data_4ZDV
# 
_entry.id   4ZDV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ZDV         
WWPDB D_1000209097 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4ZDV 
_pdbx_database_status.recvd_initial_deposition_date   2015-04-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Khaminets, A.' 1 
'Grumati, P.'   2 
'Dikic, I.'     3 
'Akutsu, M.'    4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            522 
_citation.language                  ? 
_citation.page_first                354 
_citation.page_last                 358 
_citation.title                     'Regulation of endoplasmic reticulum turnover by selective autophagy.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature14498 
_citation.pdbx_database_id_PubMed   26040720 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Khaminets, A.' 1  
primary 'Heinrich, T.'  2  
primary 'Mari, M.'      3  
primary 'Grumati, P.'   4  
primary 'Huebner, A.K.' 5  
primary 'Akutsu, M.'    6  
primary 'Liebmann, L.'  7  
primary 'Stolz, A.'     8  
primary 'Nietzsche, S.' 9  
primary 'Koch, N.'      10 
primary 'Mauthe, M.'    11 
primary 'Katona, I.'    12 
primary 'Qualmann, B.'  13 
primary 'Weis, J.'      14 
primary 'Reggiori, F.'  15 
primary 'Kurth, I.'     16 
primary 'Hubner, C.A.'  17 
primary 'Dikic, I.'     18 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4ZDV 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     62.170 
_cell.length_a_esd                 ? 
_cell.length_b                     62.170 
_cell.length_b_esd                 ? 
_cell.length_c                     74.410 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4ZDV 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                94 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Microtubule-associated proteins 1A/1B light chain 3A' 15389.448 1   ? ? ? ? 
2 water   nat water                                                  18.015    116 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Autophagy-related protein LC3 A,Autophagy-related ubiquitin-like modifier LC3 A,MAP1 light chain 3-like protein 1,MAP1A/MAP1B light chain 3 A,MAP1A/MAP1B LC3 A,Microtubule-associated protein 1 light chain 3 alpha
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPEEGDDFELLDGPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIR
RRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPEEGDDFELLDGPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIR
RRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLU n 
1 4   GLU n 
1 5   GLY n 
1 6   ASP n 
1 7   ASP n 
1 8   PHE n 
1 9   GLU n 
1 10  LEU n 
1 11  LEU n 
1 12  ASP n 
1 13  GLY n 
1 14  PRO n 
1 15  SER n 
1 16  ASP n 
1 17  ARG n 
1 18  PRO n 
1 19  PHE n 
1 20  LYS n 
1 21  GLN n 
1 22  ARG n 
1 23  ARG n 
1 24  SER n 
1 25  PHE n 
1 26  ALA n 
1 27  ASP n 
1 28  ARG n 
1 29  CYS n 
1 30  LYS n 
1 31  GLU n 
1 32  VAL n 
1 33  GLN n 
1 34  GLN n 
1 35  ILE n 
1 36  ARG n 
1 37  ASP n 
1 38  GLN n 
1 39  HIS n 
1 40  PRO n 
1 41  SER n 
1 42  LYS n 
1 43  ILE n 
1 44  PRO n 
1 45  VAL n 
1 46  ILE n 
1 47  ILE n 
1 48  GLU n 
1 49  ARG n 
1 50  TYR n 
1 51  LYS n 
1 52  GLY n 
1 53  GLU n 
1 54  LYS n 
1 55  GLN n 
1 56  LEU n 
1 57  PRO n 
1 58  VAL n 
1 59  LEU n 
1 60  ASP n 
1 61  LYS n 
1 62  THR n 
1 63  LYS n 
1 64  PHE n 
1 65  LEU n 
1 66  VAL n 
1 67  PRO n 
1 68  ASP n 
1 69  HIS n 
1 70  VAL n 
1 71  ASN n 
1 72  MET n 
1 73  SER n 
1 74  GLU n 
1 75  LEU n 
1 76  VAL n 
1 77  LYS n 
1 78  ILE n 
1 79  ILE n 
1 80  ARG n 
1 81  ARG n 
1 82  ARG n 
1 83  LEU n 
1 84  GLN n 
1 85  LEU n 
1 86  ASN n 
1 87  PRO n 
1 88  THR n 
1 89  GLN n 
1 90  ALA n 
1 91  PHE n 
1 92  PHE n 
1 93  LEU n 
1 94  LEU n 
1 95  VAL n 
1 96  ASN n 
1 97  GLN n 
1 98  HIS n 
1 99  SER n 
1 100 MET n 
1 101 VAL n 
1 102 SER n 
1 103 VAL n 
1 104 SER n 
1 105 THR n 
1 106 PRO n 
1 107 ILE n 
1 108 ALA n 
1 109 ASP n 
1 110 ILE n 
1 111 TYR n 
1 112 GLU n 
1 113 GLN n 
1 114 GLU n 
1 115 LYS n 
1 116 ASP n 
1 117 GLU n 
1 118 ASP n 
1 119 GLY n 
1 120 PHE n 
1 121 LEU n 
1 122 TYR n 
1 123 MET n 
1 124 VAL n 
1 125 TYR n 
1 126 ALA n 
1 127 SER n 
1 128 GLN n 
1 129 GLU n 
1 130 THR n 
1 131 PHE n 
1 132 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   132 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 MAP1LC3A 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MLP3A_HUMAN 
_struct_ref.pdbx_db_accession          Q9H492 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFL
LVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG
;
_struct_ref.pdbx_align_begin           2 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4ZDV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 14 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 132 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9H492 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  120 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       120 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ZDV GLY A 1  ? UNP Q9H492 ? ? 'expression tag' -11 1  
1 4ZDV PRO A 2  ? UNP Q9H492 ? ? 'expression tag' -10 2  
1 4ZDV GLU A 3  ? UNP Q9H492 ? ? 'expression tag' -9  3  
1 4ZDV GLU A 4  ? UNP Q9H492 ? ? 'expression tag' -8  4  
1 4ZDV GLY A 5  ? UNP Q9H492 ? ? 'expression tag' -7  5  
1 4ZDV ASP A 6  ? UNP Q9H492 ? ? 'expression tag' -6  6  
1 4ZDV ASP A 7  ? UNP Q9H492 ? ? 'expression tag' -5  7  
1 4ZDV PHE A 8  ? UNP Q9H492 ? ? 'expression tag' -4  8  
1 4ZDV GLU A 9  ? UNP Q9H492 ? ? 'expression tag' -3  9  
1 4ZDV LEU A 10 ? UNP Q9H492 ? ? 'expression tag' -2  10 
1 4ZDV LEU A 11 ? UNP Q9H492 ? ? 'expression tag' -1  11 
1 4ZDV ASP A 12 ? UNP Q9H492 ? ? 'expression tag' 0   12 
1 4ZDV GLY A 13 ? UNP Q9H492 ? ? 'expression tag' 1   13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4ZDV 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.42 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.15 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '8% Tacsimate (Hampton Research) pH 8.0, 20% Poly ethylene glycol 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           80 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-03-08 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9763 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9763 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4ZDV 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.8 
_reflns.d_resolution_low                 62.17 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       14123 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  11.3 
_reflns.pdbx_Rmerge_I_obs                0.081 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            17.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.Rmerge_I_obs                0.527 
_reflns_shell.d_res_high                  1.80 
_reflns_shell.d_res_low                   1.90 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           2004 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_diffrn_id              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.percent_possible_obs        ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                73.550 
_refine.B_iso_mean                               26.7200 
_refine.B_iso_min                                11.340 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4ZDV 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.8000 
_refine.ls_d_res_low                             47.7090 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     14088 
_refine.ls_number_reflns_R_free                  701 
_refine.ls_number_reflns_R_work                  13387 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9800 
_refine.ls_percent_reflns_R_free                 4.9800 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1861 
_refine.ls_R_factor_R_free                       0.2227 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1843 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3ECI 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.0900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1800 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.8500 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.8000 
_refine_hist.d_res_low                        47.7090 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             116 
_refine_hist.number_atoms_total               1161 
_refine_hist.pdbx_number_residues_total       126 
_refine_hist.pdbx_B_iso_mean_solvent          33.85 
_refine_hist.pdbx_number_atoms_protein        1045 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 1067 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.069  ? 1439 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.090  ? 156  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 190  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.127 ? 419  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.8001 1.9391  2748 . 141 2607 100.0000 . . . 0.2626 . 0.2045 . . . . . . 5 . . . 
'X-RAY DIFFRACTION' 1.9391 2.1342  2762 . 136 2626 100.0000 . . . 0.2185 . 0.1901 . . . . . . 5 . . . 
'X-RAY DIFFRACTION' 2.1342 2.4430  2775 . 152 2623 100.0000 . . . 0.2095 . 0.1861 . . . . . . 5 . . . 
'X-RAY DIFFRACTION' 2.4430 3.0779  2812 . 131 2681 100.0000 . . . 0.2482 . 0.2065 . . . . . . 5 . . . 
'X-RAY DIFFRACTION' 3.0779 47.7260 2991 . 141 2850 100.0000 . . . 0.2105 . 0.1705 . . . . . . 5 . . . 
# 
_struct.entry_id                     4ZDV 
_struct.title                        'Crystal structure of LC3 in complex with FAM134B LIR' 
_struct.pdbx_descriptor              LC3A 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4ZDV 
_struct_keywords.text            'Autophagy, ER-phagy, Complex, protein transport' 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLY A 13  ? ARG A 17  ? GLY A 1  ARG A 5   5 ? 5  
HELX_P HELX_P2 AA2 PRO A 18  ? ARG A 23  ? PRO A 6  ARG A 11  1 ? 6  
HELX_P HELX_P3 AA3 SER A 24  ? HIS A 39  ? SER A 12 HIS A 27  1 ? 16 
HELX_P HELX_P4 AA4 ASN A 71  ? LEU A 83  ? ASN A 59 LEU A 71  1 ? 13 
HELX_P HELX_P5 AA5 PRO A 106 ? LYS A 115 ? PRO A 94 LYS A 103 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 63  ? PRO A 67  ? LYS A 51  PRO A 55  
AA1 2 LYS A 42  ? ARG A 49  ? LYS A 30  ARG A 37  
AA1 3 LEU A 121 ? ALA A 126 ? LEU A 109 ALA A 114 
AA1 4 PHE A 92  ? VAL A 95  ? PHE A 80  VAL A 83  
AA1 5 HIS A 98  ? SER A 99  ? HIS A 86  SER A 87  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O VAL A 66  ? O VAL A 54  N ILE A 43  ? N ILE A 31  
AA1 2 3 N ILE A 46  ? N ILE A 34  O MET A 123 ? O MET A 111 
AA1 3 4 O VAL A 124 ? O VAL A 112 N LEU A 94  ? N LEU A 82  
AA1 4 5 N VAL A 95  ? N VAL A 83  O HIS A 98  ? O HIS A 86  
# 
_atom_sites.entry_id                    4ZDV 
_atom_sites.fract_transf_matrix[1][1]   0.016085 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016085 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013439 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 6   ? 12.050 25.359  7.162  1.00 51.53 ? -6  ASP A N   1 
ATOM   2    C CA  . ASP A 1 6   ? 12.957 24.459  7.874  1.00 54.69 ? -6  ASP A CA  1 
ATOM   3    C C   . ASP A 1 6   ? 12.470 23.009  7.856  1.00 49.28 ? -6  ASP A C   1 
ATOM   4    O O   . ASP A 1 6   ? 11.300 22.743  8.117  1.00 52.39 ? -6  ASP A O   1 
ATOM   5    C CB  . ASP A 1 6   ? 13.151 24.925  9.320  1.00 62.98 ? -6  ASP A CB  1 
ATOM   6    C CG  . ASP A 1 6   ? 14.095 26.109  9.432  1.00 70.76 ? -6  ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 6   ? 15.032 26.202  8.610  1.00 73.55 ? -6  ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 6   ? 13.903 26.943  10.345 1.00 73.11 ? -6  ASP A OD2 1 
ATOM   9    N N   . ASP A 1 7   ? 13.367 22.076  7.547  1.00 43.13 ? -5  ASP A N   1 
ATOM   10   C CA  . ASP A 1 7   ? 13.011 20.659  7.513  1.00 40.02 ? -5  ASP A CA  1 
ATOM   11   C C   . ASP A 1 7   ? 13.087 20.067  8.916  1.00 35.38 ? -5  ASP A C   1 
ATOM   12   O O   . ASP A 1 7   ? 13.772 20.611  9.781  1.00 35.77 ? -5  ASP A O   1 
ATOM   13   C CB  . ASP A 1 7   ? 13.957 19.876  6.593  1.00 43.17 ? -5  ASP A CB  1 
ATOM   14   C CG  . ASP A 1 7   ? 14.118 20.515  5.217  1.00 50.84 ? -5  ASP A CG  1 
ATOM   15   O OD1 . ASP A 1 7   ? 13.140 21.100  4.695  1.00 50.57 ? -5  ASP A OD1 1 
ATOM   16   O OD2 . ASP A 1 7   ? 15.236 20.424  4.659  1.00 54.29 ? -5  ASP A OD2 1 
ATOM   17   N N   . PHE A 1 8   ? 12.402 18.946  9.137  1.00 28.11 ? -4  PHE A N   1 
ATOM   18   C CA  . PHE A 1 8   ? 12.531 18.213  10.394 1.00 23.30 ? -4  PHE A CA  1 
ATOM   19   C C   . PHE A 1 8   ? 13.963 17.753  10.618 1.00 26.82 ? -4  PHE A C   1 
ATOM   20   O O   . PHE A 1 8   ? 14.651 17.371  9.673  1.00 27.67 ? -4  PHE A O   1 
ATOM   21   C CB  . PHE A 1 8   ? 11.619 16.980  10.410 1.00 22.06 ? -4  PHE A CB  1 
ATOM   22   C CG  . PHE A 1 8   ? 10.166 17.295  10.674 1.00 21.47 ? -4  PHE A CG  1 
ATOM   23   C CD1 . PHE A 1 8   ? 9.331  17.700  9.652  1.00 24.36 ? -4  PHE A CD1 1 
ATOM   24   C CD2 . PHE A 1 8   ? 9.639  17.150  11.950 1.00 21.38 ? -4  PHE A CD2 1 
ATOM   25   C CE1 . PHE A 1 8   ? 7.994  17.982  9.897  1.00 28.35 ? -4  PHE A CE1 1 
ATOM   26   C CE2 . PHE A 1 8   ? 8.306  17.425  12.198 1.00 22.00 ? -4  PHE A CE2 1 
ATOM   27   C CZ  . PHE A 1 8   ? 7.486  17.838  11.168 1.00 25.95 ? -4  PHE A CZ  1 
ATOM   28   N N   . GLU A 1 9   ? 14.404 17.780  11.871 1.00 23.51 ? -3  GLU A N   1 
ATOM   29   C CA  . GLU A 1 9   ? 15.679 17.174  12.253 1.00 23.98 ? -3  GLU A CA  1 
ATOM   30   C C   . GLU A 1 9   ? 15.430 15.780  12.797 1.00 23.28 ? -3  GLU A C   1 
ATOM   31   O O   . GLU A 1 9   ? 14.798 15.626  13.836 1.00 22.55 ? -3  GLU A O   1 
ATOM   32   C CB  . GLU A 1 9   ? 16.363 18.018  13.328 1.00 30.60 ? -3  GLU A CB  1 
ATOM   33   C CG  . GLU A 1 9   ? 17.008 19.281  12.799 1.00 40.04 ? -3  GLU A CG  1 
ATOM   34   C CD  . GLU A 1 9   ? 18.305 18.993  12.062 1.00 45.93 ? -3  GLU A CD  1 
ATOM   35   O OE1 . GLU A 1 9   ? 18.549 19.635  11.015 1.00 51.28 ? -3  GLU A OE1 1 
ATOM   36   O OE2 . GLU A 1 9   ? 19.074 18.125  12.534 1.00 43.56 ? -3  GLU A OE2 1 
ATOM   37   N N   . LEU A 1 10  ? 15.922 14.752  12.111 1.00 23.03 ? -2  LEU A N   1 
ATOM   38   C CA  . LEU A 1 10  ? 15.694 13.389  12.578 1.00 27.59 ? -2  LEU A CA  1 
ATOM   39   C C   . LEU A 1 10  ? 16.671 13.054  13.696 1.00 30.22 ? -2  LEU A C   1 
ATOM   40   O O   . LEU A 1 10  ? 17.877 13.274  13.567 1.00 34.24 ? -2  LEU A O   1 
ATOM   41   C CB  . LEU A 1 10  ? 15.826 12.381  11.429 1.00 34.08 ? -2  LEU A CB  1 
ATOM   42   C CG  . LEU A 1 10  ? 14.745 11.293  11.342 1.00 41.69 ? -2  LEU A CG  1 
ATOM   43   C CD1 . LEU A 1 10  ? 14.806 10.539  10.006 1.00 44.56 ? -2  LEU A CD1 1 
ATOM   44   C CD2 . LEU A 1 10  ? 14.804 10.311  12.518 1.00 40.16 ? -2  LEU A CD2 1 
ATOM   45   N N   . LEU A 1 11  ? 16.151 12.541  14.804 1.00 23.66 ? -1  LEU A N   1 
ATOM   46   C CA  . LEU A 1 11  ? 17.003 12.142  15.920 1.00 24.58 ? -1  LEU A CA  1 
ATOM   47   C C   . LEU A 1 11  ? 17.204 10.637  15.892 1.00 29.41 ? -1  LEU A C   1 
ATOM   48   O O   . LEU A 1 11  ? 16.381 9.907   15.344 1.00 31.56 ? -1  LEU A O   1 
ATOM   49   C CB  . LEU A 1 11  ? 16.369 12.553  17.251 1.00 25.44 ? -1  LEU A CB  1 
ATOM   50   C CG  . LEU A 1 11  ? 16.112 14.050  17.409 1.00 25.03 ? -1  LEU A CG  1 
ATOM   51   C CD1 . LEU A 1 11  ? 15.489 14.361  18.750 1.00 27.92 ? -1  LEU A CD1 1 
ATOM   52   C CD2 . LEU A 1 11  ? 17.401 14.839  17.242 1.00 21.93 ? -1  LEU A CD2 1 
ATOM   53   N N   . ASP A 1 12  ? 18.300 10.164  16.480 1.00 38.85 ? 0   ASP A N   1 
ATOM   54   C CA  . ASP A 1 12  ? 18.576 8.728   16.493 1.00 42.95 ? 0   ASP A CA  1 
ATOM   55   C C   . ASP A 1 12  ? 18.443 8.130   17.894 1.00 41.53 ? 0   ASP A C   1 
ATOM   56   O O   . ASP A 1 12  ? 18.952 8.688   18.867 1.00 45.99 ? 0   ASP A O   1 
ATOM   57   C CB  . ASP A 1 12  ? 19.965 8.441   15.904 1.00 50.10 ? 0   ASP A CB  1 
ATOM   58   C CG  . ASP A 1 12  ? 20.026 8.685   14.398 1.00 57.53 ? 0   ASP A CG  1 
ATOM   59   O OD1 . ASP A 1 12  ? 20.038 9.865   13.981 1.00 60.71 ? 0   ASP A OD1 1 
ATOM   60   O OD2 . ASP A 1 12  ? 20.063 7.698   13.630 1.00 59.52 ? 0   ASP A OD2 1 
ATOM   61   N N   . GLY A 1 13  ? 17.749 7.002   17.996 1.00 39.90 ? 1   GLY A N   1 
ATOM   62   C CA  . GLY A 1 13  ? 17.654 6.289   19.260 1.00 43.02 ? 1   GLY A CA  1 
ATOM   63   C C   . GLY A 1 13  ? 18.761 5.254   19.402 1.00 43.64 ? 1   GLY A C   1 
ATOM   64   O O   . GLY A 1 13  ? 19.635 5.158   18.535 1.00 41.19 ? 1   GLY A O   1 
ATOM   65   N N   . PRO A 1 14  ? 18.737 4.485   20.502 1.00 46.05 ? 2   PRO A N   1 
ATOM   66   C CA  . PRO A 1 14  ? 19.710 3.419   20.784 1.00 46.30 ? 2   PRO A CA  1 
ATOM   67   C C   . PRO A 1 14  ? 19.797 2.362   19.681 1.00 48.18 ? 2   PRO A C   1 
ATOM   68   O O   . PRO A 1 14  ? 20.906 1.948   19.340 1.00 50.51 ? 2   PRO A O   1 
ATOM   69   C CB  . PRO A 1 14  ? 19.178 2.799   22.074 1.00 46.70 ? 2   PRO A CB  1 
ATOM   70   C CG  . PRO A 1 14  ? 18.486 3.936   22.759 1.00 48.65 ? 2   PRO A CG  1 
ATOM   71   C CD  . PRO A 1 14  ? 17.844 4.729   21.649 1.00 48.10 ? 2   PRO A CD  1 
ATOM   72   N N   . SER A 1 15  ? 18.657 1.939   19.136 1.00 46.85 ? 3   SER A N   1 
ATOM   73   C CA  . SER A 1 15  ? 18.636 0.947   18.063 1.00 49.76 ? 3   SER A CA  1 
ATOM   74   C C   . SER A 1 15  ? 19.392 1.451   16.842 1.00 51.78 ? 3   SER A C   1 
ATOM   75   O O   . SER A 1 15  ? 19.991 0.672   16.097 1.00 53.47 ? 3   SER A O   1 
ATOM   76   C CB  . SER A 1 15  ? 17.197 0.588   17.676 1.00 52.35 ? 3   SER A CB  1 
ATOM   77   O OG  . SER A 1 15  ? 16.573 1.653   16.979 1.00 53.44 ? 3   SER A OG  1 
ATOM   78   N N   . ASP A 1 16  ? 19.387 2.766   16.652 1.00 51.93 ? 4   ASP A N   1 
ATOM   79   C CA  . ASP A 1 16  ? 20.143 3.383   15.566 1.00 55.56 ? 4   ASP A CA  1 
ATOM   80   C C   . ASP A 1 16  ? 21.658 3.256   15.798 1.00 49.49 ? 4   ASP A C   1 
ATOM   81   O O   . ASP A 1 16  ? 22.469 3.692   14.971 1.00 51.33 ? 4   ASP A O   1 
ATOM   82   C CB  . ASP A 1 16  ? 19.739 4.853   15.395 1.00 64.12 ? 4   ASP A CB  1 
ATOM   83   C CG  . ASP A 1 16  ? 18.237 5.030   15.168 1.00 71.19 ? 4   ASP A CG  1 
ATOM   84   O OD1 . ASP A 1 16  ? 17.749 4.618   14.095 1.00 73.41 ? 4   ASP A OD1 1 
ATOM   85   O OD2 . ASP A 1 16  ? 17.548 5.590   16.053 1.00 73.02 ? 4   ASP A OD2 1 
ATOM   86   N N   . ARG A 1 17  ? 22.029 2.665   16.932 1.00 38.44 ? 5   ARG A N   1 
ATOM   87   C CA  . ARG A 1 17  ? 23.422 2.372   17.231 1.00 28.50 ? 5   ARG A CA  1 
ATOM   88   C C   . ARG A 1 17  ? 23.629 0.862   17.347 1.00 18.57 ? 5   ARG A C   1 
ATOM   89   O O   . ARG A 1 17  ? 22.896 0.183   18.062 1.00 21.87 ? 5   ARG A O   1 
ATOM   90   C CB  . ARG A 1 17  ? 23.854 3.068   18.522 1.00 31.25 ? 5   ARG A CB  1 
ATOM   91   C CG  . ARG A 1 17  ? 23.992 4.582   18.388 1.00 35.71 ? 5   ARG A CG  1 
ATOM   92   C CD  . ARG A 1 17  ? 24.557 5.207   19.658 1.00 38.62 ? 5   ARG A CD  1 
ATOM   93   N NE  . ARG A 1 17  ? 23.590 5.198   20.754 1.00 41.96 ? 5   ARG A NE  1 
ATOM   94   C CZ  . ARG A 1 17  ? 22.711 6.172   20.974 1.00 41.84 ? 5   ARG A CZ  1 
ATOM   95   N NH1 . ARG A 1 17  ? 22.683 7.229   20.170 1.00 40.69 ? 5   ARG A NH1 1 
ATOM   96   N NH2 . ARG A 1 17  ? 21.861 6.087   21.993 1.00 43.72 ? 5   ARG A NH2 1 
ATOM   97   N N   . PRO A 1 18  ? 24.630 0.341   16.640 1.00 18.27 ? 6   PRO A N   1 
ATOM   98   C CA  . PRO A 1 18  ? 24.943 -1.094  16.732 1.00 18.21 ? 6   PRO A CA  1 
ATOM   99   C C   . PRO A 1 18  ? 25.207 -1.525  18.184 1.00 19.89 ? 6   PRO A C   1 
ATOM   100  O O   . PRO A 1 18  ? 25.794 -0.776  18.977 1.00 16.22 ? 6   PRO A O   1 
ATOM   101  C CB  . PRO A 1 18  ? 26.236 -1.227  15.917 1.00 19.00 ? 6   PRO A CB  1 
ATOM   102  C CG  . PRO A 1 18  ? 26.260 -0.022  15.010 1.00 20.75 ? 6   PRO A CG  1 
ATOM   103  C CD  . PRO A 1 18  ? 25.592 1.079   15.800 1.00 17.32 ? 6   PRO A CD  1 
ATOM   104  N N   . PHE A 1 19  ? 24.787 -2.739  18.526 1.00 16.40 ? 7   PHE A N   1 
ATOM   105  C CA  . PHE A 1 19  ? 25.048 -3.306  19.848 1.00 12.75 ? 7   PHE A CA  1 
ATOM   106  C C   . PHE A 1 19  ? 26.525 -3.187  20.266 1.00 12.61 ? 7   PHE A C   1 
ATOM   107  O O   . PHE A 1 19  ? 26.828 -2.929  21.430 1.00 14.18 ? 7   PHE A O   1 
ATOM   108  C CB  . PHE A 1 19  ? 24.611 -4.780  19.847 1.00 16.27 ? 7   PHE A CB  1 
ATOM   109  C CG  . PHE A 1 19  ? 24.843 -5.485  21.149 1.00 17.39 ? 7   PHE A CG  1 
ATOM   110  C CD1 . PHE A 1 19  ? 24.018 -5.246  22.241 1.00 17.59 ? 7   PHE A CD1 1 
ATOM   111  C CD2 . PHE A 1 19  ? 25.873 -6.402  21.278 1.00 14.49 ? 7   PHE A CD2 1 
ATOM   112  C CE1 . PHE A 1 19  ? 24.220 -5.901  23.437 1.00 17.64 ? 7   PHE A CE1 1 
ATOM   113  C CE2 . PHE A 1 19  ? 26.085 -7.069  22.473 1.00 13.82 ? 7   PHE A CE2 1 
ATOM   114  C CZ  . PHE A 1 19  ? 25.257 -6.818  23.557 1.00 19.31 ? 7   PHE A CZ  1 
ATOM   115  N N   . LYS A 1 20  ? 27.440 -3.351  19.319 1.00 14.40 ? 8   LYS A N   1 
ATOM   116  C CA  . LYS A 1 20  ? 28.873 -3.262  19.632 1.00 12.13 ? 8   LYS A CA  1 
ATOM   117  C C   . LYS A 1 20  ? 29.301 -1.884  20.157 1.00 15.70 ? 8   LYS A C   1 
ATOM   118  O O   . LYS A 1 20  ? 30.319 -1.763  20.838 1.00 12.80 ? 8   LYS A O   1 
ATOM   119  C CB  . LYS A 1 20  ? 29.727 -3.627  18.419 1.00 14.35 ? 8   LYS A CB  1 
ATOM   120  C CG  . LYS A 1 20  ? 29.773 -5.138  18.107 1.00 14.17 ? 8   LYS A CG  1 
ATOM   121  C CD  . LYS A 1 20  ? 30.848 -5.419  17.078 1.00 16.98 ? 8   LYS A CD  1 
ATOM   122  C CE  . LYS A 1 20  ? 30.930 -6.909  16.748 1.00 21.87 ? 8   LYS A CE  1 
ATOM   123  N NZ  . LYS A 1 20  ? 32.086 -7.171  15.841 1.00 21.82 ? 8   LYS A NZ  1 
ATOM   124  N N   . GLN A 1 21  ? 28.534 -0.855  19.818 1.00 14.05 ? 9   GLN A N   1 
ATOM   125  C CA  . GLN A 1 21  ? 28.790 0.507   20.294 1.00 14.78 ? 9   GLN A CA  1 
ATOM   126  C C   . GLN A 1 21  ? 28.037 0.855   21.570 1.00 13.74 ? 9   GLN A C   1 
ATOM   127  O O   . GLN A 1 21  ? 28.380 1.829   22.241 1.00 19.02 ? 9   GLN A O   1 
ATOM   128  C CB  . GLN A 1 21  ? 28.415 1.531   19.211 1.00 16.55 ? 9   GLN A CB  1 
ATOM   129  C CG  . GLN A 1 21  ? 29.198 1.355   17.942 1.00 15.35 ? 9   GLN A CG  1 
ATOM   130  C CD  . GLN A 1 21  ? 28.850 2.377   16.885 1.00 21.28 ? 9   GLN A CD  1 
ATOM   131  O OE1 . GLN A 1 21  ? 28.145 3.348   17.148 1.00 19.40 ? 9   GLN A OE1 1 
ATOM   132  N NE2 . GLN A 1 21  ? 29.354 2.163   15.675 1.00 26.10 ? 9   GLN A NE2 1 
ATOM   133  N N   . ARG A 1 22  ? 27.007 0.076   21.888 1.00 13.35 ? 10  ARG A N   1 
ATOM   134  C CA  . ARG A 1 22  ? 26.182 0.305   23.070 1.00 15.93 ? 10  ARG A CA  1 
ATOM   135  C C   . ARG A 1 22  ? 26.779 -0.330  24.322 1.00 18.21 ? 10  ARG A C   1 
ATOM   136  O O   . ARG A 1 22  ? 26.597 0.173   25.426 1.00 17.48 ? 10  ARG A O   1 
ATOM   137  C CB  . ARG A 1 22  ? 24.757 -0.229  22.838 1.00 17.28 ? 10  ARG A CB  1 
ATOM   138  C CG  . ARG A 1 22  ? 23.839 0.803   22.201 1.00 27.21 ? 10  ARG A CG  1 
ATOM   139  C CD  . ARG A 1 22  ? 22.734 0.181   21.368 1.00 28.76 ? 10  ARG A CD  1 
ATOM   140  N NE  . ARG A 1 22  ? 22.084 -0.953  22.018 1.00 28.21 ? 10  ARG A NE  1 
ATOM   141  C CZ  . ARG A 1 22  ? 21.519 -1.952  21.349 1.00 32.77 ? 10  ARG A CZ  1 
ATOM   142  N NH1 . ARG A 1 22  ? 21.531 -1.946  20.023 1.00 32.87 ? 10  ARG A NH1 1 
ATOM   143  N NH2 . ARG A 1 22  ? 20.945 -2.955  22.001 1.00 37.85 ? 10  ARG A NH2 1 
ATOM   144  N N   . ARG A 1 23  ? 27.482 -1.447  24.135 1.00 16.04 ? 11  ARG A N   1 
ATOM   145  C CA  . ARG A 1 23  ? 28.104 -2.187  25.227 1.00 15.78 ? 11  ARG A CA  1 
ATOM   146  C C   . ARG A 1 23  ? 29.555 -2.406  24.845 1.00 16.38 ? 11  ARG A C   1 
ATOM   147  O O   . ARG A 1 23  ? 29.859 -2.791  23.704 1.00 15.55 ? 11  ARG A O   1 
ATOM   148  C CB  . ARG A 1 23  ? 27.411 -3.542  25.424 1.00 19.68 ? 11  ARG A CB  1 
ATOM   149  C CG  . ARG A 1 23  ? 25.941 -3.443  25.839 1.00 28.13 ? 11  ARG A CG  1 
ATOM   150  C CD  . ARG A 1 23  ? 25.830 -3.038  27.299 1.00 36.76 ? 11  ARG A CD  1 
ATOM   151  N NE  . ARG A 1 23  ? 26.026 -4.176  28.198 1.00 44.18 ? 11  ARG A NE  1 
ATOM   152  C CZ  . ARG A 1 23  ? 26.385 -4.073  29.476 1.00 49.64 ? 11  ARG A CZ  1 
ATOM   153  N NH1 . ARG A 1 23  ? 26.604 -2.879  30.013 1.00 50.36 ? 11  ARG A NH1 1 
ATOM   154  N NH2 . ARG A 1 23  ? 26.534 -5.166  30.219 1.00 50.46 ? 11  ARG A NH2 1 
ATOM   155  N N   . SER A 1 24  ? 30.459 -2.153  25.783 1.00 15.95 ? 12  SER A N   1 
ATOM   156  C CA  . SER A 1 24  ? 31.888 -2.222  25.480 1.00 16.85 ? 12  SER A CA  1 
ATOM   157  C C   . SER A 1 24  ? 32.306 -3.648  25.155 1.00 18.28 ? 12  SER A C   1 
ATOM   158  O O   . SER A 1 24  ? 31.663 -4.615  25.598 1.00 15.32 ? 12  SER A O   1 
ATOM   159  C CB  . SER A 1 24  ? 32.704 -1.731  26.669 1.00 21.79 ? 12  SER A CB  1 
ATOM   160  O OG  . SER A 1 24  ? 32.597 -2.641  27.750 1.00 20.87 ? 12  SER A OG  1 
ATOM   161  N N   . PHE A 1 25  ? 33.384 -3.775  24.387 1.00 17.01 ? 13  PHE A N   1 
ATOM   162  C CA  . PHE A 1 25  ? 33.944 -5.087  24.079 1.00 18.49 ? 13  PHE A CA  1 
ATOM   163  C C   . PHE A 1 25  ? 34.135 -5.929  25.345 1.00 17.76 ? 13  PHE A C   1 
ATOM   164  O O   . PHE A 1 25  ? 33.715 -7.085  25.395 1.00 17.17 ? 13  PHE A O   1 
ATOM   165  C CB  . PHE A 1 25  ? 35.258 -4.947  23.298 1.00 16.52 ? 13  PHE A CB  1 
ATOM   166  C CG  . PHE A 1 25  ? 35.904 -6.268  22.963 1.00 16.37 ? 13  PHE A CG  1 
ATOM   167  C CD1 . PHE A 1 25  ? 35.425 -7.050  21.921 1.00 16.74 ? 13  PHE A CD1 1 
ATOM   168  C CD2 . PHE A 1 25  ? 36.975 -6.732  23.713 1.00 20.57 ? 13  PHE A CD2 1 
ATOM   169  C CE1 . PHE A 1 25  ? 36.026 -8.282  21.623 1.00 18.64 ? 13  PHE A CE1 1 
ATOM   170  C CE2 . PHE A 1 25  ? 37.573 -7.952  23.423 1.00 22.24 ? 13  PHE A CE2 1 
ATOM   171  C CZ  . PHE A 1 25  ? 37.093 -8.724  22.378 1.00 21.04 ? 13  PHE A CZ  1 
ATOM   172  N N   . ALA A 1 26  ? 34.732 -5.339  26.376 1.00 19.38 ? 14  ALA A N   1 
ATOM   173  C CA  . ALA A 1 26  ? 34.928 -6.046  27.642 1.00 21.02 ? 14  ALA A CA  1 
ATOM   174  C C   . ALA A 1 26  ? 33.619 -6.589  28.224 1.00 20.46 ? 14  ALA A C   1 
ATOM   175  O O   . ALA A 1 26  ? 33.546 -7.748  28.630 1.00 20.51 ? 14  ALA A O   1 
ATOM   176  C CB  . ALA A 1 26  ? 35.619 -5.142  28.650 1.00 24.23 ? 14  ALA A CB  1 
ATOM   177  N N   . ASP A 1 27  ? 32.585 -5.757  28.258 1.00 16.48 ? 15  ASP A N   1 
ATOM   178  C CA  . ASP A 1 27  ? 31.300 -6.177  28.824 1.00 17.23 ? 15  ASP A CA  1 
ATOM   179  C C   . ASP A 1 27  ? 30.618 -7.237  27.980 1.00 16.90 ? 15  ASP A C   1 
ATOM   180  O O   . ASP A 1 27  ? 29.946 -8.129  28.507 1.00 19.54 ? 15  ASP A O   1 
ATOM   181  C CB  . ASP A 1 27  ? 30.368 -4.972  29.010 1.00 22.24 ? 15  ASP A CB  1 
ATOM   182  C CG  . ASP A 1 27  ? 30.772 -4.101  30.190 1.00 34.55 ? 15  ASP A CG  1 
ATOM   183  O OD1 . ASP A 1 27  ? 31.682 -4.509  30.948 1.00 39.83 ? 15  ASP A OD1 1 
ATOM   184  O OD2 . ASP A 1 27  ? 30.172 -3.017  30.367 1.00 35.02 ? 15  ASP A OD2 1 
ATOM   185  N N   . ARG A 1 28  ? 30.766 -7.137  26.661 1.00 14.66 ? 16  ARG A N   1 
ATOM   186  C CA  . ARG A 1 28  ? 30.168 -8.136  25.783 1.00 14.34 ? 16  ARG A CA  1 
ATOM   187  C C   . ARG A 1 28  ? 30.834 -9.493  25.998 1.00 14.86 ? 16  ARG A C   1 
ATOM   188  O O   . ARG A 1 28  ? 30.162 -10.528 26.033 1.00 16.24 ? 16  ARG A O   1 
ATOM   189  C CB  . ARG A 1 28  ? 30.263 -7.704  24.318 1.00 14.88 ? 16  ARG A CB  1 
ATOM   190  C CG  . ARG A 1 28  ? 29.384 -6.496  23.987 1.00 13.72 ? 16  ARG A CG  1 
ATOM   191  C CD  . ARG A 1 28  ? 29.463 -6.133  22.517 1.00 13.24 ? 16  ARG A CD  1 
ATOM   192  N NE  . ARG A 1 28  ? 30.507 -5.144  22.230 1.00 13.05 ? 16  ARG A NE  1 
ATOM   193  C CZ  . ARG A 1 28  ? 31.581 -5.348  21.474 1.00 15.77 ? 16  ARG A CZ  1 
ATOM   194  N NH1 . ARG A 1 28  ? 31.828 -6.537  20.935 1.00 13.29 ? 16  ARG A NH1 1 
ATOM   195  N NH2 . ARG A 1 28  ? 32.436 -4.350  21.262 1.00 14.41 ? 16  ARG A NH2 1 
ATOM   196  N N   . CYS A 1 29  ? 32.152 -9.497  26.136 1.00 15.28 ? 17  CYS A N   1 
ATOM   197  C CA  . CYS A 1 29  ? 32.869 -10.751 26.389 1.00 16.35 ? 17  CYS A CA  1 
ATOM   198  C C   . CYS A 1 29  ? 32.372 -11.391 27.682 1.00 18.37 ? 17  CYS A C   1 
ATOM   199  O O   . CYS A 1 29  ? 32.142 -12.605 27.754 1.00 20.72 ? 17  CYS A O   1 
ATOM   200  C CB  . CYS A 1 29  ? 34.378 -10.507 26.492 1.00 20.43 ? 17  CYS A CB  1 
ATOM   201  S SG  . CYS A 1 29  ? 35.177 -10.193 24.909 1.00 17.34 ? 17  CYS A SG  1 
ATOM   202  N N   . LYS A 1 30  ? 32.223 -10.561 28.709 1.00 18.24 ? 18  LYS A N   1 
ATOM   203  C CA  . LYS A 1 30  ? 31.763 -11.015 30.017 1.00 22.82 ? 18  LYS A CA  1 
ATOM   204  C C   . LYS A 1 30  ? 30.380 -11.650 29.928 1.00 22.10 ? 18  LYS A C   1 
ATOM   205  O O   . LYS A 1 30  ? 30.130 -12.709 30.508 1.00 21.66 ? 18  LYS A O   1 
ATOM   206  C CB  . LYS A 1 30  ? 31.735 -9.840  31.002 1.00 28.16 ? 18  LYS A CB  1 
ATOM   207  C CG  . LYS A 1 30  ? 30.958 -10.106 32.278 1.00 35.84 ? 18  LYS A CG  1 
ATOM   208  C CD  . LYS A 1 30  ? 30.917 -8.875  33.185 1.00 40.33 ? 18  LYS A CD  1 
ATOM   209  C CE  . LYS A 1 30  ? 30.425 -9.238  34.582 1.00 45.51 ? 18  LYS A CE  1 
ATOM   210  N NZ  . LYS A 1 30  ? 30.821 -8.222  35.600 1.00 48.05 ? 18  LYS A NZ  1 
ATOM   211  N N   . GLU A 1 31  ? 29.488 -10.998 29.188 1.00 16.97 ? 19  GLU A N   1 
ATOM   212  C CA  . GLU A 1 31  ? 28.120 -11.457 29.062 1.00 19.29 ? 19  GLU A CA  1 
ATOM   213  C C   . GLU A 1 31  ? 28.069 -12.812 28.352 1.00 20.67 ? 19  GLU A C   1 
ATOM   214  O O   . GLU A 1 31  ? 27.334 -13.714 28.771 1.00 16.70 ? 19  GLU A O   1 
ATOM   215  C CB  . GLU A 1 31  ? 27.308 -10.419 28.295 1.00 25.80 ? 19  GLU A CB  1 
ATOM   216  C CG  . GLU A 1 31  ? 25.828 -10.629 28.352 1.00 32.07 ? 19  GLU A CG  1 
ATOM   217  C CD  . GLU A 1 31  ? 25.077 -9.345  28.083 1.00 39.16 ? 19  GLU A CD  1 
ATOM   218  O OE1 . GLU A 1 31  ? 25.651 -8.444  27.421 1.00 37.03 ? 19  GLU A OE1 1 
ATOM   219  O OE2 . GLU A 1 31  ? 23.922 -9.238  28.547 1.00 44.38 ? 19  GLU A OE2 1 
ATOM   220  N N   . VAL A 1 32  ? 28.857 -12.958 27.289 1.00 16.33 ? 20  VAL A N   1 
ATOM   221  C CA  . VAL A 1 32  ? 28.924 -14.232 26.575 1.00 19.39 ? 20  VAL A CA  1 
ATOM   222  C C   . VAL A 1 32  ? 29.430 -15.366 27.456 1.00 17.20 ? 20  VAL A C   1 
ATOM   223  O O   . VAL A 1 32  ? 28.852 -16.468 27.486 1.00 17.96 ? 20  VAL A O   1 
ATOM   224  C CB  . VAL A 1 32  ? 29.800 -14.134 25.308 1.00 19.27 ? 20  VAL A CB  1 
ATOM   225  C CG1 . VAL A 1 32  ? 30.125 -15.531 24.775 1.00 17.74 ? 20  VAL A CG1 1 
ATOM   226  C CG2 . VAL A 1 32  ? 29.067 -13.345 24.264 1.00 17.42 ? 20  VAL A CG2 1 
ATOM   227  N N   . GLN A 1 33  ? 30.504 -15.103 28.187 1.00 17.64 ? 21  GLN A N   1 
ATOM   228  C CA  . GLN A 1 33  ? 31.098 -16.164 28.978 1.00 18.67 ? 21  GLN A CA  1 
ATOM   229  C C   . GLN A 1 33  ? 30.198 -16.593 30.134 1.00 21.05 ? 21  GLN A C   1 
ATOM   230  O O   . GLN A 1 33  ? 30.182 -17.773 30.477 1.00 23.67 ? 21  GLN A O   1 
ATOM   231  C CB  . GLN A 1 33  ? 32.502 -15.761 29.424 1.00 22.09 ? 21  GLN A CB  1 
ATOM   232  C CG  . GLN A 1 33  ? 33.416 -15.657 28.227 1.00 24.36 ? 21  GLN A CG  1 
ATOM   233  C CD  . GLN A 1 33  ? 34.664 -14.860 28.504 1.00 26.32 ? 21  GLN A CD  1 
ATOM   234  O OE1 . GLN A 1 33  ? 35.238 -14.936 29.600 1.00 27.83 ? 21  GLN A OE1 1 
ATOM   235  N NE2 . GLN A 1 33  ? 35.097 -14.082 27.509 1.00 22.99 ? 21  GLN A NE2 1 
ATOM   236  N N   . GLN A 1 34  ? 29.416 -15.662 30.690 1.00 18.92 ? 22  GLN A N   1 
ATOM   237  C CA  . GLN A 1 34  ? 28.415 -16.025 31.705 1.00 21.68 ? 22  GLN A CA  1 
ATOM   238  C C   . GLN A 1 34  ? 27.314 -16.919 31.143 1.00 21.36 ? 22  GLN A C   1 
ATOM   239  O O   . GLN A 1 34  ? 26.929 -17.917 31.765 1.00 22.83 ? 22  GLN A O   1 
ATOM   240  C CB  . GLN A 1 34  ? 27.746 -14.789 32.302 1.00 24.28 ? 22  GLN A CB  1 
ATOM   241  C CG  . GLN A 1 34  ? 28.553 -14.015 33.311 1.00 37.81 ? 22  GLN A CG  1 
ATOM   242  C CD  . GLN A 1 34  ? 27.856 -12.720 33.685 1.00 49.34 ? 22  GLN A CD  1 
ATOM   243  O OE1 . GLN A 1 34  ? 26.731 -12.462 33.243 1.00 55.03 ? 22  GLN A OE1 1 
ATOM   244  N NE2 . GLN A 1 34  ? 28.518 -11.893 34.488 1.00 52.43 ? 22  GLN A NE2 1 
ATOM   245  N N   . ILE A 1 35  ? 26.786 -16.547 29.982 1.00 19.79 ? 23  ILE A N   1 
ATOM   246  C CA  . ILE A 1 35  ? 25.642 -17.261 29.413 1.00 20.44 ? 23  ILE A CA  1 
ATOM   247  C C   . ILE A 1 35  ? 26.049 -18.619 28.827 1.00 22.32 ? 23  ILE A C   1 
ATOM   248  O O   . ILE A 1 35  ? 25.276 -19.575 28.882 1.00 22.38 ? 23  ILE A O   1 
ATOM   249  C CB  . ILE A 1 35  ? 24.866 -16.388 28.390 1.00 19.51 ? 23  ILE A CB  1 
ATOM   250  C CG1 . ILE A 1 35  ? 23.379 -16.761 28.373 1.00 25.09 ? 23  ILE A CG1 1 
ATOM   251  C CG2 . ILE A 1 35  ? 25.467 -16.484 26.992 1.00 18.55 ? 23  ILE A CG2 1 
ATOM   252  C CD1 . ILE A 1 35  ? 22.710 -16.625 29.728 1.00 25.19 ? 23  ILE A CD1 1 
ATOM   253  N N   . ARG A 1 36  ? 27.277 -18.721 28.311 1.00 19.47 ? 24  ARG A N   1 
ATOM   254  C CA  . ARG A 1 36  ? 27.771 -19.998 27.788 1.00 21.12 ? 24  ARG A CA  1 
ATOM   255  C C   . ARG A 1 36  ? 28.069 -20.994 28.909 1.00 23.59 ? 24  ARG A C   1 
ATOM   256  O O   . ARG A 1 36  ? 27.985 -22.215 28.710 1.00 25.04 ? 24  ARG A O   1 
ATOM   257  C CB  . ARG A 1 36  ? 29.004 -19.794 26.890 1.00 19.40 ? 24  ARG A CB  1 
ATOM   258  C CG  . ARG A 1 36  ? 28.673 -19.191 25.514 1.00 19.80 ? 24  ARG A CG  1 
ATOM   259  C CD  . ARG A 1 36  ? 28.079 -20.252 24.574 1.00 24.16 ? 24  ARG A CD  1 
ATOM   260  N NE  . ARG A 1 36  ? 29.094 -21.210 24.133 1.00 28.07 ? 24  ARG A NE  1 
ATOM   261  C CZ  . ARG A 1 36  ? 28.861 -22.223 23.302 1.00 30.05 ? 24  ARG A CZ  1 
ATOM   262  N NH1 . ARG A 1 36  ? 27.643 -22.412 22.804 1.00 31.35 ? 24  ARG A NH1 1 
ATOM   263  N NH2 . ARG A 1 36  ? 29.847 -23.043 22.960 1.00 28.10 ? 24  ARG A NH2 1 
ATOM   264  N N   . ASP A 1 37  ? 28.419 -20.479 30.086 1.00 23.25 ? 25  ASP A N   1 
ATOM   265  C CA  . ASP A 1 37  ? 28.629 -21.335 31.253 1.00 24.80 ? 25  ASP A CA  1 
ATOM   266  C C   . ASP A 1 37  ? 27.286 -21.871 31.758 1.00 27.97 ? 25  ASP A C   1 
ATOM   267  O O   . ASP A 1 37  ? 27.164 -23.030 32.150 1.00 28.84 ? 25  ASP A O   1 
ATOM   268  C CB  . ASP A 1 37  ? 29.366 -20.548 32.348 1.00 27.21 ? 25  ASP A CB  1 
ATOM   269  C CG  . ASP A 1 37  ? 29.588 -21.356 33.617 1.00 33.35 ? 25  ASP A CG  1 
ATOM   270  O OD1 . ASP A 1 37  ? 30.464 -22.252 33.629 1.00 30.72 ? 25  ASP A OD1 1 
ATOM   271  O OD2 . ASP A 1 37  ? 28.894 -21.078 34.619 1.00 38.09 ? 25  ASP A OD2 1 
ATOM   272  N N   . GLN A 1 38  ? 26.273 -21.016 31.718 1.00 27.72 ? 26  GLN A N   1 
ATOM   273  C CA  . GLN A 1 38  ? 24.938 -21.349 32.208 1.00 31.86 ? 26  GLN A CA  1 
ATOM   274  C C   . GLN A 1 38  ? 24.185 -22.265 31.233 1.00 31.85 ? 26  GLN A C   1 
ATOM   275  O O   . GLN A 1 38  ? 23.498 -23.205 31.649 1.00 32.45 ? 26  GLN A O   1 
ATOM   276  C CB  . GLN A 1 38  ? 24.171 -20.047 32.435 1.00 36.24 ? 26  GLN A CB  1 
ATOM   277  C CG  . GLN A 1 38  ? 22.867 -20.154 33.196 1.00 45.31 ? 26  GLN A CG  1 
ATOM   278  C CD  . GLN A 1 38  ? 22.343 -18.782 33.596 1.00 52.93 ? 26  GLN A CD  1 
ATOM   279  O OE1 . GLN A 1 38  ? 23.121 -17.853 33.828 1.00 55.46 ? 26  GLN A OE1 1 
ATOM   280  N NE2 . GLN A 1 38  ? 21.022 -18.646 33.666 1.00 56.94 ? 26  GLN A NE2 1 
ATOM   281  N N   . HIS A 1 39  ? 24.325 -21.994 29.936 1.00 25.90 ? 27  HIS A N   1 
ATOM   282  C CA  . HIS A 1 39  ? 23.651 -22.771 28.901 1.00 28.59 ? 27  HIS A CA  1 
ATOM   283  C C   . HIS A 1 39  ? 24.629 -23.206 27.819 1.00 29.46 ? 27  HIS A C   1 
ATOM   284  O O   . HIS A 1 39  ? 24.669 -22.598 26.744 1.00 29.26 ? 27  HIS A O   1 
ATOM   285  C CB  . HIS A 1 39  ? 22.558 -21.937 28.239 1.00 29.98 ? 27  HIS A CB  1 
ATOM   286  C CG  . HIS A 1 39  ? 21.616 -21.287 29.196 1.00 36.87 ? 27  HIS A CG  1 
ATOM   287  N ND1 . HIS A 1 39  ? 20.538 -21.942 29.756 1.00 37.87 ? 27  HIS A ND1 1 
ATOM   288  C CD2 . HIS A 1 39  ? 21.566 -20.012 29.678 1.00 37.30 ? 27  HIS A CD2 1 
ATOM   289  C CE1 . HIS A 1 39  ? 19.880 -21.115 30.547 1.00 39.42 ? 27  HIS A CE1 1 
ATOM   290  N NE2 . HIS A 1 39  ? 20.482 -19.942 30.516 1.00 39.70 ? 27  HIS A NE2 1 
ATOM   291  N N   . PRO A 1 40  ? 25.404 -24.267 28.082 1.00 30.33 ? 28  PRO A N   1 
ATOM   292  C CA  . PRO A 1 40  ? 26.474 -24.681 27.165 1.00 30.09 ? 28  PRO A CA  1 
ATOM   293  C C   . PRO A 1 40  ? 25.952 -25.157 25.808 1.00 30.42 ? 28  PRO A C   1 
ATOM   294  O O   . PRO A 1 40  ? 26.706 -25.159 24.838 1.00 33.05 ? 28  PRO A O   1 
ATOM   295  C CB  . PRO A 1 40  ? 27.143 -25.846 27.905 1.00 36.90 ? 28  PRO A CB  1 
ATOM   296  C CG  . PRO A 1 40  ? 26.688 -25.728 29.327 1.00 38.46 ? 28  PRO A CG  1 
ATOM   297  C CD  . PRO A 1 40  ? 25.325 -25.138 29.266 1.00 36.79 ? 28  PRO A CD  1 
ATOM   298  N N   . SER A 1 41  ? 24.683 -25.549 25.752 1.00 32.34 ? 29  SER A N   1 
ATOM   299  C CA  . SER A 1 41  ? 24.088 -26.082 24.528 1.00 34.27 ? 29  SER A CA  1 
ATOM   300  C C   . SER A 1 41  ? 23.343 -25.019 23.722 1.00 32.88 ? 29  SER A C   1 
ATOM   301  O O   . SER A 1 41  ? 22.631 -25.341 22.770 1.00 35.28 ? 29  SER A O   1 
ATOM   302  C CB  . SER A 1 41  ? 23.137 -27.240 24.858 1.00 38.59 ? 29  SER A CB  1 
ATOM   303  O OG  . SER A 1 41  ? 21.999 -26.786 25.579 1.00 40.31 ? 29  SER A OG  1 
ATOM   304  N N   . LYS A 1 42  ? 23.503 -23.750 24.086 1.00 28.95 ? 30  LYS A N   1 
ATOM   305  C CA  . LYS A 1 42  ? 22.780 -22.687 23.396 1.00 22.39 ? 30  LYS A CA  1 
ATOM   306  C C   . LYS A 1 42  ? 23.751 -21.658 22.825 1.00 21.80 ? 30  LYS A C   1 
ATOM   307  O O   . LYS A 1 42  ? 24.831 -21.444 23.378 1.00 21.30 ? 30  LYS A O   1 
ATOM   308  C CB  . LYS A 1 42  ? 21.761 -22.017 24.331 1.00 23.96 ? 30  LYS A CB  1 
ATOM   309  C CG  . LYS A 1 42  ? 20.686 -22.979 24.867 1.00 29.70 ? 30  LYS A CG  1 
ATOM   310  C CD  . LYS A 1 42  ? 19.719 -22.264 25.795 1.00 34.17 ? 30  LYS A CD  1 
ATOM   311  C CE  . LYS A 1 42  ? 18.854 -23.268 26.553 1.00 38.56 ? 30  LYS A CE  1 
ATOM   312  N NZ  . LYS A 1 42  ? 19.685 -24.237 27.338 1.00 41.12 ? 30  LYS A NZ  1 
ATOM   313  N N   . ILE A 1 43  ? 23.361 -21.038 21.717 1.00 20.05 ? 31  ILE A N   1 
ATOM   314  C CA  . ILE A 1 43  ? 24.207 -20.047 21.040 1.00 16.97 ? 31  ILE A CA  1 
ATOM   315  C C   . ILE A 1 43  ? 23.707 -18.635 21.311 1.00 16.54 ? 31  ILE A C   1 
ATOM   316  O O   . ILE A 1 43  ? 22.514 -18.342 21.094 1.00 16.76 ? 31  ILE A O   1 
ATOM   317  C CB  . ILE A 1 43  ? 24.190 -20.266 19.507 1.00 19.32 ? 31  ILE A CB  1 
ATOM   318  C CG1 . ILE A 1 43  ? 24.559 -21.713 19.157 1.00 21.75 ? 31  ILE A CG1 1 
ATOM   319  C CG2 . ILE A 1 43  ? 25.089 -19.256 18.801 1.00 17.84 ? 31  ILE A CG2 1 
ATOM   320  C CD1 . ILE A 1 43  ? 25.872 -22.197 19.767 1.00 21.38 ? 31  ILE A CD1 1 
ATOM   321  N N   . PRO A 1 44  ? 24.606 -17.740 21.778 1.00 15.76 ? 32  PRO A N   1 
ATOM   322  C CA  . PRO A 1 44  ? 24.224 -16.339 21.998 1.00 16.13 ? 32  PRO A CA  1 
ATOM   323  C C   . PRO A 1 44  ? 24.296 -15.526 20.706 1.00 16.87 ? 32  PRO A C   1 
ATOM   324  O O   . PRO A 1 44  ? 25.341 -15.479 20.073 1.00 14.27 ? 32  PRO A O   1 
ATOM   325  C CB  . PRO A 1 44  ? 25.281 -15.837 22.993 1.00 15.85 ? 32  PRO A CB  1 
ATOM   326  C CG  . PRO A 1 44  ? 26.505 -16.671 22.682 1.00 16.04 ? 32  PRO A CG  1 
ATOM   327  C CD  . PRO A 1 44  ? 25.987 -18.026 22.227 1.00 16.20 ? 32  PRO A CD  1 
ATOM   328  N N   . VAL A 1 45  ? 23.178 -14.908 20.326 1.00 14.77 ? 33  VAL A N   1 
ATOM   329  C CA  . VAL A 1 45  ? 23.052 -14.252 19.034 1.00 13.31 ? 33  VAL A CA  1 
ATOM   330  C C   . VAL A 1 45  ? 22.603 -12.794 19.212 1.00 12.73 ? 33  VAL A C   1 
ATOM   331  O O   . VAL A 1 45  ? 21.741 -12.495 20.040 1.00 13.68 ? 33  VAL A O   1 
ATOM   332  C CB  . VAL A 1 45  ? 22.037 -15.027 18.137 1.00 16.18 ? 33  VAL A CB  1 
ATOM   333  C CG1 . VAL A 1 45  ? 21.960 -14.419 16.745 1.00 18.26 ? 33  VAL A CG1 1 
ATOM   334  C CG2 . VAL A 1 45  ? 22.431 -16.492 18.029 1.00 14.18 ? 33  VAL A CG2 1 
ATOM   335  N N   . ILE A 1 46  ? 23.216 -11.901 18.444 1.00 12.34 ? 34  ILE A N   1 
ATOM   336  C CA  . ILE A 1 46  ? 22.800 -10.504 18.351 1.00 13.61 ? 34  ILE A CA  1 
ATOM   337  C C   . ILE A 1 46  ? 22.121 -10.342 17.007 1.00 14.74 ? 34  ILE A C   1 
ATOM   338  O O   . ILE A 1 46  ? 22.705 -10.669 15.975 1.00 14.92 ? 34  ILE A O   1 
ATOM   339  C CB  . ILE A 1 46  ? 24.013 -9.555  18.394 1.00 11.75 ? 34  ILE A CB  1 
ATOM   340  C CG1 . ILE A 1 46  ? 24.733 -9.681  19.738 1.00 13.02 ? 34  ILE A CG1 1 
ATOM   341  C CG2 . ILE A 1 46  ? 23.592 -8.112  18.122 1.00 11.97 ? 34  ILE A CG2 1 
ATOM   342  C CD1 . ILE A 1 46  ? 23.826 -9.368  20.917 1.00 13.14 ? 34  ILE A CD1 1 
ATOM   343  N N   . ILE A 1 47  ? 20.875 -9.876  17.014 1.00 11.48 ? 35  ILE A N   1 
ATOM   344  C CA  . ILE A 1 47  ? 20.130 -9.687  15.768 1.00 11.34 ? 35  ILE A CA  1 
ATOM   345  C C   . ILE A 1 47  ? 19.693 -8.226  15.683 1.00 15.70 ? 35  ILE A C   1 
ATOM   346  O O   . ILE A 1 47  ? 19.078 -7.711  16.610 1.00 18.08 ? 35  ILE A O   1 
ATOM   347  C CB  . ILE A 1 47  ? 18.893 -10.630 15.706 1.00 16.12 ? 35  ILE A CB  1 
ATOM   348  C CG1 . ILE A 1 47  ? 19.341 -12.087 15.865 1.00 17.56 ? 35  ILE A CG1 1 
ATOM   349  C CG2 . ILE A 1 47  ? 18.142 -10.462 14.384 1.00 18.78 ? 35  ILE A CG2 1 
ATOM   350  C CD1 . ILE A 1 47  ? 18.204 -13.098 15.898 1.00 18.50 ? 35  ILE A CD1 1 
ATOM   351  N N   . GLU A 1 48  ? 20.042 -7.563  14.584 1.00 14.69 ? 36  GLU A N   1 
ATOM   352  C CA  . GLU A 1 48  ? 19.797 -6.123  14.429 1.00 15.70 ? 36  GLU A CA  1 
ATOM   353  C C   . GLU A 1 48  ? 19.340 -5.822  13.020 1.00 15.46 ? 36  GLU A C   1 
ATOM   354  O O   . GLU A 1 48  ? 19.704 -6.523  12.087 1.00 16.19 ? 36  GLU A O   1 
ATOM   355  C CB  . GLU A 1 48  ? 21.099 -5.351  14.679 1.00 18.62 ? 36  GLU A CB  1 
ATOM   356  C CG  . GLU A 1 48  ? 21.770 -5.647  15.998 1.00 22.05 ? 36  GLU A CG  1 
ATOM   357  C CD  . GLU A 1 48  ? 23.042 -4.841  16.198 1.00 18.19 ? 36  GLU A CD  1 
ATOM   358  O OE1 . GLU A 1 48  ? 24.097 -5.180  15.601 1.00 20.42 ? 36  GLU A OE1 1 
ATOM   359  O OE2 . GLU A 1 48  ? 22.983 -3.861  16.958 1.00 22.36 ? 36  GLU A OE2 1 
ATOM   360  N N   . ARG A 1 49  ? 18.564 -4.757  12.850 1.00 14.61 ? 37  ARG A N   1 
ATOM   361  C CA  . ARG A 1 49  ? 18.249 -4.281  11.512 1.00 13.33 ? 37  ARG A CA  1 
ATOM   362  C C   . ARG A 1 49  ? 19.500 -3.710  10.865 1.00 16.36 ? 37  ARG A C   1 
ATOM   363  O O   . ARG A 1 49  ? 20.297 -3.032  11.523 1.00 20.54 ? 37  ARG A O   1 
ATOM   364  C CB  . ARG A 1 49  ? 17.160 -3.195  11.577 1.00 16.20 ? 37  ARG A CB  1 
ATOM   365  C CG  . ARG A 1 49  ? 16.574 -2.820  10.214 1.00 17.17 ? 37  ARG A CG  1 
ATOM   366  C CD  . ARG A 1 49  ? 15.374 -1.869  10.356 1.00 20.76 ? 37  ARG A CD  1 
ATOM   367  N NE  . ARG A 1 49  ? 15.768 -0.566  10.893 1.00 22.56 ? 37  ARG A NE  1 
ATOM   368  C CZ  . ARG A 1 49  ? 14.937 0.458   11.063 1.00 22.55 ? 37  ARG A CZ  1 
ATOM   369  N NH1 . ARG A 1 49  ? 13.655 0.338   10.741 1.00 19.47 ? 37  ARG A NH1 1 
ATOM   370  N NH2 . ARG A 1 49  ? 15.391 1.607   11.554 1.00 23.78 ? 37  ARG A NH2 1 
ATOM   371  N N   . TYR A 1 50  ? 19.679 -3.992  9.576  1.00 13.75 ? 38  TYR A N   1 
ATOM   372  C CA  . TYR A 1 50  ? 20.765 -3.431  8.785  1.00 18.87 ? 38  TYR A CA  1 
ATOM   373  C C   . TYR A 1 50  ? 20.717 -1.913  8.844  1.00 21.32 ? 38  TYR A C   1 
ATOM   374  O O   . TYR A 1 50  ? 19.634 -1.322  8.848  1.00 22.16 ? 38  TYR A O   1 
ATOM   375  C CB  . TYR A 1 50  ? 20.635 -3.910  7.343  1.00 20.81 ? 38  TYR A CB  1 
ATOM   376  C CG  . TYR A 1 50  ? 21.677 -3.377  6.389  1.00 29.48 ? 38  TYR A CG  1 
ATOM   377  C CD1 . TYR A 1 50  ? 23.033 -3.509  6.661  1.00 32.00 ? 38  TYR A CD1 1 
ATOM   378  C CD2 . TYR A 1 50  ? 21.299 -2.773  5.194  1.00 34.62 ? 38  TYR A CD2 1 
ATOM   379  C CE1 . TYR A 1 50  ? 23.986 -3.031  5.776  1.00 36.72 ? 38  TYR A CE1 1 
ATOM   380  C CE2 . TYR A 1 50  ? 22.241 -2.297  4.305  1.00 38.45 ? 38  TYR A CE2 1 
ATOM   381  C CZ  . TYR A 1 50  ? 23.581 -2.429  4.599  1.00 40.15 ? 38  TYR A CZ  1 
ATOM   382  O OH  . TYR A 1 50  ? 24.522 -1.955  3.711  1.00 44.75 ? 38  TYR A OH  1 
ATOM   383  N N   . LYS A 1 51  ? 21.886 -1.281  8.910  1.00 26.19 ? 39  LYS A N   1 
ATOM   384  C CA  . LYS A 1 51  ? 21.945 0.169   9.089  1.00 28.57 ? 39  LYS A CA  1 
ATOM   385  C C   . LYS A 1 51  ? 21.257 0.922   7.956  1.00 30.83 ? 39  LYS A C   1 
ATOM   386  O O   . LYS A 1 51  ? 20.652 1.974   8.179  1.00 33.17 ? 39  LYS A O   1 
ATOM   387  C CB  . LYS A 1 51  ? 23.393 0.645   9.253  1.00 33.23 ? 39  LYS A CB  1 
ATOM   388  C CG  . LYS A 1 51  ? 24.235 0.491   7.995  1.00 37.98 ? 39  LYS A CG  1 
ATOM   389  C CD  . LYS A 1 51  ? 25.704 0.811   8.248  1.00 44.04 ? 39  LYS A CD  1 
ATOM   390  C CE  . LYS A 1 51  ? 26.368 -0.285  9.062  1.00 47.32 ? 39  LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 51  ? 27.823 -0.411  8.733  1.00 49.28 ? 39  LYS A NZ  1 
ATOM   392  N N   . GLY A 1 52  ? 21.324 0.376   6.746  1.00 30.51 ? 40  GLY A N   1 
ATOM   393  C CA  . GLY A 1 52  ? 20.699 1.016   5.606  1.00 33.87 ? 40  GLY A CA  1 
ATOM   394  C C   . GLY A 1 52  ? 19.235 0.672   5.388  1.00 33.71 ? 40  GLY A C   1 
ATOM   395  O O   . GLY A 1 52  ? 18.575 1.248   4.521  1.00 35.14 ? 40  GLY A O   1 
ATOM   396  N N   . GLU A 1 53  ? 18.717 -0.264  6.175  1.00 28.89 ? 41  GLU A N   1 
ATOM   397  C CA  . GLU A 1 53  ? 17.341 -0.723  6.000  1.00 26.78 ? 41  GLU A CA  1 
ATOM   398  C C   . GLU A 1 53  ? 16.347 0.211   6.674  1.00 25.97 ? 41  GLU A C   1 
ATOM   399  O O   . GLU A 1 53  ? 16.463 0.491   7.868  1.00 25.89 ? 41  GLU A O   1 
ATOM   400  C CB  . GLU A 1 53  ? 17.181 -2.136  6.562  1.00 24.60 ? 41  GLU A CB  1 
ATOM   401  C CG  . GLU A 1 53  ? 15.763 -2.677  6.474  1.00 26.73 ? 41  GLU A CG  1 
ATOM   402  C CD  . GLU A 1 53  ? 15.270 -2.783  5.044  1.00 28.48 ? 41  GLU A CD  1 
ATOM   403  O OE1 . GLU A 1 53  ? 16.049 -3.240  4.166  1.00 28.67 ? 41  GLU A OE1 1 
ATOM   404  O OE2 . GLU A 1 53  ? 14.104 -2.405  4.800  1.00 28.18 ? 41  GLU A OE2 1 
ATOM   405  N N   . LYS A 1 54  ? 15.361 0.674   5.912  1.00 29.50 ? 42  LYS A N   1 
ATOM   406  C CA  . LYS A 1 54  ? 14.396 1.640   6.423  1.00 33.38 ? 42  LYS A CA  1 
ATOM   407  C C   . LYS A 1 54  ? 12.945 1.167   6.388  1.00 32.49 ? 42  LYS A C   1 
ATOM   408  O O   . LYS A 1 54  ? 12.071 1.826   6.949  1.00 33.50 ? 42  LYS A O   1 
ATOM   409  C CB  . LYS A 1 54  ? 14.537 2.970   5.670  1.00 38.64 ? 42  LYS A CB  1 
ATOM   410  C CG  . LYS A 1 54  ? 15.904 3.613   5.844  1.00 44.85 ? 42  LYS A CG  1 
ATOM   411  C CD  . LYS A 1 54  ? 16.308 3.587   7.314  1.00 50.20 ? 42  LYS A CD  1 
ATOM   412  C CE  . LYS A 1 54  ? 17.635 4.283   7.556  1.00 54.33 ? 42  LYS A CE  1 
ATOM   413  N NZ  . LYS A 1 54  ? 17.954 4.304   9.010  1.00 56.39 ? 42  LYS A NZ  1 
ATOM   414  N N   . GLN A 1 55  ? 12.680 0.034   5.741  1.00 27.41 ? 43  GLN A N   1 
ATOM   415  C CA  . GLN A 1 55  ? 11.295 -0.399  5.563  1.00 29.51 ? 43  GLN A CA  1 
ATOM   416  C C   . GLN A 1 55  ? 10.836 -1.467  6.555  1.00 30.37 ? 43  GLN A C   1 
ATOM   417  O O   . GLN A 1 55  ? 9.687  -1.463  7.013  1.00 36.96 ? 43  GLN A O   1 
ATOM   418  C CB  . GLN A 1 55  ? 11.056 -0.853  4.123  1.00 36.71 ? 43  GLN A CB  1 
ATOM   419  C CG  . GLN A 1 55  ? 11.309 0.255   3.112  1.00 43.06 ? 43  GLN A CG  1 
ATOM   420  C CD  . GLN A 1 55  ? 10.374 1.439   3.299  1.00 50.10 ? 43  GLN A CD  1 
ATOM   421  O OE1 . GLN A 1 55  ? 9.181  1.270   3.570  1.00 51.95 ? 43  GLN A OE1 1 
ATOM   422  N NE2 . GLN A 1 55  ? 10.914 2.646   3.168  1.00 53.23 ? 43  GLN A NE2 1 
ATOM   423  N N   . LEU A 1 56  ? 11.737 -2.369  6.909  1.00 20.66 ? 44  LEU A N   1 
ATOM   424  C CA  . LEU A 1 56  ? 11.414 -3.382  7.902  1.00 17.80 ? 44  LEU A CA  1 
ATOM   425  C C   . LEU A 1 56  ? 11.467 -2.739  9.283  1.00 19.77 ? 44  LEU A C   1 
ATOM   426  O O   . LEU A 1 56  ? 12.246 -1.805  9.507  1.00 20.36 ? 44  LEU A O   1 
ATOM   427  C CB  . LEU A 1 56  ? 12.419 -4.535  7.808  1.00 15.31 ? 44  LEU A CB  1 
ATOM   428  C CG  . LEU A 1 56  ? 12.367 -5.314  6.492  1.00 14.01 ? 44  LEU A CG  1 
ATOM   429  C CD1 . LEU A 1 56  ? 13.608 -6.214  6.338  1.00 14.08 ? 44  LEU A CD1 1 
ATOM   430  C CD2 . LEU A 1 56  ? 11.096 -6.143  6.463  1.00 14.51 ? 44  LEU A CD2 1 
ATOM   431  N N   . PRO A 1 57  ? 10.652 -3.238  10.221 1.00 21.80 ? 45  PRO A N   1 
ATOM   432  C CA  . PRO A 1 57  ? 10.621 -2.623  11.553 1.00 21.97 ? 45  PRO A CA  1 
ATOM   433  C C   . PRO A 1 57  ? 11.823 -2.992  12.423 1.00 20.51 ? 45  PRO A C   1 
ATOM   434  O O   . PRO A 1 57  ? 12.572 -3.934  12.128 1.00 17.04 ? 45  PRO A O   1 
ATOM   435  C CB  . PRO A 1 57  ? 9.325  -3.168  12.164 1.00 23.79 ? 45  PRO A CB  1 
ATOM   436  C CG  . PRO A 1 57  ? 9.097  -4.478  11.466 1.00 24.03 ? 45  PRO A CG  1 
ATOM   437  C CD  . PRO A 1 57  ? 9.678  -4.338  10.083 1.00 21.83 ? 45  PRO A CD  1 
ATOM   438  N N   . VAL A 1 58  ? 12.016 -2.220  13.489 1.00 20.25 ? 46  VAL A N   1 
ATOM   439  C CA  . VAL A 1 58  ? 13.044 -2.517  14.480 1.00 20.53 ? 46  VAL A CA  1 
ATOM   440  C C   . VAL A 1 58  ? 12.569 -3.662  15.375 1.00 23.60 ? 46  VAL A C   1 
ATOM   441  O O   . VAL A 1 58  ? 11.430 -3.685  15.836 1.00 24.53 ? 46  VAL A O   1 
ATOM   442  C CB  . VAL A 1 58  ? 13.357 -1.275  15.344 1.00 26.23 ? 46  VAL A CB  1 
ATOM   443  C CG1 . VAL A 1 58  ? 14.338 -1.616  16.451 1.00 30.21 ? 46  VAL A CG1 1 
ATOM   444  C CG2 . VAL A 1 58  ? 13.917 -0.157  14.473 1.00 26.73 ? 46  VAL A CG2 1 
ATOM   445  N N   . LEU A 1 59  ? 13.449 -4.621  15.618 1.00 23.56 ? 47  LEU A N   1 
ATOM   446  C CA  . LEU A 1 59  ? 13.134 -5.741  16.490 1.00 24.78 ? 47  LEU A CA  1 
ATOM   447  C C   . LEU A 1 59  ? 13.047 -5.252  17.938 1.00 26.28 ? 47  LEU A C   1 
ATOM   448  O O   . LEU A 1 59  ? 13.751 -4.314  18.332 1.00 27.10 ? 47  LEU A O   1 
ATOM   449  C CB  . LEU A 1 59  ? 14.221 -6.809  16.330 1.00 25.41 ? 47  LEU A CB  1 
ATOM   450  C CG  . LEU A 1 59  ? 13.985 -8.263  16.727 1.00 28.27 ? 47  LEU A CG  1 
ATOM   451  C CD1 . LEU A 1 59  ? 12.716 -8.789  16.112 1.00 27.90 ? 47  LEU A CD1 1 
ATOM   452  C CD2 . LEU A 1 59  ? 15.183 -9.094  16.270 1.00 30.17 ? 47  LEU A CD2 1 
ATOM   453  N N   . ASP A 1 60  ? 12.190 -5.894  18.728 1.00 25.73 ? 48  ASP A N   1 
ATOM   454  C CA  . ASP A 1 60  ? 11.948 -5.508  20.121 1.00 27.37 ? 48  ASP A CA  1 
ATOM   455  C C   . ASP A 1 60  ? 13.124 -5.793  21.067 1.00 29.26 ? 48  ASP A C   1 
ATOM   456  O O   . ASP A 1 60  ? 13.309 -5.110  22.075 1.00 29.48 ? 48  ASP A O   1 
ATOM   457  C CB  . ASP A 1 60  ? 10.705 -6.242  20.637 1.00 32.03 ? 48  ASP A CB  1 
ATOM   458  C CG  . ASP A 1 60  ? 10.845 -7.766  20.552 1.00 36.15 ? 48  ASP A CG  1 
ATOM   459  O OD1 . ASP A 1 60  ? 11.313 -8.291  19.513 1.00 32.95 ? 48  ASP A OD1 1 
ATOM   460  O OD2 . ASP A 1 60  ? 10.490 -8.444  21.540 1.00 39.12 ? 48  ASP A OD2 1 
ATOM   461  N N   . LYS A 1 61  ? 13.904 -6.813  20.739 1.00 24.76 ? 49  LYS A N   1 
ATOM   462  C CA  . LYS A 1 61  ? 15.011 -7.260  21.572 1.00 22.50 ? 49  LYS A CA  1 
ATOM   463  C C   . LYS A 1 61  ? 16.215 -7.408  20.657 1.00 18.91 ? 49  LYS A C   1 
ATOM   464  O O   . LYS A 1 61  ? 16.048 -7.468  19.438 1.00 20.54 ? 49  LYS A O   1 
ATOM   465  C CB  . LYS A 1 61  ? 14.683 -8.619  22.202 1.00 28.52 ? 49  LYS A CB  1 
ATOM   466  C CG  . LYS A 1 61  ? 13.513 -8.617  23.184 1.00 34.55 ? 49  LYS A CG  1 
ATOM   467  C CD  . LYS A 1 61  ? 13.869 -7.856  24.452 1.00 38.16 ? 49  LYS A CD  1 
ATOM   468  C CE  . LYS A 1 61  ? 12.774 -7.984  25.514 1.00 42.02 ? 49  LYS A CE  1 
ATOM   469  N NZ  . LYS A 1 61  ? 12.819 -6.841  26.482 1.00 44.16 ? 49  LYS A NZ  1 
ATOM   470  N N   . THR A 1 62  ? 17.413 -7.485  21.239 1.00 18.04 ? 50  THR A N   1 
ATOM   471  C CA  . THR A 1 62  ? 18.650 -7.580  20.461 1.00 17.74 ? 50  THR A CA  1 
ATOM   472  C C   . THR A 1 62  ? 19.395 -8.891  20.724 1.00 19.09 ? 50  THR A C   1 
ATOM   473  O O   . THR A 1 62  ? 19.983 -9.466  19.802 1.00 18.36 ? 50  THR A O   1 
ATOM   474  C CB  . THR A 1 62  ? 19.610 -6.429  20.812 1.00 23.41 ? 50  THR A CB  1 
ATOM   475  O OG1 . THR A 1 62  ? 19.004 -5.176  20.481 1.00 25.60 ? 50  THR A OG1 1 
ATOM   476  C CG2 . THR A 1 62  ? 20.904 -6.550  20.038 1.00 24.76 ? 50  THR A CG2 1 
ATOM   477  N N   . LYS A 1 63  ? 19.397 -9.328  21.985 1.00 17.04 ? 51  LYS A N   1 
ATOM   478  C CA  . LYS A 1 63  ? 20.148 -10.515 22.422 1.00 17.79 ? 51  LYS A CA  1 
ATOM   479  C C   . LYS A 1 63  ? 19.244 -11.727 22.529 1.00 18.64 ? 51  LYS A C   1 
ATOM   480  O O   . LYS A 1 63  ? 18.235 -11.698 23.244 1.00 19.09 ? 51  LYS A O   1 
ATOM   481  C CB  . LYS A 1 63  ? 20.750 -10.313 23.813 1.00 21.04 ? 51  LYS A CB  1 
ATOM   482  C CG  . LYS A 1 63  ? 21.845 -9.302  23.895 1.00 26.97 ? 51  LYS A CG  1 
ATOM   483  C CD  . LYS A 1 63  ? 22.470 -9.300  25.286 1.00 30.80 ? 51  LYS A CD  1 
ATOM   484  C CE  . LYS A 1 63  ? 21.444 -8.943  26.338 1.00 34.94 ? 51  LYS A CE  1 
ATOM   485  N NZ  . LYS A 1 63  ? 22.072 -8.346  27.550 1.00 38.09 ? 51  LYS A NZ  1 
ATOM   486  N N   . PHE A 1 64  ? 19.642 -12.816 21.881 1.00 16.06 ? 52  PHE A N   1 
ATOM   487  C CA  . PHE A 1 64  ? 18.823 -14.021 21.854 1.00 17.41 ? 52  PHE A CA  1 
ATOM   488  C C   . PHE A 1 64  ? 19.656 -15.234 22.212 1.00 20.64 ? 52  PHE A C   1 
ATOM   489  O O   . PHE A 1 64  ? 20.866 -15.217 22.013 1.00 16.57 ? 52  PHE A O   1 
ATOM   490  C CB  . PHE A 1 64  ? 18.253 -14.205 20.455 1.00 16.80 ? 52  PHE A CB  1 
ATOM   491  C CG  . PHE A 1 64  ? 17.256 -13.145 20.076 1.00 18.00 ? 52  PHE A CG  1 
ATOM   492  C CD1 . PHE A 1 64  ? 15.918 -13.304 20.386 1.00 23.00 ? 52  PHE A CD1 1 
ATOM   493  C CD2 . PHE A 1 64  ? 17.659 -11.992 19.433 1.00 17.39 ? 52  PHE A CD2 1 
ATOM   494  C CE1 . PHE A 1 64  ? 14.998 -12.331 20.053 1.00 20.67 ? 52  PHE A CE1 1 
ATOM   495  C CE2 . PHE A 1 64  ? 16.742 -11.014 19.098 1.00 21.60 ? 52  PHE A CE2 1 
ATOM   496  C CZ  . PHE A 1 64  ? 15.403 -11.193 19.411 1.00 17.44 ? 52  PHE A CZ  1 
ATOM   497  N N   . LEU A 1 65  ? 19.012 -16.278 22.732 1.00 15.17 ? 53  LEU A N   1 
ATOM   498  C CA  . LEU A 1 65  ? 19.681 -17.572 22.936 1.00 16.85 ? 53  LEU A CA  1 
ATOM   499  C C   . LEU A 1 65  ? 19.010 -18.608 22.056 1.00 19.25 ? 53  LEU A C   1 
ATOM   500  O O   . LEU A 1 65  ? 17.787 -18.745 22.089 1.00 21.15 ? 53  LEU A O   1 
ATOM   501  C CB  . LEU A 1 65  ? 19.585 -18.030 24.387 1.00 20.50 ? 53  LEU A CB  1 
ATOM   502  C CG  . LEU A 1 65  ? 20.664 -17.613 25.371 1.00 26.60 ? 53  LEU A CG  1 
ATOM   503  C CD1 . LEU A 1 65  ? 20.433 -18.307 26.697 1.00 29.32 ? 53  LEU A CD1 1 
ATOM   504  C CD2 . LEU A 1 65  ? 22.035 -17.957 24.818 1.00 24.99 ? 53  LEU A CD2 1 
ATOM   505  N N   . VAL A 1 66  ? 19.801 -19.336 21.273 1.00 19.59 ? 54  VAL A N   1 
ATOM   506  C CA  . VAL A 1 66  ? 19.252 -20.320 20.338 1.00 21.65 ? 54  VAL A CA  1 
ATOM   507  C C   . VAL A 1 66  ? 19.812 -21.703 20.623 1.00 21.78 ? 54  VAL A C   1 
ATOM   508  O O   . VAL A 1 66  ? 21.027 -21.877 20.647 1.00 21.74 ? 54  VAL A O   1 
ATOM   509  C CB  . VAL A 1 66  ? 19.608 -19.947 18.878 1.00 19.02 ? 54  VAL A CB  1 
ATOM   510  C CG1 . VAL A 1 66  ? 18.926 -20.893 17.887 1.00 18.93 ? 54  VAL A CG1 1 
ATOM   511  C CG2 . VAL A 1 66  ? 19.229 -18.498 18.584 1.00 17.13 ? 54  VAL A CG2 1 
ATOM   512  N N   . PRO A 1 67  ? 18.931 -22.706 20.832 1.00 23.32 ? 55  PRO A N   1 
ATOM   513  C CA  . PRO A 1 67  ? 19.415 -24.080 21.033 1.00 25.92 ? 55  PRO A CA  1 
ATOM   514  C C   . PRO A 1 67  ? 20.313 -24.478 19.862 1.00 25.35 ? 55  PRO A C   1 
ATOM   515  O O   . PRO A 1 67  ? 19.982 -24.147 18.724 1.00 25.66 ? 55  PRO A O   1 
ATOM   516  C CB  . PRO A 1 67  ? 18.123 -24.915 21.029 1.00 24.67 ? 55  PRO A CB  1 
ATOM   517  C CG  . PRO A 1 67  ? 17.050 -23.937 21.444 1.00 24.76 ? 55  PRO A CG  1 
ATOM   518  C CD  . PRO A 1 67  ? 17.459 -22.625 20.839 1.00 24.68 ? 55  PRO A CD  1 
ATOM   519  N N   . ASP A 1 68  ? 21.428 -25.158 20.120 1.00 25.23 ? 56  ASP A N   1 
ATOM   520  C CA  . ASP A 1 68  ? 22.456 -25.269 19.080 1.00 28.89 ? 56  ASP A CA  1 
ATOM   521  C C   . ASP A 1 68  ? 22.149 -26.223 17.915 1.00 30.03 ? 56  ASP A C   1 
ATOM   522  O O   . ASP A 1 68  ? 22.908 -26.275 16.941 1.00 27.45 ? 56  ASP A O   1 
ATOM   523  C CB  . ASP A 1 68  ? 23.853 -25.518 19.678 1.00 31.88 ? 56  ASP A CB  1 
ATOM   524  C CG  . ASP A 1 68  ? 23.961 -26.839 20.413 1.00 39.02 ? 56  ASP A CG  1 
ATOM   525  O OD1 . ASP A 1 68  ? 23.033 -27.675 20.314 1.00 39.46 ? 56  ASP A OD1 1 
ATOM   526  O OD2 . ASP A 1 68  ? 24.996 -27.043 21.086 1.00 41.57 ? 56  ASP A OD2 1 
ATOM   527  N N   . HIS A 1 69  ? 21.033 -26.949 18.004 1.00 32.96 ? 57  HIS A N   1 
ATOM   528  C CA  . HIS A 1 69  ? 20.650 -27.907 16.964 1.00 31.25 ? 57  HIS A CA  1 
ATOM   529  C C   . HIS A 1 69  ? 19.696 -27.269 15.954 1.00 31.96 ? 57  HIS A C   1 
ATOM   530  O O   . HIS A 1 69  ? 19.367 -27.869 14.932 1.00 35.55 ? 57  HIS A O   1 
ATOM   531  C CB  . HIS A 1 69  ? 20.010 -29.154 17.590 1.00 32.58 ? 57  HIS A CB  1 
ATOM   532  C CG  . HIS A 1 69  ? 18.842 -28.846 18.463 1.00 34.90 ? 57  HIS A CG  1 
ATOM   533  N ND1 . HIS A 1 69  ? 18.966 -28.559 19.811 1.00 35.33 ? 57  HIS A ND1 1 
ATOM   534  C CD2 . HIS A 1 69  ? 17.517 -28.747 18.184 1.00 40.38 ? 57  HIS A CD2 1 
ATOM   535  C CE1 . HIS A 1 69  ? 17.774 -28.317 20.317 1.00 36.24 ? 57  HIS A CE1 1 
ATOM   536  N NE2 . HIS A 1 69  ? 16.878 -28.418 19.358 1.00 39.95 ? 57  HIS A NE2 1 
ATOM   537  N N   . VAL A 1 70  ? 19.261 -26.046 16.240 1.00 25.67 ? 58  VAL A N   1 
ATOM   538  C CA  . VAL A 1 70  ? 18.386 -25.304 15.338 1.00 25.51 ? 58  VAL A CA  1 
ATOM   539  C C   . VAL A 1 70  ? 19.072 -24.984 13.999 1.00 26.83 ? 58  VAL A C   1 
ATOM   540  O O   . VAL A 1 70  ? 20.188 -24.447 13.982 1.00 26.09 ? 58  VAL A O   1 
ATOM   541  C CB  . VAL A 1 70  ? 17.926 -24.005 16.013 1.00 24.82 ? 58  VAL A CB  1 
ATOM   542  C CG1 . VAL A 1 70  ? 17.210 -23.097 15.033 1.00 25.74 ? 58  VAL A CG1 1 
ATOM   543  C CG2 . VAL A 1 70  ? 17.038 -24.343 17.195 1.00 28.06 ? 58  VAL A CG2 1 
ATOM   544  N N   . ASN A 1 71  ? 18.413 -25.332 12.889 1.00 27.27 ? 59  ASN A N   1 
ATOM   545  C CA  . ASN A 1 71  ? 18.894 -25.011 11.538 1.00 29.39 ? 59  ASN A CA  1 
ATOM   546  C C   . ASN A 1 71  ? 18.796 -23.524 11.266 1.00 22.39 ? 59  ASN A C   1 
ATOM   547  O O   . ASN A 1 71  ? 17.890 -22.862 11.783 1.00 22.25 ? 59  ASN A O   1 
ATOM   548  C CB  . ASN A 1 71  ? 18.041 -25.712 10.482 1.00 36.64 ? 59  ASN A CB  1 
ATOM   549  C CG  . ASN A 1 71  ? 18.341 -27.184 10.367 1.00 48.31 ? 59  ASN A CG  1 
ATOM   550  O OD1 . ASN A 1 71  ? 19.194 -27.719 11.079 1.00 52.50 ? 59  ASN A OD1 1 
ATOM   551  N ND2 . ASN A 1 71  ? 17.629 -27.857 9.466  1.00 51.38 ? 59  ASN A ND2 1 
ATOM   552  N N   . MET A 1 72  ? 19.680 -22.997 10.420 1.00 18.25 ? 60  MET A N   1 
ATOM   553  C CA  . MET A 1 72  ? 19.682 -21.550 10.177 1.00 20.23 ? 60  MET A CA  1 
ATOM   554  C C   . MET A 1 72  ? 18.382 -21.093 9.546  1.00 22.76 ? 60  MET A C   1 
ATOM   555  O O   . MET A 1 72  ? 17.845 -20.054 9.919  1.00 19.85 ? 60  MET A O   1 
ATOM   556  C CB  . MET A 1 72  ? 20.848 -21.110 9.285  1.00 22.49 ? 60  MET A CB  1 
ATOM   557  C CG  . MET A 1 72  ? 22.233 -21.286 9.893  1.00 23.17 ? 60  MET A CG  1 
ATOM   558  S SD  . MET A 1 72  ? 22.429 -20.653 11.576 1.00 22.97 ? 60  MET A SD  1 
ATOM   559  C CE  . MET A 1 72  ? 22.341 -18.888 11.317 1.00 15.42 ? 60  MET A CE  1 
ATOM   560  N N   . SER A 1 73  ? 17.869 -21.881 8.599  1.00 22.80 ? 61  SER A N   1 
ATOM   561  C CA  . SER A 1 73  ? 16.658 -21.510 7.882  1.00 22.46 ? 61  SER A CA  1 
ATOM   562  C C   . SER A 1 73  ? 15.495 -21.433 8.853  1.00 21.57 ? 61  SER A C   1 
ATOM   563  O O   . SER A 1 73  ? 14.573 -20.646 8.674  1.00 22.49 ? 61  SER A O   1 
ATOM   564  C CB  . SER A 1 73  ? 16.367 -22.519 6.771  1.00 27.82 ? 61  SER A CB  1 
ATOM   565  O OG  . SER A 1 73  ? 16.307 -23.829 7.304  1.00 34.40 ? 61  SER A OG  1 
ATOM   566  N N   . GLU A 1 74  ? 15.553 -22.257 9.892  1.00 23.12 ? 62  GLU A N   1 
ATOM   567  C CA  . GLU A 1 74  ? 14.528 -22.269 10.923 1.00 23.74 ? 62  GLU A CA  1 
ATOM   568  C C   . GLU A 1 74  ? 14.585 -21.009 11.788 1.00 21.11 ? 62  GLU A C   1 
ATOM   569  O O   . GLU A 1 74  ? 13.553 -20.417 12.101 1.00 19.25 ? 62  GLU A O   1 
ATOM   570  C CB  . GLU A 1 74  ? 14.688 -23.526 11.773 1.00 34.91 ? 62  GLU A CB  1 
ATOM   571  C CG  . GLU A 1 74  ? 14.191 -23.411 13.194 1.00 47.89 ? 62  GLU A CG  1 
ATOM   572  C CD  . GLU A 1 74  ? 12.682 -23.487 13.303 1.00 59.61 ? 62  GLU A CD  1 
ATOM   573  O OE1 . GLU A 1 74  ? 12.178 -23.598 14.443 1.00 64.70 ? 62  GLU A OE1 1 
ATOM   574  O OE2 . GLU A 1 74  ? 11.997 -23.434 12.257 1.00 63.90 ? 62  GLU A OE2 1 
ATOM   575  N N   . LEU A 1 75  ? 15.795 -20.586 12.151 1.00 20.39 ? 63  LEU A N   1 
ATOM   576  C CA  . LEU A 1 75  ? 15.980 -19.333 12.885 1.00 18.79 ? 63  LEU A CA  1 
ATOM   577  C C   . LEU A 1 75  ? 15.474 -18.155 12.060 1.00 16.02 ? 63  LEU A C   1 
ATOM   578  O O   . LEU A 1 75  ? 14.838 -17.236 12.588 1.00 16.06 ? 63  LEU A O   1 
ATOM   579  C CB  . LEU A 1 75  ? 17.461 -19.137 13.266 1.00 17.54 ? 63  LEU A CB  1 
ATOM   580  C CG  . LEU A 1 75  ? 17.821 -17.816 13.949 1.00 15.39 ? 63  LEU A CG  1 
ATOM   581  C CD1 . LEU A 1 75  ? 16.938 -17.583 15.179 1.00 15.87 ? 63  LEU A CD1 1 
ATOM   582  C CD2 . LEU A 1 75  ? 19.285 -17.805 14.348 1.00 18.76 ? 63  LEU A CD2 1 
ATOM   583  N N   . VAL A 1 76  ? 15.723 -18.175 10.755 1.00 15.27 ? 64  VAL A N   1 
ATOM   584  C CA  . VAL A 1 76  ? 15.207 -17.101 9.918  1.00 16.06 ? 64  VAL A CA  1 
ATOM   585  C C   . VAL A 1 76  ? 13.676 -16.977 10.017 1.00 15.60 ? 64  VAL A C   1 
ATOM   586  O O   . VAL A 1 76  ? 13.152 -15.879 10.132 1.00 14.33 ? 64  VAL A O   1 
ATOM   587  C CB  . VAL A 1 76  ? 15.640 -17.249 8.457  1.00 18.73 ? 64  VAL A CB  1 
ATOM   588  C CG1 . VAL A 1 76  ? 15.022 -16.139 7.613  1.00 18.00 ? 64  VAL A CG1 1 
ATOM   589  C CG2 . VAL A 1 76  ? 17.160 -17.200 8.369  1.00 19.90 ? 64  VAL A CG2 1 
ATOM   590  N N   . LYS A 1 77  ? 12.959 -18.093 10.008 1.00 17.27 ? 65  LYS A N   1 
ATOM   591  C CA  . LYS A 1 77  ? 11.492 -18.017 10.119 1.00 18.83 ? 65  LYS A CA  1 
ATOM   592  C C   . LYS A 1 77  ? 11.020 -17.505 11.480 1.00 18.12 ? 65  LYS A C   1 
ATOM   593  O O   . LYS A 1 77  ? 10.014 -16.789 11.570 1.00 15.43 ? 65  LYS A O   1 
ATOM   594  C CB  . LYS A 1 77  ? 10.863 -19.373 9.863  1.00 26.77 ? 65  LYS A CB  1 
ATOM   595  C CG  . LYS A 1 77  ? 11.623 -20.208 8.894  1.00 35.62 ? 65  LYS A CG  1 
ATOM   596  C CD  . LYS A 1 77  ? 11.114 -20.061 7.491  1.00 38.95 ? 65  LYS A CD  1 
ATOM   597  C CE  . LYS A 1 77  ? 10.445 -21.350 7.074  1.00 42.83 ? 65  LYS A CE  1 
ATOM   598  N NZ  . LYS A 1 77  ? 11.175 -22.512 7.667  1.00 48.01 ? 65  LYS A NZ  1 
ATOM   599  N N   . ILE A 1 78  ? 11.721 -17.897 12.541 1.00 15.58 ? 66  ILE A N   1 
ATOM   600  C CA  . ILE A 1 78  ? 11.398 -17.416 13.887 1.00 15.42 ? 66  ILE A CA  1 
ATOM   601  C C   . ILE A 1 78  ? 11.431 -15.900 13.942 1.00 14.61 ? 66  ILE A C   1 
ATOM   602  O O   . ILE A 1 78  ? 10.516 -15.255 14.480 1.00 16.53 ? 66  ILE A O   1 
ATOM   603  C CB  . ILE A 1 78  ? 12.371 -17.984 14.951 1.00 15.57 ? 66  ILE A CB  1 
ATOM   604  C CG1 . ILE A 1 78  ? 12.185 -19.496 15.096 1.00 19.78 ? 66  ILE A CG1 1 
ATOM   605  C CG2 . ILE A 1 78  ? 12.159 -17.301 16.294 1.00 15.37 ? 66  ILE A CG2 1 
ATOM   606  C CD1 . ILE A 1 78  ? 13.242 -20.141 16.007 1.00 22.62 ? 66  ILE A CD1 1 
ATOM   607  N N   . ILE A 1 79  ? 12.492 -15.327 13.384 1.00 15.58 ? 67  ILE A N   1 
ATOM   608  C CA  . ILE A 1 79  ? 12.665 -13.887 13.412 1.00 15.68 ? 67  ILE A CA  1 
ATOM   609  C C   . ILE A 1 79  ? 11.652 -13.205 12.504 1.00 13.75 ? 67  ILE A C   1 
ATOM   610  O O   . ILE A 1 79  ? 11.093 -12.154 12.836 1.00 15.49 ? 67  ILE A O   1 
ATOM   611  C CB  . ILE A 1 79  ? 14.101 -13.495 13.008 1.00 15.20 ? 67  ILE A CB  1 
ATOM   612  C CG1 . ILE A 1 79  ? 15.103 -14.159 13.955 1.00 17.11 ? 67  ILE A CG1 1 
ATOM   613  C CG2 . ILE A 1 79  ? 14.267 -11.990 13.058 1.00 14.90 ? 67  ILE A CG2 1 
ATOM   614  C CD1 . ILE A 1 79  ? 14.773 -13.946 15.442 1.00 20.21 ? 67  ILE A CD1 1 
ATOM   615  N N   . ARG A 1 80  ? 11.407 -13.803 11.345 1.00 13.84 ? 68  ARG A N   1 
ATOM   616  C CA  . ARG A 1 80  ? 10.407 -13.265 10.452 1.00 15.54 ? 68  ARG A CA  1 
ATOM   617  C C   . ARG A 1 80  ? 9.030  -13.165 11.148 1.00 17.73 ? 68  ARG A C   1 
ATOM   618  O O   . ARG A 1 80  ? 8.340  -12.141 11.037 1.00 17.77 ? 68  ARG A O   1 
ATOM   619  C CB  . ARG A 1 80  ? 10.354 -14.105 9.164  1.00 17.03 ? 68  ARG A CB  1 
ATOM   620  C CG  . ARG A 1 80  ? 9.902  -13.334 7.944  1.00 18.19 ? 68  ARG A CG  1 
ATOM   621  C CD  . ARG A 1 80  ? 9.611  -14.215 6.726  1.00 15.22 ? 68  ARG A CD  1 
ATOM   622  N NE  . ARG A 1 80  ? 9.120  -13.381 5.628  1.00 17.73 ? 68  ARG A NE  1 
ATOM   623  C CZ  . ARG A 1 80  ? 7.844  -13.033 5.492  1.00 18.67 ? 68  ARG A CZ  1 
ATOM   624  N NH1 . ARG A 1 80  ? 6.941  -13.467 6.365  1.00 21.02 ? 68  ARG A NH1 1 
ATOM   625  N NH2 . ARG A 1 80  ? 7.467  -12.254 4.498  1.00 16.32 ? 68  ARG A NH2 1 
ATOM   626  N N   . ARG A 1 81  ? 8.633  -14.206 11.884 1.00 16.18 ? 69  ARG A N   1 
ATOM   627  C CA  . ARG A 1 81  ? 7.386  -14.159 12.658 1.00 15.01 ? 69  ARG A CA  1 
ATOM   628  C C   . ARG A 1 81  ? 7.419  -13.163 13.813 1.00 16.55 ? 69  ARG A C   1 
ATOM   629  O O   . ARG A 1 81  ? 6.408  -12.523 14.120 1.00 18.64 ? 69  ARG A O   1 
ATOM   630  C CB  . ARG A 1 81  ? 6.991  -15.540 13.209 1.00 15.80 ? 69  ARG A CB  1 
ATOM   631  C CG  . ARG A 1 81  ? 6.486  -16.510 12.178 1.00 18.04 ? 69  ARG A CG  1 
ATOM   632  C CD  . ARG A 1 81  ? 5.966  -17.790 12.844 1.00 17.39 ? 69  ARG A CD  1 
ATOM   633  N NE  . ARG A 1 81  ? 6.992  -18.439 13.671 1.00 19.90 ? 69  ARG A NE  1 
ATOM   634  C CZ  . ARG A 1 81  ? 7.828  -19.380 13.225 1.00 20.99 ? 69  ARG A CZ  1 
ATOM   635  N NH1 . ARG A 1 81  ? 7.782  -19.771 11.959 1.00 22.53 ? 69  ARG A NH1 1 
ATOM   636  N NH2 . ARG A 1 81  ? 8.717  -19.923 14.049 1.00 22.75 ? 69  ARG A NH2 1 
ATOM   637  N N   . ARG A 1 82  ? 8.566  -13.033 14.466 1.00 14.80 ? 70  ARG A N   1 
ATOM   638  C CA  . ARG A 1 82  ? 8.661  -12.087 15.569 1.00 17.58 ? 70  ARG A CA  1 
ATOM   639  C C   . ARG A 1 82  ? 8.441  -10.634 15.115 1.00 20.30 ? 70  ARG A C   1 
ATOM   640  O O   . ARG A 1 82  ? 7.862  -9.825  15.850 1.00 21.11 ? 70  ARG A O   1 
ATOM   641  C CB  . ARG A 1 82  ? 9.991  -12.238 16.289 1.00 19.40 ? 70  ARG A CB  1 
ATOM   642  C CG  . ARG A 1 82  ? 10.005 -11.590 17.645 1.00 22.43 ? 70  ARG A CG  1 
ATOM   643  C CD  . ARG A 1 82  ? 11.371 -11.726 18.298 1.00 22.01 ? 70  ARG A CD  1 
ATOM   644  N NE  . ARG A 1 82  ? 11.360 -11.177 19.648 1.00 23.91 ? 70  ARG A NE  1 
ATOM   645  C CZ  . ARG A 1 82  ? 11.183 -11.895 20.752 1.00 26.17 ? 70  ARG A CZ  1 
ATOM   646  N NH1 . ARG A 1 82  ? 11.193 -11.293 21.932 1.00 29.03 ? 70  ARG A NH1 1 
ATOM   647  N NH2 . ARG A 1 82  ? 11.000 -13.208 20.681 1.00 25.82 ? 70  ARG A NH2 1 
ATOM   648  N N   . LEU A 1 83  ? 8.876  -10.323 13.894 1.00 16.23 ? 71  LEU A N   1 
ATOM   649  C CA  . LEU A 1 83  ? 8.661  -9.010  13.283 1.00 16.47 ? 71  LEU A CA  1 
ATOM   650  C C   . LEU A 1 83  ? 7.260  -8.870  12.700 1.00 17.95 ? 71  LEU A C   1 
ATOM   651  O O   . LEU A 1 83  ? 6.894  -7.802  12.213 1.00 18.06 ? 71  LEU A O   1 
ATOM   652  C CB  . LEU A 1 83  ? 9.670  -8.772  12.160 1.00 16.34 ? 71  LEU A CB  1 
ATOM   653  C CG  . LEU A 1 83  ? 11.138 -8.580  12.535 1.00 18.58 ? 71  LEU A CG  1 
ATOM   654  C CD1 . LEU A 1 83  ? 12.004 -8.702  11.282 1.00 17.70 ? 71  LEU A CD1 1 
ATOM   655  C CD2 . LEU A 1 83  ? 11.325 -7.204  13.188 1.00 20.86 ? 71  LEU A CD2 1 
ATOM   656  N N   . GLN A 1 84  ? 6.492  -9.955  12.738 1.00 14.79 ? 72  GLN A N   1 
ATOM   657  C CA  . GLN A 1 84  ? 5.117  -9.985  12.223 1.00 15.67 ? 72  GLN A CA  1 
ATOM   658  C C   . GLN A 1 84  ? 4.992  -9.513  10.781 1.00 18.14 ? 72  GLN A C   1 
ATOM   659  O O   . GLN A 1 84  ? 4.069  -8.771  10.423 1.00 19.12 ? 72  GLN A O   1 
ATOM   660  C CB  . GLN A 1 84  ? 4.198  -9.173  13.135 1.00 18.80 ? 72  GLN A CB  1 
ATOM   661  C CG  . GLN A 1 84  ? 4.252  -9.641  14.576 1.00 19.82 ? 72  GLN A CG  1 
ATOM   662  C CD  . GLN A 1 84  ? 3.288  -8.891  15.455 1.00 28.48 ? 72  GLN A CD  1 
ATOM   663  O OE1 . GLN A 1 84  ? 3.665  -7.926  16.117 1.00 36.36 ? 72  GLN A OE1 1 
ATOM   664  N NE2 . GLN A 1 84  ? 2.036  -9.320  15.461 1.00 30.64 ? 72  GLN A NE2 1 
ATOM   665  N N   . LEU A 1 85  ? 5.909  -9.956  9.935  1.00 15.72 ? 73  LEU A N   1 
ATOM   666  C CA  . LEU A 1 85  ? 5.850  -9.582  8.529  1.00 15.22 ? 73  LEU A CA  1 
ATOM   667  C C   . LEU A 1 85  ? 4.736  -10.273 7.766  1.00 17.66 ? 73  LEU A C   1 
ATOM   668  O O   . LEU A 1 85  ? 4.393  -11.426 8.039  1.00 18.19 ? 73  LEU A O   1 
ATOM   669  C CB  . LEU A 1 85  ? 7.182  -9.885  7.839  1.00 14.96 ? 73  LEU A CB  1 
ATOM   670  C CG  . LEU A 1 85  ? 8.434  -9.293  8.474  1.00 15.88 ? 73  LEU A CG  1 
ATOM   671  C CD1 . LEU A 1 85  ? 9.604  -9.558  7.540  1.00 16.05 ? 73  LEU A CD1 1 
ATOM   672  C CD2 . LEU A 1 85  ? 8.261  -7.804  8.696  1.00 14.99 ? 73  LEU A CD2 1 
ATOM   673  N N   . ASN A 1 86  ? 4.175  -9.552  6.801  1.00 16.96 ? 74  ASN A N   1 
ATOM   674  C CA  . ASN A 1 86  ? 3.238  -10.119 5.853  1.00 20.17 ? 74  ASN A CA  1 
ATOM   675  C C   . ASN A 1 86  ? 3.959  -10.995 4.822  1.00 16.11 ? 74  ASN A C   1 
ATOM   676  O O   . ASN A 1 86  ? 5.170  -10.836 4.598  1.00 15.63 ? 74  ASN A O   1 
ATOM   677  C CB  . ASN A 1 86  ? 2.448  -8.995  5.171  1.00 25.94 ? 74  ASN A CB  1 
ATOM   678  C CG  . ASN A 1 86  ? 1.571  -8.231  6.149  1.00 31.50 ? 74  ASN A CG  1 
ATOM   679  O OD1 . ASN A 1 86  ? 0.893  -8.831  6.993  1.00 32.26 ? 74  ASN A OD1 1 
ATOM   680  N ND2 . ASN A 1 86  ? 1.589  -6.904  6.053  1.00 33.19 ? 74  ASN A ND2 1 
ATOM   681  N N   . PRO A 1 87  ? 3.226  -11.937 4.205  1.00 20.62 ? 75  PRO A N   1 
ATOM   682  C CA  . PRO A 1 87  ? 3.831  -12.881 3.255  1.00 22.13 ? 75  PRO A CA  1 
ATOM   683  C C   . PRO A 1 87  ? 4.596  -12.220 2.103  1.00 22.20 ? 75  PRO A C   1 
ATOM   684  O O   . PRO A 1 87  ? 5.594  -12.776 1.657  1.00 23.50 ? 75  PRO A O   1 
ATOM   685  C CB  . PRO A 1 87  ? 2.624  -13.651 2.719  1.00 24.39 ? 75  PRO A CB  1 
ATOM   686  C CG  . PRO A 1 87  ? 1.668  -13.652 3.864  1.00 25.41 ? 75  PRO A CG  1 
ATOM   687  C CD  . PRO A 1 87  ? 1.826  -12.292 4.507  1.00 23.63 ? 75  PRO A CD  1 
ATOM   688  N N   . THR A 1 88  ? 4.159  -11.051 1.644  1.00 19.76 ? 76  THR A N   1 
ATOM   689  C CA  . THR A 1 88  ? 4.823  -10.412 0.508  1.00 17.00 ? 76  THR A CA  1 
ATOM   690  C C   . THR A 1 88  ? 6.031  -9.536  0.862  1.00 16.22 ? 76  THR A C   1 
ATOM   691  O O   . THR A 1 88  ? 6.661  -8.967  -0.038 1.00 17.35 ? 76  THR A O   1 
ATOM   692  C CB  . THR A 1 88  ? 3.831  -9.582  -0.331 1.00 25.84 ? 76  THR A CB  1 
ATOM   693  O OG1 . THR A 1 88  ? 3.108  -8.705  0.541  1.00 27.09 ? 76  THR A OG1 1 
ATOM   694  C CG2 . THR A 1 88  ? 2.855  -10.492 -1.057 1.00 29.90 ? 76  THR A CG2 1 
ATOM   695  N N   . GLN A 1 89  ? 6.377  -9.424  2.144  1.00 15.60 ? 77  GLN A N   1 
ATOM   696  C CA  . GLN A 1 89  ? 7.510  -8.585  2.526  1.00 14.94 ? 77  GLN A CA  1 
ATOM   697  C C   . GLN A 1 89  ? 8.827  -9.349  2.409  1.00 19.50 ? 77  GLN A C   1 
ATOM   698  O O   . GLN A 1 89  ? 8.989  -10.410 3.018  1.00 17.87 ? 77  GLN A O   1 
ATOM   699  C CB  . GLN A 1 89  ? 7.353  -8.046  3.948  1.00 16.66 ? 77  GLN A CB  1 
ATOM   700  C CG  . GLN A 1 89  ? 6.178  -7.095  4.127  1.00 19.74 ? 77  GLN A CG  1 
ATOM   701  C CD  . GLN A 1 89  ? 6.134  -6.484  5.516  1.00 21.70 ? 77  GLN A CD  1 
ATOM   702  O OE1 . GLN A 1 89  ? 5.306  -6.866  6.358  1.00 24.43 ? 77  GLN A OE1 1 
ATOM   703  N NE2 . GLN A 1 89  ? 7.029  -5.529  5.768  1.00 23.72 ? 77  GLN A NE2 1 
ATOM   704  N N   . ALA A 1 90  ? 9.754  -8.805  1.627  1.00 15.88 ? 78  ALA A N   1 
ATOM   705  C CA  . ALA A 1 90  ? 11.083 -9.398  1.469  1.00 14.61 ? 78  ALA A CA  1 
ATOM   706  C C   . ALA A 1 90  ? 11.837 -9.373  2.806  1.00 13.96 ? 78  ALA A C   1 
ATOM   707  O O   . ALA A 1 90  ? 11.780 -8.384  3.559  1.00 13.52 ? 78  ALA A O   1 
ATOM   708  C CB  . ALA A 1 90  ? 11.861 -8.645  0.417  1.00 14.77 ? 78  ALA A CB  1 
ATOM   709  N N   . PHE A 1 91  ? 12.552 -10.451 3.109  1.00 15.44 ? 79  PHE A N   1 
ATOM   710  C CA  . PHE A 1 91  ? 13.266 -10.531 4.378  1.00 13.48 ? 79  PHE A CA  1 
ATOM   711  C C   . PHE A 1 91  ? 14.472 -11.449 4.248  1.00 13.62 ? 79  PHE A C   1 
ATOM   712  O O   . PHE A 1 91  ? 14.334 -12.621 3.902  1.00 15.98 ? 79  PHE A O   1 
ATOM   713  C CB  . PHE A 1 91  ? 12.330 -11.052 5.474  1.00 13.45 ? 79  PHE A CB  1 
ATOM   714  C CG  . PHE A 1 91  ? 13.003 -11.240 6.813  1.00 14.47 ? 79  PHE A CG  1 
ATOM   715  C CD1 . PHE A 1 91  ? 13.322 -10.146 7.601  1.00 14.76 ? 79  PHE A CD1 1 
ATOM   716  C CD2 . PHE A 1 91  ? 13.297 -12.515 7.293  1.00 18.17 ? 79  PHE A CD2 1 
ATOM   717  C CE1 . PHE A 1 91  ? 13.943 -10.306 8.844  1.00 15.12 ? 79  PHE A CE1 1 
ATOM   718  C CE2 . PHE A 1 91  ? 13.916 -12.679 8.533  1.00 18.27 ? 79  PHE A CE2 1 
ATOM   719  C CZ  . PHE A 1 91  ? 14.245 -11.563 9.302  1.00 17.89 ? 79  PHE A CZ  1 
ATOM   720  N N   . PHE A 1 92  ? 15.647 -10.904 4.516  1.00 13.95 ? 80  PHE A N   1 
ATOM   721  C CA  . PHE A 1 92  ? 16.873 -11.699 4.507  1.00 16.58 ? 80  PHE A CA  1 
ATOM   722  C C   . PHE A 1 92  ? 17.563 -11.525 5.844  1.00 15.98 ? 80  PHE A C   1 
ATOM   723  O O   . PHE A 1 92  ? 17.678 -10.404 6.337  1.00 16.82 ? 80  PHE A O   1 
ATOM   724  C CB  . PHE A 1 92  ? 17.806 -11.226 3.407  1.00 14.95 ? 80  PHE A CB  1 
ATOM   725  C CG  . PHE A 1 92  ? 17.304 -11.507 2.020  1.00 17.93 ? 80  PHE A CG  1 
ATOM   726  C CD1 . PHE A 1 92  ? 16.364 -10.680 1.427  1.00 22.01 ? 80  PHE A CD1 1 
ATOM   727  C CD2 . PHE A 1 92  ? 17.799 -12.585 1.300  1.00 22.10 ? 80  PHE A CD2 1 
ATOM   728  C CE1 . PHE A 1 92  ? 15.903 -10.934 0.146  1.00 24.28 ? 80  PHE A CE1 1 
ATOM   729  C CE2 . PHE A 1 92  ? 17.353 -12.847 0.013  1.00 25.46 ? 80  PHE A CE2 1 
ATOM   730  C CZ  . PHE A 1 92  ? 16.398 -12.020 -0.568 1.00 24.25 ? 80  PHE A CZ  1 
ATOM   731  N N   . LEU A 1 93  ? 18.006 -12.628 6.445  1.00 13.78 ? 81  LEU A N   1 
ATOM   732  C CA  . LEU A 1 93  ? 18.772 -12.551 7.690  1.00 12.82 ? 81  LEU A CA  1 
ATOM   733  C C   . LEU A 1 93  ? 20.171 -13.000 7.304  1.00 16.48 ? 81  LEU A C   1 
ATOM   734  O O   . LEU A 1 93  ? 20.333 -14.078 6.746  1.00 17.57 ? 81  LEU A O   1 
ATOM   735  C CB  . LEU A 1 93  ? 18.164 -13.471 8.756  1.00 16.92 ? 81  LEU A CB  1 
ATOM   736  C CG  . LEU A 1 93  ? 18.779 -13.455 10.164 1.00 17.67 ? 81  LEU A CG  1 
ATOM   737  C CD1 . LEU A 1 93  ? 18.760 -12.060 10.764 1.00 16.12 ? 81  LEU A CD1 1 
ATOM   738  C CD2 . LEU A 1 93  ? 18.047 -14.417 11.080 1.00 16.83 ? 81  LEU A CD2 1 
ATOM   739  N N   . LEU A 1 94  ? 21.169 -12.160 7.574  1.00 15.39 ? 82  LEU A N   1 
ATOM   740  C CA  . LEU A 1 94  ? 22.510 -12.354 7.031  1.00 15.58 ? 82  LEU A CA  1 
ATOM   741  C C   . LEU A 1 94  ? 23.533 -12.592 8.128  1.00 16.38 ? 82  LEU A C   1 
ATOM   742  O O   . LEU A 1 94  ? 23.499 -11.938 9.167  1.00 16.99 ? 82  LEU A O   1 
ATOM   743  C CB  . LEU A 1 94  ? 22.935 -11.102 6.251  1.00 17.79 ? 82  LEU A CB  1 
ATOM   744  C CG  . LEU A 1 94  ? 21.906 -10.521 5.278  1.00 23.44 ? 82  LEU A CG  1 
ATOM   745  C CD1 . LEU A 1 94  ? 22.423 -9.200  4.704  1.00 28.24 ? 82  LEU A CD1 1 
ATOM   746  C CD2 . LEU A 1 94  ? 21.605 -11.504 4.163  1.00 22.15 ? 82  LEU A CD2 1 
ATOM   747  N N   . VAL A 1 95  ? 24.446 -13.528 7.884  1.00 17.47 ? 83  VAL A N   1 
ATOM   748  C CA  . VAL A 1 95  ? 25.612 -13.725 8.742  1.00 15.64 ? 83  VAL A CA  1 
ATOM   749  C C   . VAL A 1 95  ? 26.851 -13.502 7.874  1.00 19.44 ? 83  VAL A C   1 
ATOM   750  O O   . VAL A 1 95  ? 27.022 -14.191 6.876  1.00 20.66 ? 83  VAL A O   1 
ATOM   751  C CB  . VAL A 1 95  ? 25.661 -15.165 9.304  1.00 16.18 ? 83  VAL A CB  1 
ATOM   752  C CG1 . VAL A 1 95  ? 27.004 -15.426 9.975  1.00 18.43 ? 83  VAL A CG1 1 
ATOM   753  C CG2 . VAL A 1 95  ? 24.530 -15.391 10.298 1.00 19.17 ? 83  VAL A CG2 1 
ATOM   754  N N   . ASN A 1 96  ? 27.698 -12.544 8.241  1.00 18.86 ? 84  ASN A N   1 
ATOM   755  C CA  . ASN A 1 96  ? 28.879 -12.225 7.425  1.00 21.19 ? 84  ASN A CA  1 
ATOM   756  C C   . ASN A 1 96  ? 28.471 -11.954 5.972  1.00 22.93 ? 84  ASN A C   1 
ATOM   757  O O   . ASN A 1 96  ? 29.087 -12.454 5.024  1.00 22.35 ? 84  ASN A O   1 
ATOM   758  C CB  . ASN A 1 96  ? 29.914 -13.347 7.499  1.00 25.40 ? 84  ASN A CB  1 
ATOM   759  C CG  . ASN A 1 96  ? 31.261 -12.933 6.934  1.00 31.78 ? 84  ASN A CG  1 
ATOM   760  O OD1 . ASN A 1 96  ? 31.688 -11.790 7.103  1.00 34.43 ? 84  ASN A OD1 1 
ATOM   761  N ND2 . ASN A 1 96  ? 31.924 -13.853 6.239  1.00 35.62 ? 84  ASN A ND2 1 
ATOM   762  N N   . GLN A 1 97  ? 27.423 -11.145 5.832  1.00 21.06 ? 85  GLN A N   1 
ATOM   763  C CA  . GLN A 1 97  ? 26.744 -10.825 4.564  1.00 28.11 ? 85  GLN A CA  1 
ATOM   764  C C   . GLN A 1 97  ? 26.220 -11.966 3.681  1.00 26.28 ? 85  GLN A C   1 
ATOM   765  O O   . GLN A 1 97  ? 25.866 -11.720 2.527  1.00 29.90 ? 85  GLN A O   1 
ATOM   766  C CB  . GLN A 1 97  ? 27.482 -9.772  3.706  1.00 36.83 ? 85  GLN A CB  1 
ATOM   767  C CG  . GLN A 1 97  ? 28.961 -9.565  3.958  1.00 44.01 ? 85  GLN A CG  1 
ATOM   768  C CD  . GLN A 1 97  ? 29.234 -8.272  4.676  1.00 49.56 ? 85  GLN A CD  1 
ATOM   769  O OE1 . GLN A 1 97  ? 28.600 -7.970  5.687  1.00 52.72 ? 85  GLN A OE1 1 
ATOM   770  N NE2 . GLN A 1 97  ? 30.171 -7.487  4.152  1.00 50.61 ? 85  GLN A NE2 1 
ATOM   771  N N   . HIS A 1 98  ? 26.134 -13.186 4.207  1.00 21.70 ? 86  HIS A N   1 
ATOM   772  C CA  . HIS A 1 98  ? 25.501 -14.276 3.454  1.00 20.37 ? 86  HIS A CA  1 
ATOM   773  C C   . HIS A 1 98  ? 24.107 -14.584 3.983  1.00 18.75 ? 86  HIS A C   1 
ATOM   774  O O   . HIS A 1 98  ? 23.897 -14.653 5.195  1.00 17.34 ? 86  HIS A O   1 
ATOM   775  C CB  . HIS A 1 98  ? 26.356 -15.545 3.479  1.00 21.56 ? 86  HIS A CB  1 
ATOM   776  C CG  . HIS A 1 98  ? 27.629 -15.430 2.700  1.00 28.00 ? 86  HIS A CG  1 
ATOM   777  N ND1 . HIS A 1 98  ? 27.692 -15.639 1.342  1.00 33.14 ? 86  HIS A ND1 1 
ATOM   778  C CD2 . HIS A 1 98  ? 28.890 -15.123 3.097  1.00 33.01 ? 86  HIS A CD2 1 
ATOM   779  C CE1 . HIS A 1 98  ? 28.938 -15.472 0.930  1.00 36.39 ? 86  HIS A CE1 1 
ATOM   780  N NE2 . HIS A 1 98  ? 29.685 -15.160 1.972  1.00 34.26 ? 86  HIS A NE2 1 
ATOM   781  N N   . SER A 1 99  ? 23.164 -14.797 3.072  1.00 19.24 ? 87  SER A N   1 
ATOM   782  C CA  . SER A 1 99  ? 21.792 -15.093 3.456  1.00 17.83 ? 87  SER A CA  1 
ATOM   783  C C   . SER A 1 99  ? 21.633 -16.479 4.082  1.00 18.42 ? 87  SER A C   1 
ATOM   784  O O   . SER A 1 99  ? 22.079 -17.493 3.527  1.00 18.42 ? 87  SER A O   1 
ATOM   785  C CB  . SER A 1 99  ? 20.862 -14.979 2.250  1.00 19.17 ? 87  SER A CB  1 
ATOM   786  O OG  . SER A 1 99  ? 19.537 -15.348 2.615  1.00 22.38 ? 87  SER A OG  1 
ATOM   787  N N   . MET A 1 100 ? 20.971 -16.514 5.233  1.00 18.58 ? 88  MET A N   1 
ATOM   788  C CA  . MET A 1 100 ? 20.741 -17.757 5.958  1.00 18.83 ? 88  MET A CA  1 
ATOM   789  C C   . MET A 1 100 ? 19.363 -18.325 5.649  1.00 21.59 ? 88  MET A C   1 
ATOM   790  O O   . MET A 1 100 ? 19.002 -19.394 6.148  1.00 21.73 ? 88  MET A O   1 
ATOM   791  C CB  . MET A 1 100 ? 20.864 -17.501 7.465  1.00 20.86 ? 88  MET A CB  1 
ATOM   792  C CG  . MET A 1 100 ? 22.241 -16.997 7.893  1.00 19.03 ? 88  MET A CG  1 
ATOM   793  S SD  . MET A 1 100 ? 23.476 -18.312 7.747  1.00 22.73 ? 88  MET A SD  1 
ATOM   794  C CE  . MET A 1 100 ? 24.405 -17.801 6.288  1.00 20.33 ? 88  MET A CE  1 
ATOM   795  N N   . VAL A 1 101 ? 18.612 -17.618 4.804  1.00 19.81 ? 89  VAL A N   1 
ATOM   796  C CA  . VAL A 1 101 ? 17.205 -17.943 4.535  1.00 19.12 ? 89  VAL A CA  1 
ATOM   797  C C   . VAL A 1 101 ? 16.939 -19.425 4.202  1.00 26.36 ? 89  VAL A C   1 
ATOM   798  O O   . VAL A 1 101 ? 15.976 -20.022 4.697  1.00 30.74 ? 89  VAL A O   1 
ATOM   799  C CB  . VAL A 1 101 ? 16.624 -17.032 3.423  1.00 22.57 ? 89  VAL A CB  1 
ATOM   800  C CG1 . VAL A 1 101 ? 15.211 -17.481 3.054  1.00 25.72 ? 89  VAL A CG1 1 
ATOM   801  C CG2 . VAL A 1 101 ? 16.608 -15.572 3.871  1.00 24.30 ? 89  VAL A CG2 1 
ATOM   802  N N   . SER A 1 102 ? 17.803 -20.028 3.396  1.00 26.36 ? 90  SER A N   1 
ATOM   803  C CA  . SER A 1 102 ? 17.609 -21.428 3.021  1.00 29.82 ? 90  SER A CA  1 
ATOM   804  C C   . SER A 1 102 ? 18.770 -22.329 3.428  1.00 28.61 ? 90  SER A C   1 
ATOM   805  O O   . SER A 1 102 ? 18.901 -23.451 2.932  1.00 29.43 ? 90  SER A O   1 
ATOM   806  C CB  . SER A 1 102 ? 17.330 -21.554 1.521  1.00 32.37 ? 90  SER A CB  1 
ATOM   807  O OG  . SER A 1 102 ? 16.151 -20.847 1.184  1.00 32.03 ? 90  SER A OG  1 
ATOM   808  N N   . VAL A 1 103 ? 19.597 -21.836 4.344  1.00 25.77 ? 91  VAL A N   1 
ATOM   809  C CA  . VAL A 1 103 ? 20.725 -22.597 4.874  1.00 24.95 ? 91  VAL A CA  1 
ATOM   810  C C   . VAL A 1 103 ? 20.249 -23.617 5.908  1.00 30.21 ? 91  VAL A C   1 
ATOM   811  O O   . VAL A 1 103 ? 19.636 -23.255 6.918  1.00 28.88 ? 91  VAL A O   1 
ATOM   812  C CB  . VAL A 1 103 ? 21.764 -21.661 5.511  1.00 26.23 ? 91  VAL A CB  1 
ATOM   813  C CG1 . VAL A 1 103 ? 22.903 -22.462 6.157  1.00 26.72 ? 91  VAL A CG1 1 
ATOM   814  C CG2 . VAL A 1 103 ? 22.304 -20.704 4.463  1.00 28.59 ? 91  VAL A CG2 1 
ATOM   815  N N   . SER A 1 104 ? 20.529 -24.893 5.647  1.00 33.61 ? 92  SER A N   1 
ATOM   816  C CA  . SER A 1 104 ? 20.072 -25.980 6.512  1.00 33.58 ? 92  SER A CA  1 
ATOM   817  C C   . SER A 1 104 ? 21.066 -26.328 7.628  1.00 31.97 ? 92  SER A C   1 
ATOM   818  O O   . SER A 1 104 ? 20.784 -27.169 8.477  1.00 36.02 ? 92  SER A O   1 
ATOM   819  C CB  . SER A 1 104 ? 19.757 -27.227 5.676  1.00 37.59 ? 92  SER A CB  1 
ATOM   820  O OG  . SER A 1 104 ? 20.899 -27.651 4.948  1.00 40.55 ? 92  SER A OG  1 
ATOM   821  N N   . THR A 1 105 ? 22.224 -25.680 7.625  1.00 30.81 ? 93  THR A N   1 
ATOM   822  C CA  . THR A 1 105 ? 23.271 -25.950 8.612  1.00 27.63 ? 93  THR A CA  1 
ATOM   823  C C   . THR A 1 105 ? 22.822 -25.661 10.054 1.00 25.34 ? 93  THR A C   1 
ATOM   824  O O   . THR A 1 105 ? 22.214 -24.621 10.315 1.00 25.00 ? 93  THR A O   1 
ATOM   825  C CB  . THR A 1 105 ? 24.506 -25.090 8.309  1.00 31.10 ? 93  THR A CB  1 
ATOM   826  O OG1 . THR A 1 105 ? 24.904 -25.289 6.945  1.00 32.65 ? 93  THR A OG1 1 
ATOM   827  C CG2 . THR A 1 105 ? 25.649 -25.436 9.242  1.00 32.05 ? 93  THR A CG2 1 
ATOM   828  N N   . PRO A 1 106 ? 23.129 -26.579 10.994 1.00 24.20 ? 94  PRO A N   1 
ATOM   829  C CA  . PRO A 1 106 ? 22.903 -26.337 12.429 1.00 24.92 ? 94  PRO A CA  1 
ATOM   830  C C   . PRO A 1 106 ? 23.606 -25.066 12.913 1.00 24.49 ? 94  PRO A C   1 
ATOM   831  O O   . PRO A 1 106 ? 24.749 -24.814 12.514 1.00 25.94 ? 94  PRO A O   1 
ATOM   832  C CB  . PRO A 1 106 ? 23.569 -27.543 13.095 1.00 26.93 ? 94  PRO A CB  1 
ATOM   833  C CG  . PRO A 1 106 ? 23.515 -28.630 12.055 1.00 27.49 ? 94  PRO A CG  1 
ATOM   834  C CD  . PRO A 1 106 ? 23.633 -27.941 10.727 1.00 25.81 ? 94  PRO A CD  1 
ATOM   835  N N   . ILE A 1 107 ? 22.964 -24.289 13.776 1.00 20.68 ? 95  ILE A N   1 
ATOM   836  C CA  . ILE A 1 107 ? 23.580 -23.031 14.215 1.00 19.75 ? 95  ILE A CA  1 
ATOM   837  C C   . ILE A 1 107 ? 24.872 -23.278 15.018 1.00 22.59 ? 95  ILE A C   1 
ATOM   838  O O   . ILE A 1 107 ? 25.762 -22.423 15.043 1.00 24.87 ? 95  ILE A O   1 
ATOM   839  C CB  . ILE A 1 107 ? 22.584 -22.099 14.974 1.00 20.32 ? 95  ILE A CB  1 
ATOM   840  C CG1 . ILE A 1 107 ? 23.223 -20.741 15.267 1.00 20.31 ? 95  ILE A CG1 1 
ATOM   841  C CG2 . ILE A 1 107 ? 22.117 -22.714 16.270 1.00 18.00 ? 95  ILE A CG2 1 
ATOM   842  C CD1 . ILE A 1 107 ? 22.224 -19.691 15.750 1.00 19.70 ? 95  ILE A CD1 1 
ATOM   843  N N   . ALA A 1 108 ? 24.988 -24.449 15.644 1.00 22.28 ? 96  ALA A N   1 
ATOM   844  C CA  . ALA A 1 108 ? 26.216 -24.807 16.361 1.00 24.03 ? 96  ALA A CA  1 
ATOM   845  C C   . ALA A 1 108 ? 27.445 -24.728 15.455 1.00 25.88 ? 96  ALA A C   1 
ATOM   846  O O   . ALA A 1 108 ? 28.520 -24.278 15.874 1.00 25.25 ? 96  ALA A O   1 
ATOM   847  C CB  . ALA A 1 108 ? 26.102 -26.198 16.962 1.00 29.48 ? 96  ALA A CB  1 
ATOM   848  N N   . ASP A 1 109 ? 27.285 -25.175 14.211 1.00 28.36 ? 97  ASP A N   1 
ATOM   849  C CA  . ASP A 1 109 ? 28.383 -25.173 13.252 1.00 30.88 ? 97  ASP A CA  1 
ATOM   850  C C   . ASP A 1 109 ? 28.665 -23.778 12.702 1.00 28.39 ? 97  ASP A C   1 
ATOM   851  O O   . ASP A 1 109 ? 29.819 -23.394 12.529 1.00 30.52 ? 97  ASP A O   1 
ATOM   852  C CB  . ASP A 1 109 ? 28.096 -26.149 12.119 1.00 35.51 ? 97  ASP A CB  1 
ATOM   853  C CG  . ASP A 1 109 ? 27.983 -27.577 12.609 1.00 41.68 ? 97  ASP A CG  1 
ATOM   854  O OD1 . ASP A 1 109 ? 28.643 -27.913 13.620 1.00 44.31 ? 97  ASP A OD1 1 
ATOM   855  O OD2 . ASP A 1 109 ? 27.232 -28.358 11.987 1.00 43.52 ? 97  ASP A OD2 1 
ATOM   856  N N   . ILE A 1 110 ? 27.608 -23.021 12.429 1.00 23.30 ? 98  ILE A N   1 
ATOM   857  C CA  . ILE A 1 110 ? 27.770 -21.626 12.015 1.00 20.32 ? 98  ILE A CA  1 
ATOM   858  C C   . ILE A 1 110 ? 28.481 -20.812 13.109 1.00 23.09 ? 98  ILE A C   1 
ATOM   859  O O   . ILE A 1 110 ? 29.336 -19.972 12.817 1.00 26.21 ? 98  ILE A O   1 
ATOM   860  C CB  . ILE A 1 110 ? 26.409 -20.988 11.667 1.00 20.05 ? 98  ILE A CB  1 
ATOM   861  C CG1 . ILE A 1 110 ? 25.750 -21.752 10.508 1.00 24.38 ? 98  ILE A CG1 1 
ATOM   862  C CG2 . ILE A 1 110 ? 26.557 -19.504 11.338 1.00 19.53 ? 98  ILE A CG2 1 
ATOM   863  C CD1 . ILE A 1 110 ? 26.573 -21.782 9.238  1.00 25.30 ? 98  ILE A CD1 1 
ATOM   864  N N   . TYR A 1 111 ? 28.129 -21.073 14.367 1.00 21.25 ? 99  TYR A N   1 
ATOM   865  C CA  . TYR A 1 111 ? 28.754 -20.391 15.498 1.00 20.78 ? 99  TYR A CA  1 
ATOM   866  C C   . TYR A 1 111 ? 30.260 -20.610 15.486 1.00 21.03 ? 99  TYR A C   1 
ATOM   867  O O   . TYR A 1 111 ? 31.022 -19.652 15.591 1.00 18.57 ? 99  TYR A O   1 
ATOM   868  C CB  . TYR A 1 111 ? 28.170 -20.896 16.814 1.00 19.87 ? 99  TYR A CB  1 
ATOM   869  C CG  . TYR A 1 111 ? 28.665 -20.172 18.051 1.00 17.26 ? 99  TYR A CG  1 
ATOM   870  C CD1 . TYR A 1 111 ? 28.413 -18.818 18.242 1.00 17.19 ? 99  TYR A CD1 1 
ATOM   871  C CD2 . TYR A 1 111 ? 29.337 -20.857 19.048 1.00 18.83 ? 99  TYR A CD2 1 
ATOM   872  C CE1 . TYR A 1 111 ? 28.838 -18.171 19.390 1.00 17.21 ? 99  TYR A CE1 1 
ATOM   873  C CE2 . TYR A 1 111 ? 29.771 -20.223 20.191 1.00 17.86 ? 99  TYR A CE2 1 
ATOM   874  C CZ  . TYR A 1 111 ? 29.522 -18.878 20.358 1.00 20.15 ? 99  TYR A CZ  1 
ATOM   875  O OH  . TYR A 1 111 ? 29.964 -18.263 21.517 1.00 18.50 ? 99  TYR A OH  1 
ATOM   876  N N   . GLU A 1 112 ? 30.679 -21.871 15.363 1.00 22.25 ? 100 GLU A N   1 
ATOM   877  C CA  . GLU A 1 112 ? 32.100 -22.232 15.254 1.00 29.48 ? 100 GLU A CA  1 
ATOM   878  C C   . GLU A 1 112 ? 32.814 -21.415 14.189 1.00 26.62 ? 100 GLU A C   1 
ATOM   879  O O   . GLU A 1 112 ? 33.939 -20.949 14.384 1.00 28.53 ? 100 GLU A O   1 
ATOM   880  C CB  . GLU A 1 112 ? 32.245 -23.700 14.837 1.00 37.48 ? 100 GLU A CB  1 
ATOM   881  C CG  . GLU A 1 112 ? 32.149 -24.749 15.922 1.00 47.34 ? 100 GLU A CG  1 
ATOM   882  C CD  . GLU A 1 112 ? 32.359 -26.164 15.363 1.00 54.96 ? 100 GLU A CD  1 
ATOM   883  O OE1 . GLU A 1 112 ? 32.213 -26.361 14.131 1.00 54.95 ? 100 GLU A OE1 1 
ATOM   884  O OE2 . GLU A 1 112 ? 32.678 -27.080 16.153 1.00 59.39 ? 100 GLU A OE2 1 
ATOM   885  N N   . GLN A 1 113 ? 32.145 -21.256 13.051 1.00 21.80 ? 101 GLN A N   1 
ATOM   886  C CA  . GLN A 1 113 ? 32.769 -20.711 11.854 1.00 22.16 ? 101 GLN A CA  1 
ATOM   887  C C   . GLN A 1 113 ? 32.707 -19.199 11.810 1.00 22.10 ? 101 GLN A C   1 
ATOM   888  O O   . GLN A 1 113 ? 33.576 -18.563 11.229 1.00 22.97 ? 101 GLN A O   1 
ATOM   889  C CB  . GLN A 1 113 ? 32.084 -21.285 10.606 1.00 23.80 ? 101 GLN A CB  1 
ATOM   890  C CG  . GLN A 1 113 ? 32.222 -22.807 10.444 1.00 28.81 ? 101 GLN A CG  1 
ATOM   891  C CD  . GLN A 1 113 ? 31.161 -23.399 9.515  1.00 33.17 ? 101 GLN A CD  1 
ATOM   892  O OE1 . GLN A 1 113 ? 30.477 -22.674 8.792  1.00 34.16 ? 101 GLN A OE1 1 
ATOM   893  N NE2 . GLN A 1 113 ? 31.021 -24.723 9.537  1.00 34.96 ? 101 GLN A NE2 1 
ATOM   894  N N   . GLU A 1 114 ? 31.674 -18.621 12.418 1.00 19.04 ? 102 GLU A N   1 
ATOM   895  C CA  . GLU A 1 114 ? 31.367 -17.215 12.171 1.00 17.44 ? 102 GLU A CA  1 
ATOM   896  C C   . GLU A 1 114 ? 31.249 -16.324 13.410 1.00 17.38 ? 102 GLU A C   1 
ATOM   897  O O   . GLU A 1 114 ? 30.981 -15.125 13.285 1.00 16.64 ? 102 GLU A O   1 
ATOM   898  C CB  . GLU A 1 114 ? 30.077 -17.110 11.334 1.00 18.81 ? 102 GLU A CB  1 
ATOM   899  C CG  . GLU A 1 114 ? 30.126 -17.863 9.988  1.00 24.49 ? 102 GLU A CG  1 
ATOM   900  C CD  . GLU A 1 114 ? 31.166 -17.292 9.019  1.00 30.04 ? 102 GLU A CD  1 
ATOM   901  O OE1 . GLU A 1 114 ? 31.566 -16.114 9.186  1.00 27.99 ? 102 GLU A OE1 1 
ATOM   902  O OE2 . GLU A 1 114 ? 31.581 -18.023 8.087  1.00 34.01 ? 102 GLU A OE2 1 
ATOM   903  N N   . LYS A 1 115 ? 31.438 -16.879 14.603 1.00 17.53 ? 103 LYS A N   1 
ATOM   904  C CA  . LYS A 1 115 ? 31.299 -16.032 15.795 1.00 16.26 ? 103 LYS A CA  1 
ATOM   905  C C   . LYS A 1 115 ? 32.320 -14.905 15.829 1.00 16.28 ? 103 LYS A C   1 
ATOM   906  O O   . LYS A 1 115 ? 33.427 -15.006 15.293 1.00 17.96 ? 103 LYS A O   1 
ATOM   907  C CB  . LYS A 1 115 ? 31.367 -16.828 17.100 1.00 18.47 ? 103 LYS A CB  1 
ATOM   908  C CG  . LYS A 1 115 ? 32.696 -17.492 17.394 1.00 19.71 ? 103 LYS A CG  1 
ATOM   909  C CD  . LYS A 1 115 ? 32.646 -18.161 18.766 1.00 22.79 ? 103 LYS A CD  1 
ATOM   910  C CE  . LYS A 1 115 ? 33.728 -19.214 18.912 1.00 32.23 ? 103 LYS A CE  1 
ATOM   911  N NZ  . LYS A 1 115 ? 35.073 -18.596 18.840 1.00 35.84 ? 103 LYS A NZ  1 
ATOM   912  N N   . ASP A 1 116 ? 31.919 -13.828 16.477 1.00 14.71 ? 104 ASP A N   1 
ATOM   913  C CA  . ASP A 1 116 ? 32.754 -12.662 16.634 1.00 15.40 ? 104 ASP A CA  1 
ATOM   914  C C   . ASP A 1 116 ? 33.802 -12.920 17.710 1.00 18.50 ? 104 ASP A C   1 
ATOM   915  O O   . ASP A 1 116 ? 33.708 -13.901 18.467 1.00 15.99 ? 104 ASP A O   1 
ATOM   916  C CB  . ASP A 1 116 ? 31.867 -11.509 17.060 1.00 18.05 ? 104 ASP A CB  1 
ATOM   917  C CG  . ASP A 1 116 ? 32.593 -10.205 17.050 1.00 24.15 ? 104 ASP A CG  1 
ATOM   918  O OD1 . ASP A 1 116 ? 32.686 -9.620  15.953 1.00 27.88 ? 104 ASP A OD1 1 
ATOM   919  O OD2 . ASP A 1 116 ? 33.078 -9.788  18.132 1.00 25.64 ? 104 ASP A OD2 1 
ATOM   920  N N   . GLU A 1 117 ? 34.798 -12.038 17.790 1.00 15.21 ? 105 GLU A N   1 
ATOM   921  C CA  . GLU A 1 117 ? 35.832 -12.155 18.815 1.00 16.02 ? 105 GLU A CA  1 
ATOM   922  C C   . GLU A 1 117 ? 35.233 -12.126 20.223 1.00 17.29 ? 105 GLU A C   1 
ATOM   923  O O   . GLU A 1 117 ? 35.770 -12.744 21.156 1.00 17.13 ? 105 GLU A O   1 
ATOM   924  C CB  . GLU A 1 117 ? 36.874 -11.040 18.643 1.00 18.43 ? 105 GLU A CB  1 
ATOM   925  C CG  . GLU A 1 117 ? 37.945 -10.977 19.714 1.00 24.97 ? 105 GLU A CG  1 
ATOM   926  C CD  . GLU A 1 117 ? 38.880 -12.189 19.697 1.00 32.15 ? 105 GLU A CD  1 
ATOM   927  O OE1 . GLU A 1 117 ? 39.188 -12.696 18.589 1.00 29.92 ? 105 GLU A OE1 1 
ATOM   928  O OE2 . GLU A 1 117 ? 39.296 -12.635 20.793 1.00 32.82 ? 105 GLU A OE2 1 
ATOM   929  N N   . ASP A 1 118 ? 34.112 -11.433 20.389 1.00 15.01 ? 106 ASP A N   1 
ATOM   930  C CA  . ASP A 1 118 ? 33.525 -11.354 21.727 1.00 15.28 ? 106 ASP A CA  1 
ATOM   931  C C   . ASP A 1 118 ? 32.728 -12.605 22.087 1.00 15.77 ? 106 ASP A C   1 
ATOM   932  O O   . ASP A 1 118 ? 32.302 -12.775 23.230 1.00 16.85 ? 106 ASP A O   1 
ATOM   933  C CB  . ASP A 1 118 ? 32.673 -10.096 21.919 1.00 14.39 ? 106 ASP A CB  1 
ATOM   934  C CG  . ASP A 1 118 ? 31.442 -10.049 21.002 1.00 16.33 ? 106 ASP A CG  1 
ATOM   935  O OD1 . ASP A 1 118 ? 31.149 -11.038 20.294 1.00 14.05 ? 106 ASP A OD1 1 
ATOM   936  O OD2 . ASP A 1 118 ? 30.773 -8.991  20.971 1.00 13.63 ? 106 ASP A OD2 1 
ATOM   937  N N   . GLY A 1 119 ? 32.529 -13.478 21.112 1.00 15.26 ? 107 GLY A N   1 
ATOM   938  C CA  . GLY A 1 119 ? 31.800 -14.715 21.359 1.00 15.59 ? 107 GLY A CA  1 
ATOM   939  C C   . GLY A 1 119 ? 30.319 -14.687 20.993 1.00 15.62 ? 107 GLY A C   1 
ATOM   940  O O   . GLY A 1 119 ? 29.632 -15.715 21.089 1.00 15.46 ? 107 GLY A O   1 
ATOM   941  N N   . PHE A 1 120 ? 29.802 -13.528 20.595 1.00 15.97 ? 108 PHE A N   1 
ATOM   942  C CA  . PHE A 1 120 ? 28.438 -13.481 20.069 1.00 13.94 ? 108 PHE A CA  1 
ATOM   943  C C   . PHE A 1 120 ? 28.477 -13.871 18.597 1.00 14.43 ? 108 PHE A C   1 
ATOM   944  O O   . PHE A 1 120 ? 29.481 -13.654 17.914 1.00 13.98 ? 108 PHE A O   1 
ATOM   945  C CB  . PHE A 1 120 ? 27.828 -12.068 20.148 1.00 13.31 ? 108 PHE A CB  1 
ATOM   946  C CG  . PHE A 1 120 ? 27.239 -11.703 21.495 1.00 13.58 ? 108 PHE A CG  1 
ATOM   947  C CD1 . PHE A 1 120 ? 26.004 -12.213 21.898 1.00 15.27 ? 108 PHE A CD1 1 
ATOM   948  C CD2 . PHE A 1 120 ? 27.893 -10.800 22.331 1.00 14.69 ? 108 PHE A CD2 1 
ATOM   949  C CE1 . PHE A 1 120 ? 25.451 -11.851 23.121 1.00 14.73 ? 108 PHE A CE1 1 
ATOM   950  C CE2 . PHE A 1 120 ? 27.346 -10.429 23.551 1.00 15.51 ? 108 PHE A CE2 1 
ATOM   951  C CZ  . PHE A 1 120 ? 26.117 -10.963 23.948 1.00 14.57 ? 108 PHE A CZ  1 
ATOM   952  N N   . LEU A 1 121 ? 27.373 -14.424 18.105 1.00 13.83 ? 109 LEU A N   1 
ATOM   953  C CA  . LEU A 1 121 ? 27.143 -14.540 16.664 1.00 13.71 ? 109 LEU A CA  1 
ATOM   954  C C   . LEU A 1 121 ? 26.250 -13.371 16.232 1.00 13.21 ? 109 LEU A C   1 
ATOM   955  O O   . LEU A 1 121 ? 25.121 -13.243 16.707 1.00 15.27 ? 109 LEU A O   1 
ATOM   956  C CB  . LEU A 1 121 ? 26.449 -15.878 16.340 1.00 14.18 ? 109 LEU A CB  1 
ATOM   957  C CG  . LEU A 1 121 ? 26.148 -16.151 14.861 1.00 14.82 ? 109 LEU A CG  1 
ATOM   958  C CD1 . LEU A 1 121 ? 27.429 -16.115 14.040 1.00 14.47 ? 109 LEU A CD1 1 
ATOM   959  C CD2 . LEU A 1 121 ? 25.473 -17.503 14.703 1.00 16.43 ? 109 LEU A CD2 1 
ATOM   960  N N   . TYR A 1 122 ? 26.766 -12.519 15.343 1.00 12.80 ? 110 TYR A N   1 
ATOM   961  C CA  . TYR A 1 122 ? 26.054 -11.321 14.880 1.00 12.28 ? 110 TYR A CA  1 
ATOM   962  C C   . TYR A 1 122 ? 25.308 -11.543 13.581 1.00 14.08 ? 110 TYR A C   1 
ATOM   963  O O   . TYR A 1 122 ? 25.870 -12.058 12.614 1.00 15.72 ? 110 TYR A O   1 
ATOM   964  C CB  . TYR A 1 122 ? 27.070 -10.186 14.673 1.00 12.17 ? 110 TYR A CB  1 
ATOM   965  C CG  . TYR A 1 122 ? 27.538 -9.623  15.976 1.00 12.14 ? 110 TYR A CG  1 
ATOM   966  C CD1 . TYR A 1 122 ? 28.575 -10.228 16.698 1.00 12.55 ? 110 TYR A CD1 1 
ATOM   967  C CD2 . TYR A 1 122 ? 26.937 -8.493  16.508 1.00 13.25 ? 110 TYR A CD2 1 
ATOM   968  C CE1 . TYR A 1 122 ? 28.973 -9.715  17.920 1.00 13.68 ? 110 TYR A CE1 1 
ATOM   969  C CE2 . TYR A 1 122 ? 27.338 -7.973  17.731 1.00 12.76 ? 110 TYR A CE2 1 
ATOM   970  C CZ  . TYR A 1 122 ? 28.341 -8.586  18.433 1.00 15.00 ? 110 TYR A CZ  1 
ATOM   971  O OH  . TYR A 1 122 ? 28.730 -8.053  19.644 1.00 12.42 ? 110 TYR A OH  1 
ATOM   972  N N   . MET A 1 123 ? 24.045 -11.123 13.551 1.00 14.48 ? 111 MET A N   1 
ATOM   973  C CA  . MET A 1 123 ? 23.236 -11.224 12.348 1.00 14.43 ? 111 MET A CA  1 
ATOM   974  C C   . MET A 1 123 ? 22.582 -9.886  12.080 1.00 14.33 ? 111 MET A C   1 
ATOM   975  O O   . MET A 1 123 ? 22.312 -9.121  13.001 1.00 13.15 ? 111 MET A O   1 
ATOM   976  C CB  . MET A 1 123 ? 22.152 -12.279 12.536 1.00 14.54 ? 111 MET A CB  1 
ATOM   977  C CG  . MET A 1 123 ? 22.711 -13.593 13.018 1.00 17.30 ? 111 MET A CG  1 
ATOM   978  S SD  . MET A 1 123 ? 21.404 -14.800 13.207 1.00 21.99 ? 111 MET A SD  1 
ATOM   979  C CE  . MET A 1 123 ? 22.400 -16.225 13.595 1.00 28.85 ? 111 MET A CE  1 
ATOM   980  N N   . VAL A 1 124 ? 22.304 -9.637  10.810 1.00 13.68 ? 112 VAL A N   1 
ATOM   981  C CA  . VAL A 1 124 ? 21.717 -8.390  10.365 1.00 17.57 ? 112 VAL A CA  1 
ATOM   982  C C   . VAL A 1 124 ? 20.559 -8.737  9.418  1.00 14.68 ? 112 VAL A C   1 
ATOM   983  O O   . VAL A 1 124 ? 20.672 -9.685  8.633  1.00 15.16 ? 112 VAL A O   1 
ATOM   984  C CB  . VAL A 1 124 ? 22.828 -7.569  9.663  1.00 24.26 ? 112 VAL A CB  1 
ATOM   985  C CG1 . VAL A 1 124 ? 22.270 -6.597  8.694  1.00 31.50 ? 112 VAL A CG1 1 
ATOM   986  C CG2 . VAL A 1 124 ? 23.688 -6.862  10.703 1.00 25.96 ? 112 VAL A CG2 1 
ATOM   987  N N   . TYR A 1 125 ? 19.436 -8.015  9.501  1.00 13.22 ? 113 TYR A N   1 
ATOM   988  C CA  . TYR A 1 125 ? 18.358 -8.250  8.532  1.00 14.12 ? 113 TYR A CA  1 
ATOM   989  C C   . TYR A 1 125 ? 18.071 -7.048  7.638  1.00 13.57 ? 113 TYR A C   1 
ATOM   990  O O   . TYR A 1 125 ? 18.256 -5.904  8.051  1.00 16.99 ? 113 TYR A O   1 
ATOM   991  C CB  . TYR A 1 125 ? 17.086 -8.776  9.199  1.00 16.12 ? 113 TYR A CB  1 
ATOM   992  C CG  . TYR A 1 125 ? 16.437 -7.852  10.216 1.00 15.80 ? 113 TYR A CG  1 
ATOM   993  C CD1 . TYR A 1 125 ? 15.539 -6.857  9.816  1.00 15.37 ? 113 TYR A CD1 1 
ATOM   994  C CD2 . TYR A 1 125 ? 16.663 -8.021  11.575 1.00 13.12 ? 113 TYR A CD2 1 
ATOM   995  C CE1 . TYR A 1 125 ? 14.925 -6.030  10.752 1.00 14.81 ? 113 TYR A CE1 1 
ATOM   996  C CE2 . TYR A 1 125 ? 16.042 -7.195  12.520 1.00 16.50 ? 113 TYR A CE2 1 
ATOM   997  C CZ  . TYR A 1 125 ? 15.185 -6.207  12.096 1.00 14.64 ? 113 TYR A CZ  1 
ATOM   998  O OH  . TYR A 1 125 ? 14.578 -5.403  13.033 1.00 18.82 ? 113 TYR A OH  1 
ATOM   999  N N   . ALA A 1 126 ? 17.621 -7.330  6.413  1.00 15.51 ? 114 ALA A N   1 
ATOM   1000 C CA  . ALA A 1 126 ? 17.386 -6.307  5.395  1.00 13.80 ? 114 ALA A CA  1 
ATOM   1001 C C   . ALA A 1 126 ? 16.433 -6.844  4.335  1.00 15.43 ? 114 ALA A C   1 
ATOM   1002 O O   . ALA A 1 126 ? 16.102 -8.028  4.333  1.00 17.23 ? 114 ALA A O   1 
ATOM   1003 C CB  . ALA A 1 126 ? 18.691 -5.906  4.741  1.00 16.13 ? 114 ALA A CB  1 
ATOM   1004 N N   . SER A 1 127 ? 16.002 -5.972  3.430  1.00 17.87 ? 115 SER A N   1 
ATOM   1005 C CA  . SER A 1 127 ? 15.083 -6.372  2.368  1.00 19.89 ? 115 SER A CA  1 
ATOM   1006 C C   . SER A 1 127 ? 15.744 -7.157  1.227  1.00 24.91 ? 115 SER A C   1 
ATOM   1007 O O   . SER A 1 127 ? 15.048 -7.798  0.440  1.00 23.55 ? 115 SER A O   1 
ATOM   1008 C CB  . SER A 1 127 ? 14.352 -5.151  1.808  1.00 20.09 ? 115 SER A CB  1 
ATOM   1009 O OG  . SER A 1 127 ? 13.464 -4.615  2.768  1.00 21.34 ? 115 SER A OG  1 
ATOM   1010 N N   . GLN A 1 128 ? 17.076 -7.107  1.123  1.00 26.08 ? 116 GLN A N   1 
ATOM   1011 C CA  . GLN A 1 128 ? 17.803 -7.905  0.119  1.00 32.43 ? 116 GLN A CA  1 
ATOM   1012 C C   . GLN A 1 128 ? 19.105 -8.439  0.684  1.00 30.55 ? 116 GLN A C   1 
ATOM   1013 O O   . GLN A 1 128 ? 19.601 -7.918  1.680  1.00 28.13 ? 116 GLN A O   1 
ATOM   1014 C CB  . GLN A 1 128 ? 18.136 -7.100  -1.142 1.00 38.18 ? 116 GLN A CB  1 
ATOM   1015 C CG  . GLN A 1 128 ? 17.360 -5.822  -1.321 1.00 44.87 ? 116 GLN A CG  1 
ATOM   1016 C CD  . GLN A 1 128 ? 17.807 -4.748  -0.369 1.00 45.65 ? 116 GLN A CD  1 
ATOM   1017 O OE1 . GLN A 1 128 ? 18.791 -4.911  0.363  1.00 46.41 ? 116 GLN A OE1 1 
ATOM   1018 N NE2 . GLN A 1 128 ? 17.078 -3.646  -0.351 1.00 48.32 ? 116 GLN A NE2 1 
ATOM   1019 N N   . GLU A 1 129 ? 19.650 -9.476  0.046  1.00 31.30 ? 117 GLU A N   1 
ATOM   1020 C CA  . GLU A 1 129 ? 20.979 -9.973  0.391  1.00 31.82 ? 117 GLU A CA  1 
ATOM   1021 C C   . GLU A 1 129 ? 21.979 -9.062  -0.285 1.00 39.21 ? 117 GLU A C   1 
ATOM   1022 O O   . GLU A 1 129 ? 22.859 -8.490  0.358  1.00 39.50 ? 117 GLU A O   1 
ATOM   1023 C CB  . GLU A 1 129 ? 21.179 -11.413 -0.088 1.00 31.54 ? 117 GLU A CB  1 
ATOM   1024 C CG  . GLU A 1 129 ? 22.582 -11.961 0.180  1.00 35.47 ? 117 GLU A CG  1 
ATOM   1025 C CD  . GLU A 1 129 ? 22.794 -13.361 -0.393 1.00 38.99 ? 117 GLU A CD  1 
ATOM   1026 O OE1 . GLU A 1 129 ? 22.246 -13.646 -1.485 1.00 42.38 ? 117 GLU A OE1 1 
ATOM   1027 O OE2 . GLU A 1 129 ? 23.501 -14.179 0.250  1.00 35.45 ? 117 GLU A OE2 1 
ATOM   1028 N N   . THR A 1 130 ? 21.814 -8.935  -1.601 1.00 44.43 ? 118 THR A N   1 
ATOM   1029 C CA  . THR A 1 130 ? 22.551 -7.973  -2.420 1.00 48.43 ? 118 THR A CA  1 
ATOM   1030 C C   . THR A 1 130 ? 21.558 -7.141  -3.244 1.00 49.52 ? 118 THR A C   1 
ATOM   1031 O O   . THR A 1 130 ? 20.575 -7.676  -3.773 1.00 41.77 ? 118 THR A O   1 
ATOM   1032 C CB  . THR A 1 130 ? 23.539 -8.676  -3.388 1.00 48.92 ? 118 THR A CB  1 
ATOM   1033 O OG1 . THR A 1 130 ? 22.812 -9.444  -4.358 1.00 47.76 ? 118 THR A OG1 1 
ATOM   1034 C CG2 . THR A 1 130 ? 24.488 -9.594  -2.625 1.00 47.75 ? 118 THR A CG2 1 
ATOM   1035 N N   . PHE A 1 131 ? 21.807 -5.836  -3.349 1.00 54.42 ? 119 PHE A N   1 
ATOM   1036 C CA  . PHE A 1 131 ? 20.948 -4.965  -4.153 1.00 58.26 ? 119 PHE A CA  1 
ATOM   1037 C C   . PHE A 1 131 ? 21.040 -5.333  -5.640 1.00 60.46 ? 119 PHE A C   1 
ATOM   1038 O O   . PHE A 1 131 ? 20.230 -4.894  -6.465 1.00 61.27 ? 119 PHE A O   1 
ATOM   1039 C CB  . PHE A 1 131 ? 21.319 -3.491  -3.955 1.00 59.00 ? 119 PHE A CB  1 
ATOM   1040 C CG  . PHE A 1 131 ? 21.144 -2.987  -2.540 1.00 58.79 ? 119 PHE A CG  1 
ATOM   1041 C CD1 . PHE A 1 131 ? 19.975 -2.337  -2.159 1.00 59.47 ? 119 PHE A CD1 1 
ATOM   1042 C CD2 . PHE A 1 131 ? 22.162 -3.132  -1.603 1.00 58.53 ? 119 PHE A CD2 1 
ATOM   1043 C CE1 . PHE A 1 131 ? 19.819 -1.853  -0.863 1.00 59.22 ? 119 PHE A CE1 1 
ATOM   1044 C CE2 . PHE A 1 131 ? 22.012 -2.655  -0.306 1.00 58.81 ? 119 PHE A CE2 1 
ATOM   1045 C CZ  . PHE A 1 131 ? 20.840 -2.013  0.064  1.00 58.55 ? 119 PHE A CZ  1 
HETATM 1046 O O   . HOH B 2 .   ? 15.951 -1.845  0.002  1.00 36.91 ? 201 HOH A O   1 
HETATM 1047 O O   . HOH B 2 .   ? 20.793 -2.815  18.077 1.00 40.04 ? 202 HOH A O   1 
HETATM 1048 O O   . HOH B 2 .   ? 16.304 -25.981 6.437  1.00 44.44 ? 203 HOH A O   1 
HETATM 1049 O O   . HOH B 2 .   ? 34.050 -7.718  18.631 1.00 25.26 ? 204 HOH A O   1 
HETATM 1050 O O   . HOH B 2 .   ? 22.336 -25.713 27.715 1.00 36.56 ? 205 HOH A O   1 
HETATM 1051 O O   . HOH B 2 .   ? 17.408 -25.372 2.513  1.00 42.89 ? 206 HOH A O   1 
HETATM 1052 O O   . HOH B 2 .   ? 26.322 -23.556 5.880  1.00 32.12 ? 207 HOH A O   1 
HETATM 1053 O O   . HOH B 2 .   ? 10.418 -21.573 12.737 1.00 34.50 ? 208 HOH A O   1 
HETATM 1054 O O   . HOH B 2 .   ? 17.986 -2.479  2.785  1.00 36.47 ? 209 HOH A O   1 
HETATM 1055 O O   . HOH B 2 .   ? 30.356 -20.197 7.540  1.00 32.84 ? 210 HOH A O   1 
HETATM 1056 O O   . HOH B 2 .   ? 13.988 -19.423 6.227  1.00 26.85 ? 211 HOH A O   1 
HETATM 1057 O O   . HOH B 2 .   ? 34.015 -18.813 7.765  1.00 45.33 ? 212 HOH A O   1 
HETATM 1058 O O   . HOH B 2 .   ? 25.056 -8.940  1.719  1.00 42.42 ? 213 HOH A O   1 
HETATM 1059 O O   . HOH B 2 .   ? 32.278 -18.891 22.611 1.00 23.22 ? 214 HOH A O   1 
HETATM 1060 O O   . HOH B 2 .   ? 14.045 21.329  12.312 1.00 29.14 ? 215 HOH A O   1 
HETATM 1061 O O   . HOH B 2 .   ? 24.106 -18.185 1.973  1.00 24.77 ? 216 HOH A O   1 
HETATM 1062 O O   . HOH B 2 .   ? 20.759 -28.278 21.747 1.00 40.85 ? 217 HOH A O   1 
HETATM 1063 O O   . HOH B 2 .   ? 28.034 -12.005 11.079 1.00 30.75 ? 218 HOH A O   1 
HETATM 1064 O O   . HOH B 2 .   ? 17.666 -5.655  17.521 1.00 27.41 ? 219 HOH A O   1 
HETATM 1065 O O   . HOH B 2 .   ? 29.500 -1.385  28.377 1.00 27.31 ? 220 HOH A O   1 
HETATM 1066 O O   . HOH B 2 .   ? 32.553 -10.960 4.715  1.00 51.87 ? 221 HOH A O   1 
HETATM 1067 O O   . HOH B 2 .   ? 39.921 -15.229 20.641 1.00 20.23 ? 222 HOH A O   1 
HETATM 1068 O O   . HOH B 2 .   ? 14.419 -8.033  -2.153 1.00 22.91 ? 223 HOH A O   1 
HETATM 1069 O O   . HOH B 2 .   ? 31.827 -19.526 29.283 1.00 23.56 ? 224 HOH A O   1 
HETATM 1070 O O   . HOH B 2 .   ? 24.379 -7.464  14.211 1.00 19.34 ? 225 HOH A O   1 
HETATM 1071 O O   . HOH B 2 .   ? 18.543 -16.422 0.359  1.00 31.49 ? 226 HOH A O   1 
HETATM 1072 O O   . HOH B 2 .   ? 1.282  -10.130 1.908  1.00 38.73 ? 227 HOH A O   1 
HETATM 1073 O O   . HOH B 2 .   ? 34.924 -16.870 14.056 1.00 37.86 ? 228 HOH A O   1 
HETATM 1074 O O   . HOH B 2 .   ? 11.026 -5.754  2.843  1.00 18.39 ? 229 HOH A O   1 
HETATM 1075 O O   . HOH B 2 .   ? 17.718 15.393  10.192 1.00 35.50 ? 230 HOH A O   1 
HETATM 1076 O O   . HOH B 2 .   ? 20.659 8.648   21.280 1.00 47.14 ? 231 HOH A O   1 
HETATM 1077 O O   . HOH B 2 .   ? 25.080 -16.386 0.107  1.00 29.47 ? 232 HOH A O   1 
HETATM 1078 O O   . HOH B 2 .   ? 20.975 -1.800  15.533 1.00 51.02 ? 233 HOH A O   1 
HETATM 1079 O O   . HOH B 2 .   ? 31.048 -16.487 5.894  1.00 31.49 ? 234 HOH A O   1 
HETATM 1080 O O   . HOH B 2 .   ? 23.278 -30.002 18.894 1.00 42.01 ? 235 HOH A O   1 
HETATM 1081 O O   . HOH B 2 .   ? 9.069  -5.074  15.795 1.00 42.56 ? 236 HOH A O   1 
HETATM 1082 O O   . HOH B 2 .   ? 33.718 -14.349 24.975 1.00 20.84 ? 237 HOH A O   1 
HETATM 1083 O O   . HOH B 2 .   ? 35.316 -17.378 30.862 1.00 28.54 ? 238 HOH A O   1 
HETATM 1084 O O   . HOH B 2 .   ? 29.235 -24.608 18.512 1.00 32.92 ? 239 HOH A O   1 
HETATM 1085 O O   . HOH B 2 .   ? 17.915 -7.206  23.932 1.00 27.07 ? 240 HOH A O   1 
HETATM 1086 O O   . HOH B 2 .   ? 18.369 0.539   10.438 1.00 40.26 ? 241 HOH A O   1 
HETATM 1087 O O   . HOH B 2 .   ? 28.279 -16.602 6.423  1.00 25.72 ? 242 HOH A O   1 
HETATM 1088 O O   . HOH B 2 .   ? 5.438  -5.813  10.974 1.00 31.23 ? 243 HOH A O   1 
HETATM 1089 O O   . HOH B 2 .   ? 8.852  -4.505  3.955  1.00 23.64 ? 244 HOH A O   1 
HETATM 1090 O O   . HOH B 2 .   ? 19.970 -19.029 1.968  1.00 29.17 ? 245 HOH A O   1 
HETATM 1091 O O   . HOH B 2 .   ? 35.377 -10.241 15.608 1.00 34.72 ? 246 HOH A O   1 
HETATM 1092 O O   . HOH B 2 .   ? 24.156 -2.706  9.671  1.00 32.21 ? 247 HOH A O   1 
HETATM 1093 O O   . HOH B 2 .   ? 29.472 -12.924 14.110 1.00 17.32 ? 248 HOH A O   1 
HETATM 1094 O O   . HOH B 2 .   ? 41.599 -13.324 17.299 1.00 34.58 ? 249 HOH A O   1 
HETATM 1095 O O   . HOH B 2 .   ? 31.077 -10.847 14.004 1.00 26.47 ? 250 HOH A O   1 
HETATM 1096 O O   . HOH B 2 .   ? 24.871 -19.953 25.803 1.00 27.89 ? 251 HOH A O   1 
HETATM 1097 O O   . HOH B 2 .   ? 3.790  -6.146  8.619  1.00 35.27 ? 252 HOH A O   1 
HETATM 1098 O O   . HOH B 2 .   ? 27.343 5.176   15.154 1.00 43.20 ? 253 HOH A O   1 
HETATM 1099 O O   . HOH B 2 .   ? 26.676 -4.595  16.606 1.00 16.37 ? 254 HOH A O   1 
HETATM 1100 O O   . HOH B 2 .   ? 15.748 -26.287 12.866 1.00 32.64 ? 255 HOH A O   1 
HETATM 1101 O O   . HOH B 2 .   ? 28.538 -7.423  30.861 1.00 33.72 ? 256 HOH A O   1 
HETATM 1102 O O   . HOH B 2 .   ? -0.447 -5.375  7.311  1.00 52.04 ? 257 HOH A O   1 
HETATM 1103 O O   . HOH B 2 .   ? 12.397 -12.544 1.195  1.00 26.46 ? 258 HOH A O   1 
HETATM 1104 O O   . HOH B 2 .   ? 1.376  -7.994  9.938  1.00 50.63 ? 259 HOH A O   1 
HETATM 1105 O O   . HOH B 2 .   ? 25.844 -9.678  7.725  1.00 22.73 ? 260 HOH A O   1 
HETATM 1106 O O   . HOH B 2 .   ? 34.253 -13.468 31.874 1.00 36.69 ? 261 HOH A O   1 
HETATM 1107 O O   . HOH B 2 .   ? 31.397 -13.696 10.766 1.00 45.99 ? 262 HOH A O   1 
HETATM 1108 O O   . HOH B 2 .   ? 37.236 -20.482 19.213 1.00 39.43 ? 263 HOH A O   1 
HETATM 1109 O O   . HOH B 2 .   ? 37.868 -15.773 28.693 1.00 27.15 ? 264 HOH A O   1 
HETATM 1110 O O   . HOH B 2 .   ? 25.161 -13.062 30.586 1.00 30.16 ? 265 HOH A O   1 
HETATM 1111 O O   . HOH B 2 .   ? 24.391 -3.412  13.309 1.00 33.16 ? 266 HOH A O   1 
HETATM 1112 O O   . HOH B 2 .   ? 15.863 23.248  6.608  1.00 48.01 ? 267 HOH A O   1 
HETATM 1113 O O   . HOH B 2 .   ? 2.766  -5.967  3.556  1.00 38.93 ? 268 HOH A O   1 
HETATM 1114 O O   . HOH B 2 .   ? 4.080  -6.110  1.462  1.00 40.92 ? 269 HOH A O   1 
HETATM 1115 O O   . HOH B 2 .   ? 10.221 0.065   13.842 1.00 29.93 ? 270 HOH A O   1 
HETATM 1116 O O   . HOH B 2 .   ? 12.367 -14.739 4.383  1.00 29.77 ? 271 HOH A O   1 
HETATM 1117 O O   . HOH B 2 .   ? 21.856 -6.102  2.175  1.00 43.39 ? 272 HOH A O   1 
HETATM 1118 O O   . HOH B 2 .   ? 18.281 -2.741  14.985 1.00 40.53 ? 273 HOH A O   1 
HETATM 1119 O O   . HOH B 2 .   ? 31.085 -0.000  23.101 1.00 17.09 ? 274 HOH A O   1 
HETATM 1120 O O   . HOH B 2 .   ? 22.223 -25.259 3.225  1.00 42.10 ? 275 HOH A O   1 
HETATM 1121 O O   . HOH B 2 .   ? 15.361 0.684   2.914  1.00 28.96 ? 276 HOH A O   1 
HETATM 1122 O O   . HOH B 2 .   ? 34.372 -5.079  19.091 1.00 23.12 ? 277 HOH A O   1 
HETATM 1123 O O   . HOH B 2 .   ? 8.344  -17.207 9.112  1.00 24.19 ? 278 HOH A O   1 
HETATM 1124 O O   . HOH B 2 .   ? 10.436 -13.394 2.913  1.00 28.49 ? 279 HOH A O   1 
HETATM 1125 O O   . HOH B 2 .   ? 35.156 -15.704 21.245 1.00 32.71 ? 280 HOH A O   1 
HETATM 1126 O O   . HOH B 2 .   ? 36.259 -2.728  26.176 1.00 19.26 ? 281 HOH A O   1 
HETATM 1127 O O   . HOH B 2 .   ? 5.997  -5.997  0.000  1.00 20.46 ? 282 HOH A O   1 
HETATM 1128 O O   . HOH B 2 .   ? 7.091  -5.481  14.179 1.00 32.26 ? 283 HOH A O   1 
HETATM 1129 O O   . HOH B 2 .   ? 26.291 -10.176 10.249 1.00 40.63 ? 284 HOH A O   1 
HETATM 1130 O O   . HOH B 2 .   ? 6.683  -4.068  8.441  1.00 41.12 ? 285 HOH A O   1 
HETATM 1131 O O   . HOH B 2 .   ? 16.507 -4.157  15.445 1.00 31.39 ? 286 HOH A O   1 
HETATM 1132 O O   . HOH B 2 .   ? 10.920 1.643   11.405 1.00 47.46 ? 287 HOH A O   1 
HETATM 1133 O O   . HOH B 2 .   ? 37.502 -12.132 27.731 1.00 25.40 ? 288 HOH A O   1 
HETATM 1134 O O   . HOH B 2 .   ? 23.973 -29.176 16.599 1.00 40.70 ? 289 HOH A O   1 
HETATM 1135 O O   . HOH B 2 .   ? 19.136 -10.635 -2.807 1.00 41.26 ? 290 HOH A O   1 
HETATM 1136 O O   . HOH B 2 .   ? 36.129 -15.775 17.748 1.00 33.47 ? 291 HOH A O   1 
HETATM 1137 O O   . HOH B 2 .   ? 12.615 3.931   9.254  1.00 49.28 ? 292 HOH A O   1 
HETATM 1138 O O   . HOH B 2 .   ? 9.691  1.040   9.004  1.00 42.78 ? 293 HOH A O   1 
HETATM 1139 O O   . HOH B 2 .   ? 0.754  -10.168 12.609 1.00 29.61 ? 294 HOH A O   1 
HETATM 1140 O O   . HOH B 2 .   ? 11.306 17.172  6.648  1.00 43.70 ? 295 HOH A O   1 
HETATM 1141 O O   . HOH B 2 .   ? 37.468 -16.631 19.970 1.00 29.50 ? 296 HOH A O   1 
HETATM 1142 O O   . HOH B 2 .   ? 0.991  -7.563  18.078 1.00 45.98 ? 297 HOH A O   1 
HETATM 1143 O O   . HOH B 2 .   ? 29.991 -1.089  15.396 1.00 29.58 ? 298 HOH A O   1 
HETATM 1144 O O   . HOH B 2 .   ? 25.360 -7.343  6.428  1.00 32.51 ? 299 HOH A O   1 
HETATM 1145 O O   . HOH B 2 .   ? 1.773  -11.494 10.429 1.00 37.55 ? 300 HOH A O   1 
HETATM 1146 O O   . HOH B 2 .   ? 36.377 -17.727 27.331 1.00 24.35 ? 301 HOH A O   1 
HETATM 1147 O O   . HOH B 2 .   ? 6.909  -3.365  2.557  1.00 35.02 ? 302 HOH A O   1 
HETATM 1148 O O   . HOH B 2 .   ? 23.484 3.596   24.504 1.00 34.61 ? 303 HOH A O   1 
HETATM 1149 O O   . HOH B 2 .   ? 21.227 -4.688  26.435 1.00 48.59 ? 304 HOH A O   1 
HETATM 1150 O O   . HOH B 2 .   ? 41.257 -16.056 18.254 1.00 34.04 ? 305 HOH A O   1 
HETATM 1151 O O   . HOH B 2 .   ? 31.114 -18.900 37.410 1.00 38.71 ? 306 HOH A O   1 
HETATM 1152 O O   . HOH B 2 .   ? 26.591 -7.037  12.580 1.00 32.33 ? 307 HOH A O   1 
HETATM 1153 O O   . HOH B 2 .   ? 12.175 -17.348 5.784  1.00 32.06 ? 308 HOH A O   1 
HETATM 1154 O O   . HOH B 2 .   ? 9.533  -17.679 6.422  1.00 34.50 ? 309 HOH A O   1 
HETATM 1155 O O   . HOH B 2 .   ? 33.920 -16.951 23.423 1.00 39.41 ? 310 HOH A O   1 
HETATM 1156 O O   . HOH B 2 .   ? 25.964 -19.605 3.155  1.00 36.73 ? 311 HOH A O   1 
HETATM 1157 O O   . HOH B 2 .   ? 15.773 -15.773 0.000  1.00 32.80 ? 312 HOH A O   1 
HETATM 1158 O O   . HOH B 2 .   ? 23.253 -20.319 0.077  1.00 32.49 ? 313 HOH A O   1 
HETATM 1159 O O   . HOH B 2 .   ? 26.021 -4.712  8.485  1.00 29.18 ? 314 HOH A O   1 
HETATM 1160 O O   . HOH B 2 .   ? 7.491  2.598   8.267  1.00 43.45 ? 315 HOH A O   1 
HETATM 1161 O O   . HOH B 2 .   ? 26.975 -5.041  10.817 1.00 34.91 ? 316 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 6   ? 0.6824 0.4967 0.7789 0.1190  -0.0555 0.0611  -6  ASP A N   
2    C CA  . ASP A 6   ? 0.7187 0.5452 0.8143 0.1083  -0.0486 0.0531  -6  ASP A CA  
3    C C   . ASP A 6   ? 0.6434 0.5006 0.7285 0.1074  -0.0424 0.0496  -6  ASP A C   
4    O O   . ASP A 6   ? 0.6784 0.5505 0.7618 0.1174  -0.0443 0.0425  -6  ASP A O   
5    C CB  . ASP A 6   ? 0.8221 0.6420 0.9288 0.1114  -0.0519 0.0354  -6  ASP A CB  
6    C CG  . ASP A 6   ? 0.9269 0.7170 1.0446 0.1066  -0.0563 0.0380  -6  ASP A CG  
7    O OD1 . ASP A 6   ? 0.9660 0.7460 1.0825 0.0954  -0.0534 0.0525  -6  ASP A OD1 
8    O OD2 . ASP A 6   ? 0.9576 0.7348 1.0853 0.1137  -0.0625 0.0253  -6  ASP A OD2 
9    N N   . ASP A 7   ? 0.5644 0.4310 0.6432 0.0954  -0.0351 0.0545  -5  ASP A N   
10   C CA  . ASP A 7   ? 0.5194 0.4125 0.5886 0.0933  -0.0294 0.0514  -5  ASP A CA  
11   C C   . ASP A 7   ? 0.4553 0.3608 0.5283 0.0930  -0.0277 0.0351  -5  ASP A C   
12   O O   . ASP A 7   ? 0.4611 0.3551 0.5427 0.0909  -0.0293 0.0278  -5  ASP A O   
13   C CB  . ASP A 7   ? 0.5604 0.4584 0.6216 0.0813  -0.0224 0.0626  -5  ASP A CB  
14   C CG  . ASP A 7   ? 0.6632 0.5484 0.7200 0.0797  -0.0233 0.0800  -5  ASP A CG  
15   O OD1 . ASP A 7   ? 0.6617 0.5429 0.7167 0.0888  -0.0287 0.0849  -5  ASP A OD1 
16   O OD2 . ASP A 7   ? 0.7091 0.5893 0.7644 0.0692  -0.0185 0.0890  -5  ASP A OD2 
17   N N   . PHE A 8   ? 0.3574 0.2865 0.4240 0.0944  -0.0246 0.0298  -4  PHE A N   
18   C CA  . PHE A 8   ? 0.2915 0.2343 0.3596 0.0925  -0.0221 0.0166  -4  PHE A CA  
19   C C   . PHE A 8   ? 0.3369 0.2762 0.4058 0.0806  -0.0176 0.0177  -4  PHE A C   
20   O O   . PHE A 8   ? 0.3499 0.2873 0.4142 0.0729  -0.0137 0.0284  -4  PHE A O   
21   C CB  . PHE A 8   ? 0.2699 0.2382 0.3303 0.0939  -0.0190 0.0138  -4  PHE A CB  
22   C CG  . PHE A 8   ? 0.2584 0.2367 0.3207 0.1059  -0.0232 0.0077  -4  PHE A CG  
23   C CD1 . PHE A 8   ? 0.2961 0.2732 0.3563 0.1124  -0.0265 0.0157  -4  PHE A CD1 
24   C CD2 . PHE A 8   ? 0.2518 0.2428 0.3178 0.1107  -0.0236 -0.0060 -4  PHE A CD2 
25   C CE1 . PHE A 8   ? 0.3420 0.3300 0.4052 0.1240  -0.0305 0.0097  -4  PHE A CE1 
26   C CE2 . PHE A 8   ? 0.2549 0.2576 0.3235 0.1220  -0.0269 -0.0120 -4  PHE A CE2 
27   C CZ  . PHE A 8   ? 0.3056 0.3070 0.3735 0.1287  -0.0303 -0.0043 -4  PHE A CZ  
28   N N   . GLU A 9   ? 0.2930 0.2328 0.3674 0.0795  -0.0182 0.0062  -3  GLU A N   
29   C CA  . GLU A 9   ? 0.2981 0.2392 0.3736 0.0690  -0.0142 0.0055  -3  GLU A CA  
30   C C   . GLU A 9   ? 0.2841 0.2476 0.3531 0.0669  -0.0102 0.0002  -3  GLU A C   
31   O O   . GLU A 9   ? 0.2712 0.2452 0.3406 0.0720  -0.0117 -0.0105 -3  GLU A O   
32   C CB  . GLU A 9   ? 0.3830 0.3116 0.4683 0.0685  -0.0181 -0.0040 -3  GLU A CB  
33   C CG  . GLU A 9   ? 0.5080 0.4120 0.6013 0.0665  -0.0216 0.0026  -3  GLU A CG  
34   C CD  . GLU A 9   ? 0.5838 0.4833 0.6779 0.0544  -0.0169 0.0135  -3  GLU A CD  
35   O OE1 . GLU A 9   ? 0.6558 0.5415 0.7510 0.0520  -0.0171 0.0256  -3  GLU A OE1 
36   O OE2 . GLU A 9   ? 0.5503 0.4607 0.6440 0.0476  -0.0132 0.0102  -3  GLU A OE2 
37   N N   . LEU A 10  ? 0.2803 0.2514 0.3434 0.0595  -0.0050 0.0075  -2  LEU A N   
38   C CA  . LEU A 10  ? 0.3336 0.3238 0.3909 0.0572  -0.0016 0.0034  -2  LEU A CA  
39   C C   . LEU A 10  ? 0.3649 0.3568 0.4264 0.0520  -0.0009 -0.0036 -2  LEU A C   
40   O O   . LEU A 10  ? 0.4175 0.3997 0.4837 0.0457  0.0000  -0.0006 -2  LEU A O   
41   C CB  . LEU A 10  ? 0.4160 0.4131 0.4657 0.0520  0.0031  0.0126  -2  LEU A CB  
42   C CG  . LEU A 10  ? 0.5089 0.5242 0.5510 0.0540  0.0044  0.0112  -2  LEU A CG  
43   C CD1 . LEU A 10  ? 0.5466 0.5653 0.5810 0.0500  0.0079  0.0201  -2  LEU A CD1 
44   C CD2 . LEU A 10  ? 0.4854 0.5134 0.5272 0.0514  0.0057  0.0033  -2  LEU A CD2 
45   N N   . LEU A 11  ? 0.2780 0.2832 0.3378 0.0545  -0.0016 -0.0126 -1  LEU A N   
46   C CA  . LEU A 11  ? 0.2876 0.2965 0.3499 0.0501  -0.0015 -0.0191 -1  LEU A CA  
47   C C   . LEU A 11  ? 0.3462 0.3686 0.4025 0.0444  0.0027  -0.0161 -1  LEU A C   
48   O O   . LEU A 11  ? 0.3723 0.4043 0.4224 0.0453  0.0048  -0.0125 -1  LEU A O   
49   C CB  . LEU A 11  ? 0.2959 0.3112 0.3594 0.0564  -0.0051 -0.0310 -1  LEU A CB  
50   C CG  . LEU A 11  ? 0.2932 0.2944 0.3633 0.0633  -0.0100 -0.0363 -1  LEU A CG  
51   C CD1 . LEU A 11  ? 0.3267 0.3369 0.3972 0.0701  -0.0130 -0.0496 -1  LEU A CD1 
52   C CD2 . LEU A 11  ? 0.2576 0.2399 0.3358 0.0580  -0.0119 -0.0343 -1  LEU A CD2 
53   N N   . ASP A 12  ? 0.4647 0.4878 0.5235 0.0386  0.0034  -0.0177 0   ASP A N   
54   C CA  . ASP A 12  ? 0.5145 0.5486 0.5687 0.0335  0.0067  -0.0149 0   ASP A CA  
55   C C   . ASP A 12  ? 0.4932 0.5392 0.5454 0.0336  0.0052  -0.0220 0   ASP A C   
56   O O   . ASP A 12  ? 0.5492 0.5930 0.6054 0.0341  0.0022  -0.0285 0   ASP A O   
57   C CB  . ASP A 12  ? 0.6060 0.6333 0.6643 0.0267  0.0092  -0.0093 0   ASP A CB  
58   C CG  . ASP A 12  ? 0.7028 0.7227 0.7602 0.0257  0.0121  -0.0006 0   ASP A CG  
59   O OD1 . ASP A 12  ? 0.7458 0.7542 0.8069 0.0275  0.0105  0.0013  0   ASP A OD1 
60   O OD2 . ASP A 12  ? 0.7280 0.7532 0.7804 0.0230  0.0158  0.0043  0   ASP A OD2 
61   N N   . GLY A 13  ? 0.4705 0.5294 0.5161 0.0329  0.0071  -0.0205 1   GLY A N   
62   C CA  . GLY A 13  ? 0.5071 0.5780 0.5496 0.0319  0.0062  -0.0249 1   GLY A CA  
63   C C   . GLY A 13  ? 0.5146 0.5858 0.5577 0.0255  0.0072  -0.0214 1   GLY A C   
64   O O   . GLY A 13  ? 0.4853 0.5478 0.5320 0.0222  0.0089  -0.0167 1   GLY A O   
65   N N   . PRO A 14  ? 0.5428 0.6246 0.5824 0.0239  0.0062  -0.0236 2   PRO A N   
66   C CA  . PRO A 14  ? 0.5454 0.6282 0.5854 0.0187  0.0062  -0.0202 2   PRO A CA  
67   C C   . PRO A 14  ? 0.5705 0.6510 0.6093 0.0153  0.0095  -0.0130 2   PRO A C   
68   O O   . PRO A 14  ? 0.6003 0.6753 0.6433 0.0122  0.0101  -0.0103 2   PRO A O   
69   C CB  . PRO A 14  ? 0.5480 0.6443 0.5820 0.0186  0.0046  -0.0225 2   PRO A CB  
70   C CG  . PRO A 14  ? 0.5716 0.6721 0.6048 0.0240  0.0028  -0.0304 2   PRO A CG  
71   C CD  . PRO A 14  ? 0.5662 0.6596 0.6017 0.0276  0.0044  -0.0299 2   PRO A CD  
72   N N   . SER A 15  ? 0.5536 0.6390 0.5873 0.0160  0.0113  -0.0106 3   SER A N   
73   C CA  . SER A 15  ? 0.5918 0.6751 0.6236 0.0130  0.0140  -0.0051 3   SER A CA  
74   C C   . SER A 15  ? 0.6197 0.6922 0.6554 0.0130  0.0161  -0.0027 3   SER A C   
75   O O   . SER A 15  ? 0.6421 0.7114 0.6783 0.0102  0.0182  0.0007  3   SER A O   
76   C CB  . SER A 15  ? 0.6239 0.7150 0.6502 0.0138  0.0149  -0.0038 3   SER A CB  
77   O OG  . SER A 15  ? 0.6384 0.7271 0.6650 0.0182  0.0152  -0.0049 3   SER A OG  
78   N N   . ASP A 16  ? 0.6225 0.6895 0.6612 0.0161  0.0155  -0.0045 4   ASP A N   
79   C CA  . ASP A 16  ? 0.6704 0.7274 0.7131 0.0155  0.0175  -0.0012 4   ASP A CA  
80   C C   . ASP A 16  ? 0.5926 0.6455 0.6424 0.0119  0.0178  -0.0010 4   ASP A C   
81   O O   . ASP A 16  ? 0.6166 0.6629 0.6709 0.0103  0.0201  0.0020  4   ASP A O   
82   C CB  . ASP A 16  ? 0.7802 0.8309 0.8250 0.0195  0.0160  -0.0025 4   ASP A CB  
83   C CG  . ASP A 16  ? 0.8700 0.9260 0.9090 0.0240  0.0153  -0.0030 4   ASP A CG  
84   O OD1 . ASP A 16  ? 0.8992 0.9564 0.9337 0.0238  0.0174  0.0015  4   ASP A OD1 
85   O OD2 . ASP A 16  ? 0.8917 0.9518 0.9310 0.0280  0.0126  -0.0083 4   ASP A OD2 
86   N N   . ARG A 17  ? 0.4506 0.5087 0.5015 0.0106  0.0155  -0.0039 5   ARG A N   
87   C CA  . ARG A 17  ? 0.3228 0.3794 0.3808 0.0077  0.0151  -0.0039 5   ARG A CA  
88   C C   . ARG A 17  ? 0.1962 0.2577 0.2519 0.0058  0.0156  -0.0017 5   ARG A C   
89   O O   . ARG A 17  ? 0.2379 0.3054 0.2878 0.0060  0.0138  -0.0023 5   ARG A O   
90   C CB  . ARG A 17  ? 0.3557 0.4134 0.4181 0.0081  0.0107  -0.0093 5   ARG A CB  
91   C CG  . ARG A 17  ? 0.4131 0.4628 0.4808 0.0093  0.0095  -0.0119 5   ARG A CG  
92   C CD  . ARG A 17  ? 0.4480 0.4985 0.5207 0.0093  0.0046  -0.0185 5   ARG A CD  
93   N NE  . ARG A 17  ? 0.4902 0.5482 0.5558 0.0128  0.0017  -0.0239 5   ARG A NE  
94   C CZ  . ARG A 17  ? 0.4901 0.5463 0.5535 0.0170  0.0002  -0.0287 5   ARG A CZ  
95   N NH1 . ARG A 17  ? 0.4776 0.5227 0.5456 0.0182  0.0008  -0.0280 5   ARG A NH1 
96   N NH2 . ARG A 17  ? 0.5128 0.5785 0.5697 0.0203  -0.0018 -0.0339 5   ARG A NH2 
97   N N   . PRO A 18  ? 0.1916 0.2506 0.2522 0.0039  0.0181  0.0008  6   PRO A N   
98   C CA  . PRO A 18  ? 0.1901 0.2519 0.2500 0.0028  0.0180  0.0023  6   PRO A CA  
99   C C   . PRO A 18  ? 0.2095 0.2759 0.2703 0.0024  0.0132  0.0008  6   PRO A C   
100  O O   . PRO A 18  ? 0.1610 0.2285 0.2267 0.0025  0.0104  -0.0021 6   PRO A O   
101  C CB  . PRO A 18  ? 0.1982 0.2575 0.2663 0.0017  0.0210  0.0036  6   PRO A CB  
102  C CG  . PRO A 18  ? 0.2211 0.2764 0.2907 0.0016  0.0243  0.0047  6   PRO A CG  
103  C CD  . PRO A 18  ? 0.1787 0.2328 0.2467 0.0027  0.0209  0.0022  6   PRO A CD  
104  N N   . PHE A 19  ? 0.1660 0.2350 0.2220 0.0017  0.0119  0.0028  7   PHE A N   
105  C CA  . PHE A 19  ? 0.1185 0.1920 0.1741 0.0011  0.0073  0.0031  7   PHE A CA  
106  C C   . PHE A 19  ? 0.1134 0.1869 0.1788 0.0013  0.0050  0.0019  7   PHE A C   
107  O O   . PHE A 19  ? 0.1316 0.2097 0.1976 0.0014  0.0006  0.0002  7   PHE A O   
108  C CB  . PHE A 19  ? 0.1645 0.2379 0.2156 -0.0003 0.0067  0.0071  7   PHE A CB  
109  C CG  . PHE A 19  ? 0.1778 0.2553 0.2276 -0.0012 0.0018  0.0094  7   PHE A CG  
110  C CD1 . PHE A 19  ? 0.1802 0.2653 0.2227 -0.0019 -0.0005 0.0093  7   PHE A CD1 
111  C CD2 . PHE A 19  ? 0.1402 0.2146 0.1956 -0.0010 -0.0005 0.0117  7   PHE A CD2 
112  C CE1 . PHE A 19  ? 0.1801 0.2699 0.2200 -0.0030 -0.0049 0.0124  7   PHE A CE1 
113  C CE2 . PHE A 19  ? 0.1312 0.2091 0.1849 -0.0016 -0.0056 0.0149  7   PHE A CE2 
114  C CZ  . PHE A 19  ? 0.2008 0.2865 0.2461 -0.0029 -0.0078 0.0157  7   PHE A CZ  
115  N N   . LYS A 20  ? 0.1348 0.2046 0.2078 0.0014  0.0078  0.0025  8   LYS A N   
116  C CA  . LYS A 20  ? 0.1018 0.1734 0.1858 0.0014  0.0059  0.0014  8   LYS A CA  
117  C C   . LYS A 20  ? 0.1447 0.2180 0.2340 0.0006  0.0040  -0.0023 8   LYS A C   
118  O O   . LYS A 20  ? 0.1039 0.1809 0.2013 0.0003  0.0003  -0.0040 8   LYS A O   
119  C CB  . LYS A 20  ? 0.1280 0.1974 0.2198 0.0018  0.0104  0.0024  8   LYS A CB  
120  C CG  . LYS A 20  ? 0.1268 0.1943 0.2173 0.0033  0.0105  0.0045  8   LYS A CG  
121  C CD  . LYS A 20  ? 0.1591 0.2270 0.2592 0.0047  0.0146  0.0038  8   LYS A CD  
122  C CE  . LYS A 20  ? 0.2222 0.2869 0.3218 0.0070  0.0143  0.0045  8   LYS A CE  
123  N NZ  . LYS A 20  ? 0.2173 0.2845 0.3274 0.0093  0.0183  0.0026  8   LYS A NZ  
124  N N   . GLN A 21  ? 0.1261 0.1964 0.2115 0.0005  0.0060  -0.0039 9   GLN A N   
125  C CA  . GLN A 21  ? 0.1341 0.2036 0.2240 -0.0001 0.0038  -0.0081 9   GLN A CA  
126  C C   . GLN A 21  ? 0.1220 0.1954 0.2047 0.0013  -0.0009 -0.0121 9   GLN A C   
127  O O   . GLN A 21  ? 0.1874 0.2610 0.2741 0.0010  -0.0044 -0.0171 9   GLN A O   
128  C CB  . GLN A 21  ? 0.1586 0.2212 0.2490 -0.0005 0.0080  -0.0075 9   GLN A CB  
129  C CG  . GLN A 21  ? 0.1419 0.2024 0.2389 -0.0021 0.0132  -0.0037 9   GLN A CG  
130  C CD  . GLN A 21  ? 0.2193 0.2732 0.3159 -0.0028 0.0171  -0.0017 9   GLN A CD  
131  O OE1 . GLN A 21  ? 0.1980 0.2476 0.2916 -0.0018 0.0153  -0.0036 9   GLN A OE1 
132  N NE2 . GLN A 21  ? 0.2796 0.3331 0.3791 -0.0041 0.0225  0.0024  9   GLN A NE2 
133  N N   . ARG A 22  ? 0.1194 0.1963 0.1917 0.0024  -0.0010 -0.0103 10  ARG A N   
134  C CA  . ARG A 22  ? 0.1526 0.2359 0.2168 0.0038  -0.0044 -0.0136 10  ARG A CA  
135  C C   . ARG A 22  ? 0.1793 0.2700 0.2428 0.0033  -0.0096 -0.0137 10  ARG A C   
136  O O   . ARG A 22  ? 0.1693 0.2660 0.2289 0.0042  -0.0135 -0.0184 10  ARG A O   
137  C CB  . ARG A 22  ? 0.1723 0.2582 0.2262 0.0046  -0.0017 -0.0109 10  ARG A CB  
138  C CG  . ARG A 22  ? 0.2997 0.3823 0.3517 0.0068  0.0010  -0.0135 10  ARG A CG  
139  C CD  . ARG A 22  ? 0.3213 0.4044 0.3671 0.0068  0.0047  -0.0094 10  ARG A CD  
140  N NE  . ARG A 22  ? 0.3140 0.4051 0.3527 0.0054  0.0038  -0.0065 10  ARG A NE  
141  C CZ  . ARG A 22  ? 0.3731 0.4638 0.4084 0.0035  0.0061  -0.0017 10  ARG A CZ  
142  N NH1 . ARG A 22  ? 0.3759 0.4597 0.4133 0.0036  0.0093  -0.0002 10  ARG A NH1 
143  N NH2 . ARG A 22  ? 0.4370 0.5344 0.4667 0.0013  0.0049  0.0015  10  ARG A NH2 
144  N N   . ARG A 23  ? 0.1507 0.2410 0.2176 0.0022  -0.0100 -0.0087 11  ARG A N   
145  C CA  . ARG A 23  ? 0.1455 0.2420 0.2121 0.0019  -0.0153 -0.0070 11  ARG A CA  
146  C C   . ARG A 23  ? 0.1496 0.2438 0.2290 0.0016  -0.0164 -0.0063 11  ARG A C   
147  O O   . ARG A 23  ? 0.1391 0.2277 0.2240 0.0015  -0.0121 -0.0037 11  ARG A O   
148  C CB  . ARG A 23  ? 0.1972 0.2953 0.2552 0.0013  -0.0153 -0.0003 11  ARG A CB  
149  C CG  . ARG A 23  ? 0.3065 0.4097 0.3525 0.0010  -0.0140 -0.0003 11  ARG A CG  
150  C CD  . ARG A 23  ? 0.4144 0.5281 0.4541 0.0016  -0.0186 -0.0035 11  ARG A CD  
151  N NE  . ARG A 23  ? 0.5083 0.6273 0.5431 0.0003  -0.0226 0.0029  11  ARG A NE  
152  C CZ  . ARG A 23  ? 0.5758 0.7039 0.6065 0.0007  -0.0280 0.0017  11  ARG A CZ  
153  N NH1 . ARG A 23  ? 0.5831 0.7159 0.6145 0.0024  -0.0301 -0.0070 11  ARG A NH1 
154  N NH2 . ARG A 23  ? 0.5865 0.7186 0.6122 -0.0007 -0.0318 0.0092  11  ARG A NH2 
155  N N   . SER A 24  ? 0.1406 0.2405 0.2251 0.0017  -0.0221 -0.0090 12  SER A N   
156  C CA  . SER A 24  ? 0.1472 0.2473 0.2459 0.0014  -0.0234 -0.0092 12  SER A CA  
157  C C   . SER A 24  ? 0.1647 0.2638 0.2659 0.0028  -0.0232 -0.0030 12  SER A C   
158  O O   . SER A 24  ? 0.1304 0.2296 0.2222 0.0035  -0.0249 0.0017  12  SER A O   
159  C CB  . SER A 24  ? 0.2057 0.3136 0.3087 0.0011  -0.0307 -0.0135 12  SER A CB  
160  O OG  . SER A 24  ? 0.1946 0.3089 0.2897 0.0024  -0.0361 -0.0101 12  SER A OG  
161  N N   . PHE A 25  ? 0.1445 0.2429 0.2590 0.0032  -0.0214 -0.0029 13  PHE A N   
162  C CA  . PHE A 25  ? 0.1619 0.2594 0.2812 0.0056  -0.0218 0.0015  13  PHE A CA  
163  C C   . PHE A 25  ? 0.1524 0.2543 0.2680 0.0073  -0.0296 0.0049  13  PHE A C   
164  O O   . PHE A 25  ? 0.1482 0.2460 0.2580 0.0086  -0.0305 0.0103  13  PHE A O   
165  C CB  . PHE A 25  ? 0.1306 0.2306 0.2665 0.0063  -0.0194 -0.0003 13  PHE A CB  
166  C CG  . PHE A 25  ? 0.1266 0.2263 0.2690 0.0101  -0.0199 0.0028  13  PHE A CG  
167  C CD1 . PHE A 25  ? 0.1350 0.2273 0.2739 0.0116  -0.0145 0.0047  13  PHE A CD1 
168  C CD2 . PHE A 25  ? 0.1742 0.2808 0.3263 0.0126  -0.0264 0.0034  13  PHE A CD2 
169  C CE1 . PHE A 25  ? 0.1573 0.2481 0.3027 0.0158  -0.0155 0.0065  13  PHE A CE1 
170  C CE2 . PHE A 25  ? 0.1935 0.2991 0.3525 0.0171  -0.0275 0.0060  13  PHE A CE2 
171  C CZ  . PHE A 25  ? 0.1823 0.2793 0.3380 0.0189  -0.0219 0.0073  13  PHE A CZ  
172  N N   . ALA A 26  ? 0.1692 0.2793 0.2879 0.0069  -0.0357 0.0020  14  ALA A N   
173  C CA  . ALA A 26  ? 0.1896 0.3053 0.3036 0.0084  -0.0438 0.0056  14  ALA A CA  
174  C C   . ALA A 26  ? 0.1890 0.3028 0.2856 0.0075  -0.0442 0.0104  14  ALA A C   
175  O O   . ALA A 26  ? 0.1915 0.3039 0.2839 0.0087  -0.0477 0.0175  14  ALA A O   
176  C CB  . ALA A 26  ? 0.2257 0.3514 0.3436 0.0076  -0.0502 0.0003  14  ALA A CB  
177  N N   . ASP A 27  ? 0.1418 0.2556 0.2288 0.0053  -0.0408 0.0070  15  ASP A N   
178  C CA  . ASP A 27  ? 0.1562 0.2711 0.2275 0.0041  -0.0406 0.0111  15  ASP A CA  
179  C C   . ASP A 27  ? 0.1560 0.2619 0.2243 0.0035  -0.0362 0.0173  15  ASP A C   
180  O O   . ASP A 27  ? 0.1925 0.2986 0.2514 0.0023  -0.0380 0.0240  15  ASP A O   
181  C CB  . ASP A 27  ? 0.2211 0.3393 0.2846 0.0029  -0.0377 0.0046  15  ASP A CB  
182  C CG  . ASP A 27  ? 0.3743 0.5024 0.4362 0.0032  -0.0436 -0.0015 15  ASP A CG  
183  O OD1 . ASP A 27  ? 0.4383 0.5718 0.5032 0.0041  -0.0501 0.0003  15  ASP A OD1 
184  O OD2 . ASP A 27  ? 0.3809 0.5112 0.4385 0.0031  -0.0420 -0.0085 15  ASP A OD2 
185  N N   . ARG A 28  ? 0.1275 0.2259 0.2035 0.0040  -0.0305 0.0152  16  ARG A N   
186  C CA  . ARG A 28  ? 0.1271 0.2168 0.2008 0.0036  -0.0267 0.0197  16  ARG A CA  
187  C C   . ARG A 28  ? 0.1337 0.2194 0.2115 0.0055  -0.0313 0.0257  16  ARG A C   
188  O O   . ARG A 28  ? 0.1551 0.2353 0.2266 0.0042  -0.0319 0.0317  16  ARG A O   
189  C CB  . ARG A 28  ? 0.1337 0.2175 0.2140 0.0041  -0.0199 0.0156  16  ARG A CB  
190  C CG  . ARG A 28  ? 0.1204 0.2055 0.1953 0.0024  -0.0155 0.0112  16  ARG A CG  
191  C CD  . ARG A 28  ? 0.1145 0.1939 0.1947 0.0027  -0.0090 0.0088  16  ARG A CD  
192  N NE  . ARG A 28  ? 0.1078 0.1891 0.1988 0.0032  -0.0081 0.0046  16  ARG A NE  
193  C CZ  . ARG A 28  ? 0.1389 0.2193 0.2411 0.0043  -0.0060 0.0041  16  ARG A CZ  
194  N NH1 . ARG A 28  ? 0.1078 0.1848 0.2122 0.0062  -0.0050 0.0067  16  ARG A NH1 
195  N NH2 . ARG A 28  ? 0.1173 0.2007 0.2295 0.0035  -0.0049 0.0008  16  ARG A NH2 
196  N N   . CYS A 29  ? 0.1343 0.2226 0.2238 0.0084  -0.0348 0.0242  17  CYS A N   
197  C CA  . CYS A 29  ? 0.1472 0.2320 0.2421 0.0115  -0.0400 0.0297  17  CYS A CA  
198  C C   . CYS A 29  ? 0.1757 0.2627 0.2594 0.0100  -0.0465 0.0374  17  CYS A C   
199  O O   . CYS A 29  ? 0.2089 0.2883 0.2902 0.0102  -0.0490 0.0446  17  CYS A O   
200  C CB  . CYS A 29  ? 0.1919 0.2828 0.3017 0.0151  -0.0435 0.0265  17  CYS A CB  
201  S SG  . CYS A 29  ? 0.1484 0.2370 0.2735 0.0173  -0.0360 0.0200  17  CYS A SG  
202  N N   . LYS A 30  ? 0.1728 0.2705 0.2498 0.0084  -0.0493 0.0358  18  LYS A N   
203  C CA  . LYS A 30  ? 0.2329 0.3361 0.2978 0.0067  -0.0550 0.0428  18  LYS A CA  
204  C C   . LYS A 30  ? 0.2296 0.3277 0.2824 0.0027  -0.0517 0.0489  18  LYS A C   
205  O O   . LYS A 30  ? 0.2268 0.3222 0.2739 0.0014  -0.0558 0.0584  18  LYS A O   
206  C CB  . LYS A 30  ? 0.2981 0.4147 0.3570 0.0058  -0.0573 0.0374  18  LYS A CB  
207  C CG  . LYS A 30  ? 0.3981 0.5229 0.4409 0.0034  -0.0609 0.0434  18  LYS A CG  
208  C CD  . LYS A 30  ? 0.4524 0.5909 0.4891 0.0032  -0.0628 0.0358  18  LYS A CD  
209  C CE  . LYS A 30  ? 0.5196 0.6691 0.5407 0.0016  -0.0676 0.0422  18  LYS A CE  
210  N NZ  . LYS A 30  ? 0.5484 0.7119 0.5655 0.0028  -0.0723 0.0343  18  LYS A NZ  
211  N N   . GLU A 31  ? 0.1660 0.2631 0.2157 0.0005  -0.0445 0.0438  19  GLU A N   
212  C CA  . GLU A 31  ? 0.1995 0.2944 0.2390 -0.0037 -0.0410 0.0484  19  GLU A CA  
213  C C   . GLU A 31  ? 0.2203 0.3015 0.2636 -0.0042 -0.0412 0.0546  19  GLU A C   
214  O O   . GLU A 31  ? 0.1733 0.2520 0.2092 -0.0080 -0.0429 0.0631  19  GLU A O   
215  C CB  . GLU A 31  ? 0.2819 0.3785 0.3197 -0.0047 -0.0338 0.0408  19  GLU A CB  
216  C CG  . GLU A 31  ? 0.3640 0.4634 0.3911 -0.0090 -0.0305 0.0441  19  GLU A CG  
217  C CD  . GLU A 31  ? 0.4527 0.5588 0.4766 -0.0088 -0.0254 0.0362  19  GLU A CD  
218  O OE1 . GLU A 31  ? 0.4239 0.5274 0.4554 -0.0058 -0.0233 0.0288  19  GLU A OE1 
219  O OE2 . GLU A 31  ? 0.5191 0.6336 0.5337 -0.0114 -0.0235 0.0377  19  GLU A OE2 
220  N N   . VAL A 32  ? 0.1643 0.2369 0.2194 -0.0007 -0.0394 0.0503  20  VAL A N   
221  C CA  . VAL A 32  ? 0.2061 0.2648 0.2659 -0.0001 -0.0400 0.0543  20  VAL A CA  
222  C C   . VAL A 32  ? 0.1795 0.2340 0.2399 0.0009  -0.0480 0.0635  20  VAL A C   
223  O O   . VAL A 32  ? 0.1936 0.2385 0.2503 -0.0019 -0.0499 0.0710  20  VAL A O   
224  C CB  . VAL A 32  ? 0.2023 0.2550 0.2748 0.0045  -0.0365 0.0469  20  VAL A CB  
225  C CG1 . VAL A 32  ? 0.1854 0.2244 0.2641 0.0068  -0.0389 0.0501  20  VAL A CG1 
226  C CG2 . VAL A 32  ? 0.1795 0.2328 0.2496 0.0026  -0.0287 0.0404  20  VAL A CG2 
227  N N   . GLN A 33  ? 0.1812 0.2424 0.2465 0.0048  -0.0532 0.0634  21  GLN A N   
228  C CA  . GLN A 33  ? 0.1951 0.2521 0.2621 0.0069  -0.0615 0.0724  21  GLN A CA  
229  C C   . GLN A 33  ? 0.2290 0.2894 0.2813 0.0014  -0.0651 0.0831  21  GLN A C   
230  O O   . GLN A 33  ? 0.2656 0.3167 0.3170 0.0008  -0.0704 0.0930  21  GLN A O   
231  C CB  . GLN A 33  ? 0.2325 0.2974 0.3094 0.0126  -0.0666 0.0693  21  GLN A CB  
232  C CG  . GLN A 33  ? 0.2575 0.3180 0.3501 0.0178  -0.0631 0.0609  21  GLN A CG  
233  C CD  . GLN A 33  ? 0.2749 0.3472 0.3782 0.0218  -0.0656 0.0552  21  GLN A CD  
234  O OE1 . GLN A 33  ? 0.2916 0.3712 0.3946 0.0234  -0.0734 0.0594  21  GLN A OE1 
235  N NE2 . GLN A 33  ? 0.2285 0.3034 0.3414 0.0231  -0.0593 0.0459  21  GLN A NE2 
236  N N   . GLN A 34  ? 0.2013 0.2749 0.2427 -0.0025 -0.0620 0.0810  22  GLN A N   
237  C CA  . GLN A 34  ? 0.2392 0.3186 0.2659 -0.0084 -0.0637 0.0907  22  GLN A CA  
238  C C   . GLN A 34  ? 0.2399 0.3085 0.2632 -0.0139 -0.0604 0.0967  22  GLN A C   
239  O O   . GLN A 34  ? 0.2618 0.3264 0.2793 -0.0180 -0.0645 0.1086  22  GLN A O   
240  C CB  . GLN A 34  ? 0.2698 0.3665 0.2862 -0.0107 -0.0600 0.0852  22  GLN A CB  
241  C CG  . GLN A 34  ? 0.4372 0.5474 0.4518 -0.0073 -0.0649 0.0819  22  GLN A CG  
242  C CD  . GLN A 34  ? 0.5813 0.7062 0.5873 -0.0088 -0.0604 0.0736  22  GLN A CD  
243  O OE1 . GLN A 34  ? 0.6546 0.7805 0.6558 -0.0121 -0.0539 0.0716  22  GLN A OE1 
244  N NE2 . GLN A 34  ? 0.6170 0.7535 0.6216 -0.0060 -0.0644 0.0681  22  GLN A NE2 
245  N N   . ILE A 35  ? 0.2201 0.2846 0.2471 -0.0147 -0.0534 0.0887  23  ILE A N   
246  C CA  . ILE A 35  ? 0.2322 0.2886 0.2560 -0.0206 -0.0502 0.0927  23  ILE A CA  
247  C C   . ILE A 35  ? 0.2598 0.2965 0.2919 -0.0197 -0.0540 0.0975  23  ILE A C   
248  O O   . ILE A 35  ? 0.2644 0.2931 0.2929 -0.0256 -0.0553 0.1058  23  ILE A O   
249  C CB  . ILE A 35  ? 0.2192 0.2790 0.2430 -0.0217 -0.0420 0.0827  23  ILE A CB  
250  C CG1 . ILE A 35  ? 0.2918 0.3539 0.3076 -0.0294 -0.0388 0.0877  23  ILE A CG1 
251  C CG2 . ILE A 35  ? 0.2075 0.2549 0.2427 -0.0172 -0.0395 0.0748  23  ILE A CG2 
252  C CD1 . ILE A 35  ? 0.2919 0.3693 0.2960 -0.0341 -0.0400 0.0953  23  ILE A CD1 
253  N N   . ARG A 36  ? 0.2223 0.2515 0.2659 -0.0124 -0.0562 0.0923  24  ARG A N   
254  C CA  . ARG A 36  ? 0.2466 0.2570 0.2990 -0.0098 -0.0604 0.0955  24  ARG A CA  
255  C C   . ARG A 36  ? 0.2804 0.2856 0.3305 -0.0105 -0.0694 0.1089  24  ARG A C   
256  O O   . ARG A 36  ? 0.3032 0.2915 0.3568 -0.0116 -0.0734 0.1154  24  ARG A O   
257  C CB  . ARG A 36  ? 0.2215 0.2279 0.2877 -0.0012 -0.0596 0.0854  24  ARG A CB  
258  C CG  . ARG A 36  ? 0.2257 0.2317 0.2948 -0.0009 -0.0511 0.0740  24  ARG A CG  
259  C CD  . ARG A 36  ? 0.2859 0.2754 0.3567 -0.0030 -0.0503 0.0738  24  ARG A CD  
260  N NE  . ARG A 36  ? 0.3361 0.3118 0.4186 0.0038  -0.0545 0.0724  24  ARG A NE  
261  C CZ  . ARG A 36  ? 0.3654 0.3247 0.4518 0.0039  -0.0552 0.0706  24  ARG A CZ  
262  N NH1 . ARG A 36  ? 0.3856 0.3406 0.4652 -0.0031 -0.0520 0.0704  24  ARG A NH1 
263  N NH2 . ARG A 36  ? 0.3408 0.2884 0.4385 0.0114  -0.0592 0.0683  24  ARG A NH2 
264  N N   . ASP A 37  ? 0.2733 0.2925 0.3175 -0.0098 -0.0728 0.1132  25  ASP A N   
265  C CA  . ASP A 37  ? 0.2954 0.3122 0.3349 -0.0110 -0.0814 0.1273  25  ASP A CA  
266  C C   . ASP A 37  ? 0.3397 0.3561 0.3668 -0.0211 -0.0806 0.1385  25  ASP A C   
267  O O   . ASP A 37  ? 0.3552 0.3594 0.3812 -0.0241 -0.0864 0.1511  25  ASP A O   
268  C CB  . ASP A 37  ? 0.3214 0.3556 0.3570 -0.0074 -0.0853 0.1275  25  ASP A CB  
269  C CG  . ASP A 37  ? 0.4014 0.4355 0.4303 -0.0084 -0.0945 0.1427  25  ASP A CG  
270  O OD1 . ASP A 37  ? 0.3693 0.3907 0.4071 -0.0031 -0.1020 0.1479  25  ASP A OD1 
271  O OD2 . ASP A 37  ? 0.4618 0.5095 0.4761 -0.0142 -0.0945 0.1495  25  ASP A OD2 
272  N N   . GLN A 38  ? 0.3348 0.3649 0.3534 -0.0263 -0.0732 0.1340  26  GLN A N   
273  C CA  . GLN A 38  ? 0.3894 0.4244 0.3967 -0.0363 -0.0711 0.1435  26  GLN A CA  
274  C C   . GLN A 38  ? 0.3933 0.4112 0.4056 -0.0416 -0.0692 0.1450  26  GLN A C   
275  O O   . GLN A 38  ? 0.4045 0.4162 0.4123 -0.0493 -0.0718 0.1576  26  GLN A O   
276  C CB  . GLN A 38  ? 0.4406 0.4973 0.4390 -0.0385 -0.0638 0.1361  26  GLN A CB  
277  C CG  . GLN A 38  ? 0.5554 0.6249 0.5411 -0.0478 -0.0612 0.1451  26  GLN A CG  
278  C CD  . GLN A 38  ? 0.6470 0.7397 0.6245 -0.0473 -0.0552 0.1366  26  GLN A CD  
279  O OE1 . GLN A 38  ? 0.6762 0.7766 0.6543 -0.0406 -0.0559 0.1280  26  GLN A OE1 
280  N NE2 . GLN A 38  ? 0.6964 0.8001 0.6670 -0.0544 -0.0495 0.1383  26  GLN A NE2 
281  N N   . HIS A 39  ? 0.3174 0.3277 0.3388 -0.0377 -0.0649 0.1324  27  HIS A N   
282  C CA  . HIS A 39  ? 0.3551 0.3499 0.3814 -0.0421 -0.0631 0.1312  27  HIS A CA  
283  C C   . HIS A 39  ? 0.3676 0.3447 0.4069 -0.0341 -0.0649 0.1227  27  HIS A C   
284  O O   . HIS A 39  ? 0.3632 0.3415 0.4069 -0.0307 -0.0592 0.1101  27  HIS A O   
285  C CB  . HIS A 39  ? 0.3701 0.3763 0.3926 -0.0462 -0.0546 0.1228  27  HIS A CB  
286  C CG  . HIS A 39  ? 0.4544 0.4815 0.4650 -0.0522 -0.0514 0.1278  27  HIS A CG  
287  N ND1 . HIS A 39  ? 0.4682 0.4982 0.4723 -0.0623 -0.0518 0.1392  27  HIS A ND1 
288  C CD2 . HIS A 39  ? 0.4553 0.5023 0.4598 -0.0496 -0.0475 0.1221  27  HIS A CD2 
289  C CE1 . HIS A 39  ? 0.4837 0.5360 0.4779 -0.0651 -0.0478 0.1403  27  HIS A CE1 
290  N NE2 . HIS A 39  ? 0.4841 0.5462 0.4783 -0.0572 -0.0455 0.1295  27  HIS A NE2 
291  N N   . PRO A 40  ? 0.3820 0.3431 0.4275 -0.0308 -0.0727 0.1297  28  PRO A N   
292  C CA  . PRO A 40  ? 0.3793 0.3257 0.4381 -0.0215 -0.0748 0.1212  28  PRO A CA  
293  C C   . PRO A 40  ? 0.3864 0.3189 0.4504 -0.0231 -0.0713 0.1128  28  PRO A C   
294  O O   . PRO A 40  ? 0.4188 0.3448 0.4922 -0.0153 -0.0699 0.1018  28  PRO A O   
295  C CB  . PRO A 40  ? 0.4692 0.4009 0.5320 -0.0191 -0.0849 0.1330  28  PRO A CB  
296  C CG  . PRO A 40  ? 0.4890 0.4329 0.5396 -0.0256 -0.0877 0.1471  28  PRO A CG  
297  C CD  . PRO A 40  ? 0.4669 0.4235 0.5073 -0.0352 -0.0802 0.1463  28  PRO A CD  
298  N N   . SER A 41  ? 0.4138 0.3434 0.4717 -0.0332 -0.0700 0.1177  29  SER A N   
299  C CA  . SER A 41  ? 0.4412 0.3576 0.5033 -0.0359 -0.0678 0.1103  29  SER A CA  
300  C C   . SER A 41  ? 0.4202 0.3513 0.4779 -0.0380 -0.0589 0.0997  29  SER A C   
301  O O   . SER A 41  ? 0.4525 0.3766 0.5113 -0.0418 -0.0567 0.0941  29  SER A O   
302  C CB  . SER A 41  ? 0.5012 0.4041 0.5611 -0.0464 -0.0725 0.1219  29  SER A CB  
303  O OG  . SER A 41  ? 0.5209 0.4404 0.5702 -0.0565 -0.0692 0.1299  29  SER A OG  
304  N N   . LYS A 42  ? 0.3654 0.3163 0.4183 -0.0354 -0.0542 0.0967  30  LYS A N   
305  C CA  . LYS A 42  ? 0.2792 0.2438 0.3279 -0.0369 -0.0463 0.0878  30  LYS A CA  
306  C C   . LYS A 42  ? 0.2679 0.2397 0.3208 -0.0277 -0.0422 0.0767  30  LYS A C   
307  O O   . LYS A 42  ? 0.2595 0.2336 0.3160 -0.0216 -0.0448 0.0776  30  LYS A O   
308  C CB  . LYS A 42  ? 0.2964 0.2794 0.3347 -0.0441 -0.0437 0.0944  30  LYS A CB  
309  C CG  . LYS A 42  ? 0.3717 0.3507 0.4059 -0.0548 -0.0467 0.1060  30  LYS A CG  
310  C CD  . LYS A 42  ? 0.4246 0.4251 0.4487 -0.0611 -0.0432 0.1117  30  LYS A CD  
311  C CE  . LYS A 42  ? 0.4822 0.4804 0.5026 -0.0719 -0.0466 0.1259  30  LYS A CE  
312  N NZ  . LYS A 42  ? 0.5187 0.5031 0.5407 -0.0711 -0.0544 0.1370  30  LYS A NZ  
313  N N   . ILE A 43  ? 0.2445 0.2202 0.2972 -0.0270 -0.0361 0.0668  31  ILE A N   
314  C CA  . ILE A 43  ? 0.2020 0.1842 0.2586 -0.0194 -0.0315 0.0568  31  ILE A CA  
315  C C   . ILE A 43  ? 0.1927 0.1930 0.2427 -0.0208 -0.0264 0.0549  31  ILE A C   
316  O O   . ILE A 43  ? 0.1956 0.2018 0.2393 -0.0262 -0.0233 0.0547  31  ILE A O   
317  C CB  . ILE A 43  ? 0.2332 0.2074 0.2936 -0.0169 -0.0280 0.0467  31  ILE A CB  
318  C CG1 . ILE A 43  ? 0.2681 0.2230 0.3351 -0.0154 -0.0332 0.0469  31  ILE A CG1 
319  C CG2 . ILE A 43  ? 0.2105 0.1923 0.2749 -0.0097 -0.0228 0.0377  31  ILE A CG2 
320  C CD1 . ILE A 43  ? 0.2628 0.2115 0.3380 -0.0086 -0.0383 0.0498  31  ILE A CD1 
321  N N   . PRO A 44  ? 0.1791 0.1882 0.2313 -0.0157 -0.0259 0.0529  32  PRO A N   
322  C CA  . PRO A 44  ? 0.1805 0.2049 0.2274 -0.0161 -0.0215 0.0498  32  PRO A CA  
323  C C   . PRO A 44  ? 0.1886 0.2144 0.2381 -0.0131 -0.0154 0.0404  32  PRO A C   
324  O O   . PRO A 44  ? 0.1544 0.1763 0.2114 -0.0078 -0.0144 0.0355  32  PRO A O   
325  C CB  . PRO A 44  ? 0.1739 0.2049 0.2235 -0.0122 -0.0245 0.0512  32  PRO A CB  
326  C CG  . PRO A 44  ? 0.1765 0.1966 0.2364 -0.0069 -0.0280 0.0507  32  PRO A CG  
327  C CD  . PRO A 44  ? 0.1833 0.1888 0.2433 -0.0097 -0.0302 0.0540  32  PRO A CD  
328  N N   . VAL A 45  ? 0.1620 0.1943 0.2051 -0.0163 -0.0114 0.0384  33  VAL A N   
329  C CA  . VAL A 45  ? 0.1430 0.1758 0.1867 -0.0142 -0.0061 0.0309  33  VAL A CA  
330  C C   . VAL A 45  ? 0.1330 0.1781 0.1727 -0.0138 -0.0026 0.0286  33  VAL A C   
331  O O   . VAL A 45  ? 0.1441 0.1975 0.1780 -0.0170 -0.0033 0.0318  33  VAL A O   
332  C CB  . VAL A 45  ? 0.1825 0.2093 0.2231 -0.0181 -0.0053 0.0301  33  VAL A CB  
333  C CG1 . VAL A 45  ? 0.2086 0.2363 0.2490 -0.0155 -0.0003 0.0227  33  VAL A CG1 
334  C CG2 . VAL A 45  ? 0.1603 0.1731 0.2053 -0.0186 -0.0096 0.0320  33  VAL A CG2 
335  N N   . ILE A 46  ? 0.1265 0.1727 0.1697 -0.0098 0.0011  0.0231  34  ILE A N   
336  C CA  . ILE A 46  ? 0.1408 0.1953 0.1811 -0.0090 0.0044  0.0202  34  ILE A CA  
337  C C   . ILE A 46  ? 0.1565 0.2095 0.1940 -0.0091 0.0084  0.0170  34  ILE A C   
338  O O   . ILE A 46  ? 0.1597 0.2068 0.2004 -0.0071 0.0104  0.0142  34  ILE A O   
339  C CB  . ILE A 46  ? 0.1145 0.1706 0.1613 -0.0050 0.0055  0.0172  34  ILE A CB  
340  C CG1 . ILE A 46  ? 0.1287 0.1876 0.1783 -0.0046 0.0008  0.0198  34  ILE A CG1 
341  C CG2 . ILE A 46  ? 0.1162 0.1779 0.1608 -0.0041 0.0087  0.0141  34  ILE A CG2 
342  C CD1 . ILE A 46  ? 0.1300 0.1971 0.1721 -0.0071 -0.0014 0.0223  34  ILE A CD1 
343  N N   . ILE A 47  ? 0.1152 0.1746 0.1466 -0.0112 0.0093  0.0173  35  ILE A N   
344  C CA  . ILE A 47  ? 0.1144 0.1738 0.1425 -0.0113 0.0123  0.0146  35  ILE A CA  
345  C C   . ILE A 47  ? 0.1680 0.2346 0.1941 -0.0089 0.0146  0.0129  35  ILE A C   
346  O O   . ILE A 47  ? 0.1963 0.2704 0.2202 -0.0094 0.0135  0.0139  35  ILE A O   
347  C CB  . ILE A 47  ? 0.1760 0.2365 0.1999 -0.0162 0.0105  0.0167  35  ILE A CB  
348  C CG1 . ILE A 47  ? 0.1966 0.2475 0.2232 -0.0186 0.0074  0.0188  35  ILE A CG1 
349  C CG2 . ILE A 47  ? 0.2106 0.2719 0.2309 -0.0161 0.0128  0.0134  35  ILE A CG2 
350  C CD1 . ILE A 47  ? 0.2095 0.2599 0.2333 -0.0248 0.0049  0.0215  35  ILE A CD1 
351  N N   . GLU A 48  ? 0.1557 0.2198 0.1824 -0.0061 0.0179  0.0104  36  GLU A N   
352  C CA  . GLU A 48  ? 0.1676 0.2356 0.1934 -0.0034 0.0197  0.0093  36  GLU A CA  
353  C C   . GLU A 48  ? 0.1660 0.2333 0.1881 -0.0023 0.0224  0.0084  36  GLU A C   
354  O O   . GLU A 48  ? 0.1769 0.2399 0.1984 -0.0027 0.0239  0.0075  36  GLU A O   
355  C CB  . GLU A 48  ? 0.2034 0.2685 0.2355 -0.0012 0.0205  0.0085  36  GLU A CB  
356  C CG  . GLU A 48  ? 0.2452 0.3112 0.2813 -0.0018 0.0174  0.0090  36  GLU A CG  
357  C CD  . GLU A 48  ? 0.1945 0.2587 0.2379 -0.0000 0.0178  0.0076  36  GLU A CD  
358  O OE1 . GLU A 48  ? 0.2221 0.2826 0.2711 0.0005  0.0195  0.0074  36  GLU A OE1 
359  O OE2 . GLU A 48  ? 0.2460 0.3133 0.2902 0.0008  0.0163  0.0063  36  GLU A OE2 
360  N N   . ARG A 49  ? 0.1547 0.2262 0.1741 -0.0003 0.0229  0.0084  37  ARG A N   
361  C CA  . ARG A 49  ? 0.1400 0.2108 0.1557 0.0014  0.0252  0.0084  37  ARG A CA  
362  C C   . ARG A 49  ? 0.1792 0.2442 0.1982 0.0030  0.0283  0.0089  37  ARG A C   
363  O O   . ARG A 49  ? 0.2309 0.2939 0.2555 0.0038  0.0284  0.0091  37  ARG A O   
364  C CB  . ARG A 49  ? 0.1753 0.2516 0.1885 0.0040  0.0242  0.0088  37  ARG A CB  
365  C CG  . ARG A 49  ? 0.1891 0.2661 0.1972 0.0057  0.0254  0.0098  37  ARG A CG  
366  C CD  . ARG A 49  ? 0.2330 0.3163 0.2395 0.0090  0.0235  0.0101  37  ARG A CD  
367  N NE  . ARG A 49  ? 0.2556 0.3353 0.2662 0.0125  0.0234  0.0103  37  ARG A NE  
368  C CZ  . ARG A 49  ? 0.2544 0.3372 0.2652 0.0167  0.0217  0.0099  37  ARG A CZ  
369  N NH1 . ARG A 49  ? 0.2136 0.3051 0.2211 0.0181  0.0201  0.0098  37  ARG A NH1 
370  N NH2 . ARG A 49  ? 0.2703 0.3477 0.2855 0.0197  0.0212  0.0093  37  ARG A NH2 
371  N N   . TYR A 50  ? 0.1479 0.2113 0.1633 0.0032  0.0310  0.0090  38  TYR A N   
372  C CA  . TYR A 50  ? 0.2129 0.2733 0.2307 0.0044  0.0350  0.0102  38  TYR A CA  
373  C C   . TYR A 50  ? 0.2439 0.3032 0.2630 0.0061  0.0353  0.0131  38  TYR A C   
374  O O   . TYR A 50  ? 0.2552 0.3165 0.2704 0.0077  0.0333  0.0140  38  TYR A O   
375  C CB  . TYR A 50  ? 0.2395 0.3008 0.2504 0.0046  0.0377  0.0097  38  TYR A CB  
376  C CG  . TYR A 50  ? 0.3493 0.4098 0.3610 0.0055  0.0427  0.0115  38  TYR A CG  
377  C CD1 . TYR A 50  ? 0.3789 0.4381 0.3990 0.0050  0.0452  0.0109  38  TYR A CD1 
378  C CD2 . TYR A 50  ? 0.4163 0.4788 0.4204 0.0065  0.0450  0.0144  38  TYR A CD2 
379  C CE1 . TYR A 50  ? 0.4376 0.4984 0.4592 0.0052  0.0504  0.0129  38  TYR A CE1 
380  C CE2 . TYR A 50  ? 0.4645 0.5277 0.4687 0.0066  0.0500  0.0171  38  TYR A CE2 
381  C CZ  . TYR A 50  ? 0.4832 0.5459 0.4964 0.0057  0.0531  0.0163  38  TYR A CZ  
382  O OH  . TYR A 50  ? 0.5402 0.6057 0.5543 0.0053  0.0587  0.0193  38  TYR A OH  
383  N N   . LYS A 51  ? 0.3044 0.3605 0.3302 0.0058  0.0375  0.0144  39  LYS A N   
384  C CA  . LYS A 51  ? 0.3346 0.3874 0.3635 0.0068  0.0371  0.0169  39  LYS A CA  
385  C C   . LYS A 51  ? 0.3658 0.4178 0.3879 0.0085  0.0384  0.0209  39  LYS A C   
386  O O   . LYS A 51  ? 0.3962 0.4456 0.4183 0.0106  0.0360  0.0224  39  LYS A O   
387  C CB  . LYS A 51  ? 0.3915 0.4414 0.4297 0.0050  0.0393  0.0178  39  LYS A CB  
388  C CG  . LYS A 51  ? 0.4513 0.5023 0.4893 0.0038  0.0448  0.0206  39  LYS A CG  
389  C CD  . LYS A 51  ? 0.5243 0.5752 0.5736 0.0014  0.0470  0.0212  39  LYS A CD  
390  C CE  . LYS A 51  ? 0.5630 0.6169 0.6183 0.0012  0.0456  0.0166  39  LYS A CE  
391  N NZ  . LYS A 51  ? 0.5834 0.6409 0.6481 -0.0003 0.0497  0.0169  39  LYS A NZ  
392  N N   . GLY A 52  ? 0.3630 0.4174 0.3790 0.0081  0.0416  0.0223  40  GLY A N   
393  C CA  . GLY A 52  ? 0.4080 0.4627 0.4161 0.0097  0.0425  0.0268  40  GLY A CA  
394  C C   . GLY A 52  ? 0.4072 0.4664 0.4073 0.0118  0.0391  0.0255  40  GLY A C   
395  O O   . GLY A 52  ? 0.4272 0.4873 0.4207 0.0138  0.0387  0.0293  40  GLY A O   
396  N N   . GLU A 53  ? 0.3447 0.4072 0.3456 0.0110  0.0365  0.0207  41  GLU A N   
397  C CA  . GLU A 53  ? 0.3180 0.3867 0.3128 0.0119  0.0333  0.0191  41  GLU A CA  
398  C C   . GLU A 53  ? 0.3066 0.3771 0.3032 0.0150  0.0296  0.0198  41  GLU A C   
399  O O   . GLU A 53  ? 0.3039 0.3733 0.3067 0.0152  0.0282  0.0179  41  GLU A O   
400  C CB  . GLU A 53  ? 0.2892 0.3607 0.2849 0.0089  0.0319  0.0144  41  GLU A CB  
401  C CG  . GLU A 53  ? 0.3152 0.3940 0.3064 0.0084  0.0285  0.0127  41  GLU A CG  
402  C CD  . GLU A 53  ? 0.3392 0.4212 0.3218 0.0092  0.0287  0.0134  41  GLU A CD  
403  O OE1 . GLU A 53  ? 0.3437 0.4230 0.3228 0.0084  0.0318  0.0126  41  GLU A OE1 
404  O OE2 . GLU A 53  ? 0.3344 0.4226 0.3137 0.0110  0.0258  0.0143  41  GLU A OE2 
405  N N   . LYS A 54  ? 0.3519 0.4260 0.3428 0.0178  0.0279  0.0221  42  LYS A N   
406  C CA  . LYS A 54  ? 0.3996 0.4760 0.3928 0.0221  0.0244  0.0225  42  LYS A CA  
407  C C   . LYS A 54  ? 0.3856 0.4731 0.3757 0.0232  0.0210  0.0204  42  LYS A C   
408  O O   . LYS A 54  ? 0.3959 0.4879 0.3890 0.0271  0.0182  0.0195  42  LYS A O   
409  C CB  . LYS A 54  ? 0.4688 0.5385 0.4607 0.0259  0.0245  0.0283  42  LYS A CB  
410  C CG  . LYS A 54  ? 0.5493 0.6085 0.5464 0.0242  0.0274  0.0307  42  LYS A CG  
411  C CD  . LYS A 54  ? 0.6147 0.6723 0.6203 0.0232  0.0265  0.0257  42  LYS A CD  
412  C CE  . LYS A 54  ? 0.6680 0.7160 0.6804 0.0213  0.0286  0.0275  42  LYS A CE  
413  N NZ  . LYS A 54  ? 0.6919 0.7392 0.7116 0.0208  0.0268  0.0221  42  LYS A NZ  
414  N N   . GLN A 55  ? 0.3213 0.4139 0.3062 0.0198  0.0212  0.0189  43  GLN A N   
415  C CA  . GLN A 55  ? 0.3449 0.4490 0.3274 0.0201  0.0177  0.0172  43  GLN A CA  
416  C C   . GLN A 55  ? 0.3522 0.4630 0.3387 0.0156  0.0166  0.0130  43  GLN A C   
417  O O   . GLN A 55  ? 0.4313 0.5530 0.4202 0.0163  0.0139  0.0117  43  GLN A O   
418  C CB  . GLN A 55  ? 0.4380 0.5448 0.4118 0.0193  0.0173  0.0181  43  GLN A CB  
419  C CG  . GLN A 55  ? 0.5217 0.6240 0.4904 0.0237  0.0179  0.0238  43  GLN A CG  
420  C CD  . GLN A 55  ? 0.6090 0.7145 0.5802 0.0298  0.0143  0.0266  43  GLN A CD  
421  O OE1 . GLN A 55  ? 0.6281 0.7446 0.6013 0.0312  0.0106  0.0242  43  GLN A OE1 
422  N NE2 . GLN A 55  ? 0.6514 0.7476 0.6237 0.0336  0.0151  0.0317  43  GLN A NE2 
423  N N   . LEU A 56  ? 0.2307 0.3358 0.2185 0.0111  0.0186  0.0114  44  LEU A N   
424  C CA  . LEU A 56  ? 0.1918 0.3013 0.1832 0.0064  0.0175  0.0090  44  LEU A CA  
425  C C   . LEU A 56  ? 0.2143 0.3254 0.2115 0.0082  0.0175  0.0089  44  LEU A C   
426  O O   . LEU A 56  ? 0.2234 0.3275 0.2226 0.0116  0.0189  0.0098  44  LEU A O   
427  C CB  . LEU A 56  ? 0.1631 0.2643 0.1542 0.0019  0.0191  0.0076  44  LEU A CB  
428  C CG  . LEU A 56  ? 0.1490 0.2491 0.1341 0.0000  0.0190  0.0058  44  LEU A CG  
429  C CD1 . LEU A 56  ? 0.1531 0.2433 0.1388 -0.0022 0.0212  0.0039  44  LEU A CD1 
430  C CD2 . LEU A 56  ? 0.1525 0.2617 0.1371 -0.0040 0.0153  0.0039  44  LEU A CD2 
431  N N   . PRO A 57  ? 0.2359 0.3568 0.2358 0.0056  0.0160  0.0078  45  PRO A N   
432  C CA  . PRO A 57  ? 0.2353 0.3601 0.2395 0.0077  0.0160  0.0069  45  PRO A CA  
433  C C   . PRO A 57  ? 0.2189 0.3355 0.2251 0.0052  0.0173  0.0070  45  PRO A C   
434  O O   . PRO A 57  ? 0.1776 0.2868 0.1830 0.0012  0.0179  0.0078  45  PRO A O   
435  C CB  . PRO A 57  ? 0.2527 0.3930 0.2583 0.0049  0.0145  0.0062  45  PRO A CB  
436  C CG  . PRO A 57  ? 0.2565 0.3965 0.2599 -0.0016 0.0136  0.0071  45  PRO A CG  
437  C CD  . PRO A 57  ? 0.2335 0.3634 0.2326 0.0003  0.0140  0.0071  45  PRO A CD  
438  N N   . VAL A 58  ? 0.2140 0.3322 0.2231 0.0081  0.0173  0.0056  46  VAL A N   
439  C CA  . VAL A 58  ? 0.2186 0.3318 0.2297 0.0060  0.0176  0.0055  46  VAL A CA  
440  C C   . VAL A 58  ? 0.2549 0.3764 0.2655 0.0005  0.0167  0.0067  46  VAL A C   
441  O O   . VAL A 58  ? 0.2625 0.3970 0.2726 0.0000  0.0161  0.0064  46  VAL A O   
442  C CB  . VAL A 58  ? 0.2900 0.4029 0.3038 0.0108  0.0172  0.0027  46  VAL A CB  
443  C CG1 . VAL A 58  ? 0.3407 0.4509 0.3563 0.0085  0.0167  0.0023  46  VAL A CG1 
444  C CG2 . VAL A 58  ? 0.2992 0.4018 0.3145 0.0152  0.0178  0.0027  46  VAL A CG2 
445  N N   . LEU A 59  ? 0.2567 0.3709 0.2676 -0.0037 0.0165  0.0086  47  LEU A N   
446  C CA  . LEU A 59  ? 0.2705 0.3902 0.2809 -0.0093 0.0152  0.0113  47  LEU A CA  
447  C C   . LEU A 59  ? 0.2865 0.4152 0.2968 -0.0081 0.0148  0.0108  47  LEU A C   
448  O O   . LEU A 59  ? 0.2975 0.4229 0.3091 -0.0037 0.0149  0.0080  47  LEU A O   
449  C CB  . LEU A 59  ? 0.2823 0.3897 0.2937 -0.0127 0.0145  0.0134  47  LEU A CB  
450  C CG  . LEU A 59  ? 0.3186 0.4256 0.3297 -0.0195 0.0126  0.0173  47  LEU A CG  
451  C CD1 . LEU A 59  ? 0.3122 0.4257 0.3220 -0.0234 0.0122  0.0177  47  LEU A CD1 
452  C CD2 . LEU A 59  ? 0.3469 0.4393 0.3600 -0.0202 0.0119  0.0177  47  LEU A CD2 
453  N N   . ASP A 60  ? 0.2761 0.4166 0.2849 -0.0125 0.0143  0.0133  48  ASP A N   
454  C CA  . ASP A 60  ? 0.2934 0.4459 0.3007 -0.0116 0.0143  0.0127  48  ASP A CA  
455  C C   . ASP A 60  ? 0.3197 0.4661 0.3261 -0.0126 0.0128  0.0144  48  ASP A C   
456  O O   . ASP A 60  ? 0.3208 0.4736 0.3258 -0.0096 0.0125  0.0118  48  ASP A O   
457  C CB  . ASP A 60  ? 0.3476 0.5159 0.3534 -0.0172 0.0148  0.0162  48  ASP A CB  
458  C CG  . ASP A 60  ? 0.4020 0.5640 0.4076 -0.0256 0.0133  0.0228  48  ASP A CG  
459  O OD1 . ASP A 60  ? 0.3655 0.5136 0.3727 -0.0268 0.0124  0.0231  48  ASP A OD1 
460  O OD2 . ASP A 60  ? 0.4372 0.6081 0.4409 -0.0310 0.0130  0.0277  48  ASP A OD2 
461  N N   . LYS A 61  ? 0.2663 0.4007 0.2738 -0.0164 0.0115  0.0184  49  LYS A N   
462  C CA  . LYS A 61  ? 0.2396 0.3683 0.2471 -0.0175 0.0093  0.0210  49  LYS A CA  
463  C C   . LYS A 61  ? 0.1981 0.3106 0.2099 -0.0157 0.0089  0.0199  49  LYS A C   
464  O O   . LYS A 61  ? 0.2202 0.3268 0.2334 -0.0153 0.0104  0.0186  49  LYS A O   
465  C CB  . LYS A 61  ? 0.3157 0.4470 0.3209 -0.0246 0.0076  0.0283  49  LYS A CB  
466  C CG  . LYS A 61  ? 0.3874 0.5370 0.3882 -0.0276 0.0085  0.0307  49  LYS A CG  
467  C CD  . LYS A 61  ? 0.4312 0.5901 0.4285 -0.0241 0.0080  0.0285  49  LYS A CD  
468  C CE  . LYS A 61  ? 0.4752 0.6542 0.4673 -0.0275 0.0093  0.0314  49  LYS A CE  
469  N NZ  . LYS A 61  ? 0.4994 0.6904 0.4880 -0.0217 0.0099  0.0252  49  LYS A NZ  
470  N N   . THR A 62  ? 0.1882 0.2951 0.2021 -0.0146 0.0069  0.0205  50  THR A N   
471  C CA  . THR A 62  ? 0.1869 0.2809 0.2061 -0.0125 0.0069  0.0192  50  THR A CA  
472  C C   . THR A 62  ? 0.2058 0.2923 0.2271 -0.0152 0.0040  0.0239  50  THR A C   
473  O O   . THR A 62  ? 0.1987 0.2751 0.2239 -0.0147 0.0045  0.0234  50  THR A O   
474  C CB  . THR A 62  ? 0.2577 0.3512 0.2804 -0.0081 0.0067  0.0151  50  THR A CB  
475  O OG1 . THR A 62  ? 0.2845 0.3820 0.3063 -0.0049 0.0088  0.0106  50  THR A OG1 
476  C CG2 . THR A 62  ? 0.2762 0.3590 0.3056 -0.0064 0.0071  0.0142  50  THR A CG2 
477  N N   . LYS A 63  ? 0.1791 0.2708 0.1977 -0.0174 0.0010  0.0282  51  LYS A N   
478  C CA  . LYS A 63  ? 0.1903 0.2747 0.2109 -0.0194 -0.0028 0.0336  51  LYS A CA  
479  C C   . LYS A 63  ? 0.2025 0.2860 0.2198 -0.0255 -0.0041 0.0401  51  LYS A C   
480  O O   . LYS A 63  ? 0.2063 0.3011 0.2180 -0.0291 -0.0037 0.0432  51  LYS A O   
481  C CB  . LYS A 63  ? 0.2300 0.3207 0.2489 -0.0185 -0.0063 0.0358  51  LYS A CB  
482  C CG  . LYS A 63  ? 0.3036 0.3941 0.3272 -0.0134 -0.0066 0.0302  51  LYS A CG  
483  C CD  . LYS A 63  ? 0.3506 0.4472 0.3723 -0.0130 -0.0113 0.0326  51  LYS A CD  
484  C CE  . LYS A 63  ? 0.4015 0.5122 0.4139 -0.0150 -0.0112 0.0336  51  LYS A CE  
485  N NZ  . LYS A 63  ? 0.4394 0.5584 0.4494 -0.0128 -0.0148 0.0317  51  LYS A NZ  
486  N N   . PHE A 64  ? 0.1728 0.2433 0.1940 -0.0267 -0.0057 0.0420  52  PHE A N   
487  C CA  . PHE A 64  ? 0.1917 0.2584 0.2112 -0.0332 -0.0074 0.0478  52  PHE A CA  
488  C C   . PHE A 64  ? 0.2357 0.2898 0.2586 -0.0340 -0.0124 0.0534  52  PHE A C   
489  O O   . PHE A 64  ? 0.1848 0.2316 0.2132 -0.0286 -0.0136 0.0507  52  PHE A O   
490  C CB  . PHE A 64  ? 0.1854 0.2467 0.2064 -0.0340 -0.0050 0.0431  52  PHE A CB  
491  C CG  . PHE A 64  ? 0.1976 0.2711 0.2152 -0.0336 -0.0009 0.0389  52  PHE A CG  
492  C CD1 . PHE A 64  ? 0.2586 0.3427 0.2726 -0.0392 -0.0004 0.0420  52  PHE A CD1 
493  C CD2 . PHE A 64  ? 0.1890 0.2640 0.2078 -0.0277 0.0022  0.0323  52  PHE A CD2 
494  C CE1 . PHE A 64  ? 0.2258 0.3219 0.2376 -0.0378 0.0028  0.0379  52  PHE A CE1 
495  C CE2 . PHE A 64  ? 0.2399 0.3250 0.2559 -0.0266 0.0052  0.0289  52  PHE A CE2 
496  C CZ  . PHE A 64  ? 0.1847 0.2806 0.1974 -0.0312 0.0053  0.0314  52  PHE A CZ  
497  N N   . LEU A 65  ? 0.1680 0.2200 0.1886 -0.0407 -0.0153 0.0616  53  LEU A N   
498  C CA  . LEU A 65  ? 0.1929 0.2297 0.2175 -0.0417 -0.0207 0.0676  53  LEU A CA  
499  C C   . LEU A 65  ? 0.2264 0.2516 0.2534 -0.0468 -0.0216 0.0678  53  LEU A C   
500  O O   . LEU A 65  ? 0.2494 0.2814 0.2728 -0.0538 -0.0203 0.0706  53  LEU A O   
501  C CB  . LEU A 65  ? 0.2391 0.2809 0.2590 -0.0459 -0.0247 0.0786  53  LEU A CB  
502  C CG  . LEU A 65  ? 0.3152 0.3612 0.3344 -0.0407 -0.0275 0.0805  53  LEU A CG  
503  C CD1 . LEU A 65  ? 0.3503 0.3999 0.3637 -0.0460 -0.0320 0.0930  53  LEU A CD1 
504  C CD2 . LEU A 65  ? 0.2964 0.3283 0.3247 -0.0338 -0.0303 0.0767  53  LEU A CD2 
505  N N   . VAL A 66  ? 0.2340 0.2426 0.2676 -0.0432 -0.0238 0.0642  54  VAL A N   
506  C CA  . VAL A 66  ? 0.2634 0.2594 0.2997 -0.0473 -0.0251 0.0623  54  VAL A CA  
507  C C   . VAL A 66  ? 0.2696 0.2470 0.3110 -0.0483 -0.0317 0.0681  54  VAL A C   
508  O O   . VAL A 66  ? 0.2699 0.2393 0.3166 -0.0411 -0.0339 0.0664  54  VAL A O   
509  C CB  . VAL A 66  ? 0.2304 0.2226 0.2697 -0.0414 -0.0214 0.0502  54  VAL A CB  
510  C CG1 . VAL A 66  ? 0.2325 0.2134 0.2733 -0.0459 -0.0229 0.0468  54  VAL A CG1 
511  C CG2 . VAL A 66  ? 0.2024 0.2111 0.2373 -0.0392 -0.0154 0.0450  54  VAL A CG2 
512  N N   . PRO A 67  ? 0.2917 0.2621 0.3325 -0.0573 -0.0351 0.0752  55  PRO A N   
513  C CA  . PRO A 67  ? 0.3296 0.2792 0.3761 -0.0584 -0.0422 0.0810  55  PRO A CA  
514  C C   . PRO A 67  ? 0.3251 0.2591 0.3790 -0.0502 -0.0430 0.0698  55  PRO A C   
515  O O   . PRO A 67  ? 0.3283 0.2644 0.3821 -0.0491 -0.0390 0.0595  55  PRO A O   
516  C CB  . PRO A 67  ? 0.3155 0.2608 0.3609 -0.0703 -0.0443 0.0870  55  PRO A CB  
517  C CG  . PRO A 67  ? 0.3112 0.2803 0.3492 -0.0757 -0.0388 0.0892  55  PRO A CG  
518  C CD  . PRO A 67  ? 0.3068 0.2878 0.3431 -0.0668 -0.0329 0.0779  55  PRO A CD  
519  N N   . ASP A 68  ? 0.3260 0.2461 0.3864 -0.0442 -0.0480 0.0717  56  ASP A N   
520  C CA  . ASP A 68  ? 0.3730 0.2841 0.4407 -0.0342 -0.0472 0.0598  56  ASP A CA  
521  C C   . ASP A 68  ? 0.3917 0.2857 0.4634 -0.0352 -0.0490 0.0516  56  ASP A C   
522  O O   . ASP A 68  ? 0.3591 0.2479 0.4358 -0.0268 -0.0474 0.0402  56  ASP A O   
523  C CB  . ASP A 68  ? 0.4105 0.3158 0.4850 -0.0255 -0.0514 0.0625  56  ASP A CB  
524  C CG  . ASP A 68  ? 0.5058 0.3926 0.5842 -0.0280 -0.0602 0.0731  56  ASP A CG  
525  O OD1 . ASP A 68  ? 0.5156 0.3909 0.5928 -0.0365 -0.0632 0.0771  56  ASP A OD1 
526  O OD2 . ASP A 68  ? 0.5376 0.4212 0.6209 -0.0216 -0.0646 0.0777  56  ASP A OD2 
527  N N   . HIS A 69  ? 0.4320 0.3188 0.5017 -0.0455 -0.0521 0.0569  57  HIS A N   
528  C CA  . HIS A 69  ? 0.4147 0.2845 0.4883 -0.0477 -0.0549 0.0490  57  HIS A CA  
529  C C   . HIS A 69  ? 0.4214 0.3034 0.4895 -0.0514 -0.0493 0.0399  57  HIS A C   
530  O O   . HIS A 69  ? 0.4698 0.3413 0.5397 -0.0525 -0.0507 0.0308  57  HIS A O   
531  C CB  . HIS A 69  ? 0.4363 0.2893 0.5125 -0.0576 -0.0626 0.0599  57  HIS A CB  
532  C CG  . HIS A 69  ? 0.4632 0.3302 0.5328 -0.0695 -0.0614 0.0720  57  HIS A CG  
533  N ND1 . HIS A 69  ? 0.4667 0.3431 0.5326 -0.0715 -0.0620 0.0855  57  HIS A ND1 
534  C CD2 . HIS A 69  ? 0.5309 0.4065 0.5968 -0.0799 -0.0594 0.0721  57  HIS A CD2 
535  C CE1 . HIS A 69  ? 0.4756 0.3657 0.5357 -0.0824 -0.0600 0.0933  57  HIS A CE1 
536  N NE2 . HIS A 69  ? 0.5223 0.4125 0.5830 -0.0877 -0.0583 0.0856  57  HIS A NE2 
537  N N   . VAL A 70  ? 0.3367 0.2406 0.3979 -0.0528 -0.0433 0.0420  58  VAL A N   
538  C CA  . VAL A 70  ? 0.3321 0.2494 0.3880 -0.0552 -0.0381 0.0344  58  VAL A CA  
539  C C   . VAL A 70  ? 0.3489 0.2650 0.4055 -0.0459 -0.0344 0.0201  58  VAL A C   
540  O O   . VAL A 70  ? 0.3379 0.2571 0.3963 -0.0367 -0.0316 0.0172  58  VAL A O   
541  C CB  . VAL A 70  ? 0.3178 0.2580 0.3672 -0.0566 -0.0329 0.0397  58  VAL A CB  
542  C CG1 . VAL A 70  ? 0.3264 0.2806 0.3709 -0.0565 -0.0275 0.0314  58  VAL A CG1 
543  C CG2 . VAL A 70  ? 0.3580 0.3025 0.4055 -0.0669 -0.0356 0.0527  58  VAL A CG2 
544  N N   . ASN A 71  ? 0.3563 0.2687 0.4114 -0.0486 -0.0346 0.0113  59  ASN A N   
545  C CA  . ASN A 71  ? 0.3831 0.2968 0.4367 -0.0408 -0.0307 -0.0023 59  ASN A CA  
546  C C   . ASN A 71  ? 0.2897 0.2245 0.3367 -0.0377 -0.0234 -0.0037 59  ASN A C   
547  O O   . ASN A 71  ? 0.2849 0.2328 0.3276 -0.0435 -0.0219 0.0028  59  ASN A O   
548  C CB  . ASN A 71  ? 0.4778 0.3846 0.5299 -0.0456 -0.0333 -0.0109 59  ASN A CB  
549  C CG  . ASN A 71  ? 0.6311 0.5140 0.6904 -0.0462 -0.0404 -0.0141 59  ASN A CG  
550  O OD1 . ASN A 71  ? 0.6860 0.5569 0.7517 -0.0425 -0.0436 -0.0092 59  ASN A OD1 
551  N ND2 . ASN A 71  ? 0.6727 0.5480 0.7314 -0.0507 -0.0436 -0.0225 59  ASN A ND2 
552  N N   . MET A 72  ? 0.2363 0.1746 0.2827 -0.0288 -0.0187 -0.0121 60  MET A N   
553  C CA  . MET A 72  ? 0.2572 0.2136 0.2980 -0.0258 -0.0120 -0.0124 60  MET A CA  
554  C C   . MET A 72  ? 0.2882 0.2548 0.3216 -0.0312 -0.0107 -0.0143 60  MET A C   
555  O O   . MET A 72  ? 0.2479 0.2287 0.2775 -0.0329 -0.0078 -0.0094 60  MET A O   
556  C CB  . MET A 72  ? 0.2847 0.2434 0.3263 -0.0162 -0.0070 -0.0207 60  MET A CB  
557  C CG  . MET A 72  ? 0.2922 0.2458 0.3422 -0.0096 -0.0073 -0.0190 60  MET A CG  
558  S SD  . MET A 72  ? 0.2867 0.2468 0.3392 -0.0116 -0.0085 -0.0062 60  MET A SD  
559  C CE  . MET A 72  ? 0.1865 0.1660 0.2332 -0.0101 -0.0012 -0.0062 60  MET A CE  
560  N N   . SER A 73  ? 0.2916 0.2512 0.3235 -0.0336 -0.0133 -0.0219 61  SER A N   
561  C CA  . SER A 73  ? 0.2861 0.2560 0.3114 -0.0384 -0.0128 -0.0247 61  SER A CA  
562  C C   . SER A 73  ? 0.2723 0.2491 0.2981 -0.0474 -0.0153 -0.0151 61  SER A C   
563  O O   . SER A 73  ? 0.2806 0.2722 0.3018 -0.0500 -0.0134 -0.0139 61  SER A O   
564  C CB  . SER A 73  ? 0.3576 0.3174 0.3819 -0.0398 -0.0164 -0.0352 61  SER A CB  
565  O OG  . SER A 73  ? 0.4444 0.3870 0.4757 -0.0448 -0.0229 -0.0335 61  SER A OG  
566  N N   . GLU A 74  ? 0.2934 0.2602 0.3249 -0.0521 -0.0195 -0.0080 62  GLU A N   
567  C CA  . GLU A 74  ? 0.2985 0.2728 0.3309 -0.0611 -0.0215 0.0021  62  GLU A CA  
568  C C   . GLU A 74  ? 0.2607 0.2511 0.2903 -0.0585 -0.0169 0.0089  62  GLU A C   
569  O O   . GLU A 74  ? 0.2329 0.2384 0.2600 -0.0630 -0.0156 0.0127  62  GLU A O   
570  C CB  . GLU A 74  ? 0.4433 0.4012 0.4819 -0.0666 -0.0273 0.0087  62  GLU A CB  
571  C CG  . GLU A 74  ? 0.6047 0.5706 0.6441 -0.0732 -0.0279 0.0218  62  GLU A CG  
572  C CD  . GLU A 74  ? 0.7497 0.7270 0.7883 -0.0839 -0.0290 0.0255  62  GLU A CD  
573  O OE1 . GLU A 74  ? 0.8117 0.7954 0.8512 -0.0908 -0.0298 0.0364  62  GLU A OE1 
574  O OE2 . GLU A 74  ? 0.8032 0.7846 0.8403 -0.0856 -0.0290 0.0176  62  GLU A OE2 
575  N N   . LEU A 75  ? 0.2521 0.2399 0.2829 -0.0509 -0.0146 0.0096  63  LEU A N   
576  C CA  . LEU A 75  ? 0.2278 0.2297 0.2562 -0.0475 -0.0105 0.0142  63  LEU A CA  
577  C C   . LEU A 75  ? 0.1900 0.2056 0.2131 -0.0446 -0.0059 0.0093  63  LEU A C   
578  O O   . LEU A 75  ? 0.1866 0.2164 0.2072 -0.0456 -0.0039 0.0131  63  LEU A O   
579  C CB  . LEU A 75  ? 0.2129 0.2090 0.2447 -0.0399 -0.0094 0.0144  63  LEU A CB  
580  C CG  . LEU A 75  ? 0.1820 0.1908 0.2120 -0.0359 -0.0056 0.0175  63  LEU A CG  
581  C CD1 . LEU A 75  ? 0.1853 0.2045 0.2131 -0.0417 -0.0067 0.0258  63  LEU A CD1 
582  C CD2 . LEU A 75  ? 0.2250 0.2278 0.2601 -0.0295 -0.0057 0.0177  63  LEU A CD2 
583  N N   . VAL A 76  ? 0.1824 0.1944 0.2035 -0.0408 -0.0046 0.0009  64  VAL A N   
584  C CA  . VAL A 76  ? 0.1901 0.2146 0.2056 -0.0382 -0.0009 -0.0027 64  VAL A CA  
585  C C   . VAL A 76  ? 0.1811 0.2172 0.1945 -0.0449 -0.0026 -0.0003 64  VAL A C   
586  O O   . VAL A 76  ? 0.1614 0.2109 0.1720 -0.0433 -0.0001 0.0016  64  VAL A O   
587  C CB  . VAL A 76  ? 0.2266 0.2463 0.2388 -0.0338 0.0006  -0.0118 64  VAL A CB  
588  C CG1 . VAL A 76  ? 0.2152 0.2481 0.2207 -0.0316 0.0037  -0.0139 64  VAL A CG1 
589  C CG2 . VAL A 76  ? 0.2428 0.2552 0.2580 -0.0266 0.0033  -0.0141 64  VAL A CG2 
590  N N   . LYS A 77  ? 0.2032 0.2343 0.2188 -0.0524 -0.0071 -0.0002 65  LYS A N   
591  C CA  . LYS A 77  ? 0.2187 0.2627 0.2339 -0.0594 -0.0087 0.0022  65  LYS A CA  
592  C C   . LYS A 77  ? 0.2052 0.2612 0.2221 -0.0622 -0.0076 0.0110  65  LYS A C   
593  O O   . LYS A 77  ? 0.1659 0.2385 0.1816 -0.0635 -0.0063 0.0123  65  LYS A O   
594  C CB  . LYS A 77  ? 0.3210 0.3565 0.3395 -0.0681 -0.0142 0.0007  65  LYS A CB  
595  C CG  . LYS A 77  ? 0.4388 0.4573 0.4572 -0.0654 -0.0162 -0.0076 65  LYS A CG  
596  C CD  . LYS A 77  ? 0.4810 0.5044 0.4944 -0.0642 -0.0166 -0.0168 65  LYS A CD  
597  C CE  . LYS A 77  ? 0.5321 0.5465 0.5487 -0.0726 -0.0229 -0.0211 65  LYS A CE  
598  N NZ  . LYS A 77  ? 0.6025 0.5966 0.6252 -0.0747 -0.0262 -0.0193 65  LYS A NZ  
599  N N   . ILE A 78  ? 0.1746 0.2232 0.1942 -0.0629 -0.0082 0.0169  66  ILE A N   
600  C CA  . ILE A 78  ? 0.1685 0.2289 0.1884 -0.0649 -0.0069 0.0249  66  ILE A CA  
601  C C   . ILE A 78  ? 0.1549 0.2287 0.1715 -0.0576 -0.0024 0.0231  66  ILE A C   
602  O O   . ILE A 78  ? 0.1740 0.2642 0.1899 -0.0591 -0.0010 0.0257  66  ILE A O   
603  C CB  . ILE A 78  ? 0.1733 0.2229 0.1955 -0.0650 -0.0085 0.0310  66  ILE A CB  
604  C CG1 . ILE A 78  ? 0.2298 0.2659 0.2559 -0.0733 -0.0136 0.0348  66  ILE A CG1 
605  C CG2 . ILE A 78  ? 0.1667 0.2303 0.1872 -0.0655 -0.0066 0.0380  66  ILE A CG2 
606  C CD1 . ILE A 78  ? 0.2693 0.2923 0.2978 -0.0723 -0.0162 0.0409  66  ILE A CD1 
607  N N   . ILE A 79  ? 0.1700 0.2369 0.1852 -0.0496 -0.0002 0.0186  67  ILE A N   
608  C CA  . ILE A 79  ? 0.1689 0.2451 0.1816 -0.0427 0.0036  0.0172  67  ILE A CA  
609  C C   . ILE A 79  ? 0.1418 0.2289 0.1517 -0.0417 0.0046  0.0136  67  ILE A C   
610  O O   . ILE A 79  ? 0.1599 0.2598 0.1689 -0.0390 0.0064  0.0144  67  ILE A O   
611  C CB  . ILE A 79  ? 0.1662 0.2323 0.1791 -0.0356 0.0056  0.0140  67  ILE A CB  
612  C CG1 . ILE A 79  ? 0.1922 0.2489 0.2089 -0.0360 0.0039  0.0177  67  ILE A CG1 
613  C CG2 . ILE A 79  ? 0.1601 0.2345 0.1714 -0.0294 0.0091  0.0131  67  ILE A CG2 
614  C CD1 . ILE A 79  ? 0.2286 0.2941 0.2452 -0.0387 0.0031  0.0242  67  ILE A CD1 
615  N N   . ARG A 80  ? 0.1450 0.2272 0.1537 -0.0433 0.0031  0.0092  68  ARG A N   
616  C CA  . ARG A 80  ? 0.1639 0.2569 0.1697 -0.0426 0.0031  0.0061  68  ARG A CA  
617  C C   . ARG A 80  ? 0.1853 0.2947 0.1936 -0.0477 0.0019  0.0097  68  ARG A C   
618  O O   . ARG A 80  ? 0.1818 0.3045 0.1890 -0.0441 0.0031  0.0093  68  ARG A O   
619  C CB  . ARG A 80  ? 0.1861 0.2714 0.1897 -0.0445 0.0007  0.0003  68  ARG A CB  
620  C CG  . ARG A 80  ? 0.2000 0.2929 0.1983 -0.0403 0.0015  -0.0038 68  ARG A CG  
621  C CD  . ARG A 80  ? 0.1649 0.2534 0.1602 -0.0431 -0.0016 -0.0102 68  ARG A CD  
622  N NE  . ARG A 80  ? 0.1955 0.2935 0.1847 -0.0388 -0.0012 -0.0130 68  ARG A NE  
623  C CZ  . ARG A 80  ? 0.2024 0.3152 0.1919 -0.0408 -0.0035 -0.0123 68  ARG A CZ  
624  N NH1 . ARG A 80  ? 0.2275 0.3479 0.2233 -0.0475 -0.0058 -0.0092 68  ARG A NH1 
625  N NH2 . ARG A 80  ? 0.1719 0.2926 0.1554 -0.0361 -0.0036 -0.0141 68  ARG A NH2 
626  N N   . ARG A 81  ? 0.1646 0.2735 0.1766 -0.0560 -0.0006 0.0136  69  ARG A N   
627  C CA  . ARG A 81  ? 0.1429 0.2694 0.1581 -0.0616 -0.0009 0.0178  69  ARG A CA  
628  C C   . ARG A 81  ? 0.1588 0.2964 0.1737 -0.0574 0.0023  0.0213  69  ARG A C   
629  O O   . ARG A 81  ? 0.1787 0.3346 0.1950 -0.0570 0.0034  0.0218  69  ARG A O   
630  C CB  . ARG A 81  ? 0.1527 0.2756 0.1721 -0.0726 -0.0041 0.0225  69  ARG A CB  
631  C CG  . ARG A 81  ? 0.1824 0.2994 0.2035 -0.0787 -0.0082 0.0186  69  ARG A CG  
632  C CD  . ARG A 81  ? 0.1731 0.2877 0.1998 -0.0907 -0.0116 0.0245  69  ARG A CD  
633  N NE  . ARG A 81  ? 0.2103 0.3087 0.2373 -0.0916 -0.0121 0.0297  69  ARG A NE  
634  C CZ  . ARG A 81  ? 0.2311 0.3077 0.2588 -0.0920 -0.0153 0.0273  69  ARG A CZ  
635  N NH1 . ARG A 81  ? 0.2534 0.3219 0.2807 -0.0916 -0.0177 0.0190  69  ARG A NH1 
636  N NH2 . ARG A 81  ? 0.2573 0.3208 0.2860 -0.0922 -0.0162 0.0328  69  ARG A NH2 
637  N N   . ARG A 82  ? 0.1403 0.2680 0.1539 -0.0539 0.0036  0.0231  70  ARG A N   
638  C CA  . ARG A 82  ? 0.1724 0.3101 0.1853 -0.0498 0.0062  0.0252  70  ARG A CA  
639  C C   . ARG A 82  ? 0.2047 0.3506 0.2161 -0.0411 0.0085  0.0206  70  ARG A C   
640  O O   . ARG A 82  ? 0.2099 0.3703 0.2218 -0.0385 0.0101  0.0208  70  ARG A O   
641  C CB  . ARG A 82  ? 0.1999 0.3251 0.2120 -0.0477 0.0063  0.0275  70  ARG A CB  
642  C CG  . ARG A 82  ? 0.2351 0.3712 0.2460 -0.0459 0.0079  0.0303  70  ARG A CG  
643  C CD  . ARG A 82  ? 0.2340 0.3581 0.2442 -0.0436 0.0072  0.0322  70  ARG A CD  
644  N NE  . ARG A 82  ? 0.2549 0.3903 0.2631 -0.0424 0.0081  0.0346  70  ARG A NE  
645  C CZ  . ARG A 82  ? 0.2823 0.4229 0.2892 -0.0483 0.0070  0.0413  70  ARG A CZ  
646  N NH1 . ARG A 82  ? 0.3157 0.4680 0.3194 -0.0463 0.0080  0.0424  70  ARG A NH1 
647  N NH2 . ARG A 82  ? 0.2797 0.4134 0.2881 -0.0561 0.0045  0.0470  70  ARG A NH2 
648  N N   . LEU A 83  ? 0.1568 0.2935 0.1664 -0.0367 0.0085  0.0164  71  LEU A N   
649  C CA  . LEU A 83  ? 0.1586 0.3006 0.1666 -0.0289 0.0100  0.0131  71  LEU A CA  
650  C C   . LEU A 83  ? 0.1721 0.3287 0.1810 -0.0299 0.0086  0.0117  71  LEU A C   
651  O O   . LEU A 83  ? 0.1719 0.3344 0.1800 -0.0234 0.0091  0.0096  71  LEU A O   
652  C CB  . LEU A 83  ? 0.1627 0.2904 0.1678 -0.0244 0.0107  0.0103  71  LEU A CB  
653  C CG  . LEU A 83  ? 0.1952 0.3101 0.2005 -0.0214 0.0124  0.0107  71  LEU A CG  
654  C CD1 . LEU A 83  ? 0.1889 0.2918 0.1918 -0.0190 0.0133  0.0082  71  LEU A CD1 
655  C CD2 . LEU A 83  ? 0.2224 0.3418 0.2285 -0.0152 0.0141  0.0106  71  LEU A CD2 
656  N N   . GLN A 84  ? 0.1295 0.2915 0.1408 -0.0382 0.0065  0.0132  72  GLN A N   
657  C CA  . GLN A 84  ? 0.1347 0.3124 0.1483 -0.0407 0.0046  0.0120  72  GLN A CA  
658  C C   . GLN A 84  ? 0.1678 0.3433 0.1781 -0.0357 0.0032  0.0080  72  GLN A C   
659  O O   . GLN A 84  ? 0.1752 0.3647 0.1866 -0.0319 0.0023  0.0067  72  GLN A O   
660  C CB  . GLN A 84  ? 0.1664 0.3643 0.1835 -0.0381 0.0062  0.0131  72  GLN A CB  
661  C CG  . GLN A 84  ? 0.1771 0.3800 0.1962 -0.0434 0.0078  0.0175  72  GLN A CG  
662  C CD  . GLN A 84  ? 0.2780 0.5036 0.3004 -0.0408 0.0099  0.0175  72  GLN A CD  
663  O OE1 . GLN A 84  ? 0.3778 0.6050 0.3986 -0.0335 0.0121  0.0160  72  GLN A OE1 
664  N NE2 . GLN A 84  ? 0.2977 0.5415 0.3251 -0.0466 0.0091  0.0186  72  GLN A NE2 
665  N N   . LEU A 85  ? 0.1441 0.3031 0.1501 -0.0355 0.0027  0.0060  73  LEU A N   
666  C CA  . LEU A 85  ? 0.1400 0.2972 0.1411 -0.0313 0.0015  0.0025  73  LEU A CA  
667  C C   . LEU A 85  ? 0.1675 0.3340 0.1695 -0.0367 -0.0026 0.0000  73  LEU A C   
668  O O   . LEU A 85  ? 0.1731 0.3393 0.1787 -0.0455 -0.0048 0.0001  73  LEU A O   
669  C CB  . LEU A 85  ? 0.1446 0.2834 0.1407 -0.0294 0.0029  0.0005  73  LEU A CB  
670  C CG  . LEU A 85  ? 0.1595 0.2883 0.1556 -0.0246 0.0066  0.0025  73  LEU A CG  
671  C CD1 . LEU A 85  ? 0.1679 0.2823 0.1596 -0.0225 0.0080  -0.0002 73  LEU A CD1 
672  C CD2 . LEU A 85  ? 0.1459 0.2817 0.1420 -0.0173 0.0083  0.0040  73  LEU A CD2 
673  N N   . ASN A 86  ? 0.1571 0.3316 0.1558 -0.0317 -0.0041 -0.0018 74  ASN A N   
674  C CA  . ASN A 86  ? 0.1951 0.3780 0.1933 -0.0358 -0.0087 -0.0052 74  ASN A CA  
675  C C   . ASN A 86  ? 0.1507 0.3187 0.1425 -0.0383 -0.0101 -0.0097 74  ASN A C   
676  O O   . ASN A 86  ? 0.1512 0.3047 0.1380 -0.0341 -0.0069 -0.0100 74  ASN A O   
677  C CB  . ASN A 86  ? 0.2642 0.4609 0.2606 -0.0285 -0.0104 -0.0052 74  ASN A CB  
678  C CG  . ASN A 86  ? 0.3265 0.5401 0.3304 -0.0259 -0.0096 -0.0024 74  ASN A CG  
679  O OD1 . ASN A 86  ? 0.3301 0.5542 0.3415 -0.0327 -0.0100 -0.0014 74  ASN A OD1 
680  N ND2 . ASN A 86  ? 0.3475 0.5638 0.3499 -0.0160 -0.0085 -0.0009 74  ASN A ND2 
681  N N   . PRO A 87  ? 0.2062 0.3784 0.1988 -0.0451 -0.0148 -0.0137 75  PRO A N   
682  C CA  . PRO A 87  ? 0.2319 0.3903 0.2188 -0.0477 -0.0166 -0.0197 75  PRO A CA  
683  C C   . PRO A 87  ? 0.2382 0.3909 0.2143 -0.0393 -0.0147 -0.0222 75  PRO A C   
684  O O   . PRO A 87  ? 0.2609 0.3993 0.2325 -0.0388 -0.0133 -0.0260 75  PRO A O   
685  C CB  . PRO A 87  ? 0.2560 0.4250 0.2458 -0.0552 -0.0229 -0.0238 75  PRO A CB  
686  C CG  . PRO A 87  ? 0.2607 0.4437 0.2611 -0.0607 -0.0233 -0.0187 75  PRO A CG  
687  C CD  . PRO A 87  ? 0.2359 0.4256 0.2363 -0.0519 -0.0187 -0.0133 75  PRO A CD  
688  N N   . THR A 88  ? 0.2049 0.3688 0.1773 -0.0325 -0.0146 -0.0197 76  THR A N   
689  C CA  . THR A 88  ? 0.1750 0.3346 0.1365 -0.0253 -0.0129 -0.0207 76  THR A CA  
690  C C   . THR A 88  ? 0.1692 0.3185 0.1288 -0.0188 -0.0067 -0.0161 76  THR A C   
691  O O   . THR A 88  ? 0.1875 0.3333 0.1385 -0.0134 -0.0046 -0.0157 76  THR A O   
692  C CB  . THR A 88  ? 0.2833 0.4583 0.2403 -0.0209 -0.0166 -0.0196 76  THR A CB  
693  O OG1 . THR A 88  ? 0.2928 0.4788 0.2576 -0.0182 -0.0165 -0.0142 76  THR A OG1 
694  C CG2 . THR A 88  ? 0.3318 0.5160 0.2880 -0.0270 -0.0231 -0.0258 76  THR A CG2 
695  N N   . GLN A 89  ? 0.1601 0.3052 0.1275 -0.0197 -0.0040 -0.0126 77  GLN A N   
696  C CA  . GLN A 89  ? 0.1549 0.2909 0.1217 -0.0141 0.0012  -0.0088 77  GLN A CA  
697  C C   . GLN A 89  ? 0.2181 0.3393 0.1834 -0.0155 0.0042  -0.0116 77  GLN A C   
698  O O   . GLN A 89  ? 0.1978 0.3130 0.1681 -0.0209 0.0033  -0.0138 77  GLN A O   
699  C CB  . GLN A 89  ? 0.1729 0.3119 0.1482 -0.0137 0.0025  -0.0045 77  GLN A CB  
700  C CG  . GLN A 89  ? 0.2061 0.3599 0.1839 -0.0102 0.0004  -0.0019 77  GLN A CG  
701  C CD  . GLN A 89  ? 0.2276 0.3843 0.2127 -0.0085 0.0023  0.0011  77  GLN A CD  
702  O OE1 . GLN A 89  ? 0.2566 0.4238 0.2480 -0.0125 0.0009  0.0011  77  GLN A OE1 
703  N NE2 . GLN A 89  ? 0.2562 0.4045 0.2405 -0.0028 0.0056  0.0035  77  GLN A NE2 
704  N N   . ALA A 90  ? 0.1763 0.2921 0.1351 -0.0105 0.0078  -0.0113 78  ALA A N   
705  C CA  . ALA A 90  ? 0.1645 0.2682 0.1225 -0.0104 0.0114  -0.0142 78  ALA A CA  
706  C C   . ALA A 90  ? 0.1557 0.2521 0.1225 -0.0109 0.0137  -0.0111 78  ALA A C   
707  O O   . ALA A 90  ? 0.1480 0.2472 0.1184 -0.0085 0.0149  -0.0060 78  ALA A O   
708  C CB  . ALA A 90  ? 0.1695 0.2724 0.1194 -0.0050 0.0154  -0.0131 78  ALA A CB  
709  N N   . PHE A 91  ? 0.1764 0.2634 0.1468 -0.0137 0.0140  -0.0145 79  PHE A N   
710  C CA  . PHE A 91  ? 0.1510 0.2316 0.1293 -0.0144 0.0154  -0.0115 79  PHE A CA  
711  C C   . PHE A 91  ? 0.1560 0.2252 0.1363 -0.0141 0.0169  -0.0154 79  PHE A C   
712  O O   . PHE A 91  ? 0.1877 0.2519 0.1677 -0.0172 0.0142  -0.0206 79  PHE A O   
713  C CB  . PHE A 91  ? 0.1477 0.2317 0.1317 -0.0199 0.0115  -0.0095 79  PHE A CB  
714  C CG  . PHE A 91  ? 0.1602 0.2385 0.1511 -0.0210 0.0123  -0.0061 79  PHE A CG  
715  C CD1 . PHE A 91  ? 0.1621 0.2435 0.1553 -0.0175 0.0146  -0.0019 79  PHE A CD1 
716  C CD2 . PHE A 91  ? 0.2086 0.2781 0.2036 -0.0254 0.0100  -0.0071 79  PHE A CD2 
717  C CE1 . PHE A 91  ? 0.1662 0.2435 0.1649 -0.0184 0.0147  0.0009  79  PHE A CE1 
718  C CE2 . PHE A 91  ? 0.2095 0.2744 0.2101 -0.0262 0.0101  -0.0031 79  PHE A CE2 
719  C CZ  . PHE A 91  ? 0.2027 0.2723 0.2047 -0.0226 0.0125  0.0007  79  PHE A CZ  
720  N N   . PHE A 92  ? 0.1605 0.2258 0.1436 -0.0103 0.0210  -0.0134 80  PHE A N   
721  C CA  . PHE A 92  ? 0.1956 0.2517 0.1827 -0.0090 0.0226  -0.0168 80  PHE A CA  
722  C C   . PHE A 92  ? 0.1865 0.2389 0.1819 -0.0089 0.0229  -0.0124 80  PHE A C   
723  O O   . PHE A 92  ? 0.1952 0.2520 0.1919 -0.0072 0.0247  -0.0079 80  PHE A O   
724  C CB  . PHE A 92  ? 0.1760 0.2332 0.1588 -0.0042 0.0278  -0.0191 80  PHE A CB  
725  C CG  . PHE A 92  ? 0.2157 0.2767 0.1889 -0.0038 0.0277  -0.0244 80  PHE A CG  
726  C CD1 . PHE A 92  ? 0.2669 0.3367 0.2326 -0.0036 0.0270  -0.0217 80  PHE A CD1 
727  C CD2 . PHE A 92  ? 0.2707 0.3268 0.2423 -0.0030 0.0279  -0.0324 80  PHE A CD2 
728  C CE1 . PHE A 92  ? 0.2974 0.3719 0.2534 -0.0031 0.0264  -0.0265 80  PHE A CE1 
729  C CE2 . PHE A 92  ? 0.3150 0.3755 0.2768 -0.0024 0.0275  -0.0382 80  PHE A CE2 
730  C CZ  . PHE A 92  ? 0.2993 0.3693 0.2527 -0.0027 0.0267  -0.0350 80  PHE A CZ  
731  N N   . LEU A 93  ? 0.1595 0.2036 0.1605 -0.0107 0.0205  -0.0138 81  LEU A N   
732  C CA  . LEU A 93  ? 0.1459 0.1867 0.1545 -0.0102 0.0203  -0.0097 81  LEU A CA  
733  C C   . LEU A 93  ? 0.1929 0.2274 0.2059 -0.0061 0.0227  -0.0135 81  LEU A C   
734  O O   . LEU A 93  ? 0.2089 0.2367 0.2220 -0.0059 0.0214  -0.0189 81  LEU A O   
735  C CB  . LEU A 93  ? 0.1980 0.2351 0.2098 -0.0154 0.0152  -0.0069 81  LEU A CB  
736  C CG  . LEU A 93  ? 0.2062 0.2411 0.2242 -0.0155 0.0139  -0.0018 81  LEU A CG  
737  C CD1 . LEU A 93  ? 0.1836 0.2275 0.2012 -0.0137 0.0161  0.0019  81  LEU A CD1 
738  C CD2 . LEU A 93  ? 0.1959 0.2280 0.2154 -0.0215 0.0090  0.0020  81  LEU A CD2 
739  N N   . LEU A 94  ? 0.1769 0.2139 0.1940 -0.0027 0.0261  -0.0114 82  LEU A N   
740  C CA  . LEU A 94  ? 0.1784 0.2135 0.2001 0.0018  0.0297  -0.0151 82  LEU A CA  
741  C C   . LEU A 94  ? 0.1863 0.2179 0.2180 0.0031  0.0282  -0.0129 82  LEU A C   
742  O O   . LEU A 94  ? 0.1924 0.2265 0.2267 0.0018  0.0268  -0.0078 82  LEU A O   
743  C CB  . LEU A 94  ? 0.2047 0.2476 0.2237 0.0042  0.0355  -0.0141 82  LEU A CB  
744  C CG  . LEU A 94  ? 0.2780 0.3262 0.2864 0.0032  0.0367  -0.0139 82  LEU A CG  
745  C CD1 . LEU A 94  ? 0.3372 0.3916 0.3441 0.0053  0.0420  -0.0106 82  LEU A CD1 
746  C CD2 . LEU A 94  ? 0.2643 0.3109 0.2665 0.0037  0.0365  -0.0207 82  LEU A CD2 
747  N N   . VAL A 95  ? 0.2001 0.2263 0.2375 0.0064  0.0282  -0.0173 83  VAL A N   
748  C CA  . VAL A 95  ? 0.1740 0.1983 0.2219 0.0090  0.0270  -0.0159 83  VAL A CA  
749  C C   . VAL A 95  ? 0.2188 0.2481 0.2717 0.0142  0.0327  -0.0204 83  VAL A C   
750  O O   . VAL A 95  ? 0.2354 0.2629 0.2867 0.0170  0.0347  -0.0269 83  VAL A O   
751  C CB  . VAL A 95  ? 0.1831 0.1962 0.2355 0.0091  0.0211  -0.0168 83  VAL A CB  
752  C CG1 . VAL A 95  ? 0.2081 0.2201 0.2720 0.0135  0.0200  -0.0162 83  VAL A CG1 
753  C CG2 . VAL A 95  ? 0.2233 0.2331 0.2718 0.0032  0.0158  -0.0109 83  VAL A CG2 
754  N N   . ASN A 96  ? 0.2071 0.2434 0.2662 0.0152  0.0355  -0.0173 84  ASN A N   
755  C CA  . ASN A 96  ? 0.2322 0.2760 0.2971 0.0192  0.0417  -0.0206 84  ASN A CA  
756  C C   . ASN A 96  ? 0.2560 0.3043 0.3110 0.0194  0.0472  -0.0239 84  ASN A C   
757  O O   . ASN A 96  ? 0.2473 0.2986 0.3032 0.0232  0.0512  -0.0300 84  ASN A O   
758  C CB  . ASN A 96  ? 0.2831 0.3239 0.3582 0.0243  0.0405  -0.0256 84  ASN A CB  
759  C CG  . ASN A 96  ? 0.3574 0.4089 0.4414 0.0283  0.0468  -0.0282 84  ASN A CG  
760  O OD1 . ASN A 96  ? 0.3870 0.4467 0.4743 0.0262  0.0499  -0.0238 84  ASN A OD1 
761  N ND2 . ASN A 96  ? 0.4044 0.4563 0.4927 0.0338  0.0488  -0.0356 84  ASN A ND2 
762  N N   . GLN A 97  ? 0.2351 0.2846 0.2807 0.0156  0.0472  -0.0199 85  GLN A N   
763  C CA  . GLN A 97  ? 0.3269 0.3804 0.3609 0.0151  0.0508  -0.0214 85  GLN A CA  
764  C C   . GLN A 97  ? 0.3073 0.3571 0.3340 0.0164  0.0498  -0.0288 85  GLN A C   
765  O O   . GLN A 97  ? 0.3546 0.4096 0.3718 0.0167  0.0532  -0.0309 85  GLN A O   
766  C CB  . GLN A 97  ? 0.4342 0.4974 0.4678 0.0160  0.0582  -0.0193 85  GLN A CB  
767  C CG  . GLN A 97  ? 0.5191 0.5877 0.5655 0.0181  0.0619  -0.0192 85  GLN A CG  
768  C CD  . GLN A 97  ? 0.5866 0.6577 0.6386 0.0151  0.0621  -0.0119 85  GLN A CD  
769  O OE1 . GLN A 97  ? 0.6285 0.6942 0.6805 0.0128  0.0569  -0.0085 85  GLN A OE1 
770  N NE2 . GLN A 97  ? 0.5955 0.6751 0.6524 0.0149  0.0683  -0.0096 85  GLN A NE2 
771  N N   . HIS A 98  ? 0.2510 0.2917 0.2818 0.0168  0.0446  -0.0326 86  HIS A N   
772  C CA  . HIS A 98  ? 0.2382 0.2733 0.2625 0.0171  0.0423  -0.0400 86  HIS A CA  
773  C C   . HIS A 98  ? 0.2215 0.2504 0.2407 0.0116  0.0359  -0.0373 86  HIS A C   
774  O O   . HIS A 98  ? 0.2034 0.2278 0.2279 0.0089  0.0317  -0.0318 86  HIS A O   
775  C CB  . HIS A 98  ? 0.2529 0.2807 0.2855 0.0216  0.0408  -0.0472 86  HIS A CB  
776  C CG  . HIS A 98  ? 0.3303 0.3664 0.3671 0.0277  0.0476  -0.0523 86  HIS A CG  
777  N ND1 . HIS A 98  ? 0.3961 0.4378 0.4253 0.0306  0.0521  -0.0602 86  HIS A ND1 
778  C CD2 . HIS A 98  ? 0.3882 0.4298 0.4363 0.0311  0.0508  -0.0507 86  HIS A CD2 
779  C CE1 . HIS A 98  ? 0.4321 0.4829 0.4677 0.0357  0.0584  -0.0631 86  HIS A CE1 
780  N NE2 . HIS A 98  ? 0.4010 0.4519 0.4488 0.0360  0.0576  -0.0574 86  HIS A NE2 
781  N N   . SER A 99  ? 0.2306 0.2605 0.2398 0.0099  0.0351  -0.0412 87  SER A N   
782  C CA  . SER A 99  ? 0.2152 0.2416 0.2204 0.0043  0.0293  -0.0391 87  SER A CA  
783  C C   . SER A 99  ? 0.2250 0.2387 0.2360 0.0021  0.0231  -0.0417 87  SER A C   
784  O O   . SER A 99  ? 0.2269 0.2333 0.2396 0.0048  0.0222  -0.0498 87  SER A O   
785  C CB  . SER A 99  ? 0.2342 0.2662 0.2278 0.0031  0.0296  -0.0432 87  SER A CB  
786  O OG  . SER A 99  ? 0.2764 0.3062 0.2678 -0.0027 0.0237  -0.0417 87  SER A OG  
787  N N   . MET A 100 ? 0.2270 0.2379 0.2409 -0.0029 0.0187  -0.0348 88  MET A N   
788  C CA  . MET A 100 ? 0.2324 0.2311 0.2518 -0.0063 0.0125  -0.0345 88  MET A CA  
789  C C   . MET A 100 ? 0.2697 0.2666 0.2839 -0.0128 0.0080  -0.0363 88  MET A C   
790  O O   . MET A 100 ? 0.2737 0.2599 0.2920 -0.0172 0.0024  -0.0358 88  MET A O   
791  C CB  . MET A 100 ? 0.2563 0.2546 0.2818 -0.0085 0.0105  -0.0251 88  MET A CB  
792  C CG  . MET A 100 ? 0.2303 0.2305 0.2624 -0.0027 0.0137  -0.0234 88  MET A CG  
793  S SD  . MET A 100 ? 0.2784 0.2657 0.3195 0.0029  0.0117  -0.0296 88  MET A SD  
794  C CE  . MET A 100 ? 0.2458 0.2415 0.2851 0.0101  0.0195  -0.0384 88  MET A CE  
795  N N   . VAL A 101 ? 0.2465 0.2538 0.2523 -0.0136 0.0101  -0.0380 89  VAL A N   
796  C CA  . VAL A 101 ? 0.2386 0.2481 0.2398 -0.0201 0.0059  -0.0389 89  VAL A CA  
797  C C   . VAL A 101 ? 0.3339 0.3305 0.3372 -0.0235 0.0003  -0.0459 89  VAL A C   
798  O O   . VAL A 101 ? 0.3896 0.3831 0.3952 -0.0310 -0.0049 -0.0432 89  VAL A O   
799  C CB  . VAL A 101 ? 0.2813 0.3037 0.2727 -0.0186 0.0088  -0.0413 89  VAL A CB  
800  C CG1 . VAL A 101 ? 0.3213 0.3468 0.3090 -0.0250 0.0037  -0.0436 89  VAL A CG1 
801  C CG2 . VAL A 101 ? 0.2999 0.3334 0.2901 -0.0166 0.0128  -0.0333 89  VAL A CG2 
802  N N   . SER A 102 ? 0.3363 0.3255 0.3396 -0.0181 0.0013  -0.0551 90  SER A N   
803  C CA  . SER A 102 ? 0.3841 0.3593 0.3897 -0.0205 -0.0043 -0.0633 90  SER A CA  
804  C C   . SER A 102 ? 0.3709 0.3308 0.3855 -0.0159 -0.0056 -0.0659 90  SER A C   
805  O O   . SER A 102 ? 0.3848 0.3318 0.4016 -0.0151 -0.0096 -0.0751 90  SER A O   
806  C CB  . SER A 102 ? 0.4180 0.3974 0.4145 -0.0185 -0.0037 -0.0750 90  SER A CB  
807  O OG  . SER A 102 ? 0.4118 0.4045 0.4008 -0.0231 -0.0041 -0.0722 90  SER A OG  
808  N N   . VAL A 103 ? 0.3325 0.2938 0.3527 -0.0127 -0.0029 -0.0582 91  VAL A N   
809  C CA  . VAL A 103 ? 0.3232 0.2718 0.3532 -0.0078 -0.0045 -0.0589 91  VAL A CA  
810  C C   . VAL A 103 ? 0.3925 0.3262 0.4291 -0.0144 -0.0123 -0.0529 91  VAL A C   
811  O O   . VAL A 103 ? 0.3742 0.3122 0.4111 -0.0206 -0.0137 -0.0419 91  VAL A O   
812  C CB  . VAL A 103 ? 0.3353 0.2923 0.3692 -0.0024 0.0006  -0.0525 91  VAL A CB  
813  C CG1 . VAL A 103 ? 0.3418 0.2867 0.3868 0.0027  -0.0021 -0.0524 91  VAL A CG1 
814  C CG2 . VAL A 103 ? 0.3625 0.3333 0.3907 0.0034  0.0083  -0.0577 91  VAL A CG2 
815  N N   . SER A 104 ? 0.4396 0.3559 0.4814 -0.0130 -0.0173 -0.0599 92  SER A N   
816  C CA  . SER A 104 ? 0.4427 0.3423 0.4910 -0.0198 -0.0253 -0.0542 92  SER A CA  
817  C C   . SER A 104 ? 0.4223 0.3125 0.4800 -0.0159 -0.0276 -0.0465 92  SER A C   
818  O O   . SER A 104 ? 0.4764 0.3529 0.5395 -0.0213 -0.0342 -0.0393 92  SER A O   
819  C CB  . SER A 104 ? 0.4985 0.3816 0.5482 -0.0212 -0.0310 -0.0656 92  SER A CB  
820  O OG  . SER A 104 ? 0.5371 0.4134 0.5901 -0.0104 -0.0295 -0.0774 92  SER A OG  
821  N N   . THR A 105 ? 0.4041 0.3024 0.4641 -0.0068 -0.0223 -0.0476 93  THR A N   
822  C CA  . THR A 105 ? 0.3630 0.2546 0.4322 -0.0018 -0.0245 -0.0414 93  THR A CA  
823  C C   . THR A 105 ? 0.3330 0.2274 0.4025 -0.0089 -0.0272 -0.0259 93  THR A C   
824  O O   . THR A 105 ? 0.3257 0.2357 0.3885 -0.0133 -0.0233 -0.0205 93  THR A O   
825  C CB  . THR A 105 ? 0.4018 0.3066 0.4733 0.0081  -0.0175 -0.0451 93  THR A CB  
826  O OG1 . THR A 105 ? 0.4217 0.3271 0.4917 0.0146  -0.0139 -0.0593 93  THR A OG1 
827  C CG2 . THR A 105 ? 0.4123 0.3109 0.4946 0.0140  -0.0204 -0.0401 93  THR A CG2 
828  N N   . PRO A 106 ? 0.3211 0.2005 0.3979 -0.0097 -0.0340 -0.0188 94  PRO A N   
829  C CA  . PRO A 106 ? 0.3291 0.2121 0.4057 -0.0151 -0.0365 -0.0039 94  PRO A CA  
830  C C   . PRO A 106 ? 0.3179 0.2190 0.3934 -0.0103 -0.0309 -0.0005 94  PRO A C   
831  O O   . PRO A 106 ? 0.3338 0.2377 0.4143 -0.0009 -0.0280 -0.0068 94  PRO A O   
832  C CB  . PRO A 106 ? 0.3581 0.2212 0.4440 -0.0125 -0.0443 0.0006  94  PRO A CB  
833  C CG  . PRO A 106 ? 0.3699 0.2151 0.4595 -0.0106 -0.0477 -0.0108 94  PRO A CG  
834  C CD  . PRO A 106 ? 0.3460 0.2035 0.4310 -0.0055 -0.0403 -0.0246 94  PRO A CD  
835  N N   . ILE A 107 ? 0.2674 0.1809 0.3373 -0.0164 -0.0296 0.0090  95  ILE A N   
836  C CA  . ILE A 107 ? 0.2505 0.1806 0.3193 -0.0122 -0.0248 0.0112  95  ILE A CA  
837  C C   . ILE A 107 ? 0.2850 0.2111 0.3622 -0.0056 -0.0280 0.0150  95  ILE A C   
838  O O   . ILE A 107 ? 0.3094 0.2463 0.3892 0.0004  -0.0242 0.0128  95  ILE A O   
839  C CB  . ILE A 107 ? 0.2554 0.2002 0.3163 -0.0195 -0.0228 0.0191  95  ILE A CB  
840  C CG1 . ILE A 107 ? 0.2503 0.2108 0.3104 -0.0148 -0.0178 0.0190  95  ILE A CG1 
841  C CG2 . ILE A 107 ? 0.2277 0.1682 0.2881 -0.0261 -0.0285 0.0311  95  ILE A CG2 
842  C CD1 . ILE A 107 ? 0.2403 0.2159 0.2925 -0.0202 -0.0149 0.0234  95  ILE A CD1 
843  N N   . ALA A 108 ? 0.2848 0.1952 0.3666 -0.0067 -0.0354 0.0209  96  ALA A N   
844  C CA  . ALA A 108 ? 0.3057 0.2113 0.3962 0.0004  -0.0396 0.0245  96  ALA A CA  
845  C C   . ALA A 108 ? 0.3260 0.2324 0.4249 0.0114  -0.0364 0.0131  96  ALA A C   
846  O O   . ALA A 108 ? 0.3133 0.2277 0.4184 0.0178  -0.0359 0.0139  96  ALA A O   
847  C CB  . ALA A 108 ? 0.3800 0.2656 0.4746 -0.0021 -0.0485 0.0319  96  ALA A CB  
848  N N   . ASP A 109 ? 0.3597 0.2591 0.4590 0.0134  -0.0343 0.0022  97  ASP A N   
849  C CA  . ASP A 109 ? 0.3884 0.2898 0.4951 0.0238  -0.0305 -0.0095 97  ASP A CA  
850  C C   . ASP A 109 ? 0.3511 0.2732 0.4543 0.0256  -0.0214 -0.0140 97  ASP A C   
851  O O   . ASP A 109 ? 0.3727 0.3033 0.4836 0.0332  -0.0183 -0.0179 97  ASP A O   
852  C CB  . ASP A 109 ? 0.4516 0.3388 0.5588 0.0254  -0.0315 -0.0204 97  ASP A CB  
853  C CG  . ASP A 109 ? 0.5355 0.3995 0.6485 0.0246  -0.0411 -0.0167 97  ASP A CG  
854  O OD1 . ASP A 109 ? 0.5682 0.4272 0.6883 0.0276  -0.0465 -0.0084 97  ASP A OD1 
855  O OD2 . ASP A 109 ? 0.5641 0.4147 0.6747 0.0208  -0.0437 -0.0219 97  ASP A OD2 
856  N N   . ILE A 110 ? 0.2874 0.2178 0.3799 0.0184  -0.0175 -0.0129 98  ILE A N   
857  C CA  . ILE A 110 ? 0.2449 0.1936 0.3335 0.0191  -0.0096 -0.0150 98  ILE A CA  
858  C C   . ILE A 110 ? 0.2751 0.2342 0.3680 0.0203  -0.0098 -0.0077 98  ILE A C   
859  O O   . ILE A 110 ? 0.3093 0.2802 0.4063 0.0247  -0.0047 -0.0109 98  ILE A O   
860  C CB  . ILE A 110 ? 0.2435 0.1983 0.3202 0.0112  -0.0067 -0.0139 98  ILE A CB  
861  C CG1 . ILE A 110 ? 0.3026 0.2487 0.3751 0.0101  -0.0069 -0.0223 98  ILE A CG1 
862  C CG2 . ILE A 110 ? 0.2325 0.2043 0.3054 0.0119  0.0005  -0.0146 98  ILE A CG2 
863  C CD1 . ILE A 110 ? 0.3126 0.2613 0.3874 0.0179  -0.0018 -0.0339 98  ILE A CD1 
864  N N   . TYR A 111 ? 0.2535 0.2085 0.3454 0.0160  -0.0157 0.0022  99  TYR A N   
865  C CA  . TYR A 111 ? 0.2434 0.2078 0.3385 0.0169  -0.0171 0.0089  99  TYR A CA  
866  C C   . TYR A 111 ? 0.2419 0.2072 0.3497 0.0259  -0.0180 0.0055  99  TYR A C   
867  O O   . TYR A 111 ? 0.2050 0.1835 0.3170 0.0285  -0.0146 0.0044  99  TYR A O   
868  C CB  . TYR A 111 ? 0.2349 0.1937 0.3264 0.0114  -0.0241 0.0199  99  TYR A CB  
869  C CG  . TYR A 111 ? 0.1979 0.1675 0.2902 0.0116  -0.0261 0.0268  99  TYR A CG  
870  C CD1 . TYR A 111 ? 0.1938 0.1784 0.2809 0.0091  -0.0214 0.0266  99  TYR A CD1 
871  C CD2 . TYR A 111 ? 0.2178 0.1820 0.3157 0.0142  -0.0332 0.0335  99  TYR A CD2 
872  C CE1 . TYR A 111 ? 0.1908 0.1850 0.2782 0.0092  -0.0238 0.0317  99  TYR A CE1 
873  C CE2 . TYR A 111 ? 0.2020 0.1769 0.2997 0.0142  -0.0357 0.0393  99  TYR A CE2 
874  C CZ  . TYR A 111 ? 0.2277 0.2177 0.3201 0.0116  -0.0309 0.0378  99  TYR A CZ  
875  O OH  . TYR A 111 ? 0.2036 0.2039 0.2956 0.0118  -0.0340 0.0425  99  TYR A OH  
876  N N   . GLU A 112 ? 0.2597 0.2110 0.3746 0.0305  -0.0229 0.0036  100 GLU A N   
877  C CA  . GLU A 112 ? 0.3466 0.2985 0.4752 0.0403  -0.0240 -0.0008 100 GLU A CA  
878  C C   . GLU A 112 ? 0.3043 0.2702 0.4370 0.0450  -0.0153 -0.0104 100 GLU A C   
879  O O   . GLU A 112 ? 0.3215 0.2986 0.4640 0.0502  -0.0139 -0.0114 100 GLU A O   
880  C CB  . GLU A 112 ? 0.4521 0.3854 0.5866 0.0452  -0.0290 -0.0050 100 GLU A CB  
881  C CG  . GLU A 112 ? 0.5813 0.4990 0.7183 0.0443  -0.0391 0.0046  100 GLU A CG  
882  C CD  . GLU A 112 ? 0.6821 0.5797 0.8264 0.0501  -0.0439 -0.0012 100 GLU A CD  
883  O OE1 . GLU A 112 ? 0.6831 0.5781 0.8268 0.0523  -0.0393 -0.0128 100 GLU A OE1 
884  O OE2 . GLU A 112 ? 0.7406 0.6248 0.8911 0.0526  -0.0526 0.0056  100 GLU A OE2 
885  N N   . GLN A 113 ? 0.2458 0.2118 0.3708 0.0428  -0.0095 -0.0170 101 GLN A N   
886  C CA  . GLN A 113 ? 0.2456 0.2229 0.3733 0.0474  -0.0011 -0.0264 101 GLN A CA  
887  C C   . GLN A 113 ? 0.2408 0.2347 0.3640 0.0432  0.0053  -0.0239 101 GLN A C   
888  O O   . GLN A 113 ? 0.2458 0.2522 0.3749 0.0469  0.0114  -0.0282 101 GLN A O   
889  C CB  . GLN A 113 ? 0.2713 0.2411 0.3919 0.0473  0.0016  -0.0350 101 GLN A CB  
890  C CG  . GLN A 113 ? 0.3387 0.2908 0.4650 0.0524  -0.0044 -0.0402 101 GLN A CG  
891  C CD  . GLN A 113 ? 0.4007 0.3424 0.5172 0.0490  -0.0043 -0.0466 101 GLN A CD  
892  O OE1 . GLN A 113 ? 0.4139 0.3640 0.5201 0.0445  0.0013  -0.0488 101 GLN A OE1 
893  N NE2 . GLN A 113 ? 0.4284 0.3513 0.5487 0.0510  -0.0111 -0.0496 101 GLN A NE2 
894  N N   . GLU A 114 ? 0.2055 0.1993 0.3186 0.0355  0.0039  -0.0168 102 GLU A N   
895  C CA  . GLU A 114 ? 0.1830 0.1895 0.2900 0.0314  0.0099  -0.0156 102 GLU A CA  
896  C C   . GLU A 114 ? 0.1805 0.1932 0.2866 0.0272  0.0074  -0.0076 102 GLU A C   
897  O O   . GLU A 114 ? 0.1697 0.1913 0.2712 0.0240  0.0116  -0.0066 102 GLU A O   
898  C CB  . GLU A 114 ? 0.2056 0.2093 0.2997 0.0266  0.0128  -0.0176 102 GLU A CB  
899  C CG  . GLU A 114 ? 0.2794 0.2787 0.3723 0.0304  0.0158  -0.0270 102 GLU A CG  
900  C CD  . GLU A 114 ? 0.3440 0.3555 0.4420 0.0357  0.0236  -0.0331 102 GLU A CD  
901  O OE1 . GLU A 114 ? 0.3135 0.3367 0.4133 0.0343  0.0275  -0.0295 102 GLU A OE1 
902  O OE2 . GLU A 114 ? 0.3941 0.4036 0.4944 0.0410  0.0257  -0.0416 102 GLU A OE2 
903  N N   . LYS A 115 ? 0.1829 0.1908 0.2926 0.0273  0.0002  -0.0020 103 LYS A N   
904  C CA  . LYS A 115 ? 0.1653 0.1801 0.2726 0.0235  -0.0024 0.0046  103 LYS A CA  
905  C C   . LYS A 115 ? 0.1584 0.1864 0.2736 0.0255  0.0010  0.0028  103 LYS A C   
906  O O   . LYS A 115 ? 0.1747 0.2070 0.3008 0.0307  0.0034  -0.0017 103 LYS A O   
907  C CB  . LYS A 115 ? 0.1946 0.2035 0.3035 0.0233  -0.0109 0.0116  103 LYS A CB  
908  C CG  . LYS A 115 ? 0.2064 0.2140 0.3286 0.0304  -0.0150 0.0110  103 LYS A CG  
909  C CD  . LYS A 115 ? 0.2474 0.2496 0.3689 0.0294  -0.0240 0.0198  103 LYS A CD  
910  C CE  . LYS A 115 ? 0.3650 0.3607 0.4989 0.0370  -0.0295 0.0197  103 LYS A CE  
911  N NZ  . LYS A 115 ? 0.4021 0.4109 0.5488 0.0428  -0.0277 0.0153  103 LYS A NZ  
912  N N   . ASP A 116 ? 0.1379 0.1726 0.2482 0.0212  0.0011  0.0060  104 ASP A N   
913  C CA  . ASP A 116 ? 0.1407 0.1866 0.2579 0.0215  0.0034  0.0048  104 ASP A CA  
914  C C   . ASP A 116 ? 0.1753 0.2250 0.3027 0.0244  -0.0028 0.0070  104 ASP A C   
915  O O   . ASP A 116 ? 0.1459 0.1891 0.2724 0.0256  -0.0093 0.0110  104 ASP A O   
916  C CB  . ASP A 116 ? 0.1761 0.2258 0.2840 0.0162  0.0043  0.0069  104 ASP A CB  
917  C CG  . ASP A 116 ? 0.2480 0.3072 0.3626 0.0156  0.0071  0.0051  104 ASP A CG  
918  O OD1 . ASP A 116 ? 0.2941 0.3555 0.4095 0.0154  0.0137  0.0023  104 ASP A OD1 
919  O OD2 . ASP A 116 ? 0.2637 0.3279 0.3825 0.0152  0.0025  0.0066  104 ASP A OD2 
920  N N   . GLU A 117 ? 0.1268 0.1871 0.2640 0.0252  -0.0013 0.0050  105 GLU A N   
921  C CA  . GLU A 117 ? 0.1316 0.1979 0.2792 0.0279  -0.0077 0.0066  105 GLU A CA  
922  C C   . GLU A 117 ? 0.1510 0.2160 0.2900 0.0249  -0.0149 0.0122  105 GLU A C   
923  O O   . GLU A 117 ? 0.1473 0.2130 0.2905 0.0275  -0.0222 0.0156  105 GLU A O   
924  C CB  . GLU A 117 ? 0.1540 0.2330 0.3133 0.0275  -0.0046 0.0033  105 GLU A CB  
925  C CG  . GLU A 117 ? 0.2302 0.3178 0.4009 0.0295  -0.0115 0.0043  105 GLU A CG  
926  C CD  . GLU A 117 ? 0.3172 0.4048 0.4997 0.0367  -0.0151 0.0040  105 GLU A CD  
927  O OE1 . GLU A 117 ? 0.2875 0.3739 0.4755 0.0405  -0.0096 0.0002  105 GLU A OE1 
928  O OE2 . GLU A 117 ? 0.3241 0.4131 0.5100 0.0389  -0.0235 0.0075  105 GLU A OE2 
929  N N   . ASP A 118 ? 0.1265 0.1906 0.2530 0.0198  -0.0131 0.0133  106 ASP A N   
930  C CA  . ASP A 118 ? 0.1326 0.1979 0.2502 0.0170  -0.0192 0.0180  106 ASP A CA  
931  C C   . ASP A 118 ? 0.1447 0.2007 0.2539 0.0165  -0.0230 0.0238  106 ASP A C   
932  O O   . ASP A 118 ? 0.1603 0.2177 0.2621 0.0143  -0.0283 0.0291  106 ASP A O   
933  C CB  . ASP A 118 ? 0.1228 0.1924 0.2315 0.0125  -0.0164 0.0164  106 ASP A CB  
934  C CG  . ASP A 118 ? 0.1526 0.2163 0.2517 0.0100  -0.0106 0.0158  106 ASP A CG  
935  O OD1 . ASP A 118 ? 0.1267 0.1826 0.2244 0.0110  -0.0091 0.0167  106 ASP A OD1 
936  O OD2 . ASP A 118 ? 0.1193 0.1860 0.2125 0.0074  -0.0078 0.0139  106 ASP A OD2 
937  N N   . GLY A 119 ? 0.1411 0.1877 0.2512 0.0180  -0.0203 0.0229  107 GLY A N   
938  C CA  . GLY A 119 ? 0.1509 0.1868 0.2546 0.0168  -0.0240 0.0283  107 GLY A CA  
939  C C   . GLY A 119 ? 0.1567 0.1886 0.2480 0.0113  -0.0206 0.0293  107 GLY A C   
940  O O   . GLY A 119 ? 0.1594 0.1821 0.2459 0.0091  -0.0233 0.0337  107 GLY A O   
941  N N   . PHE A 120 ? 0.1605 0.1991 0.2472 0.0089  -0.0152 0.0255  108 PHE A N   
942  C CA  . PHE A 120 ? 0.1390 0.1750 0.2156 0.0046  -0.0116 0.0255  108 PHE A CA  
943  C C   . PHE A 120 ? 0.1465 0.1759 0.2259 0.0065  -0.0070 0.0203  108 PHE A C   
944  O O   . PHE A 120 ? 0.1374 0.1683 0.2253 0.0107  -0.0041 0.0156  108 PHE A O   
945  C CB  . PHE A 120 ? 0.1298 0.1751 0.2007 0.0022  -0.0079 0.0233  108 PHE A CB  
946  C CG  . PHE A 120 ? 0.1334 0.1857 0.1970 -0.0007 -0.0115 0.0274  108 PHE A CG  
947  C CD1 . PHE A 120 ? 0.1580 0.2100 0.2122 -0.0051 -0.0125 0.0320  108 PHE A CD1 
948  C CD2 . PHE A 120 ? 0.1438 0.2043 0.2099 0.0006  -0.0135 0.0260  108 PHE A CD2 
949  C CE1 . PHE A 120 ? 0.1506 0.2115 0.1976 -0.0076 -0.0150 0.0355  108 PHE A CE1 
950  C CE2 . PHE A 120 ? 0.1543 0.2226 0.2127 -0.0016 -0.0165 0.0286  108 PHE A CE2 
951  C CZ  . PHE A 120 ? 0.1454 0.2145 0.1939 -0.0055 -0.0169 0.0334  108 PHE A CZ  
952  N N   . LEU A 121 ? 0.1432 0.1667 0.2154 0.0032  -0.0061 0.0209  109 LEU A N   
953  C CA  . LEU A 121 ? 0.1432 0.1630 0.2148 0.0041  -0.0011 0.0150  109 LEU A CA  
954  C C   . LEU A 121 ? 0.1368 0.1641 0.2009 0.0013  0.0036  0.0135  109 LEU A C   
955  O O   . LEU A 121 ? 0.1647 0.1943 0.2212 -0.0030 0.0025  0.0168  109 LEU A O   
956  C CB  . LEU A 121 ? 0.1539 0.1622 0.2226 0.0019  -0.0039 0.0159  109 LEU A CB  
957  C CG  . LEU A 121 ? 0.1641 0.1681 0.2310 0.0028  0.0002  0.0090  109 LEU A CG  
958  C CD1 . LEU A 121 ? 0.1567 0.1613 0.2319 0.0096  0.0036  0.0026  109 LEU A CD1 
959  C CD2 . LEU A 121 ? 0.1891 0.1808 0.2542 -0.0000 -0.0039 0.0096  109 LEU A CD2 
960  N N   . TYR A 122 ? 0.1294 0.1610 0.1961 0.0039  0.0089  0.0090  110 TYR A N   
961  C CA  . TYR A 122 ? 0.1227 0.1605 0.1833 0.0022  0.0130  0.0079  110 TYR A CA  
962  C C   . TYR A 122 ? 0.1483 0.1836 0.2029 0.0016  0.0165  0.0048  110 TYR A C   
963  O O   . TYR A 122 ? 0.1693 0.2013 0.2266 0.0043  0.0189  0.0008  110 TYR A O   
964  C CB  . TYR A 122 ? 0.1173 0.1609 0.1843 0.0047  0.0165  0.0060  110 TYR A CB  
965  C CG  . TYR A 122 ? 0.1141 0.1621 0.1851 0.0044  0.0129  0.0084  110 TYR A CG  
966  C CD1 . TYR A 122 ? 0.1167 0.1643 0.1959 0.0065  0.0090  0.0094  110 TYR A CD1 
967  C CD2 . TYR A 122 ? 0.1279 0.1809 0.1945 0.0025  0.0129  0.0092  110 TYR A CD2 
968  C CE1 . TYR A 122 ? 0.1285 0.1812 0.2103 0.0061  0.0050  0.0112  110 TYR A CE1 
969  C CE2 . TYR A 122 ? 0.1193 0.1767 0.1887 0.0023  0.0091  0.0101  110 TYR A CE2 
970  C CZ  . TYR A 122 ? 0.1452 0.2029 0.2217 0.0038  0.0052  0.0112  110 TYR A CZ  
971  O OH  . TYR A 122 ? 0.1101 0.1733 0.1885 0.0036  0.0010  0.0118  110 TYR A OH  
972  N N   . MET A 123 ? 0.1551 0.1934 0.2016 -0.0016 0.0167  0.0062  111 MET A N   
973  C CA  . MET A 123 ? 0.1568 0.1945 0.1969 -0.0024 0.0192  0.0034  111 MET A CA  
974  C C   . MET A 123 ? 0.1548 0.1996 0.1901 -0.0027 0.0220  0.0041  111 MET A C   
975  O O   . MET A 123 ? 0.1384 0.1877 0.1737 -0.0034 0.0207  0.0067  111 MET A O   
976  C CB  . MET A 123 ? 0.1609 0.1948 0.1967 -0.0065 0.0155  0.0046  111 MET A CB  
977  C CG  . MET A 123 ? 0.1971 0.2220 0.2381 -0.0067 0.0115  0.0054  111 MET A CG  
978  S SD  . MET A 123 ? 0.2598 0.2791 0.2964 -0.0130 0.0069  0.0077  111 MET A SD  
979  C CE  . MET A 123 ? 0.3487 0.3546 0.3930 -0.0113 0.0023  0.0082  111 MET A CE  
980  N N   . VAL A 124 ? 0.1478 0.1935 0.1786 -0.0017 0.0254  0.0016  112 VAL A N   
981  C CA  . VAL A 124 ? 0.1967 0.2479 0.2230 -0.0012 0.0278  0.0027  112 VAL A CA  
982  C C   . VAL A 124 ? 0.1624 0.2150 0.1805 -0.0026 0.0276  0.0012  112 VAL A C   
983  O O   . VAL A 124 ? 0.1701 0.2191 0.1866 -0.0027 0.0279  -0.0023 112 VAL A O   
984  C CB  . VAL A 124 ? 0.2801 0.3320 0.3097 0.0016  0.0324  0.0022  112 VAL A CB  
985  C CG1 . VAL A 124 ? 0.3727 0.4279 0.3961 0.0023  0.0353  0.0033  112 VAL A CG1 
986  C CG2 . VAL A 124 ? 0.2987 0.3514 0.3362 0.0021  0.0318  0.0041  112 VAL A CG2 
987  N N   . TYR A 125 ? 0.1435 0.2016 0.1571 -0.0034 0.0267  0.0030  113 TYR A N   
988  C CA  . TYR A 125 ? 0.1564 0.2174 0.1628 -0.0044 0.0263  0.0015  113 TYR A CA  
989  C C   . TYR A 125 ? 0.1496 0.2149 0.1512 -0.0016 0.0288  0.0027  113 TYR A C   
990  O O   . TYR A 125 ? 0.1917 0.2583 0.1955 0.0004  0.0297  0.0055  113 TYR A O   
991  C CB  . TYR A 125 ? 0.1808 0.2459 0.1859 -0.0083 0.0222  0.0024  113 TYR A CB  
992  C CG  . TYR A 125 ? 0.1740 0.2462 0.1802 -0.0080 0.0212  0.0055  113 TYR A CG  
993  C CD1 . TYR A 125 ? 0.1673 0.2466 0.1701 -0.0058 0.0215  0.0061  113 TYR A CD1 
994  C CD2 . TYR A 125 ? 0.1385 0.2110 0.1489 -0.0095 0.0195  0.0074  113 TYR A CD2 
995  C CE1 . TYR A 125 ? 0.1574 0.2435 0.1617 -0.0046 0.0205  0.0076  113 TYR A CE1 
996  C CE2 . TYR A 125 ? 0.1786 0.2590 0.1894 -0.0087 0.0187  0.0090  113 TYR A CE2 
997  C CZ  . TYR A 125 ? 0.1537 0.2407 0.1619 -0.0061 0.0193  0.0086  113 TYR A CZ  
998  O OH  . TYR A 125 ? 0.2037 0.2986 0.2127 -0.0045 0.0186  0.0089  113 TYR A OH  
999  N N   . ALA A 126 ? 0.1758 0.2429 0.1707 -0.0014 0.0294  0.0007  114 ALA A N   
1000 C CA  . ALA A 126 ? 0.1548 0.2256 0.1437 0.0013  0.0315  0.0026  114 ALA A CA  
1001 C C   . ALA A 126 ? 0.1768 0.2519 0.1575 0.0005  0.0298  -0.0001 114 ALA A C   
1002 O O   . ALA A 126 ? 0.2001 0.2740 0.1806 -0.0025 0.0273  -0.0041 114 ALA A O   
1003 C CB  . ALA A 126 ? 0.1851 0.2530 0.1747 0.0035  0.0365  0.0033  114 ALA A CB  
1004 N N   . SER A 127 ? 0.2083 0.2880 0.1825 0.0029  0.0305  0.0024  115 SER A N   
1005 C CA  . SER A 127 ? 0.2350 0.3203 0.2006 0.0025  0.0284  -0.0001 115 SER A CA  
1006 C C   . SER A 127 ? 0.3011 0.3848 0.2607 0.0026  0.0309  -0.0049 115 SER A C   
1007 O O   . SER A 127 ? 0.2848 0.3724 0.2377 0.0014  0.0283  -0.0091 115 SER A O   
1008 C CB  . SER A 127 ? 0.2373 0.3286 0.1976 0.0057  0.0275  0.0049  115 SER A CB  
1009 O OG  . SER A 127 ? 0.2502 0.3451 0.2157 0.0061  0.0243  0.0071  115 SER A OG  
1010 N N   . GLN A 128 ? 0.3165 0.3958 0.2786 0.0040  0.0357  -0.0049 116 GLN A N   
1011 C CA  . GLN A 128 ? 0.3986 0.4774 0.3560 0.0049  0.0388  -0.0107 116 GLN A CA  
1012 C C   . GLN A 128 ? 0.3739 0.4465 0.3403 0.0053  0.0418  -0.0131 116 GLN A C   
1013 O O   . GLN A 128 ? 0.3414 0.4111 0.3163 0.0052  0.0424  -0.0089 116 GLN A O   
1014 C CB  . GLN A 128 ? 0.4726 0.5573 0.4207 0.0076  0.0432  -0.0078 116 GLN A CB  
1015 C CG  . GLN A 128 ? 0.5574 0.6463 0.5011 0.0087  0.0418  0.0000  116 GLN A CG  
1016 C CD  . GLN A 128 ? 0.5658 0.6505 0.5183 0.0092  0.0432  0.0068  116 GLN A CD  
1017 O OE1 . GLN A 128 ? 0.5740 0.6539 0.5355 0.0085  0.0456  0.0060  116 GLN A OE1 
1018 N NE2 . GLN A 128 ? 0.5996 0.6860 0.5502 0.0107  0.0411  0.0130  116 GLN A NE2 
1019 N N   . GLU A 129 ? 0.3845 0.4556 0.3492 0.0062  0.0432  -0.0204 117 GLU A N   
1020 C CA  . GLU A 129 ? 0.3896 0.4565 0.3630 0.0079  0.0464  -0.0232 117 GLU A CA  
1021 C C   . GLU A 129 ? 0.4815 0.5545 0.4537 0.0105  0.0535  -0.0199 117 GLU A C   
1022 O O   . GLU A 129 ? 0.4824 0.5547 0.4635 0.0109  0.0561  -0.0157 117 GLU A O   
1023 C CB  . GLU A 129 ? 0.3877 0.4504 0.3603 0.0088  0.0452  -0.0332 117 GLU A CB  
1024 C CG  . GLU A 129 ? 0.4354 0.4946 0.4176 0.0119  0.0484  -0.0367 117 GLU A CG  
1025 C CD  . GLU A 129 ? 0.4819 0.5363 0.4634 0.0140  0.0471  -0.0477 117 GLU A CD  
1026 O OE1 . GLU A 129 ? 0.5272 0.5851 0.4979 0.0144  0.0470  -0.0533 117 GLU A OE1 
1027 O OE2 . GLU A 129 ? 0.4362 0.4830 0.4277 0.0157  0.0457  -0.0508 117 GLU A OE2 
1028 N N   . THR A 130 ? 0.5492 0.6290 0.5100 0.0119  0.0563  -0.0216 118 THR A N   
1029 C CA  . THR A 130 ? 0.5986 0.6862 0.5554 0.0134  0.0631  -0.0167 118 THR A CA  
1030 C C   . THR A 130 ? 0.6148 0.7079 0.5588 0.0130  0.0621  -0.0113 118 THR A C   
1031 O O   . THR A 130 ? 0.5192 0.6139 0.4542 0.0128  0.0580  -0.0157 118 THR A O   
1032 C CB  . THR A 130 ? 0.6037 0.6970 0.5579 0.0164  0.0689  -0.0240 118 THR A CB  
1033 O OG1 . THR A 130 ? 0.5922 0.6882 0.5343 0.0174  0.0668  -0.0316 118 THR A OG1 
1034 C CG2 . THR A 130 ? 0.5863 0.6743 0.5538 0.0180  0.0691  -0.0301 118 THR A CG2 
1035 N N   . PHE A 131 ? 0.6762 0.7717 0.6198 0.0127  0.0652  -0.0017 119 PHE A N   
1036 C CA  . PHE A 131 ? 0.7273 0.8274 0.6591 0.0130  0.0640  0.0048  119 PHE A CA  
1037 C C   . PHE A 131 ? 0.7566 0.8663 0.6743 0.0146  0.0675  0.0014  119 PHE A C   
1038 O O   . PHE A 131 ? 0.7693 0.8842 0.6746 0.0152  0.0656  0.0050  119 PHE A O   
1039 C CB  . PHE A 131 ? 0.7358 0.8346 0.6712 0.0123  0.0666  0.0162  119 PHE A CB  
1040 C CG  . PHE A 131 ? 0.7319 0.8221 0.6797 0.0112  0.0627  0.0191  119 PHE A CG  
1041 C CD1 . PHE A 131 ? 0.7419 0.8296 0.6882 0.0117  0.0570  0.0231  119 PHE A CD1 
1042 C CD2 . PHE A 131 ? 0.7256 0.8117 0.6865 0.0101  0.0648  0.0176  119 PHE A CD2 
1043 C CE1 . PHE A 131 ? 0.7374 0.8185 0.6942 0.0112  0.0538  0.0248  119 PHE A CE1 
1044 C CE2 . PHE A 131 ? 0.7281 0.8075 0.6991 0.0092  0.0611  0.0196  119 PHE A CE2 
1045 C CZ  . PHE A 131 ? 0.7263 0.8032 0.6950 0.0098  0.0558  0.0230  119 PHE A CZ  
1046 O O   . HOH B .   ? 0.4548 0.5417 0.4059 0.0141  0.0369  0.0224  201 HOH A O   
1047 O O   . HOH B .   ? 0.4695 0.5481 0.5038 0.0022  0.0141  0.0041  202 HOH A O   
1048 O O   . HOH B .   ? 0.5793 0.4923 0.6167 -0.0476 -0.0324 -0.0466 203 HOH A O   
1049 O O   . HOH B .   ? 0.2513 0.3283 0.3802 0.0122  0.0033  0.0040  204 HOH A O   
1050 O O   . HOH B .   ? 0.4682 0.4173 0.5038 -0.0562 -0.0696 0.1435  205 HOH A O   
1051 O O   . HOH B .   ? 0.5615 0.4879 0.5801 -0.0268 -0.0224 -0.0844 206 HOH A O   
1052 O O   . HOH B .   ? 0.4059 0.3408 0.4737 0.0258  0.0008  -0.0661 207 HOH A O   
1053 O O   . HOH B .   ? 0.4193 0.4408 0.4506 -0.0881 -0.0222 0.0228  208 HOH A O   
1054 O O   . HOH B .   ? 0.4452 0.5190 0.4217 0.0098  0.0401  0.0171  209 HOH A O   
1055 O O   . HOH B .   ? 0.3904 0.3734 0.4838 0.0410  0.0174  -0.0500 210 HOH A O   
1056 O O   . HOH B .   ? 0.3345 0.3434 0.3421 -0.0435 -0.0084 -0.0281 211 HOH A O   
1057 O O   . HOH B .   ? 0.5267 0.5443 0.6513 0.0559  0.0285  -0.0515 212 HOH A O   
1058 O O   . HOH B .   ? 0.5133 0.5814 0.5172 0.0129  0.0591  -0.0172 213 HOH A O   
1059 O O   . HOH B .   ? 0.2566 0.2584 0.3671 0.0230  -0.0445 0.0460  214 HOH A O   
1060 O O   . HOH B .   ? 0.3741 0.2627 0.4704 0.0961  -0.0347 -0.0002 215 HOH A O   
1061 O O   . HOH B .   ? 0.3059 0.3132 0.3220 0.0175  0.0297  -0.0656 216 HOH A O   
1062 O O   . HOH B .   ? 0.5355 0.4156 0.6010 -0.0607 -0.0664 0.1006  217 HOH A O   
1063 O O   . HOH B .   ? 0.3543 0.3901 0.4240 0.0121  0.0266  -0.0068 218 HOH A O   
1064 O O   . HOH B .   ? 0.3105 0.4008 0.3302 -0.0059 0.0141  0.0111  219 HOH A O   
1065 O O   . HOH B .   ? 0.2853 0.4009 0.3515 0.0027  -0.0312 -0.0162 220 HOH A O   
1066 O O   . HOH B .   ? 0.6028 0.6817 0.6864 0.0285  0.0653  -0.0283 221 HOH A O   
1067 O O   . HOH B .   ? 0.1660 0.2407 0.3618 0.0518  -0.0308 0.0095  222 HOH A O   
1068 O O   . HOH B .   ? 0.2801 0.3787 0.2116 0.0036  0.0277  -0.0145 223 HOH A O   
1069 O O   . HOH B .   ? 0.2648 0.2894 0.3410 0.0117  -0.0767 0.0932  224 HOH A O   
1070 O O   . HOH B .   ? 0.2111 0.2643 0.2595 0.0002  0.0212  0.0073  225 HOH A O   
1071 O O   . HOH B .   ? 0.3964 0.4279 0.3722 -0.0032 0.0211  -0.0576 226 HOH A O   
1072 O O   . HOH B .   ? 0.4276 0.6328 0.4111 -0.0331 -0.0221 -0.0163 227 HOH A O   
1073 O O   . HOH B .   ? 0.4230 0.4488 0.5666 0.0439  0.0041  -0.0121 228 HOH A O   
1074 O O   . HOH B .   ? 0.2079 0.3185 0.1724 0.0014  0.0156  0.0023  229 HOH A O   
1075 O O   . HOH B .   ? 0.4451 0.3934 0.5104 0.0473  -0.0009 0.0283  230 HOH A O   
1076 O O   . HOH B .   ? 0.5601 0.6091 0.6218 0.0297  -0.0037 -0.0409 231 HOH A O   
1077 O O   . HOH B .   ? 0.3603 0.3946 0.3650 0.0238  0.0449  -0.0672 232 HOH A O   
1078 O O   . HOH B .   ? 0.6115 0.6797 0.6474 0.0045  0.0202  0.0050  233 HOH A O   
1079 O O   . HOH B .   ? 0.3615 0.3901 0.4450 0.0383  0.0401  -0.0469 234 HOH A O   
1080 O O   . HOH B .   ? 0.5581 0.3879 0.6502 -0.0338 -0.0730 0.0672  235 HOH A O   
1081 O O   . HOH B .   ? 0.4829 0.6417 0.4927 -0.0083 0.0149  0.0090  236 HOH A O   
1082 O O   . HOH B .   ? 0.2083 0.2651 0.3186 0.0203  -0.0436 0.0392  237 HOH A O   
1083 O O   . HOH B .   ? 0.3073 0.3721 0.4050 0.0265  -0.0882 0.0808  238 HOH A O   
1084 O O   . HOH B .   ? 0.4094 0.3229 0.5185 0.0173  -0.0480 0.0357  239 HOH A O   
1085 O O   . HOH B .   ? 0.2994 0.4212 0.3078 -0.0145 0.0025  0.0225  240 HOH A O   
1086 O O   . HOH B .   ? 0.4828 0.5456 0.5014 0.0122  0.0278  0.0132  241 HOH A O   
1087 O O   . HOH B .   ? 0.3001 0.3139 0.3633 0.0259  0.0314  -0.0398 242 HOH A O   
1088 O O   . HOH B .   ? 0.3328 0.5131 0.3406 -0.0110 0.0077  0.0062  243 HOH A O   
1089 O O   . HOH B .   ? 0.2656 0.3950 0.2376 0.0048  0.0100  0.0061  244 HOH A O   
1090 O O   . HOH B .   ? 0.3701 0.3693 0.3690 -0.0025 0.0138  -0.0635 245 HOH A O   
1091 O O   . HOH B .   ? 0.3677 0.4405 0.5109 0.0232  0.0146  -0.0023 246 HOH A O   
1092 O O   . HOH B .   ? 0.3762 0.4319 0.4158 0.0036  0.0391  0.0107  247 HOH A O   
1093 O O   . HOH B .   ? 0.1796 0.2119 0.2665 0.0141  0.0135  0.0008  248 HOH A O   
1094 O O   . HOH B .   ? 0.3294 0.4341 0.5505 0.0523  -0.0038 -0.0092 249 HOH A O   
1095 O O   . HOH B .   ? 0.2858 0.3349 0.3850 0.0156  0.0197  -0.0007 250 HOH A O   
1096 O O   . HOH B .   ? 0.3371 0.3423 0.3803 -0.0236 -0.0463 0.0880  251 HOH A O   
1097 O O   . HOH B .   ? 0.3805 0.5741 0.3855 -0.0119 0.0015  0.0036  252 HOH A O   
1098 O O   . HOH B .   ? 0.5050 0.5403 0.5962 -0.0019 0.0210  0.0030  253 HOH A O   
1099 O O   . HOH B .   ? 0.1644 0.2261 0.2313 0.0017  0.0172  0.0058  254 HOH A O   
1100 O O   . HOH B .   ? 0.4248 0.3377 0.4778 -0.0712 -0.0406 0.0172  255 HOH A O   
1101 O O   . HOH B .   ? 0.3734 0.5005 0.4074 -0.0004 -0.0426 0.0240  256 HOH A O   
1102 O O   . HOH B .   ? 0.5689 0.8226 0.5858 -0.0073 -0.0093 0.0003  257 HOH A O   
1103 O O   . HOH B .   ? 0.3210 0.4022 0.2822 -0.0177 0.0098  -0.0292 258 HOH A O   
1104 O O   . HOH B .   ? 0.5583 0.7878 0.5776 -0.0298 -0.0016 0.0046  259 HOH A O   
1105 O O   . HOH B .   ? 0.2580 0.3058 0.2996 0.0085  0.0402  -0.0084 260 HOH A O   
1106 O O   . HOH B .   ? 0.4045 0.5079 0.4815 0.0158  -0.0781 0.0613  261 HOH A O   
1107 O O   . HOH B .   ? 0.5372 0.5743 0.6361 0.0258  0.0275  -0.0160 262 HOH A O   
1108 O O   . HOH B .   ? 0.4410 0.4422 0.6150 0.0599  -0.0391 0.0144  263 HOH A O   
1109 O O   . HOH B .   ? 0.2713 0.3501 0.4103 0.0374  -0.0786 0.0540  264 HOH A O   
1110 O O   . HOH B .   ? 0.3441 0.4478 0.3539 -0.0167 -0.0408 0.0690  265 HOH A O   
1111 O O   . HOH B .   ? 0.3843 0.4416 0.4339 0.0023  0.0279  0.0073  266 HOH A O   
1112 O O   . HOH B .   ? 0.6361 0.4650 0.7231 0.0747  -0.0326 0.0757  267 HOH A O   
1113 O O   . HOH B .   ? 0.4329 0.6299 0.4165 -0.0053 -0.0095 -0.0012 268 HOH A O   
1114 O O   . HOH B .   ? 0.4700 0.6492 0.4357 -0.0027 -0.0088 -0.0028 269 HOH A O   
1115 O O   . HOH B .   ? 0.3305 0.4639 0.3426 0.0206  0.0152  0.0012  270 HOH A O   
1116 O O   . HOH B .   ? 0.3612 0.4236 0.3462 -0.0311 0.0034  -0.0241 271 HOH A O   
1117 O O   . HOH B .   ? 0.5305 0.6000 0.5181 0.0076  0.0513  0.0001  272 HOH A O   
1118 O O   . HOH B .   ? 0.4792 0.5582 0.5025 0.0036  0.0199  0.0064  273 HOH A O   
1119 O O   . HOH B .   ? 0.1537 0.2385 0.2572 -0.0011 0.0000  -0.0000 274 HOH A O   
1120 O O   . HOH B .   ? 0.5477 0.4650 0.5869 0.0056  -0.0099 -0.0876 275 HOH A O   
1121 O O   . HOH B .   ? 0.3502 0.4267 0.3233 0.0187  0.0312  0.0290  276 HOH A O   
1122 O O   . HOH B .   ? 0.2197 0.3048 0.3539 0.0061  0.0041  0.0007  277 HOH A O   
1123 O O   . HOH B .   ? 0.2754 0.3559 0.2878 -0.0681 -0.0109 -0.0003 278 HOH A O   
1124 O O   . HOH B .   ? 0.3405 0.4279 0.3142 -0.0297 0.0014  -0.0249 279 HOH A O   
1125 O O   . HOH B .   ? 0.3547 0.3949 0.4933 0.0327  -0.0305 0.0235  280 HOH A O   
1126 O O   . HOH B .   ? 0.1576 0.2754 0.2988 0.0021  -0.0358 -0.0110 281 HOH A O   
1127 O O   . HOH B .   ? 0.3022 0.3022 0.1728 0.0010  -0.0031 -0.0031 282 HOH A O   
1128 O O   . HOH B .   ? 0.3471 0.5209 0.3577 -0.0107 0.0128  0.0085  283 HOH A O   
1129 O O   . HOH B .   ? 0.4825 0.5253 0.5360 0.0071  0.0314  -0.0041 284 HOH A O   
1130 O O   . HOH B .   ? 0.4691 0.6272 0.4660 0.0027  0.0079  0.0059  285 HOH A O   
1131 O O   . HOH B .   ? 0.3616 0.4524 0.3785 -0.0008 0.0179  0.0080  286 HOH A O   
1132 O O   . HOH B .   ? 0.5605 0.6729 0.5699 0.0278  0.0150  0.0062  287 HOH A O   
1133 O O   . HOH B .   ? 0.2420 0.3424 0.3806 0.0272  -0.0617 0.0323  288 HOH A O   
1134 O O   . HOH B .   ? 0.5377 0.3758 0.6329 -0.0201 -0.0627 0.0378  289 HOH A O   
1135 O O   . HOH B .   ? 0.5152 0.5960 0.4564 0.0087  0.0442  -0.0347 290 HOH A O   
1136 O O   . HOH B .   ? 0.3585 0.3996 0.5135 0.0410  -0.0124 0.0046  291 HOH A O   
1137 O O   . HOH B .   ? 0.5942 0.6761 0.6020 0.0340  0.0163  0.0155  292 HOH A O   
1138 O O   . HOH B .   ? 0.5019 0.6212 0.5023 0.0275  0.0133  0.0110  293 HOH A O   
1139 O O   . HOH B .   ? 0.2834 0.5277 0.3139 -0.0522 0.0010  0.0132  294 HOH A O   
1140 O O   . HOH B .   ? 0.5530 0.5114 0.5960 0.0917  -0.0189 0.0495  295 HOH A O   
1141 O O   . HOH B .   ? 0.3030 0.3465 0.4715 0.0471  -0.0289 0.0137  296 HOH A O   
1142 O O   . HOH B .   ? 0.4801 0.7588 0.5081 -0.0358 0.0149  0.0168  297 HOH A O   
1143 O O   . HOH B .   ? 0.3210 0.3842 0.4187 -0.0012 0.0246  0.0036  298 HOH A O   
1144 O O   . HOH B .   ? 0.3821 0.4392 0.4140 0.0073  0.0474  -0.0028 299 HOH A O   
1145 O O   . HOH B .   ? 0.3976 0.6088 0.4205 -0.0568 -0.0048 0.0082  300 HOH A O   
1146 O O   . HOH B .   ? 0.2492 0.2956 0.3803 0.0364  -0.0732 0.0602  301 HOH A O   
1147 O O   . HOH B .   ? 0.4055 0.5538 0.3713 0.0119  0.0035  0.0087  302 HOH A O   
1148 O O   . HOH B .   ? 0.3916 0.4800 0.4433 0.0131  -0.0075 -0.0328 303 HOH A O   
1149 O O   . HOH B .   ? 0.5691 0.6937 0.5834 -0.0037 -0.0067 0.0086  304 HOH A O   
1150 O O   . HOH B .   ? 0.3320 0.4114 0.5501 0.0636  -0.0189 -0.0043 305 HOH A O   
1151 O O   . HOH B .   ? 0.4567 0.5540 0.4602 -0.0026 -0.1082 0.1426  306 HOH A O   
1152 O O   . HOH B .   ? 0.3717 0.4245 0.4323 0.0041  0.0289  0.0040  307 HOH A O   
1153 O O   . HOH B .   ? 0.3928 0.4346 0.3910 -0.0442 -0.0050 -0.0237 308 HOH A O   
1154 O O   . HOH B .   ? 0.4157 0.4767 0.4183 -0.0590 -0.0118 -0.0180 309 HOH A O   
1155 O O   . HOH B .   ? 0.4491 0.4783 0.5699 0.0272  -0.0442 0.0408  310 HOH A O   
1156 O O   . HOH B .   ? 0.4552 0.4467 0.4938 0.0256  0.0261  -0.0686 311 HOH A O   
1157 O O   . HOH B .   ? 0.4349 0.4349 0.3762 -0.0125 -0.0196 -0.0196 312 HOH A O   
1158 O O   . HOH B .   ? 0.4116 0.4056 0.4172 0.0188  0.0238  -0.0890 313 HOH A O   
1159 O O   . HOH B .   ? 0.3350 0.3930 0.3807 0.0047  0.0450  0.0062  314 HOH A O   
1160 O O   . HOH B .   ? 0.5049 0.6395 0.5067 0.0400  0.0072  0.0119  315 HOH A O   
1161 O O   . HOH B .   ? 0.4031 0.4600 0.4632 0.0042  0.0380  0.0052  316 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -11 ?   ?   ?   A . n 
A 1 2   PRO 2   -10 ?   ?   ?   A . n 
A 1 3   GLU 3   -9  ?   ?   ?   A . n 
A 1 4   GLU 4   -8  ?   ?   ?   A . n 
A 1 5   GLY 5   -7  ?   ?   ?   A . n 
A 1 6   ASP 6   -6  -6  ASP ASP A . n 
A 1 7   ASP 7   -5  -5  ASP ASP A . n 
A 1 8   PHE 8   -4  -4  PHE PHE A . n 
A 1 9   GLU 9   -3  -3  GLU GLU A . n 
A 1 10  LEU 10  -2  -2  LEU LEU A . n 
A 1 11  LEU 11  -1  -1  LEU LEU A . n 
A 1 12  ASP 12  0   0   ASP ASP A . n 
A 1 13  GLY 13  1   1   GLY GLY A . n 
A 1 14  PRO 14  2   2   PRO PRO A . n 
A 1 15  SER 15  3   3   SER SER A . n 
A 1 16  ASP 16  4   4   ASP ASP A . n 
A 1 17  ARG 17  5   5   ARG ARG A . n 
A 1 18  PRO 18  6   6   PRO PRO A . n 
A 1 19  PHE 19  7   7   PHE PHE A . n 
A 1 20  LYS 20  8   8   LYS LYS A . n 
A 1 21  GLN 21  9   9   GLN GLN A . n 
A 1 22  ARG 22  10  10  ARG ARG A . n 
A 1 23  ARG 23  11  11  ARG ARG A . n 
A 1 24  SER 24  12  12  SER SER A . n 
A 1 25  PHE 25  13  13  PHE PHE A . n 
A 1 26  ALA 26  14  14  ALA ALA A . n 
A 1 27  ASP 27  15  15  ASP ASP A . n 
A 1 28  ARG 28  16  16  ARG ARG A . n 
A 1 29  CYS 29  17  17  CYS CYS A . n 
A 1 30  LYS 30  18  18  LYS LYS A . n 
A 1 31  GLU 31  19  19  GLU GLU A . n 
A 1 32  VAL 32  20  20  VAL VAL A . n 
A 1 33  GLN 33  21  21  GLN GLN A . n 
A 1 34  GLN 34  22  22  GLN GLN A . n 
A 1 35  ILE 35  23  23  ILE ILE A . n 
A 1 36  ARG 36  24  24  ARG ARG A . n 
A 1 37  ASP 37  25  25  ASP ASP A . n 
A 1 38  GLN 38  26  26  GLN GLN A . n 
A 1 39  HIS 39  27  27  HIS HIS A . n 
A 1 40  PRO 40  28  28  PRO PRO A . n 
A 1 41  SER 41  29  29  SER SER A . n 
A 1 42  LYS 42  30  30  LYS LYS A . n 
A 1 43  ILE 43  31  31  ILE ILE A . n 
A 1 44  PRO 44  32  32  PRO PRO A . n 
A 1 45  VAL 45  33  33  VAL VAL A . n 
A 1 46  ILE 46  34  34  ILE ILE A . n 
A 1 47  ILE 47  35  35  ILE ILE A . n 
A 1 48  GLU 48  36  36  GLU GLU A . n 
A 1 49  ARG 49  37  37  ARG ARG A . n 
A 1 50  TYR 50  38  38  TYR TYR A . n 
A 1 51  LYS 51  39  39  LYS LYS A . n 
A 1 52  GLY 52  40  40  GLY GLY A . n 
A 1 53  GLU 53  41  41  GLU GLU A . n 
A 1 54  LYS 54  42  42  LYS LYS A . n 
A 1 55  GLN 55  43  43  GLN GLN A . n 
A 1 56  LEU 56  44  44  LEU LEU A . n 
A 1 57  PRO 57  45  45  PRO PRO A . n 
A 1 58  VAL 58  46  46  VAL VAL A . n 
A 1 59  LEU 59  47  47  LEU LEU A . n 
A 1 60  ASP 60  48  48  ASP ASP A . n 
A 1 61  LYS 61  49  49  LYS LYS A . n 
A 1 62  THR 62  50  50  THR THR A . n 
A 1 63  LYS 63  51  51  LYS LYS A . n 
A 1 64  PHE 64  52  52  PHE PHE A . n 
A 1 65  LEU 65  53  53  LEU LEU A . n 
A 1 66  VAL 66  54  54  VAL VAL A . n 
A 1 67  PRO 67  55  55  PRO PRO A . n 
A 1 68  ASP 68  56  56  ASP ASP A . n 
A 1 69  HIS 69  57  57  HIS HIS A . n 
A 1 70  VAL 70  58  58  VAL VAL A . n 
A 1 71  ASN 71  59  59  ASN ASN A . n 
A 1 72  MET 72  60  60  MET MET A . n 
A 1 73  SER 73  61  61  SER SER A . n 
A 1 74  GLU 74  62  62  GLU GLU A . n 
A 1 75  LEU 75  63  63  LEU LEU A . n 
A 1 76  VAL 76  64  64  VAL VAL A . n 
A 1 77  LYS 77  65  65  LYS LYS A . n 
A 1 78  ILE 78  66  66  ILE ILE A . n 
A 1 79  ILE 79  67  67  ILE ILE A . n 
A 1 80  ARG 80  68  68  ARG ARG A . n 
A 1 81  ARG 81  69  69  ARG ARG A . n 
A 1 82  ARG 82  70  70  ARG ARG A . n 
A 1 83  LEU 83  71  71  LEU LEU A . n 
A 1 84  GLN 84  72  72  GLN GLN A . n 
A 1 85  LEU 85  73  73  LEU LEU A . n 
A 1 86  ASN 86  74  74  ASN ASN A . n 
A 1 87  PRO 87  75  75  PRO PRO A . n 
A 1 88  THR 88  76  76  THR THR A . n 
A 1 89  GLN 89  77  77  GLN GLN A . n 
A 1 90  ALA 90  78  78  ALA ALA A . n 
A 1 91  PHE 91  79  79  PHE PHE A . n 
A 1 92  PHE 92  80  80  PHE PHE A . n 
A 1 93  LEU 93  81  81  LEU LEU A . n 
A 1 94  LEU 94  82  82  LEU LEU A . n 
A 1 95  VAL 95  83  83  VAL VAL A . n 
A 1 96  ASN 96  84  84  ASN ASN A . n 
A 1 97  GLN 97  85  85  GLN GLN A . n 
A 1 98  HIS 98  86  86  HIS HIS A . n 
A 1 99  SER 99  87  87  SER SER A . n 
A 1 100 MET 100 88  88  MET MET A . n 
A 1 101 VAL 101 89  89  VAL VAL A . n 
A 1 102 SER 102 90  90  SER SER A . n 
A 1 103 VAL 103 91  91  VAL VAL A . n 
A 1 104 SER 104 92  92  SER SER A . n 
A 1 105 THR 105 93  93  THR THR A . n 
A 1 106 PRO 106 94  94  PRO PRO A . n 
A 1 107 ILE 107 95  95  ILE ILE A . n 
A 1 108 ALA 108 96  96  ALA ALA A . n 
A 1 109 ASP 109 97  97  ASP ASP A . n 
A 1 110 ILE 110 98  98  ILE ILE A . n 
A 1 111 TYR 111 99  99  TYR TYR A . n 
A 1 112 GLU 112 100 100 GLU GLU A . n 
A 1 113 GLN 113 101 101 GLN GLN A . n 
A 1 114 GLU 114 102 102 GLU GLU A . n 
A 1 115 LYS 115 103 103 LYS LYS A . n 
A 1 116 ASP 116 104 104 ASP ASP A . n 
A 1 117 GLU 117 105 105 GLU GLU A . n 
A 1 118 ASP 118 106 106 ASP ASP A . n 
A 1 119 GLY 119 107 107 GLY GLY A . n 
A 1 120 PHE 120 108 108 PHE PHE A . n 
A 1 121 LEU 121 109 109 LEU LEU A . n 
A 1 122 TYR 122 110 110 TYR TYR A . n 
A 1 123 MET 123 111 111 MET MET A . n 
A 1 124 VAL 124 112 112 VAL VAL A . n 
A 1 125 TYR 125 113 113 TYR TYR A . n 
A 1 126 ALA 126 114 114 ALA ALA A . n 
A 1 127 SER 127 115 115 SER SER A . n 
A 1 128 GLN 128 116 116 GLN GLN A . n 
A 1 129 GLU 129 117 117 GLU GLU A . n 
A 1 130 THR 130 118 118 THR THR A . n 
A 1 131 PHE 131 119 119 PHE PHE A . n 
A 1 132 GLY 132 120 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   201 68  HOH HOH A . 
B 2 HOH 2   202 113 HOH HOH A . 
B 2 HOH 3   203 106 HOH HOH A . 
B 2 HOH 4   204 32  HOH HOH A . 
B 2 HOH 5   205 39  HOH HOH A . 
B 2 HOH 6   206 75  HOH HOH A . 
B 2 HOH 7   207 72  HOH HOH A . 
B 2 HOH 8   208 44  HOH HOH A . 
B 2 HOH 9   209 41  HOH HOH A . 
B 2 HOH 10  210 71  HOH HOH A . 
B 2 HOH 11  211 43  HOH HOH A . 
B 2 HOH 12  212 76  HOH HOH A . 
B 2 HOH 13  213 69  HOH HOH A . 
B 2 HOH 14  214 15  HOH HOH A . 
B 2 HOH 15  215 3   HOH HOH A . 
B 2 HOH 16  216 51  HOH HOH A . 
B 2 HOH 17  217 82  HOH HOH A . 
B 2 HOH 18  218 79  HOH HOH A . 
B 2 HOH 19  219 30  HOH HOH A . 
B 2 HOH 20  220 16  HOH HOH A . 
B 2 HOH 21  221 97  HOH HOH A . 
B 2 HOH 22  222 7   HOH HOH A . 
B 2 HOH 23  223 17  HOH HOH A . 
B 2 HOH 24  224 11  HOH HOH A . 
B 2 HOH 25  225 22  HOH HOH A . 
B 2 HOH 26  226 18  HOH HOH A . 
B 2 HOH 27  227 60  HOH HOH A . 
B 2 HOH 28  228 77  HOH HOH A . 
B 2 HOH 29  229 1   HOH HOH A . 
B 2 HOH 30  230 90  HOH HOH A . 
B 2 HOH 31  231 86  HOH HOH A . 
B 2 HOH 32  232 50  HOH HOH A . 
B 2 HOH 33  233 93  HOH HOH A . 
B 2 HOH 34  234 70  HOH HOH A . 
B 2 HOH 35  235 87  HOH HOH A . 
B 2 HOH 36  236 108 HOH HOH A . 
B 2 HOH 37  237 12  HOH HOH A . 
B 2 HOH 38  238 35  HOH HOH A . 
B 2 HOH 39  239 28  HOH HOH A . 
B 2 HOH 40  240 13  HOH HOH A . 
B 2 HOH 41  241 58  HOH HOH A . 
B 2 HOH 42  242 25  HOH HOH A . 
B 2 HOH 43  243 46  HOH HOH A . 
B 2 HOH 44  244 26  HOH HOH A . 
B 2 HOH 45  245 31  HOH HOH A . 
B 2 HOH 46  246 55  HOH HOH A . 
B 2 HOH 47  247 57  HOH HOH A . 
B 2 HOH 48  248 10  HOH HOH A . 
B 2 HOH 49  249 54  HOH HOH A . 
B 2 HOH 50  250 4   HOH HOH A . 
B 2 HOH 51  251 96  HOH HOH A . 
B 2 HOH 52  252 47  HOH HOH A . 
B 2 HOH 53  253 92  HOH HOH A . 
B 2 HOH 54  254 2   HOH HOH A . 
B 2 HOH 55  255 89  HOH HOH A . 
B 2 HOH 56  256 33  HOH HOH A . 
B 2 HOH 57  257 85  HOH HOH A . 
B 2 HOH 58  258 23  HOH HOH A . 
B 2 HOH 59  259 95  HOH HOH A . 
B 2 HOH 60  260 5   HOH HOH A . 
B 2 HOH 61  261 107 HOH HOH A . 
B 2 HOH 62  262 99  HOH HOH A . 
B 2 HOH 63  263 52  HOH HOH A . 
B 2 HOH 64  264 36  HOH HOH A . 
B 2 HOH 65  265 20  HOH HOH A . 
B 2 HOH 66  266 81  HOH HOH A . 
B 2 HOH 67  267 98  HOH HOH A . 
B 2 HOH 68  268 61  HOH HOH A . 
B 2 HOH 69  269 101 HOH HOH A . 
B 2 HOH 70  270 64  HOH HOH A . 
B 2 HOH 71  271 19  HOH HOH A . 
B 2 HOH 72  272 91  HOH HOH A . 
B 2 HOH 73  273 105 HOH HOH A . 
B 2 HOH 74  274 8   HOH HOH A . 
B 2 HOH 75  275 74  HOH HOH A . 
B 2 HOH 76  276 42  HOH HOH A . 
B 2 HOH 77  277 21  HOH HOH A . 
B 2 HOH 78  278 14  HOH HOH A . 
B 2 HOH 79  279 48  HOH HOH A . 
B 2 HOH 80  280 56  HOH HOH A . 
B 2 HOH 81  281 9   HOH HOH A . 
B 2 HOH 82  282 6   HOH HOH A . 
B 2 HOH 83  283 63  HOH HOH A . 
B 2 HOH 84  284 100 HOH HOH A . 
B 2 HOH 85  285 62  HOH HOH A . 
B 2 HOH 86  286 27  HOH HOH A . 
B 2 HOH 87  287 65  HOH HOH A . 
B 2 HOH 88  288 24  HOH HOH A . 
B 2 HOH 89  289 103 HOH HOH A . 
B 2 HOH 90  290 88  HOH HOH A . 
B 2 HOH 91  291 84  HOH HOH A . 
B 2 HOH 92  292 83  HOH HOH A . 
B 2 HOH 93  293 66  HOH HOH A . 
B 2 HOH 94  294 67  HOH HOH A . 
B 2 HOH 95  295 102 HOH HOH A . 
B 2 HOH 96  296 53  HOH HOH A . 
B 2 HOH 97  297 59  HOH HOH A . 
B 2 HOH 98  298 94  HOH HOH A . 
B 2 HOH 99  299 110 HOH HOH A . 
B 2 HOH 100 300 109 HOH HOH A . 
B 2 HOH 101 301 37  HOH HOH A . 
B 2 HOH 102 302 111 HOH HOH A . 
B 2 HOH 103 303 104 HOH HOH A . 
B 2 HOH 104 304 112 HOH HOH A . 
B 2 HOH 105 305 78  HOH HOH A . 
B 2 HOH 106 306 38  HOH HOH A . 
B 2 HOH 107 307 29  HOH HOH A . 
B 2 HOH 108 308 45  HOH HOH A . 
B 2 HOH 109 309 114 HOH HOH A . 
B 2 HOH 110 310 34  HOH HOH A . 
B 2 HOH 111 311 73  HOH HOH A . 
B 2 HOH 112 312 49  HOH HOH A . 
B 2 HOH 113 313 115 HOH HOH A . 
B 2 HOH 114 314 40  HOH HOH A . 
B 2 HOH 115 315 116 HOH HOH A . 
B 2 HOH 116 316 80  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  8310 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 274 ? B HOH . 
2 1 A HOH 282 ? B HOH . 
3 1 A HOH 312 ? B HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-06-03 
2 'Structure model' 1 1 2015-06-17 
3 'Structure model' 1 2 2015-06-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         21.0685 
_pdbx_refine_tls.origin_y         -10.5138 
_pdbx_refine_tls.origin_z         14.5465 
_pdbx_refine_tls.T[1][1]          0.1189 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          -0.0094 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          0.0137 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          0.1680 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          0.0116 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          0.1507 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          1.4820 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          -0.0402 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          0.3345 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          0.7421 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          0.0742 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          1.1082 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          0.0565 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          -0.0356 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          -0.1539 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          -0.0245 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          -0.0040 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          -0.1293 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tls.S[3][1]          0.1371 
_pdbx_refine_tls.S[3][1]_esd      ? 
_pdbx_refine_tls.S[3][2]          -0.0924 
_pdbx_refine_tls.S[3][2]_esd      ? 
_pdbx_refine_tls.S[3][3]          -0.0547 
_pdbx_refine_tls.S[3][3]_esd      ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? A -6 ? ? A 119 ? all 
2 'X-RAY DIFFRACTION' 1 ? ? B 1  ? ? B 116 ? all 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .    3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA       ? ? ? .    4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .    5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NE2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLN 
_pdbx_validate_close_contact.auth_seq_id_1    116 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    201 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    GLN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     85 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             54.55 
_pdbx_validate_torsion.psi             14.18 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY -11 ? A GLY 1   
2 1 Y 1 A PRO -10 ? A PRO 2   
3 1 Y 1 A GLU -9  ? A GLU 3   
4 1 Y 1 A GLU -8  ? A GLU 4   
5 1 Y 1 A GLY -7  ? A GLY 5   
6 1 Y 1 A GLY 120 ? A GLY 132 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#