1 117 ASN 117 95  95  ASN ASN B . n 
B 1 118 ASP 118 96  96  ASP ASP B . n 
B 1 119 VAL 119 97  97  VAL VAL B . n 
B 1 120 LEU 120 98  98  LEU LEU B . n 
B 1 121 SER 121 99  99  SER SER B . n 
B 1 122 LEU 122 100 100 LEU LEU B . n 
B 1 123 LEU 123 101 101 LEU LEU B . n 
B 1 124 GLU 124 102 102 GLU GLU B . n 
B 1 125 LYS 125 103 103 LYS LYS B . n 
B 1 126 PHE 126 104 104 PHE PHE B . n 
B 1 127 LEU 127 105 105 LEU LEU B . n 
B 1 128 ILE 128 106 106 ILE ILE B . n 
B 1 129 PRO 129 107 107 PRO PRO B . n 
B 1 130 ASN 130 108 108 ASN ASN B . n 
B 1 131 ALA 131 109 109 ALA ALA B . n 
B 1 132 SER 132 110 110 SER SER B . n 
B 1 133 GLN 133 111 111 GLN GLN B . n 
B 1 134 ALA 134 112 112 ALA ALA B . n 
B 1 135 GLU 135 113 113 GLU GLU B . n 
B 1 136 SER 136 114 114 SER SER B . n 
B 1 137 LYS 137 115 115 LYS LYS B . n 
B 1 138 VAL 138 116 116 VAL VAL B . n 
B 1 139 PHE 139 117 117 PHE PHE B . n 
B 1 140 TYR 140 118 118 TYR TYR B . n 
B 1 141 LEU 141 119 119 LEU LEU B . n 
B 1 142 LYS 142 120 120 LYS LYS B . n 
B 1 143 MET 143 121 121 MET MET B . n 
B 1 144 LYS 144 122 122 LYS LYS B . n 
B 1 145 GLY 145 123 123 GLY GLY B . n 
B 1 146 ASP 146 124 124 ASP ASP B . n 
B 1 147 TYR 147 125 125 TYR TYR B . n 
B 1 148 TYR 148 126 126 TYR TYR B . n 
B 1 149 ARG 149 127 127 ARG ARG B . n 
B 1 150 TYR 150 128 128 TYR TYR B . n 
B 1 151 LEU 151 129 129 LEU LEU B . n 
B 1 152 ALA 152 130 130 ALA ALA B . n 
B 1 153 GLU 153 131 131 GLU GLU B . n 
B 1 154 VAL 154 132 132 VAL VAL B . n 
B 1 155 ALA 155 133 133 ALA ALA B . n 
B 1 156 ALA 156 134 134 ALA ALA B . n 
B 1 157 GLY 157 135 135 GLY GLY B . n 
B 1 158 ASP 158 136 136 ASP ASP B . n 
B 1 159 ASP 159 137 137 ASP ASP B . n 
B 1 160 LYS 160 138 138 LYS LYS B . n 
B 1 161 LYS 161 139 139 LYS LYS B . n 
B 1 162 GLY 162 140 140 GLY GLY B . n 
B 1 163 ILE 163 141 141 ILE ILE B . n 
B 1 164 VAL 164 142 142 VAL VAL B . n 
B 1 165 ASP 165 143 143 ASP ASP B . n 
B 1 166 GLN 166 144 144 GLN GLN B . n 
B 1 167 SER 167 145 145 SER SER B . n 
B 1 168 GLN 168 146 146 GLN GLN B . n 
B 1 169 GLN 169 147 147 GLN GLN B . n 
B 1 170 ALA 170 148 148 ALA ALA B . n 
B 1 171 TYR 171 149 149 TYR TYR B . n 
B 1 172 GLN 172 150 150 GLN GLN B . n 
B 1 173 GLU 173 151 151 GLU GLU B . n 
B 1 174 ALA 174 152 152 ALA ALA B . n 
B 1 175 PHE 175 153 153 PHE PHE B . n 
B 1 176 GLU 176 154 154 GLU GLU B . n 
B 1 177 ILE 177 155 155 ILE ILE B . n 
B 1 178 SER 178 156 156 SER SER B . n 
B 1 179 LYS 179 157 157 LYS LYS B . n 
B 1 180 LYS 180 158 158 LYS LYS B . n 
B 1 181 GLU 181 159 159 GLU GLU B . n 
B 1 182 MET 182 160 160 MET MET B . n 
B 1 183 GLN 183 161 161 GLN GLN B . n 
B 1 184 PRO 184 162 162 PRO PRO B . n 
B 1 185 THR 185 163 163 THR THR B . n 
B 1 186 HIS 186 164 164 HIS HIS B . n 
B 1 187 PRO 187 165 165 PRO PRO B . n 
B 1 188 ILE 188 166 166 ILE ILE B . n 
B 1 189 ARG 189 167 167 ARG ARG B . n 
B 1 190 LEU 190 168 168 LEU LEU B . n 
B 1 191 GLY 191 169 169 GLY GLY B . n 
B 1 192 LEU 192 170 170 LEU LEU B . n 
B 1 193 ALA 193 171 171 ALA ALA B . n 
B 1 194 LEU 194 172 172 LEU LEU B . n 
B 1 195 ASN 195 173 173 ASN ASN B . n 
B 1 196 PHE 196 174 174 PHE PHE B . n 
B 1 197 SER 197 175 175 SER SER B . n 
B 1 198 VAL 198 176 176 VAL VAL B . n 
B 1 199 PHE 199 177 177 PHE PHE B . n 
B 1 200 TYR 200 178 178 TYR TYR B . n 
B 1 201 TYR 201 179 179 TYR TYR B . n 
B 1 202 GLU 202 180 180 GLU GLU B . n 
B 1 203 ILE 203 181 181 ILE ILE B . n 
B 1 204 LEU 204 182 182 LEU LEU B . n 
B 1 205 ASN 205 183 183 ASN ASN B . n 
B 1 206 SER 206 184 184 SER SER B . n 
B 1 207 PRO 207 185 185 PRO PRO B . n 
B 1 208 GLU 208 186 186 GLU GLU B . n 
B 1 209 LYS 209 187 187 LYS LYS B . n 
B 1 210 ALA 210 188 188 ALA ALA B . n 
B 1 211 CYS 211 189 189 CYS CYS B . n 
B 1 212 SER 212 190 190 SER SER B . n 
B 1 213 LEU 213 191 191 LEU LEU B . n 
B 1 214 ALA 214 192 192 ALA ALA B . n 
B 1 215 LYS 215 193 193 LYS LYS B . n 
B 1 216 THR 216 194 194 THR THR B . n 
B 1 217 ALA 217 195 195 ALA ALA B . n 
B 1 218 PHE 218 196 196 PHE PHE B . n 
B 1 219 ASP 219 197 197 ASP ASP B . n 
B 1 220 GLU 220 198 198 GLU GLU B . n 
B 1 221 ALA 221 199 199 ALA ALA B . n 
B 1 222 ILE 222 200 200 ILE ILE B . n 
B 1 223 ALA 223 201 201 ALA ALA B . n 
B 1 224 GLU 224 202 202 GLU GLU B . n 
B 1 225 LEU 225 203 203 LEU LEU B . n 
B 1 226 ASP 226 204 204 ASP ASP B . n 
B 1 227 THR 227 205 205 THR THR B . n 
B 1 228 LEU 228 206 206 LEU LEU B . n 
B 1 229 SER 229 207 207 SER SER B . n 
B 1 230 GLU 230 208 208 GLU GLU B . n 
B 1 231 GLU 231 209 ?   ?   ?   B . n 
B 1 232 SER 232 210 210 SER SER B . n 
B 1 233 TYR 233 211 211 TYR TYR B . n 
B 1 234 LYS 234 212 212 LYS LYS B . n 
B 1 235 ASP 235 213 213 ASP ASP B . n 
B 1 236 SER 236 214 214 SER SER B . n 
B 1 237 THR 237 215 215 THR THR B . n 
B 1 238 LEU 238 216 216 LEU LEU B . n 
B 1 239 ILE 239 217 217 ILE ILE B . n 
B 1 240 MET 240 218 218 MET MET B . n 
B 1 241 GLN 241 219 219 GLN GLN B . n 
B 1 242 LEU 242 220 220 LEU LEU B . n 
B 1 243 LEU 243 221 221 LEU LEU B . n 
B 1 244 ARG 244 222 222 ARG ARG B . n 
B 1 245 ASP 245 223 223 ASP ASP B . n 
B 1 246 ASN 246 224 224 ASN ASN B . n 
B 1 247 LEU 247 225 225 LEU LEU B . n 
B 1 248 THR 248 226 226 THR THR B . n 
B 1 249 LEU 249 227 227 LEU LEU B . n 
B 1 250 TRP 250 228 228 TRP TRP B . n 
B 1 251 THR 251 229 229 THR THR B . n 
B 1 252 SER 252 230 230 SER SER B . n 
B 1 253 GLY 253 231 231 GLY GLY B . n 
B 1 254 GLY 254 232 ?   ?   ?   B . n 
B 1 255 SER 255 233 ?   ?   ?   B . n 
B 1 256 GLY 256 234 ?   ?   ?   B . n 
B 1 257 GLY 257 235 ?   ?   ?   B . n 
B 1 258 SER 258 236 236 SER SER B . n 
B 1 259 ARG 259 237 237 ARG ARG B . n 
B 1 260 SER 260 238 238 SER SER B . n 
B 1 261 MET 261 239 239 MET MET B . n 
B 1 262 GLU 262 240 240 GLU GLU B . n 
B 1 263 VAL 263 241 ?   ?   ?   B . n 
B 1 264 VAL 264 242 ?   ?   ?   B . n 
B 1 265 PRO 265 243 ?   ?   ?   B . n 
B 1 266 TYR 266 244 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 GOL 1 301 10 GOL GOL A . 
D 2 GOL 1 302 11 GOL GOL A . 
E 3 SO4 1 303 13 SO4 SO4 A . 
F 4 TME 1 304 15 TME TME A . 
G 4 TME 1 305 16 TME TME A . 
H 4 TME 1 306 17 TME TME A . 
I 4 TME 1 307 18 TME TME A . 
J 2 GOL 1 301 9  GOL GOL B . 
K 3 SO4 1 302 12 SO4 SO4 B . 
L 4 TME 1 303 14 TME TME B . 
M 4 TME 1 304 19 TME TME B . 
N 5 HOH 1 401 3  HOH HOH A . 
N 5 HOH 2 402 5  HOH HOH A . 
N 5 HOH 3 403 1  HOH HOH A . 
O 5 HOH 1 401 2  HOH HOH B . 
O 5 HOH 2 402 4  HOH HOH B . 
O 5 HOH 3 403 6  HOH HOH B . 
O 5 HOH 4 404 8  HOH HOH B . 
O 5 HOH 5 405 7  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3670  ? 
1 MORE         -21   ? 
1 'SSA (A^2)'  23970 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-09-09 
2 'Structure model' 1 1 2020-01-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 2 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.pdbx_database_id_PubMed'         
2 2 'Structure model' '_citation.title'                           
3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(phenix.refine: 1.9_1692)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                           2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                           3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                           4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   B THR 163 ? ? OG  B SER 214 ? ? 2.13 
2 1 OG1 B THR 163 ? ? OG1 B THR 205 ? ? 2.16 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              0 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              0 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              0 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                129.15 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            13.85 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A -2  ? ? 77.12   37.65   
2  1 GLN A 32  ? ? -49.25  -18.65  
3  1 PHE A 104 ? ? -131.27 -61.61  
4  1 SER A 110 ? ? -68.56  -85.49  
5  1 SER A 184 ? ? -114.37 75.70   
6  1 TRP A 228 ? ? -66.88  11.13   
7  1 THR A 229 ? ? -129.40 -66.03  
8  1 ALA B -2  ? ? -64.88  21.94   
9  1 LEU B 0   ? ? -102.09 -168.28 
10 1 PHE B 104 ? ? -149.85 -63.98  
11 1 SER B 110 ? ? -98.81  -70.64  
12 1 SER B 184 ? ? -113.94 72.98   
13 1 GLU B 202 ? ? -97.97  42.47   
14 1 LEU B 203 ? ? -56.50  2.61    
15 1 THR B 205 ? ? -66.90  98.33   
16 1 LEU B 206 ? ? -111.21 -126.09 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A TYR -5  ? CE1 ? A TYR 17  CE1 
2   1 Y 1 A TYR -5  ? CE2 ? A TYR 17  CE2 
3   1 Y 1 A TYR -5  ? CZ  ? A TYR 17  CZ  
4   1 Y 1 A TYR -5  ? OH  ? A TYR 17  OH  
5   1 Y 1 A LYS -3  ? CG  ? A LYS 19  CG  
6   1 Y 1 A LYS -3  ? CD  ? A LYS 19  CD  
7   1 Y 1 A LYS -3  ? CE  ? A LYS 19  CE  
8   1 Y 1 A LYS -3  ? NZ  ? A LYS 19  NZ  
9   1 Y 1 A GLN 8   ? CG  ? A GLN 30  CG  
10  1 Y 1 A GLN 8   ? CD  ? A GLN 30  CD  
11  1 Y 1 A GLN 8   ? OE1 ? A GLN 30  OE1 
12  1 Y 1 A GLN 8   ? NE2 ? A GLN 30  NE2 
13  1 Y 1 A GLN 15  ? CG  ? A GLN 37  CG  
14  1 Y 1 A GLN 15  ? CD  ? A GLN 37  CD  
15  1 Y 1 A GLN 15  ? OE1 ? A GLN 37  OE1 
16  1 Y 1 A GLN 15  ? NE2 ? A GLN 37  NE2 
17  1 Y 1 A LYS 68  ? CG  ? A LYS 90  CG  
18  1 Y 1 A LYS 68  ? CD  ? A LYS 90  CD  
19  1 Y 1 A LYS 68  ? CE  ? A LYS 90  CE  
20  1 Y 1 A LYS 68  ? NZ  ? A LYS 90  NZ  
21  1 Y 1 A GLU 70  ? CG  ? A GLU 92  CG  
22  1 Y 1 A GLU 70  ? CD  ? A GLU 92  CD  
23  1 Y 1 A GLU 70  ? OE1 ? A GLU 92  OE1 
24  1 Y 1 A GLU 70  ? OE2 ? A GLU 92  OE2 
25  1 Y 1 A GLU 73  ? CG  ? A GLU 95  CG  
26  1 Y 1 A GLU 73  ? CD  ? A GLU 95  CD  
27  1 Y 1 A GLU 73  ? OE1 ? A GLU 95  OE1 
28  1 Y 1 A GLU 73  ? OE2 ? A GLU 95  OE2 
29  1 Y 1 A LYS 74  ? CG  ? A LYS 96  CG  
30  1 Y 1 A LYS 74  ? CD  ? A LYS 96  CD  
31  1 Y 1 A LYS 74  ? CE  ? A LYS 96  CE  
32  1 Y 1 A LYS 74  ? NZ  ? A LYS 96  NZ  
33  1 Y 1 A LYS 75  ? CG  ? A LYS 97  CG  
34  1 Y 1 A LYS 75  ? CD  ? A LYS 97  CD  
35  1 Y 1 A LYS 75  ? CE  ? A LYS 97  CE  
36  1 Y 1 A LYS 75  ? NZ  ? A LYS 97  NZ  
37  1 Y 1 A GLN 76  ? CG  ? A GLN 98  CG  
38  1 Y 1 A GLN 76  ? CD  ? A GLN 98  CD  
39  1 Y 1 A GLN 76  ? OE1 ? A GLN 98  OE1 
40  1 Y 1 A GLN 76  ? NE2 ? A GLN 98  NE2 
41  1 Y 1 A ARG 80  ? CZ  ? A ARG 102 CZ  
42  1 Y 1 A ARG 80  ? NH1 ? A ARG 102 NH1 
43  1 Y 1 A ARG 80  ? NH2 ? A ARG 102 NH2 
44  1 Y 1 A LYS 85  ? CG  ? A LYS 107 CG  
45  1 Y 1 A LYS 85  ? CD  ? A LYS 107 CD  
46  1 Y 1 A LYS 85  ? CE  ? A LYS 107 CE  
47  1 Y 1 A LYS 85  ? NZ  ? A LYS 107 NZ  
48  1 Y 1 A LYS 103 ? CG  ? A LYS 125 CG  
49  1 Y 1 A LYS 103 ? CD  ? A LYS 125 CD  
50  1 Y 1 A LYS 103 ? CE  ? A LYS 125 CE  
51  1 Y 1 A LYS 103 ? NZ  ? A LYS 125 NZ  
52  1 Y 1 A LYS 115 ? CG  ? A LYS 137 CG  
53  1 Y 1 A LYS 115 ? CD  ? A LYS 137 CD  
54  1 Y 1 A LYS 115 ? CE  ? A LYS 137 CE  
55  1 Y 1 A LYS 115 ? NZ  ? A LYS 137 NZ  
56  1 Y 1 A LYS 138 ? CG  ? A LYS 160 CG  
57  1 Y 1 A LYS 138 ? CD  ? A LYS 160 CD  
58  1 Y 1 A LYS 138 ? CE  ? A LYS 160 CE  
59  1 Y 1 A LYS 138 ? NZ  ? A LYS 160 NZ  
60  1 Y 1 A LYS 139 ? CG  ? A LYS 161 CG  
61  1 Y 1 A LYS 139 ? CD  ? A LYS 161 CD  
62  1 Y 1 A LYS 139 ? CE  ? A LYS 161 CE  
63  1 Y 1 A LYS 139 ? NZ  ? A LYS 161 NZ  
64  1 Y 1 A GLN 147 ? CG  ? A GLN 169 CG  
65  1 Y 1 A GLN 147 ? CD  ? A GLN 169 CD  
66  1 Y 1 A GLN 147 ? OE1 ? A GLN 169 OE1 
67  1 Y 1 A GLN 147 ? NE2 ? A GLN 169 NE2 
68  1 Y 1 A LYS 157 ? CG  ? A LYS 179 CG  
69  1 Y 1 A LYS 157 ? CD  ? A LYS 179 CD  
70  1 Y 1 A LYS 157 ? CE  ? A LYS 179 CE  
71  1 Y 1 A LYS 157 ? NZ  ? A LYS 179 NZ  
72  1 Y 1 A LYS 158 ? CG  ? A LYS 180 CG  
73  1 Y 1 A LYS 158 ? CD  ? A LYS 180 CD  
74  1 Y 1 A LYS 158 ? CE  ? A LYS 180 CE  
75  1 Y 1 A LYS 158 ? NZ  ? A LYS 180 NZ  
76  1 Y 1 A LYS 187 ? CG  ? A LYS 209 CG  
77  1 Y 1 A LYS 187 ? CD  ? A LYS 209 CD  
78  1 Y 1 A LYS 187 ? CE  ? A LYS 209 CE  
79  1 Y 1 A LYS 187 ? NZ  ? A LYS 209 NZ  
80  1 Y 1 A LYS 193 ? CG  ? A LYS 215 CG  
81  1 Y 1 A LYS 193 ? CD  ? A LYS 215 CD  
82  1 Y 1 A LYS 193 ? CE  ? A LYS 215 CE  
83  1 Y 1 A LYS 193 ? NZ  ? A LYS 215 NZ  
84  1 Y 1 A GLU 208 ? CG  ? A GLU 230 CG  
85  1 Y 1 A GLU 208 ? CD  ? A GLU 230 CD  
86  1 Y 1 A GLU 208 ? OE1 ? A GLU 230 OE1 
87  1 Y 1 A GLU 208 ? OE2 ? A GLU 230 OE2 
88  1 Y 1 A LYS 212 ? CG  ? A LYS 234 CG  
89  1 Y 1 A LYS 212 ? CD  ? A LYS 234 CD  
90  1 Y 1 A LYS 212 ? CE  ? A LYS 234 CE  
91  1 Y 1 A LYS 212 ? NZ  ? A LYS 234 NZ  
92  1 Y 1 A SER 230 ? OG  ? A SER 252 OG  
93  1 Y 1 A ARG 237 ? CG  ? A ARG 259 CG  
94  1 Y 1 A ARG 237 ? CD  ? A ARG 259 CD  
95  1 Y 1 A ARG 237 ? NE  ? A ARG 259 NE  
96  1 Y 1 A ARG 237 ? CZ  ? A ARG 259 CZ  
97  1 Y 1 A ARG 237 ? NH1 ? A ARG 259 NH1 
98  1 Y 1 A ARG 237 ? NH2 ? A ARG 259 NH2 
99  1 Y 1 B SER -7  ? OG  ? B SER 15  OG  
100 1 Y 1 B TYR -5  ? CG  ? B TYR 17  CG  
101 1 Y 1 B TYR -5  ? CD1 ? B TYR 17  CD1 
102 1 Y 1 B TYR -5  ? CD2 ? B TYR 17  CD2 
103 1 Y 1 B TYR -5  ? CE1 ? B TYR 17  CE1 
104 1 Y 1 B TYR -5  ? CE2 ? B TYR 17  CE2 
105 1 Y 1 B TYR -5  ? CZ  ? B TYR 17  CZ  
106 1 Y 1 B TYR -5  ? OH  ? B TYR 17  OH  
107 1 Y 1 B LYS -3  ? CG  ? B LYS 19  CG  
108 1 Y 1 B LYS -3  ? CD  ? B LYS 19  CD  
109 1 Y 1 B LYS -3  ? CE  ? B LYS 19  CE  
110 1 Y 1 B LYS -3  ? NZ  ? B LYS 19  NZ  
111 1 Y 1 B LYS 3   ? CG  ? B LYS 25  CG  
112 1 Y 1 B LYS 3   ? CD  ? B LYS 25  CD  
113 1 Y 1 B LYS 3   ? CE  ? B LYS 25  CE  
114 1 Y 1 B LYS 3   ? NZ  ? B LYS 25  NZ  
115 1 Y 1 B LYS 49  ? CG  ? B LYS 71  CG  
116 1 Y 1 B LYS 49  ? CD  ? B LYS 71  CD  
117 1 Y 1 B LYS 49  ? CE  ? B LYS 71  CE  
118 1 Y 1 B LYS 49  ? NZ  ? B LYS 71  NZ  
119 1 Y 1 B LYS 68  ? CG  ? B LYS 90  CG  
120 1 Y 1 B LYS 68  ? CD  ? B LYS 90  CD  
121 1 Y 1 B LYS 68  ? CE  ? B LYS 90  CE  
122 1 Y 1 B LYS 68  ? NZ  ? B LYS 90  NZ  
123 1 Y 1 B GLU 70  ? CG  ? B GLU 92  CG  
124 1 Y 1 B GLU 70  ? CD  ? B GLU 92  CD  
125 1 Y 1 B GLU 70  ? OE1 ? B GLU 92  OE1 
126 1 Y 1 B GLU 70  ? OE2 ? B GLU 92  OE2 
127 1 Y 1 B GLU 73  ? CG  ? B GLU 95  CG  
128 1 Y 1 B GLU 73  ? CD  ? B GLU 95  CD  
129 1 Y 1 B GLU 73  ? OE1 ? B GLU 95  OE1 
130 1 Y 1 B GLU 73  ? OE2 ? B GLU 95  OE2 
131 1 Y 1 B LYS 74  ? CG  ? B LYS 96  CG  
132 1 Y 1 B LYS 74  ? CD  ? B LYS 96  CD  
133 1 Y 1 B LYS 74  ? CE  ? B LYS 96  CE  
134 1 Y 1 B LYS 74  ? NZ  ? B LYS 96  NZ  
135 1 Y 1 B LYS 75  ? CG  ? B LYS 97  CG  
136 1 Y 1 B LYS 75  ? CD  ? B LYS 97  CD  
137 1 Y 1 B LYS 75  ? CE  ? B LYS 97  CE  
138 1 Y 1 B LYS 75  ? NZ  ? B LYS 97  NZ  
139 1 Y 1 B LYS 85  ? CG  ? B LYS 107 CG  
140 1 Y 1 B LYS 85  ? CD  ? B LYS 107 CD  
141 1 Y 1 B LYS 85  ? CE  ? B LYS 107 CE  
142 1 Y 1 B LYS 85  ? NZ  ? B LYS 107 NZ  
143 1 Y 1 B LYS 103 ? CG  ? B LYS 125 CG  
144 1 Y 1 B LYS 103 ? CD  ? B LYS 125 CD  
145 1 Y 1 B LYS 103 ? CE  ? B LYS 125 CE  
146 1 Y 1 B LYS 103 ? NZ  ? B LYS 125 NZ  
147 1 Y 1 B LYS 115 ? CG  ? B LYS 137 CG  
148 1 Y 1 B LYS 115 ? CD  ? B LYS 137 CD  
149 1 Y 1 B LYS 115 ? CE  ? B LYS 137 CE  
150 1 Y 1 B LYS 115 ? NZ  ? B LYS 137 NZ  
151 1 Y 1 B ASP 136 ? CG  ? B ASP 158 CG  
152 1 Y 1 B ASP 136 ? OD1 ? B ASP 158 OD1 
153 1 Y 1 B ASP 136 ? OD2 ? B ASP 158 OD2 
154 1 Y 1 B LYS 139 ? CG  ? B LYS 161 CG  
155 1 Y 1 B LYS 139 ? CD  ? B LYS 161 CD  
156 1 Y 1 B LYS 139 ? CE  ? B LYS 161 CE  
157 1 Y 1 B LYS 139 ? NZ  ? B LYS 161 NZ  
158 1 Y 1 B GLN 147 ? CG  ? B GLN 169 CG  
159 1 Y 1 B GLN 147 ? CD  ? B GLN 169 CD  
160 1 Y 1 B GLN 147 ? OE1 ? B GLN 169 OE1 
161 1 Y 1 B GLN 147 ? NE2 ? B GLN 169 NE2 
162 1 Y 1 B LYS 157 ? CG  ? B LYS 179 CG  
163 1 Y 1 B LYS 157 ? CD  ? B LYS 179 CD  
164 1 Y 1 B LYS 157 ? CE  ? B LYS 179 CE  
165 1 Y 1 B LYS 157 ? NZ  ? B LYS 179 NZ  
166 1 Y 1 B LYS 187 ? CG  ? B LYS 209 CG  
167 1 Y 1 B LYS 187 ? CD  ? B LYS 209 CD  
168 1 Y 1 B LYS 187 ? CE  ? B LYS 209 CE  
169 1 Y 1 B LYS 187 ? NZ  ? B LYS 209 NZ  
170 1 Y 1 B LEU 206 ? CD1 ? B LEU 228 CD1 
171 1 Y 1 B LEU 206 ? CD2 ? B LEU 228 CD2 
172 1 Y 1 B SER 207 ? OG  ? B SER 229 OG  
173 1 Y 1 B SER 210 ? OG  ? B SER 232 OG  
174 1 Y 1 B LYS 212 ? CG  ? B LYS 234 CG  
175 1 Y 1 B LYS 212 ? CD  ? B LYS 234 CD  
176 1 Y 1 B LYS 212 ? CE  ? B LYS 234 CE  
177 1 Y 1 B LYS 212 ? NZ  ? B LYS 234 NZ  
178 1 Y 1 B ASP 213 ? CG  ? B ASP 235 CG  
179 1 Y 1 B ASP 213 ? OD1 ? B ASP 235 OD1 
180 1 Y 1 B ASP 213 ? OD2 ? B ASP 235 OD2 
181 1 Y 1 B GLU 240 ? CG  ? B GLU 262 CG  
182 1 Y 1 B GLU 240 ? CD  ? B GLU 262 CD  
183 1 Y 1 B GLU 240 ? OE1 ? B GLU 262 OE1 
184 1 Y 1 B GLU 240 ? OE2 ? B GLU 262 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -21 ? A MET 1   
2  1 Y 1 A SER -20 ? A SER 2   
3  1 Y 1 A TYR -19 ? A TYR 3   
4  1 Y 1 A TYR -18 ? A TYR 4   
5  1 Y 1 A HIS -17 ? A HIS 5   
6  1 Y 1 A HIS -16 ? A HIS 6   
7  1 Y 1 A HIS -15 ? A HIS 7   
8  1 Y 1 A HIS -14 ? A HIS 8   
9  1 Y 1 A HIS -13 ? A HIS 9   
10 1 Y 1 A HIS -12 ? A HIS 10  
11 1 Y 1 A LEU -11 ? A LEU 11  
12 1 Y 1 A GLU -10 ? A GLU 12  
13 1 Y 1 A SER -9  ? A SER 13  
14 1 Y 1 A THR -8  ? A THR 14  
15 1 Y 1 A SER -7  ? A SER 15  
16 1 Y 1 A GLY 71  ? A GLY 93  
17 1 Y 1 A ALA 72  ? A ALA 94  
18 1 Y 1 A GLY 231 ? A GLY 253 
19 1 Y 1 A GLY 232 ? A GLY 254 
20 1 Y 1 A SER 233 ? A SER 255 
21 1 Y 1 A GLY 234 ? A GLY 256 
22 1 Y 1 A GLY 235 ? A GLY 257 
23 1 Y 1 A SER 236 ? A SER 258 
24 1 Y 1 B MET -21 ? B MET 1   
25 1 Y 1 B SER -20 ? B SER 2   
26 1 Y 1 B TYR -19 ? B TYR 3   
27 1 Y 1 B TYR -18 ? B TYR 4   
28 1 Y 1 B HIS -17 ? B HIS 5   
29 1 Y 1 B HIS -16 ? B HIS 6   
30 1 Y 1 B HIS -15 ? B HIS 7   
31 1 Y 1 B HIS -14 ? B HIS 8   
32 1 Y 1 B HIS -13 ? B HIS 9   
33 1 Y 1 B HIS -12 ? B HIS 10  
34 1 Y 1 B LEU -11 ? B LEU 11  
35 1 Y 1 B GLU -10 ? B GLU 12  
36 1 Y 1 B SER -9  ? B SER 13  
37 1 Y 1 B THR -8  ? B THR 14  
38 1 Y 1 B GLY 71  ? B GLY 93  
39 1 Y 1 B ALA 72  ? B ALA 94  
40 1 Y 1 B GLU 209 ? B GLU 231 
41 1 Y 1 B GLY 232 ? B GLY 254 
42 1 Y 1 B SER 233 ? B SER 255 
43 1 Y 1 B GLY 234 ? B GLY 256 
44 1 Y 1 B GLY 235 ? B GLY 257 
45 1 Y 1 B VAL 241 ? B VAL 263 
46 1 Y 1 B VAL 242 ? B VAL 264 
47 1 Y 1 B PRO 243 ? B PRO 265 
48 1 Y 1 B TYR 244 ? B TYR 266 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 GLYCEROL      GOL 
3 'SULFATE ION' SO4 
4 PROPANE       TME 
5 water         HOH 
#