data_4ZHF
# 
_entry.id   4ZHF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ZHF         
WWPDB D_1000209283 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4ZHC PDB . 
unspecified 4ZHD PDB . 
unspecified 4ZHG PDB . 
unspecified 4ZHH PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4ZHF 
_pdbx_database_status.recvd_initial_deposition_date   2015-04-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Allred, B.E.'           1 
'Rupert, P.B.'           2 
'Gauny, S.S.'            3 
'An, D.D.'               4 
'Ralston, C.Y.'          5 
'Sturzbecher-Hoehne, M.' 6 
'Strong, R.K.'           7 
'Abergel, R.J.'          8 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            112 
_citation.language                  ? 
_citation.page_first                10342 
_citation.page_last                 10347 
_citation.title                     'Siderocalin-mediated recognition, sensitization, and cellular uptake of actinides.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1508902112 
_citation.pdbx_database_id_PubMed   26240330 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Allred, B.E.'           1 
primary 'Rupert, P.B.'           2 
primary 'Gauny, S.S.'            3 
primary 'An, D.D.'               4 
primary 'Ralston, C.Y.'          5 
primary 'Sturzbecher-Hoehne, M.' 6 
primary 'Strong, R.K.'           7 
primary 'Abergel, R.J.'          8 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4ZHF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     107.676 
_cell.length_a_esd                 ? 
_cell.length_b                     117.775 
_cell.length_b_esd                 ? 
_cell.length_c                     121.203 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        24 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4ZHF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Neutrophil gelatinase-associated lipocalin' 20700.564 6   ? C87S 'residues 22-198' ? 
2 non-polymer syn 'CURIUM ION' 247.000   6   ? ?    ?                 ? 
3 non-polymer syn 
;N,N'-butane-1,4-diylbis[1-hydroxy-N-(3-{[(1-hydroxy-6-oxo-1,6-dihydropyridin-2-yl)carbonyl]amino}propyl)-6-oxo-1,6-dihydropyridine-2-carboxamide]
;
750.712   6   ? ?    ?                 ? 
4 non-polymer syn 'SULFATE ION' 96.063    10  ? ?    ?                 ? 
5 non-polymer syn GLYCEROL 92.094    4   ? ?    ?                 ? 
6 water       nat water 18.015    252 ? ?    ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'NGAL,25 kDa alpha-2-microglobulin-related subunit of MMP-9,Lipocalin-2,Oncogene 24p3,Siderocalin LCN2,p25' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDY
WIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKS
LGLPENHIVFPVPIDQCIDG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDY
WIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKS
LGLPENHIVFPVPIDQCIDG
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLN n 
1 4   ASP n 
1 5   SER n 
1 6   THR n 
1 7   SER n 
1 8   ASP n 
1 9   LEU n 
1 10  ILE n 
1 11  PRO n 
1 12  ALA n 
1 13  PRO n 
1 14  PRO n 
1 15  LEU n 
1 16  SER n 
1 17  LYS n 
1 18  VAL n 
1 19  PRO n 
1 20  LEU n 
1 21  GLN n 
1 22  GLN n 
1 23  ASN n 
1 24  PHE n 
1 25  GLN n 
1 26  ASP n 
1 27  ASN n 
1 28  GLN n 
1 29  PHE n 
1 30  GLN n 
1 31  GLY n 
1 32  LYS n 
1 33  TRP n 
1 34  TYR n 
1 35  VAL n 
1 36  VAL n 
1 37  GLY n 
1 38  LEU n 
1 39  ALA n 
1 40  GLY n 
1 41  ASN n 
1 42  ALA n 
1 43  ILE n 
1 44  LEU n 
1 45  ARG n 
1 46  GLU n 
1 47  ASP n 
1 48  LYS n 
1 49  ASP n 
1 50  PRO n 
1 51  GLN n 
1 52  LYS n 
1 53  MET n 
1 54  TYR n 
1 55  ALA n 
1 56  THR n 
1 57  ILE n 
1 58  TYR n 
1 59  GLU n 
1 60  LEU n 
1 61  LYS n 
1 62  GLU n 
1 63  ASP n 
1 64  LYS n 
1 65  SER n 
1 66  TYR n 
1 67  ASN n 
1 68  VAL n 
1 69  THR n 
1 70  SER n 
1 71  VAL n 
1 72  LEU n 
1 73  PHE n 
1 74  ARG n 
1 75  LYS n 
1 76  LYS n 
1 77  LYS n 
1 78  CYS n 
1 79  ASP n 
1 80  TYR n 
1 81  TRP n 
1 82  ILE n 
1 83  ARG n 
1 84  THR n 
1 85  PHE n 
1 86  VAL n 
1 87  PRO n 
1 88  GLY n 
1 89  SER n 
1 90  GLN n 
1 91  PRO n 
1 92  GLY n 
1 93  GLU n 
1 94  PHE n 
1 95  THR n 
1 96  LEU n 
1 97  GLY n 
1 98  ASN n 
1 99  ILE n 
1 100 LYS n 
1 101 SER n 
1 102 TYR n 
1 103 PRO n 
1 104 GLY n 
1 105 LEU n 
1 106 THR n 
1 107 SER n 
1 108 TYR n 
1 109 LEU n 
1 110 VAL n 
1 111 ARG n 
1 112 VAL n 
1 113 VAL n 
1 114 SER n 
1 115 THR n 
1 116 ASN n 
1 117 TYR n 
1 118 ASN n 
1 119 GLN n 
1 120 HIS n 
1 121 ALA n 
1 122 MET n 
1 123 VAL n 
1 124 PHE n 
1 125 PHE n 
1 126 LYS n 
1 127 LYS n 
1 128 VAL n 
1 129 SER n 
1 130 GLN n 
1 131 ASN n 
1 132 ARG n 
1 133 GLU n 
1 134 TYR n 
1 135 PHE n 
1 136 LYS n 
1 137 ILE n 
1 138 THR n 
1 139 LEU n 
1 140 TYR n 
1 141 GLY n 
1 142 ARG n 
1 143 THR n 
1 144 LYS n 
1 145 GLU n 
1 146 LEU n 
1 147 THR n 
1 148 SER n 
1 149 GLU n 
1 150 LEU n 
1 151 LYS n 
1 152 GLU n 
1 153 ASN n 
1 154 PHE n 
1 155 ILE n 
1 156 ARG n 
1 157 PHE n 
1 158 SER n 
1 159 LYS n 
1 160 SER n 
1 161 LEU n 
1 162 GLY n 
1 163 LEU n 
1 164 PRO n 
1 165 GLU n 
1 166 ASN n 
1 167 HIS n 
1 168 ILE n 
1 169 VAL n 
1 170 PHE n 
1 171 PRO n 
1 172 VAL n 
1 173 PRO n 
1 174 ILE n 
1 175 ASP n 
1 176 GLN n 
1 177 CYS n 
1 178 ILE n 
1 179 ASP n 
1 180 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   180 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'LCN2, HNL, NGAL' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NGAL_HUMAN 
_struct_ref.pdbx_db_accession          P80188 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWI
RTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLG
LPENHIVFPVPIDQCIDG
;
_struct_ref.pdbx_align_begin           21 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ZHF A 3 ? 180 ? P80188 21 ? 198 ? 1 178 
2 1 4ZHF B 3 ? 180 ? P80188 21 ? 198 ? 1 178 
3 1 4ZHF C 3 ? 180 ? P80188 21 ? 198 ? 1 178 
4 1 4ZHF D 3 ? 180 ? P80188 21 ? 198 ? 1 178 
5 1 4ZHF E 3 ? 180 ? P80188 21 ? 198 ? 1 178 
6 1 4ZHF F 3 ? 180 ? P80188 21 ? 198 ? 1 178 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ZHF GLY A 1  ? UNP P80188 ?   ?   'expression tag'      -1 1  
1 4ZHF SER A 2  ? UNP P80188 ?   ?   'expression tag'      0  2  
1 4ZHF SER A 89 ? UNP P80188 CYS 107 'engineered mutation' 87 3  
2 4ZHF GLY B 1  ? UNP P80188 ?   ?   'expression tag'      -1 4  
2 4ZHF SER B 2  ? UNP P80188 ?   ?   'expression tag'      0  5  
2 4ZHF SER B 89 ? UNP P80188 CYS 107 'engineered mutation' 87 6  
3 4ZHF GLY C 1  ? UNP P80188 ?   ?   'expression tag'      -1 7  
3 4ZHF SER C 2  ? UNP P80188 ?   ?   'expression tag'      0  8  
3 4ZHF SER C 89 ? UNP P80188 CYS 107 'engineered mutation' 87 9  
4 4ZHF GLY D 1  ? UNP P80188 ?   ?   'expression tag'      -1 10 
4 4ZHF SER D 2  ? UNP P80188 ?   ?   'expression tag'      0  11 
4 4ZHF SER D 89 ? UNP P80188 CYS 107 'engineered mutation' 87 12 
5 4ZHF GLY E 1  ? UNP P80188 ?   ?   'expression tag'      -1 13 
5 4ZHF SER E 2  ? UNP P80188 ?   ?   'expression tag'      0  14 
5 4ZHF SER E 89 ? UNP P80188 CYS 107 'engineered mutation' 87 15 
6 4ZHF GLY F 1  ? UNP P80188 ?   ?   'expression tag'      -1 16 
6 4ZHF SER F 2  ? UNP P80188 ?   ?   'expression tag'      0  17 
6 4ZHF SER F 89 ? UNP P80188 CYS 107 'engineered mutation' 87 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4OL non-polymer         . 
;N,N'-butane-1,4-diylbis[1-hydroxy-N-(3-{[(1-hydroxy-6-oxo-1,6-dihydropyridin-2-yl)carbonyl]amino}propyl)-6-oxo-1,6-dihydropyridine-2-carboxamide]
;
?                               'C34 H38 N8 O12' 750.712 
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION' ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'    117.146 
ZCM non-polymer         . 'CURIUM ION' ?                               'Cm 3'           247.000 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4ZHF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.14 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         60.77 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'NaCl, Li2SO4, Acetate, Ammonium Sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-03-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Double-crystal, Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4ZHF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.450 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       56438 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.900 
_reflns.pdbx_Rmerge_I_obs                0.135 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         13.731 
_reflns.pdbx_netI_over_sigmaI            7.600 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.387 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.150 
_reflns.pdbx_Rpim_I_all                  0.064 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         277210 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.450 2.490  ? ? ? ? ? 2806 ? 100.000 ? ? ? ? 0.463 ? ? ? ? ? ? ? ? 5.000 ? 0.692 ? ? 0.513 0.216 0 1  1 0.876 ? 
2.490 2.540  ? ? ? ? ? 2794 ? 100.000 ? ? ? ? 0.427 ? ? ? ? ? ? ? ? 5.000 ? 0.707 ? ? 0.473 0.198 0 2  1 0.891 ? 
2.540 2.590  ? ? ? ? ? 2797 ? 99.900  ? ? ? ? 0.375 ? ? ? ? ? ? ? ? 5.000 ? 0.725 ? ? 0.415 0.175 0 3  1 0.914 ? 
2.590 2.640  ? ? ? ? ? 2851 ? 99.800  ? ? ? ? 0.358 ? ? ? ? ? ? ? ? 5.000 ? 0.773 ? ? 0.397 0.166 0 4  1 0.927 ? 
2.640 2.700  ? ? ? ? ? 2825 ? 99.900  ? ? ? ? 0.321 ? ? ? ? ? ? ? ? 5.000 ? 0.804 ? ? 0.356 0.149 0 5  1 0.933 ? 
2.700 2.760  ? ? ? ? ? 2796 ? 99.800  ? ? ? ? 0.275 ? ? ? ? ? ? ? ? 5.000 ? 0.858 ? ? 0.304 0.128 0 6  1 0.948 ? 
2.760 2.830  ? ? ? ? ? 2820 ? 100.000 ? ? ? ? 0.248 ? ? ? ? ? ? ? ? 5.000 ? 0.981 ? ? 0.275 0.116 0 7  1 0.955 ? 
2.830 2.900  ? ? ? ? ? 2839 ? 99.900  ? ? ? ? 0.231 ? ? ? ? ? ? ? ? 5.000 ? 1.088 ? ? 0.256 0.108 0 8  1 0.960 ? 
2.900 2.990  ? ? ? ? ? 2808 ? 99.600  ? ? ? ? 0.202 ? ? ? ? ? ? ? ? 5.000 ? 1.267 ? ? 0.224 0.094 0 9  1 0.968 ? 
2.990 3.090  ? ? ? ? ? 2804 ? 99.300  ? ? ? ? 0.175 ? ? ? ? ? ? ? ? 4.900 ? 1.498 ? ? 0.194 0.082 0 10 1 0.972 ? 
3.090 3.200  ? ? ? ? ? 2835 ? 99.500  ? ? ? ? 0.162 ? ? ? ? ? ? ? ? 4.900 ? 1.553 ? ? 0.180 0.076 0 11 1 0.976 ? 
3.200 3.320  ? ? ? ? ? 2814 ? 99.500  ? ? ? ? 0.140 ? ? ? ? ? ? ? ? 4.900 ? 1.893 ? ? 0.156 0.066 0 12 1 0.984 ? 
3.320 3.480  ? ? ? ? ? 2857 ? 99.600  ? ? ? ? 0.129 ? ? ? ? ? ? ? ? 4.900 ? 1.990 ? ? 0.143 0.061 0 13 1 0.985 ? 
3.480 3.660  ? ? ? ? ? 2811 ? 98.900  ? ? ? ? 0.116 ? ? ? ? ? ? ? ? 4.900 ? 2.186 ? ? 0.129 0.055 0 14 1 0.986 ? 
3.660 3.890  ? ? ? ? ? 2809 ? 98.300  ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 4.900 ? 2.203 ? ? 0.124 0.053 0 15 1 0.987 ? 
3.890 4.190  ? ? ? ? ? 2813 ? 98.100  ? ? ? ? 0.111 ? ? ? ? ? ? ? ? 4.800 ? 2.103 ? ? 0.124 0.053 0 16 1 0.985 ? 
4.190 4.610  ? ? ? ? ? 2823 ? 98.000  ? ? ? ? 0.106 ? ? ? ? ? ? ? ? 4.800 ? 1.765 ? ? 0.118 0.051 0 17 1 0.981 ? 
4.610 5.280  ? ? ? ? ? 2826 ? 97.000  ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 4.800 ? 1.383 ? ? 0.105 0.045 0 18 1 0.989 ? 
5.280 6.650  ? ? ? ? ? 2836 ? 96.600  ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 4.800 ? 1.527 ? ? 0.093 0.039 0 19 1 0.993 ? 
6.650 50.000 ? ? ? ? ? 2874 ? 93.300  ? ? ? ? 0.077 ? ? ? ? ? ? ? ? 4.900 ? 1.858 ? ? 0.085 0.035 0 20 1 0.995 ? 
# 
_refine.aniso_B[1][1]                            0.4400 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            0.2400 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -0.6700 
_refine.B_iso_max                                114.500 
_refine.B_iso_mean                               29.4130 
_refine.B_iso_min                                8.950 
_refine.correlation_coeff_Fo_to_Fc               0.9250 
_refine.correlation_coeff_Fo_to_Fc_free          0.9100 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4ZHF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.4500 
_refine.ls_d_res_low                             50. 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     53541 
_refine.ls_number_reflns_R_free                  2852 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.7800 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2039 
_refine.ls_R_factor_R_free                       0.2241 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2029 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      0.2132 
_refine.ls_wR_factor_R_work                      0.1930 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4ZHG 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.3780 
_refine.pdbx_overall_ESU_R_Free                  0.2330 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           2 
_refine.overall_SU_B                             14.5050 
_refine.overall_SU_ML                            0.1640 
_refine.overall_SU_R_Cruickshank_DPI             0.3780 
_refine.overall_SU_R_free                        0.2330 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.8550 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.4500 
_refine_hist.d_res_low                        50. 
_refine_hist.pdbx_number_atoms_ligand         404 
_refine_hist.number_atoms_solvent             252 
_refine_hist.number_atoms_total               9140 
_refine_hist.pdbx_number_residues_total       1055 
_refine_hist.pdbx_B_iso_mean_ligand           40.22 
_refine_hist.pdbx_B_iso_mean_solvent          23.83 
_refine_hist.pdbx_number_atoms_protein        8484 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  0.020  9208  ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.003  0.020  8523  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 0.972  2.003  12526 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 0.731  3.000  19630 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 7.830  5.000  1077  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 33.546 24.417 412   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 15.921 15.000 1489  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 16.824 15.000 39    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.064  0.200  1315  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.021  10395 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  2206  ? r_gen_planes_other     ? ? 
'X-RAY DIFFRACTION' ? 1.702  1.419  4245  ? r_mcbond_it            ? ? 
'X-RAY DIFFRACTION' ? 1.699  1.419  4244  ? r_mcbond_other         ? ? 
'X-RAY DIFFRACTION' ? 2.752  2.120  5304  ? r_mcangle_it           ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1  'X-RAY DIFFRACTION' 1  1 'interatomic distance' A 10232 0.100 0.050 ? ? ? 
2  'X-RAY DIFFRACTION' 1  2 'interatomic distance' B 10232 0.100 0.050 ? ? ? 
3  'X-RAY DIFFRACTION' 2  1 'interatomic distance' A 10110 0.110 0.050 ? ? ? 
4  'X-RAY DIFFRACTION' 2  2 'interatomic distance' C 10110 0.110 0.050 ? ? ? 
5  'X-RAY DIFFRACTION' 3  1 'interatomic distance' A 10541 0.080 0.050 ? ? ? 
6  'X-RAY DIFFRACTION' 3  2 'interatomic distance' D 10541 0.080 0.050 ? ? ? 
7  'X-RAY DIFFRACTION' 4  1 'interatomic distance' A 10089 0.100 0.050 ? ? ? 
8  'X-RAY DIFFRACTION' 4  2 'interatomic distance' E 10089 0.100 0.050 ? ? ? 
9  'X-RAY DIFFRACTION' 5  1 'interatomic distance' A 10228 0.100 0.050 ? ? ? 
10 'X-RAY DIFFRACTION' 5  2 'interatomic distance' F 10228 0.100 0.050 ? ? ? 
11 'X-RAY DIFFRACTION' 6  1 'interatomic distance' B 10531 0.070 0.050 ? ? ? 
12 'X-RAY DIFFRACTION' 6  2 'interatomic distance' C 10531 0.070 0.050 ? ? ? 
13 'X-RAY DIFFRACTION' 7  1 'interatomic distance' B 10297 0.100 0.050 ? ? ? 
14 'X-RAY DIFFRACTION' 7  2 'interatomic distance' D 10297 0.100 0.050 ? ? ? 
15 'X-RAY DIFFRACTION' 8  1 'interatomic distance' B 10055 0.100 0.050 ? ? ? 
16 'X-RAY DIFFRACTION' 8  2 'interatomic distance' E 10055 0.100 0.050 ? ? ? 
17 'X-RAY DIFFRACTION' 9  1 'interatomic distance' B 10316 0.100 0.050 ? ? ? 
18 'X-RAY DIFFRACTION' 9  2 'interatomic distance' F 10316 0.100 0.050 ? ? ? 
19 'X-RAY DIFFRACTION' 10 1 'interatomic distance' C 10097 0.100 0.050 ? ? ? 
20 'X-RAY DIFFRACTION' 10 2 'interatomic distance' D 10097 0.100 0.050 ? ? ? 
21 'X-RAY DIFFRACTION' 11 1 'interatomic distance' C 9924  0.110 0.050 ? ? ? 
22 'X-RAY DIFFRACTION' 11 2 'interatomic distance' E 9924  0.110 0.050 ? ? ? 
23 'X-RAY DIFFRACTION' 12 1 'interatomic distance' C 10119 0.110 0.050 ? ? ? 
24 'X-RAY DIFFRACTION' 12 2 'interatomic distance' F 10119 0.110 0.050 ? ? ? 
25 'X-RAY DIFFRACTION' 13 1 'interatomic distance' D 10037 0.110 0.050 ? ? ? 
26 'X-RAY DIFFRACTION' 13 2 'interatomic distance' E 10037 0.110 0.050 ? ? ? 
27 'X-RAY DIFFRACTION' 14 1 'interatomic distance' D 10083 0.110 0.050 ? ? ? 
28 'X-RAY DIFFRACTION' 14 2 'interatomic distance' F 10083 0.110 0.050 ? ? ? 
29 'X-RAY DIFFRACTION' 15 1 'interatomic distance' E 10369 0.060 0.050 ? ? ? 
30 'X-RAY DIFFRACTION' 15 2 'interatomic distance' F 10369 0.060 0.050 ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.450 
_refine_ls_shell.d_res_low                        2.5170 
_refine_ls_shell.number_reflns_all                4107 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             213 
_refine_ls_shell.number_reflns_R_work             3894 
_refine_ls_shell.percent_reflns_obs               99.2000 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3240 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2560 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1  1 A 
1  2 B 
2  1 A 
2  2 C 
3  1 A 
3  2 D 
4  1 A 
4  2 E 
5  1 A 
5  2 F 
6  1 B 
6  2 C 
7  1 B 
7  2 D 
8  1 B 
8  2 E 
9  1 B 
9  2 F 
10 1 C 
10 2 D 
11 1 C 
11 2 E 
12 1 C 
12 2 F 
13 1 D 
13 2 E 
14 1 D 
14 2 F 
15 1 E 
15 2 F 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1  1 0 0 A 3 A 176 ? ? ? ? ? ? ? ? ? 
1  2 0 0 B 3 B 176 ? ? ? ? ? ? ? ? ? 
2  1 0 0 A 3 A 176 ? ? ? ? ? ? ? ? ? 
2  2 0 0 C 3 C 176 ? ? ? ? ? ? ? ? ? 
3  1 0 0 A 2 A 178 ? ? ? ? ? ? ? ? ? 
3  2 0 0 D 2 D 178 ? ? ? ? ? ? ? ? ? 
4  1 0 0 A 2 A 176 ? ? ? ? ? ? ? ? ? 
4  2 0 0 E 2 E 176 ? ? ? ? ? ? ? ? ? 
5  1 0 0 A 3 A 176 ? ? ? ? ? ? ? ? ? 
5  2 0 0 F 3 F 176 ? ? ? ? ? ? ? ? ? 
6  1 0 0 B 3 B 177 ? ? ? ? ? ? ? ? ? 
6  2 0 0 C 3 C 177 ? ? ? ? ? ? ? ? ? 
7  1 0 0 B 3 B 176 ? ? ? ? ? ? ? ? ? 
7  2 0 0 D 3 D 176 ? ? ? ? ? ? ? ? ? 
8  1 0 0 B 3 B 176 ? ? ? ? ? ? ? ? ? 
8  2 0 0 E 3 E 176 ? ? ? ? ? ? ? ? ? 
9  1 0 0 B 3 B 177 ? ? ? ? ? ? ? ? ? 
9  2 0 0 F 3 F 177 ? ? ? ? ? ? ? ? ? 
10 1 0 0 C 3 C 176 ? ? ? ? ? ? ? ? ? 
10 2 0 0 D 3 D 176 ? ? ? ? ? ? ? ? ? 
11 1 0 0 C 3 C 176 ? ? ? ? ? ? ? ? ? 
11 2 0 0 E 3 E 176 ? ? ? ? ? ? ? ? ? 
12 1 0 0 C 3 C 177 ? ? ? ? ? ? ? ? ? 
12 2 0 0 F 3 F 177 ? ? ? ? ? ? ? ? ? 
13 1 0 0 D 2 D 176 ? ? ? ? ? ? ? ? ? 
13 2 0 0 E 2 E 176 ? ? ? ? ? ? ? ? ? 
14 1 0 0 D 3 D 176 ? ? ? ? ? ? ? ? ? 
14 2 0 0 F 3 F 176 ? ? ? ? ? ? ? ? ? 
15 1 0 0 E 3 E 176 ? ? ? ? ? ? ? ? ? 
15 2 0 0 F 3 F 176 ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
12 ? 
13 ? 
14 ? 
15 ? 
# 
_struct.entry_id                     4ZHF 
_struct.title                        'Siderocalin-mediated recognition and cellular uptake of actinides' 
_struct.pdbx_descriptor              'Neutrophil gelatinase-associated lipocalin' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4ZHF 
_struct_keywords.text            'Metal Binding Protein-inhibitor complex' 
_struct_keywords.pdbx_keywords   'Metal Binding Protein/inhibitor' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 3 ? 
I  N N 4 ? 
J  N N 2 ? 
K  N N 3 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 5 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 5 ? 
T  N N 2 ? 
U  N N 3 ? 
V  N N 4 ? 
W  N N 5 ? 
X  N N 4 ? 
Y  N N 2 ? 
Z  N N 3 ? 
AA N N 4 ? 
BA N N 5 ? 
CA N N 4 ? 
DA N N 2 ? 
EA N N 3 ? 
FA N N 4 ? 
GA N N 6 ? 
HA N N 6 ? 
IA N N 6 ? 
JA N N 6 ? 
KA N N 6 ? 
LA N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PRO A 14  ? VAL A 18  ? PRO A 12  VAL A 16  5 ? 5  
HELX_P HELX_P2  AA2 ASN A 98  ? TYR A 102 ? ASN A 96  TYR A 100 5 ? 5  
HELX_P HELX_P3  AA3 THR A 147 ? LEU A 161 ? THR A 145 LEU A 159 1 ? 15 
HELX_P HELX_P4  AA4 PRO A 164 ? ASN A 166 ? PRO A 162 ASN A 164 5 ? 3  
HELX_P HELX_P5  AA5 PRO B 14  ? VAL B 18  ? PRO B 12  VAL B 16  5 ? 5  
HELX_P HELX_P6  AA6 ASN B 98  ? TYR B 102 ? ASN B 96  TYR B 100 5 ? 5  
HELX_P HELX_P7  AA7 THR B 147 ? LEU B 161 ? THR B 145 LEU B 159 1 ? 15 
HELX_P HELX_P8  AA8 PRO B 164 ? ASN B 166 ? PRO B 162 ASN B 164 5 ? 3  
HELX_P HELX_P9  AA9 PRO C 14  ? VAL C 18  ? PRO C 12  VAL C 16  5 ? 5  
HELX_P HELX_P10 AB1 ASN C 98  ? TYR C 102 ? ASN C 96  TYR C 100 5 ? 5  
HELX_P HELX_P11 AB2 THR C 147 ? LEU C 161 ? THR C 145 LEU C 159 1 ? 15 
HELX_P HELX_P12 AB3 PRO C 164 ? ASN C 166 ? PRO C 162 ASN C 164 5 ? 3  
HELX_P HELX_P13 AB4 PRO D 14  ? VAL D 18  ? PRO D 12  VAL D 16  5 ? 5  
HELX_P HELX_P14 AB5 ASN D 98  ? TYR D 102 ? ASN D 96  TYR D 100 5 ? 5  
HELX_P HELX_P15 AB6 THR D 147 ? LEU D 161 ? THR D 145 LEU D 159 1 ? 15 
HELX_P HELX_P16 AB7 PRO D 164 ? ASN D 166 ? PRO D 162 ASN D 164 5 ? 3  
HELX_P HELX_P17 AB8 PRO E 14  ? VAL E 18  ? PRO E 12  VAL E 16  5 ? 5  
HELX_P HELX_P18 AB9 GLN E 25  ? GLN E 30  ? GLN E 23  GLN E 28  1 ? 6  
HELX_P HELX_P19 AC1 ASN E 98  ? TYR E 102 ? ASN E 96  TYR E 100 5 ? 5  
HELX_P HELX_P20 AC2 THR E 147 ? LEU E 161 ? THR E 145 LEU E 159 1 ? 15 
HELX_P HELX_P21 AC3 PRO E 164 ? ASN E 166 ? PRO E 162 ASN E 164 5 ? 3  
HELX_P HELX_P22 AC4 PRO F 14  ? VAL F 18  ? PRO F 12  VAL F 16  5 ? 5  
HELX_P HELX_P23 AC5 GLN F 25  ? GLN F 30  ? GLN F 23  GLN F 28  1 ? 6  
HELX_P HELX_P24 AC6 ASN F 98  ? TYR F 102 ? ASN F 96  TYR F 100 5 ? 5  
HELX_P HELX_P25 AC7 THR F 147 ? LEU F 161 ? THR F 145 LEU F 159 1 ? 15 
HELX_P HELX_P26 AC8 PRO F 164 ? ASN F 166 ? PRO F 162 ASN F 164 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 78 SG ? ? ? 1_555 A CYS 177 SG ? ? A CYS 76 A CYS 175 1_555 ? ? ? ? ? ? ? 2.075 ? 
disulf2 disulf ? ? B CYS 78 SG ? ? ? 1_555 B CYS 177 SG ? ? B CYS 76 B CYS 175 1_555 ? ? ? ? ? ? ? 2.066 ? 
disulf3 disulf ? ? C CYS 78 SG ? ? ? 1_555 C CYS 177 SG ? ? C CYS 76 C CYS 175 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf4 disulf ? ? D CYS 78 SG ? ? ? 1_555 D CYS 177 SG ? ? D CYS 76 D CYS 175 1_555 ? ? ? ? ? ? ? 2.059 ? 
disulf5 disulf ? ? E CYS 78 SG ? ? ? 1_555 E CYS 177 SG ? ? E CYS 76 E CYS 175 1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf6 disulf ? ? F CYS 78 SG ? ? ? 1_555 F CYS 177 SG ? ? F CYS 76 F CYS 175 1_555 ? ? ? ? ? ? ? 2.064 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 10 ? 
AA2 ? 10 ? 
AA3 ? 10 ? 
AA4 ? 10 ? 
AA5 ? 10 ? 
AA6 ? 10 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? anti-parallel 
AA1 2 3  ? anti-parallel 
AA1 3 4  ? anti-parallel 
AA1 4 5  ? anti-parallel 
AA1 5 6  ? anti-parallel 
AA1 6 7  ? anti-parallel 
AA1 7 8  ? anti-parallel 
AA1 8 9  ? anti-parallel 
AA1 9 10 ? anti-parallel 
AA2 1 2  ? anti-parallel 
AA2 2 3  ? anti-parallel 
AA2 3 4  ? anti-parallel 
AA2 4 5  ? anti-parallel 
AA2 5 6  ? anti-parallel 
AA2 6 7  ? anti-parallel 
AA2 7 8  ? anti-parallel 
AA2 8 9  ? anti-parallel 
AA2 9 10 ? anti-parallel 
AA3 1 2  ? anti-parallel 
AA3 2 3  ? anti-parallel 
AA3 3 4  ? anti-parallel 
AA3 4 5  ? anti-parallel 
AA3 5 6  ? anti-parallel 
AA3 6 7  ? anti-parallel 
AA3 7 8  ? anti-parallel 
AA3 8 9  ? anti-parallel 
AA3 9 10 ? anti-parallel 
AA4 1 2  ? anti-parallel 
AA4 2 3  ? anti-parallel 
AA4 3 4  ? anti-parallel 
AA4 4 5  ? anti-parallel 
AA4 5 6  ? anti-parallel 
AA4 6 7  ? anti-parallel 
AA4 7 8  ? anti-parallel 
AA4 8 9  ? anti-parallel 
AA4 9 10 ? anti-parallel 
AA5 1 2  ? anti-parallel 
AA5 2 3  ? anti-parallel 
AA5 3 4  ? anti-parallel 
AA5 4 5  ? anti-parallel 
AA5 5 6  ? anti-parallel 
AA5 6 7  ? anti-parallel 
AA5 7 8  ? anti-parallel 
AA5 8 9  ? anti-parallel 
AA5 9 10 ? anti-parallel 
AA6 1 2  ? anti-parallel 
AA6 2 3  ? anti-parallel 
AA6 3 4  ? anti-parallel 
AA6 4 5  ? anti-parallel 
AA6 5 6  ? anti-parallel 
AA6 6 7  ? anti-parallel 
AA6 7 8  ? anti-parallel 
AA6 8 9  ? anti-parallel 
AA6 9 10 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  ILE A 168 ? VAL A 169 ? ILE A 166 VAL A 167 
AA1 2  GLY A 31  ? GLY A 40  ? GLY A 29  GLY A 38  
AA1 3  ARG A 132 ? GLY A 141 ? ARG A 130 GLY A 139 
AA1 4  HIS A 120 ? SER A 129 ? HIS A 118 SER A 127 
AA1 5  LEU A 105 ? THR A 115 ? LEU A 103 THR A 113 
AA1 6  GLU A 93  ? LEU A 96  ? GLU A 91  LEU A 94  
AA1 7  LYS A 77  ? PRO A 87  ? LYS A 75  PRO A 85  
AA1 8  TYR A 66  ? ARG A 74  ? TYR A 64  ARG A 72  
AA1 9  ALA A 55  ? LEU A 60  ? ALA A 53  LEU A 58  
AA1 10 GLY A 31  ? GLY A 40  ? GLY A 29  GLY A 38  
AA2 1  ILE B 168 ? VAL B 169 ? ILE B 166 VAL B 167 
AA2 2  GLY B 31  ? GLY B 40  ? GLY B 29  GLY B 38  
AA2 3  ARG B 132 ? GLY B 141 ? ARG B 130 GLY B 139 
AA2 4  HIS B 120 ? SER B 129 ? HIS B 118 SER B 127 
AA2 5  LEU B 105 ? THR B 115 ? LEU B 103 THR B 113 
AA2 6  GLU B 93  ? LEU B 96  ? GLU B 91  LEU B 94  
AA2 7  LYS B 77  ? PRO B 87  ? LYS B 75  PRO B 85  
AA2 8  TYR B 66  ? ARG B 74  ? TYR B 64  ARG B 72  
AA2 9  ALA B 55  ? LEU B 60  ? ALA B 53  LEU B 58  
AA2 10 GLY B 31  ? GLY B 40  ? GLY B 29  GLY B 38  
AA3 1  ILE C 168 ? VAL C 169 ? ILE C 166 VAL C 167 
AA3 2  GLY C 31  ? GLY C 40  ? GLY C 29  GLY C 38  
AA3 3  ARG C 132 ? GLY C 141 ? ARG C 130 GLY C 139 
AA3 4  HIS C 120 ? SER C 129 ? HIS C 118 SER C 127 
AA3 5  LEU C 105 ? THR C 115 ? LEU C 103 THR C 113 
AA3 6  GLU C 93  ? LEU C 96  ? GLU C 91  LEU C 94  
AA3 7  LYS C 77  ? PRO C 87  ? LYS C 75  PRO C 85  
AA3 8  TYR C 66  ? ARG C 74  ? TYR C 64  ARG C 72  
AA3 9  ALA C 55  ? LEU C 60  ? ALA C 53  LEU C 58  
AA3 10 GLY C 31  ? GLY C 40  ? GLY C 29  GLY C 38  
AA4 1  ILE D 168 ? VAL D 169 ? ILE D 166 VAL D 167 
AA4 2  GLY D 31  ? GLY D 40  ? GLY D 29  GLY D 38  
AA4 3  ARG D 132 ? GLY D 141 ? ARG D 130 GLY D 139 
AA4 4  HIS D 120 ? SER D 129 ? HIS D 118 SER D 127 
AA4 5  LEU D 105 ? THR D 115 ? LEU D 103 THR D 113 
AA4 6  GLU D 93  ? LEU D 96  ? GLU D 91  LEU D 94  
AA4 7  LYS D 77  ? PRO D 87  ? LYS D 75  PRO D 85  
AA4 8  TYR D 66  ? ARG D 74  ? TYR D 64  ARG D 72  
AA4 9  ALA D 55  ? LEU D 60  ? ALA D 53  LEU D 58  
AA4 10 GLY D 31  ? GLY D 40  ? GLY D 29  GLY D 38  
AA5 1  ILE E 168 ? VAL E 169 ? ILE E 166 VAL E 167 
AA5 2  GLY E 31  ? GLY E 40  ? GLY E 29  GLY E 38  
AA5 3  ARG E 132 ? GLY E 141 ? ARG E 130 GLY E 139 
AA5 4  HIS E 120 ? SER E 129 ? HIS E 118 SER E 127 
AA5 5  LEU E 105 ? THR E 115 ? LEU E 103 THR E 113 
AA5 6  GLU E 93  ? LEU E 96  ? GLU E 91  LEU E 94  
AA5 7  LYS E 77  ? PRO E 87  ? LYS E 75  PRO E 85  
AA5 8  TYR E 66  ? ARG E 74  ? TYR E 64  ARG E 72  
AA5 9  ALA E 55  ? LEU E 60  ? ALA E 53  LEU E 58  
AA5 10 GLY E 31  ? GLY E 40  ? GLY E 29  GLY E 38  
AA6 1  ILE F 168 ? VAL F 169 ? ILE F 166 VAL F 167 
AA6 2  GLY F 31  ? GLY F 40  ? GLY F 29  GLY F 38  
AA6 3  ARG F 132 ? GLY F 141 ? ARG F 130 GLY F 139 
AA6 4  HIS F 120 ? SER F 129 ? HIS F 118 SER F 127 
AA6 5  LEU F 105 ? THR F 115 ? LEU F 103 THR F 113 
AA6 6  GLU F 93  ? LEU F 96  ? GLU F 91  LEU F 94  
AA6 7  LYS F 77  ? PRO F 87  ? LYS F 75  PRO F 85  
AA6 8  TYR F 66  ? ARG F 74  ? TYR F 64  ARG F 72  
AA6 9  ALA F 55  ? LEU F 60  ? ALA F 53  LEU F 58  
AA6 10 GLY F 31  ? GLY F 40  ? GLY F 29  GLY F 38  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O VAL A 169 ? O VAL A 167 N LEU A 38  ? N LEU A 36  
AA1 2 3  N TYR A 34  ? N TYR A 32  O GLY A 141 ? O GLY A 139 
AA1 3 4  O TYR A 140 ? O TYR A 138 N ALA A 121 ? N ALA A 119 
AA1 4 5  O LYS A 126 ? O LYS A 124 N LEU A 109 ? N LEU A 107 
AA1 5 6  O VAL A 110 ? O VAL A 108 N PHE A 94  ? N PHE A 92  
AA1 6 7  O THR A 95  ? O THR A 93  N VAL A 86  ? N VAL A 84  
AA1 7 8  O ARG A 83  ? O ARG A 81  N VAL A 68  ? N VAL A 66  
AA1 8 9  O THR A 69  ? O THR A 67  N ILE A 57  ? N ILE A 55  
AA1 9 10 O THR A 56  ? O THR A 54  N TRP A 33  ? N TRP A 31  
AA2 1 2  O VAL B 169 ? O VAL B 167 N LEU B 38  ? N LEU B 36  
AA2 2 3  N TYR B 34  ? N TYR B 32  O GLY B 141 ? O GLY B 139 
AA2 3 4  O TYR B 140 ? O TYR B 138 N ALA B 121 ? N ALA B 119 
AA2 4 5  O LYS B 126 ? O LYS B 124 N LEU B 109 ? N LEU B 107 
AA2 5 6  O VAL B 110 ? O VAL B 108 N PHE B 94  ? N PHE B 92  
AA2 6 7  O THR B 95  ? O THR B 93  N VAL B 86  ? N VAL B 84  
AA2 7 8  O ASP B 79  ? O ASP B 77  N LEU B 72  ? N LEU B 70  
AA2 8 9  O THR B 69  ? O THR B 67  N ILE B 57  ? N ILE B 55  
AA2 9 10 O THR B 56  ? O THR B 54  N TRP B 33  ? N TRP B 31  
AA3 1 2  O VAL C 169 ? O VAL C 167 N LEU C 38  ? N LEU C 36  
AA3 2 3  N TYR C 34  ? N TYR C 32  O GLY C 141 ? O GLY C 139 
AA3 3 4  O TYR C 140 ? O TYR C 138 N ALA C 121 ? N ALA C 119 
AA3 4 5  O LYS C 126 ? O LYS C 124 N LEU C 109 ? N LEU C 107 
AA3 5 6  O VAL C 110 ? O VAL C 108 N PHE C 94  ? N PHE C 92  
AA3 6 7  O THR C 95  ? O THR C 93  N VAL C 86  ? N VAL C 84  
AA3 7 8  O ASP C 79  ? O ASP C 77  N LEU C 72  ? N LEU C 70  
AA3 8 9  O THR C 69  ? O THR C 67  N ILE C 57  ? N ILE C 55  
AA3 9 10 O THR C 56  ? O THR C 54  N TRP C 33  ? N TRP C 31  
AA4 1 2  O VAL D 169 ? O VAL D 167 N LEU D 38  ? N LEU D 36  
AA4 2 3  N TYR D 34  ? N TYR D 32  O GLY D 141 ? O GLY D 139 
AA4 3 4  O TYR D 140 ? O TYR D 138 N ALA D 121 ? N ALA D 119 
AA4 4 5  O LYS D 126 ? O LYS D 124 N LEU D 109 ? N LEU D 107 
AA4 5 6  O VAL D 110 ? O VAL D 108 N PHE D 94  ? N PHE D 92  
AA4 6 7  O THR D 95  ? O THR D 93  N VAL D 86  ? N VAL D 84  
AA4 7 8  O ARG D 83  ? O ARG D 81  N VAL D 68  ? N VAL D 66  
AA4 8 9  O THR D 69  ? O THR D 67  N ILE D 57  ? N ILE D 55  
AA4 9 10 O THR D 56  ? O THR D 54  N TRP D 33  ? N TRP D 31  
AA5 1 2  O VAL E 169 ? O VAL E 167 N LEU E 38  ? N LEU E 36  
AA5 2 3  N TYR E 34  ? N TYR E 32  O GLY E 141 ? O GLY E 139 
AA5 3 4  O TYR E 140 ? O TYR E 138 N ALA E 121 ? N ALA E 119 
AA5 4 5  O PHE E 124 ? O PHE E 122 N ARG E 111 ? N ARG E 109 
AA5 5 6  O VAL E 110 ? O VAL E 108 N PHE E 94  ? N PHE E 92  
AA5 6 7  O THR E 95  ? O THR E 93  N VAL E 86  ? N VAL E 84  
AA5 7 8  O ASP E 79  ? O ASP E 77  N LEU E 72  ? N LEU E 70  
AA5 8 9  O THR E 69  ? O THR E 67  N ILE E 57  ? N ILE E 55  
AA5 9 10 O TYR E 58  ? O TYR E 56  N GLY E 31  ? N GLY E 29  
AA6 1 2  O VAL F 169 ? O VAL F 167 N LEU F 38  ? N LEU F 36  
AA6 2 3  N TYR F 34  ? N TYR F 32  O GLY F 141 ? O GLY F 139 
AA6 3 4  O TYR F 140 ? O TYR F 138 N ALA F 121 ? N ALA F 119 
AA6 4 5  O PHE F 124 ? O PHE F 122 N ARG F 111 ? N ARG F 109 
AA6 5 6  O VAL F 110 ? O VAL F 108 N PHE F 94  ? N PHE F 92  
AA6 6 7  O THR F 95  ? O THR F 93  N VAL F 86  ? N VAL F 84  
AA6 7 8  O ASP F 79  ? O ASP F 77  N LEU F 72  ? N LEU F 70  
AA6 8 9  O THR F 69  ? O THR F 67  N ILE F 57  ? N ILE F 55  
AA6 9 10 O TYR F 58  ? O TYR F 56  N GLY F 31  ? N GLY F 29  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZCM 201 ? 1  'binding site for residue ZCM A 201' 
AC2 Software A 4OL 202 ? 16 'binding site for residue 4OL A 202' 
AC3 Software A SO4 203 ? 9  'binding site for residue SO4 A 203' 
AC4 Software B ZCM 201 ? 1  'binding site for residue ZCM B 201' 
AC5 Software B 4OL 202 ? 16 'binding site for residue 4OL B 202' 
AC6 Software B SO4 203 ? 3  'binding site for residue SO4 B 203' 
AC7 Software B SO4 204 ? 8  'binding site for residue SO4 B 204' 
AC8 Software B GOL 205 ? 3  'binding site for residue GOL B 205' 
AC9 Software C ZCM 201 ? 1  'binding site for residue ZCM C 201' 
AD1 Software C 4OL 202 ? 16 'binding site for residue 4OL C 202' 
AD2 Software C SO4 203 ? 4  'binding site for residue SO4 C 203' 
AD3 Software C SO4 204 ? 10 'binding site for residue SO4 C 204' 
AD4 Software C GOL 205 ? 3  'binding site for residue GOL C 205' 
AD5 Software D ZCM 201 ? 1  'binding site for residue ZCM D 201' 
AD6 Software D 4OL 202 ? 15 'binding site for residue 4OL D 202' 
AD7 Software D SO4 203 ? 10 'binding site for residue SO4 D 203' 
AD8 Software D GOL 204 ? 3  'binding site for residue GOL D 204' 
AD9 Software D SO4 205 ? 2  'binding site for residue SO4 D 205' 
AE1 Software E ZCM 201 ? 1  'binding site for residue ZCM E 201' 
AE2 Software E 4OL 202 ? 15 'binding site for residue 4OL E 202' 
AE3 Software E SO4 203 ? 9  'binding site for residue SO4 E 203' 
AE4 Software E GOL 204 ? 4  'binding site for residue GOL E 204' 
AE5 Software E SO4 205 ? 4  'binding site for residue SO4 E 205' 
AE6 Software F ZCM 201 ? 1  'binding site for residue ZCM F 201' 
AE7 Software F 4OL 202 ? 13 'binding site for residue 4OL F 202' 
AE8 Software F SO4 203 ? 10 'binding site for residue SO4 F 203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 1  4OL H  .   ? 4OL A 202 . ? 1_555 ? 
2   AC2 16 ALA A  42  ? ALA A 40  . ? 1_555 ? 
3   AC2 16 ILE A  43  ? ILE A 41  . ? 1_555 ? 
4   AC2 16 SER A  70  ? SER A 68  . ? 1_555 ? 
5   AC2 16 LEU A  72  ? LEU A 70  . ? 1_555 ? 
6   AC2 16 TRP A  81  ? TRP A 79  . ? 1_555 ? 
7   AC2 16 ARG A  83  ? ARG A 81  . ? 1_555 ? 
8   AC2 16 TYR A  102 ? TYR A 100 . ? 1_555 ? 
9   AC2 16 TYR A  108 ? TYR A 106 . ? 1_555 ? 
10  AC2 16 LYS A  127 ? LYS A 125 . ? 1_555 ? 
11  AC2 16 TYR A  134 ? TYR A 132 . ? 1_555 ? 
12  AC2 16 LYS A  136 ? LYS A 134 . ? 1_555 ? 
13  AC2 16 ZCM G  .   ? ZCM A 201 . ? 1_555 ? 
14  AC2 16 SO4 I  .   ? SO4 A 203 . ? 1_555 ? 
15  AC2 16 HOH GA .   ? HOH A 312 . ? 1_555 ? 
16  AC2 16 HOH GA .   ? HOH A 315 . ? 1_555 ? 
17  AC2 16 HOH GA .   ? HOH A 325 . ? 1_555 ? 
18  AC3 9  TYR A  54  ? TYR A 52  . ? 1_555 ? 
19  AC3 9  THR A  56  ? THR A 54  . ? 1_555 ? 
20  AC3 9  SER A  70  ? SER A 68  . ? 1_555 ? 
21  AC3 9  ARG A  83  ? ARG A 81  . ? 1_555 ? 
22  AC3 9  PHE A  125 ? PHE A 123 . ? 1_555 ? 
23  AC3 9  LYS A  136 ? LYS A 134 . ? 1_555 ? 
24  AC3 9  THR A  138 ? THR A 136 . ? 1_555 ? 
25  AC3 9  TYR A  140 ? TYR A 138 . ? 1_555 ? 
26  AC3 9  4OL H  .   ? 4OL A 202 . ? 1_555 ? 
27  AC4 1  4OL K  .   ? 4OL B 202 . ? 1_555 ? 
28  AC5 16 ILE B  43  ? ILE B 41  . ? 1_555 ? 
29  AC5 16 TYR B  54  ? TYR B 52  . ? 1_555 ? 
30  AC5 16 SER B  70  ? SER B 68  . ? 1_555 ? 
31  AC5 16 LEU B  72  ? LEU B 70  . ? 1_555 ? 
32  AC5 16 TRP B  81  ? TRP B 79  . ? 1_555 ? 
33  AC5 16 TYR B  102 ? TYR B 100 . ? 1_555 ? 
34  AC5 16 TYR B  108 ? TYR B 106 . ? 1_555 ? 
35  AC5 16 LYS B  127 ? LYS B 125 . ? 1_555 ? 
36  AC5 16 PHE B  135 ? PHE B 133 . ? 1_555 ? 
37  AC5 16 LYS B  136 ? LYS B 134 . ? 1_555 ? 
38  AC5 16 ZCM J  .   ? ZCM B 201 . ? 1_555 ? 
39  AC5 16 SO4 M  .   ? SO4 B 204 . ? 1_555 ? 
40  AC5 16 HOH HA .   ? HOH B 301 . ? 1_555 ? 
41  AC5 16 HOH HA .   ? HOH B 305 . ? 1_555 ? 
42  AC5 16 HOH HA .   ? HOH B 310 . ? 1_555 ? 
43  AC5 16 HOH HA .   ? HOH B 332 . ? 1_555 ? 
44  AC6 3  ASN B  116 ? ASN B 114 . ? 1_555 ? 
45  AC6 3  HIS B  120 ? HIS B 118 . ? 1_555 ? 
46  AC6 3  GLN D  119 ? GLN D 117 . ? 1_555 ? 
47  AC7 8  TYR B  54  ? TYR B 52  . ? 1_555 ? 
48  AC7 8  THR B  56  ? THR B 54  . ? 1_555 ? 
49  AC7 8  SER B  70  ? SER B 68  . ? 1_555 ? 
50  AC7 8  ARG B  83  ? ARG B 81  . ? 1_555 ? 
51  AC7 8  PHE B  125 ? PHE B 123 . ? 1_555 ? 
52  AC7 8  LYS B  136 ? LYS B 134 . ? 1_555 ? 
53  AC7 8  TYR B  140 ? TYR B 138 . ? 1_555 ? 
54  AC7 8  4OL K  .   ? 4OL B 202 . ? 1_555 ? 
55  AC8 3  LYS B  61  ? LYS B 59  . ? 1_555 ? 
56  AC8 3  GLU B  62  ? GLU B 60  . ? 1_555 ? 
57  AC8 3  ASP B  63  ? ASP B 61  . ? 1_555 ? 
58  AC9 1  4OL P  .   ? 4OL C 202 . ? 1_555 ? 
59  AD1 16 ALA C  42  ? ALA C 40  . ? 1_555 ? 
60  AD1 16 ILE C  43  ? ILE C 41  . ? 1_555 ? 
61  AD1 16 TYR C  54  ? TYR C 52  . ? 1_555 ? 
62  AD1 16 SER C  70  ? SER C 68  . ? 1_555 ? 
63  AD1 16 TRP C  81  ? TRP C 79  . ? 1_555 ? 
64  AD1 16 ARG C  83  ? ARG C 81  . ? 1_555 ? 
65  AD1 16 TYR C  102 ? TYR C 100 . ? 1_555 ? 
66  AD1 16 TYR C  108 ? TYR C 106 . ? 1_555 ? 
67  AD1 16 LYS C  127 ? LYS C 125 . ? 1_555 ? 
68  AD1 16 LYS C  136 ? LYS C 134 . ? 1_555 ? 
69  AD1 16 ZCM O  .   ? ZCM C 201 . ? 1_555 ? 
70  AD1 16 SO4 R  .   ? SO4 C 204 . ? 1_555 ? 
71  AD1 16 HOH IA .   ? HOH C 301 . ? 1_555 ? 
72  AD1 16 HOH IA .   ? HOH C 303 . ? 1_555 ? 
73  AD1 16 HOH IA .   ? HOH C 308 . ? 1_555 ? 
74  AD1 16 HOH IA .   ? HOH C 321 . ? 1_555 ? 
75  AD2 4  LYS C  77  ? LYS C 75  . ? 1_555 ? 
76  AD2 4  ILE D  10  ? ILE D 8   . ? 2_445 ? 
77  AD2 4  ASN D  166 ? ASN D 164 . ? 2_445 ? 
78  AD2 4  HIS D  167 ? HIS D 165 . ? 2_445 ? 
79  AD3 10 TYR C  54  ? TYR C 52  . ? 1_555 ? 
80  AD3 10 THR C  56  ? THR C 54  . ? 1_555 ? 
81  AD3 10 SER C  70  ? SER C 68  . ? 1_555 ? 
82  AD3 10 ARG C  83  ? ARG C 81  . ? 1_555 ? 
83  AD3 10 PHE C  125 ? PHE C 123 . ? 1_555 ? 
84  AD3 10 LYS C  136 ? LYS C 134 . ? 1_555 ? 
85  AD3 10 THR C  138 ? THR C 136 . ? 1_555 ? 
86  AD3 10 TYR C  140 ? TYR C 138 . ? 1_555 ? 
87  AD3 10 4OL P  .   ? 4OL C 202 . ? 1_555 ? 
88  AD3 10 HOH IA .   ? HOH C 324 . ? 1_555 ? 
89  AD4 3  GLN A  119 ? GLN A 117 . ? 1_555 ? 
90  AD4 3  ASN C  116 ? ASN C 114 . ? 1_555 ? 
91  AD4 3  HIS C  120 ? HIS C 118 . ? 1_555 ? 
92  AD5 1  4OL U  .   ? 4OL D 202 . ? 1_555 ? 
93  AD6 15 ILE D  43  ? ILE D 41  . ? 1_555 ? 
94  AD6 15 TYR D  54  ? TYR D 52  . ? 1_555 ? 
95  AD6 15 SER D  70  ? SER D 68  . ? 1_555 ? 
96  AD6 15 LEU D  72  ? LEU D 70  . ? 1_555 ? 
97  AD6 15 TRP D  81  ? TRP D 79  . ? 1_555 ? 
98  AD6 15 TYR D  102 ? TYR D 100 . ? 1_555 ? 
99  AD6 15 TYR D  108 ? TYR D 106 . ? 1_555 ? 
100 AD6 15 LYS D  127 ? LYS D 125 . ? 1_555 ? 
101 AD6 15 LYS D  136 ? LYS D 134 . ? 1_555 ? 
102 AD6 15 ZCM T  .   ? ZCM D 201 . ? 1_555 ? 
103 AD6 15 SO4 V  .   ? SO4 D 203 . ? 1_555 ? 
104 AD6 15 HOH JA .   ? HOH D 302 . ? 1_555 ? 
105 AD6 15 HOH JA .   ? HOH D 308 . ? 1_555 ? 
106 AD6 15 HOH JA .   ? HOH D 321 . ? 1_555 ? 
107 AD6 15 HOH JA .   ? HOH D 330 . ? 1_555 ? 
108 AD7 10 TYR D  54  ? TYR D 52  . ? 1_555 ? 
109 AD7 10 THR D  56  ? THR D 54  . ? 1_555 ? 
110 AD7 10 SER D  70  ? SER D 68  . ? 1_555 ? 
111 AD7 10 ARG D  83  ? ARG D 81  . ? 1_555 ? 
112 AD7 10 PHE D  125 ? PHE D 123 . ? 1_555 ? 
113 AD7 10 LYS D  136 ? LYS D 134 . ? 1_555 ? 
114 AD7 10 THR D  138 ? THR D 136 . ? 1_555 ? 
115 AD7 10 TYR D  140 ? TYR D 138 . ? 1_555 ? 
116 AD7 10 4OL U  .   ? 4OL D 202 . ? 1_555 ? 
117 AD7 10 HOH JA .   ? HOH D 316 . ? 1_555 ? 
118 AD8 3  ASN D  116 ? ASN D 114 . ? 1_555 ? 
119 AD8 3  HOH JA .   ? HOH D 317 . ? 1_555 ? 
120 AD8 3  ASN F  118 ? ASN F 116 . ? 1_555 ? 
121 AD9 2  HIS C  167 ? HIS C 165 . ? 1_555 ? 
122 AD9 2  LYS D  77  ? LYS D 75  . ? 1_555 ? 
123 AE1 1  4OL Z  .   ? 4OL E 202 . ? 1_555 ? 
124 AE2 15 ALA E  42  ? ALA E 40  . ? 1_555 ? 
125 AE2 15 ILE E  43  ? ILE E 41  . ? 1_555 ? 
126 AE2 15 TYR E  54  ? TYR E 52  . ? 1_555 ? 
127 AE2 15 SER E  70  ? SER E 68  . ? 1_555 ? 
128 AE2 15 TRP E  81  ? TRP E 79  . ? 1_555 ? 
129 AE2 15 ARG E  83  ? ARG E 81  . ? 1_555 ? 
130 AE2 15 TYR E  108 ? TYR E 106 . ? 1_555 ? 
131 AE2 15 PHE E  125 ? PHE E 123 . ? 1_555 ? 
132 AE2 15 LYS E  127 ? LYS E 125 . ? 1_555 ? 
133 AE2 15 TYR E  134 ? TYR E 132 . ? 1_555 ? 
134 AE2 15 PHE E  135 ? PHE E 133 . ? 1_555 ? 
135 AE2 15 LYS E  136 ? LYS E 134 . ? 1_555 ? 
136 AE2 15 ZCM Y  .   ? ZCM E 201 . ? 1_555 ? 
137 AE2 15 SO4 AA .   ? SO4 E 203 . ? 1_555 ? 
138 AE2 15 HOH KA .   ? HOH E 322 . ? 1_555 ? 
139 AE3 9  TYR E  54  ? TYR E 52  . ? 1_555 ? 
140 AE3 9  THR E  56  ? THR E 54  . ? 1_555 ? 
141 AE3 9  SER E  70  ? SER E 68  . ? 1_555 ? 
142 AE3 9  ARG E  83  ? ARG E 81  . ? 1_555 ? 
143 AE3 9  PHE E  125 ? PHE E 123 . ? 1_555 ? 
144 AE3 9  LYS E  136 ? LYS E 134 . ? 1_555 ? 
145 AE3 9  THR E  138 ? THR E 136 . ? 1_555 ? 
146 AE3 9  TYR E  140 ? TYR E 138 . ? 1_555 ? 
147 AE3 9  4OL Z  .   ? 4OL E 202 . ? 1_555 ? 
148 AE4 4  LYS E  77  ? LYS E 75  . ? 1_555 ? 
149 AE4 4  PRO F  164 ? PRO F 162 . ? 2_544 ? 
150 AE4 4  ASN F  166 ? ASN F 164 . ? 2_544 ? 
151 AE4 4  HIS F  167 ? HIS F 165 . ? 2_544 ? 
152 AE5 4  ASN A  116 ? ASN A 114 . ? 4_545 ? 
153 AE5 4  HIS A  120 ? HIS A 118 . ? 4_545 ? 
154 AE5 4  ASN E  118 ? ASN E 116 . ? 1_555 ? 
155 AE5 4  HOH KA .   ? HOH E 301 . ? 1_555 ? 
156 AE6 1  4OL EA .   ? 4OL F 202 . ? 1_555 ? 
157 AE7 13 ILE F  43  ? ILE F 41  . ? 1_555 ? 
158 AE7 13 SER F  70  ? SER F 68  . ? 1_555 ? 
159 AE7 13 LEU F  72  ? LEU F 70  . ? 1_555 ? 
160 AE7 13 TRP F  81  ? TRP F 79  . ? 1_555 ? 
161 AE7 13 TYR F  102 ? TYR F 100 . ? 1_555 ? 
162 AE7 13 TYR F  108 ? TYR F 106 . ? 1_555 ? 
163 AE7 13 LYS F  127 ? LYS F 125 . ? 1_555 ? 
164 AE7 13 LYS F  136 ? LYS F 134 . ? 1_555 ? 
165 AE7 13 ZCM DA .   ? ZCM F 201 . ? 1_555 ? 
166 AE7 13 SO4 FA .   ? SO4 F 203 . ? 1_555 ? 
167 AE7 13 HOH LA .   ? HOH F 301 . ? 1_555 ? 
168 AE7 13 HOH LA .   ? HOH F 310 . ? 1_555 ? 
169 AE7 13 HOH LA .   ? HOH F 317 . ? 1_555 ? 
170 AE8 10 TYR F  54  ? TYR F 52  . ? 1_555 ? 
171 AE8 10 THR F  56  ? THR F 54  . ? 1_555 ? 
172 AE8 10 SER F  70  ? SER F 68  . ? 1_555 ? 
173 AE8 10 ARG F  83  ? ARG F 81  . ? 1_555 ? 
174 AE8 10 PHE F  125 ? PHE F 123 . ? 1_555 ? 
175 AE8 10 LYS F  136 ? LYS F 134 . ? 1_555 ? 
176 AE8 10 THR F  138 ? THR F 136 . ? 1_555 ? 
177 AE8 10 TYR F  140 ? TYR F 138 . ? 1_555 ? 
178 AE8 10 4OL EA .   ? 4OL F 202 . ? 1_555 ? 
179 AE8 10 HOH LA .   ? HOH F 301 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4ZHF 
_atom_sites.fract_transf_matrix[1][1]   0.009287 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008491 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008251 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CM 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A  1 4   ? 1.548   6.163   34.332  1.00 82.13  ? 2   ASP A N   1 
ATOM   2    C  CA  . ASP A  1 4   ? 1.507   7.592   33.890  1.00 84.13  ? 2   ASP A CA  1 
ATOM   3    C  C   . ASP A  1 4   ? 0.626   7.762   32.648  1.00 84.95  ? 2   ASP A C   1 
ATOM   4    O  O   . ASP A  1 4   ? 1.057   7.474   31.531  1.00 85.37  ? 2   ASP A O   1 
ATOM   5    C  CB  . ASP A  1 4   ? 2.925   8.115   33.610  1.00 86.13  ? 2   ASP A CB  1 
ATOM   6    C  CG  . ASP A  1 4   ? 3.414   9.092   34.674  1.00 86.87  ? 2   ASP A CG  1 
ATOM   7    O  OD1 . ASP A  1 4   ? 2.918   9.019   35.818  1.00 83.70  ? 2   ASP A OD1 1 
ATOM   8    O  OD2 . ASP A  1 4   ? 4.298   9.925   34.371  1.00 84.59  ? 2   ASP A OD2 1 
ATOM   9    N  N   . SER A  1 5   ? -0.600  8.246   32.854  1.00 83.04  ? 3   SER A N   1 
ATOM   10   C  CA  . SER A  1 5   ? -1.588  8.364   31.773  1.00 81.64  ? 3   SER A CA  1 
ATOM   11   C  C   . SER A  1 5   ? -2.701  9.377   32.089  1.00 83.30  ? 3   SER A C   1 
ATOM   12   O  O   . SER A  1 5   ? -2.736  9.993   33.164  1.00 80.27  ? 3   SER A O   1 
ATOM   13   C  CB  . SER A  1 5   ? -2.211  6.991   31.454  1.00 75.39  ? 3   SER A CB  1 
ATOM   14   O  OG  . SER A  1 5   ? -2.877  6.447   32.577  1.00 70.74  ? 3   SER A OG  1 
ATOM   15   N  N   . THR A  1 6   ? -3.594  9.555   31.118  1.00 83.54  ? 4   THR A N   1 
ATOM   16   C  CA  . THR A  1 6   ? -4.971  9.986   31.378  1.00 78.40  ? 4   THR A CA  1 
ATOM   17   C  C   . THR A  1 6   ? -5.920  8.988   30.699  1.00 74.37  ? 4   THR A C   1 
ATOM   18   O  O   . THR A  1 6   ? -5.512  8.271   29.786  1.00 80.64  ? 4   THR A O   1 
ATOM   19   C  CB  . THR A  1 6   ? -5.225  11.421  30.847  1.00 77.84  ? 4   THR A CB  1 
ATOM   20   O  OG1 . THR A  1 6   ? -4.230  12.315  31.371  1.00 75.55  ? 4   THR A OG1 1 
ATOM   21   C  CG2 . THR A  1 6   ? -6.617  11.927  31.248  1.00 73.24  ? 4   THR A CG2 1 
ATOM   22   N  N   . SER A  1 7   ? -7.162  8.905   31.169  1.00 66.49  ? 5   SER A N   1 
ATOM   23   C  CA  . SER A  1 7   ? -8.186  8.147   30.459  1.00 59.03  ? 5   SER A CA  1 
ATOM   24   C  C   . SER A  1 7   ? -9.585  8.423   31.021  1.00 52.93  ? 5   SER A C   1 
ATOM   25   O  O   . SER A  1 7   ? -9.733  8.905   32.149  1.00 51.58  ? 5   SER A O   1 
ATOM   26   C  CB  . SER A  1 7   ? -7.866  6.653   30.531  1.00 58.91  ? 5   SER A CB  1 
ATOM   27   O  OG  . SER A  1 7   ? -7.894  6.197   31.870  1.00 59.90  ? 5   SER A OG  1 
ATOM   28   N  N   . ASP A  1 8   ? -10.602 8.132   30.211  1.00 45.90  ? 6   ASP A N   1 
ATOM   29   C  CA  . ASP A  1 8   ? -11.991 8.421   30.549  1.00 41.80  ? 6   ASP A CA  1 
ATOM   30   C  C   . ASP A  1 8   ? -12.827 7.200   30.260  1.00 36.84  ? 6   ASP A C   1 
ATOM   31   O  O   . ASP A  1 8   ? -12.735 6.628   29.186  1.00 36.02  ? 6   ASP A O   1 
ATOM   32   C  CB  . ASP A  1 8   ? -12.519 9.587   29.720  1.00 43.69  ? 6   ASP A CB  1 
ATOM   33   C  CG  . ASP A  1 8   ? -12.120 10.931  30.285  1.00 47.60  ? 6   ASP A CG  1 
ATOM   34   O  OD1 . ASP A  1 8   ? -12.857 11.921  30.075  1.00 49.49  ? 6   ASP A OD1 1 
ATOM   35   O  OD2 . ASP A  1 8   ? -11.055 11.000  30.929  1.00 49.33  ? 6   ASP A OD2 1 
ATOM   36   N  N   . LEU A  1 9   ? -13.658 6.811   31.214  1.00 33.69  ? 7   LEU A N   1 
ATOM   37   C  CA  . LEU A  1 9   ? -14.378 5.562   31.119  1.00 30.65  ? 7   LEU A CA  1 
ATOM   38   C  C   . LEU A  1 9   ? -15.855 5.762   31.412  1.00 28.98  ? 7   LEU A C   1 
ATOM   39   O  O   . LEU A  1 9   ? -16.223 6.498   32.317  1.00 30.11  ? 7   LEU A O   1 
ATOM   40   C  CB  . LEU A  1 9   ? -13.783 4.543   32.096  1.00 29.70  ? 7   LEU A CB  1 
ATOM   41   C  CG  . LEU A  1 9   ? -12.370 4.036   31.788  1.00 30.91  ? 7   LEU A CG  1 
ATOM   42   C  CD1 . LEU A  1 9   ? -11.884 3.113   32.893  1.00 30.30  ? 7   LEU A CD1 1 
ATOM   43   C  CD2 . LEU A  1 9   ? -12.331 3.321   30.454  1.00 31.12  ? 7   LEU A CD2 1 
ATOM   44   N  N   . ILE A  1 10  ? -16.704 5.066   30.668  1.00 27.15  ? 8   ILE A N   1 
ATOM   45   C  CA  . ILE A  1 10  ? -18.099 4.936   31.053  1.00 25.08  ? 8   ILE A CA  1 
ATOM   46   C  C   . ILE A  1 10  ? -18.181 4.202   32.387  1.00 23.57  ? 8   ILE A C   1 
ATOM   47   O  O   . ILE A  1 10  ? -17.526 3.185   32.579  1.00 23.09  ? 8   ILE A O   1 
ATOM   48   C  CB  . ILE A  1 10  ? -18.912 4.187   29.984  1.00 24.01  ? 8   ILE A CB  1 
ATOM   49   C  CG1 . ILE A  1 10  ? -19.024 5.045   28.720  1.00 25.50  ? 8   ILE A CG1 1 
ATOM   50   C  CG2 . ILE A  1 10  ? -20.302 3.840   30.501  1.00 22.20  ? 8   ILE A CG2 1 
ATOM   51   C  CD1 . ILE A  1 10  ? -19.276 4.235   27.466  1.00 25.80  ? 8   ILE A CD1 1 
ATOM   52   N  N   . PRO A  1 11  ? -18.955 4.744   33.331  1.00 23.28  ? 9   PRO A N   1 
ATOM   53   C  CA  . PRO A  1 11  ? -19.033 4.180   34.669  1.00 22.60  ? 9   PRO A CA  1 
ATOM   54   C  C   . PRO A  1 11  ? -19.593 2.761   34.657  1.00 21.33  ? 9   PRO A C   1 
ATOM   55   O  O   . PRO A  1 11  ? -20.475 2.450   33.863  1.00 21.34  ? 9   PRO A O   1 
ATOM   56   C  CB  . PRO A  1 11  ? -20.000 5.126   35.400  1.00 22.50  ? 9   PRO A CB  1 
ATOM   57   C  CG  . PRO A  1 11  ? -19.967 6.398   34.625  1.00 23.63  ? 9   PRO A CG  1 
ATOM   58   C  CD  . PRO A  1 11  ? -19.742 5.983   33.202  1.00 23.99  ? 9   PRO A CD  1 
ATOM   59   N  N   . ALA A  1 12  ? -19.095 1.911   35.537  1.00 20.85  ? 10  ALA A N   1 
ATOM   60   C  CA  . ALA A  1 12  ? -19.680 0.591   35.712  1.00 20.73  ? 10  ALA A CA  1 
ATOM   61   C  C   . ALA A  1 12  ? -21.121 0.730   36.182  1.00 20.84  ? 10  ALA A C   1 
ATOM   62   O  O   . ALA A  1 12  ? -21.417 1.589   36.994  1.00 22.94  ? 10  ALA A O   1 
ATOM   63   C  CB  . ALA A  1 12  ? -18.871 -0.213  36.713  1.00 20.47  ? 10  ALA A CB  1 
ATOM   64   N  N   . PRO A  1 13  ? -22.026 -0.111  35.659  1.00 20.64  ? 11  PRO A N   1 
ATOM   65   C  CA  . PRO A  1 13  ? -23.388 -0.096  36.174  1.00 20.69  ? 11  PRO A CA  1 
ATOM   66   C  C   . PRO A  1 13  ? -23.437 -0.602  37.618  1.00 22.77  ? 11  PRO A C   1 
ATOM   67   O  O   . PRO A  1 13  ? -22.576 -1.386  38.024  1.00 23.06  ? 11  PRO A O   1 
ATOM   68   C  CB  . PRO A  1 13  ? -24.108 -1.076  35.253  1.00 20.00  ? 11  PRO A CB  1 
ATOM   69   C  CG  . PRO A  1 13  ? -23.058 -2.090  34.913  1.00 19.98  ? 11  PRO A CG  1 
ATOM   70   C  CD  . PRO A  1 13  ? -21.753 -1.320  34.860  1.00 20.02  ? 11  PRO A CD  1 
ATOM   71   N  N   . PRO A  1 14  ? -24.454 -0.182  38.384  1.00 23.94  ? 12  PRO A N   1 
ATOM   72   C  CA  . PRO A  1 14  ? -24.720 -0.867  39.643  1.00 22.61  ? 12  PRO A CA  1 
ATOM   73   C  C   . PRO A  1 14  ? -25.060 -2.341  39.414  1.00 22.88  ? 12  PRO A C   1 
ATOM   74   O  O   . PRO A  1 14  ? -25.735 -2.685  38.446  1.00 21.78  ? 12  PRO A O   1 
ATOM   75   C  CB  . PRO A  1 14  ? -25.930 -0.111  40.217  1.00 22.77  ? 12  PRO A CB  1 
ATOM   76   C  CG  . PRO A  1 14  ? -26.599 0.509   39.030  1.00 23.56  ? 12  PRO A CG  1 
ATOM   77   C  CD  . PRO A  1 14  ? -25.514 0.784   38.025  1.00 23.64  ? 12  PRO A CD  1 
ATOM   78   N  N   . LEU A  1 15  ? -24.641 -3.193  40.341  1.00 23.45  ? 13  LEU A N   1 
ATOM   79   C  CA  . LEU A  1 15  ? -24.843 -4.626  40.209  1.00 23.34  ? 13  LEU A CA  1 
ATOM   80   C  C   . LEU A  1 15  ? -26.309 -5.041  40.187  1.00 23.53  ? 13  LEU A C   1 
ATOM   81   O  O   . LEU A  1 15  ? -26.655 -6.102  39.667  1.00 24.29  ? 13  LEU A O   1 
ATOM   82   C  CB  . LEU A  1 15  ? -24.118 -5.345  41.325  1.00 23.39  ? 13  LEU A CB  1 
ATOM   83   C  CG  . LEU A  1 15  ? -22.598 -5.220  41.201  1.00 25.37  ? 13  LEU A CG  1 
ATOM   84   C  CD1 . LEU A  1 15  ? -21.913 -6.001  42.312  1.00 28.23  ? 13  LEU A CD1 1 
ATOM   85   C  CD2 . LEU A  1 15  ? -22.132 -5.704  39.832  1.00 25.91  ? 13  LEU A CD2 1 
ATOM   86   N  N   . SER A  1 16  ? -27.173 -4.180  40.702  1.00 23.01  ? 14  SER A N   1 
ATOM   87   C  CA  . SER A  1 16  ? -28.600 -4.445  40.694  1.00 22.56  ? 14  SER A CA  1 
ATOM   88   C  C   . SER A  1 16  ? -29.138 -4.496  39.271  1.00 24.21  ? 14  SER A C   1 
ATOM   89   O  O   . SER A  1 16  ? -30.228 -5.018  39.034  1.00 27.97  ? 14  SER A O   1 
ATOM   90   C  CB  . SER A  1 16  ? -29.341 -3.373  41.509  1.00 22.79  ? 14  SER A CB  1 
ATOM   91   O  OG  . SER A  1 16  ? -29.354 -2.123  40.827  1.00 22.84  ? 14  SER A OG  1 
ATOM   92   N  N   . LYS A  1 17  ? -28.396 -3.953  38.311  1.00 23.11  ? 15  LYS A N   1 
ATOM   93   C  CA  . LYS A  1 17  ? -28.864 -3.971  36.927  1.00 24.25  ? 15  LYS A CA  1 
ATOM   94   C  C   . LYS A  1 17  ? -28.333 -5.170  36.141  1.00 23.04  ? 15  LYS A C   1 
ATOM   95   O  O   . LYS A  1 17  ? -28.577 -5.291  34.936  1.00 23.39  ? 15  LYS A O   1 
ATOM   96   C  CB  . LYS A  1 17  ? -28.474 -2.678  36.211  1.00 28.75  ? 15  LYS A CB  1 
ATOM   97   C  CG  . LYS A  1 17  ? -29.343 -1.487  36.560  1.00 30.78  ? 15  LYS A CG  1 
ATOM   98   C  CD  . LYS A  1 17  ? -29.232 -0.413  35.498  1.00 36.89  ? 15  LYS A CD  1 
ATOM   99   C  CE  . LYS A  1 17  ? -29.182 0.976   36.112  1.00 39.90  ? 15  LYS A CE  1 
ATOM   100  N  NZ  . LYS A  1 17  ? -29.729 2.000   35.182  1.00 41.26  ? 15  LYS A NZ  1 
ATOM   101  N  N   . VAL A  1 18  ? -27.602 -6.048  36.821  1.00 21.18  ? 16  VAL A N   1 
ATOM   102  C  CA  . VAL A  1 18  ? -27.010 -7.219  36.179  1.00 18.89  ? 16  VAL A CA  1 
ATOM   103  C  C   . VAL A  1 18  ? -27.624 -8.509  36.734  1.00 17.76  ? 16  VAL A C   1 
ATOM   104  O  O   . VAL A  1 18  ? -27.247 -8.960  37.805  1.00 16.41  ? 16  VAL A O   1 
ATOM   105  C  CB  . VAL A  1 18  ? -25.488 -7.254  36.402  1.00 17.82  ? 16  VAL A CB  1 
ATOM   106  C  CG1 . VAL A  1 18  ? -24.882 -8.403  35.630  1.00 17.64  ? 16  VAL A CG1 1 
ATOM   107  C  CG2 . VAL A  1 18  ? -24.850 -5.940  35.988  1.00 18.89  ? 16  VAL A CG2 1 
ATOM   108  N  N   . PRO A  1 19  ? -28.573 -9.105  35.999  1.00 18.97  ? 17  PRO A N   1 
ATOM   109  C  CA  . PRO A  1 19  ? -29.223 -10.319 36.465  1.00 20.14  ? 17  PRO A CA  1 
ATOM   110  C  C   . PRO A  1 19  ? -28.250 -11.455 36.681  1.00 20.31  ? 17  PRO A C   1 
ATOM   111  O  O   . PRO A  1 19  ? -27.159 -11.482 36.110  1.00 18.17  ? 17  PRO A O   1 
ATOM   112  C  CB  . PRO A  1 19  ? -30.192 -10.686 35.326  1.00 20.75  ? 17  PRO A CB  1 
ATOM   113  C  CG  . PRO A  1 19  ? -30.445 -9.412  34.607  1.00 21.53  ? 17  PRO A CG  1 
ATOM   114  C  CD  . PRO A  1 19  ? -29.174 -8.605  34.747  1.00 21.57  ? 17  PRO A CD  1 
ATOM   115  N  N   . LEU A  1 20  ? -28.670 -12.373 37.536  1.00 21.23  ? 18  LEU A N   1 
ATOM   116  C  CA  . LEU A  1 20  ? -27.964 -13.597 37.776  1.00 19.66  ? 18  LEU A CA  1 
ATOM   117  C  C   . LEU A  1 20  ? -28.805 -14.770 37.257  1.00 18.76  ? 18  LEU A C   1 
ATOM   118  O  O   . LEU A  1 20  ? -29.970 -14.898 37.591  1.00 17.09  ? 18  LEU A O   1 
ATOM   119  C  CB  . LEU A  1 20  ? -27.741 -13.721 39.268  1.00 20.57  ? 18  LEU A CB  1 
ATOM   120  C  CG  . LEU A  1 20  ? -27.086 -15.023 39.684  1.00 25.88  ? 18  LEU A CG  1 
ATOM   121  C  CD1 . LEU A  1 20  ? -25.601 -14.978 39.327  1.00 25.79  ? 18  LEU A CD1 1 
ATOM   122  C  CD2 . LEU A  1 20  ? -27.303 -15.272 41.170  1.00 27.10  ? 18  LEU A CD2 1 
ATOM   123  N  N   . GLN A  1 21  ? -28.224 -15.601 36.401  1.00 19.42  ? 19  GLN A N   1 
ATOM   124  C  CA  . GLN A  1 21  ? -28.898 -16.821 35.948  1.00 19.87  ? 19  GLN A CA  1 
ATOM   125  C  C   . GLN A  1 21  ? -29.472 -17.579 37.144  1.00 20.47  ? 19  GLN A C   1 
ATOM   126  O  O   . GLN A  1 21  ? -28.739 -17.914 38.073  1.00 22.12  ? 19  GLN A O   1 
ATOM   127  C  CB  . GLN A  1 21  ? -27.904 -17.707 35.193  1.00 18.99  ? 19  GLN A CB  1 
ATOM   128  C  CG  . GLN A  1 21  ? -28.436 -19.086 34.830  1.00 19.69  ? 19  GLN A CG  1 
ATOM   129  C  CD  . GLN A  1 21  ? -29.643 -19.031 33.903  1.00 21.02  ? 19  GLN A CD  1 
ATOM   130  O  OE1 . GLN A  1 21  ? -29.626 -18.374 32.865  1.00 19.12  ? 19  GLN A OE1 1 
ATOM   131  N  NE2 . GLN A  1 21  ? -30.690 -19.737 34.270  1.00 21.59  ? 19  GLN A NE2 1 
ATOM   132  N  N   . GLN A  1 22  ? -30.782 -17.810 37.148  1.00 22.35  ? 20  GLN A N   1 
ATOM   133  C  CA  . GLN A  1 22  ? -31.421 -18.562 38.244  1.00 23.63  ? 20  GLN A CA  1 
ATOM   134  C  C   . GLN A  1 22  ? -30.940 -20.021 38.258  1.00 21.58  ? 20  GLN A C   1 
ATOM   135  O  O   . GLN A  1 22  ? -30.725 -20.624 37.215  1.00 19.87  ? 20  GLN A O   1 
ATOM   136  C  CB  . GLN A  1 22  ? -32.965 -18.466 38.194  1.00 26.80  ? 20  GLN A CB  1 
ATOM   137  C  CG  . GLN A  1 22  ? -33.648 -19.284 37.087  1.00 33.81  ? 20  GLN A CG  1 
ATOM   138  C  CD  . GLN A  1 22  ? -34.249 -20.615 37.558  1.00 39.42  ? 20  GLN A CD  1 
ATOM   139  O  OE1 . GLN A  1 22  ? -34.632 -20.783 38.727  1.00 40.72  ? 20  GLN A OE1 1 
ATOM   140  N  NE2 . GLN A  1 22  ? -34.329 -21.573 36.639  1.00 37.60  ? 20  GLN A NE2 1 
ATOM   141  N  N   . ASN A  1 23  ? -30.694 -20.542 39.456  1.00 21.97  ? 21  ASN A N   1 
ATOM   142  C  CA  . ASN A  1 23  ? -30.336 -21.936 39.664  1.00 23.28  ? 21  ASN A CA  1 
ATOM   143  C  C   . ASN A  1 23  ? -29.153 -22.390 38.810  1.00 22.83  ? 21  ASN A C   1 
ATOM   144  O  O   . ASN A  1 23  ? -29.228 -23.399 38.106  1.00 22.46  ? 21  ASN A O   1 
ATOM   145  C  CB  . ASN A  1 23  ? -31.546 -22.838 39.409  1.00 28.16  ? 21  ASN A CB  1 
ATOM   146  C  CG  . ASN A  1 23  ? -31.351 -24.252 39.947  1.00 34.58  ? 21  ASN A CG  1 
ATOM   147  O  OD1 . ASN A  1 23  ? -30.678 -24.461 40.958  1.00 44.93  ? 21  ASN A OD1 1 
ATOM   148  N  ND2 . ASN A  1 23  ? -31.950 -25.230 39.275  1.00 38.95  ? 21  ASN A ND2 1 
ATOM   149  N  N   . PHE A  1 24  ? -28.056 -21.653 38.886  1.00 19.90  ? 22  PHE A N   1 
ATOM   150  C  CA  . PHE A  1 24  ? -26.920 -21.924 38.038  1.00 18.87  ? 22  PHE A CA  1 
ATOM   151  C  C   . PHE A  1 24  ? -26.406 -23.352 38.227  1.00 19.33  ? 22  PHE A C   1 
ATOM   152  O  O   . PHE A  1 24  ? -26.213 -23.805 39.360  1.00 20.65  ? 22  PHE A O   1 
ATOM   153  C  CB  . PHE A  1 24  ? -25.799 -20.931 38.329  1.00 18.98  ? 22  PHE A CB  1 
ATOM   154  C  CG  . PHE A  1 24  ? -24.560 -21.173 37.527  1.00 18.73  ? 22  PHE A CG  1 
ATOM   155  C  CD1 . PHE A  1 24  ? -23.433 -21.706 38.117  1.00 20.09  ? 22  PHE A CD1 1 
ATOM   156  C  CD2 . PHE A  1 24  ? -24.509 -20.828 36.197  1.00 18.31  ? 22  PHE A CD2 1 
ATOM   157  C  CE1 . PHE A  1 24  ? -22.277 -21.892 37.388  1.00 19.63  ? 22  PHE A CE1 1 
ATOM   158  C  CE2 . PHE A  1 24  ? -23.355 -21.018 35.457  1.00 18.76  ? 22  PHE A CE2 1 
ATOM   159  C  CZ  . PHE A  1 24  ? -22.240 -21.549 36.059  1.00 19.18  ? 22  PHE A CZ  1 
ATOM   160  N  N   . GLN A  1 25  ? -26.127 -24.027 37.114  1.00 18.15  ? 23  GLN A N   1 
ATOM   161  C  CA  . GLN A  1 25  ? -25.614 -25.388 37.138  1.00 20.02  ? 23  GLN A CA  1 
ATOM   162  C  C   . GLN A  1 25  ? -24.142 -25.411 36.697  1.00 19.53  ? 23  GLN A C   1 
ATOM   163  O  O   . GLN A  1 25  ? -23.841 -25.427 35.500  1.00 18.61  ? 23  GLN A O   1 
ATOM   164  C  CB  . GLN A  1 25  ? -26.440 -26.277 36.202  1.00 21.80  ? 23  GLN A CB  1 
ATOM   165  C  CG  . GLN A  1 25  ? -27.915 -26.396 36.556  1.00 23.39  ? 23  GLN A CG  1 
ATOM   166  C  CD  . GLN A  1 25  ? -28.143 -27.041 37.912  1.00 26.19  ? 23  GLN A CD  1 
ATOM   167  O  OE1 . GLN A  1 25  ? -27.872 -28.221 38.098  1.00 31.49  ? 23  GLN A OE1 1 
ATOM   168  N  NE2 . GLN A  1 25  ? -28.668 -26.276 38.859  1.00 29.07  ? 23  GLN A NE2 1 
ATOM   169  N  N   . ASP A  1 26  ? -23.232 -25.460 37.667  1.00 19.42  ? 24  ASP A N   1 
ATOM   170  C  CA  . ASP A  1 26  ? -21.812 -25.298 37.388  1.00 18.88  ? 24  ASP A CA  1 
ATOM   171  C  C   . ASP A  1 26  ? -21.248 -26.401 36.499  1.00 19.35  ? 24  ASP A C   1 
ATOM   172  O  O   . ASP A  1 26  ? -20.394 -26.146 35.641  1.00 19.43  ? 24  ASP A O   1 
ATOM   173  C  CB  . ASP A  1 26  ? -20.993 -25.159 38.689  1.00 19.23  ? 24  ASP A CB  1 
ATOM   174  C  CG  . ASP A  1 26  ? -21.157 -26.344 39.643  1.00 18.46  ? 24  ASP A CG  1 
ATOM   175  O  OD1 . ASP A  1 26  ? -21.834 -27.320 39.293  1.00 19.23  ? 24  ASP A OD1 1 
ATOM   176  O  OD2 . ASP A  1 26  ? -20.560 -26.308 40.735  1.00 18.29  ? 24  ASP A OD2 1 
ATOM   177  N  N   . ASN A  1 27  ? -21.748 -27.615 36.657  1.00 20.47  ? 25  ASN A N   1 
ATOM   178  C  CA  . ASN A  1 27  ? -21.251 -28.720 35.852  1.00 22.58  ? 25  ASN A CA  1 
ATOM   179  C  C   . ASN A  1 27  ? -21.652 -28.560 34.396  1.00 19.68  ? 25  ASN A C   1 
ATOM   180  O  O   . ASN A  1 27  ? -20.863 -28.824 33.501  1.00 17.79  ? 25  ASN A O   1 
ATOM   181  C  CB  . ASN A  1 27  ? -21.707 -30.061 36.427  1.00 25.57  ? 25  ASN A CB  1 
ATOM   182  C  CG  . ASN A  1 27  ? -23.208 -30.137 36.593  1.00 31.82  ? 25  ASN A CG  1 
ATOM   183  O  OD1 . ASN A  1 27  ? -23.836 -29.214 37.130  1.00 32.75  ? 25  ASN A OD1 1 
ATOM   184  N  ND2 . ASN A  1 27  ? -23.799 -31.242 36.145  1.00 37.15  ? 25  ASN A ND2 1 
ATOM   185  N  N   . GLN A  1 28  ? -22.880 -28.118 34.156  1.00 20.86  ? 26  GLN A N   1 
ATOM   186  C  CA  . GLN A  1 28  ? -23.410 -28.016 32.786  1.00 20.33  ? 26  GLN A CA  1 
ATOM   187  C  C   . GLN A  1 28  ? -22.750 -26.864 32.035  1.00 20.00  ? 26  GLN A C   1 
ATOM   188  O  O   . GLN A  1 28  ? -22.817 -26.794 30.800  1.00 18.74  ? 26  GLN A O   1 
ATOM   189  C  CB  . GLN A  1 28  ? -24.926 -27.789 32.810  1.00 22.35  ? 26  GLN A CB  1 
ATOM   190  C  CG  . GLN A  1 28  ? -25.762 -29.001 33.164  1.00 27.88  ? 26  GLN A CG  1 
ATOM   191  C  CD  . GLN A  1 28  ? -27.240 -28.783 32.865  1.00 35.07  ? 26  GLN A CD  1 
ATOM   192  O  OE1 . GLN A  1 28  ? -27.636 -28.512 31.714  1.00 39.05  ? 26  GLN A OE1 1 
ATOM   193  N  NE2 . GLN A  1 28  ? -28.062 -28.882 33.898  1.00 36.25  ? 26  GLN A NE2 1 
ATOM   194  N  N   . PHE A  1 29  ? -22.160 -25.930 32.775  1.00 17.41  ? 27  PHE A N   1 
ATOM   195  C  CA  . PHE A  1 29  ? -21.580 -24.751 32.149  1.00 17.29  ? 27  PHE A CA  1 
ATOM   196  C  C   . PHE A  1 29  ? -20.167 -25.011 31.622  1.00 17.05  ? 27  PHE A C   1 
ATOM   197  O  O   . PHE A  1 29  ? -19.627 -24.201 30.882  1.00 16.56  ? 27  PHE A O   1 
ATOM   198  C  CB  . PHE A  1 29  ? -21.568 -23.588 33.131  1.00 16.85  ? 27  PHE A CB  1 
ATOM   199  C  CG  . PHE A  1 29  ? -21.296 -22.261 32.484  1.00 16.38  ? 27  PHE A CG  1 
ATOM   200  C  CD1 . PHE A  1 29  ? -20.087 -21.630 32.664  1.00 16.83  ? 27  PHE A CD1 1 
ATOM   201  C  CD2 . PHE A  1 29  ? -22.262 -21.640 31.717  1.00 16.31  ? 27  PHE A CD2 1 
ATOM   202  C  CE1 . PHE A  1 29  ? -19.836 -20.404 32.090  1.00 16.18  ? 27  PHE A CE1 1 
ATOM   203  C  CE2 . PHE A  1 29  ? -22.022 -20.404 31.139  1.00 16.36  ? 27  PHE A CE2 1 
ATOM   204  C  CZ  . PHE A  1 29  ? -20.805 -19.781 31.333  1.00 16.16  ? 27  PHE A CZ  1 
ATOM   205  N  N   . GLN A  1 30  ? -19.603 -26.158 31.993  1.00 17.97  ? 28  GLN A N   1 
ATOM   206  C  CA  . GLN A  1 30  ? -18.257 -26.575 31.585  1.00 18.68  ? 28  GLN A CA  1 
ATOM   207  C  C   . GLN A  1 30  ? -18.092 -26.725 30.079  1.00 17.85  ? 28  GLN A C   1 
ATOM   208  O  O   . GLN A  1 30  ? -19.056 -26.884 29.352  1.00 16.49  ? 28  GLN A O   1 
ATOM   209  C  CB  . GLN A  1 30  ? -17.945 -27.949 32.167  1.00 20.04  ? 28  GLN A CB  1 
ATOM   210  C  CG  . GLN A  1 30  ? -17.689 -27.980 33.656  1.00 21.60  ? 28  GLN A CG  1 
ATOM   211  C  CD  . GLN A  1 30  ? -17.218 -29.337 34.108  1.00 21.23  ? 28  GLN A CD  1 
ATOM   212  O  OE1 . GLN A  1 30  ? -16.029 -29.568 34.224  1.00 24.63  ? 28  GLN A OE1 1 
ATOM   213  N  NE2 . GLN A  1 30  ? -18.142 -30.262 34.278  1.00 20.97  ? 28  GLN A NE2 1 
ATOM   214  N  N   . GLY A  1 31  ? -16.840 -26.735 29.639  1.00 18.13  ? 29  GLY A N   1 
ATOM   215  C  CA  . GLY A  1 31  ? -16.515 -26.971 28.249  1.00 17.06  ? 29  GLY A CA  1 
ATOM   216  C  C   . GLY A  1 31  ? -16.153 -25.693 27.510  1.00 18.04  ? 29  GLY A C   1 
ATOM   217  O  O   . GLY A  1 31  ? -15.870 -24.654 28.122  1.00 17.86  ? 29  GLY A O   1 
ATOM   218  N  N   . LYS A  1 32  ? -16.174 -25.772 26.182  1.00 18.33  ? 30  LYS A N   1 
ATOM   219  C  CA  . LYS A  1 32  ? -15.703 -24.678 25.351  1.00 19.38  ? 30  LYS A CA  1 
ATOM   220  C  C   . LYS A  1 32  ? -16.836 -23.717 25.005  1.00 17.59  ? 30  LYS A C   1 
ATOM   221  O  O   . LYS A  1 32  ? -17.935 -24.141 24.673  1.00 16.33  ? 30  LYS A O   1 
ATOM   222  C  CB  . LYS A  1 32  ? -15.096 -25.225 24.061  1.00 21.57  ? 30  LYS A CB  1 
ATOM   223  C  CG  . LYS A  1 32  ? -14.580 -24.136 23.141  1.00 25.52  ? 30  LYS A CG  1 
ATOM   224  C  CD  . LYS A  1 32  ? -13.981 -24.712 21.876  1.00 29.01  ? 30  LYS A CD  1 
ATOM   225  C  CE  . LYS A  1 32  ? -12.538 -25.114 22.112  1.00 37.35  ? 30  LYS A CE  1 
ATOM   226  N  NZ  . LYS A  1 32  ? -11.940 -25.644 20.854  1.00 42.85  ? 30  LYS A NZ  1 
ATOM   227  N  N   . TRP A  1 33  ? -16.561 -22.424 25.113  1.00 17.01  ? 31  TRP A N   1 
ATOM   228  C  CA  . TRP A  1 33  ? -17.465 -21.387 24.620  1.00 16.54  ? 31  TRP A CA  1 
ATOM   229  C  C   . TRP A  1 33  ? -16.707 -20.461 23.671  1.00 17.10  ? 31  TRP A C   1 
ATOM   230  O  O   . TRP A  1 33  ? -15.560 -20.118 23.928  1.00 16.55  ? 31  TRP A O   1 
ATOM   231  C  CB  . TRP A  1 33  ? -17.998 -20.543 25.773  1.00 15.29  ? 31  TRP A CB  1 
ATOM   232  C  CG  . TRP A  1 33  ? -18.924 -21.231 26.725  1.00 15.51  ? 31  TRP A CG  1 
ATOM   233  C  CD1 . TRP A  1 33  ? -18.608 -21.736 27.958  1.00 14.92  ? 31  TRP A CD1 1 
ATOM   234  C  CD2 . TRP A  1 33  ? -20.339 -21.419 26.567  1.00 14.76  ? 31  TRP A CD2 1 
ATOM   235  N  NE1 . TRP A  1 33  ? -19.731 -22.250 28.562  1.00 14.40  ? 31  TRP A NE1 1 
ATOM   236  C  CE2 . TRP A  1 33  ? -20.807 -22.054 27.734  1.00 14.48  ? 31  TRP A CE2 1 
ATOM   237  C  CE3 . TRP A  1 33  ? -21.256 -21.092 25.562  1.00 15.19  ? 31  TRP A CE3 1 
ATOM   238  C  CZ2 . TRP A  1 33  ? -22.140 -22.382 27.913  1.00 13.89  ? 31  TRP A CZ2 1 
ATOM   239  C  CZ3 . TRP A  1 33  ? -22.573 -21.424 25.735  1.00 15.18  ? 31  TRP A CZ3 1 
ATOM   240  C  CH2 . TRP A  1 33  ? -23.006 -22.069 26.902  1.00 14.67  ? 31  TRP A CH2 1 
ATOM   241  N  N   . TYR A  1 34  ? -17.359 -20.056 22.585  1.00 17.07  ? 32  TYR A N   1 
ATOM   242  C  CA  . TYR A  1 34  ? -16.790 -19.088 21.664  1.00 18.07  ? 32  TYR A CA  1 
ATOM   243  C  C   . TYR A  1 34  ? -17.275 -17.704 22.032  1.00 18.18  ? 32  TYR A C   1 
ATOM   244  O  O   . TYR A  1 34  ? -18.431 -17.520 22.363  1.00 17.13  ? 32  TYR A O   1 
ATOM   245  C  CB  . TYR A  1 34  ? -17.218 -19.395 20.230  1.00 19.43  ? 32  TYR A CB  1 
ATOM   246  C  CG  . TYR A  1 34  ? -16.633 -20.659 19.672  1.00 19.54  ? 32  TYR A CG  1 
ATOM   247  C  CD1 . TYR A  1 34  ? -15.347 -20.686 19.190  1.00 20.80  ? 32  TYR A CD1 1 
ATOM   248  C  CD2 . TYR A  1 34  ? -17.371 -21.834 19.631  1.00 20.29  ? 32  TYR A CD2 1 
ATOM   249  C  CE1 . TYR A  1 34  ? -14.803 -21.850 18.676  1.00 22.01  ? 32  TYR A CE1 1 
ATOM   250  C  CE2 . TYR A  1 34  ? -16.833 -23.002 19.125  1.00 20.35  ? 32  TYR A CE2 1 
ATOM   251  C  CZ  . TYR A  1 34  ? -15.553 -23.001 18.631  1.00 21.57  ? 32  TYR A CZ  1 
ATOM   252  O  OH  . TYR A  1 34  ? -15.010 -24.152 18.095  1.00 22.10  ? 32  TYR A OH  1 
ATOM   253  N  N   . VAL A  1 35  ? -16.384 -16.723 21.974  1.00 18.59  ? 33  VAL A N   1 
ATOM   254  C  CA  . VAL A  1 35  ? -16.788 -15.363 22.250  1.00 18.55  ? 33  VAL A CA  1 
ATOM   255  C  C   . VAL A  1 35  ? -17.350 -14.708 20.996  1.00 18.67  ? 33  VAL A C   1 
ATOM   256  O  O   . VAL A  1 35  ? -16.616 -14.256 20.127  1.00 19.73  ? 33  VAL A O   1 
ATOM   257  C  CB  . VAL A  1 35  ? -15.636 -14.532 22.828  1.00 19.36  ? 33  VAL A CB  1 
ATOM   258  C  CG1 . VAL A  1 35  ? -16.070 -13.091 23.003  1.00 19.95  ? 33  VAL A CG1 1 
ATOM   259  C  CG2 . VAL A  1 35  ? -15.184 -15.119 24.152  1.00 18.00  ? 33  VAL A CG2 1 
ATOM   260  N  N   . VAL A  1 36  ? -18.668 -14.705 20.907  1.00 18.01  ? 34  VAL A N   1 
ATOM   261  C  CA  . VAL A  1 36  ? -19.371 -14.318 19.702  1.00 18.54  ? 34  VAL A CA  1 
ATOM   262  C  C   . VAL A  1 36  ? -19.712 -12.831 19.767  1.00 18.61  ? 34  VAL A C   1 
ATOM   263  O  O   . VAL A  1 36  ? -19.903 -12.176 18.744  1.00 17.85  ? 34  VAL A O   1 
ATOM   264  C  CB  . VAL A  1 36  ? -20.667 -15.142 19.573  1.00 20.16  ? 34  VAL A CB  1 
ATOM   265  C  CG1 . VAL A  1 36  ? -21.608 -14.525 18.546  1.00 23.29  ? 34  VAL A CG1 1 
ATOM   266  C  CG2 . VAL A  1 36  ? -20.343 -16.581 19.206  1.00 21.17  ? 34  VAL A CG2 1 
ATOM   267  N  N   . GLY A  1 37  ? -19.808 -12.304 20.985  1.00 18.14  ? 35  GLY A N   1 
ATOM   268  C  CA  . GLY A  1 37  ? -20.033 -10.875 21.187  1.00 18.05  ? 35  GLY A CA  1 
ATOM   269  C  C   . GLY A  1 37  ? -19.248 -10.349 22.372  1.00 18.60  ? 35  GLY A C   1 
ATOM   270  O  O   . GLY A  1 37  ? -19.045 -11.060 23.349  1.00 17.18  ? 35  GLY A O   1 
ATOM   271  N  N   . LEU A  1 38  ? -18.835 -9.088  22.289  1.00 20.37  ? 36  LEU A N   1 
ATOM   272  C  CA  . LEU A  1 38  ? -18.058 -8.435  23.333  1.00 20.89  ? 36  LEU A CA  1 
ATOM   273  C  C   . LEU A  1 38  ? -18.533 -6.996  23.468  1.00 20.89  ? 36  LEU A C   1 
ATOM   274  O  O   . LEU A  1 38  ? -18.597 -6.256  22.481  1.00 22.56  ? 36  LEU A O   1 
ATOM   275  C  CB  . LEU A  1 38  ? -16.603 -8.375  22.917  1.00 24.47  ? 36  LEU A CB  1 
ATOM   276  C  CG  . LEU A  1 38  ? -15.571 -9.213  23.651  1.00 27.23  ? 36  LEU A CG  1 
ATOM   277  C  CD1 . LEU A  1 38  ? -14.194 -8.783  23.171  1.00 30.06  ? 36  LEU A CD1 1 
ATOM   278  C  CD2 . LEU A  1 38  ? -15.686 -9.035  25.150  1.00 28.26  ? 36  LEU A CD2 1 
ATOM   279  N  N   . ALA A  1 39  ? -18.840 -6.578  24.683  1.00 19.19  ? 37  ALA A N   1 
ATOM   280  C  CA  . ALA A  1 39  ? -19.206 -5.193  24.916  1.00 19.25  ? 37  ALA A CA  1 
ATOM   281  C  C   . ALA A  1 39  ? -18.579 -4.733  26.214  1.00 18.95  ? 37  ALA A C   1 
ATOM   282  O  O   . ALA A  1 39  ? -18.477 -5.517  27.155  1.00 18.15  ? 37  ALA A O   1 
ATOM   283  C  CB  . ALA A  1 39  ? -20.723 -5.049  24.968  1.00 18.52  ? 37  ALA A CB  1 
ATOM   284  N  N   . GLY A  1 40  ? -18.173 -3.466  26.281  1.00 18.90  ? 38  GLY A N   1 
ATOM   285  C  CA  . GLY A  1 40  ? -17.617 -2.939  27.518  1.00 18.54  ? 38  GLY A CA  1 
ATOM   286  C  C   . GLY A  1 40  ? -16.973 -1.576  27.399  1.00 19.55  ? 38  GLY A C   1 
ATOM   287  O  O   . GLY A  1 40  ? -16.854 -1.030  26.307  1.00 19.93  ? 38  GLY A O   1 
ATOM   288  N  N   . ASN A  1 41  ? -16.593 -1.004  28.537  1.00 19.62  ? 39  ASN A N   1 
ATOM   289  C  CA  . ASN A  1 41  ? -16.203 0.393   28.562  1.00 21.49  ? 39  ASN A CA  1 
ATOM   290  C  C   . ASN A  1 41  ? -14.786 0.628   28.058  1.00 23.94  ? 39  ASN A C   1 
ATOM   291  O  O   . ASN A  1 41  ? -14.372 1.770   27.850  1.00 25.26  ? 39  ASN A O   1 
ATOM   292  C  CB  . ASN A  1 41  ? -16.443 1.036   29.935  1.00 21.17  ? 39  ASN A CB  1 
ATOM   293  C  CG  . ASN A  1 41  ? -15.605 0.424   31.055  1.00 20.56  ? 39  ASN A CG  1 
ATOM   294  O  OD1 . ASN A  1 41  ? -14.973 -0.615  30.898  1.00 20.05  ? 39  ASN A OD1 1 
ATOM   295  N  ND2 . ASN A  1 41  ? -15.646 1.061   32.212  1.00 20.42  ? 39  ASN A ND2 1 
ATOM   296  N  N   . ALA A  1 42  ? -14.071 -0.462  27.800  1.00 24.74  ? 40  ALA A N   1 
ATOM   297  C  CA  . ALA A  1 42  ? -12.795 -0.394  27.093  1.00 28.39  ? 40  ALA A CA  1 
ATOM   298  C  C   . ALA A  1 42  ? -12.816 -1.102  25.742  1.00 30.29  ? 40  ALA A C   1 
ATOM   299  O  O   . ALA A  1 42  ? -11.791 -1.203  25.085  1.00 32.44  ? 40  ALA A O   1 
ATOM   300  C  CB  . ALA A  1 42  ? -11.687 -0.980  27.960  1.00 29.23  ? 40  ALA A CB  1 
ATOM   301  N  N   . ILE A  1 43  ? -13.973 -1.623  25.355  1.00 32.48  ? 41  ILE A N   1 
ATOM   302  C  CA  . ILE A  1 43  ? -14.159 -2.197  24.032  1.00 36.26  ? 41  ILE A CA  1 
ATOM   303  C  C   . ILE A  1 43  ? -14.486 -1.108  23.026  1.00 39.37  ? 41  ILE A C   1 
ATOM   304  O  O   . ILE A  1 43  ? -15.415 -0.329  23.225  1.00 40.17  ? 41  ILE A O   1 
ATOM   305  C  CB  . ILE A  1 43  ? -15.320 -3.207  24.020  1.00 36.15  ? 41  ILE A CB  1 
ATOM   306  C  CG1 . ILE A  1 43  ? -14.976 -4.419  24.878  1.00 36.64  ? 41  ILE A CG1 1 
ATOM   307  C  CG2 . ILE A  1 43  ? -15.621 -3.643  22.602  1.00 37.07  ? 41  ILE A CG2 1 
ATOM   308  C  CD1 . ILE A  1 43  ? -13.740 -5.153  24.410  1.00 39.21  ? 41  ILE A CD1 1 
ATOM   309  N  N   . LEU A  1 44  ? -13.717 -1.057  21.944  1.00 44.59  ? 42  LEU A N   1 
ATOM   310  C  CA  . LEU A  1 44  ? -13.889 -0.020  20.931  1.00 48.91  ? 42  LEU A CA  1 
ATOM   311  C  C   . LEU A  1 44  ? -13.877 -0.644  19.537  1.00 52.02  ? 42  LEU A C   1 
ATOM   312  O  O   . LEU A  1 44  ? -12.904 -1.285  19.131  1.00 52.55  ? 42  LEU A O   1 
ATOM   313  C  CB  . LEU A  1 44  ? -12.783 1.034   21.055  1.00 51.68  ? 42  LEU A CB  1 
ATOM   314  C  CG  . LEU A  1 44  ? -13.124 2.464   20.631  1.00 55.64  ? 42  LEU A CG  1 
ATOM   315  C  CD1 . LEU A  1 44  ? -14.604 2.772   20.803  1.00 55.36  ? 42  LEU A CD1 1 
ATOM   316  C  CD2 . LEU A  1 44  ? -12.282 3.462   21.415  1.00 57.63  ? 42  LEU A CD2 1 
ATOM   317  N  N   . ARG A  1 45  ? -14.975 -0.471  18.813  1.00 55.01  ? 43  ARG A N   1 
ATOM   318  C  CA  . ARG A  1 45  ? -15.057 -0.951  17.445  1.00 56.35  ? 43  ARG A CA  1 
ATOM   319  C  C   . ARG A  1 45  ? -13.934 -0.353  16.593  1.00 58.67  ? 43  ARG A C   1 
ATOM   320  O  O   . ARG A  1 45  ? -13.824 0.867   16.473  1.00 57.53  ? 43  ARG A O   1 
ATOM   321  C  CB  . ARG A  1 45  ? -16.417 -0.604  16.847  1.00 58.87  ? 43  ARG A CB  1 
ATOM   322  C  CG  . ARG A  1 45  ? -16.755 -1.519  15.693  1.00 61.70  ? 43  ARG A CG  1 
ATOM   323  C  CD  . ARG A  1 45  ? -18.098 -1.181  15.071  1.00 64.70  ? 43  ARG A CD  1 
ATOM   324  N  NE  . ARG A  1 45  ? -17.946 -0.948  13.635  1.00 62.74  ? 43  ARG A NE  1 
ATOM   325  C  CZ  . ARG A  1 45  ? -18.599 -1.617  12.689  1.00 59.66  ? 43  ARG A CZ  1 
ATOM   326  N  NH1 . ARG A  1 45  ? -18.377 -1.348  11.409  1.00 59.04  ? 43  ARG A NH1 1 
ATOM   327  N  NH2 . ARG A  1 45  ? -19.485 -2.544  13.019  1.00 59.99  ? 43  ARG A NH2 1 
ATOM   328  N  N   . GLU A  1 46  ? -13.094 -1.221  16.028  1.00 59.74  ? 44  GLU A N   1 
ATOM   329  C  CA  . GLU A  1 46  ? -11.946 -0.797  15.229  1.00 62.79  ? 44  GLU A CA  1 
ATOM   330  C  C   . GLU A  1 46  ? -12.066 -1.319  13.791  1.00 63.57  ? 44  GLU A C   1 
ATOM   331  O  O   . GLU A  1 46  ? -11.781 -2.492  13.513  1.00 54.52  ? 44  GLU A O   1 
ATOM   332  C  CB  . GLU A  1 46  ? -10.645 -1.291  15.873  1.00 62.61  ? 44  GLU A CB  1 
ATOM   333  N  N   . ASP A  1 47  ? -12.478 -0.430  12.884  1.00 66.25  ? 45  ASP A N   1 
ATOM   334  C  CA  . ASP A  1 47  ? -12.692 -0.775  11.477  1.00 69.32  ? 45  ASP A CA  1 
ATOM   335  C  C   . ASP A  1 47  ? -11.420 -1.313  10.815  1.00 71.52  ? 45  ASP A C   1 
ATOM   336  O  O   . ASP A  1 47  ? -11.473 -2.279  10.052  1.00 67.24  ? 45  ASP A O   1 
ATOM   337  C  CB  . ASP A  1 47  ? -13.194 0.449   10.699  1.00 68.51  ? 45  ASP A CB  1 
ATOM   338  N  N   . LYS A  1 48  ? -10.282 -0.694  11.120  1.00 77.39  ? 46  LYS A N   1 
ATOM   339  C  CA  . LYS A  1 48  ? -9.019  -1.023  10.452  1.00 80.90  ? 46  LYS A CA  1 
ATOM   340  C  C   . LYS A  1 48  ? -8.536  -2.440  10.785  1.00 80.48  ? 46  LYS A C   1 
ATOM   341  O  O   . LYS A  1 48  ? -8.142  -3.186  9.890   1.00 85.49  ? 46  LYS A O   1 
ATOM   342  C  CB  . LYS A  1 48  ? -7.935  0.000   10.806  1.00 82.04  ? 46  LYS A CB  1 
ATOM   343  N  N   . ASP A  1 49  ? -8.577  -2.810  12.063  1.00 71.55  ? 47  ASP A N   1 
ATOM   344  C  CA  . ASP A  1 49  ? -8.004  -4.086  12.504  1.00 66.50  ? 47  ASP A CA  1 
ATOM   345  C  C   . ASP A  1 49  ? -8.985  -4.841  13.392  1.00 62.27  ? 47  ASP A C   1 
ATOM   346  O  O   . ASP A  1 49  ? -8.893  -4.788  14.620  1.00 55.48  ? 47  ASP A O   1 
ATOM   347  C  CB  . ASP A  1 49  ? -6.694  -3.864  13.257  1.00 69.07  ? 47  ASP A CB  1 
ATOM   348  N  N   . PRO A  1 50  ? -9.943  -5.541  12.769  1.00 59.10  ? 48  PRO A N   1 
ATOM   349  C  CA  . PRO A  1 50  ? -11.091 -6.047  13.513  1.00 55.40  ? 48  PRO A CA  1 
ATOM   350  C  C   . PRO A  1 50  ? -10.676 -7.137  14.490  1.00 49.75  ? 48  PRO A C   1 
ATOM   351  O  O   . PRO A  1 50  ? -9.747  -7.894  14.220  1.00 47.51  ? 48  PRO A O   1 
ATOM   352  C  CB  . PRO A  1 50  ? -11.996 -6.620  12.418  1.00 58.27  ? 48  PRO A CB  1 
ATOM   353  C  CG  . PRO A  1 50  ? -11.060 -7.011  11.322  1.00 60.85  ? 48  PRO A CG  1 
ATOM   354  C  CD  . PRO A  1 50  ? -9.894  -6.060  11.391  1.00 62.71  ? 48  PRO A CD  1 
ATOM   355  N  N   . GLN A  1 51  ? -11.369 -7.221  15.612  1.00 44.52  ? 49  GLN A N   1 
ATOM   356  C  CA  . GLN A  1 51  ? -11.038 -8.208  16.614  1.00 42.62  ? 49  GLN A CA  1 
ATOM   357  C  C   . GLN A  1 51  ? -11.447 -9.624  16.182  1.00 37.33  ? 49  GLN A C   1 
ATOM   358  O  O   . GLN A  1 51  ? -12.531 -9.848  15.639  1.00 35.43  ? 49  GLN A O   1 
ATOM   359  C  CB  . GLN A  1 51  ? -11.702 -7.837  17.926  1.00 43.27  ? 49  GLN A CB  1 
ATOM   360  C  CG  . GLN A  1 51  ? -11.897 -9.014  18.853  1.00 47.55  ? 49  GLN A CG  1 
ATOM   361  C  CD  . GLN A  1 51  ? -11.311 -8.763  20.222  1.00 50.32  ? 49  GLN A CD  1 
ATOM   362  O  OE1 . GLN A  1 51  ? -11.437 -7.668  20.770  1.00 52.34  ? 49  GLN A OE1 1 
ATOM   363  N  NE2 . GLN A  1 51  ? -10.656 -9.778  20.780  1.00 52.92  ? 49  GLN A NE2 1 
ATOM   364  N  N   . LYS A  1 52  ? -10.556 -10.577 16.415  1.00 35.44  ? 50  LYS A N   1 
ATOM   365  C  CA  . LYS A  1 52  ? -10.807 -11.964 16.039  1.00 33.24  ? 50  LYS A CA  1 
ATOM   366  C  C   . LYS A  1 52  ? -11.487 -12.725 17.162  1.00 28.31  ? 50  LYS A C   1 
ATOM   367  O  O   . LYS A  1 52  ? -11.232 -12.482 18.338  1.00 26.42  ? 50  LYS A O   1 
ATOM   368  C  CB  . LYS A  1 52  ? -9.502  -12.649 15.670  1.00 33.96  ? 50  LYS A CB  1 
ATOM   369  C  CG  . LYS A  1 52  ? -8.887  -12.084 14.411  1.00 37.60  ? 50  LYS A CG  1 
ATOM   370  C  CD  . LYS A  1 52  ? -7.586  -12.780 14.073  1.00 41.44  ? 50  LYS A CD  1 
ATOM   371  C  CE  . LYS A  1 52  ? -6.759  -11.945 13.117  1.00 46.73  ? 50  LYS A CE  1 
ATOM   372  N  NZ  . LYS A  1 52  ? -5.680  -12.771 12.522  1.00 52.03  ? 50  LYS A NZ  1 
ATOM   373  N  N   . MET A  1 53  ? -12.378 -13.631 16.781  1.00 25.90  ? 51  MET A N   1 
ATOM   374  C  CA  . MET A  1 53  ? -12.982 -14.549 17.730  1.00 23.19  ? 51  MET A CA  1 
ATOM   375  C  C   . MET A  1 53  ? -11.913 -15.347 18.480  1.00 21.83  ? 51  MET A C   1 
ATOM   376  O  O   . MET A  1 53  ? -10.907 -15.769 17.902  1.00 21.97  ? 51  MET A O   1 
ATOM   377  C  CB  . MET A  1 53  ? -13.920 -15.505 16.994  1.00 22.97  ? 51  MET A CB  1 
ATOM   378  C  CG  . MET A  1 53  ? -14.764 -16.368 17.908  1.00 21.82  ? 51  MET A CG  1 
ATOM   379  S  SD  . MET A  1 53  ? -16.057 -17.232 17.006  1.00 22.18  ? 51  MET A SD  1 
ATOM   380  C  CE  . MET A  1 53  ? -17.157 -15.880 16.625  1.00 23.06  ? 51  MET A CE  1 
ATOM   381  N  N   . TYR A  1 54  ? -12.138 -15.540 19.772  1.00 19.98  ? 52  TYR A N   1 
ATOM   382  C  CA  . TYR A  1 54  ? -11.363 -16.487 20.557  1.00 19.69  ? 52  TYR A CA  1 
ATOM   383  C  C   . TYR A  1 54  ? -12.316 -17.362 21.344  1.00 18.09  ? 52  TYR A C   1 
ATOM   384  O  O   . TYR A  1 54  ? -13.520 -17.116 21.340  1.00 18.56  ? 52  TYR A O   1 
ATOM   385  C  CB  . TYR A  1 54  ? -10.392 -15.770 21.501  1.00 20.42  ? 52  TYR A CB  1 
ATOM   386  C  CG  . TYR A  1 54  ? -11.043 -14.814 22.480  1.00 20.32  ? 52  TYR A CG  1 
ATOM   387  C  CD1 . TYR A  1 54  ? -11.262 -13.485 22.146  1.00 20.88  ? 52  TYR A CD1 1 
ATOM   388  C  CD2 . TYR A  1 54  ? -11.397 -15.233 23.753  1.00 20.16  ? 52  TYR A CD2 1 
ATOM   389  C  CE1 . TYR A  1 54  ? -11.839 -12.606 23.040  1.00 20.81  ? 52  TYR A CE1 1 
ATOM   390  C  CE2 . TYR A  1 54  ? -11.965 -14.362 24.665  1.00 19.97  ? 52  TYR A CE2 1 
ATOM   391  C  CZ  . TYR A  1 54  ? -12.201 -13.052 24.297  1.00 20.72  ? 52  TYR A CZ  1 
ATOM   392  O  OH  . TYR A  1 54  ? -12.807 -12.184 25.179  1.00 19.75  ? 52  TYR A OH  1 
ATOM   393  N  N   . ALA A  1 55  ? -11.777 -18.394 21.989  1.00 17.24  ? 53  ALA A N   1 
ATOM   394  C  CA  . ALA A  1 55  ? -12.575 -19.337 22.752  1.00 16.07  ? 53  ALA A CA  1 
ATOM   395  C  C   . ALA A  1 55  ? -12.120 -19.380 24.208  1.00 16.32  ? 53  ALA A C   1 
ATOM   396  O  O   . ALA A  1 55  ? -10.962 -19.132 24.527  1.00 16.68  ? 53  ALA A O   1 
ATOM   397  C  CB  . ALA A  1 55  ? -12.484 -20.725 22.146  1.00 15.73  ? 53  ALA A CB  1 
ATOM   398  N  N   . THR A  1 56  ? -13.044 -19.713 25.089  1.00 15.97  ? 54  THR A N   1 
ATOM   399  C  CA  . THR A  1 56  ? -12.738 -19.813 26.492  1.00 16.56  ? 54  THR A CA  1 
ATOM   400  C  C   . THR A  1 56  ? -13.316 -21.101 27.043  1.00 16.89  ? 54  THR A C   1 
ATOM   401  O  O   . THR A  1 56  ? -14.497 -21.395 26.844  1.00 16.45  ? 54  THR A O   1 
ATOM   402  C  CB  . THR A  1 56  ? -13.298 -18.606 27.258  1.00 17.19  ? 54  THR A CB  1 
ATOM   403  O  OG1 . THR A  1 56  ? -12.649 -17.421 26.804  1.00 18.64  ? 54  THR A OG1 1 
ATOM   404  C  CG2 . THR A  1 56  ? -13.061 -18.748 28.749  1.00 18.65  ? 54  THR A CG2 1 
ATOM   405  N  N   . ILE A  1 57  ? -12.478 -21.855 27.756  1.00 17.42  ? 55  ILE A N   1 
ATOM   406  C  CA  . ILE A  1 57  ? -12.803 -23.204 28.174  1.00 17.11  ? 55  ILE A CA  1 
ATOM   407  C  C   . ILE A  1 57  ? -12.898 -23.294 29.697  1.00 17.71  ? 55  ILE A C   1 
ATOM   408  O  O   . ILE A  1 57  ? -11.953 -22.958 30.416  1.00 17.39  ? 55  ILE A O   1 
ATOM   409  C  CB  . ILE A  1 57  ? -11.737 -24.202 27.667  1.00 18.39  ? 55  ILE A CB  1 
ATOM   410  C  CG1 . ILE A  1 57  ? -11.639 -24.124 26.143  1.00 19.16  ? 55  ILE A CG1 1 
ATOM   411  C  CG2 . ILE A  1 57  ? -12.070 -25.621 28.101  1.00 16.92  ? 55  ILE A CG2 1 
ATOM   412  C  CD1 . ILE A  1 57  ? -10.350 -24.689 25.597  1.00 20.83  ? 55  ILE A CD1 1 
ATOM   413  N  N   . TYR A  1 58  ? -14.048 -23.752 30.183  1.00 17.71  ? 56  TYR A N   1 
ATOM   414  C  CA  . TYR A  1 58  ? -14.307 -23.840 31.629  1.00 19.26  ? 56  TYR A CA  1 
ATOM   415  C  C   . TYR A  1 58  ? -14.213 -25.283 32.108  1.00 20.34  ? 56  TYR A C   1 
ATOM   416  O  O   . TYR A  1 58  ? -14.928 -26.154 31.616  1.00 20.51  ? 56  TYR A O   1 
ATOM   417  C  CB  . TYR A  1 58  ? -15.706 -23.306 31.952  1.00 17.17  ? 56  TYR A CB  1 
ATOM   418  C  CG  . TYR A  1 58  ? -15.846 -21.811 31.860  1.00 16.40  ? 56  TYR A CG  1 
ATOM   419  C  CD1 . TYR A  1 58  ? -16.004 -21.039 33.007  1.00 18.16  ? 56  TYR A CD1 1 
ATOM   420  C  CD2 . TYR A  1 58  ? -15.842 -21.166 30.634  1.00 16.01  ? 56  TYR A CD2 1 
ATOM   421  C  CE1 . TYR A  1 58  ? -16.142 -19.660 32.932  1.00 17.43  ? 56  TYR A CE1 1 
ATOM   422  C  CE2 . TYR A  1 58  ? -15.985 -19.797 30.551  1.00 16.37  ? 56  TYR A CE2 1 
ATOM   423  C  CZ  . TYR A  1 58  ? -16.130 -19.049 31.706  1.00 16.43  ? 56  TYR A CZ  1 
ATOM   424  O  OH  . TYR A  1 58  ? -16.280 -17.687 31.630  1.00 16.28  ? 56  TYR A OH  1 
ATOM   425  N  N   . GLU A  1 59  ? -13.339 -25.526 33.075  1.00 23.09  ? 57  GLU A N   1 
ATOM   426  C  CA  . GLU A  1 59  ? -13.194 -26.848 33.659  1.00 23.49  ? 57  GLU A CA  1 
ATOM   427  C  C   . GLU A  1 59  ? -13.475 -26.780 35.156  1.00 21.81  ? 57  GLU A C   1 
ATOM   428  O  O   . GLU A  1 59  ? -12.770 -26.110 35.911  1.00 19.67  ? 57  GLU A O   1 
ATOM   429  C  CB  . GLU A  1 59  ? -11.775 -27.383 33.442  1.00 28.19  ? 57  GLU A CB  1 
ATOM   430  C  CG  . GLU A  1 59  ? -11.498 -27.990 32.082  1.00 34.46  ? 57  GLU A CG  1 
ATOM   431  C  CD  . GLU A  1 59  ? -9.991  -28.108 31.825  1.00 44.59  ? 57  GLU A CD  1 
ATOM   432  O  OE1 . GLU A  1 59  ? -9.209  -28.257 32.793  1.00 54.33  ? 57  GLU A OE1 1 
ATOM   433  O  OE2 . GLU A  1 59  ? -9.572  -28.046 30.653  1.00 59.66  ? 57  GLU A OE2 1 
ATOM   434  N  N   . LEU A  1 60  ? -14.477 -27.527 35.588  1.00 21.40  ? 58  LEU A N   1 
ATOM   435  C  CA  . LEU A  1 60  ? -14.867 -27.561 36.996  1.00 22.37  ? 58  LEU A CA  1 
ATOM   436  C  C   . LEU A  1 60  ? -13.933 -28.480 37.768  1.00 24.35  ? 58  LEU A C   1 
ATOM   437  O  O   . LEU A  1 60  ? -13.794 -29.649 37.439  1.00 25.30  ? 58  LEU A O   1 
ATOM   438  C  CB  . LEU A  1 60  ? -16.298 -28.066 37.112  1.00 21.53  ? 58  LEU A CB  1 
ATOM   439  C  CG  . LEU A  1 60  ? -16.997 -27.926 38.457  1.00 21.87  ? 58  LEU A CG  1 
ATOM   440  C  CD1 . LEU A  1 60  ? -17.068 -26.465 38.881  1.00 22.42  ? 58  LEU A CD1 1 
ATOM   441  C  CD2 . LEU A  1 60  ? -18.389 -28.525 38.372  1.00 22.04  ? 58  LEU A CD2 1 
ATOM   442  N  N   . LYS A  1 61  ? -13.293 -27.950 38.797  1.00 28.10  ? 59  LYS A N   1 
ATOM   443  C  CA  . LYS A  1 61  ? -12.382 -28.750 39.617  1.00 30.86  ? 59  LYS A CA  1 
ATOM   444  C  C   . LYS A  1 61  ? -13.107 -29.418 40.777  1.00 31.10  ? 59  LYS A C   1 
ATOM   445  O  O   . LYS A  1 61  ? -14.252 -29.086 41.088  1.00 32.28  ? 59  LYS A O   1 
ATOM   446  C  CB  . LYS A  1 61  ? -11.257 -27.876 40.165  1.00 32.01  ? 59  LYS A CB  1 
ATOM   447  C  CG  . LYS A  1 61  ? -10.577 -27.031 39.106  1.00 35.92  ? 59  LYS A CG  1 
ATOM   448  C  CD  . LYS A  1 61  ? -9.116  -26.797 39.434  1.00 42.94  ? 59  LYS A CD  1 
ATOM   449  C  CE  . LYS A  1 61  ? -8.934  -26.221 40.828  1.00 48.17  ? 59  LYS A CE  1 
ATOM   450  N  NZ  . LYS A  1 61  ? -8.135  -24.968 40.803  1.00 53.75  ? 59  LYS A NZ  1 
ATOM   451  N  N   . GLU A  1 62  ? -12.423 -30.355 41.418  1.00 31.79  ? 60  GLU A N   1 
ATOM   452  C  CA  . GLU A  1 62  ? -12.956 -31.042 42.581  1.00 34.98  ? 60  GLU A CA  1 
ATOM   453  C  C   . GLU A  1 62  ? -13.510 -30.061 43.610  1.00 34.52  ? 60  GLU A C   1 
ATOM   454  O  O   . GLU A  1 62  ? -14.573 -30.298 44.181  1.00 33.16  ? 60  GLU A O   1 
ATOM   455  C  CB  . GLU A  1 62  ? -11.866 -31.906 43.218  1.00 39.80  ? 60  GLU A CB  1 
ATOM   456  C  CG  . GLU A  1 62  ? -12.227 -32.434 44.593  1.00 47.61  ? 60  GLU A CG  1 
ATOM   457  C  CD  . GLU A  1 62  ? -11.705 -33.840 44.837  1.00 58.74  ? 60  GLU A CD  1 
ATOM   458  O  OE1 . GLU A  1 62  ? -11.469 -34.580 43.852  1.00 62.72  ? 60  GLU A OE1 1 
ATOM   459  O  OE2 . GLU A  1 62  ? -11.529 -34.205 46.020  1.00 60.20  ? 60  GLU A OE2 1 
ATOM   460  N  N   . ASP A  1 63  ? -12.786 -28.968 43.848  1.00 32.30  ? 61  ASP A N   1 
ATOM   461  C  CA  . ASP A  1 63  ? -13.169 -28.009 44.874  1.00 31.66  ? 61  ASP A CA  1 
ATOM   462  C  C   . ASP A  1 63  ? -14.221 -26.999 44.396  1.00 30.55  ? 61  ASP A C   1 
ATOM   463  O  O   . ASP A  1 63  ? -14.538 -26.048 45.106  1.00 31.52  ? 61  ASP A O   1 
ATOM   464  C  CB  . ASP A  1 63  ? -11.930 -27.291 45.420  1.00 32.11  ? 61  ASP A CB  1 
ATOM   465  C  CG  . ASP A  1 63  ? -11.336 -26.277 44.443  1.00 32.85  ? 61  ASP A CG  1 
ATOM   466  O  OD1 . ASP A  1 63  ? -11.886 -26.074 43.336  1.00 29.82  ? 61  ASP A OD1 1 
ATOM   467  O  OD2 . ASP A  1 63  ? -10.295 -25.677 44.788  1.00 35.17  ? 61  ASP A OD2 1 
ATOM   468  N  N   . LYS A  1 64  ? -14.735 -27.192 43.185  1.00 30.98  ? 62  LYS A N   1 
ATOM   469  C  CA  . LYS A  1 64  ? -15.852 -26.390 42.648  1.00 31.45  ? 62  LYS A CA  1 
ATOM   470  C  C   . LYS A  1 64  ? -15.443 -25.033 42.092  1.00 26.72  ? 62  LYS A C   1 
ATOM   471  O  O   . LYS A  1 64  ? -16.295 -24.245 41.679  1.00 23.95  ? 62  LYS A O   1 
ATOM   472  C  CB  . LYS A  1 64  ? -16.946 -26.187 43.701  1.00 36.05  ? 62  LYS A CB  1 
ATOM   473  C  CG  . LYS A  1 64  ? -17.572 -27.477 44.207  1.00 40.53  ? 62  LYS A CG  1 
ATOM   474  C  CD  . LYS A  1 64  ? -18.175 -28.297 43.078  1.00 39.39  ? 62  LYS A CD  1 
ATOM   475  C  CE  . LYS A  1 64  ? -18.768 -29.594 43.609  1.00 38.91  ? 62  LYS A CE  1 
ATOM   476  N  NZ  . LYS A  1 64  ? -18.996 -30.568 42.511  1.00 36.56  ? 62  LYS A NZ  1 
ATOM   477  N  N   . SER A  1 65  ? -14.147 -24.746 42.101  1.00 25.13  ? 63  SER A N   1 
ATOM   478  C  CA  . SER A  1 65  ? -13.623 -23.636 41.322  1.00 24.07  ? 63  SER A CA  1 
ATOM   479  C  C   . SER A  1 65  ? -13.483 -24.057 39.867  1.00 20.91  ? 63  SER A C   1 
ATOM   480  O  O   . SER A  1 65  ? -13.428 -25.249 39.567  1.00 19.44  ? 63  SER A O   1 
ATOM   481  C  CB  . SER A  1 65  ? -12.268 -23.201 41.880  1.00 26.09  ? 63  SER A CB  1 
ATOM   482  O  OG  . SER A  1 65  ? -12.455 -22.560 43.128  1.00 28.43  ? 63  SER A OG  1 
ATOM   483  N  N   . TYR A  1 66  ? -13.457 -23.082 38.968  1.00 19.22  ? 64  TYR A N   1 
ATOM   484  C  CA  . TYR A  1 66  ? -13.161 -23.352 37.558  1.00 19.18  ? 64  TYR A CA  1 
ATOM   485  C  C   . TYR A  1 66  ? -11.703 -23.037 37.249  1.00 19.91  ? 64  TYR A C   1 
ATOM   486  O  O   . TYR A  1 66  ? -11.196 -21.979 37.620  1.00 19.86  ? 64  TYR A O   1 
ATOM   487  C  CB  . TYR A  1 66  ? -14.013 -22.486 36.633  1.00 17.51  ? 64  TYR A CB  1 
ATOM   488  C  CG  . TYR A  1 66  ? -15.453 -22.879 36.485  1.00 16.65  ? 64  TYR A CG  1 
ATOM   489  C  CD1 . TYR A  1 66  ? -16.466 -22.020 36.895  1.00 16.46  ? 64  TYR A CD1 1 
ATOM   490  C  CD2 . TYR A  1 66  ? -15.814 -24.061 35.848  1.00 16.51  ? 64  TYR A CD2 1 
ATOM   491  C  CE1 . TYR A  1 66  ? -17.796 -22.353 36.736  1.00 16.31  ? 64  TYR A CE1 1 
ATOM   492  C  CE2 . TYR A  1 66  ? -17.144 -24.385 35.660  1.00 16.07  ? 64  TYR A CE2 1 
ATOM   493  C  CZ  . TYR A  1 66  ? -18.133 -23.524 36.114  1.00 15.97  ? 64  TYR A CZ  1 
ATOM   494  O  OH  . TYR A  1 66  ? -19.471 -23.808 35.943  1.00 16.71  ? 64  TYR A OH  1 
ATOM   495  N  N   . ASN A  1 67  ? -11.046 -23.949 36.547  1.00 20.08  ? 65  ASN A N   1 
ATOM   496  C  CA  A ASN A  1 67  ? -9.947  -23.578 35.686  0.50 20.58  ? 65  ASN A CA  1 
ATOM   497  C  CA  B ASN A  1 67  ? -9.959  -23.581 35.657  0.50 20.28  ? 65  ASN A CA  1 
ATOM   498  C  C   . ASN A  1 67  ? -10.486 -23.042 34.350  1.00 18.79  ? 65  ASN A C   1 
ATOM   499  O  O   . ASN A  1 67  ? -11.252 -23.712 33.655  1.00 17.56  ? 65  ASN A O   1 
ATOM   500  C  CB  A ASN A  1 67  ? -8.997  -24.768 35.522  0.50 22.36  ? 65  ASN A CB  1 
ATOM   501  C  CB  B ASN A  1 67  ? -9.107  -24.789 35.316  0.50 21.52  ? 65  ASN A CB  1 
ATOM   502  C  CG  A ASN A  1 67  ? -7.875  -24.762 36.539  0.50 26.05  ? 65  ASN A CG  1 
ATOM   503  C  CG  B ASN A  1 67  ? -7.650  -24.567 35.610  0.50 24.34  ? 65  ASN A CG  1 
ATOM   504  O  OD1 A ASN A  1 67  ? -7.312  -25.813 36.854  0.50 29.30  ? 65  ASN A OD1 1 
ATOM   505  O  OD1 B ASN A  1 67  ? -7.242  -24.432 36.771  0.50 27.54  ? 65  ASN A OD1 1 
ATOM   506  N  ND2 A ASN A  1 67  ? -7.564  -23.589 37.088  0.50 27.03  ? 65  ASN A ND2 1 
ATOM   507  N  ND2 B ASN A  1 67  ? -6.850  -24.484 34.553  0.50 25.08  ? 65  ASN A ND2 1 
ATOM   508  N  N   . VAL A  1 68  ? -10.071 -21.832 34.003  1.00 17.45  ? 66  VAL A N   1 
ATOM   509  C  CA  . VAL A  1 68  ? -10.576 -21.163 32.818  1.00 15.98  ? 66  VAL A CA  1 
ATOM   510  C  C   . VAL A  1 68  ? -9.429  -20.864 31.854  1.00 16.64  ? 66  VAL A C   1 
ATOM   511  O  O   . VAL A  1 68  ? -8.458  -20.192 32.220  1.00 17.81  ? 66  VAL A O   1 
ATOM   512  C  CB  . VAL A  1 68  ? -11.283 -19.850 33.197  1.00 15.55  ? 66  VAL A CB  1 
ATOM   513  C  CG1 . VAL A  1 68  ? -11.952 -19.231 31.981  1.00 14.82  ? 66  VAL A CG1 1 
ATOM   514  C  CG2 . VAL A  1 68  ? -12.303 -20.102 34.302  1.00 14.75  ? 66  VAL A CG2 1 
ATOM   515  N  N   . THR A  1 69  ? -9.545  -21.367 30.629  1.00 16.01  ? 67  THR A N   1 
ATOM   516  C  CA  . THR A  1 69  ? -8.488  -21.235 29.643  1.00 17.30  ? 67  THR A CA  1 
ATOM   517  C  C   . THR A  1 69  ? -9.009  -20.569 28.378  1.00 17.29  ? 67  THR A C   1 
ATOM   518  O  O   . THR A  1 69  ? -9.984  -21.012 27.788  1.00 16.47  ? 67  THR A O   1 
ATOM   519  C  CB  . THR A  1 69  ? -7.898  -22.611 29.272  1.00 17.58  ? 67  THR A CB  1 
ATOM   520  O  OG1 . THR A  1 69  ? -7.549  -23.322 30.469  1.00 17.72  ? 67  THR A OG1 1 
ATOM   521  C  CG2 . THR A  1 69  ? -6.657  -22.442 28.392  1.00 18.55  ? 67  THR A CG2 1 
ATOM   522  N  N   . SER A  1 70  ? -8.391  -19.464 27.995  1.00 18.83  ? 68  SER A N   1 
ATOM   523  C  CA  . SER A  1 70  ? -8.790  -18.773 26.779  1.00 19.05  ? 68  SER A CA  1 
ATOM   524  C  C   . SER A  1 70  ? -7.726  -18.998 25.731  1.00 20.07  ? 68  SER A C   1 
ATOM   525  O  O   . SER A  1 70  ? -6.537  -18.917 26.024  1.00 21.13  ? 68  SER A O   1 
ATOM   526  C  CB  . SER A  1 70  ? -8.980  -17.272 27.037  1.00 19.86  ? 68  SER A CB  1 
ATOM   527  O  OG  . SER A  1 70  ? -10.260 -17.004 27.599  1.00 19.01  ? 68  SER A OG  1 
ATOM   528  N  N   . VAL A  1 71  ? -8.167  -19.313 24.519  1.00 20.00  ? 69  VAL A N   1 
ATOM   529  C  CA  . VAL A  1 71  ? -7.272  -19.587 23.413  1.00 21.50  ? 69  VAL A CA  1 
ATOM   530  C  C   . VAL A  1 71  ? -7.461  -18.512 22.345  1.00 22.01  ? 69  VAL A C   1 
ATOM   531  O  O   . VAL A  1 71  ? -8.571  -18.322 21.843  1.00 20.54  ? 69  VAL A O   1 
ATOM   532  C  CB  . VAL A  1 71  ? -7.581  -20.968 22.798  1.00 21.43  ? 69  VAL A CB  1 
ATOM   533  C  CG1 . VAL A  1 71  ? -6.529  -21.363 21.784  1.00 22.86  ? 69  VAL A CG1 1 
ATOM   534  C  CG2 . VAL A  1 71  ? -7.697  -22.015 23.892  1.00 21.51  ? 69  VAL A CG2 1 
ATOM   535  N  N   . LEU A  1 72  ? -6.378  -17.817 22.005  1.00 23.72  ? 70  LEU A N   1 
ATOM   536  C  CA  . LEU A  1 72  ? -6.428  -16.720 21.038  1.00 25.25  ? 70  LEU A CA  1 
ATOM   537  C  C   . LEU A  1 72  ? -5.428  -16.966 19.914  1.00 27.04  ? 70  LEU A C   1 
ATOM   538  O  O   . LEU A  1 72  ? -4.376  -17.568 20.135  1.00 26.78  ? 70  LEU A O   1 
ATOM   539  C  CB  . LEU A  1 72  ? -6.060  -15.391 21.701  1.00 26.96  ? 70  LEU A CB  1 
ATOM   540  C  CG  . LEU A  1 72  ? -7.052  -14.795 22.705  1.00 26.34  ? 70  LEU A CG  1 
ATOM   541  C  CD1 . LEU A  1 72  ? -6.999  -15.584 24.006  1.00 26.24  ? 70  LEU A CD1 1 
ATOM   542  C  CD2 . LEU A  1 72  ? -6.766  -13.326 22.968  1.00 27.34  ? 70  LEU A CD2 1 
ATOM   543  N  N   . PHE A  1 73  ? -5.753  -16.475 18.719  1.00 27.16  ? 71  PHE A N   1 
ATOM   544  C  CA  . PHE A  1 73  ? -4.809  -16.470 17.610  1.00 29.10  ? 71  PHE A CA  1 
ATOM   545  C  C   . PHE A  1 73  ? -4.159  -15.099 17.500  1.00 31.55  ? 71  PHE A C   1 
ATOM   546  O  O   . PHE A  1 73  ? -4.817  -14.130 17.144  1.00 31.09  ? 71  PHE A O   1 
ATOM   547  C  CB  . PHE A  1 73  ? -5.538  -16.820 16.301  1.00 28.20  ? 71  PHE A CB  1 
ATOM   548  C  CG  . PHE A  1 73  ? -4.634  -16.942 15.104  1.00 29.01  ? 71  PHE A CG  1 
ATOM   549  C  CD1 . PHE A  1 73  ? -3.514  -17.736 15.150  1.00 29.79  ? 71  PHE A CD1 1 
ATOM   550  C  CD2 . PHE A  1 73  ? -4.930  -16.282 13.924  1.00 30.08  ? 71  PHE A CD2 1 
ATOM   551  C  CE1 . PHE A  1 73  ? -2.694  -17.864 14.041  1.00 32.13  ? 71  PHE A CE1 1 
ATOM   552  C  CE2 . PHE A  1 73  ? -4.115  -16.395 12.809  1.00 31.95  ? 71  PHE A CE2 1 
ATOM   553  C  CZ  . PHE A  1 73  ? -2.988  -17.190 12.868  1.00 33.02  ? 71  PHE A CZ  1 
ATOM   554  N  N   . ARG A  1 74  ? -2.871  -15.017 17.822  1.00 35.70  ? 72  ARG A N   1 
ATOM   555  C  CA  . ARG A  1 74  ? -2.162  -13.750 17.755  1.00 39.43  ? 72  ARG A CA  1 
ATOM   556  C  C   . ARG A  1 74  ? -0.701  -13.920 17.383  1.00 41.15  ? 72  ARG A C   1 
ATOM   557  O  O   . ARG A  1 74  ? -0.017  -14.829 17.856  1.00 40.27  ? 72  ARG A O   1 
ATOM   558  C  CB  . ARG A  1 74  ? -2.299  -12.969 19.065  1.00 42.80  ? 72  ARG A CB  1 
ATOM   559  C  CG  . ARG A  1 74  ? -1.597  -13.577 20.264  1.00 46.62  ? 72  ARG A CG  1 
ATOM   560  C  CD  . ARG A  1 74  ? -1.893  -12.753 21.513  1.00 51.67  ? 72  ARG A CD  1 
ATOM   561  N  NE  . ARG A  1 74  ? -1.376  -11.378 21.399  1.00 55.91  ? 72  ARG A NE  1 
ATOM   562  C  CZ  . ARG A  1 74  ? -0.107  -11.022 21.592  1.00 56.58  ? 72  ARG A CZ  1 
ATOM   563  N  NH1 . ARG A  1 74  ? 0.255   -9.748  21.464  1.00 59.45  ? 72  ARG A NH1 1 
ATOM   564  N  NH2 . ARG A  1 74  ? 0.804   -11.931 21.917  1.00 55.85  ? 72  ARG A NH2 1 
ATOM   565  N  N   . LYS A  1 75  ? -0.231  -13.026 16.521  1.00 44.16  ? 73  LYS A N   1 
ATOM   566  C  CA  . LYS A  1 75  ? 1.121   -13.097 16.002  1.00 47.37  ? 73  LYS A CA  1 
ATOM   567  C  C   . LYS A  1 75  ? 1.387   -14.460 15.375  1.00 44.23  ? 73  LYS A C   1 
ATOM   568  O  O   . LYS A  1 75  ? 2.496   -14.985 15.452  1.00 45.54  ? 73  LYS A O   1 
ATOM   569  C  CB  . LYS A  1 75  ? 2.114   -12.803 17.123  1.00 52.49  ? 73  LYS A CB  1 
ATOM   570  C  CG  . LYS A  1 75  ? 2.023   -11.371 17.641  1.00 58.29  ? 73  LYS A CG  1 
ATOM   571  C  CD  . LYS A  1 75  ? 2.887   -11.150 18.878  1.00 63.66  ? 73  LYS A CD  1 
ATOM   572  C  CE  . LYS A  1 75  ? 3.834   -9.967  18.713  1.00 68.44  ? 73  LYS A CE  1 
ATOM   573  N  NZ  . LYS A  1 75  ? 3.125   -8.663  18.839  1.00 69.53  ? 73  LYS A NZ  1 
ATOM   574  N  N   . LYS A  1 76  ? 0.349   -15.019 14.763  1.00 40.58  ? 74  LYS A N   1 
ATOM   575  C  CA  . LYS A  1 76  ? 0.448   -16.245 13.988  1.00 40.02  ? 74  LYS A CA  1 
ATOM   576  C  C   . LYS A  1 76  ? 0.631   -17.500 14.836  1.00 37.38  ? 74  LYS A C   1 
ATOM   577  O  O   . LYS A  1 76  ? 1.022   -18.541 14.319  1.00 37.43  ? 74  LYS A O   1 
ATOM   578  C  CB  . LYS A  1 76  ? 1.559   -16.128 12.944  1.00 43.58  ? 74  LYS A CB  1 
ATOM   579  C  CG  . LYS A  1 76  ? 1.231   -15.122 11.855  1.00 45.87  ? 74  LYS A CG  1 
ATOM   580  C  CD  . LYS A  1 76  ? 2.381   -14.949 10.877  1.00 50.52  ? 74  LYS A CD  1 
ATOM   581  C  CE  . LYS A  1 76  ? 2.128   -13.783 9.931   1.00 52.53  ? 74  LYS A CE  1 
ATOM   582  N  NZ  . LYS A  1 76  ? 3.148   -13.726 8.849   1.00 55.82  ? 74  LYS A NZ  1 
ATOM   583  N  N   . LYS A  1 77  ? 0.326   -17.405 16.128  1.00 35.13  ? 75  LYS A N   1 
ATOM   584  C  CA  . LYS A  1 77  ? 0.440   -18.543 17.042  1.00 33.49  ? 75  LYS A CA  1 
ATOM   585  C  C   . LYS A  1 77  ? -0.778  -18.637 17.937  1.00 30.80  ? 75  LYS A C   1 
ATOM   586  O  O   . LYS A  1 77  ? -1.535  -17.682 18.060  1.00 29.71  ? 75  LYS A O   1 
ATOM   587  C  CB  . LYS A  1 77  ? 1.693   -18.419 17.905  1.00 34.90  ? 75  LYS A CB  1 
ATOM   588  C  CG  . LYS A  1 77  ? 2.971   -18.488 17.100  1.00 37.21  ? 75  LYS A CG  1 
ATOM   589  C  CD  . LYS A  1 77  ? 4.172   -18.784 17.974  1.00 38.71  ? 75  LYS A CD  1 
ATOM   590  C  CE  . LYS A  1 77  ? 5.439   -18.712 17.154  1.00 41.39  ? 75  LYS A CE  1 
ATOM   591  N  NZ  . LYS A  1 77  ? 6.636   -19.016 17.976  1.00 43.41  ? 75  LYS A NZ  1 
ATOM   592  N  N   . CYS A  1 78  ? -0.972  -19.804 18.545  1.00 29.96  ? 76  CYS A N   1 
ATOM   593  C  CA  . CYS A  1 78  ? -2.001  -19.977 19.558  1.00 28.16  ? 76  CYS A CA  1 
ATOM   594  C  C   . CYS A  1 78  ? -1.490  -19.535 20.906  1.00 29.24  ? 76  CYS A C   1 
ATOM   595  O  O   . CYS A  1 78  ? -0.436  -19.977 21.357  1.00 29.74  ? 76  CYS A O   1 
ATOM   596  C  CB  . CYS A  1 78  ? -2.444  -21.432 19.626  1.00 27.11  ? 76  CYS A CB  1 
ATOM   597  S  SG  . CYS A  1 78  ? -2.993  -22.072 18.027  1.00 27.27  ? 76  CYS A SG  1 
ATOM   598  N  N   . ASP A  1 79  ? -2.235  -18.628 21.522  1.00 30.14  ? 77  ASP A N   1 
ATOM   599  C  CA  . ASP A  1 79  ? -1.852  -18.025 22.781  1.00 34.12  ? 77  ASP A CA  1 
ATOM   600  C  C   . ASP A  1 79  ? -2.858  -18.475 23.834  1.00 31.63  ? 77  ASP A C   1 
ATOM   601  O  O   . ASP A  1 79  ? -4.058  -18.523 23.570  1.00 30.33  ? 77  ASP A O   1 
ATOM   602  C  CB  . ASP A  1 79  ? -1.856  -16.490 22.642  1.00 40.30  ? 77  ASP A CB  1 
ATOM   603  C  CG  . ASP A  1 79  ? -1.629  -15.781 23.969  1.00 47.21  ? 77  ASP A CG  1 
ATOM   604  O  OD1 . ASP A  1 79  ? -2.288  -14.745 24.221  1.00 53.45  ? 77  ASP A OD1 1 
ATOM   605  O  OD2 . ASP A  1 79  ? -0.798  -16.263 24.767  1.00 51.24  ? 77  ASP A OD2 1 
ATOM   606  N  N   . TYR A  1 80  ? -2.380  -18.791 25.030  1.00 31.35  ? 78  TYR A N   1 
ATOM   607  C  CA  . TYR A  1 80  ? -3.232  -19.377 26.055  1.00 29.92  ? 78  TYR A CA  1 
ATOM   608  C  C   . TYR A  1 80  ? -3.171  -18.532 27.333  1.00 30.66  ? 78  TYR A C   1 
ATOM   609  O  O   . TYR A  1 80  ? -2.092  -18.286 27.840  1.00 34.42  ? 78  TYR A O   1 
ATOM   610  C  CB  . TYR A  1 80  ? -2.769  -20.813 26.342  1.00 29.38  ? 78  TYR A CB  1 
ATOM   611  C  CG  . TYR A  1 80  ? -2.875  -21.752 25.149  1.00 28.47  ? 78  TYR A CG  1 
ATOM   612  C  CD1 . TYR A  1 80  ? -4.036  -22.462 24.903  1.00 26.73  ? 78  TYR A CD1 1 
ATOM   613  C  CD2 . TYR A  1 80  ? -1.822  -21.914 24.259  1.00 30.06  ? 78  TYR A CD2 1 
ATOM   614  C  CE1 . TYR A  1 80  ? -4.146  -23.312 23.809  1.00 26.41  ? 78  TYR A CE1 1 
ATOM   615  C  CE2 . TYR A  1 80  ? -1.924  -22.761 23.159  1.00 29.52  ? 78  TYR A CE2 1 
ATOM   616  C  CZ  . TYR A  1 80  ? -3.090  -23.459 22.937  1.00 28.03  ? 78  TYR A CZ  1 
ATOM   617  O  OH  . TYR A  1 80  ? -3.219  -24.309 21.838  1.00 27.97  ? 78  TYR A OH  1 
ATOM   618  N  N   . TRP A  1 81  ? -4.319  -18.067 27.832  1.00 28.87  ? 79  TRP A N   1 
ATOM   619  C  CA  . TRP A  1 81  ? -4.396  -17.455 29.165  1.00 28.78  ? 79  TRP A CA  1 
ATOM   620  C  C   . TRP A  1 81  ? -5.199  -18.335 30.118  1.00 26.15  ? 79  TRP A C   1 
ATOM   621  O  O   . TRP A  1 81  ? -6.397  -18.564 29.929  1.00 24.48  ? 79  TRP A O   1 
ATOM   622  C  CB  . TRP A  1 81  ? -5.018  -16.043 29.122  1.00 30.31  ? 79  TRP A CB  1 
ATOM   623  C  CG  . TRP A  1 81  ? -5.092  -15.398 30.507  1.00 32.19  ? 79  TRP A CG  1 
ATOM   624  C  CD1 . TRP A  1 81  ? -4.126  -15.437 31.479  1.00 33.88  ? 79  TRP A CD1 1 
ATOM   625  C  CD2 . TRP A  1 81  ? -6.198  -14.676 31.077  1.00 31.76  ? 79  TRP A CD2 1 
ATOM   626  N  NE1 . TRP A  1 81  ? -4.555  -14.770 32.610  1.00 34.01  ? 79  TRP A NE1 1 
ATOM   627  C  CE2 . TRP A  1 81  ? -5.822  -14.300 32.394  1.00 32.75  ? 79  TRP A CE2 1 
ATOM   628  C  CE3 . TRP A  1 81  ? -7.459  -14.300 30.605  1.00 30.86  ? 79  TRP A CE3 1 
ATOM   629  C  CZ2 . TRP A  1 81  ? -6.667  -13.573 33.244  1.00 33.35  ? 79  TRP A CZ2 1 
ATOM   630  C  CZ3 . TRP A  1 81  ? -8.307  -13.577 31.458  1.00 32.71  ? 79  TRP A CZ3 1 
ATOM   631  C  CH2 . TRP A  1 81  ? -7.904  -13.228 32.763  1.00 32.78  ? 79  TRP A CH2 1 
ATOM   632  N  N   . ILE A  1 82  ? -4.530  -18.816 31.152  1.00 26.33  ? 80  ILE A N   1 
ATOM   633  C  CA  . ILE A  1 82  ? -5.157  -19.663 32.143  1.00 25.86  ? 80  ILE A CA  1 
ATOM   634  C  C   . ILE A  1 82  ? -5.368  -18.872 33.422  1.00 26.84  ? 80  ILE A C   1 
ATOM   635  O  O   . ILE A  1 82  ? -4.457  -18.224 33.904  1.00 27.10  ? 80  ILE A O   1 
ATOM   636  C  CB  . ILE A  1 82  ? -4.272  -20.878 32.458  1.00 26.87  ? 80  ILE A CB  1 
ATOM   637  C  CG1 . ILE A  1 82  ? -4.014  -21.675 31.174  1.00 27.44  ? 80  ILE A CG1 1 
ATOM   638  C  CG2 . ILE A  1 82  ? -4.928  -21.754 33.516  1.00 25.52  ? 80  ILE A CG2 1 
ATOM   639  C  CD1 . ILE A  1 82  ? -2.857  -22.645 31.272  1.00 28.60  ? 80  ILE A CD1 1 
ATOM   640  N  N   . ARG A  1 83  ? -6.567  -18.947 33.985  1.00 27.74  ? 81  ARG A N   1 
ATOM   641  C  CA  . ARG A  1 83  ? -6.795  -18.415 35.328  1.00 29.94  ? 81  ARG A CA  1 
ATOM   642  C  C   . ARG A  1 83  ? -7.892  -19.187 36.066  1.00 27.31  ? 81  ARG A C   1 
ATOM   643  O  O   . ARG A  1 83  ? -8.479  -20.120 35.521  1.00 24.59  ? 81  ARG A O   1 
ATOM   644  C  CB  . ARG A  1 83  ? -7.145  -16.927 35.257  1.00 31.33  ? 81  ARG A CB  1 
ATOM   645  C  CG  . ARG A  1 83  ? -8.501  -16.629 34.653  1.00 30.71  ? 81  ARG A CG  1 
ATOM   646  C  CD  . ARG A  1 83  ? -8.501  -16.907 33.160  1.00 35.90  ? 81  ARG A CD  1 
ATOM   647  N  NE  . ARG A  1 83  ? -9.629  -16.273 32.482  1.00 36.75  ? 81  ARG A NE  1 
ATOM   648  C  CZ  . ARG A  1 83  ? -9.954  -16.491 31.212  1.00 38.61  ? 81  ARG A CZ  1 
ATOM   649  N  NH1 . ARG A  1 83  ? -9.224  -17.315 30.456  1.00 36.65  ? 81  ARG A NH1 1 
ATOM   650  N  NH2 . ARG A  1 83  ? -11.016 -15.887 30.694  1.00 38.41  ? 81  ARG A NH2 1 
ATOM   651  N  N   . THR A  1 84  ? -8.145  -18.793 37.310  1.00 25.85  ? 82  THR A N   1 
ATOM   652  C  CA  . THR A  1 84  ? -9.028  -19.528 38.195  1.00 23.59  ? 82  THR A CA  1 
ATOM   653  C  C   . THR A  1 84  ? -10.219 -18.652 38.558  1.00 20.91  ? 82  THR A C   1 
ATOM   654  O  O   . THR A  1 84  ? -10.044 -17.542 39.018  1.00 21.46  ? 82  THR A O   1 
ATOM   655  C  CB  . THR A  1 84  ? -8.251  -19.977 39.454  1.00 25.08  ? 82  THR A CB  1 
ATOM   656  O  OG1 . THR A  1 84  ? -7.195  -20.850 39.052  1.00 25.54  ? 82  THR A OG1 1 
ATOM   657  C  CG2 . THR A  1 84  ? -9.139  -20.726 40.434  1.00 25.82  ? 82  THR A CG2 1 
ATOM   658  N  N   . PHE A  1 85  ? -11.431 -19.170 38.384  1.00 19.01  ? 83  PHE A N   1 
ATOM   659  C  CA  . PHE A  1 85  ? -12.642 -18.537 38.955  1.00 17.63  ? 83  PHE A CA  1 
ATOM   660  C  C   . PHE A  1 85  ? -13.116 -19.235 40.235  1.00 17.94  ? 83  PHE A C   1 
ATOM   661  O  O   . PHE A  1 85  ? -13.460 -20.420 40.213  1.00 17.60  ? 83  PHE A O   1 
ATOM   662  C  CB  . PHE A  1 85  ? -13.770 -18.566 37.942  1.00 16.07  ? 83  PHE A CB  1 
ATOM   663  C  CG  . PHE A  1 85  ? -13.579 -17.629 36.788  1.00 15.76  ? 83  PHE A CG  1 
ATOM   664  C  CD1 . PHE A  1 85  ? -14.538 -17.547 35.798  1.00 15.11  ? 83  PHE A CD1 1 
ATOM   665  C  CD2 . PHE A  1 85  ? -12.436 -16.852 36.674  1.00 16.95  ? 83  PHE A CD2 1 
ATOM   666  C  CE1 . PHE A  1 85  ? -14.371 -16.703 34.716  1.00 15.03  ? 83  PHE A CE1 1 
ATOM   667  C  CE2 . PHE A  1 85  ? -12.262 -16.000 35.602  1.00 17.08  ? 83  PHE A CE2 1 
ATOM   668  C  CZ  . PHE A  1 85  ? -13.223 -15.937 34.611  1.00 16.12  ? 83  PHE A CZ  1 
ATOM   669  N  N   . VAL A  1 86  ? -13.097 -18.502 41.348  1.00 18.64  ? 84  VAL A N   1 
ATOM   670  C  CA  . VAL A  1 86  ? -13.500 -19.019 42.653  1.00 19.31  ? 84  VAL A CA  1 
ATOM   671  C  C   . VAL A  1 86  ? -14.948 -18.642 42.962  1.00 18.25  ? 84  VAL A C   1 
ATOM   672  O  O   . VAL A  1 86  ? -15.329 -17.490 42.837  1.00 17.99  ? 84  VAL A O   1 
ATOM   673  C  CB  . VAL A  1 86  ? -12.594 -18.459 43.776  1.00 21.97  ? 84  VAL A CB  1 
ATOM   674  C  CG1 . VAL A  1 86  ? -13.029 -18.974 45.145  1.00 22.51  ? 84  VAL A CG1 1 
ATOM   675  C  CG2 . VAL A  1 86  ? -11.137 -18.825 43.518  1.00 23.51  ? 84  VAL A CG2 1 
ATOM   676  N  N   . PRO A  1 87  ? -15.763 -19.616 43.385  1.00 18.48  ? 85  PRO A N   1 
ATOM   677  C  CA  . PRO A  1 87  ? -17.168 -19.333 43.668  1.00 17.95  ? 85  PRO A CA  1 
ATOM   678  C  C   . PRO A  1 87  ? -17.338 -18.172 44.637  1.00 18.22  ? 85  PRO A C   1 
ATOM   679  O  O   . PRO A  1 87  ? -16.666 -18.120 45.657  1.00 18.75  ? 85  PRO A O   1 
ATOM   680  C  CB  . PRO A  1 87  ? -17.677 -20.635 44.300  1.00 18.40  ? 85  PRO A CB  1 
ATOM   681  C  CG  . PRO A  1 87  ? -16.722 -21.686 43.847  1.00 19.12  ? 85  PRO A CG  1 
ATOM   682  C  CD  . PRO A  1 87  ? -15.395 -21.003 43.714  1.00 19.56  ? 85  PRO A CD  1 
ATOM   683  N  N   . GLY A  1 88  ? -18.248 -17.260 44.309  1.00 18.69  ? 86  GLY A N   1 
ATOM   684  C  CA  . GLY A  1 88  ? -18.533 -16.102 45.142  1.00 19.62  ? 86  GLY A CA  1 
ATOM   685  C  C   . GLY A  1 88  ? -19.865 -16.199 45.890  1.00 20.19  ? 86  GLY A C   1 
ATOM   686  O  O   . GLY A  1 88  ? -20.252 -17.281 46.359  1.00 19.78  ? 86  GLY A O   1 
ATOM   687  N  N   . SER A  1 89  ? -20.552 -15.059 45.990  1.00 19.27  ? 87  SER A N   1 
ATOM   688  C  CA  . SER A  1 89  ? -21.578 -14.827 47.000  1.00 20.36  ? 87  SER A CA  1 
ATOM   689  C  C   . SER A  1 89  ? -22.879 -15.551 46.697  1.00 21.47  ? 87  SER A C   1 
ATOM   690  O  O   . SER A  1 89  ? -23.741 -15.665 47.568  1.00 21.29  ? 87  SER A O   1 
ATOM   691  C  CB  . SER A  1 89  ? -21.872 -13.338 47.115  1.00 19.68  ? 87  SER A CB  1 
ATOM   692  O  OG  . SER A  1 89  ? -22.609 -12.899 45.983  1.00 18.12  ? 87  SER A OG  1 
ATOM   693  N  N   . GLN A  1 90  ? -23.030 -16.002 45.456  1.00 22.71  ? 88  GLN A N   1 
ATOM   694  C  CA  . GLN A  1 90  ? -24.195 -16.809 45.053  1.00 23.23  ? 88  GLN A CA  1 
ATOM   695  C  C   . GLN A  1 90  ? -23.861 -17.630 43.784  1.00 21.88  ? 88  GLN A C   1 
ATOM   696  O  O   . GLN A  1 90  ? -22.940 -17.287 43.032  1.00 19.73  ? 88  GLN A O   1 
ATOM   697  C  CB  . GLN A  1 90  ? -25.410 -15.894 44.798  1.00 23.69  ? 88  GLN A CB  1 
ATOM   698  C  CG  . GLN A  1 90  ? -25.112 -14.791 43.798  1.00 24.12  ? 88  GLN A CG  1 
ATOM   699  C  CD  . GLN A  1 90  ? -26.084 -13.616 43.833  1.00 24.41  ? 88  GLN A CD  1 
ATOM   700  O  OE1 . GLN A  1 90  ? -27.187 -13.697 44.367  1.00 23.25  ? 88  GLN A OE1 1 
ATOM   701  N  NE2 . GLN A  1 90  ? -25.667 -12.510 43.234  1.00 25.67  ? 88  GLN A NE2 1 
ATOM   702  N  N   . PRO A  1 91  ? -24.606 -18.721 43.537  1.00 21.62  ? 89  PRO A N   1 
ATOM   703  C  CA  . PRO A  1 91  ? -24.241 -19.608 42.428  1.00 20.51  ? 89  PRO A CA  1 
ATOM   704  C  C   . PRO A  1 91  ? -24.272 -18.885 41.091  1.00 18.66  ? 89  PRO A C   1 
ATOM   705  O  O   . PRO A  1 91  ? -25.223 -18.174 40.798  1.00 16.24  ? 89  PRO A O   1 
ATOM   706  C  CB  . PRO A  1 91  ? -25.305 -20.717 42.485  1.00 20.95  ? 89  PRO A CB  1 
ATOM   707  C  CG  . PRO A  1 91  ? -25.812 -20.688 43.887  1.00 21.77  ? 89  PRO A CG  1 
ATOM   708  C  CD  . PRO A  1 91  ? -25.768 -19.232 44.282  1.00 23.01  ? 89  PRO A CD  1 
ATOM   709  N  N   . GLY A  1 92  ? -23.205 -19.029 40.312  1.00 17.88  ? 90  GLY A N   1 
ATOM   710  C  CA  . GLY A  1 92  ? -23.074 -18.283 39.064  1.00 16.12  ? 90  GLY A CA  1 
ATOM   711  C  C   . GLY A  1 92  ? -22.224 -17.020 39.192  1.00 15.39  ? 90  GLY A C   1 
ATOM   712  O  O   . GLY A  1 92  ? -21.977 -16.334 38.206  1.00 13.42  ? 90  GLY A O   1 
ATOM   713  N  N   . GLU A  1 93  ? -21.791 -16.705 40.409  1.00 15.86  ? 91  GLU A N   1 
ATOM   714  C  CA  . GLU A  1 93  ? -20.913 -15.566 40.654  1.00 16.59  ? 91  GLU A CA  1 
ATOM   715  C  C   . GLU A  1 93  ? -19.534 -16.031 41.123  1.00 16.20  ? 91  GLU A C   1 
ATOM   716  O  O   . GLU A  1 93  ? -19.421 -17.019 41.833  1.00 18.57  ? 91  GLU A O   1 
ATOM   717  C  CB  . GLU A  1 93  ? -21.565 -14.629 41.685  1.00 18.76  ? 91  GLU A CB  1 
ATOM   718  C  CG  . GLU A  1 93  ? -20.935 -13.244 41.779  1.00 20.63  ? 91  GLU A CG  1 
ATOM   719  C  CD  . GLU A  1 93  ? -21.832 -12.207 42.452  1.00 22.66  ? 91  GLU A CD  1 
ATOM   720  O  OE1 . GLU A  1 93  ? -22.949 -11.926 41.951  1.00 27.33  ? 91  GLU A OE1 1 
ATOM   721  O  OE2 . GLU A  1 93  ? -21.419 -11.651 43.488  1.00 23.02  ? 91  GLU A OE2 1 
ATOM   722  N  N   . PHE A  1 94  ? -18.481 -15.374 40.655  1.00 16.19  ? 92  PHE A N   1 
ATOM   723  C  CA  . PHE A  1 94  ? -17.109 -15.808 40.922  1.00 16.52  ? 92  PHE A CA  1 
ATOM   724  C  C   . PHE A  1 94  ? -16.197 -14.604 41.128  1.00 17.58  ? 92  PHE A C   1 
ATOM   725  O  O   . PHE A  1 94  ? -16.454 -13.523 40.618  1.00 16.97  ? 92  PHE A O   1 
ATOM   726  C  CB  . PHE A  1 94  ? -16.587 -16.656 39.759  1.00 16.31  ? 92  PHE A CB  1 
ATOM   727  C  CG  . PHE A  1 94  ? -17.509 -17.777 39.381  1.00 15.79  ? 92  PHE A CG  1 
ATOM   728  C  CD1 . PHE A  1 94  ? -18.540 -17.572 38.491  1.00 15.66  ? 92  PHE A CD1 1 
ATOM   729  C  CD2 . PHE A  1 94  ? -17.360 -19.022 39.938  1.00 15.87  ? 92  PHE A CD2 1 
ATOM   730  C  CE1 . PHE A  1 94  ? -19.399 -18.603 38.153  1.00 15.71  ? 92  PHE A CE1 1 
ATOM   731  C  CE2 . PHE A  1 94  ? -18.216 -20.052 39.618  1.00 16.17  ? 92  PHE A CE2 1 
ATOM   732  C  CZ  . PHE A  1 94  ? -19.236 -19.849 38.720  1.00 15.37  ? 92  PHE A CZ  1 
ATOM   733  N  N   . THR A  1 95  ? -15.117 -14.805 41.866  1.00 19.48  ? 93  THR A N   1 
ATOM   734  C  CA  . THR A  1 95  ? -13.980 -13.895 41.849  1.00 20.62  ? 93  THR A CA  1 
ATOM   735  C  C   . THR A  1 95  ? -12.766 -14.591 41.251  1.00 20.79  ? 93  THR A C   1 
ATOM   736  O  O   . THR A  1 95  ? -12.737 -15.809 41.109  1.00 20.13  ? 93  THR A O   1 
ATOM   737  C  CB  . THR A  1 95  ? -13.648 -13.380 43.273  1.00 22.44  ? 93  THR A CB  1 
ATOM   738  O  OG1 . THR A  1 95  ? -13.406 -14.487 44.146  1.00 24.44  ? 93  THR A OG1 1 
ATOM   739  C  CG2 . THR A  1 95  ? -14.816 -12.588 43.826  1.00 23.37  ? 93  THR A CG2 1 
ATOM   740  N  N   . LEU A  1 96  ? -11.769 -13.801 40.876  1.00 22.31  ? 94  LEU A N   1 
ATOM   741  C  CA  . LEU A  1 96  ? -10.530 -14.336 40.332  1.00 22.56  ? 94  LEU A CA  1 
ATOM   742  C  C   . LEU A  1 96  ? -9.739  -14.891 41.493  1.00 23.85  ? 94  LEU A C   1 
ATOM   743  O  O   . LEU A  1 96  ? -9.612  -14.239 42.529  1.00 24.69  ? 94  LEU A O   1 
ATOM   744  C  CB  . LEU A  1 96  ? -9.734  -13.233 39.638  1.00 22.87  ? 94  LEU A CB  1 
ATOM   745  C  CG  . LEU A  1 96  ? -8.623  -13.632 38.681  1.00 23.18  ? 94  LEU A CG  1 
ATOM   746  C  CD1 . LEU A  1 96  ? -9.187  -14.422 37.518  1.00 22.06  ? 94  LEU A CD1 1 
ATOM   747  C  CD2 . LEU A  1 96  ? -7.914  -12.388 38.177  1.00 23.91  ? 94  LEU A CD2 1 
ATOM   748  N  N   . GLY A  1 97  ? -9.197  -16.092 41.327  1.00 24.36  ? 95  GLY A N   1 
ATOM   749  C  CA  . GLY A  1 97  ? -8.269  -16.636 42.310  1.00 26.29  ? 95  GLY A CA  1 
ATOM   750  C  C   . GLY A  1 97  ? -6.893  -16.011 42.219  1.00 28.63  ? 95  GLY A C   1 
ATOM   751  O  O   . GLY A  1 97  ? -6.484  -15.546 41.160  1.00 28.84  ? 95  GLY A O   1 
ATOM   752  N  N   . ASN A  1 98  ? -6.171  -16.009 43.334  1.00 30.69  ? 96  ASN A N   1 
ATOM   753  C  CA  . ASN A  1 98  ? -4.790  -15.556 43.334  1.00 32.97  ? 96  ASN A CA  1 
ATOM   754  C  C   . ASN A  1 98  ? -4.642  -14.107 42.831  1.00 32.79  ? 96  ASN A C   1 
ATOM   755  O  O   . ASN A  1 98  ? -3.689  -13.764 42.125  1.00 34.22  ? 96  ASN A O   1 
ATOM   756  C  CB  . ASN A  1 98  ? -3.939  -16.510 42.480  1.00 33.63  ? 96  ASN A CB  1 
ATOM   757  C  CG  . ASN A  1 98  ? -2.542  -16.643 43.000  1.00 36.86  ? 96  ASN A CG  1 
ATOM   758  O  OD1 . ASN A  1 98  ? -2.120  -15.906 43.889  1.00 39.43  ? 96  ASN A OD1 1 
ATOM   759  N  ND2 . ASN A  1 98  ? -1.804  -17.579 42.433  1.00 39.11  ? 96  ASN A ND2 1 
ATOM   760  N  N   . ILE A  1 99  ? -5.560  -13.248 43.245  1.00 31.74  ? 97  ILE A N   1 
ATOM   761  C  CA  . ILE A  1 99  ? -5.572  -11.872 42.782  1.00 32.09  ? 97  ILE A CA  1 
ATOM   762  C  C   . ILE A  1 99  ? -4.273  -11.123 43.044  1.00 35.21  ? 97  ILE A C   1 
ATOM   763  O  O   . ILE A  1 99  ? -3.907  -10.235 42.276  1.00 36.37  ? 97  ILE A O   1 
ATOM   764  C  CB  . ILE A  1 99  ? -6.720  -11.068 43.407  1.00 31.62  ? 97  ILE A CB  1 
ATOM   765  C  CG1 . ILE A  1 99  ? -7.905  -11.059 42.453  1.00 30.68  ? 97  ILE A CG1 1 
ATOM   766  C  CG2 . ILE A  1 99  ? -6.279  -9.641  43.681  1.00 33.15  ? 97  ILE A CG2 1 
ATOM   767  C  CD1 . ILE A  1 99  ? -9.073  -10.246 42.946  1.00 30.41  ? 97  ILE A CD1 1 
ATOM   768  N  N   . LYS A  1 100 ? -3.576  -11.474 44.120  1.00 36.89  ? 98  LYS A N   1 
ATOM   769  C  CA  . LYS A  1 100 ? -2.353  -10.773 44.491  1.00 39.37  ? 98  LYS A CA  1 
ATOM   770  C  C   . LYS A  1 100 ? -1.260  -10.939 43.438  1.00 40.32  ? 98  LYS A C   1 
ATOM   771  O  O   . LYS A  1 100 ? -0.311  -10.151 43.383  1.00 42.53  ? 98  LYS A O   1 
ATOM   772  C  CB  . LYS A  1 100 ? -1.829  -11.275 45.848  1.00 41.73  ? 98  LYS A CB  1 
ATOM   773  N  N   . SER A  1 101 ? -1.363  -11.990 42.636  1.00 38.63  ? 99  SER A N   1 
ATOM   774  C  CA  . SER A  1 101 ? -0.303  -12.316 41.693  1.00 39.77  ? 99  SER A CA  1 
ATOM   775  C  C   . SER A  1 101 ? -0.443  -11.507 40.400  1.00 39.51  ? 99  SER A C   1 
ATOM   776  O  O   . SER A  1 101 ? 0.399   -11.603 39.514  1.00 40.20  ? 99  SER A O   1 
ATOM   777  C  CB  . SER A  1 101 ? -0.315  -13.815 41.376  1.00 38.28  ? 99  SER A CB  1 
ATOM   778  O  OG  . SER A  1 101 ? -1.343  -14.126 40.456  1.00 35.94  ? 99  SER A OG  1 
ATOM   779  N  N   . TYR A  1 102 ? -1.523  -10.740 40.278  1.00 38.46  ? 100 TYR A N   1 
ATOM   780  C  CA  . TYR A  1 102 ? -1.690  -9.832  39.143  1.00 38.78  ? 100 TYR A CA  1 
ATOM   781  C  C   . TYR A  1 102 ? -1.447  -8.391  39.572  1.00 39.98  ? 100 TYR A C   1 
ATOM   782  O  O   . TYR A  1 102 ? -2.254  -7.807  40.292  1.00 39.41  ? 100 TYR A O   1 
ATOM   783  C  CB  . TYR A  1 102 ? -3.089  -9.948  38.556  1.00 35.63  ? 100 TYR A CB  1 
ATOM   784  C  CG  . TYR A  1 102 ? -3.487  -11.341 38.183  1.00 34.79  ? 100 TYR A CG  1 
ATOM   785  C  CD1 . TYR A  1 102 ? -4.214  -12.130 39.064  1.00 34.07  ? 100 TYR A CD1 1 
ATOM   786  C  CD2 . TYR A  1 102 ? -3.165  -11.870 36.940  1.00 35.44  ? 100 TYR A CD2 1 
ATOM   787  C  CE1 . TYR A  1 102 ? -4.605  -13.411 38.719  1.00 33.05  ? 100 TYR A CE1 1 
ATOM   788  C  CE2 . TYR A  1 102 ? -3.550  -13.153 36.587  1.00 34.24  ? 100 TYR A CE2 1 
ATOM   789  C  CZ  . TYR A  1 102 ? -4.275  -13.920 37.482  1.00 33.17  ? 100 TYR A CZ  1 
ATOM   790  O  OH  . TYR A  1 102 ? -4.681  -15.196 37.135  1.00 30.33  ? 100 TYR A OH  1 
ATOM   791  N  N   . PRO A  1 103 ? -0.319  -7.819  39.151  1.00 42.34  ? 101 PRO A N   1 
ATOM   792  C  CA  . PRO A  1 103 ? 0.046   -6.509  39.683  1.00 44.27  ? 101 PRO A CA  1 
ATOM   793  C  C   . PRO A  1 103 ? -0.979  -5.454  39.272  1.00 42.80  ? 101 PRO A C   1 
ATOM   794  O  O   . PRO A  1 103 ? -1.446  -5.458  38.132  1.00 40.64  ? 101 PRO A O   1 
ATOM   795  C  CB  . PRO A  1 103 ? 1.418   -6.235  39.047  1.00 46.42  ? 101 PRO A CB  1 
ATOM   796  C  CG  . PRO A  1 103 ? 1.911   -7.564  38.565  1.00 46.33  ? 101 PRO A CG  1 
ATOM   797  C  CD  . PRO A  1 103 ? 0.676   -8.336  38.199  1.00 43.58  ? 101 PRO A CD  1 
ATOM   798  N  N   . GLY A  1 104 ? -1.342  -4.582  40.208  1.00 43.65  ? 102 GLY A N   1 
ATOM   799  C  CA  . GLY A  1 104 ? -2.298  -3.506  39.938  1.00 42.82  ? 102 GLY A CA  1 
ATOM   800  C  C   . GLY A  1 104 ? -3.756  -3.884  40.155  1.00 40.36  ? 102 GLY A C   1 
ATOM   801  O  O   . GLY A  1 104 ? -4.626  -3.017  40.228  1.00 40.05  ? 102 GLY A O   1 
ATOM   802  N  N   . LEU A  1 105 ? -4.030  -5.181  40.250  1.00 37.64  ? 103 LEU A N   1 
ATOM   803  C  CA  . LEU A  1 105 ? -5.398  -5.670  40.272  1.00 33.89  ? 103 LEU A CA  1 
ATOM   804  C  C   . LEU A  1 105 ? -5.938  -5.720  41.702  1.00 33.64  ? 103 LEU A C   1 
ATOM   805  O  O   . LEU A  1 105 ? -5.343  -6.349  42.571  1.00 36.06  ? 103 LEU A O   1 
ATOM   806  C  CB  . LEU A  1 105 ? -5.451  -7.049  39.641  1.00 32.33  ? 103 LEU A CB  1 
ATOM   807  C  CG  . LEU A  1 105 ? -6.844  -7.654  39.494  1.00 29.77  ? 103 LEU A CG  1 
ATOM   808  C  CD1 . LEU A  1 105 ? -7.724  -6.780  38.613  1.00 28.30  ? 103 LEU A CD1 1 
ATOM   809  C  CD2 . LEU A  1 105 ? -6.750  -9.051  38.913  1.00 28.77  ? 103 LEU A CD2 1 
ATOM   810  N  N   . THR A  1 106 ? -7.057  -5.049  41.952  1.00 31.70  ? 104 THR A N   1 
ATOM   811  C  CA  . THR A  1 106 ? -7.611  -4.987  43.308  1.00 31.33  ? 104 THR A CA  1 
ATOM   812  C  C   . THR A  1 106 ? -8.955  -5.707  43.461  1.00 29.05  ? 104 THR A C   1 
ATOM   813  O  O   . THR A  1 106 ? -9.273  -6.196  44.540  1.00 29.14  ? 104 THR A O   1 
ATOM   814  C  CB  . THR A  1 106 ? -7.728  -3.534  43.842  1.00 31.93  ? 104 THR A CB  1 
ATOM   815  O  OG1 . THR A  1 106 ? -8.493  -2.734  42.943  1.00 30.03  ? 104 THR A OG1 1 
ATOM   816  C  CG2 . THR A  1 106 ? -6.347  -2.908  44.011  1.00 34.62  ? 104 THR A CG2 1 
ATOM   817  N  N   . SER A  1 107 ? -9.736  -5.796  42.392  1.00 27.23  ? 105 SER A N   1 
ATOM   818  C  CA  . SER A  1 107 ? -10.946 -6.602  42.436  1.00 24.65  ? 105 SER A CA  1 
ATOM   819  C  C   . SER A  1 107 ? -11.335 -7.141  41.063  1.00 23.55  ? 105 SER A C   1 
ATOM   820  O  O   . SER A  1 107 ? -10.959 -6.587  40.027  1.00 23.17  ? 105 SER A O   1 
ATOM   821  C  CB  . SER A  1 107 ? -12.098 -5.809  43.044  1.00 24.05  ? 105 SER A CB  1 
ATOM   822  O  OG  . SER A  1 107 ? -12.466 -4.727  42.219  1.00 24.79  ? 105 SER A OG  1 
ATOM   823  N  N   . TYR A  1 108 ? -12.091 -8.234  41.068  1.00 22.19  ? 106 TYR A N   1 
ATOM   824  C  CA  . TYR A  1 108 ? -12.427 -8.920  39.840  1.00 21.38  ? 106 TYR A CA  1 
ATOM   825  C  C   . TYR A  1 108 ? -13.640 -9.803  40.050  1.00 20.62  ? 106 TYR A C   1 
ATOM   826  O  O   . TYR A  1 108 ? -13.576 -10.802 40.760  1.00 20.87  ? 106 TYR A O   1 
ATOM   827  C  CB  . TYR A  1 108 ? -11.261 -9.786  39.378  1.00 22.31  ? 106 TYR A CB  1 
ATOM   828  C  CG  . TYR A  1 108 ? -11.380 -10.221 37.942  1.00 21.77  ? 106 TYR A CG  1 
ATOM   829  C  CD1 . TYR A  1 108 ? -12.205 -11.279 37.581  1.00 19.83  ? 106 TYR A CD1 1 
ATOM   830  C  CD2 . TYR A  1 108 ? -10.692 -9.563  36.945  1.00 22.80  ? 106 TYR A CD2 1 
ATOM   831  C  CE1 . TYR A  1 108 ? -12.326 -11.674 36.276  1.00 18.97  ? 106 TYR A CE1 1 
ATOM   832  C  CE2 . TYR A  1 108 ? -10.811 -9.954  35.630  1.00 22.26  ? 106 TYR A CE2 1 
ATOM   833  C  CZ  . TYR A  1 108 ? -11.631 -11.009 35.302  1.00 21.03  ? 106 TYR A CZ  1 
ATOM   834  O  OH  . TYR A  1 108 ? -11.759 -11.375 33.976  1.00 20.74  ? 106 TYR A OH  1 
ATOM   835  N  N   . LEU A  1 109 ? -14.750 -9.433  39.424  1.00 19.95  ? 107 LEU A N   1 
ATOM   836  C  CA  . LEU A  1 109 ? -16.019 -10.106 39.656  1.00 18.49  ? 107 LEU A CA  1 
ATOM   837  C  C   . LEU A  1 109 ? -16.558 -10.674 38.362  1.00 16.26  ? 107 LEU A C   1 
ATOM   838  O  O   . LEU A  1 109 ? -16.558 -9.997  37.336  1.00 15.60  ? 107 LEU A O   1 
ATOM   839  C  CB  . LEU A  1 109 ? -17.035 -9.133  40.254  1.00 18.74  ? 107 LEU A CB  1 
ATOM   840  C  CG  . LEU A  1 109 ? -18.431 -9.727  40.456  1.00 18.93  ? 107 LEU A CG  1 
ATOM   841  C  CD1 . LEU A  1 109 ? -18.430 -10.681 41.635  1.00 19.07  ? 107 LEU A CD1 1 
ATOM   842  C  CD2 . LEU A  1 109 ? -19.448 -8.629  40.680  1.00 21.28  ? 107 LEU A CD2 1 
ATOM   843  N  N   . VAL A  1 110 ? -17.039 -11.909 38.431  1.00 15.53  ? 108 VAL A N   1 
ATOM   844  C  CA  . VAL A  1 110 ? -17.700 -12.561 37.309  1.00 15.17  ? 108 VAL A CA  1 
ATOM   845  C  C   . VAL A  1 110 ? -19.132 -12.918 37.700  1.00 15.58  ? 108 VAL A C   1 
ATOM   846  O  O   . VAL A  1 110 ? -19.370 -13.468 38.771  1.00 15.66  ? 108 VAL A O   1 
ATOM   847  C  CB  . VAL A  1 110 ? -16.990 -13.874 36.942  1.00 14.83  ? 108 VAL A CB  1 
ATOM   848  C  CG1 . VAL A  1 110 ? -17.661 -14.545 35.755  1.00 13.42  ? 108 VAL A CG1 1 
ATOM   849  C  CG2 . VAL A  1 110 ? -15.520 -13.617 36.659  1.00 15.70  ? 108 VAL A CG2 1 
ATOM   850  N  N   . ARG A  1 111 ? -20.088 -12.592 36.838  1.00 15.84  ? 109 ARG A N   1 
ATOM   851  C  CA  . ARG A  1 111 ? -21.459 -13.003 37.066  1.00 15.90  ? 109 ARG A CA  1 
ATOM   852  C  C   . ARG A  1 111 ? -22.093 -13.544 35.807  1.00 14.80  ? 109 ARG A C   1 
ATOM   853  O  O   . ARG A  1 111 ? -22.186 -12.845 34.808  1.00 15.75  ? 109 ARG A O   1 
ATOM   854  C  CB  . ARG A  1 111 ? -22.283 -11.844 37.593  1.00 17.97  ? 109 ARG A CB  1 
ATOM   855  C  CG  . ARG A  1 111 ? -23.756 -12.193 37.747  1.00 21.86  ? 109 ARG A CG  1 
ATOM   856  C  CD  . ARG A  1 111 ? -24.536 -11.025 38.321  1.00 24.96  ? 109 ARG A CD  1 
ATOM   857  N  NE  . ARG A  1 111 ? -24.193 -10.792 39.726  1.00 22.81  ? 109 ARG A NE  1 
ATOM   858  C  CZ  . ARG A  1 111 ? -24.690 -9.795  40.456  1.00 20.92  ? 109 ARG A CZ  1 
ATOM   859  N  NH1 . ARG A  1 111 ? -24.322 -9.664  41.717  1.00 19.65  ? 109 ARG A NH1 1 
ATOM   860  N  NH2 . ARG A  1 111 ? -25.565 -8.950  39.927  1.00 18.69  ? 109 ARG A NH2 1 
ATOM   861  N  N   . VAL A  1 112 ? -22.526 -14.794 35.853  1.00 14.08  ? 110 VAL A N   1 
ATOM   862  C  CA  . VAL A  1 112 ? -23.243 -15.381 34.729  1.00 13.92  ? 110 VAL A CA  1 
ATOM   863  C  C   . VAL A  1 112 ? -24.670 -14.844 34.710  1.00 14.09  ? 110 VAL A C   1 
ATOM   864  O  O   . VAL A  1 112 ? -25.456 -15.096 35.621  1.00 14.50  ? 110 VAL A O   1 
ATOM   865  C  CB  . VAL A  1 112 ? -23.285 -16.914 34.810  1.00 13.22  ? 110 VAL A CB  1 
ATOM   866  C  CG1 . VAL A  1 112 ? -24.064 -17.485 33.643  1.00 13.93  ? 110 VAL A CG1 1 
ATOM   867  C  CG2 . VAL A  1 112 ? -21.876 -17.477 34.840  1.00 13.22  ? 110 VAL A CG2 1 
ATOM   868  N  N   . VAL A  1 113 ? -24.987 -14.095 33.664  1.00 14.11  ? 111 VAL A N   1 
ATOM   869  C  CA  . VAL A  1 113 ? -26.243 -13.386 33.563  1.00 14.56  ? 111 VAL A CA  1 
ATOM   870  C  C   . VAL A  1 113 ? -27.357 -14.311 33.064  1.00 15.70  ? 111 VAL A C   1 
ATOM   871  O  O   . VAL A  1 113 ? -28.454 -14.305 33.597  1.00 18.10  ? 111 VAL A O   1 
ATOM   872  C  CB  . VAL A  1 113 ? -26.111 -12.198 32.598  1.00 15.14  ? 111 VAL A CB  1 
ATOM   873  C  CG1 . VAL A  1 113 ? -27.460 -11.523 32.411  1.00 17.33  ? 111 VAL A CG1 1 
ATOM   874  C  CG2 . VAL A  1 113 ? -25.075 -11.206 33.100  1.00 14.76  ? 111 VAL A CG2 1 
ATOM   875  N  N   . SER A  1 114 ? -27.090 -15.067 32.006  1.00 15.68  ? 112 SER A N   1 
ATOM   876  C  CA  . SER A  1 114 ? -28.040 -16.065 31.517  1.00 15.81  ? 112 SER A CA  1 
ATOM   877  C  C   . SER A  1 114 ? -27.362 -17.090 30.624  1.00 15.80  ? 112 SER A C   1 
ATOM   878  O  O   . SER A  1 114 ? -26.397 -16.773 29.934  1.00 15.67  ? 112 SER A O   1 
ATOM   879  C  CB  . SER A  1 114 ? -29.180 -15.407 30.747  1.00 17.08  ? 112 SER A CB  1 
ATOM   880  O  OG  . SER A  1 114 ? -28.741 -15.033 29.461  1.00 20.52  ? 112 SER A OG  1 
ATOM   881  N  N   . THR A  1 115 ? -27.899 -18.303 30.617  1.00 14.96  ? 113 THR A N   1 
ATOM   882  C  CA  . THR A  1 115 ? -27.427 -19.343 29.739  1.00 16.09  ? 113 THR A CA  1 
ATOM   883  C  C   . THR A  1 115 ? -28.453 -20.471 29.622  1.00 16.00  ? 113 THR A C   1 
ATOM   884  O  O   . THR A  1 115 ? -29.291 -20.658 30.503  1.00 16.35  ? 113 THR A O   1 
ATOM   885  C  CB  . THR A  1 115 ? -26.103 -19.931 30.251  1.00 17.57  ? 113 THR A CB  1 
ATOM   886  O  OG1 . THR A  1 115 ? -25.596 -20.887 29.314  1.00 15.25  ? 113 THR A OG1 1 
ATOM   887  C  CG2 . THR A  1 115 ? -26.306 -20.599 31.610  1.00 17.78  ? 113 THR A CG2 1 
ATOM   888  N  N   . ASN A  1 116 ? -28.397 -21.200 28.514  1.00 15.81  ? 114 ASN A N   1 
ATOM   889  C  CA  . ASN A  1 116 ? -29.112 -22.460 28.403  1.00 17.14  ? 114 ASN A CA  1 
ATOM   890  C  C   . ASN A  1 116 ? -28.152 -23.627 28.260  1.00 17.71  ? 114 ASN A C   1 
ATOM   891  O  O   . ASN A  1 116 ? -28.564 -24.749 27.970  1.00 20.57  ? 114 ASN A O   1 
ATOM   892  C  CB  . ASN A  1 116 ? -30.103 -22.417 27.239  1.00 17.85  ? 114 ASN A CB  1 
ATOM   893  C  CG  . ASN A  1 116 ? -29.428 -22.485 25.876  1.00 18.45  ? 114 ASN A CG  1 
ATOM   894  O  OD1 . ASN A  1 116 ? -28.200 -22.397 25.753  1.00 15.72  ? 114 ASN A OD1 1 
ATOM   895  N  ND2 . ASN A  1 116 ? -30.248 -22.659 24.832  1.00 18.63  ? 114 ASN A ND2 1 
ATOM   896  N  N   . TYR A  1 117 ? -26.872 -23.348 28.496  1.00 17.19  ? 115 TYR A N   1 
ATOM   897  C  CA  . TYR A  1 117 ? -25.852 -24.375 28.735  1.00 17.08  ? 115 TYR A CA  1 
ATOM   898  C  C   . TYR A  1 117 ? -25.375 -25.064 27.451  1.00 18.38  ? 115 TYR A C   1 
ATOM   899  O  O   . TYR A  1 117 ? -24.184 -25.328 27.299  1.00 20.12  ? 115 TYR A O   1 
ATOM   900  C  CB  . TYR A  1 117 ? -26.313 -25.413 29.788  1.00 17.96  ? 115 TYR A CB  1 
ATOM   901  C  CG  . TYR A  1 117 ? -26.619 -24.814 31.150  1.00 16.40  ? 115 TYR A CG  1 
ATOM   902  C  CD1 . TYR A  1 117 ? -25.594 -24.405 32.001  1.00 16.46  ? 115 TYR A CD1 1 
ATOM   903  C  CD2 . TYR A  1 117 ? -27.926 -24.607 31.561  1.00 17.26  ? 115 TYR A CD2 1 
ATOM   904  C  CE1 . TYR A  1 117 ? -25.863 -23.816 33.222  1.00 16.38  ? 115 TYR A CE1 1 
ATOM   905  C  CE2 . TYR A  1 117 ? -28.208 -24.033 32.789  1.00 16.36  ? 115 TYR A CE2 1 
ATOM   906  C  CZ  . TYR A  1 117 ? -27.171 -23.651 33.617  1.00 16.69  ? 115 TYR A CZ  1 
ATOM   907  O  OH  . TYR A  1 117 ? -27.436 -23.055 34.818  1.00 16.75  ? 115 TYR A OH  1 
ATOM   908  N  N   . ASN A  1 118 ? -26.284 -25.335 26.517  1.00 18.49  ? 116 ASN A N   1 
ATOM   909  C  CA  . ASN A  1 118 ? -25.929 -26.081 25.310  1.00 16.97  ? 116 ASN A CA  1 
ATOM   910  C  C   . ASN A  1 118 ? -25.915 -25.236 24.014  1.00 16.86  ? 116 ASN A C   1 
ATOM   911  O  O   . ASN A  1 118 ? -25.653 -25.764 22.934  1.00 16.19  ? 116 ASN A O   1 
ATOM   912  C  CB  . ASN A  1 118 ? -26.855 -27.283 25.156  1.00 17.31  ? 116 ASN A CB  1 
ATOM   913  C  CG  . ASN A  1 118 ? -28.306 -26.886 25.086  1.00 19.03  ? 116 ASN A CG  1 
ATOM   914  O  OD1 . ASN A  1 118 ? -28.643 -25.805 24.609  1.00 18.66  ? 116 ASN A OD1 1 
ATOM   915  N  ND2 . ASN A  1 118 ? -29.179 -27.748 25.585  1.00 20.89  ? 116 ASN A ND2 1 
ATOM   916  N  N   . GLN A  1 119 ? -26.132 -23.929 24.132  1.00 15.74  ? 117 GLN A N   1 
ATOM   917  C  CA  . GLN A  1 119 ? -26.077 -23.033 22.968  1.00 16.87  ? 117 GLN A CA  1 
ATOM   918  C  C   . GLN A  1 119 ? -25.440 -21.680 23.293  1.00 16.66  ? 117 GLN A C   1 
ATOM   919  O  O   . GLN A  1 119 ? -24.485 -21.283 22.637  1.00 15.62  ? 117 GLN A O   1 
ATOM   920  C  CB  . GLN A  1 119 ? -27.468 -22.792 22.393  1.00 17.94  ? 117 GLN A CB  1 
ATOM   921  C  CG  . GLN A  1 119 ? -28.043 -23.989 21.657  1.00 19.43  ? 117 GLN A CG  1 
ATOM   922  C  CD  . GLN A  1 119 ? -29.477 -23.769 21.237  1.00 19.60  ? 117 GLN A CD  1 
ATOM   923  O  OE1 . GLN A  1 119 ? -30.231 -23.086 21.922  1.00 22.94  ? 117 GLN A OE1 1 
ATOM   924  N  NE2 . GLN A  1 119 ? -29.854 -24.320 20.100  1.00 20.51  ? 117 GLN A NE2 1 
ATOM   925  N  N   . HIS A  1 120 ? -25.997 -20.955 24.270  1.00 15.50  ? 118 HIS A N   1 
ATOM   926  C  CA  A HIS A  1 120 ? -25.607 -19.563 24.481  0.50 14.59  ? 118 HIS A CA  1 
ATOM   927  C  CA  B HIS A  1 120 ? -25.649 -19.559 24.486  0.50 16.49  ? 118 HIS A CA  1 
ATOM   928  C  C   . HIS A  1 120 ? -25.401 -19.234 25.954  1.00 15.24  ? 118 HIS A C   1 
ATOM   929  O  O   . HIS A  1 120 ? -25.909 -19.924 26.843  1.00 15.30  ? 118 HIS A O   1 
ATOM   930  C  CB  A HIS A  1 120 ? -26.615 -18.593 23.846  0.50 14.15  ? 118 HIS A CB  1 
ATOM   931  C  CB  B HIS A  1 120 ? -26.787 -18.669 23.971  0.50 18.33  ? 118 HIS A CB  1 
ATOM   932  C  CG  A HIS A  1 120 ? -28.016 -18.767 24.342  0.50 13.51  ? 118 HIS A CG  1 
ATOM   933  C  CG  B HIS A  1 120 ? -27.629 -19.312 22.913  0.50 21.79  ? 118 HIS A CG  1 
ATOM   934  N  ND1 A HIS A  1 120 ? -28.462 -18.205 25.515  0.50 12.83  ? 118 HIS A ND1 1 
ATOM   935  N  ND1 B HIS A  1 120 ? -27.145 -19.612 21.659  0.50 23.69  ? 118 HIS A ND1 1 
ATOM   936  C  CD2 A HIS A  1 120 ? -29.068 -19.445 23.825  0.50 13.82  ? 118 HIS A CD2 1 
ATOM   937  C  CD2 B HIS A  1 120 ? -28.928 -19.701 22.916  0.50 23.51  ? 118 HIS A CD2 1 
ATOM   938  C  CE1 A HIS A  1 120 ? -29.727 -18.534 25.705  0.50 13.52  ? 118 HIS A CE1 1 
ATOM   939  C  CE1 B HIS A  1 120 ? -28.105 -20.164 20.936  0.50 25.03  ? 118 HIS A CE1 1 
ATOM   940  N  NE2 A HIS A  1 120 ? -30.117 -19.291 24.696  0.50 13.74  ? 118 HIS A NE2 1 
ATOM   941  N  NE2 B HIS A  1 120 ? -29.197 -20.231 21.677  0.50 24.98  ? 118 HIS A NE2 1 
ATOM   942  N  N   . ALA A  1 121 ? -24.645 -18.166 26.197  1.00 15.50  ? 119 ALA A N   1 
ATOM   943  C  CA  . ALA A  1 121 ? -24.506 -17.580 27.524  1.00 16.02  ? 119 ALA A CA  1 
ATOM   944  C  C   . ALA A  1 121 ? -24.127 -16.092 27.429  1.00 17.23  ? 119 ALA A C   1 
ATOM   945  O  O   . ALA A  1 121 ? -23.500 -15.666 26.456  1.00 15.00  ? 119 ALA A O   1 
ATOM   946  C  CB  . ALA A  1 121 ? -23.462 -18.334 28.335  1.00 15.76  ? 119 ALA A CB  1 
ATOM   947  N  N   . MET A  1 122 ? -24.528 -15.309 28.439  1.00 17.54  ? 120 MET A N   1 
ATOM   948  C  CA  . MET A  1 122 ? -23.997 -13.957 28.638  1.00 17.81  ? 120 MET A CA  1 
ATOM   949  C  C   . MET A  1 122 ? -23.388 -13.864 30.016  1.00 16.49  ? 120 MET A C   1 
ATOM   950  O  O   . MET A  1 122 ? -23.980 -14.316 30.987  1.00 15.48  ? 120 MET A O   1 
ATOM   951  C  CB  . MET A  1 122 ? -25.087 -12.893 28.551  1.00 20.01  ? 120 MET A CB  1 
ATOM   952  C  CG  . MET A  1 122 ? -25.672 -12.689 27.180  1.00 23.06  ? 120 MET A CG  1 
ATOM   953  S  SD  . MET A  1 122 ? -26.494 -11.086 27.087  1.00 28.34  ? 120 MET A SD  1 
ATOM   954  C  CE  . MET A  1 122 ? -27.835 -11.318 28.256  1.00 30.83  ? 120 MET A CE  1 
ATOM   955  N  N   . VAL A  1 123 ? -22.199 -13.283 30.082  1.00 15.77  ? 121 VAL A N   1 
ATOM   956  C  CA  . VAL A  1 123 ? -21.456 -13.211 31.312  1.00 15.18  ? 121 VAL A CA  1 
ATOM   957  C  C   . VAL A  1 123 ? -20.943 -11.796 31.517  1.00 14.77  ? 121 VAL A C   1 
ATOM   958  O  O   . VAL A  1 123 ? -20.409 -11.183 30.604  1.00 15.62  ? 121 VAL A O   1 
ATOM   959  C  CB  . VAL A  1 123 ? -20.256 -14.187 31.310  1.00 15.01  ? 121 VAL A CB  1 
ATOM   960  C  CG1 . VAL A  1 123 ? -19.574 -14.162 32.669  1.00 15.04  ? 121 VAL A CG1 1 
ATOM   961  C  CG2 . VAL A  1 123 ? -20.714 -15.601 30.966  1.00 13.39  ? 121 VAL A CG2 1 
ATOM   962  N  N   . PHE A  1 124 ? -21.102 -11.301 32.739  1.00 14.61  ? 122 PHE A N   1 
ATOM   963  C  CA  . PHE A  1 124 ? -20.700 -9.951  33.103  1.00 14.34  ? 122 PHE A CA  1 
ATOM   964  C  C   . PHE A  1 124 ? -19.408 -10.025 33.893  1.00 14.48  ? 122 PHE A C   1 
ATOM   965  O  O   . PHE A  1 124 ? -19.264 -10.881 34.767  1.00 15.23  ? 122 PHE A O   1 
ATOM   966  C  CB  . PHE A  1 124 ? -21.803 -9.296  33.941  1.00 14.36  ? 122 PHE A CB  1 
ATOM   967  C  CG  . PHE A  1 124 ? -21.419 -7.957  34.520  1.00 15.02  ? 122 PHE A CG  1 
ATOM   968  C  CD1 . PHE A  1 124 ? -20.861 -7.864  35.785  1.00 15.14  ? 122 PHE A CD1 1 
ATOM   969  C  CD2 . PHE A  1 124 ? -21.613 -6.791  33.797  1.00 14.82  ? 122 PHE A CD2 1 
ATOM   970  C  CE1 . PHE A  1 124 ? -20.501 -6.634  36.312  1.00 15.62  ? 122 PHE A CE1 1 
ATOM   971  C  CE2 . PHE A  1 124 ? -21.251 -5.569  34.313  1.00 15.22  ? 122 PHE A CE2 1 
ATOM   972  C  CZ  . PHE A  1 124 ? -20.697 -5.489  35.573  1.00 15.87  ? 122 PHE A CZ  1 
ATOM   973  N  N   . PHE A  1 125 ? -18.463 -9.150  33.562  1.00 14.80  ? 123 PHE A N   1 
ATOM   974  C  CA  . PHE A  1 125 ? -17.179 -9.075  34.255  1.00 15.10  ? 123 PHE A CA  1 
ATOM   975  C  C   . PHE A  1 125 ? -16.945 -7.653  34.718  1.00 15.83  ? 123 PHE A C   1 
ATOM   976  O  O   . PHE A  1 125 ? -17.201 -6.712  33.984  1.00 16.60  ? 123 PHE A O   1 
ATOM   977  C  CB  . PHE A  1 125 ? -16.021 -9.454  33.330  1.00 15.37  ? 123 PHE A CB  1 
ATOM   978  C  CG  . PHE A  1 125 ? -16.119 -10.829 32.756  1.00 14.95  ? 123 PHE A CG  1 
ATOM   979  C  CD1 . PHE A  1 125 ? -15.360 -11.867 33.263  1.00 15.20  ? 123 PHE A CD1 1 
ATOM   980  C  CD2 . PHE A  1 125 ? -16.957 -11.084 31.690  1.00 14.83  ? 123 PHE A CD2 1 
ATOM   981  C  CE1 . PHE A  1 125 ? -15.455 -13.150 32.737  1.00 14.92  ? 123 PHE A CE1 1 
ATOM   982  C  CE2 . PHE A  1 125 ? -17.046 -12.357 31.147  1.00 14.86  ? 123 PHE A CE2 1 
ATOM   983  C  CZ  . PHE A  1 125 ? -16.296 -13.394 31.669  1.00 14.69  ? 123 PHE A CZ  1 
ATOM   984  N  N   . LYS A  1 126 ? -16.435 -7.497  35.929  1.00 16.78  ? 124 LYS A N   1 
ATOM   985  C  CA  . LYS A  1 126 ? -16.047 -6.186  36.429  1.00 17.85  ? 124 LYS A CA  1 
ATOM   986  C  C   . LYS A  1 126 ? -14.727 -6.299  37.161  1.00 18.53  ? 124 LYS A C   1 
ATOM   987  O  O   . LYS A  1 126 ? -14.529 -7.194  37.970  1.00 17.96  ? 124 LYS A O   1 
ATOM   988  C  CB  . LYS A  1 126 ? -17.111 -5.633  37.378  1.00 18.30  ? 124 LYS A CB  1 
ATOM   989  C  CG  . LYS A  1 126 ? -16.713 -4.317  38.029  1.00 21.02  ? 124 LYS A CG  1 
ATOM   990  C  CD  . LYS A  1 126 ? -17.897 -3.624  38.698  1.00 22.02  ? 124 LYS A CD  1 
ATOM   991  C  CE  . LYS A  1 126 ? -18.046 -4.041  40.154  1.00 22.32  ? 124 LYS A CE  1 
ATOM   992  N  NZ  . LYS A  1 126 ? -16.899 -3.582  40.992  1.00 24.51  ? 124 LYS A NZ  1 
ATOM   993  N  N   . LYS A  1 127 ? -13.811 -5.399  36.862  1.00 20.05  ? 125 LYS A N   1 
ATOM   994  C  CA  . LYS A  1 127 ? -12.498 -5.455  37.454  1.00 22.01  ? 125 LYS A CA  1 
ATOM   995  C  C   . LYS A  1 127 ? -12.015 -4.050  37.749  1.00 23.45  ? 125 LYS A C   1 
ATOM   996  O  O   . LYS A  1 127 ? -12.375 -3.105  37.048  1.00 23.10  ? 125 LYS A O   1 
ATOM   997  C  CB  . LYS A  1 127 ? -11.547 -6.225  36.538  1.00 23.42  ? 125 LYS A CB  1 
ATOM   998  C  CG  . LYS A  1 127 ? -10.536 -5.417  35.756  1.00 26.63  ? 125 LYS A CG  1 
ATOM   999  C  CD  . LYS A  1 127 ? -9.551  -6.358  35.080  1.00 29.42  ? 125 LYS A CD  1 
ATOM   1000 C  CE  . LYS A  1 127 ? -8.298  -5.662  34.597  1.00 35.00  ? 125 LYS A CE  1 
ATOM   1001 N  NZ  . LYS A  1 127 ? -7.238  -6.632  34.185  1.00 40.46  ? 125 LYS A NZ  1 
ATOM   1002 N  N   . VAL A  1 128 ? -11.266 -3.906  38.838  1.00 24.87  ? 126 VAL A N   1 
ATOM   1003 C  CA  . VAL A  1 128 ? -10.627 -2.642  39.166  1.00 27.29  ? 126 VAL A CA  1 
ATOM   1004 C  C   . VAL A  1 128 ? -9.128  -2.824  39.113  1.00 30.27  ? 126 VAL A C   1 
ATOM   1005 O  O   . VAL A  1 128 ? -8.573  -3.669  39.820  1.00 31.17  ? 126 VAL A O   1 
ATOM   1006 C  CB  . VAL A  1 128 ? -11.026 -2.142  40.570  1.00 27.21  ? 126 VAL A CB  1 
ATOM   1007 C  CG1 . VAL A  1 128 ? -10.305 -0.840  40.893  1.00 28.60  ? 126 VAL A CG1 1 
ATOM   1008 C  CG2 . VAL A  1 128 ? -12.532 -1.952  40.651  1.00 25.22  ? 126 VAL A CG2 1 
ATOM   1009 N  N   . SER A  1 129 ? -8.480  -2.037  38.264  1.00 33.92  ? 127 SER A N   1 
ATOM   1010 C  CA  . SER A  1 129 ? -7.046  -2.162  38.035  1.00 39.35  ? 127 SER A CA  1 
ATOM   1011 C  C   . SER A  1 129 ? -6.432  -0.791  37.891  1.00 42.83  ? 127 SER A C   1 
ATOM   1012 O  O   . SER A  1 129 ? -6.935  0.037   37.133  1.00 45.18  ? 127 SER A O   1 
ATOM   1013 C  CB  . SER A  1 129 ? -6.786  -2.953  36.759  1.00 39.78  ? 127 SER A CB  1 
ATOM   1014 O  OG  . SER A  1 129 ? -5.410  -2.956  36.435  1.00 43.37  ? 127 SER A OG  1 
ATOM   1015 N  N   . GLN A  1 130 ? -5.347  -0.552  38.620  1.00 48.19  ? 128 GLN A N   1 
ATOM   1016 C  CA  . GLN A  1 130 ? -4.792  0.776   38.745  1.00 51.77  ? 128 GLN A CA  1 
ATOM   1017 C  C   . GLN A  1 130 ? -5.895  1.741   39.130  1.00 51.52  ? 128 GLN A C   1 
ATOM   1018 O  O   . GLN A  1 130 ? -5.913  2.875   38.665  1.00 59.40  ? 128 GLN A O   1 
ATOM   1019 C  CB  . GLN A  1 130 ? -4.142  1.211   37.430  1.00 55.19  ? 128 GLN A CB  1 
ATOM   1020 C  CG  . GLN A  1 130 ? -2.677  0.817   37.310  1.00 60.86  ? 128 GLN A CG  1 
ATOM   1021 C  CD  . GLN A  1 130 ? -2.477  -0.508  36.599  1.00 61.93  ? 128 GLN A CD  1 
ATOM   1022 O  OE1 . GLN A  1 130 ? -3.408  -1.064  36.015  1.00 62.17  ? 128 GLN A OE1 1 
ATOM   1023 N  NE2 . GLN A  1 130 ? -1.246  -1.010  36.623  1.00 64.19  ? 128 GLN A NE2 1 
ATOM   1024 N  N   . ASN A  1 131 ? -6.825  1.280   39.963  1.00 49.72  ? 129 ASN A N   1 
ATOM   1025 C  CA  . ASN A  1 131 ? -7.882  2.139   40.473  1.00 46.79  ? 129 ASN A CA  1 
ATOM   1026 C  C   . ASN A  1 131 ? -8.928  2.538   39.426  1.00 43.74  ? 129 ASN A C   1 
ATOM   1027 O  O   . ASN A  1 131 ? -9.853  3.293   39.727  1.00 42.14  ? 129 ASN A O   1 
ATOM   1028 C  CB  . ASN A  1 131 ? -7.256  3.368   41.108  1.00 50.40  ? 129 ASN A CB  1 
ATOM   1029 C  CG  . ASN A  1 131 ? -6.277  3.009   42.213  1.00 53.95  ? 129 ASN A CG  1 
ATOM   1030 O  OD1 . ASN A  1 131 ? -5.109  3.403   42.187  1.00 57.02  ? 129 ASN A OD1 1 
ATOM   1031 N  ND2 . ASN A  1 131 ? -6.765  2.290   43.217  1.00 52.00  ? 129 ASN A ND2 1 
ATOM   1032 N  N   . ARG A  1 132 ? -8.796  2.001   38.212  1.00 40.49  ? 130 ARG A N   1 
ATOM   1033 C  CA  . ARG A  1 132 ? -9.783  2.216   37.145  1.00 38.13  ? 130 ARG A CA  1 
ATOM   1034 C  C   . ARG A  1 132 ? -10.758 1.045   37.034  1.00 34.31  ? 130 ARG A C   1 
ATOM   1035 O  O   . ARG A  1 132 ? -10.363 -0.112  37.110  1.00 32.39  ? 130 ARG A O   1 
ATOM   1036 C  CB  . ARG A  1 132 ? -9.081  2.418   35.794  1.00 40.30  ? 130 ARG A CB  1 
ATOM   1037 C  CG  . ARG A  1 132 ? -8.179  3.644   35.748  1.00 44.12  ? 130 ARG A CG  1 
ATOM   1038 C  CD  . ARG A  1 132 ? -7.387  3.739   34.448  1.00 47.58  ? 130 ARG A CD  1 
ATOM   1039 N  NE  . ARG A  1 132 ? -6.438  2.635   34.290  1.00 50.82  ? 130 ARG A NE  1 
ATOM   1040 C  CZ  . ARG A  1 132 ? -5.274  2.730   33.653  1.00 53.13  ? 130 ARG A CZ  1 
ATOM   1041 N  NH1 . ARG A  1 132 ? -4.900  3.881   33.107  1.00 57.04  ? 130 ARG A NH1 1 
ATOM   1042 N  NH2 . ARG A  1 132 ? -4.474  1.674   33.573  1.00 54.86  ? 130 ARG A NH2 1 
ATOM   1043 N  N   . GLU A  1 133 ? -12.036 1.361   36.858  1.00 31.11  ? 131 GLU A N   1 
ATOM   1044 C  CA  . GLU A  1 133 ? -13.081 0.364   36.916  1.00 27.49  ? 131 GLU A CA  1 
ATOM   1045 C  C   . GLU A  1 133 ? -13.517 -0.033  35.502  1.00 25.30  ? 131 GLU A C   1 
ATOM   1046 O  O   . GLU A  1 133 ? -14.167 0.732   34.805  1.00 24.82  ? 131 GLU A O   1 
ATOM   1047 C  CB  . GLU A  1 133 ? -14.263 0.885   37.743  1.00 27.55  ? 131 GLU A CB  1 
ATOM   1048 C  CG  . GLU A  1 133 ? -15.269 -0.187  38.134  1.00 28.47  ? 131 GLU A CG  1 
ATOM   1049 C  CD  . GLU A  1 133 ? -16.205 0.229   39.262  1.00 30.80  ? 131 GLU A CD  1 
ATOM   1050 O  OE1 . GLU A  1 133 ? -16.803 -0.678  39.889  1.00 36.52  ? 131 GLU A OE1 1 
ATOM   1051 O  OE2 . GLU A  1 133 ? -16.369 1.442   39.510  1.00 28.84  ? 131 GLU A OE2 1 
ATOM   1052 N  N   . TYR A  1 134 ? -13.172 -1.249  35.097  1.00 23.06  ? 132 TYR A N   1 
ATOM   1053 C  CA  . TYR A  1 134 ? -13.543 -1.760  33.785  1.00 21.32  ? 132 TYR A CA  1 
ATOM   1054 C  C   . TYR A  1 134 ? -14.689 -2.738  33.907  1.00 18.88  ? 132 TYR A C   1 
ATOM   1055 O  O   . TYR A  1 134 ? -14.779 -3.475  34.880  1.00 18.07  ? 132 TYR A O   1 
ATOM   1056 C  CB  . TYR A  1 134 ? -12.358 -2.478  33.145  1.00 21.73  ? 132 TYR A CB  1 
ATOM   1057 C  CG  . TYR A  1 134 ? -11.152 -1.602  32.954  1.00 23.30  ? 132 TYR A CG  1 
ATOM   1058 C  CD1 . TYR A  1 134 ? -10.133 -1.588  33.887  1.00 24.35  ? 132 TYR A CD1 1 
ATOM   1059 C  CD2 . TYR A  1 134 ? -11.024 -0.791  31.832  1.00 24.04  ? 132 TYR A CD2 1 
ATOM   1060 C  CE1 . TYR A  1 134 ? -9.011  -0.796  33.710  1.00 26.17  ? 132 TYR A CE1 1 
ATOM   1061 C  CE2 . TYR A  1 134 ? -9.909  0.012   31.653  1.00 25.91  ? 132 TYR A CE2 1 
ATOM   1062 C  CZ  . TYR A  1 134 ? -8.905  0.000   32.594  1.00 26.90  ? 132 TYR A CZ  1 
ATOM   1063 O  OH  . TYR A  1 134 ? -7.787  0.775   32.419  1.00 28.92  ? 132 TYR A OH  1 
ATOM   1064 N  N   . PHE A  1 135 ? -15.570 -2.749  32.917  1.00 17.92  ? 133 PHE A N   1 
ATOM   1065 C  CA  . PHE A  1 135 ? -16.556 -3.810  32.838  1.00 16.83  ? 133 PHE A CA  1 
ATOM   1066 C  C   . PHE A  1 135 ? -16.775 -4.241  31.408  1.00 17.06  ? 133 PHE A C   1 
ATOM   1067 O  O   . PHE A  1 135 ? -16.582 -3.467  30.473  1.00 17.66  ? 133 PHE A O   1 
ATOM   1068 C  CB  . PHE A  1 135 ? -17.880 -3.411  33.511  1.00 16.02  ? 133 PHE A CB  1 
ATOM   1069 C  CG  . PHE A  1 135 ? -18.690 -2.409  32.741  1.00 16.27  ? 133 PHE A CG  1 
ATOM   1070 C  CD1 . PHE A  1 135 ? -18.373 -1.062  32.788  1.00 17.71  ? 133 PHE A CD1 1 
ATOM   1071 C  CD2 . PHE A  1 135 ? -19.798 -2.809  32.012  1.00 15.37  ? 133 PHE A CD2 1 
ATOM   1072 C  CE1 . PHE A  1 135 ? -19.140 -0.128  32.103  1.00 18.37  ? 133 PHE A CE1 1 
ATOM   1073 C  CE2 . PHE A  1 135 ? -20.553 -1.895  31.311  1.00 16.15  ? 133 PHE A CE2 1 
ATOM   1074 C  CZ  . PHE A  1 135 ? -20.235 -0.548  31.360  1.00 17.59  ? 133 PHE A CZ  1 
ATOM   1075 N  N   . LYS A  1 136 ? -17.158 -5.499  31.246  1.00 17.21  ? 134 LYS A N   1 
ATOM   1076 C  CA  . LYS A  1 136 ? -17.499 -6.013  29.935  1.00 17.98  ? 134 LYS A CA  1 
ATOM   1077 C  C   . LYS A  1 136 ? -18.571 -7.070  30.059  1.00 16.58  ? 134 LYS A C   1 
ATOM   1078 O  O   . LYS A  1 136 ? -18.741 -7.681  31.119  1.00 16.12  ? 134 LYS A O   1 
ATOM   1079 C  CB  . LYS A  1 136 ? -16.260 -6.589  29.245  1.00 19.24  ? 134 LYS A CB  1 
ATOM   1080 C  CG  . LYS A  1 136 ? -15.765 -7.882  29.853  1.00 19.74  ? 134 LYS A CG  1 
ATOM   1081 C  CD  . LYS A  1 136 ? -14.715 -8.551  28.986  1.00 22.02  ? 134 LYS A CD  1 
ATOM   1082 C  CE  . LYS A  1 136 ? -14.300 -9.893  29.581  1.00 22.82  ? 134 LYS A CE  1 
ATOM   1083 N  NZ  . LYS A  1 136 ? -12.997 -10.389 29.062  1.00 24.21  ? 134 LYS A NZ  1 
ATOM   1084 N  N   . ILE A  1 137 ? -19.303 -7.257  28.973  1.00 16.24  ? 135 ILE A N   1 
ATOM   1085 C  CA  . ILE A  1 137 ? -20.238 -8.353  28.840  1.00 16.60  ? 135 ILE A CA  1 
ATOM   1086 C  C   . ILE A  1 137 ? -19.810 -9.209  27.669  1.00 17.79  ? 135 ILE A C   1 
ATOM   1087 O  O   . ILE A  1 137 ? -19.518 -8.702  26.590  1.00 17.34  ? 135 ILE A O   1 
ATOM   1088 C  CB  . ILE A  1 137 ? -21.663 -7.855  28.576  1.00 16.72  ? 135 ILE A CB  1 
ATOM   1089 C  CG1 . ILE A  1 137 ? -22.017 -6.754  29.575  1.00 18.53  ? 135 ILE A CG1 1 
ATOM   1090 C  CG2 . ILE A  1 137 ? -22.665 -8.992  28.705  1.00 15.97  ? 135 ILE A CG2 1 
ATOM   1091 C  CD1 . ILE A  1 137 ? -21.798 -5.364  29.026  1.00 19.34  ? 135 ILE A CD1 1 
ATOM   1092 N  N   . THR A  1 138 ? -19.764 -10.512 27.898  1.00 18.74  ? 136 THR A N   1 
ATOM   1093 C  CA  . THR A  1 138 ? -19.386 -11.448 26.861  1.00 21.66  ? 136 THR A CA  1 
ATOM   1094 C  C   . THR A  1 138 ? -20.620 -12.235 26.419  1.00 19.16  ? 136 THR A C   1 
ATOM   1095 O  O   . THR A  1 138 ? -21.391 -12.711 27.245  1.00 20.49  ? 136 THR A O   1 
ATOM   1096 C  CB  . THR A  1 138 ? -18.300 -12.411 27.378  1.00 25.60  ? 136 THR A CB  1 
ATOM   1097 O  OG1 . THR A  1 138 ? -17.087 -11.681 27.614  1.00 28.28  ? 136 THR A OG1 1 
ATOM   1098 C  CG2 . THR A  1 138 ? -18.015 -13.473 26.367  1.00 30.19  ? 136 THR A CG2 1 
ATOM   1099 N  N   . LEU A  1 139 ? -20.803 -12.366 25.113  1.00 17.67  ? 137 LEU A N   1 
ATOM   1100 C  CA  . LEU A  1 139 ? -21.798 -13.286 24.565  1.00 17.42  ? 137 LEU A CA  1 
ATOM   1101 C  C   . LEU A  1 139 ? -21.114 -14.572 24.094  1.00 16.31  ? 137 LEU A C   1 
ATOM   1102 O  O   . LEU A  1 139 ? -20.322 -14.543 23.166  1.00 15.76  ? 137 LEU A O   1 
ATOM   1103 C  CB  . LEU A  1 139 ? -22.557 -12.620 23.406  1.00 18.66  ? 137 LEU A CB  1 
ATOM   1104 C  CG  . LEU A  1 139 ? -23.623 -13.469 22.702  1.00 19.53  ? 137 LEU A CG  1 
ATOM   1105 C  CD1 . LEU A  1 139 ? -24.765 -13.827 23.641  1.00 18.91  ? 137 LEU A CD1 1 
ATOM   1106 C  CD2 . LEU A  1 139 ? -24.157 -12.769 21.452  1.00 20.36  ? 137 LEU A CD2 1 
ATOM   1107 N  N   . TYR A  1 140 ? -21.454 -15.689 24.735  1.00 16.03  ? 138 TYR A N   1 
ATOM   1108 C  CA  . TYR A  1 140 ? -20.856 -16.996 24.463  1.00 15.50  ? 138 TYR A CA  1 
ATOM   1109 C  C   . TYR A  1 140 ? -21.755 -17.816 23.542  1.00 16.91  ? 138 TYR A C   1 
ATOM   1110 O  O   . TYR A  1 140 ? -22.972 -17.886 23.746  1.00 15.63  ? 138 TYR A O   1 
ATOM   1111 C  CB  . TYR A  1 140 ? -20.694 -17.792 25.765  1.00 14.36  ? 138 TYR A CB  1 
ATOM   1112 C  CG  . TYR A  1 140 ? -19.561 -17.370 26.686  1.00 14.37  ? 138 TYR A CG  1 
ATOM   1113 C  CD1 . TYR A  1 140 ? -18.482 -16.643 26.219  1.00 15.07  ? 138 TYR A CD1 1 
ATOM   1114 C  CD2 . TYR A  1 140 ? -19.560 -17.742 28.023  1.00 14.30  ? 138 TYR A CD2 1 
ATOM   1115 C  CE1 . TYR A  1 140 ? -17.435 -16.296 27.065  1.00 16.25  ? 138 TYR A CE1 1 
ATOM   1116 C  CE2 . TYR A  1 140 ? -18.517 -17.410 28.872  1.00 14.43  ? 138 TYR A CE2 1 
ATOM   1117 C  CZ  . TYR A  1 140 ? -17.458 -16.686 28.395  1.00 15.34  ? 138 TYR A CZ  1 
ATOM   1118 O  OH  . TYR A  1 140 ? -16.420 -16.351 29.237  1.00 15.88  ? 138 TYR A OH  1 
ATOM   1119 N  N   . GLY A  1 141 ? -21.150 -18.490 22.563  1.00 16.91  ? 139 GLY A N   1 
ATOM   1120 C  CA  . GLY A  1 141 ? -21.837 -19.548 21.827  1.00 16.27  ? 139 GLY A CA  1 
ATOM   1121 C  C   . GLY A  1 141 ? -21.098 -20.874 21.940  1.00 15.82  ? 139 GLY A C   1 
ATOM   1122 O  O   . GLY A  1 141 ? -19.879 -20.904 22.046  1.00 14.42  ? 139 GLY A O   1 
ATOM   1123 N  N   . ARG A  1 142 ? -21.835 -21.980 21.933  1.00 16.38  ? 140 ARG A N   1 
ATOM   1124 C  CA  . ARG A  1 142 ? -21.207 -23.295 21.851  1.00 16.44  ? 140 ARG A CA  1 
ATOM   1125 C  C   . ARG A  1 142 ? -20.691 -23.512 20.435  1.00 18.04  ? 140 ARG A C   1 
ATOM   1126 O  O   . ARG A  1 142 ? -19.756 -24.273 20.239  1.00 16.89  ? 140 ARG A O   1 
ATOM   1127 C  CB  . ARG A  1 142 ? -22.182 -24.412 22.202  1.00 17.03  ? 140 ARG A CB  1 
ATOM   1128 C  CG  . ARG A  1 142 ? -22.526 -24.520 23.682  1.00 16.24  ? 140 ARG A CG  1 
ATOM   1129 C  CD  . ARG A  1 142 ? -21.303 -24.756 24.561  1.00 16.04  ? 140 ARG A CD  1 
ATOM   1130 N  NE  . ARG A  1 142 ? -21.705 -25.104 25.917  1.00 16.37  ? 140 ARG A NE  1 
ATOM   1131 C  CZ  . ARG A  1 142 ? -20.874 -25.367 26.919  1.00 16.65  ? 140 ARG A CZ  1 
ATOM   1132 N  NH1 . ARG A  1 142 ? -21.351 -25.688 28.117  1.00 16.00  ? 140 ARG A NH1 1 
ATOM   1133 N  NH2 . ARG A  1 142 ? -19.568 -25.281 26.739  1.00 19.00  ? 140 ARG A NH2 1 
ATOM   1134 N  N   . THR A  1 143 ? -21.290 -22.818 19.465  1.00 18.38  ? 141 THR A N   1 
ATOM   1135 C  CA  . THR A  1 143 ? -20.707 -22.669 18.139  1.00 20.12  ? 141 THR A CA  1 
ATOM   1136 C  C   . THR A  1 143 ? -20.360 -21.209 17.841  1.00 21.26  ? 141 THR A C   1 
ATOM   1137 O  O   . THR A  1 143 ? -20.636 -20.323 18.635  1.00 22.19  ? 141 THR A O   1 
ATOM   1138 C  CB  . THR A  1 143 ? -21.677 -23.153 17.048  1.00 21.79  ? 141 THR A CB  1 
ATOM   1139 O  OG1 . THR A  1 143 ? -22.746 -22.210 16.902  1.00 21.73  ? 141 THR A OG1 1 
ATOM   1140 C  CG2 . THR A  1 143 ? -22.255 -24.518 17.391  1.00 22.42  ? 141 THR A CG2 1 
ATOM   1141 N  N   . LYS A  1 144 ? -19.775 -20.971 16.676  1.00 22.88  ? 142 LYS A N   1 
ATOM   1142 C  CA  . LYS A  1 144 ? -19.259 -19.652 16.303  1.00 24.16  ? 142 LYS A CA  1 
ATOM   1143 C  C   . LYS A  1 144 ? -20.339 -18.715 15.783  1.00 25.02  ? 142 LYS A C   1 
ATOM   1144 O  O   . LYS A  1 144 ? -20.088 -17.534 15.567  1.00 25.23  ? 142 LYS A O   1 
ATOM   1145 C  CB  . LYS A  1 144 ? -18.202 -19.779 15.209  1.00 24.90  ? 142 LYS A CB  1 
ATOM   1146 C  CG  . LYS A  1 144 ? -16.993 -20.593 15.609  1.00 26.49  ? 142 LYS A CG  1 
ATOM   1147 C  CD  . LYS A  1 144 ? -16.041 -20.700 14.434  1.00 28.11  ? 142 LYS A CD  1 
ATOM   1148 C  CE  . LYS A  1 144 ? -15.024 -21.792 14.660  1.00 29.13  ? 142 LYS A CE  1 
ATOM   1149 N  NZ  . LYS A  1 144 ? -14.146 -21.926 13.470  1.00 31.94  ? 142 LYS A NZ  1 
ATOM   1150 N  N   . GLU A  1 145 ? -21.533 -19.239 15.575  1.00 28.70  ? 143 GLU A N   1 
ATOM   1151 C  CA  . GLU A  1 145 ? -22.619 -18.441 15.041  1.00 34.19  ? 143 GLU A CA  1 
ATOM   1152 C  C   . GLU A  1 145 ? -23.729 -18.347 16.074  1.00 31.70  ? 143 GLU A C   1 
ATOM   1153 O  O   . GLU A  1 145 ? -23.988 -19.291 16.813  1.00 28.12  ? 143 GLU A O   1 
ATOM   1154 C  CB  . GLU A  1 145 ? -23.164 -19.079 13.767  1.00 44.60  ? 143 GLU A CB  1 
ATOM   1155 C  CG  . GLU A  1 145 ? -22.112 -19.308 12.692  1.00 53.10  ? 143 GLU A CG  1 
ATOM   1156 C  CD  . GLU A  1 145 ? -21.894 -18.091 11.807  1.00 62.20  ? 143 GLU A CD  1 
ATOM   1157 O  OE1 . GLU A  1 145 ? -22.582 -17.063 12.011  1.00 63.14  ? 143 GLU A OE1 1 
ATOM   1158 O  OE2 . GLU A  1 145 ? -21.032 -18.164 10.903  1.00 58.82  ? 143 GLU A OE2 1 
ATOM   1159 N  N   . LEU A  1 146 ? -24.391 -17.205 16.126  1.00 33.85  ? 144 LEU A N   1 
ATOM   1160 C  CA  . LEU A  1 146 ? -25.664 -17.133 16.812  1.00 35.04  ? 144 LEU A CA  1 
ATOM   1161 C  C   . LEU A  1 146 ? -26.625 -16.299 15.988  1.00 31.24  ? 144 LEU A C   1 
ATOM   1162 O  O   . LEU A  1 146 ? -26.215 -15.566 15.097  1.00 30.32  ? 144 LEU A O   1 
ATOM   1163 C  CB  . LEU A  1 146 ? -25.511 -16.530 18.214  1.00 36.76  ? 144 LEU A CB  1 
ATOM   1164 C  CG  . LEU A  1 146 ? -24.739 -17.314 19.287  1.00 37.67  ? 144 LEU A CG  1 
ATOM   1165 C  CD1 . LEU A  1 146 ? -24.601 -16.444 20.534  1.00 36.88  ? 144 LEU A CD1 1 
ATOM   1166 C  CD2 . LEU A  1 146 ? -25.396 -18.644 19.646  1.00 35.25  ? 144 LEU A CD2 1 
ATOM   1167 N  N   . THR A  1 147 ? -27.906 -16.421 16.306  1.00 31.21  ? 145 THR A N   1 
ATOM   1168 C  CA  . THR A  1 147 ? -28.963 -15.761 15.547  1.00 32.53  ? 145 THR A CA  1 
ATOM   1169 C  C   . THR A  1 147 ? -28.913 -14.255 15.740  1.00 33.36  ? 145 THR A C   1 
ATOM   1170 O  O   . THR A  1 147 ? -28.436 -13.767 16.764  1.00 36.74  ? 145 THR A O   1 
ATOM   1171 C  CB  . THR A  1 147 ? -30.350 -16.262 15.988  1.00 32.42  ? 145 THR A CB  1 
ATOM   1172 O  OG1 . THR A  1 147 ? -30.533 -16.021 17.393  1.00 28.06  ? 145 THR A OG1 1 
ATOM   1173 C  CG2 . THR A  1 147 ? -30.488 -17.762 15.702  1.00 31.50  ? 145 THR A CG2 1 
ATOM   1174 N  N   . SER A  1 148 ? -29.413 -13.531 14.748  1.00 35.39  ? 146 SER A N   1 
ATOM   1175 C  CA  . SER A  1 148 ? -29.666 -12.094 14.863  1.00 37.10  ? 146 SER A CA  1 
ATOM   1176 C  C   . SER A  1 148 ? -30.439 -11.760 16.140  1.00 37.50  ? 146 SER A C   1 
ATOM   1177 O  O   . SER A  1 148 ? -30.148 -10.776 16.824  1.00 35.20  ? 146 SER A O   1 
ATOM   1178 C  CB  . SER A  1 148 ? -30.436 -11.612 13.635  1.00 37.55  ? 146 SER A CB  1 
ATOM   1179 O  OG  . SER A  1 148 ? -30.684 -10.219 13.691  1.00 44.08  ? 146 SER A OG  1 
ATOM   1180 N  N   . GLU A  1 149 ? -31.413 -12.598 16.466  1.00 39.34  ? 147 GLU A N   1 
ATOM   1181 C  CA  . GLU A  1 149 ? -32.247 -12.373 17.632  1.00 41.34  ? 147 GLU A CA  1 
ATOM   1182 C  C   . GLU A  1 149 ? -31.401 -12.334 18.904  1.00 34.38  ? 147 GLU A C   1 
ATOM   1183 O  O   . GLU A  1 149 ? -31.569 -11.452 19.744  1.00 35.47  ? 147 GLU A O   1 
ATOM   1184 C  CB  . GLU A  1 149 ? -33.312 -13.466 17.715  1.00 47.43  ? 147 GLU A CB  1 
ATOM   1185 C  CG  . GLU A  1 149 ? -34.342 -13.282 18.812  1.00 57.81  ? 147 GLU A CG  1 
ATOM   1186 C  CD  . GLU A  1 149 ? -35.520 -14.236 18.668  1.00 68.84  ? 147 GLU A CD  1 
ATOM   1187 O  OE1 . GLU A  1 149 ? -35.810 -14.676 17.532  1.00 66.72  ? 147 GLU A OE1 1 
ATOM   1188 O  OE2 . GLU A  1 149 ? -36.159 -14.546 19.696  1.00 69.88  ? 147 GLU A OE2 1 
ATOM   1189 N  N   . LEU A  1 150 ? -30.523 -13.312 19.066  1.00 30.17  ? 148 LEU A N   1 
ATOM   1190 C  CA  . LEU A  1 150 ? -29.709 -13.391 20.260  1.00 30.20  ? 148 LEU A CA  1 
ATOM   1191 C  C   . LEU A  1 150 ? -28.722 -12.231 20.310  1.00 29.02  ? 148 LEU A C   1 
ATOM   1192 O  O   . LEU A  1 150 ? -28.437 -11.682 21.372  1.00 27.52  ? 148 LEU A O   1 
ATOM   1193 C  CB  . LEU A  1 150 ? -28.972 -14.733 20.330  1.00 32.69  ? 148 LEU A CB  1 
ATOM   1194 C  CG  . LEU A  1 150 ? -29.845 -15.938 20.701  1.00 34.48  ? 148 LEU A CG  1 
ATOM   1195 C  CD1 . LEU A  1 150 ? -29.134 -17.245 20.380  1.00 36.36  ? 148 LEU A CD1 1 
ATOM   1196 C  CD2 . LEU A  1 150 ? -30.249 -15.899 22.174  1.00 33.88  ? 148 LEU A CD2 1 
ATOM   1197 N  N   . LYS A  1 151 ? -28.206 -11.848 19.156  1.00 29.12  ? 149 LYS A N   1 
ATOM   1198 C  CA  . LYS A  1 151 ? -27.255 -10.762 19.109  1.00 30.09  ? 149 LYS A CA  1 
ATOM   1199 C  C   . LYS A  1 151 ? -27.914 -9.409  19.380  1.00 27.01  ? 149 LYS A C   1 
ATOM   1200 O  O   . LYS A  1 151 ? -27.346 -8.582  20.080  1.00 25.16  ? 149 LYS A O   1 
ATOM   1201 C  CB  . LYS A  1 151 ? -26.515 -10.776 17.779  1.00 35.93  ? 149 LYS A CB  1 
ATOM   1202 C  CG  . LYS A  1 151 ? -25.618 -12.006 17.648  1.00 45.89  ? 149 LYS A CG  1 
ATOM   1203 C  CD  . LYS A  1 151 ? -24.670 -11.917 16.463  1.00 51.58  ? 149 LYS A CD  1 
ATOM   1204 C  CE  . LYS A  1 151 ? -25.381 -12.204 15.152  1.00 56.64  ? 149 LYS A CE  1 
ATOM   1205 N  NZ  . LYS A  1 151 ? -24.436 -12.658 14.095  1.00 59.56  ? 149 LYS A NZ  1 
ATOM   1206 N  N   . GLU A  1 152 ? -29.141 -9.223  18.909  1.00 24.76  ? 150 GLU A N   1 
ATOM   1207 C  CA  . GLU A  1 152 ? -29.944 -8.052  19.293  1.00 25.54  ? 150 GLU A CA  1 
ATOM   1208 C  C   . GLU A  1 152 ? -30.257 -8.008  20.792  1.00 24.17  ? 150 GLU A C   1 
ATOM   1209 O  O   . GLU A  1 152 ? -30.240 -6.945  21.411  1.00 23.26  ? 150 GLU A O   1 
ATOM   1210 C  CB  . GLU A  1 152 ? -31.251 -7.986  18.492  1.00 26.60  ? 150 GLU A CB  1 
ATOM   1211 C  CG  . GLU A  1 152 ? -31.069 -7.597  17.025  1.00 28.96  ? 150 GLU A CG  1 
ATOM   1212 C  CD  . GLU A  1 152 ? -30.327 -6.281  16.826  1.00 30.86  ? 150 GLU A CD  1 
ATOM   1213 O  OE1 . GLU A  1 152 ? -30.542 -5.314  17.590  1.00 30.96  ? 150 GLU A OE1 1 
ATOM   1214 O  OE2 . GLU A  1 152 ? -29.512 -6.222  15.886  1.00 32.53  ? 150 GLU A OE2 1 
ATOM   1215 N  N   . ASN A  1 153 ? -30.540 -9.161  21.378  1.00 23.31  ? 151 ASN A N   1 
ATOM   1216 C  CA  . ASN A  1 153 ? -30.779 -9.219  22.811  1.00 24.21  ? 151 ASN A CA  1 
ATOM   1217 C  C   . ASN A  1 153 ? -29.554 -8.799  23.610  1.00 20.41  ? 151 ASN A C   1 
ATOM   1218 O  O   . ASN A  1 153 ? -29.654 -8.147  24.642  1.00 20.86  ? 151 ASN A O   1 
ATOM   1219 C  CB  . ASN A  1 153 ? -31.202 -10.622 23.213  1.00 26.10  ? 151 ASN A CB  1 
ATOM   1220 C  CG  . ASN A  1 153 ? -31.689 -10.681 24.637  1.00 31.32  ? 151 ASN A CG  1 
ATOM   1221 O  OD1 . ASN A  1 153 ? -32.709 -10.075 24.979  1.00 40.78  ? 151 ASN A OD1 1 
ATOM   1222 N  ND2 . ASN A  1 153 ? -30.960 -11.396 25.486  1.00 33.30  ? 151 ASN A ND2 1 
ATOM   1223 N  N   . PHE A  1 154 ? -28.393 -9.182  23.113  1.00 18.51  ? 152 PHE A N   1 
ATOM   1224 C  CA  . PHE A  1 154 ? -27.131 -8.849  23.746  1.00 17.39  ? 152 PHE A CA  1 
ATOM   1225 C  C   . PHE A  1 154 ? -26.835 -7.352  23.616  1.00 17.41  ? 152 PHE A C   1 
ATOM   1226 O  O   . PHE A  1 154 ? -26.363 -6.726  24.554  1.00 16.43  ? 152 PHE A O   1 
ATOM   1227 C  CB  . PHE A  1 154 ? -26.030 -9.687  23.089  1.00 16.72  ? 152 PHE A CB  1 
ATOM   1228 C  CG  . PHE A  1 154 ? -24.638 -9.257  23.440  1.00 15.90  ? 152 PHE A CG  1 
ATOM   1229 C  CD1 . PHE A  1 154 ? -23.835 -8.636  22.488  1.00 16.66  ? 152 PHE A CD1 1 
ATOM   1230 C  CD2 . PHE A  1 154 ? -24.121 -9.489  24.699  1.00 14.62  ? 152 PHE A CD2 1 
ATOM   1231 C  CE1 . PHE A  1 154 ? -22.537 -8.259  22.787  1.00 16.21  ? 152 PHE A CE1 1 
ATOM   1232 C  CE2 . PHE A  1 154 ? -22.827 -9.108  25.009  1.00 14.68  ? 152 PHE A CE2 1 
ATOM   1233 C  CZ  . PHE A  1 154 ? -22.031 -8.499  24.046  1.00 15.77  ? 152 PHE A CZ  1 
ATOM   1234 N  N   . ILE A  1 155 ? -27.139 -6.784  22.454  1.00 18.73  ? 153 ILE A N   1 
ATOM   1235 C  CA  . ILE A  1 155 ? -27.026 -5.346  22.243  1.00 20.17  ? 153 ILE A CA  1 
ATOM   1236 C  C   . ILE A  1 155 ? -27.976 -4.580  23.163  1.00 22.05  ? 153 ILE A C   1 
ATOM   1237 O  O   . ILE A  1 155 ? -27.598 -3.586  23.789  1.00 22.49  ? 153 ILE A O   1 
ATOM   1238 C  CB  . ILE A  1 155 ? -27.333 -4.980  20.781  1.00 21.33  ? 153 ILE A CB  1 
ATOM   1239 C  CG1 . ILE A  1 155 ? -26.233 -5.520  19.863  1.00 21.44  ? 153 ILE A CG1 1 
ATOM   1240 C  CG2 . ILE A  1 155 ? -27.475 -3.475  20.615  1.00 21.99  ? 153 ILE A CG2 1 
ATOM   1241 C  CD1 . ILE A  1 155 ? -26.593 -5.522  18.392  1.00 22.79  ? 153 ILE A CD1 1 
ATOM   1242 N  N   . ARG A  1 156 ? -29.209 -5.063  23.264  1.00 23.53  ? 154 ARG A N   1 
ATOM   1243 C  CA  . ARG A  1 156 ? -30.191 -4.459  24.156  1.00 24.94  ? 154 ARG A CA  1 
ATOM   1244 C  C   . ARG A  1 156 ? -29.664 -4.441  25.591  1.00 22.11  ? 154 ARG A C   1 
ATOM   1245 O  O   . ARG A  1 156 ? -29.722 -3.416  26.269  1.00 22.90  ? 154 ARG A O   1 
ATOM   1246 C  CB  . ARG A  1 156 ? -31.503 -5.240  24.071  1.00 28.90  ? 154 ARG A CB  1 
ATOM   1247 C  CG  . ARG A  1 156 ? -32.680 -4.635  24.823  1.00 32.97  ? 154 ARG A CG  1 
ATOM   1248 C  CD  . ARG A  1 156 ? -34.003 -5.278  24.379  1.00 37.31  ? 154 ARG A CD  1 
ATOM   1249 N  NE  . ARG A  1 156 ? -33.998 -5.638  22.948  1.00 39.80  ? 154 ARG A NE  1 
ATOM   1250 C  CZ  . ARG A  1 156 ? -34.065 -6.884  22.466  1.00 39.32  ? 154 ARG A CZ  1 
ATOM   1251 N  NH1 . ARG A  1 156 ? -34.144 -7.924  23.286  1.00 42.02  ? 154 ARG A NH1 1 
ATOM   1252 N  NH2 . ARG A  1 156 ? -34.047 -7.095  21.153  1.00 36.38  ? 154 ARG A NH2 1 
ATOM   1253 N  N   . PHE A  1 157 ? -29.153 -5.577  26.054  1.00 19.27  ? 155 PHE A N   1 
ATOM   1254 C  CA  . PHE A  1 157 ? -28.675 -5.687  27.427  1.00 17.84  ? 155 PHE A CA  1 
ATOM   1255 C  C   . PHE A  1 157 ? -27.451 -4.799  27.669  1.00 17.92  ? 155 PHE A C   1 
ATOM   1256 O  O   . PHE A  1 157 ? -27.354 -4.098  28.681  1.00 16.55  ? 155 PHE A O   1 
ATOM   1257 C  CB  . PHE A  1 157 ? -28.348 -7.140  27.750  1.00 16.99  ? 155 PHE A CB  1 
ATOM   1258 C  CG  . PHE A  1 157 ? -27.797 -7.339  29.138  1.00 15.81  ? 155 PHE A CG  1 
ATOM   1259 C  CD1 . PHE A  1 157 ? -28.574 -7.057  30.253  1.00 15.86  ? 155 PHE A CD1 1 
ATOM   1260 C  CD2 . PHE A  1 157 ? -26.510 -7.793  29.320  1.00 14.49  ? 155 PHE A CD2 1 
ATOM   1261 C  CE1 . PHE A  1 157 ? -28.064 -7.219  31.522  1.00 15.23  ? 155 PHE A CE1 1 
ATOM   1262 C  CE2 . PHE A  1 157 ? -25.996 -7.964  30.579  1.00 14.36  ? 155 PHE A CE2 1 
ATOM   1263 C  CZ  . PHE A  1 157 ? -26.771 -7.677  31.685  1.00 15.03  ? 155 PHE A CZ  1 
ATOM   1264 N  N   . SER A  1 158 ? -26.553 -4.778  26.697  1.00 18.48  ? 156 SER A N   1 
ATOM   1265 C  CA  . SER A  1 158 ? -25.377 -3.927  26.780  1.00 19.97  ? 156 SER A CA  1 
ATOM   1266 C  C   . SER A  1 158 ? -25.746 -2.456  26.918  1.00 21.33  ? 156 SER A C   1 
ATOM   1267 O  O   . SER A  1 158 ? -25.153 -1.733  27.728  1.00 22.71  ? 156 SER A O   1 
ATOM   1268 C  CB  . SER A  1 158 ? -24.480 -4.133  25.561  1.00 20.12  ? 156 SER A CB  1 
ATOM   1269 O  OG  . SER A  1 158 ? -23.897 -5.424  25.583  1.00 19.58  ? 156 SER A OG  1 
ATOM   1270 N  N   . LYS A  1 159 ? -26.728 -2.011  26.143  1.00 22.37  ? 157 LYS A N   1 
ATOM   1271 C  CA  . LYS A  1 159 ? -27.210 -0.627  26.246  1.00 23.83  ? 157 LYS A CA  1 
ATOM   1272 C  C   . LYS A  1 159 ? -27.825 -0.328  27.605  1.00 22.27  ? 157 LYS A C   1 
ATOM   1273 O  O   . LYS A  1 159 ? -27.677 0.761   28.132  1.00 24.69  ? 157 LYS A O   1 
ATOM   1274 C  CB  . LYS A  1 159 ? -28.222 -0.338  25.153  1.00 26.61  ? 157 LYS A CB  1 
ATOM   1275 C  CG  . LYS A  1 159 ? -27.559 -0.017  23.826  1.00 31.58  ? 157 LYS A CG  1 
ATOM   1276 C  CD  . LYS A  1 159 ? -28.560 0.051   22.689  1.00 37.10  ? 157 LYS A CD  1 
ATOM   1277 C  CE  . LYS A  1 159 ? -27.851 0.244   21.358  1.00 44.83  ? 157 LYS A CE  1 
ATOM   1278 N  NZ  . LYS A  1 159 ? -28.775 0.697   20.280  1.00 49.86  ? 157 LYS A NZ  1 
ATOM   1279 N  N   . SER A  1 160 ? -28.508 -1.302  28.181  1.00 21.39  ? 158 SER A N   1 
ATOM   1280 C  CA  . SER A  1 160 ? -29.149 -1.099  29.472  1.00 20.64  ? 158 SER A CA  1 
ATOM   1281 C  C   . SER A  1 160 ? -28.101 -0.867  30.557  1.00 20.22  ? 158 SER A C   1 
ATOM   1282 O  O   . SER A  1 160 ? -28.419 -0.382  31.643  1.00 20.30  ? 158 SER A O   1 
ATOM   1283 C  CB  . SER A  1 160 ? -30.005 -2.312  29.841  1.00 19.81  ? 158 SER A CB  1 
ATOM   1284 O  OG  . SER A  1 160 ? -29.209 -3.319  30.451  1.00 20.33  ? 158 SER A OG  1 
ATOM   1285 N  N   . LEU A  1 161 ? -26.852 -1.214  30.261  1.00 19.03  ? 159 LEU A N   1 
ATOM   1286 C  CA  . LEU A  1 161 ? -25.761 -0.983  31.195  1.00 19.55  ? 159 LEU A CA  1 
ATOM   1287 C  C   . LEU A  1 161 ? -24.940 0.268   30.858  1.00 20.68  ? 159 LEU A C   1 
ATOM   1288 O  O   . LEU A  1 161 ? -23.895 0.506   31.453  1.00 21.27  ? 159 LEU A O   1 
ATOM   1289 C  CB  . LEU A  1 161 ? -24.845 -2.200  31.234  1.00 18.71  ? 159 LEU A CB  1 
ATOM   1290 C  CG  . LEU A  1 161 ? -25.491 -3.521  31.649  1.00 18.44  ? 159 LEU A CG  1 
ATOM   1291 C  CD1 . LEU A  1 161 ? -24.430 -4.600  31.711  1.00 18.67  ? 159 LEU A CD1 1 
ATOM   1292 C  CD2 . LEU A  1 161 ? -26.216 -3.418  32.980  1.00 18.15  ? 159 LEU A CD2 1 
ATOM   1293 N  N   . GLY A  1 162 ? -25.407 1.053   29.895  1.00 21.61  ? 160 GLY A N   1 
ATOM   1294 C  CA  . GLY A  1 162 ? -24.821 2.360   29.621  1.00 22.44  ? 160 GLY A CA  1 
ATOM   1295 C  C   . GLY A  1 162 ? -23.912 2.396   28.408  1.00 24.36  ? 160 GLY A C   1 
ATOM   1296 O  O   . GLY A  1 162 ? -23.306 3.433   28.117  1.00 24.27  ? 160 GLY A O   1 
ATOM   1297 N  N   . LEU A  1 163 ? -23.799 1.269   27.703  1.00 25.12  ? 161 LEU A N   1 
ATOM   1298 C  CA  . LEU A  1 163 ? -22.873 1.169   26.576  1.00 26.90  ? 161 LEU A CA  1 
ATOM   1299 C  C   . LEU A  1 163 ? -23.555 1.521   25.264  1.00 28.35  ? 161 LEU A C   1 
ATOM   1300 O  O   . LEU A  1 163 ? -24.602 0.975   24.946  1.00 29.56  ? 161 LEU A O   1 
ATOM   1301 C  CB  . LEU A  1 163 ? -22.304 -0.246  26.476  1.00 25.12  ? 161 LEU A CB  1 
ATOM   1302 C  CG  . LEU A  1 163 ? -21.470 -0.696  27.667  1.00 25.18  ? 161 LEU A CG  1 
ATOM   1303 C  CD1 . LEU A  1 163 ? -21.154 -2.177  27.545  1.00 24.89  ? 161 LEU A CD1 1 
ATOM   1304 C  CD2 . LEU A  1 163 ? -20.196 0.132   27.789  1.00 26.00  ? 161 LEU A CD2 1 
ATOM   1305 N  N   . PRO A  1 164 ? -22.947 2.420   24.483  1.00 32.12  ? 162 PRO A N   1 
ATOM   1306 C  CA  . PRO A  1 164 ? -23.437 2.697   23.131  1.00 33.87  ? 162 PRO A CA  1 
ATOM   1307 C  C   . PRO A  1 164 ? -22.888 1.715   22.105  1.00 33.34  ? 162 PRO A C   1 
ATOM   1308 O  O   . PRO A  1 164 ? -22.042 0.886   22.433  1.00 35.05  ? 162 PRO A O   1 
ATOM   1309 C  CB  . PRO A  1 164 ? -22.930 4.114   22.863  1.00 34.53  ? 162 PRO A CB  1 
ATOM   1310 C  CG  . PRO A  1 164 ? -21.680 4.220   23.669  1.00 35.43  ? 162 PRO A CG  1 
ATOM   1311 C  CD  . PRO A  1 164 ? -21.829 3.303   24.859  1.00 33.38  ? 162 PRO A CD  1 
ATOM   1312 N  N   . GLU A  1 165 ? -23.367 1.818   20.872  1.00 36.03  ? 163 GLU A N   1 
ATOM   1313 C  CA  . GLU A  1 165 ? -23.188 0.760   19.885  1.00 39.08  ? 163 GLU A CA  1 
ATOM   1314 C  C   . GLU A  1 165 ? -21.715 0.571   19.526  1.00 34.91  ? 163 GLU A C   1 
ATOM   1315 O  O   . GLU A  1 165 ? -21.279 -0.541  19.229  1.00 33.60  ? 163 GLU A O   1 
ATOM   1316 C  CB  . GLU A  1 165 ? -23.983 1.084   18.609  1.00 46.41  ? 163 GLU A CB  1 
ATOM   1317 C  CG  . GLU A  1 165 ? -24.416 -0.140  17.793  1.00 56.84  ? 163 GLU A CG  1 
ATOM   1318 C  CD  . GLU A  1 165 ? -25.886 -0.505  17.972  1.00 59.88  ? 163 GLU A CD  1 
ATOM   1319 O  OE1 . GLU A  1 165 ? -26.517 0.056   18.894  1.00 56.14  ? 163 GLU A OE1 1 
ATOM   1320 O  OE2 . GLU A  1 165 ? -26.406 -1.342  17.183  1.00 47.08  ? 163 GLU A OE2 1 
ATOM   1321 N  N   . ASN A  1 166 ? -20.955 1.658   19.524  1.00 33.60  ? 164 ASN A N   1 
ATOM   1322 C  CA  . ASN A  1 166 ? -19.547 1.585   19.150  1.00 33.82  ? 164 ASN A CA  1 
ATOM   1323 C  C   . ASN A  1 166 ? -18.660 1.004   20.264  1.00 32.22  ? 164 ASN A C   1 
ATOM   1324 O  O   . ASN A  1 166 ? -17.454 0.855   20.082  1.00 34.26  ? 164 ASN A O   1 
ATOM   1325 C  CB  . ASN A  1 166 ? -19.037 2.955   18.702  1.00 35.53  ? 164 ASN A CB  1 
ATOM   1326 C  CG  . ASN A  1 166 ? -19.026 3.974   19.825  1.00 36.54  ? 164 ASN A CG  1 
ATOM   1327 O  OD1 . ASN A  1 166 ? -19.734 3.832   20.823  1.00 36.15  ? 164 ASN A OD1 1 
ATOM   1328 N  ND2 . ASN A  1 166 ? -18.201 4.992   19.680  1.00 38.06  ? 164 ASN A ND2 1 
ATOM   1329 N  N   . HIS A  1 167 ? -19.268 0.652   21.393  1.00 28.86  ? 165 HIS A N   1 
ATOM   1330 C  CA  . HIS A  1 167 ? -18.595 -0.134  22.412  1.00 28.03  ? 165 HIS A CA  1 
ATOM   1331 C  C   . HIS A  1 167 ? -19.072 -1.585  22.412  1.00 26.22  ? 165 HIS A C   1 
ATOM   1332 O  O   . HIS A  1 167 ? -18.874 -2.326  23.375  1.00 23.36  ? 165 HIS A O   1 
ATOM   1333 C  CB  . HIS A  1 167 ? -18.816 0.491   23.783  1.00 27.14  ? 165 HIS A CB  1 
ATOM   1334 C  CG  . HIS A  1 167 ? -17.946 1.680   24.046  1.00 29.07  ? 165 HIS A CG  1 
ATOM   1335 N  ND1 . HIS A  1 167 ? -16.806 1.610   24.818  1.00 30.91  ? 165 HIS A ND1 1 
ATOM   1336 C  CD2 . HIS A  1 167 ? -18.049 2.968   23.647  1.00 30.01  ? 165 HIS A CD2 1 
ATOM   1337 C  CE1 . HIS A  1 167 ? -16.238 2.802   24.874  1.00 31.31  ? 165 HIS A CE1 1 
ATOM   1338 N  NE2 . HIS A  1 167 ? -16.973 3.643   24.172  1.00 31.28  ? 165 HIS A NE2 1 
ATOM   1339 N  N   . ILE A  1 168 ? -19.678 -1.990  21.301  1.00 27.38  ? 166 ILE A N   1 
ATOM   1340 C  CA  . ILE A  1 168 ? -20.131 -3.366  21.116  1.00 25.95  ? 166 ILE A CA  1 
ATOM   1341 C  C   . ILE A  1 168 ? -19.552 -3.941  19.825  1.00 25.26  ? 166 ILE A C   1 
ATOM   1342 O  O   . ILE A  1 168 ? -19.690 -3.336  18.770  1.00 26.49  ? 166 ILE A O   1 
ATOM   1343 C  CB  . ILE A  1 168 ? -21.660 -3.415  21.027  1.00 26.38  ? 166 ILE A CB  1 
ATOM   1344 C  CG1 . ILE A  1 168 ? -22.271 -2.791  22.278  1.00 27.17  ? 166 ILE A CG1 1 
ATOM   1345 C  CG2 . ILE A  1 168 ? -22.115 -4.855  20.866  1.00 26.97  ? 166 ILE A CG2 1 
ATOM   1346 C  CD1 . ILE A  1 168 ? -23.775 -2.641  22.229  1.00 28.11  ? 166 ILE A CD1 1 
ATOM   1347 N  N   . VAL A  1 169 ? -18.886 -5.089  19.913  1.00 23.36  ? 167 VAL A N   1 
ATOM   1348 C  CA  . VAL A  1 169 ? -18.310 -5.726  18.726  1.00 23.41  ? 167 VAL A CA  1 
ATOM   1349 C  C   . VAL A  1 169 ? -18.662 -7.204  18.632  1.00 21.66  ? 167 VAL A C   1 
ATOM   1350 O  O   . VAL A  1 169 ? -18.945 -7.864  19.634  1.00 19.69  ? 167 VAL A O   1 
ATOM   1351 C  CB  . VAL A  1 169 ? -16.778 -5.577  18.646  1.00 24.22  ? 167 VAL A CB  1 
ATOM   1352 C  CG1 . VAL A  1 169 ? -16.385 -4.120  18.797  1.00 25.72  ? 167 VAL A CG1 1 
ATOM   1353 C  CG2 . VAL A  1 169 ? -16.078 -6.428  19.696  1.00 23.27  ? 167 VAL A CG2 1 
ATOM   1354 N  N   . PHE A  1 170 ? -18.616 -7.710  17.408  1.00 22.12  ? 168 PHE A N   1 
ATOM   1355 C  CA  . PHE A  1 170 ? -18.842 -9.117  17.136  1.00 21.76  ? 168 PHE A CA  1 
ATOM   1356 C  C   . PHE A  1 170 ? -17.619 -9.677  16.444  1.00 22.19  ? 168 PHE A C   1 
ATOM   1357 O  O   . PHE A  1 170 ? -17.439 -9.479  15.252  1.00 22.78  ? 168 PHE A O   1 
ATOM   1358 C  CB  . PHE A  1 170 ? -20.104 -9.289  16.281  1.00 22.11  ? 168 PHE A CB  1 
ATOM   1359 C  CG  . PHE A  1 170 ? -21.345 -8.825  16.980  1.00 21.90  ? 168 PHE A CG  1 
ATOM   1360 C  CD1 . PHE A  1 170 ? -21.839 -7.545  16.776  1.00 23.23  ? 168 PHE A CD1 1 
ATOM   1361 C  CD2 . PHE A  1 170 ? -21.945 -9.626  17.924  1.00 20.22  ? 168 PHE A CD2 1 
ATOM   1362 C  CE1 . PHE A  1 170 ? -22.949 -7.098  17.469  1.00 23.47  ? 168 PHE A CE1 1 
ATOM   1363 C  CE2 . PHE A  1 170 ? -23.046 -9.190  18.627  1.00 20.39  ? 168 PHE A CE2 1 
ATOM   1364 C  CZ  . PHE A  1 170 ? -23.555 -7.923  18.397  1.00 22.03  ? 168 PHE A CZ  1 
ATOM   1365 N  N   . PRO A  1 171 ? -16.744 -10.326 17.216  1.00 22.03  ? 169 PRO A N   1 
ATOM   1366 C  CA  . PRO A  1 171 ? -15.478 -10.823 16.706  1.00 23.23  ? 169 PRO A CA  1 
ATOM   1367 C  C   . PRO A  1 171 ? -15.694 -11.734 15.523  1.00 24.01  ? 169 PRO A C   1 
ATOM   1368 O  O   . PRO A  1 171 ? -16.642 -12.531 15.493  1.00 22.56  ? 169 PRO A O   1 
ATOM   1369 C  CB  . PRO A  1 171 ? -14.894 -11.602 17.889  1.00 22.50  ? 169 PRO A CB  1 
ATOM   1370 C  CG  . PRO A  1 171 ? -15.504 -10.974 19.081  1.00 22.15  ? 169 PRO A CG  1 
ATOM   1371 C  CD  . PRO A  1 171 ? -16.886 -10.556 18.662  1.00 21.34  ? 169 PRO A CD  1 
ATOM   1372 N  N   . VAL A  1 172 ? -14.805 -11.605 14.553  1.00 26.85  ? 170 VAL A N   1 
ATOM   1373 C  CA  . VAL A  1 172 ? -14.925 -12.315 13.297  1.00 29.38  ? 170 VAL A CA  1 
ATOM   1374 C  C   . VAL A  1 172 ? -14.526 -13.776 13.516  1.00 27.97  ? 170 VAL A C   1 
ATOM   1375 O  O   . VAL A  1 172 ? -13.482 -14.047 14.115  1.00 29.55  ? 170 VAL A O   1 
ATOM   1376 C  CB  . VAL A  1 172 ? -14.018 -11.642 12.250  1.00 32.29  ? 170 VAL A CB  1 
ATOM   1377 C  CG1 . VAL A  1 172 ? -14.056 -12.387 10.926  1.00 34.16  ? 170 VAL A CG1 1 
ATOM   1378 C  CG2 . VAL A  1 172 ? -14.442 -10.187 12.060  1.00 34.28  ? 170 VAL A CG2 1 
ATOM   1379 N  N   . PRO A  1 173 ? -15.369 -14.722 13.063  1.00 26.43  ? 171 PRO A N   1 
ATOM   1380 C  CA  . PRO A  1 173 ? -15.021 -16.149 13.165  1.00 25.26  ? 171 PRO A CA  1 
ATOM   1381 C  C   . PRO A  1 173 ? -13.714 -16.456 12.466  1.00 25.05  ? 171 PRO A C   1 
ATOM   1382 O  O   . PRO A  1 173 ? -13.442 -15.900 11.411  1.00 25.49  ? 171 PRO A O   1 
ATOM   1383 C  CB  . PRO A  1 173 ? -16.181 -16.858 12.453  1.00 24.62  ? 171 PRO A CB  1 
ATOM   1384 C  CG  . PRO A  1 173 ? -17.324 -15.907 12.559  1.00 24.59  ? 171 PRO A CG  1 
ATOM   1385 C  CD  . PRO A  1 173 ? -16.733 -14.522 12.546  1.00 25.75  ? 171 PRO A CD  1 
ATOM   1386 N  N   . ILE A  1 174 ? -12.905 -17.311 13.085  1.00 24.81  ? 172 ILE A N   1 
ATOM   1387 C  CA  . ILE A  1 174 ? -11.684 -17.804 12.478  1.00 26.06  ? 172 ILE A CA  1 
ATOM   1388 C  C   . ILE A  1 174 ? -11.562 -19.301 12.766  1.00 26.10  ? 172 ILE A C   1 
ATOM   1389 O  O   . ILE A  1 174 ? -12.293 -19.836 13.594  1.00 22.68  ? 172 ILE A O   1 
ATOM   1390 C  CB  . ILE A  1 174 ? -10.444 -17.099 13.057  1.00 26.92  ? 172 ILE A CB  1 
ATOM   1391 C  CG1 . ILE A  1 174 ? -10.354 -17.354 14.562  1.00 25.31  ? 172 ILE A CG1 1 
ATOM   1392 C  CG2 . ILE A  1 174 ? -10.477 -15.604 12.758  1.00 28.10  ? 172 ILE A CG2 1 
ATOM   1393 C  CD1 . ILE A  1 174 ? -9.029  -16.945 15.160  1.00 26.36  ? 172 ILE A CD1 1 
ATOM   1394 N  N   . ASP A  1 175 ? -10.609 -19.951 12.101  1.00 28.55  ? 173 ASP A N   1 
ATOM   1395 C  CA  . ASP A  1 175 ? -10.418 -21.392 12.213  1.00 30.24  ? 173 ASP A CA  1 
ATOM   1396 C  C   . ASP A  1 175 ? -9.180  -21.756 13.012  1.00 29.35  ? 173 ASP A C   1 
ATOM   1397 O  O   . ASP A  1 175 ? -9.107  -22.844 13.586  1.00 29.37  ? 173 ASP A O   1 
ATOM   1398 C  CB  . ASP A  1 175 ? -10.334 -22.026 10.821  1.00 34.14  ? 173 ASP A CB  1 
ATOM   1399 C  CG  . ASP A  1 175 ? -11.681 -22.069 10.126  1.00 37.91  ? 173 ASP A CG  1 
ATOM   1400 O  OD1 . ASP A  1 175 ? -11.709 -22.056 8.881   1.00 42.05  ? 173 ASP A OD1 1 
ATOM   1401 O  OD2 . ASP A  1 175 ? -12.714 -22.088 10.833  1.00 39.15  ? 173 ASP A OD2 1 
ATOM   1402 N  N   . GLN A  1 176 ? -8.201  -20.857 13.035  1.00 28.52  ? 174 GLN A N   1 
ATOM   1403 C  CA  . GLN A  1 176 ? -6.950  -21.120 13.730  1.00 27.79  ? 174 GLN A CA  1 
ATOM   1404 C  C   . GLN A  1 176 ? -7.166  -21.188 15.243  1.00 25.75  ? 174 GLN A C   1 
ATOM   1405 O  O   . GLN A  1 176 ? -7.878  -20.360 15.813  1.00 24.15  ? 174 GLN A O   1 
ATOM   1406 C  CB  . GLN A  1 176 ? -5.919  -20.049 13.367  1.00 29.70  ? 174 GLN A CB  1 
ATOM   1407 C  CG  . GLN A  1 176 ? -5.585  -20.004 11.879  1.00 31.15  ? 174 GLN A CG  1 
ATOM   1408 C  CD  . GLN A  1 176 ? -6.363  -18.943 11.116  1.00 32.02  ? 174 GLN A CD  1 
ATOM   1409 O  OE1 . GLN A  1 176 ? -7.399  -18.443 11.573  1.00 32.07  ? 174 GLN A OE1 1 
ATOM   1410 N  NE2 . GLN A  1 176 ? -5.866  -18.594 9.943   1.00 33.46  ? 174 GLN A NE2 1 
ATOM   1411 N  N   . CYS A  1 177 ? -6.591  -22.217 15.867  1.00 25.04  ? 175 CYS A N   1 
ATOM   1412 C  CA  . CYS A  1 177 ? -6.411  -22.302 17.325  1.00 23.70  ? 175 CYS A CA  1 
ATOM   1413 C  C   . CYS A  1 177 ? -7.656  -22.699 18.106  1.00 23.04  ? 175 CYS A C   1 
ATOM   1414 O  O   . CYS A  1 177 ? -7.576  -23.440 19.092  1.00 21.53  ? 175 CYS A O   1 
ATOM   1415 C  CB  . CYS A  1 177 ? -5.843  -21.000 17.891  1.00 23.82  ? 175 CYS A CB  1 
ATOM   1416 S  SG  . CYS A  1 177 ? -4.222  -20.572 17.289  1.00 26.12  ? 175 CYS A SG  1 
ATOM   1417 N  N   . ILE A  1 178 ? -8.798  -22.158 17.713  1.00 23.87  ? 176 ILE A N   1 
ATOM   1418 C  CA  . ILE A  1 178 ? -9.942  -22.157 18.589  1.00 23.82  ? 176 ILE A CA  1 
ATOM   1419 C  C   . ILE A  1 178 ? -10.896 -23.301 18.313  1.00 26.25  ? 176 ILE A C   1 
ATOM   1420 O  O   . ILE A  1 178 ? -11.855 -23.487 19.063  1.00 29.27  ? 176 ILE A O   1 
ATOM   1421 C  CB  . ILE A  1 178 ? -10.735 -20.848 18.501  1.00 23.51  ? 176 ILE A CB  1 
ATOM   1422 C  CG1 . ILE A  1 178 ? -11.437 -20.742 17.149  1.00 23.25  ? 176 ILE A CG1 1 
ATOM   1423 C  CG2 . ILE A  1 178 ? -9.818  -19.651 18.726  1.00 25.42  ? 176 ILE A CG2 1 
ATOM   1424 C  CD1 . ILE A  1 178 ? -12.246 -19.472 16.993  1.00 23.58  ? 176 ILE A CD1 1 
ATOM   1425 N  N   . ASP A  1 179 ? -10.653 -24.046 17.237  1.00 29.53  ? 177 ASP A N   1 
ATOM   1426 C  CA  . ASP A  1 179 ? -11.437 -25.248 16.923  1.00 32.53  ? 177 ASP A CA  1 
ATOM   1427 C  C   . ASP A  1 179 ? -10.812 -26.512 17.524  1.00 37.37  ? 177 ASP A C   1 
ATOM   1428 O  O   . ASP A  1 179 ? -11.234 -27.622 17.211  1.00 37.37  ? 177 ASP A O   1 
ATOM   1429 C  CB  . ASP A  1 179 ? -11.567 -25.436 15.402  1.00 33.12  ? 177 ASP A CB  1 
ATOM   1430 C  CG  . ASP A  1 179 ? -12.503 -24.419 14.755  1.00 35.86  ? 177 ASP A CG  1 
ATOM   1431 O  OD1 . ASP A  1 179 ? -13.305 -23.797 15.484  1.00 38.95  ? 177 ASP A OD1 1 
ATOM   1432 O  OD2 . ASP A  1 179 ? -12.427 -24.233 13.518  1.00 36.40  ? 177 ASP A OD2 1 
ATOM   1433 N  N   . GLY A  1 180 ? -9.802  -26.347 18.375  1.00 45.51  ? 178 GLY A N   1 
ATOM   1434 C  CA  . GLY A  1 180 ? -9.136  -27.493 19.006  1.00 48.42  ? 178 GLY A CA  1 
ATOM   1435 C  C   . GLY A  1 180 ? -9.952  -28.087 20.144  1.00 47.42  ? 178 GLY A C   1 
ATOM   1436 O  O   . GLY A  1 180 ? -10.455 -29.204 20.039  1.00 40.31  ? 178 GLY A O   1 
ATOM   1437 N  N   . SER B  1 5   ? 4.051   -26.749 30.519  1.00 57.79  ? 3   SER B N   1 
ATOM   1438 C  CA  . SER B  1 5   ? 4.538   -26.003 29.319  1.00 56.87  ? 3   SER B CA  1 
ATOM   1439 C  C   . SER B  1 5   ? 3.469   -25.021 28.843  1.00 54.51  ? 3   SER B C   1 
ATOM   1440 O  O   . SER B  1 5   ? 2.348   -25.426 28.549  1.00 51.63  ? 3   SER B O   1 
ATOM   1441 C  CB  . SER B  1 5   ? 4.914   -26.973 28.194  1.00 54.27  ? 3   SER B CB  1 
ATOM   1442 N  N   . THR B  1 6   ? 3.826   -23.739 28.774  1.00 52.84  ? 4   THR B N   1 
ATOM   1443 C  CA  . THR B  1 6   ? 2.851   -22.643 28.804  1.00 51.28  ? 4   THR B CA  1 
ATOM   1444 C  C   . THR B  1 6   ? 2.855   -21.832 27.513  1.00 45.82  ? 4   THR B C   1 
ATOM   1445 O  O   . THR B  1 6   ? 1.993   -20.980 27.314  1.00 44.00  ? 4   THR B O   1 
ATOM   1446 C  CB  . THR B  1 6   ? 3.174   -21.636 29.925  1.00 56.88  ? 4   THR B CB  1 
ATOM   1447 O  OG1 . THR B  1 6   ? 4.571   -21.689 30.238  1.00 58.28  ? 4   THR B OG1 1 
ATOM   1448 C  CG2 . THR B  1 6   ? 2.344   -21.920 31.176  1.00 58.50  ? 4   THR B CG2 1 
ATOM   1449 N  N   . SER B  1 7   ? 3.854   -22.074 26.670  1.00 41.86  ? 5   SER B N   1 
ATOM   1450 C  CA  . SER B  1 7   ? 4.248   -21.139 25.616  1.00 40.08  ? 5   SER B CA  1 
ATOM   1451 C  C   . SER B  1 7   ? 3.316   -21.204 24.398  1.00 36.31  ? 5   SER B C   1 
ATOM   1452 O  O   . SER B  1 7   ? 2.549   -22.157 24.232  1.00 32.57  ? 5   SER B O   1 
ATOM   1453 C  CB  . SER B  1 7   ? 5.683   -21.439 25.175  1.00 40.70  ? 5   SER B CB  1 
ATOM   1454 O  OG  . SER B  1 7   ? 5.761   -22.719 24.569  1.00 41.01  ? 5   SER B OG  1 
ATOM   1455 N  N   . ASP B  1 8   ? 3.391   -20.184 23.549  1.00 35.24  ? 6   ASP B N   1 
ATOM   1456 C  CA  . ASP B  1 8   ? 2.625   -20.178 22.309  1.00 33.33  ? 6   ASP B CA  1 
ATOM   1457 C  C   . ASP B  1 8   ? 3.042   -21.305 21.363  1.00 30.69  ? 6   ASP B C   1 
ATOM   1458 O  O   . ASP B  1 8   ? 4.197   -21.724 21.335  1.00 30.89  ? 6   ASP B O   1 
ATOM   1459 C  CB  . ASP B  1 8   ? 2.776   -18.839 21.596  1.00 35.10  ? 6   ASP B CB  1 
ATOM   1460 C  CG  . ASP B  1 8   ? 2.478   -17.679 22.496  1.00 38.58  ? 6   ASP B CG  1 
ATOM   1461 O  OD1 . ASP B  1 8   ? 2.917   -16.554 22.171  1.00 41.74  ? 6   ASP B OD1 1 
ATOM   1462 O  OD2 . ASP B  1 8   ? 1.828   -17.902 23.543  1.00 39.70  ? 6   ASP B OD2 1 
ATOM   1463 N  N   . LEU B  1 9   ? 2.082   -21.769 20.575  1.00 27.81  ? 7   LEU B N   1 
ATOM   1464 C  CA  . LEU B  1 9   ? 2.283   -22.894 19.684  1.00 26.12  ? 7   LEU B CA  1 
ATOM   1465 C  C   . LEU B  1 9   ? 1.923   -22.484 18.267  1.00 25.29  ? 7   LEU B C   1 
ATOM   1466 O  O   . LEU B  1 9   ? 1.014   -21.696 18.064  1.00 25.19  ? 7   LEU B O   1 
ATOM   1467 C  CB  . LEU B  1 9   ? 1.415   -24.080 20.128  1.00 24.74  ? 7   LEU B CB  1 
ATOM   1468 C  CG  . LEU B  1 9   ? 1.882   -24.826 21.381  1.00 25.14  ? 7   LEU B CG  1 
ATOM   1469 C  CD1 . LEU B  1 9   ? 0.844   -25.853 21.784  1.00 24.27  ? 7   LEU B CD1 1 
ATOM   1470 C  CD2 . LEU B  1 9   ? 3.226   -25.511 21.162  1.00 25.23  ? 7   LEU B CD2 1 
ATOM   1471 N  N   . ILE B  1 10  ? 2.621   -23.032 17.278  1.00 25.11  ? 8   ILE B N   1 
ATOM   1472 C  CA  . ILE B  1 10  ? 2.174   -22.902 15.896  1.00 24.36  ? 8   ILE B CA  1 
ATOM   1473 C  C   . ILE B  1 10  ? 0.841   -23.625 15.753  1.00 23.17  ? 8   ILE B C   1 
ATOM   1474 O  O   . ILE B  1 10  ? 0.698   -24.739 16.231  1.00 23.12  ? 8   ILE B O   1 
ATOM   1475 C  CB  . ILE B  1 10  ? 3.200   -23.485 14.904  1.00 23.61  ? 8   ILE B CB  1 
ATOM   1476 C  CG1 . ILE B  1 10  ? 4.466   -22.613 14.879  1.00 25.26  ? 8   ILE B CG1 1 
ATOM   1477 C  CG2 . ILE B  1 10  ? 2.589   -23.575 13.513  1.00 22.47  ? 8   ILE B CG2 1 
ATOM   1478 C  CD1 . ILE B  1 10  ? 5.700   -23.340 14.384  1.00 25.44  ? 8   ILE B CD1 1 
ATOM   1479 N  N   . PRO B  1 11  ? -0.147  -22.975 15.120  1.00 23.74  ? 9   PRO B N   1 
ATOM   1480 C  CA  . PRO B  1 11  ? -1.500  -23.512 15.079  1.00 23.04  ? 9   PRO B CA  1 
ATOM   1481 C  C   . PRO B  1 11  ? -1.547  -24.796 14.287  1.00 22.46  ? 9   PRO B C   1 
ATOM   1482 O  O   . PRO B  1 11  ? -0.848  -24.917 13.281  1.00 22.82  ? 9   PRO B O   1 
ATOM   1483 C  CB  . PRO B  1 11  ? -2.294  -22.428 14.342  1.00 23.56  ? 9   PRO B CB  1 
ATOM   1484 C  CG  . PRO B  1 11  ? -1.497  -21.187 14.479  1.00 24.73  ? 9   PRO B CG  1 
ATOM   1485 C  CD  . PRO B  1 11  ? -0.067  -21.621 14.541  1.00 24.87  ? 9   PRO B CD  1 
ATOM   1486 N  N   . ALA B  1 12  ? -2.369  -25.742 14.720  1.00 22.16  ? 10  ALA B N   1 
ATOM   1487 C  CA  . ALA B  1 12  ? -2.617  -26.932 13.919  1.00 21.46  ? 10  ALA B CA  1 
ATOM   1488 C  C   . ALA B  1 12  ? -3.267  -26.512 12.613  1.00 22.01  ? 10  ALA B C   1 
ATOM   1489 O  O   . ALA B  1 12  ? -4.107  -25.627 12.588  1.00 22.62  ? 10  ALA B O   1 
ATOM   1490 C  CB  . ALA B  1 12  ? -3.517  -27.908 14.658  1.00 21.24  ? 10  ALA B CB  1 
ATOM   1491 N  N   . PRO B  1 13  ? -2.854  -27.134 11.511  1.00 23.57  ? 11  PRO B N   1 
ATOM   1492 C  CA  . PRO B  1 13  ? -3.453  -26.810 10.233  1.00 24.05  ? 11  PRO B CA  1 
ATOM   1493 C  C   . PRO B  1 13  ? -4.873  -27.328 10.189  1.00 24.25  ? 11  PRO B C   1 
ATOM   1494 O  O   . PRO B  1 13  ? -5.203  -28.280 10.904  1.00 23.20  ? 11  PRO B O   1 
ATOM   1495 C  CB  . PRO B  1 13  ? -2.586  -27.579 9.243   1.00 24.13  ? 11  PRO B CB  1 
ATOM   1496 C  CG  . PRO B  1 13  ? -2.160  -28.787 10.021  1.00 24.01  ? 11  PRO B CG  1 
ATOM   1497 C  CD  . PRO B  1 13  ? -1.991  -28.329 11.442  1.00 24.05  ? 11  PRO B CD  1 
ATOM   1498 N  N   . PRO B  1 14  ? -5.723  -26.705 9.363   1.00 25.00  ? 12  PRO B N   1 
ATOM   1499 C  CA  . PRO B  1 14  ? -7.026  -27.313 9.090   1.00 24.42  ? 12  PRO B CA  1 
ATOM   1500 C  C   . PRO B  1 14  ? -6.866  -28.665 8.413   1.00 25.10  ? 12  PRO B C   1 
ATOM   1501 O  O   . PRO B  1 14  ? -5.959  -28.843 7.597   1.00 25.87  ? 12  PRO B O   1 
ATOM   1502 C  CB  . PRO B  1 14  ? -7.693  -26.315 8.142   1.00 24.32  ? 12  PRO B CB  1 
ATOM   1503 C  CG  . PRO B  1 14  ? -6.562  -25.567 7.507   1.00 25.17  ? 12  PRO B CG  1 
ATOM   1504 C  CD  . PRO B  1 14  ? -5.464  -25.517 8.532   1.00 24.91  ? 12  PRO B CD  1 
ATOM   1505 N  N   . LEU B  1 15  ? -7.753  -29.596 8.740   1.00 26.85  ? 13  LEU B N   1 
ATOM   1506 C  CA  . LEU B  1 15  ? -7.654  -30.955 8.251   1.00 30.57  ? 13  LEU B CA  1 
ATOM   1507 C  C   . LEU B  1 15  ? -7.776  -31.029 6.722   1.00 30.57  ? 13  LEU B C   1 
ATOM   1508 O  O   . LEU B  1 15  ? -7.304  -31.974 6.097   1.00 27.78  ? 13  LEU B O   1 
ATOM   1509 C  CB  . LEU B  1 15  ? -8.689  -31.833 8.940   1.00 35.11  ? 13  LEU B CB  1 
ATOM   1510 C  CG  . LEU B  1 15  ? -8.424  -32.063 10.437  1.00 41.15  ? 13  LEU B CG  1 
ATOM   1511 C  CD1 . LEU B  1 15  ? -9.474  -32.981 11.054  1.00 48.29  ? 13  LEU B CD1 1 
ATOM   1512 C  CD2 . LEU B  1 15  ? -7.032  -32.623 10.676  1.00 37.39  ? 13  LEU B CD2 1 
ATOM   1513 N  N   . SER B  1 16  ? -8.341  -29.992 6.121   1.00 30.43  ? 14  SER B N   1 
ATOM   1514 C  CA  . SER B  1 16  ? -8.458  -29.902 4.667   1.00 30.08  ? 14  SER B CA  1 
ATOM   1515 C  C   . SER B  1 16  ? -7.100  -29.761 3.970   1.00 31.07  ? 14  SER B C   1 
ATOM   1516 O  O   . SER B  1 16  ? -6.991  -29.950 2.761   1.00 27.44  ? 14  SER B O   1 
ATOM   1517 C  CB  . SER B  1 16  ? -9.362  -28.718 4.292   1.00 32.60  ? 14  SER B CB  1 
ATOM   1518 O  OG  . SER B  1 16  ? -8.689  -27.488 4.486   1.00 34.37  ? 14  SER B OG  1 
ATOM   1519 N  N   . LYS B  1 17  ? -6.054  -29.451 4.728   1.00 31.69  ? 15  LYS B N   1 
ATOM   1520 C  CA  . LYS B  1 17  ? -4.713  -29.395 4.151   1.00 28.52  ? 15  LYS B CA  1 
ATOM   1521 C  C   . LYS B  1 17  ? -3.912  -30.688 4.360   1.00 24.82  ? 15  LYS B C   1 
ATOM   1522 O  O   . LYS B  1 17  ? -2.742  -30.754 3.995   1.00 23.36  ? 15  LYS B O   1 
ATOM   1523 C  CB  . LYS B  1 17  ? -3.941  -28.225 4.742   1.00 32.71  ? 15  LYS B CB  1 
ATOM   1524 C  CG  . LYS B  1 17  ? -4.339  -26.876 4.181   1.00 38.95  ? 15  LYS B CG  1 
ATOM   1525 C  CD  . LYS B  1 17  ? -3.258  -25.842 4.432   1.00 42.81  ? 15  LYS B CD  1 
ATOM   1526 C  CE  . LYS B  1 17  ? -3.852  -24.504 4.842   1.00 43.96  ? 15  LYS B CE  1 
ATOM   1527 N  NZ  . LYS B  1 17  ? -2.961  -23.375 4.466   1.00 41.05  ? 15  LYS B NZ  1 
ATOM   1528 N  N   . VAL B  1 18  ? -4.540  -31.700 4.962   1.00 22.02  ? 16  VAL B N   1 
ATOM   1529 C  CA  . VAL B  1 18  ? -3.873  -32.964 5.270   1.00 17.34  ? 16  VAL B CA  1 
ATOM   1530 C  C   . VAL B  1 18  ? -4.535  -34.094 4.501   1.00 16.11  ? 16  VAL B C   1 
ATOM   1531 O  O   . VAL B  1 18  ? -5.562  -34.623 4.912   1.00 14.67  ? 16  VAL B O   1 
ATOM   1532 C  CB  . VAL B  1 18  ? -3.956  -33.293 6.772   1.00 17.53  ? 16  VAL B CB  1 
ATOM   1533 C  CG1 . VAL B  1 18  ? -3.154  -34.545 7.097   1.00 16.92  ? 16  VAL B CG1 1 
ATOM   1534 C  CG2 . VAL B  1 18  ? -3.462  -32.125 7.608   1.00 17.66  ? 16  VAL B CG2 1 
ATOM   1535 N  N   . PRO B  1 19  ? -3.945  -34.474 3.370   1.00 16.15  ? 17  PRO B N   1 
ATOM   1536 C  CA  . PRO B  1 19  ? -4.536  -35.528 2.571   1.00 15.55  ? 17  PRO B CA  1 
ATOM   1537 C  C   . PRO B  1 19  ? -4.708  -36.817 3.364   1.00 16.15  ? 17  PRO B C   1 
ATOM   1538 O  O   . PRO B  1 19  ? -3.989  -37.072 4.344   1.00 15.80  ? 17  PRO B O   1 
ATOM   1539 C  CB  . PRO B  1 19  ? -3.525  -35.725 1.442   1.00 16.38  ? 17  PRO B CB  1 
ATOM   1540 C  CG  . PRO B  1 19  ? -2.789  -34.426 1.342   1.00 17.13  ? 17  PRO B CG  1 
ATOM   1541 C  CD  . PRO B  1 19  ? -2.747  -33.887 2.744   1.00 17.08  ? 17  PRO B CD  1 
ATOM   1542 N  N   . LEU B  1 20  ? -5.681  -37.612 2.940   1.00 16.65  ? 18  LEU B N   1 
ATOM   1543 C  CA  . LEU B  1 20  ? -5.860  -38.961 3.447   1.00 16.24  ? 18  LEU B CA  1 
ATOM   1544 C  C   . LEU B  1 20  ? -5.494  -39.938 2.334   1.00 16.27  ? 18  LEU B C   1 
ATOM   1545 O  O   . LEU B  1 20  ? -6.006  -39.842 1.233   1.00 16.74  ? 18  LEU B O   1 
ATOM   1546 C  CB  . LEU B  1 20  ? -7.303  -39.156 3.849   1.00 15.80  ? 18  LEU B CB  1 
ATOM   1547 C  CG  . LEU B  1 20  ? -7.696  -40.556 4.280   1.00 17.09  ? 18  LEU B CG  1 
ATOM   1548 C  CD1 . LEU B  1 20  ? -7.112  -40.874 5.651   1.00 17.20  ? 18  LEU B CD1 1 
ATOM   1549 C  CD2 . LEU B  1 20  ? -9.220  -40.679 4.289   1.00 17.58  ? 18  LEU B CD2 1 
ATOM   1550 N  N   . GLN B  1 21  ? -4.595  -40.867 2.622   1.00 16.04  ? 19  GLN B N   1 
ATOM   1551 C  CA  . GLN B  1 21  ? -4.288  -41.923 1.680   1.00 17.57  ? 19  GLN B CA  1 
ATOM   1552 C  C   . GLN B  1 21  ? -5.600  -42.556 1.175   1.00 17.91  ? 19  GLN B C   1 
ATOM   1553 O  O   . GLN B  1 21  ? -6.402  -43.061 1.957   1.00 16.18  ? 19  GLN B O   1 
ATOM   1554 C  CB  . GLN B  1 21  ? -3.393  -42.979 2.349   1.00 16.24  ? 19  GLN B CB  1 
ATOM   1555 C  CG  . GLN B  1 21  ? -3.129  -44.208 1.504   1.00 15.29  ? 19  GLN B CG  1 
ATOM   1556 C  CD  . GLN B  1 21  ? -2.404  -43.871 0.213   1.00 14.68  ? 19  GLN B CD  1 
ATOM   1557 O  OE1 . GLN B  1 21  ? -1.343  -43.253 0.223   1.00 15.19  ? 19  GLN B OE1 1 
ATOM   1558 N  NE2 . GLN B  1 21  ? -2.942  -44.337 -0.896  1.00 14.46  ? 19  GLN B NE2 1 
ATOM   1559 N  N   . GLN B  1 22  ? -5.812  -42.501 -0.128  1.00 18.99  ? 20  GLN B N   1 
ATOM   1560 C  CA  . GLN B  1 22  ? -6.971  -43.131 -0.746  1.00 23.19  ? 20  GLN B CA  1 
ATOM   1561 C  C   . GLN B  1 22  ? -6.947  -44.659 -0.542  1.00 21.08  ? 20  GLN B C   1 
ATOM   1562 O  O   . GLN B  1 22  ? -5.893  -45.302 -0.635  1.00 16.09  ? 20  GLN B O   1 
ATOM   1563 C  CB  . GLN B  1 22  ? -7.016  -42.750 -2.241  1.00 29.05  ? 20  GLN B CB  1 
ATOM   1564 C  CG  . GLN B  1 22  ? -8.227  -43.291 -2.996  1.00 44.29  ? 20  GLN B CG  1 
ATOM   1565 C  CD  . GLN B  1 22  ? -8.522  -42.584 -4.329  1.00 48.89  ? 20  GLN B CD  1 
ATOM   1566 O  OE1 . GLN B  1 22  ? -7.631  -42.033 -4.988  1.00 46.55  ? 20  GLN B OE1 1 
ATOM   1567 N  NE2 . GLN B  1 22  ? -9.786  -42.630 -4.740  1.00 47.48  ? 20  GLN B NE2 1 
ATOM   1568 N  N   . ASN B  1 23  ? -8.111  -45.230 -0.239  1.00 22.38  ? 21  ASN B N   1 
ATOM   1569 C  CA  . ASN B  1 23  ? -8.283  -46.698 -0.177  1.00 25.48  ? 21  ASN B CA  1 
ATOM   1570 C  C   . ASN B  1 23  ? -7.243  -47.387 0.708   1.00 22.78  ? 21  ASN B C   1 
ATOM   1571 O  O   . ASN B  1 23  ? -6.558  -48.328 0.289   1.00 22.10  ? 21  ASN B O   1 
ATOM   1572 C  CB  . ASN B  1 23  ? -8.275  -47.319 -1.575  1.00 29.90  ? 21  ASN B CB  1 
ATOM   1573 C  CG  . ASN B  1 23  ? -8.798  -48.761 -1.587  1.00 45.58  ? 21  ASN B CG  1 
ATOM   1574 O  OD1 . ASN B  1 23  ? -9.643  -49.143 -0.771  1.00 49.29  ? 21  ASN B OD1 1 
ATOM   1575 N  ND2 . ASN B  1 23  ? -8.307  -49.563 -2.531  1.00 47.15  ? 21  ASN B ND2 1 
ATOM   1576 N  N   . PHE B  1 24  ? -7.145  -46.918 1.944   1.00 18.72  ? 22  PHE B N   1 
ATOM   1577 C  CA  . PHE B  1 24  ? -6.124  -47.396 2.863   1.00 18.23  ? 22  PHE B CA  1 
ATOM   1578 C  C   . PHE B  1 24  ? -6.234  -48.902 3.121   1.00 18.41  ? 22  PHE B C   1 
ATOM   1579 O  O   . PHE B  1 24  ? -7.326  -49.439 3.305   1.00 19.61  ? 22  PHE B O   1 
ATOM   1580 C  CB  . PHE B  1 24  ? -6.242  -46.642 4.182   1.00 18.20  ? 22  PHE B CB  1 
ATOM   1581 C  CG  . PHE B  1 24  ? -5.285  -47.101 5.217   1.00 17.30  ? 22  PHE B CG  1 
ATOM   1582 C  CD1 . PHE B  1 24  ? -5.701  -47.923 6.238   1.00 17.14  ? 22  PHE B CD1 1 
ATOM   1583 C  CD2 . PHE B  1 24  ? -3.955  -46.740 5.149   1.00 19.54  ? 22  PHE B CD2 1 
ATOM   1584 C  CE1 . PHE B  1 24  ? -4.821  -48.347 7.197   1.00 17.23  ? 22  PHE B CE1 1 
ATOM   1585 C  CE2 . PHE B  1 24  ? -3.061  -47.167 6.108   1.00 16.76  ? 22  PHE B CE2 1 
ATOM   1586 C  CZ  . PHE B  1 24  ? -3.498  -47.975 7.128   1.00 17.36  ? 22  PHE B CZ  1 
ATOM   1587 N  N   . GLN B  1 25  ? -5.095  -49.579 3.098   1.00 17.44  ? 23  GLN B N   1 
ATOM   1588 C  CA  . GLN B  1 25  ? -5.053  -51.026 3.235   1.00 17.89  ? 23  GLN B CA  1 
ATOM   1589 C  C   . GLN B  1 25  ? -4.409  -51.425 4.541   1.00 17.28  ? 23  GLN B C   1 
ATOM   1590 O  O   . GLN B  1 25  ? -3.177  -51.472 4.650   1.00 15.98  ? 23  GLN B O   1 
ATOM   1591 C  CB  . GLN B  1 25  ? -4.270  -51.632 2.084   1.00 18.88  ? 23  GLN B CB  1 
ATOM   1592 C  CG  . GLN B  1 25  ? -4.974  -51.421 0.767   1.00 21.30  ? 23  GLN B CG  1 
ATOM   1593 C  CD  . GLN B  1 25  ? -4.121  -51.820 -0.412  1.00 22.37  ? 23  GLN B CD  1 
ATOM   1594 O  OE1 . GLN B  1 25  ? -3.982  -53.003 -0.713  1.00 24.40  ? 23  GLN B OE1 1 
ATOM   1595 N  NE2 . GLN B  1 25  ? -3.555  -50.833 -1.095  1.00 22.85  ? 23  GLN B NE2 1 
ATOM   1596 N  N   . ASP B  1 26  ? -5.245  -51.696 5.536   1.00 17.41  ? 24  ASP B N   1 
ATOM   1597 C  CA  . ASP B  1 26  ? -4.759  -51.835 6.900   1.00 16.88  ? 24  ASP B CA  1 
ATOM   1598 C  C   . ASP B  1 26  ? -3.793  -53.021 7.052   1.00 17.64  ? 24  ASP B C   1 
ATOM   1599 O  O   . ASP B  1 26  ? -2.834  -52.949 7.812   1.00 17.76  ? 24  ASP B O   1 
ATOM   1600 C  CB  . ASP B  1 26  ? -5.920  -51.908 7.896   1.00 17.71  ? 24  ASP B CB  1 
ATOM   1601 C  CG  . ASP B  1 26  ? -6.889  -53.072 7.631   1.00 20.03  ? 24  ASP B CG  1 
ATOM   1602 O  OD1 . ASP B  1 26  ? -6.658  -53.885 6.710   1.00 20.30  ? 24  ASP B OD1 1 
ATOM   1603 O  OD2 . ASP B  1 26  ? -7.914  -53.147 8.348   1.00 20.46  ? 24  ASP B OD2 1 
ATOM   1604 N  N   . ASN B  1 27  ? -4.031  -54.101 6.319   1.00 18.11  ? 25  ASN B N   1 
ATOM   1605 C  CA  . ASN B  1 27  ? -3.176  -55.270 6.433   1.00 19.82  ? 25  ASN B CA  1 
ATOM   1606 C  C   . ASN B  1 27  ? -1.784  -55.002 5.850   1.00 18.61  ? 25  ASN B C   1 
ATOM   1607 O  O   . ASN B  1 27  ? -0.770  -55.407 6.424   1.00 16.92  ? 25  ASN B O   1 
ATOM   1608 C  CB  . ASN B  1 27  ? -3.817  -56.470 5.734   1.00 22.23  ? 25  ASN B CB  1 
ATOM   1609 C  CG  . ASN B  1 27  ? -3.183  -57.792 6.146   1.00 24.24  ? 25  ASN B CG  1 
ATOM   1610 O  OD1 . ASN B  1 27  ? -1.999  -58.024 5.933   1.00 27.02  ? 25  ASN B OD1 1 
ATOM   1611 N  ND2 . ASN B  1 27  ? -3.974  -58.656 6.755   1.00 26.75  ? 25  ASN B ND2 1 
ATOM   1612 N  N   . GLN B  1 28  ? -1.744  -54.282 4.729   1.00 18.01  ? 26  GLN B N   1 
ATOM   1613 C  CA  . GLN B  1 28  ? -0.480  -53.945 4.071   1.00 17.52  ? 26  GLN B CA  1 
ATOM   1614 C  C   . GLN B  1 28  ? 0.356   -52.942 4.859   1.00 17.50  ? 26  GLN B C   1 
ATOM   1615 O  O   . GLN B  1 28  ? 1.567   -52.873 4.693   1.00 19.57  ? 26  GLN B O   1 
ATOM   1616 C  CB  . GLN B  1 28  ? -0.735  -53.395 2.675   1.00 17.06  ? 26  GLN B CB  1 
ATOM   1617 C  CG  . GLN B  1 28  ? -1.268  -54.454 1.715   1.00 17.65  ? 26  GLN B CG  1 
ATOM   1618 C  CD  . GLN B  1 28  ? -0.174  -55.146 0.938   1.00 17.64  ? 26  GLN B CD  1 
ATOM   1619 O  OE1 . GLN B  1 28  ? 0.999   -54.868 1.117   1.00 17.63  ? 26  GLN B OE1 1 
ATOM   1620 N  NE2 . GLN B  1 28  ? -0.560  -56.050 0.059   1.00 19.98  ? 26  GLN B NE2 1 
ATOM   1621 N  N   . PHE B  1 29  ? -0.282  -52.192 5.747   1.00 17.79  ? 27  PHE B N   1 
ATOM   1622 C  CA  . PHE B  1 29  ? 0.418   -51.168 6.505   1.00 16.78  ? 27  PHE B CA  1 
ATOM   1623 C  C   . PHE B  1 29  ? 1.111   -51.726 7.755   1.00 16.43  ? 27  PHE B C   1 
ATOM   1624 O  O   . PHE B  1 29  ? 1.899   -51.030 8.381   1.00 15.66  ? 27  PHE B O   1 
ATOM   1625 C  CB  . PHE B  1 29  ? -0.557  -50.055 6.902   1.00 16.84  ? 27  PHE B CB  1 
ATOM   1626 C  CG  . PHE B  1 29  ? 0.118   -48.803 7.379   1.00 15.16  ? 27  PHE B CG  1 
ATOM   1627 C  CD1 . PHE B  1 29  ? 0.135   -48.483 8.717   1.00 14.72  ? 27  PHE B CD1 1 
ATOM   1628 C  CD2 . PHE B  1 29  ? 0.761   -47.963 6.485   1.00 16.85  ? 27  PHE B CD2 1 
ATOM   1629 C  CE1 . PHE B  1 29  ? 0.756   -47.340 9.159   1.00 14.35  ? 27  PHE B CE1 1 
ATOM   1630 C  CE2 . PHE B  1 29  ? 1.399   -46.818 6.920   1.00 15.36  ? 27  PHE B CE2 1 
ATOM   1631 C  CZ  . PHE B  1 29  ? 1.392   -46.511 8.260   1.00 14.77  ? 27  PHE B CZ  1 
ATOM   1632 N  N   . GLN B  1 30  ? 0.790   -52.964 8.118   1.00 18.30  ? 28  GLN B N   1 
ATOM   1633 C  CA  . GLN B  1 30  ? 1.343   -53.626 9.313   1.00 19.90  ? 28  GLN B CA  1 
ATOM   1634 C  C   . GLN B  1 30  ? 2.839   -53.744 9.297   1.00 17.46  ? 28  GLN B C   1 
ATOM   1635 O  O   . GLN B  1 30  ? 3.443   -53.705 8.246   1.00 14.72  ? 28  GLN B O   1 
ATOM   1636 C  CB  . GLN B  1 30  ? 0.862   -55.073 9.372   1.00 22.89  ? 28  GLN B CB  1 
ATOM   1637 C  CG  . GLN B  1 30  ? -0.555  -55.247 9.814   1.00 28.90  ? 28  GLN B CG  1 
ATOM   1638 C  CD  . GLN B  1 30  ? -0.851  -56.702 10.060  1.00 31.71  ? 28  GLN B CD  1 
ATOM   1639 O  OE1 . GLN B  1 30  ? -0.802  -57.176 11.194  1.00 31.38  ? 28  GLN B OE1 1 
ATOM   1640 N  NE2 . GLN B  1 30  ? -1.159  -57.422 8.990   1.00 31.45  ? 28  GLN B NE2 1 
ATOM   1641 N  N   . GLY B  1 31  ? 3.402   -54.037 10.468  1.00 18.28  ? 29  GLY B N   1 
ATOM   1642 C  CA  . GLY B  1 31  ? 4.818   -54.340 10.602  1.00 18.50  ? 29  GLY B CA  1 
ATOM   1643 C  C   . GLY B  1 31  ? 5.608   -53.167 11.172  1.00 19.88  ? 29  GLY B C   1 
ATOM   1644 O  O   . GLY B  1 31  ? 5.041   -52.203 11.707  1.00 17.16  ? 29  GLY B O   1 
ATOM   1645 N  N   . LYS B  1 32  ? 6.922   -53.244 11.026  1.00 19.25  ? 30  LYS B N   1 
ATOM   1646 C  CA  . LYS B  1 32  ? 7.806   -52.271 11.616  1.00 18.16  ? 30  LYS B CA  1 
ATOM   1647 C  C   . LYS B  1 32  ? 8.015   -51.132 10.646  1.00 16.91  ? 30  LYS B C   1 
ATOM   1648 O  O   . LYS B  1 32  ? 8.209   -51.341 9.443   1.00 15.99  ? 30  LYS B O   1 
ATOM   1649 C  CB  . LYS B  1 32  ? 9.143   -52.914 11.963  1.00 19.57  ? 30  LYS B CB  1 
ATOM   1650 C  CG  . LYS B  1 32  ? 10.135  -51.949 12.589  1.00 20.99  ? 30  LYS B CG  1 
ATOM   1651 C  CD  . LYS B  1 32  ? 11.437  -52.634 12.962  1.00 22.73  ? 30  LYS B CD  1 
ATOM   1652 C  CE  . LYS B  1 32  ? 11.337  -53.321 14.313  1.00 24.25  ? 30  LYS B CE  1 
ATOM   1653 N  NZ  . LYS B  1 32  ? 12.633  -53.959 14.694  1.00 27.65  ? 30  LYS B NZ  1 
ATOM   1654 N  N   . TRP B  1 33  ? 7.986   -49.922 11.186  1.00 17.15  ? 31  TRP B N   1 
ATOM   1655 C  CA  . TRP B  1 33  ? 8.411   -48.734 10.460  1.00 17.06  ? 31  TRP B CA  1 
ATOM   1656 C  C   . TRP B  1 33  ? 9.458   -47.999 11.288  1.00 17.47  ? 31  TRP B C   1 
ATOM   1657 O  O   . TRP B  1 33  ? 9.324   -47.870 12.503  1.00 21.13  ? 31  TRP B O   1 
ATOM   1658 C  CB  . TRP B  1 33  ? 7.217   -47.790 10.230  1.00 16.55  ? 31  TRP B CB  1 
ATOM   1659 C  CG  . TRP B  1 33  ? 6.143   -48.274 9.269   1.00 14.39  ? 31  TRP B CG  1 
ATOM   1660 C  CD1 . TRP B  1 33  ? 4.948   -48.834 9.603   1.00 13.90  ? 31  TRP B CD1 1 
ATOM   1661 C  CD2 . TRP B  1 33  ? 6.132   -48.130 7.851   1.00 14.02  ? 31  TRP B CD2 1 
ATOM   1662 N  NE1 . TRP B  1 33  ? 4.215   -49.095 8.480   1.00 13.52  ? 31  TRP B NE1 1 
ATOM   1663 C  CE2 . TRP B  1 33  ? 4.921   -48.672 7.388   1.00 13.71  ? 31  TRP B CE2 1 
ATOM   1664 C  CE3 . TRP B  1 33  ? 7.044   -47.619 6.920   1.00 14.45  ? 31  TRP B CE3 1 
ATOM   1665 C  CZ2 . TRP B  1 33  ? 4.593   -48.721 6.041   1.00 14.20  ? 31  TRP B CZ2 1 
ATOM   1666 C  CZ3 . TRP B  1 33  ? 6.717   -47.655 5.591   1.00 14.63  ? 31  TRP B CZ3 1 
ATOM   1667 C  CH2 . TRP B  1 33  ? 5.497   -48.206 5.157   1.00 15.00  ? 31  TRP B CH2 1 
ATOM   1668 N  N   . TYR B  1 34  ? 10.468  -47.460 10.623  1.00 17.46  ? 32  TYR B N   1 
ATOM   1669 C  CA  . TYR B  1 34  ? 11.442  -46.614 11.287  1.00 17.32  ? 32  TYR B CA  1 
ATOM   1670 C  C   . TYR B  1 34  ? 11.042  -45.159 11.145  1.00 16.79  ? 32  TYR B C   1 
ATOM   1671 O  O   . TYR B  1 34  ? 10.602  -44.738 10.079  1.00 15.42  ? 32  TYR B O   1 
ATOM   1672 C  CB  . TYR B  1 34  ? 12.820  -46.825 10.666  1.00 19.08  ? 32  TYR B CB  1 
ATOM   1673 C  CG  . TYR B  1 34  ? 13.412  -48.188 10.929  1.00 20.47  ? 32  TYR B CG  1 
ATOM   1674 C  CD1 . TYR B  1 34  ? 14.035  -48.470 12.138  1.00 21.09  ? 32  TYR B CD1 1 
ATOM   1675 C  CD2 . TYR B  1 34  ? 13.350  -49.195 9.963   1.00 21.20  ? 32  TYR B CD2 1 
ATOM   1676 C  CE1 . TYR B  1 34  ? 14.568  -49.718 12.391  1.00 23.06  ? 32  TYR B CE1 1 
ATOM   1677 C  CE2 . TYR B  1 34  ? 13.891  -50.444 10.199  1.00 22.23  ? 32  TYR B CE2 1 
ATOM   1678 C  CZ  . TYR B  1 34  ? 14.498  -50.699 11.416  1.00 24.11  ? 32  TYR B CZ  1 
ATOM   1679 O  OH  . TYR B  1 34  ? 15.045  -51.930 11.666  1.00 26.14  ? 32  TYR B OH  1 
ATOM   1680 N  N   . VAL B  1 35  ? 11.212  -44.380 12.209  1.00 16.82  ? 33  VAL B N   1 
ATOM   1681 C  CA  . VAL B  1 35  ? 10.912  -42.971 12.128  1.00 17.15  ? 33  VAL B CA  1 
ATOM   1682 C  C   . VAL B  1 35  ? 12.113  -42.230 11.583  1.00 18.89  ? 33  VAL B C   1 
ATOM   1683 O  O   . VAL B  1 35  ? 13.070  -41.937 12.296  1.00 20.25  ? 33  VAL B O   1 
ATOM   1684 C  CB  . VAL B  1 35  ? 10.477  -42.385 13.480  1.00 18.07  ? 33  VAL B CB  1 
ATOM   1685 C  CG1 . VAL B  1 35  ? 10.267  -40.887 13.365  1.00 17.72  ? 33  VAL B CG1 1 
ATOM   1686 C  CG2 . VAL B  1 35  ? 9.204   -43.058 13.948  1.00 17.41  ? 33  VAL B CG2 1 
ATOM   1687 N  N   . VAL B  1 36  ? 12.050  -41.940 10.291  1.00 20.14  ? 34  VAL B N   1 
ATOM   1688 C  CA  . VAL B  1 36  ? 13.178  -41.405 9.550   1.00 20.75  ? 34  VAL B CA  1 
ATOM   1689 C  C   . VAL B  1 36  ? 13.099  -39.881 9.549   1.00 20.77  ? 34  VAL B C   1 
ATOM   1690 O  O   . VAL B  1 36  ? 14.112  -39.195 9.404   1.00 20.57  ? 34  VAL B O   1 
ATOM   1691 C  CB  . VAL B  1 36  ? 13.152  -41.943 8.101   1.00 22.61  ? 34  VAL B CB  1 
ATOM   1692 C  CG1 . VAL B  1 36  ? 14.082  -41.139 7.204   1.00 25.28  ? 34  VAL B CG1 1 
ATOM   1693 C  CG2 . VAL B  1 36  ? 13.531  -43.419 8.086   1.00 23.17  ? 34  VAL B CG2 1 
ATOM   1694 N  N   . GLY B  1 37  ? 11.882  -39.359 9.707   1.00 20.01  ? 35  GLY B N   1 
ATOM   1695 C  CA  . GLY B  1 37  ? 11.670  -37.917 9.819   1.00 21.24  ? 35  GLY B CA  1 
ATOM   1696 C  C   . GLY B  1 37  ? 10.573  -37.556 10.802  1.00 20.41  ? 35  GLY B C   1 
ATOM   1697 O  O   . GLY B  1 37  ? 9.610   -38.284 10.944  1.00 19.01  ? 35  GLY B O   1 
ATOM   1698 N  N   . LEU B  1 38  ? 10.723  -36.410 11.465  1.00 21.82  ? 36  LEU B N   1 
ATOM   1699 C  CA  . LEU B  1 38  ? 9.767   -35.945 12.470  1.00 21.41  ? 36  LEU B CA  1 
ATOM   1700 C  C   . LEU B  1 38  ? 9.598   -34.449 12.328  1.00 20.36  ? 36  LEU B C   1 
ATOM   1701 O  O   . LEU B  1 38  ? 10.580  -33.718 12.324  1.00 22.17  ? 36  LEU B O   1 
ATOM   1702 C  CB  . LEU B  1 38  ? 10.335  -36.185 13.859  1.00 24.15  ? 36  LEU B CB  1 
ATOM   1703 C  CG  . LEU B  1 38  ? 9.705   -37.227 14.756  1.00 25.43  ? 36  LEU B CG  1 
ATOM   1704 C  CD1 . LEU B  1 38  ? 10.333  -37.097 16.137  1.00 27.21  ? 36  LEU B CD1 1 
ATOM   1705 C  CD2 . LEU B  1 38  ? 8.203   -37.051 14.827  1.00 25.32  ? 36  LEU B CD2 1 
ATOM   1706 N  N   . ALA B  1 39  ? 8.363   -33.986 12.245  1.00 18.77  ? 37  ALA B N   1 
ATOM   1707 C  CA  . ALA B  1 39  ? 8.102   -32.558 12.213  1.00 19.56  ? 37  ALA B CA  1 
ATOM   1708 C  C   . ALA B  1 39  ? 6.866   -32.240 13.037  1.00 19.02  ? 37  ALA B C   1 
ATOM   1709 O  O   . ALA B  1 39  ? 5.926   -33.023 13.063  1.00 17.73  ? 37  ALA B O   1 
ATOM   1710 C  CB  . ALA B  1 39  ? 7.914   -32.093 10.775  1.00 19.47  ? 37  ALA B CB  1 
ATOM   1711 N  N   . GLY B  1 40  ? 6.865   -31.099 13.717  1.00 20.22  ? 38  GLY B N   1 
ATOM   1712 C  CA  . GLY B  1 40  ? 5.688   -30.705 14.489  1.00 19.89  ? 38  GLY B CA  1 
ATOM   1713 C  C   . GLY B  1 40  ? 5.879   -29.488 15.367  1.00 20.90  ? 38  GLY B C   1 
ATOM   1714 O  O   . GLY B  1 40  ? 6.999   -28.997 15.526  1.00 22.12  ? 38  GLY B O   1 
ATOM   1715 N  N   . ASN B  1 41  ? 4.786   -29.008 15.954  1.00 20.72  ? 39  ASN B N   1 
ATOM   1716 C  CA  . ASN B  1 41  ? 4.808   -27.723 16.644  1.00 22.31  ? 39  ASN B CA  1 
ATOM   1717 C  C   . ASN B  1 41  ? 5.431   -27.785 18.039  1.00 24.11  ? 39  ASN B C   1 
ATOM   1718 O  O   . ASN B  1 41  ? 5.665   -26.753 18.666  1.00 25.06  ? 39  ASN B O   1 
ATOM   1719 C  CB  . ASN B  1 41  ? 3.424   -27.056 16.661  1.00 21.75  ? 39  ASN B CB  1 
ATOM   1720 C  CG  . ASN B  1 41  ? 2.380   -27.826 17.466  1.00 21.48  ? 39  ASN B CG  1 
ATOM   1721 O  OD1 . ASN B  1 41  ? 2.582   -28.972 17.873  1.00 20.86  ? 39  ASN B OD1 1 
ATOM   1722 N  ND2 . ASN B  1 41  ? 1.224   -27.192 17.666  1.00 21.53  ? 39  ASN B ND2 1 
ATOM   1723 N  N   . ALA B  1 42  ? 5.761   -28.994 18.483  1.00 25.87  ? 40  ALA B N   1 
ATOM   1724 C  CA  . ALA B  1 42  ? 6.580   -29.197 19.681  1.00 29.82  ? 40  ALA B CA  1 
ATOM   1725 C  C   . ALA B  1 42  ? 7.890   -29.942 19.392  1.00 34.74  ? 40  ALA B C   1 
ATOM   1726 O  O   . ALA B  1 42  ? 8.625   -30.289 20.319  1.00 39.31  ? 40  ALA B O   1 
ATOM   1727 C  CB  . ALA B  1 42  ? 5.779   -29.946 20.733  1.00 28.99  ? 40  ALA B CB  1 
ATOM   1728 N  N   . ILE B  1 43  ? 8.179   -30.187 18.114  1.00 37.85  ? 41  ILE B N   1 
ATOM   1729 C  CA  . ILE B  1 43  ? 9.490   -30.695 17.691  1.00 42.96  ? 41  ILE B CA  1 
ATOM   1730 C  C   . ILE B  1 43  ? 10.483  -29.557 17.522  1.00 47.34  ? 41  ILE B C   1 
ATOM   1731 O  O   . ILE B  1 43  ? 10.215  -28.597 16.800  1.00 49.44  ? 41  ILE B O   1 
ATOM   1732 C  CB  . ILE B  1 43  ? 9.397   -31.435 16.343  1.00 44.93  ? 41  ILE B CB  1 
ATOM   1733 C  CG1 . ILE B  1 43  ? 8.562   -32.703 16.490  1.00 51.12  ? 41  ILE B CG1 1 
ATOM   1734 C  CG2 . ILE B  1 43  ? 10.782  -31.789 15.825  1.00 43.91  ? 41  ILE B CG2 1 
ATOM   1735 C  CD1 . ILE B  1 43  ? 9.138   -33.685 17.487  1.00 54.31  ? 41  ILE B CD1 1 
ATOM   1736 N  N   . LEU B  1 44  ? 11.637  -29.678 18.173  1.00 53.78  ? 42  LEU B N   1 
ATOM   1737 C  CA  . LEU B  1 44  ? 12.665  -28.640 18.120  1.00 60.94  ? 42  LEU B CA  1 
ATOM   1738 C  C   . LEU B  1 44  ? 14.047  -29.254 17.859  1.00 58.82  ? 42  LEU B C   1 
ATOM   1739 O  O   . LEU B  1 44  ? 14.527  -30.079 18.635  1.00 53.44  ? 42  LEU B O   1 
ATOM   1740 C  CB  . LEU B  1 44  ? 12.673  -27.837 19.431  1.00 68.07  ? 42  LEU B CB  1 
ATOM   1741 C  CG  . LEU B  1 44  ? 13.104  -26.363 19.355  1.00 74.90  ? 42  LEU B CG  1 
ATOM   1742 C  CD1 . LEU B  1 44  ? 12.782  -25.748 17.999  1.00 75.87  ? 42  LEU B CD1 1 
ATOM   1743 C  CD2 . LEU B  1 44  ? 12.449  -25.563 20.471  1.00 74.15  ? 42  LEU B CD2 1 
ATOM   1744 N  N   . ARG B  1 45  ? 14.672  -28.851 16.755  1.00 62.98  ? 43  ARG B N   1 
ATOM   1745 C  CA  . ARG B  1 45  ? 16.029  -29.291 16.427  1.00 68.89  ? 43  ARG B CA  1 
ATOM   1746 C  C   . ARG B  1 45  ? 16.997  -28.896 17.540  1.00 73.82  ? 43  ARG B C   1 
ATOM   1747 O  O   . ARG B  1 45  ? 17.114  -27.720 17.884  1.00 73.94  ? 43  ARG B O   1 
ATOM   1748 C  CB  . ARG B  1 45  ? 16.485  -28.668 15.101  1.00 72.82  ? 43  ARG B CB  1 
ATOM   1749 C  CG  . ARG B  1 45  ? 17.505  -29.492 14.320  1.00 73.82  ? 43  ARG B CG  1 
ATOM   1750 C  CD  . ARG B  1 45  ? 17.463  -29.175 12.838  1.00 74.53  ? 43  ARG B CD  1 
ATOM   1751 N  NE  . ARG B  1 45  ? 17.799  -27.775 12.579  1.00 78.16  ? 43  ARG B NE  1 
ATOM   1752 C  CZ  . ARG B  1 45  ? 17.585  -27.151 11.423  1.00 82.67  ? 43  ARG B CZ  1 
ATOM   1753 N  NH1 . ARG B  1 45  ? 17.911  -25.872 11.289  1.00 83.35  ? 43  ARG B NH1 1 
ATOM   1754 N  NH2 . ARG B  1 45  ? 17.039  -27.799 10.402  1.00 89.99  ? 43  ARG B NH2 1 
ATOM   1755 N  N   . GLU B  1 46  ? 17.677  -29.886 18.108  1.00 73.73  ? 44  GLU B N   1 
ATOM   1756 C  CA  . GLU B  1 46  ? 18.786  -29.626 19.021  1.00 79.85  ? 44  GLU B CA  1 
ATOM   1757 C  C   . GLU B  1 46  ? 20.103  -30.077 18.376  1.00 82.43  ? 44  GLU B C   1 
ATOM   1758 O  O   . GLU B  1 46  ? 20.394  -31.271 18.301  1.00 76.15  ? 44  GLU B O   1 
ATOM   1759 C  CB  . GLU B  1 46  ? 18.555  -30.336 20.360  1.00 76.78  ? 44  GLU B CB  1 
ATOM   1760 N  N   . ASP B  1 47  ? 20.876  -29.112 17.880  1.00 81.89  ? 45  ASP B N   1 
ATOM   1761 C  CA  . ASP B  1 47  ? 22.179  -29.385 17.273  1.00 83.04  ? 45  ASP B CA  1 
ATOM   1762 C  C   . ASP B  1 47  ? 23.115  -30.086 18.264  1.00 81.81  ? 45  ASP B C   1 
ATOM   1763 O  O   . ASP B  1 47  ? 23.841  -31.008 17.898  1.00 70.88  ? 45  ASP B O   1 
ATOM   1764 C  CB  . ASP B  1 47  ? 22.816  -28.080 16.781  1.00 82.72  ? 45  ASP B CB  1 
ATOM   1765 N  N   . LYS B  1 48  ? 23.075  -29.654 19.522  1.00 89.42  ? 46  LYS B N   1 
ATOM   1766 C  CA  . LYS B  1 48  ? 23.965  -30.182 20.554  1.00 92.26  ? 46  LYS B CA  1 
ATOM   1767 C  C   . LYS B  1 48  ? 23.679  -31.655 20.852  1.00 92.56  ? 46  LYS B C   1 
ATOM   1768 O  O   . LYS B  1 48  ? 24.603  -32.457 20.961  1.00 96.65  ? 46  LYS B O   1 
ATOM   1769 C  CB  . LYS B  1 48  ? 23.844  -29.353 21.837  1.00 93.27  ? 46  LYS B CB  1 
ATOM   1770 N  N   . ASP B  1 49  ? 22.401  -32.007 20.976  1.00 93.53  ? 47  ASP B N   1 
ATOM   1771 C  CA  . ASP B  1 49  ? 22.007  -33.350 21.402  1.00 89.68  ? 47  ASP B CA  1 
ATOM   1772 C  C   . ASP B  1 49  ? 20.939  -33.963 20.484  1.00 77.88  ? 47  ASP B C   1 
ATOM   1773 O  O   . ASP B  1 49  ? 19.750  -33.950 20.809  1.00 74.29  ? 47  ASP B O   1 
ATOM   1774 C  CB  . ASP B  1 49  ? 21.485  -33.302 22.839  1.00 93.53  ? 47  ASP B CB  1 
ATOM   1775 C  CG  . ASP B  1 49  ? 20.976  -34.642 23.318  1.00 93.09  ? 47  ASP B CG  1 
ATOM   1776 O  OD1 . ASP B  1 49  ? 21.597  -35.676 22.988  1.00 91.23  ? 47  ASP B OD1 1 
ATOM   1777 O  OD2 . ASP B  1 49  ? 19.948  -34.657 24.026  1.00 91.32  ? 47  ASP B OD2 1 
ATOM   1778 N  N   . PRO B  1 50  ? 21.368  -34.535 19.346  1.00 67.09  ? 48  PRO B N   1 
ATOM   1779 C  CA  . PRO B  1 50  ? 20.437  -34.891 18.281  1.00 56.62  ? 48  PRO B CA  1 
ATOM   1780 C  C   . PRO B  1 50  ? 19.540  -36.065 18.658  1.00 48.98  ? 48  PRO B C   1 
ATOM   1781 O  O   . PRO B  1 50  ? 19.956  -36.967 19.381  1.00 47.27  ? 48  PRO B O   1 
ATOM   1782 C  CB  . PRO B  1 50  ? 21.360  -35.269 17.121  1.00 59.25  ? 48  PRO B CB  1 
ATOM   1783 C  CG  . PRO B  1 50  ? 22.600  -35.775 17.781  1.00 65.27  ? 48  PRO B CG  1 
ATOM   1784 C  CD  . PRO B  1 50  ? 22.734  -35.026 19.079  1.00 68.68  ? 48  PRO B CD  1 
ATOM   1785 N  N   . GLN B  1 51  ? 18.311  -36.042 18.170  1.00 43.37  ? 49  GLN B N   1 
ATOM   1786 C  CA  . GLN B  1 51  ? 17.351  -37.082 18.489  1.00 39.87  ? 49  GLN B CA  1 
ATOM   1787 C  C   . GLN B  1 51  ? 17.683  -38.393 17.767  1.00 35.86  ? 49  GLN B C   1 
ATOM   1788 O  O   . GLN B  1 51  ? 18.082  -38.397 16.605  1.00 32.57  ? 49  GLN B O   1 
ATOM   1789 C  CB  . GLN B  1 51  ? 15.949  -36.617 18.134  1.00 40.00  ? 49  GLN B CB  1 
ATOM   1790 C  CG  . GLN B  1 51  ? 14.987  -37.742 17.834  1.00 43.76  ? 49  GLN B CG  1 
ATOM   1791 C  CD  . GLN B  1 51  ? 13.690  -37.620 18.602  1.00 47.72  ? 49  GLN B CD  1 
ATOM   1792 O  OE1 . GLN B  1 51  ? 13.132  -36.532 18.735  1.00 52.78  ? 49  GLN B OE1 1 
ATOM   1793 N  NE2 . GLN B  1 51  ? 13.197  -38.745 19.106  1.00 50.70  ? 49  GLN B NE2 1 
ATOM   1794 N  N   . LYS B  1 52  ? 17.544  -39.503 18.488  1.00 32.84  ? 50  LYS B N   1 
ATOM   1795 C  CA  . LYS B  1 52  ? 17.857  -40.813 17.948  1.00 30.88  ? 50  LYS B CA  1 
ATOM   1796 C  C   . LYS B  1 52  ? 16.646  -41.430 17.264  1.00 26.47  ? 50  LYS B C   1 
ATOM   1797 O  O   . LYS B  1 52  ? 15.521  -41.253 17.705  1.00 25.31  ? 50  LYS B O   1 
ATOM   1798 C  CB  . LYS B  1 52  ? 18.351  -41.740 19.057  1.00 33.15  ? 50  LYS B CB  1 
ATOM   1799 C  CG  . LYS B  1 52  ? 19.683  -41.315 19.635  1.00 37.36  ? 50  LYS B CG  1 
ATOM   1800 C  CD  . LYS B  1 52  ? 20.136  -42.260 20.734  1.00 39.46  ? 50  LYS B CD  1 
ATOM   1801 C  CE  . LYS B  1 52  ? 21.213  -41.619 21.588  1.00 43.82  ? 50  LYS B CE  1 
ATOM   1802 N  NZ  . LYS B  1 52  ? 21.898  -42.647 22.411  1.00 46.11  ? 50  LYS B NZ  1 
ATOM   1803 N  N   . MET B  1 53  ? 16.899  -42.154 16.182  1.00 23.91  ? 51  MET B N   1 
ATOM   1804 C  CA  . MET B  1 53  ? 15.870  -42.929 15.519  1.00 21.50  ? 51  MET B CA  1 
ATOM   1805 C  C   . MET B  1 53  ? 15.238  -43.913 16.486  1.00 20.82  ? 51  MET B C   1 
ATOM   1806 O  O   . MET B  1 53  ? 15.914  -44.537 17.306  1.00 20.35  ? 51  MET B O   1 
ATOM   1807 C  CB  . MET B  1 53  ? 16.471  -43.686 14.334  1.00 20.62  ? 51  MET B CB  1 
ATOM   1808 C  CG  . MET B  1 53  ? 15.454  -44.358 13.438  1.00 18.76  ? 51  MET B CG  1 
ATOM   1809 S  SD  . MET B  1 53  ? 16.180  -44.936 11.894  1.00 19.05  ? 51  MET B SD  1 
ATOM   1810 C  CE  . MET B  1 53  ? 16.459  -43.389 11.054  1.00 19.32  ? 51  MET B CE  1 
ATOM   1811 N  N   . TYR B  1 54  ? 13.925  -44.060 16.357  1.00 20.16  ? 52  TYR B N   1 
ATOM   1812 C  CA  . TYR B  1 54  ? 13.203  -45.142 16.992  1.00 19.22  ? 52  TYR B CA  1 
ATOM   1813 C  C   . TYR B  1 54  ? 12.301  -45.806 15.974  1.00 17.70  ? 52  TYR B C   1 
ATOM   1814 O  O   . TYR B  1 54  ? 12.184  -45.338 14.846  1.00 17.06  ? 52  TYR B O   1 
ATOM   1815 C  CB  . TYR B  1 54  ? 12.385  -44.622 18.177  1.00 19.97  ? 52  TYR B CB  1 
ATOM   1816 C  CG  . TYR B  1 54  ? 11.376  -43.567 17.846  1.00 19.29  ? 52  TYR B CG  1 
ATOM   1817 C  CD1 . TYR B  1 54  ? 11.720  -42.222 17.861  1.00 20.14  ? 52  TYR B CD1 1 
ATOM   1818 C  CD2 . TYR B  1 54  ? 10.055  -43.902 17.574  1.00 18.88  ? 52  TYR B CD2 1 
ATOM   1819 C  CE1 . TYR B  1 54  ? 10.774  -41.245 17.590  1.00 20.69  ? 52  TYR B CE1 1 
ATOM   1820 C  CE2 . TYR B  1 54  ? 9.106   -42.931 17.302  1.00 18.65  ? 52  TYR B CE2 1 
ATOM   1821 C  CZ  . TYR B  1 54  ? 9.469   -41.606 17.310  1.00 19.52  ? 52  TYR B CZ  1 
ATOM   1822 O  OH  . TYR B  1 54  ? 8.531   -40.646 17.012  1.00 20.42  ? 52  TYR B OH  1 
ATOM   1823 N  N   . ALA B  1 55  ? 11.679  -46.911 16.373  1.00 17.44  ? 53  ALA B N   1 
ATOM   1824 C  CA  . ALA B  1 55  ? 10.816  -47.674 15.479  1.00 16.59  ? 53  ALA B CA  1 
ATOM   1825 C  C   . ALA B  1 55  ? 9.413   -47.805 16.046  1.00 16.17  ? 53  ALA B C   1 
ATOM   1826 O  O   . ALA B  1 55  ? 9.212   -47.816 17.258  1.00 16.81  ? 53  ALA B O   1 
ATOM   1827 C  CB  . ALA B  1 55  ? 11.401  -49.055 15.243  1.00 16.36  ? 53  ALA B CB  1 
ATOM   1828 N  N   . THR B  1 56  ? 8.442   -47.935 15.158  1.00 15.44  ? 54  THR B N   1 
ATOM   1829 C  CA  . THR B  1 56  ? 7.070   -48.104 15.579  1.00 15.51  ? 54  THR B CA  1 
ATOM   1830 C  C   . THR B  1 56  ? 6.445   -49.256 14.820  1.00 14.89  ? 54  THR B C   1 
ATOM   1831 O  O   . THR B  1 56  ? 6.508   -49.314 13.600  1.00 15.43  ? 54  THR B O   1 
ATOM   1832 C  CB  . THR B  1 56  ? 6.258   -46.802 15.371  1.00 14.16  ? 54  THR B CB  1 
ATOM   1833 O  OG1 . THR B  1 56  ? 6.793   -45.782 16.217  1.00 14.18  ? 54  THR B OG1 1 
ATOM   1834 C  CG2 . THR B  1 56  ? 4.809   -47.012 15.746  1.00 14.32  ? 54  THR B CG2 1 
ATOM   1835 N  N   . ILE B  1 57  ? 5.827   -50.157 15.560  1.00 16.07  ? 55  ILE B N   1 
ATOM   1836 C  CA  . ILE B  1 57  ? 5.368   -51.420 15.008  1.00 17.78  ? 55  ILE B CA  1 
ATOM   1837 C  C   . ILE B  1 57  ? 3.847   -51.482 15.066  1.00 18.01  ? 55  ILE B C   1 
ATOM   1838 O  O   . ILE B  1 57  ? 3.258   -51.390 16.148  1.00 18.00  ? 55  ILE B O   1 
ATOM   1839 C  CB  . ILE B  1 57  ? 5.960   -52.605 15.792  1.00 19.20  ? 55  ILE B CB  1 
ATOM   1840 C  CG1 . ILE B  1 57  ? 7.486   -52.529 15.768  1.00 21.33  ? 55  ILE B CG1 1 
ATOM   1841 C  CG2 . ILE B  1 57  ? 5.482   -53.928 15.208  1.00 19.23  ? 55  ILE B CG2 1 
ATOM   1842 C  CD1 . ILE B  1 57  ? 8.152   -53.351 16.848  1.00 26.33  ? 55  ILE B CD1 1 
ATOM   1843 N  N   . TYR B  1 58  ? 3.226   -51.677 13.907  1.00 17.10  ? 56  TYR B N   1 
ATOM   1844 C  CA  . TYR B  1 58  ? 1.775   -51.758 13.807  1.00 17.38  ? 56  TYR B CA  1 
ATOM   1845 C  C   . TYR B  1 58  ? 1.327   -53.206 13.640  1.00 19.91  ? 56  TYR B C   1 
ATOM   1846 O  O   . TYR B  1 58  ? 1.680   -53.871 12.655  1.00 22.21  ? 56  TYR B O   1 
ATOM   1847 C  CB  . TYR B  1 58  ? 1.298   -50.966 12.605  1.00 15.36  ? 56  TYR B CB  1 
ATOM   1848 C  CG  . TYR B  1 58  ? 1.389   -49.489 12.774  1.00 15.23  ? 56  TYR B CG  1 
ATOM   1849 C  CD1 . TYR B  1 58  ? 0.241   -48.721 12.939  1.00 16.28  ? 56  TYR B CD1 1 
ATOM   1850 C  CD2 . TYR B  1 58  ? 2.615   -48.838 12.751  1.00 14.88  ? 56  TYR B CD2 1 
ATOM   1851 C  CE1 . TYR B  1 58  ? 0.313   -47.347 13.075  1.00 15.75  ? 56  TYR B CE1 1 
ATOM   1852 C  CE2 . TYR B  1 58  ? 2.695   -47.472 12.897  1.00 14.75  ? 56  TYR B CE2 1 
ATOM   1853 C  CZ  . TYR B  1 58  ? 1.541   -46.733 13.047  1.00 15.26  ? 56  TYR B CZ  1 
ATOM   1854 O  OH  . TYR B  1 58  ? 1.608   -45.370 13.179  1.00 17.11  ? 56  TYR B OH  1 
ATOM   1855 N  N   . GLU B  1 59  ? 0.537   -53.692 14.586  1.00 22.85  ? 57  GLU B N   1 
ATOM   1856 C  CA  . GLU B  1 59  ? -0.025  -55.036 14.490  1.00 24.94  ? 57  GLU B CA  1 
ATOM   1857 C  C   . GLU B  1 59  ? -1.533  -54.980 14.401  1.00 23.65  ? 57  GLU B C   1 
ATOM   1858 O  O   . GLU B  1 59  ? -2.194  -54.473 15.305  1.00 23.23  ? 57  GLU B O   1 
ATOM   1859 C  CB  . GLU B  1 59  ? 0.373   -55.867 15.695  1.00 29.92  ? 57  GLU B CB  1 
ATOM   1860 C  CG  . GLU B  1 59  ? 1.712   -56.545 15.504  1.00 43.01  ? 57  GLU B CG  1 
ATOM   1861 C  CD  . GLU B  1 59  ? 2.302   -57.058 16.792  1.00 52.16  ? 57  GLU B CD  1 
ATOM   1862 O  OE1 . GLU B  1 59  ? 1.596   -57.017 17.835  1.00 56.49  ? 57  GLU B OE1 1 
ATOM   1863 O  OE2 . GLU B  1 59  ? 3.480   -57.486 16.744  1.00 55.99  ? 57  GLU B OE2 1 
ATOM   1864 N  N   . LEU B  1 60  ? -2.074  -55.499 13.305  1.00 24.07  ? 58  LEU B N   1 
ATOM   1865 C  CA  . LEU B  1 60  ? -3.514  -55.476 13.080  1.00 26.25  ? 58  LEU B CA  1 
ATOM   1866 C  C   . LEU B  1 60  ? -4.179  -56.580 13.888  1.00 26.48  ? 58  LEU B C   1 
ATOM   1867 O  O   . LEU B  1 60  ? -3.832  -57.741 13.745  1.00 28.06  ? 58  LEU B O   1 
ATOM   1868 C  CB  . LEU B  1 60  ? -3.800  -55.687 11.597  1.00 26.75  ? 58  LEU B CB  1 
ATOM   1869 C  CG  . LEU B  1 60  ? -5.231  -55.431 11.117  1.00 25.99  ? 58  LEU B CG  1 
ATOM   1870 C  CD1 . LEU B  1 60  ? -5.661  -54.001 11.427  1.00 25.70  ? 58  LEU B CD1 1 
ATOM   1871 C  CD2 . LEU B  1 60  ? -5.316  -55.718 9.628   1.00 24.05  ? 58  LEU B CD2 1 
ATOM   1872 N  N   . LYS B  1 61  ? -5.127  -56.220 14.742  1.00 29.80  ? 59  LYS B N   1 
ATOM   1873 C  CA  . LYS B  1 61  ? -5.829  -57.213 15.561  1.00 32.87  ? 59  LYS B CA  1 
ATOM   1874 C  C   . LYS B  1 61  ? -7.090  -57.733 14.860  1.00 34.03  ? 59  LYS B C   1 
ATOM   1875 O  O   . LYS B  1 61  ? -7.554  -57.152 13.884  1.00 30.22  ? 59  LYS B O   1 
ATOM   1876 C  CB  . LYS B  1 61  ? -6.210  -56.607 16.910  1.00 37.64  ? 59  LYS B CB  1 
ATOM   1877 C  CG  . LYS B  1 61  ? -5.070  -55.901 17.625  1.00 43.17  ? 59  LYS B CG  1 
ATOM   1878 C  CD  . LYS B  1 61  ? -5.214  -55.987 19.140  1.00 54.69  ? 59  LYS B CD  1 
ATOM   1879 C  CE  . LYS B  1 61  ? -6.575  -55.493 19.616  1.00 57.44  ? 59  LYS B CE  1 
ATOM   1880 N  NZ  . LYS B  1 61  ? -6.456  -54.437 20.657  1.00 53.12  ? 59  LYS B NZ  1 
ATOM   1881 N  N   . GLU B  1 62  ? -7.636  -58.832 15.372  1.00 39.93  ? 60  GLU B N   1 
ATOM   1882 C  CA  . GLU B  1 62  ? -8.871  -59.409 14.844  1.00 42.76  ? 60  GLU B CA  1 
ATOM   1883 C  C   . GLU B  1 62  ? -9.961  -58.360 14.678  1.00 39.55  ? 60  GLU B C   1 
ATOM   1884 O  O   . GLU B  1 62  ? -10.675 -58.367 13.675  1.00 36.27  ? 60  GLU B O   1 
ATOM   1885 C  CB  . GLU B  1 62  ? -9.381  -60.548 15.734  1.00 56.46  ? 60  GLU B CB  1 
ATOM   1886 C  CG  . GLU B  1 62  ? -8.464  -61.766 15.744  1.00 67.86  ? 60  GLU B CG  1 
ATOM   1887 C  CD  . GLU B  1 62  ? -9.188  -63.039 15.353  1.00 80.51  ? 60  GLU B CD  1 
ATOM   1888 O  OE1 . GLU B  1 62  ? -8.627  -63.790 14.535  1.00 84.07  ? 60  GLU B OE1 1 
ATOM   1889 O  OE2 . GLU B  1 62  ? -10.313 -63.282 15.847  1.00 86.25  ? 60  GLU B OE2 1 
ATOM   1890 N  N   . ASP B  1 63  ? -10.072 -57.448 15.643  1.00 34.79  ? 61  ASP B N   1 
ATOM   1891 C  CA  . ASP B  1 63  ? -11.130 -56.446 15.620  1.00 32.88  ? 61  ASP B CA  1 
ATOM   1892 C  C   . ASP B  1 63  ? -10.797 -55.218 14.776  1.00 30.47  ? 61  ASP B C   1 
ATOM   1893 O  O   . ASP B  1 63  ? -11.557 -54.252 14.763  1.00 28.84  ? 61  ASP B O   1 
ATOM   1894 C  CB  . ASP B  1 63  ? -11.500 -56.026 17.052  1.00 35.35  ? 61  ASP B CB  1 
ATOM   1895 C  CG  . ASP B  1 63  ? -10.448 -55.138 17.710  1.00 34.09  ? 61  ASP B CG  1 
ATOM   1896 O  OD1 . ASP B  1 63  ? -9.427  -54.804 17.073  1.00 30.42  ? 61  ASP B OD1 1 
ATOM   1897 O  OD2 . ASP B  1 63  ? -10.652 -54.768 18.881  1.00 38.70  ? 61  ASP B OD2 1 
ATOM   1898 N  N   . LYS B  1 64  ? -9.660  -55.256 14.081  1.00 29.97  ? 62  LYS B N   1 
ATOM   1899 C  CA  . LYS B  1 64  ? -9.279  -54.224 13.099  1.00 29.50  ? 62  LYS B CA  1 
ATOM   1900 C  C   . LYS B  1 64  ? -8.682  -52.970 13.724  1.00 27.30  ? 62  LYS B C   1 
ATOM   1901 O  O   . LYS B  1 64  ? -8.347  -52.018 13.020  1.00 26.44  ? 62  LYS B O   1 
ATOM   1902 C  CB  . LYS B  1 64  ? -10.459 -53.817 12.217  1.00 31.28  ? 62  LYS B CB  1 
ATOM   1903 C  CG  . LYS B  1 64  ? -11.041 -54.944 11.382  1.00 37.98  ? 62  LYS B CG  1 
ATOM   1904 C  CD  . LYS B  1 64  ? -9.998  -55.591 10.482  1.00 42.40  ? 62  LYS B CD  1 
ATOM   1905 C  CE  . LYS B  1 64  ? -10.614 -56.727 9.680   1.00 48.31  ? 62  LYS B CE  1 
ATOM   1906 N  NZ  . LYS B  1 64  ? -9.569  -57.623 9.119   1.00 56.35  ? 62  LYS B NZ  1 
ATOM   1907 N  N   . SER B  1 65  ? -8.513  -52.974 15.034  1.00 25.97  ? 63  SER B N   1 
ATOM   1908 C  CA  . SER B  1 65  ? -7.667  -51.980 15.672  1.00 26.42  ? 63  SER B CA  1 
ATOM   1909 C  C   . SER B  1 65  ? -6.206  -52.403 15.530  1.00 23.61  ? 63  SER B C   1 
ATOM   1910 O  O   . SER B  1 65  ? -5.906  -53.578 15.295  1.00 23.72  ? 63  SER B O   1 
ATOM   1911 C  CB  . SER B  1 65  ? -8.061  -51.830 17.143  1.00 29.12  ? 63  SER B CB  1 
ATOM   1912 O  OG  . SER B  1 65  ? -7.652  -52.971 17.884  1.00 40.17  ? 63  SER B OG  1 
ATOM   1913 N  N   . TYR B  1 66  ? -5.298  -51.444 15.660  1.00 21.05  ? 64  TYR B N   1 
ATOM   1914 C  CA  . TYR B  1 66  ? -3.867  -51.751 15.732  1.00 19.41  ? 64  TYR B CA  1 
ATOM   1915 C  C   . TYR B  1 66  ? -3.399  -51.740 17.182  1.00 20.11  ? 64  TYR B C   1 
ATOM   1916 O  O   . TYR B  1 66  ? -3.745  -50.842 17.951  1.00 19.50  ? 64  TYR B O   1 
ATOM   1917 C  CB  . TYR B  1 66  ? -3.053  -50.701 14.981  1.00 19.15  ? 64  TYR B CB  1 
ATOM   1918 C  CG  . TYR B  1 66  ? -3.066  -50.782 13.464  1.00 17.30  ? 64  TYR B CG  1 
ATOM   1919 C  CD1 . TYR B  1 66  ? -3.588  -49.749 12.714  1.00 18.03  ? 64  TYR B CD1 1 
ATOM   1920 C  CD2 . TYR B  1 66  ? -2.480  -51.843 12.786  1.00 17.66  ? 64  TYR B CD2 1 
ATOM   1921 C  CE1 . TYR B  1 66  ? -3.561  -49.776 11.327  1.00 17.70  ? 64  TYR B CE1 1 
ATOM   1922 C  CE2 . TYR B  1 66  ? -2.462  -51.887 11.393  1.00 18.29  ? 64  TYR B CE2 1 
ATOM   1923 C  CZ  . TYR B  1 66  ? -3.023  -50.857 10.667  1.00 17.12  ? 64  TYR B CZ  1 
ATOM   1924 O  OH  . TYR B  1 66  ? -2.993  -50.858 9.283   1.00 16.03  ? 64  TYR B OH  1 
ATOM   1925 N  N   . ASN B  1 67  ? -2.610  -52.745 17.551  1.00 20.96  ? 65  ASN B N   1 
ATOM   1926 C  CA  . ASN B  1 67  ? -1.645  -52.604 18.623  1.00 21.56  ? 65  ASN B CA  1 
ATOM   1927 C  C   . ASN B  1 67  ? -0.374  -51.947 18.084  1.00 19.73  ? 65  ASN B C   1 
ATOM   1928 O  O   . ASN B  1 67  ? 0.215   -52.408 17.100  1.00 19.13  ? 65  ASN B O   1 
ATOM   1929 C  CB  . ASN B  1 67  ? -1.351  -53.964 19.261  1.00 27.29  ? 65  ASN B CB  1 
ATOM   1930 C  CG  . ASN B  1 67  ? -2.175  -54.215 20.506  1.00 34.74  ? 65  ASN B CG  1 
ATOM   1931 O  OD1 . ASN B  1 67  ? -3.260  -53.658 20.684  1.00 42.77  ? 65  ASN B OD1 1 
ATOM   1932 N  ND2 . ASN B  1 67  ? -1.684  -55.096 21.354  1.00 45.33  ? 65  ASN B ND2 1 
ATOM   1933 N  N   . VAL B  1 68  ? -0.004  -50.822 18.683  1.00 17.51  ? 66  VAL B N   1 
ATOM   1934 C  CA  . VAL B  1 68  ? 1.083   -50.007 18.175  1.00 16.70  ? 66  VAL B CA  1 
ATOM   1935 C  C   . VAL B  1 68  ? 2.159   -49.920 19.238  1.00 17.25  ? 66  VAL B C   1 
ATOM   1936 O  O   . VAL B  1 68  ? 1.907   -49.470 20.356  1.00 18.12  ? 66  VAL B O   1 
ATOM   1937 C  CB  . VAL B  1 68  ? 0.616   -48.587 17.804  1.00 16.18  ? 66  VAL B CB  1 
ATOM   1938 C  CG1 . VAL B  1 68  ? 1.735   -47.807 17.128  1.00 15.62  ? 66  VAL B CG1 1 
ATOM   1939 C  CG2 . VAL B  1 68  ? -0.599  -48.658 16.893  1.00 15.89  ? 66  VAL B CG2 1 
ATOM   1940 N  N   . THR B  1 69  ? 3.358   -50.368 18.881  1.00 16.46  ? 67  THR B N   1 
ATOM   1941 C  CA  . THR B  1 69  ? 4.457   -50.429 19.820  1.00 16.62  ? 67  THR B CA  1 
ATOM   1942 C  C   . THR B  1 69  ? 5.618   -49.621 19.280  1.00 15.96  ? 67  THR B C   1 
ATOM   1943 O  O   . THR B  1 69  ? 6.088   -49.855 18.172  1.00 15.32  ? 67  THR B O   1 
ATOM   1944 C  CB  . THR B  1 69  ? 4.898   -51.879 20.055  1.00 17.60  ? 67  THR B CB  1 
ATOM   1945 O  OG1 . THR B  1 69  ? 3.756   -52.682 20.386  1.00 18.45  ? 67  THR B OG1 1 
ATOM   1946 C  CG2 . THR B  1 69  ? 5.915   -51.947 21.176  1.00 19.00  ? 67  THR B CG2 1 
ATOM   1947 N  N   . SER B  1 70  ? 6.058   -48.638 20.048  1.00 16.39  ? 68  SER B N   1 
ATOM   1948 C  CA  . SER B  1 70  ? 7.235   -47.872 19.683  1.00 16.66  ? 68  SER B CA  1 
ATOM   1949 C  C   . SER B  1 70  ? 8.397   -48.303 20.560  1.00 18.09  ? 68  SER B C   1 
ATOM   1950 O  O   . SER B  1 70  ? 8.252   -48.449 21.771  1.00 19.32  ? 68  SER B O   1 
ATOM   1951 C  CB  . SER B  1 70  ? 6.976   -46.369 19.837  1.00 16.74  ? 68  SER B CB  1 
ATOM   1952 O  OG  . SER B  1 70  ? 6.273   -45.860 18.709  1.00 15.25  ? 68  SER B OG  1 
ATOM   1953 N  N   . VAL B  1 71  ? 9.545   -48.520 19.939  1.00 18.36  ? 69  VAL B N   1 
ATOM   1954 C  CA  . VAL B  1 71  ? 10.734  -48.939 20.660  1.00 20.53  ? 69  VAL B CA  1 
ATOM   1955 C  C   . VAL B  1 71  ? 11.780  -47.835 20.585  1.00 20.39  ? 69  VAL B C   1 
ATOM   1956 O  O   . VAL B  1 71  ? 12.165  -47.433 19.497  1.00 19.02  ? 69  VAL B O   1 
ATOM   1957 C  CB  . VAL B  1 71  ? 11.320  -50.228 20.036  1.00 21.30  ? 69  VAL B CB  1 
ATOM   1958 C  CG1 . VAL B  1 71  ? 12.413  -50.813 20.919  1.00 22.56  ? 69  VAL B CG1 1 
ATOM   1959 C  CG2 . VAL B  1 71  ? 10.218  -51.253 19.808  1.00 22.60  ? 69  VAL B CG2 1 
ATOM   1960 N  N   . LEU B  1 72  ? 12.247  -47.372 21.740  1.00 21.89  ? 70  LEU B N   1 
ATOM   1961 C  CA  . LEU B  1 72  ? 13.240  -46.299 21.816  1.00 23.35  ? 70  LEU B CA  1 
ATOM   1962 C  C   . LEU B  1 72  ? 14.446  -46.750 22.618  1.00 24.37  ? 70  LEU B C   1 
ATOM   1963 O  O   . LEU B  1 72  ? 14.314  -47.536 23.553  1.00 25.46  ? 70  LEU B O   1 
ATOM   1964 C  CB  . LEU B  1 72  ? 12.647  -45.063 22.505  1.00 24.47  ? 70  LEU B CB  1 
ATOM   1965 C  CG  . LEU B  1 72  ? 11.560  -44.283 21.773  1.00 24.35  ? 70  LEU B CG  1 
ATOM   1966 C  CD1 . LEU B  1 72  ? 10.245  -45.049 21.797  1.00 24.41  ? 70  LEU B CD1 1 
ATOM   1967 C  CD2 . LEU B  1 72  ? 11.381  -42.919 22.425  1.00 26.64  ? 70  LEU B CD2 1 
ATOM   1968 N  N   . PHE B  1 73  ? 15.615  -46.216 22.287  1.00 24.86  ? 71  PHE B N   1 
ATOM   1969 C  CA  . PHE B  1 73  ? 16.809  -46.403 23.115  1.00 26.63  ? 71  PHE B CA  1 
ATOM   1970 C  C   . PHE B  1 73  ? 17.005  -45.164 23.969  1.00 30.28  ? 71  PHE B C   1 
ATOM   1971 O  O   . PHE B  1 73  ? 17.333  -44.104 23.460  1.00 32.15  ? 71  PHE B O   1 
ATOM   1972 C  CB  . PHE B  1 73  ? 18.034  -46.622 22.227  1.00 25.82  ? 71  PHE B CB  1 
ATOM   1973 C  CG  . PHE B  1 73  ? 19.302  -46.916 22.979  1.00 26.88  ? 71  PHE B CG  1 
ATOM   1974 C  CD1 . PHE B  1 73  ? 19.350  -47.916 23.938  1.00 27.23  ? 71  PHE B CD1 1 
ATOM   1975 C  CD2 . PHE B  1 73  ? 20.470  -46.219 22.691  1.00 27.84  ? 71  PHE B CD2 1 
ATOM   1976 C  CE1 . PHE B  1 73  ? 20.532  -48.211 24.609  1.00 28.82  ? 71  PHE B CE1 1 
ATOM   1977 C  CE2 . PHE B  1 73  ? 21.654  -46.506 23.357  1.00 29.46  ? 71  PHE B CE2 1 
ATOM   1978 C  CZ  . PHE B  1 73  ? 21.688  -47.506 24.318  1.00 29.81  ? 71  PHE B CZ  1 
ATOM   1979 N  N   . ARG B  1 74  ? 16.789  -45.286 25.268  1.00 35.43  ? 72  ARG B N   1 
ATOM   1980 C  CA  . ARG B  1 74  ? 16.951  -44.148 26.159  1.00 40.38  ? 72  ARG B CA  1 
ATOM   1981 C  C   . ARG B  1 74  ? 17.473  -44.562 27.525  1.00 41.45  ? 72  ARG B C   1 
ATOM   1982 O  O   . ARG B  1 74  ? 17.045  -45.564 28.102  1.00 40.79  ? 72  ARG B O   1 
ATOM   1983 C  CB  . ARG B  1 74  ? 15.651  -43.352 26.288  1.00 47.00  ? 72  ARG B CB  1 
ATOM   1984 C  CG  . ARG B  1 74  ? 14.512  -44.078 26.975  1.00 54.93  ? 72  ARG B CG  1 
ATOM   1985 C  CD  . ARG B  1 74  ? 13.222  -43.257 26.932  1.00 66.68  ? 72  ARG B CD  1 
ATOM   1986 N  NE  . ARG B  1 74  ? 13.240  -42.121 27.858  1.00 77.39  ? 72  ARG B NE  1 
ATOM   1987 C  CZ  . ARG B  1 74  ? 13.098  -42.226 29.178  1.00 80.30  ? 72  ARG B CZ  1 
ATOM   1988 N  NH1 . ARG B  1 74  ? 12.933  -43.416 29.740  1.00 78.35  ? 72  ARG B NH1 1 
ATOM   1989 N  NH2 . ARG B  1 74  ? 13.123  -41.139 29.940  1.00 83.24  ? 72  ARG B NH2 1 
ATOM   1990 N  N   . LYS B  1 75  ? 18.428  -43.787 28.022  1.00 42.44  ? 73  LYS B N   1 
ATOM   1991 C  CA  . LYS B  1 75  ? 19.071  -44.070 29.294  1.00 45.38  ? 73  LYS B CA  1 
ATOM   1992 C  C   . LYS B  1 75  ? 19.639  -45.486 29.295  1.00 44.30  ? 73  LYS B C   1 
ATOM   1993 O  O   . LYS B  1 75  ? 19.634  -46.167 30.318  1.00 43.94  ? 73  LYS B O   1 
ATOM   1994 C  CB  . LYS B  1 75  ? 18.083  -43.870 30.449  1.00 46.36  ? 73  LYS B CB  1 
ATOM   1995 N  N   . LYS B  1 76  ? 20.141  -45.906 28.136  1.00 43.08  ? 74  LYS B N   1 
ATOM   1996 C  CA  . LYS B  1 76  ? 20.872  -47.166 27.995  1.00 42.82  ? 74  LYS B CA  1 
ATOM   1997 C  C   . LYS B  1 76  ? 19.969  -48.394 28.081  1.00 39.05  ? 74  LYS B C   1 
ATOM   1998 O  O   . LYS B  1 76  ? 20.443  -49.512 28.281  1.00 39.18  ? 74  LYS B O   1 
ATOM   1999 C  CB  . LYS B  1 76  ? 21.995  -47.254 29.027  1.00 47.46  ? 74  LYS B CB  1 
ATOM   2000 C  CG  . LYS B  1 76  ? 23.119  -46.270 28.762  1.00 51.03  ? 74  LYS B CG  1 
ATOM   2001 C  CD  . LYS B  1 76  ? 24.198  -46.346 29.829  1.00 57.69  ? 74  LYS B CD  1 
ATOM   2002 C  CE  . LYS B  1 76  ? 25.208  -45.217 29.673  1.00 61.21  ? 74  LYS B CE  1 
ATOM   2003 N  NZ  . LYS B  1 76  ? 26.372  -45.384 30.584  1.00 65.30  ? 74  LYS B NZ  1 
ATOM   2004 N  N   . LYS B  1 77  ? 18.673  -48.184 27.888  1.00 35.72  ? 75  LYS B N   1 
ATOM   2005 C  CA  . LYS B  1 77  ? 17.710  -49.278 27.909  1.00 33.49  ? 75  LYS B CA  1 
ATOM   2006 C  C   . LYS B  1 77  ? 16.770  -49.199 26.732  1.00 30.12  ? 75  LYS B C   1 
ATOM   2007 O  O   . LYS B  1 77  ? 16.628  -48.146 26.117  1.00 29.10  ? 75  LYS B O   1 
ATOM   2008 C  CB  . LYS B  1 77  ? 16.900  -49.239 29.197  1.00 33.89  ? 75  LYS B CB  1 
ATOM   2009 C  CG  . LYS B  1 77  ? 17.749  -49.432 30.430  1.00 35.16  ? 75  LYS B CG  1 
ATOM   2010 C  CD  . LYS B  1 77  ? 16.892  -49.729 31.646  1.00 35.98  ? 75  LYS B CD  1 
ATOM   2011 C  CE  . LYS B  1 77  ? 17.747  -49.743 32.896  1.00 37.82  ? 75  LYS B CE  1 
ATOM   2012 N  NZ  . LYS B  1 77  ? 16.926  -50.057 34.082  1.00 39.57  ? 75  LYS B NZ  1 
ATOM   2013 N  N   . CYS B  1 78  ? 16.132  -50.317 26.419  1.00 29.05  ? 76  CYS B N   1 
ATOM   2014 C  CA  . CYS B  1 78  ? 15.045  -50.319 25.454  1.00 27.52  ? 76  CYS B CA  1 
ATOM   2015 C  C   . CYS B  1 78  ? 13.748  -49.943 26.143  1.00 27.00  ? 76  CYS B C   1 
ATOM   2016 O  O   . CYS B  1 78  ? 13.349  -50.567 27.115  1.00 27.45  ? 76  CYS B O   1 
ATOM   2017 C  CB  . CYS B  1 78  ? 14.900  -51.682 24.786  1.00 27.69  ? 76  CYS B CB  1 
ATOM   2018 S  SG  . CYS B  1 78  ? 16.395  -52.288 23.997  1.00 31.01  ? 76  CYS B SG  1 
ATOM   2019 N  N   . ASP B  1 79  ? 13.109  -48.905 25.625  1.00 26.50  ? 77  ASP B N   1 
ATOM   2020 C  CA  A ASP B  1 79  ? 11.897  -48.379 26.208  0.50 27.69  ? 77  ASP B CA  1 
ATOM   2021 C  CA  B ASP B  1 79  ? 11.898  -48.354 26.212  0.50 26.89  ? 77  ASP B CA  1 
ATOM   2022 C  C   . ASP B  1 79  ? 10.762  -48.615 25.227  1.00 25.55  ? 77  ASP B C   1 
ATOM   2023 O  O   . ASP B  1 79  ? 10.921  -48.460 24.027  1.00 24.90  ? 77  ASP B O   1 
ATOM   2024 C  CB  A ASP B  1 79  ? 12.055  -46.889 26.508  0.50 29.70  ? 77  ASP B CB  1 
ATOM   2025 C  CB  B ASP B  1 79  ? 12.097  -46.848 26.481  0.50 27.69  ? 77  ASP B CB  1 
ATOM   2026 C  CG  A ASP B  1 79  ? 12.903  -46.629 27.743  0.50 33.26  ? 77  ASP B CG  1 
ATOM   2027 C  CG  B ASP B  1 79  ? 10.835  -46.143 26.984  0.50 27.87  ? 77  ASP B CG  1 
ATOM   2028 O  OD1 A ASP B  1 79  ? 12.750  -45.555 28.358  0.50 37.56  ? 77  ASP B OD1 1 
ATOM   2029 O  OD1 B ASP B  1 79  ? 10.324  -46.460 28.075  0.50 28.87  ? 77  ASP B OD1 1 
ATOM   2030 O  OD2 A ASP B  1 79  ? 13.721  -47.499 28.110  0.50 34.48  ? 77  ASP B OD2 1 
ATOM   2031 O  OD2 B ASP B  1 79  ? 10.377  -45.213 26.300  0.50 27.48  ? 77  ASP B OD2 1 
ATOM   2032 N  N   . TYR B  1 80  ? 9.626   -49.048 25.740  1.00 26.57  ? 78  TYR B N   1 
ATOM   2033 C  CA  . TYR B  1 80  ? 8.530   -49.502 24.897  1.00 24.42  ? 78  TYR B CA  1 
ATOM   2034 C  C   . TYR B  1 80  ? 7.282   -48.729 25.284  1.00 26.13  ? 78  TYR B C   1 
ATOM   2035 O  O   . TYR B  1 80  ? 6.902   -48.695 26.455  1.00 29.16  ? 78  TYR B O   1 
ATOM   2036 C  CB  . TYR B  1 80  ? 8.289   -50.990 25.109  1.00 23.86  ? 78  TYR B CB  1 
ATOM   2037 C  CG  . TYR B  1 80  ? 9.454   -51.865 24.728  1.00 23.01  ? 78  TYR B CG  1 
ATOM   2038 C  CD1 . TYR B  1 80  ? 9.595   -52.338 23.438  1.00 21.14  ? 78  TYR B CD1 1 
ATOM   2039 C  CD2 . TYR B  1 80  ? 10.404  -52.230 25.666  1.00 24.47  ? 78  TYR B CD2 1 
ATOM   2040 C  CE1 . TYR B  1 80  ? 10.659  -53.138 23.080  1.00 21.16  ? 78  TYR B CE1 1 
ATOM   2041 C  CE2 . TYR B  1 80  ? 11.465  -53.049 25.323  1.00 24.36  ? 78  TYR B CE2 1 
ATOM   2042 C  CZ  . TYR B  1 80  ? 11.585  -53.499 24.026  1.00 22.73  ? 78  TYR B CZ  1 
ATOM   2043 O  OH  . TYR B  1 80  ? 12.625  -54.324 23.676  1.00 23.12  ? 78  TYR B OH  1 
ATOM   2044 N  N   . TRP B  1 81  ? 6.671   -48.068 24.312  1.00 26.37  ? 79  TRP B N   1 
ATOM   2045 C  CA  . TRP B  1 81  ? 5.348   -47.517 24.502  1.00 26.99  ? 79  TRP B CA  1 
ATOM   2046 C  C   . TRP B  1 81  ? 4.336   -48.261 23.636  1.00 26.34  ? 79  TRP B C   1 
ATOM   2047 O  O   . TRP B  1 81  ? 4.410   -48.243 22.408  1.00 23.61  ? 79  TRP B O   1 
ATOM   2048 C  CB  . TRP B  1 81  ? 5.320   -46.027 24.183  1.00 28.45  ? 79  TRP B CB  1 
ATOM   2049 C  CG  . TRP B  1 81  ? 3.958   -45.447 24.396  1.00 32.66  ? 79  TRP B CG  1 
ATOM   2050 C  CD1 . TRP B  1 81  ? 3.103   -45.720 25.439  1.00 35.04  ? 79  TRP B CD1 1 
ATOM   2051 C  CD2 . TRP B  1 81  ? 3.271   -44.520 23.545  1.00 29.89  ? 79  TRP B CD2 1 
ATOM   2052 N  NE1 . TRP B  1 81  ? 1.932   -45.018 25.281  1.00 34.20  ? 79  TRP B NE1 1 
ATOM   2053 C  CE2 . TRP B  1 81  ? 2.007   -44.275 24.130  1.00 31.36  ? 79  TRP B CE2 1 
ATOM   2054 C  CE3 . TRP B  1 81  ? 3.597   -43.876 22.348  1.00 29.71  ? 79  TRP B CE3 1 
ATOM   2055 C  CZ2 . TRP B  1 81  ? 1.078   -43.406 23.563  1.00 29.48  ? 79  TRP B CZ2 1 
ATOM   2056 C  CZ3 . TRP B  1 81  ? 2.663   -43.004 21.782  1.00 29.75  ? 79  TRP B CZ3 1 
ATOM   2057 C  CH2 . TRP B  1 81  ? 1.422   -42.782 22.392  1.00 30.20  ? 79  TRP B CH2 1 
ATOM   2058 N  N   . ILE B  1 82  ? 3.404   -48.931 24.299  1.00 29.10  ? 80  ILE B N   1 
ATOM   2059 C  CA  . ILE B  1 82  ? 2.351   -49.673 23.636  1.00 30.26  ? 80  ILE B CA  1 
ATOM   2060 C  C   . ILE B  1 82  ? 1.057   -48.904 23.771  1.00 28.21  ? 80  ILE B C   1 
ATOM   2061 O  O   . ILE B  1 82  ? 0.686   -48.502 24.861  1.00 30.31  ? 80  ILE B O   1 
ATOM   2062 C  CB  . ILE B  1 82  ? 2.160   -51.060 24.271  1.00 36.30  ? 80  ILE B CB  1 
ATOM   2063 C  CG1 . ILE B  1 82  ? 3.469   -51.850 24.209  1.00 42.02  ? 80  ILE B CG1 1 
ATOM   2064 C  CG2 . ILE B  1 82  ? 1.037   -51.815 23.567  1.00 35.38  ? 80  ILE B CG2 1 
ATOM   2065 C  CD1 . ILE B  1 82  ? 3.517   -53.051 25.132  1.00 46.39  ? 80  ILE B CD1 1 
ATOM   2066 N  N   . ARG B  1 83  ? 0.370   -48.693 22.659  1.00 27.17  ? 81  ARG B N   1 
ATOM   2067 C  CA  . ARG B  1 83  ? -0.978  -48.148 22.713  1.00 26.35  ? 81  ARG B CA  1 
ATOM   2068 C  C   . ARG B  1 83  ? -1.835  -48.693 21.572  1.00 24.35  ? 81  ARG B C   1 
ATOM   2069 O  O   . ARG B  1 83  ? -1.372  -49.487 20.756  1.00 20.94  ? 81  ARG B O   1 
ATOM   2070 C  CB  . ARG B  1 83  ? -0.945  -46.620 22.682  1.00 27.08  ? 81  ARG B CB  1 
ATOM   2071 C  CG  . ARG B  1 83  ? -0.510  -46.028 21.357  1.00 25.87  ? 81  ARG B CG  1 
ATOM   2072 C  CD  . ARG B  1 83  ? 0.968   -46.275 21.104  1.00 27.75  ? 81  ARG B CD  1 
ATOM   2073 N  NE  . ARG B  1 83  ? 1.499   -45.413 20.052  1.00 27.92  ? 81  ARG B NE  1 
ATOM   2074 C  CZ  . ARG B  1 83  ? 2.725   -45.517 19.546  1.00 32.29  ? 81  ARG B CZ  1 
ATOM   2075 N  NH1 . ARG B  1 83  ? 3.558   -46.456 19.989  1.00 32.71  ? 81  ARG B NH1 1 
ATOM   2076 N  NH2 . ARG B  1 83  ? 3.126   -44.678 18.596  1.00 32.19  ? 81  ARG B NH2 1 
ATOM   2077 N  N   . THR B  1 84  ? -3.103  -48.289 21.559  1.00 22.77  ? 82  THR B N   1 
ATOM   2078 C  CA  . THR B  1 84  ? -4.089  -48.884 20.680  1.00 20.59  ? 82  THR B CA  1 
ATOM   2079 C  C   . THR B  1 84  ? -4.627  -47.803 19.759  1.00 19.45  ? 82  THR B C   1 
ATOM   2080 O  O   . THR B  1 84  ? -5.036  -46.741 20.225  1.00 19.94  ? 82  THR B O   1 
ATOM   2081 C  CB  . THR B  1 84  ? -5.245  -49.489 21.508  1.00 21.17  ? 82  THR B CB  1 
ATOM   2082 O  OG1 . THR B  1 84  ? -4.731  -50.512 22.352  1.00 21.43  ? 82  THR B OG1 1 
ATOM   2083 C  CG2 . THR B  1 84  ? -6.303  -50.089 20.609  1.00 20.88  ? 82  THR B CG2 1 
ATOM   2084 N  N   . PHE B  1 85  ? -4.562  -48.044 18.453  1.00 18.34  ? 83  PHE B N   1 
ATOM   2085 C  CA  . PHE B  1 85  ? -5.220  -47.182 17.483  1.00 17.80  ? 83  PHE B CA  1 
ATOM   2086 C  C   . PHE B  1 85  ? -6.534  -47.808 17.048  1.00 19.33  ? 83  PHE B C   1 
ATOM   2087 O  O   . PHE B  1 85  ? -6.548  -48.880 16.445  1.00 21.38  ? 83  PHE B O   1 
ATOM   2088 C  CB  . PHE B  1 85  ? -4.338  -46.963 16.253  1.00 17.69  ? 83  PHE B CB  1 
ATOM   2089 C  CG  . PHE B  1 85  ? -3.182  -46.046 16.483  1.00 16.87  ? 83  PHE B CG  1 
ATOM   2090 C  CD1 . PHE B  1 85  ? -2.339  -45.718 15.447  1.00 16.71  ? 83  PHE B CD1 1 
ATOM   2091 C  CD2 . PHE B  1 85  ? -2.928  -45.525 17.740  1.00 19.39  ? 83  PHE B CD2 1 
ATOM   2092 C  CE1 . PHE B  1 85  ? -1.246  -44.890 15.651  1.00 18.18  ? 83  PHE B CE1 1 
ATOM   2093 C  CE2 . PHE B  1 85  ? -1.852  -44.680 17.951  1.00 19.31  ? 83  PHE B CE2 1 
ATOM   2094 C  CZ  . PHE B  1 85  ? -1.010  -44.361 16.902  1.00 18.54  ? 83  PHE B CZ  1 
ATOM   2095 N  N   . VAL B  1 86  ? -7.632  -47.120 17.345  1.00 20.18  ? 84  VAL B N   1 
ATOM   2096 C  CA  . VAL B  1 86  ? -8.962  -47.565 16.977  1.00 20.92  ? 84  VAL B CA  1 
ATOM   2097 C  C   . VAL B  1 86  ? -9.393  -46.897 15.667  1.00 21.30  ? 84  VAL B C   1 
ATOM   2098 O  O   . VAL B  1 86  ? -9.256  -45.699 15.501  1.00 20.92  ? 84  VAL B O   1 
ATOM   2099 C  CB  . VAL B  1 86  ? -9.981  -47.223 18.089  1.00 23.30  ? 84  VAL B CB  1 
ATOM   2100 C  CG1 . VAL B  1 86  ? -11.385 -47.680 17.708  1.00 23.45  ? 84  VAL B CG1 1 
ATOM   2101 C  CG2 . VAL B  1 86  ? -9.569  -47.861 19.409  1.00 23.65  ? 84  VAL B CG2 1 
ATOM   2102 N  N   . PRO B  1 87  ? -9.913  -47.682 14.720  1.00 22.99  ? 85  PRO B N   1 
ATOM   2103 C  CA  . PRO B  1 87  ? -10.329 -47.106 13.438  1.00 22.24  ? 85  PRO B CA  1 
ATOM   2104 C  C   . PRO B  1 87  ? -11.289 -45.947 13.636  1.00 20.48  ? 85  PRO B C   1 
ATOM   2105 O  O   . PRO B  1 87  ? -12.201 -46.044 14.445  1.00 22.02  ? 85  PRO B O   1 
ATOM   2106 C  CB  . PRO B  1 87  ? -11.042 -48.271 12.736  1.00 24.37  ? 85  PRO B CB  1 
ATOM   2107 C  CG  . PRO B  1 87  ? -10.505 -49.504 13.391  1.00 24.77  ? 85  PRO B CG  1 
ATOM   2108 C  CD  . PRO B  1 87  ? -10.219 -49.119 14.818  1.00 24.19  ? 85  PRO B CD  1 
ATOM   2109 N  N   . GLY B  1 88  ? -11.080 -44.862 12.901  1.00 18.32  ? 86  GLY B N   1 
ATOM   2110 C  CA  . GLY B  1 88  ? -11.963 -43.708 12.972  1.00 17.30  ? 86  GLY B CA  1 
ATOM   2111 C  C   . GLY B  1 88  ? -12.974 -43.687 11.852  1.00 17.71  ? 86  GLY B C   1 
ATOM   2112 O  O   . GLY B  1 88  ? -13.412 -44.740 11.381  1.00 20.08  ? 86  GLY B O   1 
ATOM   2113 N  N   . SER B  1 89  ? -13.347 -42.490 11.417  1.00 17.24  ? 87  SER B N   1 
ATOM   2114 C  CA  . SER B  1 89  ? -14.500 -42.299 10.536  1.00 18.20  ? 87  SER B CA  1 
ATOM   2115 C  C   . SER B  1 89  ? -14.240 -42.798 9.109   1.00 18.41  ? 87  SER B C   1 
ATOM   2116 O  O   . SER B  1 89  ? -15.172 -43.140 8.386   1.00 18.78  ? 87  SER B O   1 
ATOM   2117 C  CB  . SER B  1 89  ? -14.881 -40.813 10.492  1.00 17.23  ? 87  SER B CB  1 
ATOM   2118 O  OG  . SER B  1 89  ? -15.222 -40.356 11.774  1.00 17.29  ? 87  SER B OG  1 
ATOM   2119 N  N   . GLN B  1 90  ? -12.966 -42.837 8.730   1.00 18.40  ? 88  GLN B N   1 
ATOM   2120 C  CA  A GLN B  1 90  ? -12.547 -43.120 7.359   0.50 18.45  ? 88  GLN B CA  1 
ATOM   2121 C  CA  B GLN B  1 90  ? -12.550 -43.132 7.360   0.50 18.78  ? 88  GLN B CA  1 
ATOM   2122 C  C   . GLN B  1 90  ? -11.344 -44.050 7.428   1.00 18.55  ? 88  GLN B C   1 
ATOM   2123 O  O   . GLN B  1 90  ? -10.485 -43.872 8.287   1.00 17.95  ? 88  GLN B O   1 
ATOM   2124 C  CB  A GLN B  1 90  ? -12.123 -41.822 6.663   0.50 17.49  ? 88  GLN B CB  1 
ATOM   2125 C  CB  B GLN B  1 90  ? -12.132 -41.847 6.645   0.50 18.21  ? 88  GLN B CB  1 
ATOM   2126 C  CG  A GLN B  1 90  ? -13.241 -40.825 6.396   0.50 18.13  ? 88  GLN B CG  1 
ATOM   2127 C  CG  B GLN B  1 90  ? -13.277 -40.917 6.288   0.50 19.33  ? 88  GLN B CG  1 
ATOM   2128 C  CD  A GLN B  1 90  ? -12.893 -39.838 5.283   0.50 18.09  ? 88  GLN B CD  1 
ATOM   2129 C  CD  B GLN B  1 90  ? -14.205 -41.504 5.230   0.50 20.95  ? 88  GLN B CD  1 
ATOM   2130 O  OE1 A GLN B  1 90  ? -13.103 -40.124 4.106   0.50 19.76  ? 88  GLN B OE1 1 
ATOM   2131 O  OE1 B GLN B  1 90  ? -13.756 -42.036 4.199   0.50 21.26  ? 88  GLN B OE1 1 
ATOM   2132 N  NE2 A GLN B  1 90  ? -12.326 -38.693 5.646   0.50 17.36  ? 88  GLN B NE2 1 
ATOM   2133 N  NE2 B GLN B  1 90  ? -15.505 -41.400 5.471   0.50 21.24  ? 88  GLN B NE2 1 
ATOM   2134 N  N   . PRO B  1 91  ? -11.263 -45.029 6.508   1.00 18.57  ? 89  PRO B N   1 
ATOM   2135 C  CA  . PRO B  1 91  ? -10.088 -45.886 6.499   1.00 16.98  ? 89  PRO B CA  1 
ATOM   2136 C  C   . PRO B  1 91  ? -8.792  -45.090 6.403   1.00 15.34  ? 89  PRO B C   1 
ATOM   2137 O  O   . PRO B  1 91  ? -8.669  -44.165 5.593   1.00 14.76  ? 89  PRO B O   1 
ATOM   2138 C  CB  . PRO B  1 91  ? -10.300 -46.768 5.258   1.00 18.21  ? 89  PRO B CB  1 
ATOM   2139 C  CG  . PRO B  1 91  ? -11.768 -46.743 5.010   1.00 18.60  ? 89  PRO B CG  1 
ATOM   2140 C  CD  . PRO B  1 91  ? -12.187 -45.355 5.405   1.00 19.60  ? 89  PRO B CD  1 
ATOM   2141 N  N   . GLY B  1 92  ? -7.858  -45.405 7.288   1.00 15.87  ? 90  GLY B N   1 
ATOM   2142 C  CA  . GLY B  1 92  ? -6.599  -44.667 7.382   1.00 15.35  ? 90  GLY B CA  1 
ATOM   2143 C  C   . GLY B  1 92  ? -6.604  -43.617 8.463   1.00 14.70  ? 90  GLY B C   1 
ATOM   2144 O  O   . GLY B  1 92  ? -5.580  -42.993 8.734   1.00 15.39  ? 90  GLY B O   1 
ATOM   2145 N  N   . GLU B  1 93  ? -7.752  -43.424 9.098   1.00 16.42  ? 91  GLU B N   1 
ATOM   2146 C  CA  . GLU B  1 93  ? -7.823  -42.572 10.280  1.00 16.73  ? 91  GLU B CA  1 
ATOM   2147 C  C   . GLU B  1 93  ? -8.019  -43.411 11.520  1.00 15.87  ? 91  GLU B C   1 
ATOM   2148 O  O   . GLU B  1 93  ? -8.703  -44.425 11.487  1.00 15.15  ? 91  GLU B O   1 
ATOM   2149 C  CB  . GLU B  1 93  ? -8.969  -41.587 10.161  1.00 17.96  ? 91  GLU B CB  1 
ATOM   2150 C  CG  . GLU B  1 93  ? -8.796  -40.582 9.046   1.00 19.27  ? 91  GLU B CG  1 
ATOM   2151 C  CD  . GLU B  1 93  ? -9.795  -39.450 9.147   1.00 20.99  ? 91  GLU B CD  1 
ATOM   2152 O  OE1 . GLU B  1 93  ? -9.413  -38.328 8.776   1.00 25.08  ? 91  GLU B OE1 1 
ATOM   2153 O  OE2 . GLU B  1 93  ? -10.946 -39.679 9.590   1.00 20.20  ? 91  GLU B OE2 1 
ATOM   2154 N  N   . PHE B  1 94  ? -7.438  -42.958 12.622  1.00 16.41  ? 92  PHE B N   1 
ATOM   2155 C  CA  . PHE B  1 94  ? -7.556  -43.650 13.896  1.00 18.10  ? 92  PHE B CA  1 
ATOM   2156 C  C   . PHE B  1 94  ? -7.698  -42.667 15.044  1.00 20.03  ? 92  PHE B C   1 
ATOM   2157 O  O   . PHE B  1 94  ? -7.289  -41.509 14.943  1.00 21.59  ? 92  PHE B O   1 
ATOM   2158 C  CB  . PHE B  1 94  ? -6.346  -44.546 14.116  1.00 17.77  ? 92  PHE B CB  1 
ATOM   2159 C  CG  . PHE B  1 94  ? -6.063  -45.453 12.957  1.00 17.74  ? 92  PHE B CG  1 
ATOM   2160 C  CD1 . PHE B  1 94  ? -5.321  -45.006 11.882  1.00 18.52  ? 92  PHE B CD1 1 
ATOM   2161 C  CD2 . PHE B  1 94  ? -6.627  -46.712 12.899  1.00 18.46  ? 92  PHE B CD2 1 
ATOM   2162 C  CE1 . PHE B  1 94  ? -5.122  -45.808 10.778  1.00 19.07  ? 92  PHE B CE1 1 
ATOM   2163 C  CE2 . PHE B  1 94  ? -6.421  -47.530 11.809  1.00 17.87  ? 92  PHE B CE2 1 
ATOM   2164 C  CZ  . PHE B  1 94  ? -5.675  -47.075 10.744  1.00 18.85  ? 92  PHE B CZ  1 
ATOM   2165 N  N   . THR B  1 95  ? -8.323  -43.121 16.118  1.00 20.78  ? 93  THR B N   1 
ATOM   2166 C  CA  . THR B  1 95  ? -8.221  -42.443 17.396  1.00 23.78  ? 93  THR B CA  1 
ATOM   2167 C  C   . THR B  1 95  ? -7.515  -43.338 18.415  1.00 24.06  ? 93  THR B C   1 
ATOM   2168 O  O   . THR B  1 95  ? -7.309  -44.533 18.175  1.00 21.88  ? 93  THR B O   1 
ATOM   2169 C  CB  . THR B  1 95  ? -9.609  -42.070 17.930  1.00 23.94  ? 93  THR B CB  1 
ATOM   2170 O  OG1 . THR B  1 95  ? -10.422 -43.238 17.969  1.00 23.48  ? 93  THR B OG1 1 
ATOM   2171 C  CG2 . THR B  1 95  ? -10.287 -41.049 17.019  1.00 24.70  ? 93  THR B CG2 1 
ATOM   2172 N  N   . LEU B  1 96  ? -7.093  -42.741 19.522  1.00 23.12  ? 94  LEU B N   1 
ATOM   2173 C  CA  . LEU B  1 96  ? -6.406  -43.491 20.570  1.00 24.80  ? 94  LEU B CA  1 
ATOM   2174 C  C   . LEU B  1 96  ? -7.441  -44.222 21.389  1.00 24.13  ? 94  LEU B C   1 
ATOM   2175 O  O   . LEU B  1 96  ? -8.447  -43.640 21.782  1.00 28.20  ? 94  LEU B O   1 
ATOM   2176 C  CB  . LEU B  1 96  ? -5.604  -42.541 21.458  1.00 25.54  ? 94  LEU B CB  1 
ATOM   2177 C  CG  . LEU B  1 96  ? -4.503  -43.131 22.335  1.00 27.17  ? 94  LEU B CG  1 
ATOM   2178 C  CD1 . LEU B  1 96  ? -3.425  -43.778 21.485  1.00 26.26  ? 94  LEU B CD1 1 
ATOM   2179 C  CD2 . LEU B  1 96  ? -3.908  -42.027 23.190  1.00 28.93  ? 94  LEU B CD2 1 
ATOM   2180 N  N   . GLY B  1 97  ? -7.215  -45.502 21.634  1.00 24.79  ? 95  GLY B N   1 
ATOM   2181 C  CA  . GLY B  1 97  ? -8.068  -46.254 22.561  1.00 25.76  ? 95  GLY B CA  1 
ATOM   2182 C  C   . GLY B  1 97  ? -7.766  -45.909 24.017  1.00 27.42  ? 95  GLY B C   1 
ATOM   2183 O  O   . GLY B  1 97  ? -6.662  -45.485 24.338  1.00 27.38  ? 95  GLY B O   1 
ATOM   2184 N  N   . ASN B  1 98  ? -8.748  -46.099 24.898  1.00 29.07  ? 96  ASN B N   1 
ATOM   2185 C  CA  A ASN B  1 98  ? -8.577  -45.889 26.330  0.50 30.05  ? 96  ASN B CA  1 
ATOM   2186 C  CA  B ASN B  1 98  ? -8.558  -45.892 26.339  0.50 30.02  ? 96  ASN B CA  1 
ATOM   2187 C  C   . ASN B  1 98  ? -8.065  -44.487 26.672  1.00 30.96  ? 96  ASN B C   1 
ATOM   2188 O  O   . ASN B  1 98  ? -7.220  -44.310 27.565  1.00 31.45  ? 96  ASN B O   1 
ATOM   2189 C  CB  A ASN B  1 98  ? -7.639  -46.951 26.902  0.50 30.52  ? 96  ASN B CB  1 
ATOM   2190 C  CB  B ASN B  1 98  ? -7.576  -46.929 26.917  0.50 30.42  ? 96  ASN B CB  1 
ATOM   2191 C  CG  A ASN B  1 98  ? -8.097  -48.377 26.591  0.50 31.00  ? 96  ASN B CG  1 
ATOM   2192 C  CG  B ASN B  1 98  ? -7.742  -47.131 28.417  0.50 32.47  ? 96  ASN B CG  1 
ATOM   2193 O  OD1 A ASN B  1 98  ? -9.134  -48.831 27.078  0.50 31.66  ? 96  ASN B OD1 1 
ATOM   2194 O  OD1 B ASN B  1 98  ? -8.572  -46.483 29.060  0.50 33.36  ? 96  ASN B OD1 1 
ATOM   2195 N  ND2 A ASN B  1 98  ? -7.320  -49.089 25.775  0.50 29.55  ? 96  ASN B ND2 1 
ATOM   2196 N  ND2 B ASN B  1 98  ? -6.942  -48.032 28.983  0.50 32.60  ? 96  ASN B ND2 1 
ATOM   2197 N  N   . ILE B  1 99  ? -8.607  -43.481 25.989  1.00 31.58  ? 97  ILE B N   1 
ATOM   2198 C  CA  . ILE B  1 99  ? -8.152  -42.101 26.179  1.00 33.86  ? 97  ILE B CA  1 
ATOM   2199 C  C   . ILE B  1 99  ? -8.206  -41.625 27.637  1.00 33.59  ? 97  ILE B C   1 
ATOM   2200 O  O   . ILE B  1 99  ? -7.393  -40.807 28.048  1.00 32.35  ? 97  ILE B O   1 
ATOM   2201 C  CB  . ILE B  1 99  ? -8.927  -41.093 25.300  1.00 35.66  ? 97  ILE B CB  1 
ATOM   2202 C  CG1 . ILE B  1 99  ? -8.129  -40.802 24.034  1.00 40.01  ? 97  ILE B CG1 1 
ATOM   2203 C  CG2 . ILE B  1 99  ? -9.145  -39.790 26.052  1.00 39.77  ? 97  ILE B CG2 1 
ATOM   2204 C  CD1 . ILE B  1 99  ? -8.756  -39.766 23.127  1.00 44.11  ? 97  ILE B CD1 1 
ATOM   2205 N  N   . LYS B  1 100 ? -9.161  -42.131 28.411  1.00 34.48  ? 98  LYS B N   1 
ATOM   2206 C  CA  . LYS B  1 100 ? -9.338  -41.673 29.797  1.00 37.32  ? 98  LYS B CA  1 
ATOM   2207 C  C   . LYS B  1 100 ? -8.151  -42.054 30.689  1.00 38.91  ? 98  LYS B C   1 
ATOM   2208 O  O   . LYS B  1 100 ? -7.963  -41.476 31.755  1.00 41.66  ? 98  LYS B O   1 
ATOM   2209 C  CB  . LYS B  1 100 ? -10.633 -42.225 30.412  1.00 39.09  ? 98  LYS B CB  1 
ATOM   2210 N  N   . SER B  1 101 ? -7.354  -43.026 30.255  1.00 37.22  ? 99  SER B N   1 
ATOM   2211 C  CA  . SER B  1 101 ? -6.213  -43.492 31.047  1.00 35.60  ? 99  SER B CA  1 
ATOM   2212 C  C   . SER B  1 101 ? -4.950  -42.646 30.811  1.00 34.17  ? 99  SER B C   1 
ATOM   2213 O  O   . SER B  1 101 ? -3.895  -42.901 31.387  1.00 32.63  ? 99  SER B O   1 
ATOM   2214 C  CB  . SER B  1 101 ? -5.920  -44.952 30.702  1.00 34.92  ? 99  SER B CB  1 
ATOM   2215 O  OG  . SER B  1 101 ? -5.210  -45.040 29.491  1.00 33.07  ? 99  SER B OG  1 
ATOM   2216 N  N   . TYR B  1 102 ? -5.052  -41.653 29.942  1.00 33.10  ? 100 TYR B N   1 
ATOM   2217 C  CA  . TYR B  1 102 ? -3.995  -40.668 29.809  1.00 33.24  ? 100 TYR B CA  1 
ATOM   2218 C  C   . TYR B  1 102 ? -4.425  -39.320 30.387  1.00 34.06  ? 100 TYR B C   1 
ATOM   2219 O  O   . TYR B  1 102 ? -5.254  -38.628 29.808  1.00 33.92  ? 100 TYR B O   1 
ATOM   2220 C  CB  . TYR B  1 102 ? -3.605  -40.515 28.347  1.00 30.50  ? 100 TYR B CB  1 
ATOM   2221 C  CG  . TYR B  1 102 ? -3.296  -41.824 27.645  1.00 30.49  ? 100 TYR B CG  1 
ATOM   2222 C  CD1 . TYR B  1 102 ? -4.271  -42.479 26.902  1.00 30.13  ? 100 TYR B CD1 1 
ATOM   2223 C  CD2 . TYR B  1 102 ? -2.033  -42.397 27.712  1.00 29.36  ? 100 TYR B CD2 1 
ATOM   2224 C  CE1 . TYR B  1 102 ? -4.004  -43.673 26.258  1.00 29.48  ? 100 TYR B CE1 1 
ATOM   2225 C  CE2 . TYR B  1 102 ? -1.754  -43.587 27.061  1.00 28.95  ? 100 TYR B CE2 1 
ATOM   2226 C  CZ  . TYR B  1 102 ? -2.744  -44.228 26.337  1.00 29.26  ? 100 TYR B CZ  1 
ATOM   2227 O  OH  . TYR B  1 102 ? -2.486  -45.411 25.660  1.00 27.47  ? 100 TYR B OH  1 
ATOM   2228 N  N   . PRO B  1 103 ? -3.861  -38.946 31.539  1.00 35.24  ? 101 PRO B N   1 
ATOM   2229 C  CA  . PRO B  1 103 ? -4.376  -37.771 32.241  1.00 35.52  ? 101 PRO B CA  1 
ATOM   2230 C  C   . PRO B  1 103 ? -4.140  -36.503 31.437  1.00 33.72  ? 101 PRO B C   1 
ATOM   2231 O  O   . PRO B  1 103 ? -3.081  -36.345 30.825  1.00 32.51  ? 101 PRO B O   1 
ATOM   2232 C  CB  . PRO B  1 103 ? -3.570  -37.752 33.550  1.00 38.26  ? 101 PRO B CB  1 
ATOM   2233 C  CG  . PRO B  1 103 ? -2.990  -39.125 33.690  1.00 38.00  ? 101 PRO B CG  1 
ATOM   2234 C  CD  . PRO B  1 103 ? -2.774  -39.611 32.281  1.00 36.30  ? 101 PRO B CD  1 
ATOM   2235 N  N   . GLY B  1 104 ? -5.146  -35.636 31.385  1.00 33.09  ? 102 GLY B N   1 
ATOM   2236 C  CA  . GLY B  1 104 ? -5.050  -34.391 30.618  1.00 31.63  ? 102 GLY B CA  1 
ATOM   2237 C  C   . GLY B  1 104 ? -5.406  -34.503 29.141  1.00 28.73  ? 102 GLY B C   1 
ATOM   2238 O  O   . GLY B  1 104 ? -5.590  -33.494 28.467  1.00 28.00  ? 102 GLY B O   1 
ATOM   2239 N  N   . LEU B  1 105 ? -5.501  -35.723 28.628  1.00 27.12  ? 103 LEU B N   1 
ATOM   2240 C  CA  . LEU B  1 105 ? -5.680  -35.940 27.194  1.00 25.68  ? 103 LEU B CA  1 
ATOM   2241 C  C   . LEU B  1 105 ? -7.157  -35.926 26.810  1.00 25.84  ? 103 LEU B C   1 
ATOM   2242 O  O   . LEU B  1 105 ? -7.944  -36.693 27.360  1.00 27.39  ? 103 LEU B O   1 
ATOM   2243 C  CB  . LEU B  1 105 ? -5.036  -37.262 26.786  1.00 24.62  ? 103 LEU B CB  1 
ATOM   2244 C  CG  . LEU B  1 105 ? -5.063  -37.589 25.297  1.00 22.88  ? 103 LEU B CG  1 
ATOM   2245 C  CD1 . LEU B  1 105 ? -4.308  -36.538 24.501  1.00 22.26  ? 103 LEU B CD1 1 
ATOM   2246 C  CD2 . LEU B  1 105 ? -4.474  -38.963 25.037  1.00 22.15  ? 103 LEU B CD2 1 
ATOM   2247 N  N   . THR B  1 106 ? -7.537  -35.056 25.872  1.00 25.47  ? 104 THR B N   1 
ATOM   2248 C  CA  . THR B  1 106 ? -8.948  -34.931 25.496  1.00 25.02  ? 104 THR B CA  1 
ATOM   2249 C  C   . THR B  1 106 ? -9.245  -35.348 24.063  1.00 24.16  ? 104 THR B C   1 
ATOM   2250 O  O   . THR B  1 106 ? -10.358 -35.737 23.762  1.00 24.50  ? 104 THR B O   1 
ATOM   2251 C  CB  . THR B  1 106 ? -9.501  -33.509 25.722  1.00 25.54  ? 104 THR B CB  1 
ATOM   2252 O  OG1 . THR B  1 106 ? -8.717  -32.555 24.998  1.00 24.44  ? 104 THR B OG1 1 
ATOM   2253 C  CG2 . THR B  1 106 ? -9.511  -33.160 27.219  1.00 27.07  ? 104 THR B CG2 1 
ATOM   2254 N  N   . SER B  1 107 ? -8.274  -35.254 23.165  1.00 24.17  ? 105 SER B N   1 
ATOM   2255 C  CA  . SER B  1 107 ? -8.469  -35.804 21.831  1.00 24.09  ? 105 SER B CA  1 
ATOM   2256 C  C   . SER B  1 107 ? -7.163  -36.238 21.201  1.00 24.32  ? 105 SER B C   1 
ATOM   2257 O  O   . SER B  1 107 ? -6.087  -35.737 21.540  1.00 24.69  ? 105 SER B O   1 
ATOM   2258 C  CB  . SER B  1 107 ? -9.206  -34.830 20.903  1.00 22.79  ? 105 SER B CB  1 
ATOM   2259 O  OG  . SER B  1 107 ? -8.409  -33.719 20.577  1.00 23.58  ? 105 SER B OG  1 
ATOM   2260 N  N   A TYR B  1 108 ? -7.265  -37.186 20.279  0.50 23.76  ? 106 TYR B N   1 
ATOM   2261 N  N   B TYR B  1 108 ? -7.265  -37.187 20.279  0.50 23.76  ? 106 TYR B N   1 
ATOM   2262 C  CA  A TYR B  1 108 ? -6.091  -37.765 19.658  0.50 24.36  ? 106 TYR B CA  1 
ATOM   2263 C  CA  B TYR B  1 108 ? -6.093  -37.765 19.657  0.50 24.37  ? 106 TYR B CA  1 
ATOM   2264 C  C   A TYR B  1 108 ? -6.455  -38.381 18.319  0.50 22.38  ? 106 TYR B C   1 
ATOM   2265 C  C   B TYR B  1 108 ? -6.461  -38.376 18.317  0.50 22.39  ? 106 TYR B C   1 
ATOM   2266 O  O   A TYR B  1 108 ? -7.165  -39.381 18.267  0.50 23.54  ? 106 TYR B O   1 
ATOM   2267 O  O   B TYR B  1 108 ? -7.186  -39.364 18.262  0.50 23.53  ? 106 TYR B O   1 
ATOM   2268 C  CB  A TYR B  1 108 ? -5.505  -38.840 20.565  0.50 26.64  ? 106 TYR B CB  1 
ATOM   2269 C  CB  B TYR B  1 108 ? -5.506  -38.839 20.563  0.50 26.64  ? 106 TYR B CB  1 
ATOM   2270 C  CG  A TYR B  1 108 ? -4.089  -39.215 20.199  0.50 28.34  ? 106 TYR B CG  1 
ATOM   2271 C  CG  B TYR B  1 108 ? -4.090  -39.215 20.196  0.50 28.35  ? 106 TYR B CG  1 
ATOM   2272 C  CD1 A TYR B  1 108 ? -3.832  -40.087 19.154  0.50 29.17  ? 106 TYR B CD1 1 
ATOM   2273 C  CD1 B TYR B  1 108 ? -3.832  -40.088 19.153  0.50 29.19  ? 106 TYR B CD1 1 
ATOM   2274 C  CD2 A TYR B  1 108 ? -3.009  -38.669 20.878  0.50 29.79  ? 106 TYR B CD2 1 
ATOM   2275 C  CD2 B TYR B  1 108 ? -3.009  -38.669 20.876  0.50 29.80  ? 106 TYR B CD2 1 
ATOM   2276 C  CE1 A TYR B  1 108 ? -2.536  -40.418 18.808  0.50 28.92  ? 106 TYR B CE1 1 
ATOM   2277 C  CE1 B TYR B  1 108 ? -2.536  -40.420 18.807  0.50 28.94  ? 106 TYR B CE1 1 
ATOM   2278 C  CE2 A TYR B  1 108 ? -1.709  -38.995 20.541  0.50 30.55  ? 106 TYR B CE2 1 
ATOM   2279 C  CE2 B TYR B  1 108 ? -1.710  -38.996 20.540  0.50 30.57  ? 106 TYR B CE2 1 
ATOM   2280 C  CZ  A TYR B  1 108 ? -1.477  -39.872 19.505  0.50 31.28  ? 106 TYR B CZ  1 
ATOM   2281 C  CZ  B TYR B  1 108 ? -1.477  -39.874 19.504  0.50 31.30  ? 106 TYR B CZ  1 
ATOM   2282 O  OH  A TYR B  1 108 ? -0.180  -40.194 19.161  0.50 34.82  ? 106 TYR B OH  1 
ATOM   2283 O  OH  B TYR B  1 108 ? -0.180  -40.197 19.162  0.50 34.86  ? 106 TYR B OH  1 
ATOM   2284 N  N   . LEU B  1 109 ? -5.961  -37.779 17.243  1.00 20.73  ? 107 LEU B N   1 
ATOM   2285 C  CA  . LEU B  1 109 ? -6.333  -38.177 15.896  1.00 19.90  ? 107 LEU B CA  1 
ATOM   2286 C  C   . LEU B  1 109 ? -5.090  -38.588 15.108  1.00 18.39  ? 107 LEU B C   1 
ATOM   2287 O  O   . LEU B  1 109 ? -4.059  -37.915 15.153  1.00 16.55  ? 107 LEU B O   1 
ATOM   2288 C  CB  . LEU B  1 109 ? -7.024  -37.034 15.161  1.00 19.80  ? 107 LEU B CB  1 
ATOM   2289 C  CG  . LEU B  1 109 ? -7.389  -37.339 13.714  1.00 21.07  ? 107 LEU B CG  1 
ATOM   2290 C  CD1 . LEU B  1 109 ? -8.545  -38.329 13.662  1.00 21.79  ? 107 LEU B CD1 1 
ATOM   2291 C  CD2 . LEU B  1 109 ? -7.727  -36.071 12.943  1.00 21.22  ? 107 LEU B CD2 1 
ATOM   2292 N  N   . VAL B  1 110 ? -5.205  -39.708 14.402  1.00 17.67  ? 108 VAL B N   1 
ATOM   2293 C  CA  . VAL B  1 110 ? -4.161  -40.189 13.516  1.00 17.21  ? 108 VAL B CA  1 
ATOM   2294 C  C   . VAL B  1 110 ? -4.715  -40.230 12.105  1.00 16.53  ? 108 VAL B C   1 
ATOM   2295 O  O   . VAL B  1 110 ? -5.804  -40.739 11.891  1.00 15.35  ? 108 VAL B O   1 
ATOM   2296 C  CB  . VAL B  1 110 ? -3.721  -41.614 13.899  1.00 17.32  ? 108 VAL B CB  1 
ATOM   2297 C  CG1 . VAL B  1 110 ? -2.609  -42.097 12.976  1.00 17.51  ? 108 VAL B CG1 1 
ATOM   2298 C  CG2 . VAL B  1 110 ? -3.272  -41.662 15.347  1.00 18.16  ? 108 VAL B CG2 1 
ATOM   2299 N  N   . ARG B  1 111 ? -3.967  -39.688 11.147  1.00 16.79  ? 109 ARG B N   1 
ATOM   2300 C  CA  . ARG B  1 111 ? -4.347  -39.795 9.752   1.00 16.18  ? 109 ARG B CA  1 
ATOM   2301 C  C   . ARG B  1 111 ? -3.155  -40.184 8.899   1.00 15.90  ? 109 ARG B C   1 
ATOM   2302 O  O   . ARG B  1 111 ? -2.177  -39.439 8.806   1.00 16.88  ? 109 ARG B O   1 
ATOM   2303 C  CB  . ARG B  1 111 ? -4.931  -38.479 9.240   1.00 17.20  ? 109 ARG B CB  1 
ATOM   2304 C  CG  . ARG B  1 111 ? -5.235  -38.502 7.754   1.00 17.61  ? 109 ARG B CG  1 
ATOM   2305 C  CD  . ARG B  1 111 ? -5.841  -37.200 7.267   1.00 18.18  ? 109 ARG B CD  1 
ATOM   2306 N  NE  . ARG B  1 111 ? -7.222  -37.059 7.684   1.00 20.24  ? 109 ARG B NE  1 
ATOM   2307 C  CZ  . ARG B  1 111 ? -7.989  -36.026 7.373   1.00 23.52  ? 109 ARG B CZ  1 
ATOM   2308 N  NH1 . ARG B  1 111 ? -9.233  -35.987 7.803   1.00 23.47  ? 109 ARG B NH1 1 
ATOM   2309 N  NH2 . ARG B  1 111 ? -7.505  -35.020 6.657   1.00 26.19  ? 109 ARG B NH2 1 
ATOM   2310 N  N   . VAL B  1 112 ? -3.267  -41.320 8.216   1.00 14.08  ? 110 VAL B N   1 
ATOM   2311 C  CA  . VAL B  1 112 ? -2.256  -41.705 7.249   1.00 13.40  ? 110 VAL B CA  1 
ATOM   2312 C  C   . VAL B  1 112 ? -2.385  -40.873 5.974   1.00 12.94  ? 110 VAL B C   1 
ATOM   2313 O  O   . VAL B  1 112 ? -3.394  -40.940 5.271   1.00 11.07  ? 110 VAL B O   1 
ATOM   2314 C  CB  . VAL B  1 112 ? -2.369  -43.196 6.899   1.00 14.07  ? 110 VAL B CB  1 
ATOM   2315 C  CG1 . VAL B  1 112 ? -1.322  -43.569 5.870   1.00 13.30  ? 110 VAL B CG1 1 
ATOM   2316 C  CG2 . VAL B  1 112 ? -2.243  -44.037 8.158   1.00 14.35  ? 110 VAL B CG2 1 
ATOM   2317 N  N   . VAL B  1 113 ? -1.352  -40.087 5.689   1.00 13.28  ? 111 VAL B N   1 
ATOM   2318 C  CA  . VAL B  1 113 ? -1.392  -39.125 4.599   1.00 13.90  ? 111 VAL B CA  1 
ATOM   2319 C  C   . VAL B  1 113 ? -1.071  -39.775 3.262   1.00 15.26  ? 111 VAL B C   1 
ATOM   2320 O  O   . VAL B  1 113 ? -1.757  -39.548 2.269   1.00 16.58  ? 111 VAL B O   1 
ATOM   2321 C  CB  . VAL B  1 113 ? -0.372  -37.988 4.840   1.00 14.18  ? 111 VAL B CB  1 
ATOM   2322 C  CG1 . VAL B  1 113 ? -0.315  -37.052 3.639   1.00 14.38  ? 111 VAL B CG1 1 
ATOM   2323 C  CG2 . VAL B  1 113 ? -0.733  -37.229 6.107   1.00 14.64  ? 111 VAL B CG2 1 
ATOM   2324 N  N   . SER B  1 114 ? 0.004   -40.548 3.222   1.00 15.63  ? 112 SER B N   1 
ATOM   2325 C  CA  . SER B  1 114 ? 0.317   -41.305 2.021   1.00 17.39  ? 112 SER B CA  1 
ATOM   2326 C  C   . SER B  1 114 ? 1.298   -42.420 2.340   1.00 17.02  ? 112 SER B C   1 
ATOM   2327 O  O   . SER B  1 114 ? 2.126   -42.307 3.248   1.00 17.00  ? 112 SER B O   1 
ATOM   2328 C  CB  . SER B  1 114 ? 0.919   -40.407 0.943   1.00 18.22  ? 112 SER B CB  1 
ATOM   2329 O  OG  . SER B  1 114 ? 2.232   -40.048 1.302   1.00 23.83  ? 112 SER B OG  1 
ATOM   2330 N  N   . THR B  1 115 ? 1.218   -43.491 1.569   1.00 15.73  ? 113 THR B N   1 
ATOM   2331 C  CA  . THR B  1 115 ? 2.154   -44.580 1.733   1.00 16.01  ? 113 THR B CA  1 
ATOM   2332 C  C   . THR B  1 115 ? 2.129   -45.435 0.485   1.00 18.36  ? 113 THR B C   1 
ATOM   2333 O  O   . THR B  1 115 ? 1.144   -45.424 -0.257  1.00 17.92  ? 113 THR B O   1 
ATOM   2334 C  CB  . THR B  1 115 ? 1.796   -45.427 2.956   1.00 14.64  ? 113 THR B CB  1 
ATOM   2335 O  OG1 . THR B  1 115 ? 2.770   -46.454 3.118   1.00 14.29  ? 113 THR B OG1 1 
ATOM   2336 C  CG2 . THR B  1 115 ? 0.406   -46.050 2.801   1.00 14.78  ? 113 THR B CG2 1 
ATOM   2337 N  N   . ASN B  1 116 ? 3.224   -46.151 0.242   1.00 19.29  ? 114 ASN B N   1 
ATOM   2338 C  CA  . ASN B  1 116 ? 3.217   -47.224 -0.729  1.00 19.55  ? 114 ASN B CA  1 
ATOM   2339 C  C   . ASN B  1 116 ? 3.414   -48.563 -0.049  1.00 17.65  ? 114 ASN B C   1 
ATOM   2340 O  O   . ASN B  1 116 ? 3.659   -49.571 -0.711  1.00 18.89  ? 114 ASN B O   1 
ATOM   2341 C  CB  . ASN B  1 116 ? 4.283   -46.988 -1.803  1.00 19.80  ? 114 ASN B CB  1 
ATOM   2342 C  CG  . ASN B  1 116 ? 5.702   -47.250 -1.304  1.00 21.19  ? 114 ASN B CG  1 
ATOM   2343 O  OD1 . ASN B  1 116 ? 5.954   -47.397 -0.108  1.00 21.19  ? 114 ASN B OD1 1 
ATOM   2344 N  ND2 . ASN B  1 116 ? 6.643   -47.284 -2.232  1.00 23.91  ? 114 ASN B ND2 1 
ATOM   2345 N  N   . TYR B  1 117 ? 3.342   -48.560 1.278   1.00 16.52  ? 115 TYR B N   1 
ATOM   2346 C  CA  . TYR B  1 117 ? 3.252   -49.800 2.076   1.00 16.91  ? 115 TYR B CA  1 
ATOM   2347 C  C   . TYR B  1 117 ? 4.577   -50.579 2.224   1.00 17.22  ? 115 TYR B C   1 
ATOM   2348 O  O   . TYR B  1 117 ? 4.879   -51.072 3.322   1.00 18.78  ? 115 TYR B O   1 
ATOM   2349 C  CB  . TYR B  1 117 ? 2.135   -50.712 1.549   1.00 16.98  ? 115 TYR B CB  1 
ATOM   2350 C  CG  . TYR B  1 117 ? 0.761   -50.052 1.554   1.00 16.55  ? 115 TYR B CG  1 
ATOM   2351 C  CD1 . TYR B  1 117 ? 0.053   -49.889 2.735   1.00 16.38  ? 115 TYR B CD1 1 
ATOM   2352 C  CD2 . TYR B  1 117 ? 0.194   -49.571 0.382   1.00 18.02  ? 115 TYR B CD2 1 
ATOM   2353 C  CE1 . TYR B  1 117 ? -1.189  -49.284 2.753   1.00 15.70  ? 115 TYR B CE1 1 
ATOM   2354 C  CE2 . TYR B  1 117 ? -1.043  -48.947 0.382   1.00 16.83  ? 115 TYR B CE2 1 
ATOM   2355 C  CZ  . TYR B  1 117 ? -1.734  -48.801 1.569   1.00 16.99  ? 115 TYR B CZ  1 
ATOM   2356 O  OH  . TYR B  1 117 ? -2.977  -48.187 1.565   1.00 14.78  ? 115 TYR B OH  1 
ATOM   2357 N  N   . ASN B  1 118 ? 5.378   -50.674 1.164   1.00 17.37  ? 116 ASN B N   1 
ATOM   2358 C  CA  . ASN B  1 118 ? 6.607   -51.473 1.227   1.00 21.36  ? 116 ASN B CA  1 
ATOM   2359 C  C   . ASN B  1 118 ? 7.880   -50.677 1.442   1.00 23.71  ? 116 ASN B C   1 
ATOM   2360 O  O   . ASN B  1 118 ? 8.968   -51.270 1.420   1.00 21.30  ? 116 ASN B O   1 
ATOM   2361 C  CB  . ASN B  1 118 ? 6.923   -52.203 -0.086  1.00 25.82  ? 116 ASN B CB  1 
ATOM   2362 C  CG  . ASN B  1 118 ? 5.774   -52.979 -0.668  1.00 28.70  ? 116 ASN B CG  1 
ATOM   2363 O  OD1 . ASN B  1 118 ? 5.617   -53.002 -1.885  1.00 32.35  ? 116 ASN B OD1 1 
ATOM   2364 N  ND2 . ASN B  1 118 ? 5.050   -53.708 0.165   1.00 29.23  ? 116 ASN B ND2 1 
ATOM   2365 N  N   . GLN B  1 119 ? 7.778   -49.349 1.472   1.00 22.59  ? 117 GLN B N   1 
ATOM   2366 C  CA  . GLN B  1 119 ? 8.970   -48.498 1.542   1.00 22.65  ? 117 GLN B CA  1 
ATOM   2367 C  C   . GLN B  1 119 ? 8.776   -47.322 2.484   1.00 21.44  ? 117 GLN B C   1 
ATOM   2368 O  O   . GLN B  1 119 ? 9.540   -47.158 3.428   1.00 19.08  ? 117 GLN B O   1 
ATOM   2369 C  CB  . GLN B  1 119 ? 9.374   -47.991 0.166   1.00 25.89  ? 117 GLN B CB  1 
ATOM   2370 C  CG  . GLN B  1 119 ? 9.991   -49.049 -0.731  1.00 28.47  ? 117 GLN B CG  1 
ATOM   2371 C  CD  . GLN B  1 119 ? 10.230  -48.536 -2.141  1.00 35.50  ? 117 GLN B CD  1 
ATOM   2372 O  OE1 . GLN B  1 119 ? 9.491   -47.684 -2.642  1.00 33.54  ? 117 GLN B OE1 1 
ATOM   2373 N  NE2 . GLN B  1 119 ? 11.281  -49.039 -2.785  1.00 36.22  ? 117 GLN B NE2 1 
ATOM   2374 N  N   . HIS B  1 120 ? 7.767   -46.497 2.215   1.00 21.72  ? 118 HIS B N   1 
ATOM   2375 C  CA  . HIS B  1 120 ? 7.636   -45.226 2.911   1.00 22.92  ? 118 HIS B CA  1 
ATOM   2376 C  C   . HIS B  1 120 ? 6.195   -44.929 3.316   1.00 20.54  ? 118 HIS B C   1 
ATOM   2377 O  O   . HIS B  1 120 ? 5.241   -45.465 2.753   1.00 19.81  ? 118 HIS B O   1 
ATOM   2378 C  CB  . HIS B  1 120 ? 8.191   -44.077 2.060   1.00 26.44  ? 118 HIS B CB  1 
ATOM   2379 C  CG  . HIS B  1 120 ? 7.549   -43.957 0.712   1.00 33.11  ? 118 HIS B CG  1 
ATOM   2380 N  ND1 . HIS B  1 120 ? 6.352   -43.296 0.518   1.00 37.92  ? 118 HIS B ND1 1 
ATOM   2381 C  CD2 . HIS B  1 120 ? 7.938   -44.396 -0.510  1.00 35.06  ? 118 HIS B CD2 1 
ATOM   2382 C  CE1 . HIS B  1 120 ? 6.030   -43.338 -0.763  1.00 39.52  ? 118 HIS B CE1 1 
ATOM   2383 N  NE2 . HIS B  1 120 ? 6.973   -44.004 -1.408  1.00 41.56  ? 118 HIS B NE2 1 
ATOM   2384 N  N   . ALA B  1 121 ? 6.052   -44.050 4.296   1.00 20.57  ? 119 ALA B N   1 
ATOM   2385 C  CA  . ALA B  1 121 ? 4.752   -43.516 4.680   1.00 18.62  ? 119 ALA B CA  1 
ATOM   2386 C  C   . ALA B  1 121 ? 4.931   -42.156 5.339   1.00 18.03  ? 119 ALA B C   1 
ATOM   2387 O  O   . ALA B  1 121 ? 5.977   -41.880 5.944   1.00 16.91  ? 119 ALA B O   1 
ATOM   2388 C  CB  . ALA B  1 121 ? 4.054   -44.475 5.630   1.00 18.07  ? 119 ALA B CB  1 
ATOM   2389 N  N   . MET B  1 122 ? 3.910   -41.307 5.217   1.00 18.04  ? 120 MET B N   1 
ATOM   2390 C  CA  . MET B  1 122 ? 3.785   -40.133 6.063   1.00 18.24  ? 120 MET B CA  1 
ATOM   2391 C  C   . MET B  1 122 ? 2.498   -40.234 6.843   1.00 16.72  ? 120 MET B C   1 
ATOM   2392 O  O   . MET B  1 122 ? 1.447   -40.513 6.270   1.00 15.36  ? 120 MET B O   1 
ATOM   2393 C  CB  . MET B  1 122 ? 3.765   -38.852 5.239   1.00 22.57  ? 120 MET B CB  1 
ATOM   2394 C  CG  . MET B  1 122 ? 5.078   -38.520 4.556   1.00 27.78  ? 120 MET B CG  1 
ATOM   2395 S  SD  . MET B  1 122 ? 5.162   -36.797 4.055   1.00 30.62  ? 120 MET B SD  1 
ATOM   2396 C  CE  . MET B  1 122 ? 3.802   -36.714 2.878   1.00 38.01  ? 120 MET B CE  1 
ATOM   2397 N  N   . VAL B  1 123 ? 2.577   -39.933 8.141   1.00 15.26  ? 121 VAL B N   1 
ATOM   2398 C  CA  . VAL B  1 123 ? 1.412   -39.969 9.009   1.00 14.94  ? 121 VAL B CA  1 
ATOM   2399 C  C   . VAL B  1 123 ? 1.279   -38.668 9.807   1.00 14.95  ? 121 VAL B C   1 
ATOM   2400 O  O   . VAL B  1 123 ? 2.249   -38.177 10.368  1.00 14.38  ? 121 VAL B O   1 
ATOM   2401 C  CB  . VAL B  1 123 ? 1.491   -41.161 9.982   1.00 14.69  ? 121 VAL B CB  1 
ATOM   2402 C  CG1 . VAL B  1 123 ? 0.219   -41.272 10.801  1.00 14.33  ? 121 VAL B CG1 1 
ATOM   2403 C  CG2 . VAL B  1 123 ? 1.757   -42.446 9.212   1.00 14.68  ? 121 VAL B CG2 1 
ATOM   2404 N  N   . PHE B  1 124 ? 0.048   -38.162 9.890   1.00 14.21  ? 122 PHE B N   1 
ATOM   2405 C  CA  . PHE B  1 124 ? -0.265  -36.939 10.610  1.00 13.79  ? 122 PHE B CA  1 
ATOM   2406 C  C   . PHE B  1 124 ? -0.941  -37.271 11.940  1.00 13.72  ? 122 PHE B C   1 
ATOM   2407 O  O   . PHE B  1 124 ? -1.815  -38.144 12.009  1.00 14.27  ? 122 PHE B O   1 
ATOM   2408 C  CB  . PHE B  1 124 ? -1.196  -36.072 9.758   1.00 13.41  ? 122 PHE B CB  1 
ATOM   2409 C  CG  . PHE B  1 124 ? -1.701  -34.850 10.460  1.00 13.32  ? 122 PHE B CG  1 
ATOM   2410 C  CD1 . PHE B  1 124 ? -2.910  -34.873 11.134  1.00 13.89  ? 122 PHE B CD1 1 
ATOM   2411 C  CD2 . PHE B  1 124 ? -0.989  -33.672 10.415  1.00 13.80  ? 122 PHE B CD2 1 
ATOM   2412 C  CE1 . PHE B  1 124 ? -3.388  -33.751 11.775  1.00 14.47  ? 122 PHE B CE1 1 
ATOM   2413 C  CE2 . PHE B  1 124 ? -1.470  -32.538 11.034  1.00 14.60  ? 122 PHE B CE2 1 
ATOM   2414 C  CZ  . PHE B  1 124 ? -2.666  -32.575 11.724  1.00 14.86  ? 122 PHE B CZ  1 
ATOM   2415 N  N   . PHE B  1 125 ? -0.507  -36.600 13.001  1.00 13.39  ? 123 PHE B N   1 
ATOM   2416 C  CA  . PHE B  1 125 ? -1.052  -36.828 14.341  1.00 13.33  ? 123 PHE B CA  1 
ATOM   2417 C  C   . PHE B  1 125 ? -1.468  -35.499 14.917  1.00 14.40  ? 123 PHE B C   1 
ATOM   2418 O  O   . PHE B  1 125 ? -0.743  -34.516 14.784  1.00 14.36  ? 123 PHE B O   1 
ATOM   2419 C  CB  . PHE B  1 125 ? 0.001   -37.426 15.280  1.00 13.11  ? 123 PHE B CB  1 
ATOM   2420 C  CG  . PHE B  1 125 ? 0.553   -38.744 14.829  1.00 12.58  ? 123 PHE B CG  1 
ATOM   2421 C  CD1 . PHE B  1 125 ? 0.146   -39.922 15.439  1.00 12.75  ? 123 PHE B CD1 1 
ATOM   2422 C  CD2 . PHE B  1 125 ? 1.517   -38.805 13.842  1.00 12.35  ? 123 PHE B CD2 1 
ATOM   2423 C  CE1 . PHE B  1 125 ? 0.671   -41.145 15.052  1.00 12.39  ? 123 PHE B CE1 1 
ATOM   2424 C  CE2 . PHE B  1 125 ? 2.042   -40.024 13.441  1.00 12.88  ? 123 PHE B CE2 1 
ATOM   2425 C  CZ  . PHE B  1 125 ? 1.618   -41.201 14.049  1.00 12.24  ? 123 PHE B CZ  1 
ATOM   2426 N  N   . LYS B  1 126 ? -2.608  -35.481 15.594  1.00 15.21  ? 124 LYS B N   1 
ATOM   2427 C  CA  . LYS B  1 126 ? -3.052  -34.285 16.267  1.00 17.25  ? 124 LYS B CA  1 
ATOM   2428 C  C   . LYS B  1 126 ? -3.659  -34.646 17.613  1.00 17.54  ? 124 LYS B C   1 
ATOM   2429 O  O   . LYS B  1 126 ? -4.462  -35.563 17.724  1.00 16.92  ? 124 LYS B O   1 
ATOM   2430 C  CB  . LYS B  1 126 ? -4.087  -33.559 15.409  1.00 19.06  ? 124 LYS B CB  1 
ATOM   2431 C  CG  . LYS B  1 126 ? -4.684  -32.354 16.098  1.00 22.19  ? 124 LYS B CG  1 
ATOM   2432 C  CD  . LYS B  1 126 ? -5.453  -31.469 15.121  1.00 24.11  ? 124 LYS B CD  1 
ATOM   2433 C  CE  . LYS B  1 126 ? -6.924  -31.854 15.039  1.00 24.68  ? 124 LYS B CE  1 
ATOM   2434 N  NZ  . LYS B  1 126 ? -7.645  -31.611 16.322  1.00 27.77  ? 124 LYS B NZ  1 
ATOM   2435 N  N   . LYS B  1 127 ? -3.256  -33.934 18.648  1.00 18.48  ? 125 LYS B N   1 
ATOM   2436 C  CA  . LYS B  1 127 ? -3.699  -34.266 19.977  1.00 19.89  ? 125 LYS B CA  1 
ATOM   2437 C  C   . LYS B  1 127 ? -3.947  -32.991 20.763  1.00 20.27  ? 125 LYS B C   1 
ATOM   2438 O  O   . LYS B  1 127 ? -3.301  -31.977 20.522  1.00 19.39  ? 125 LYS B O   1 
ATOM   2439 C  CB  . LYS B  1 127 ? -2.679  -35.191 20.655  1.00 21.82  ? 125 LYS B CB  1 
ATOM   2440 C  CG  . LYS B  1 127 ? -1.802  -34.581 21.732  1.00 24.87  ? 125 LYS B CG  1 
ATOM   2441 C  CD  . LYS B  1 127 ? -1.024  -35.675 22.439  1.00 27.87  ? 125 LYS B CD  1 
ATOM   2442 C  CE  . LYS B  1 127 ? -0.420  -35.216 23.756  1.00 32.24  ? 125 LYS B CE  1 
ATOM   2443 N  NZ  . LYS B  1 127 ? 0.127   -36.365 24.541  1.00 34.07  ? 125 LYS B NZ  1 
ATOM   2444 N  N   . VAL B  1 128 ? -4.941  -33.031 21.643  1.00 20.81  ? 126 VAL B N   1 
ATOM   2445 C  CA  . VAL B  1 128 ? -5.218  -31.922 22.542  1.00 22.30  ? 126 VAL B CA  1 
ATOM   2446 C  C   . VAL B  1 128 ? -5.027  -32.380 23.984  1.00 23.27  ? 126 VAL B C   1 
ATOM   2447 O  O   . VAL B  1 128 ? -5.633  -33.351 24.427  1.00 23.05  ? 126 VAL B O   1 
ATOM   2448 C  CB  . VAL B  1 128 ? -6.652  -31.388 22.363  1.00 22.97  ? 126 VAL B CB  1 
ATOM   2449 C  CG1 . VAL B  1 128 ? -6.913  -30.251 23.337  1.00 24.25  ? 126 VAL B CG1 1 
ATOM   2450 C  CG2 . VAL B  1 128 ? -6.883  -30.927 20.926  1.00 22.01  ? 126 VAL B CG2 1 
ATOM   2451 N  N   . SER B  1 129 ? -4.142  -31.697 24.691  1.00 24.16  ? 127 SER B N   1 
ATOM   2452 C  CA  . SER B  1 129 ? -3.765  -32.090 26.030  1.00 25.48  ? 127 SER B CA  1 
ATOM   2453 C  C   . SER B  1 129 ? -3.588  -30.839 26.865  1.00 27.23  ? 127 SER B C   1 
ATOM   2454 O  O   . SER B  1 129 ? -2.894  -29.912 26.454  1.00 27.12  ? 127 SER B O   1 
ATOM   2455 C  CB  . SER B  1 129 ? -2.460  -32.888 26.000  1.00 25.67  ? 127 SER B CB  1 
ATOM   2456 O  OG  . SER B  1 129 ? -1.981  -33.125 27.311  1.00 28.03  ? 127 SER B OG  1 
ATOM   2457 N  N   . GLN B  1 130 ? -4.223  -30.809 28.030  1.00 29.34  ? 128 GLN B N   1 
ATOM   2458 C  CA  . GLN B  1 130 ? -4.298  -29.600 28.818  1.00 32.27  ? 128 GLN B CA  1 
ATOM   2459 C  C   . GLN B  1 130 ? -4.767  -28.440 27.939  1.00 30.16  ? 128 GLN B C   1 
ATOM   2460 O  O   . GLN B  1 130 ? -4.284  -27.321 28.080  1.00 31.64  ? 128 GLN B O   1 
ATOM   2461 C  CB  . GLN B  1 130 ? -2.928  -29.270 29.417  1.00 36.88  ? 128 GLN B CB  1 
ATOM   2462 C  CG  . GLN B  1 130 ? -2.653  -29.913 30.765  1.00 42.67  ? 128 GLN B CG  1 
ATOM   2463 C  CD  . GLN B  1 130 ? -1.867  -31.207 30.651  1.00 49.57  ? 128 GLN B CD  1 
ATOM   2464 O  OE1 . GLN B  1 130 ? -1.391  -31.579 29.572  1.00 49.93  ? 128 GLN B OE1 1 
ATOM   2465 N  NE2 . GLN B  1 130 ? -1.733  -31.908 31.771  1.00 57.48  ? 128 GLN B NE2 1 
ATOM   2466 N  N   . ASN B  1 131 ? -5.700  -28.710 27.034  1.00 26.84  ? 129 ASN B N   1 
ATOM   2467 C  CA  . ASN B  1 131 ? -6.271  -27.677 26.173  1.00 25.99  ? 129 ASN B CA  1 
ATOM   2468 C  C   . ASN B  1 131 ? -5.309  -27.137 25.118  1.00 24.95  ? 129 ASN B C   1 
ATOM   2469 O  O   . ASN B  1 131 ? -5.671  -26.247 24.351  1.00 24.84  ? 129 ASN B O   1 
ATOM   2470 C  CB  . ASN B  1 131 ? -6.817  -26.511 27.001  1.00 27.07  ? 129 ASN B CB  1 
ATOM   2471 C  CG  . ASN B  1 131 ? -7.854  -26.948 28.007  1.00 27.75  ? 129 ASN B CG  1 
ATOM   2472 O  OD1 . ASN B  1 131 ? -7.689  -26.740 29.210  1.00 29.28  ? 129 ASN B OD1 1 
ATOM   2473 N  ND2 . ASN B  1 131 ? -8.917  -27.572 27.527  1.00 26.66  ? 129 ASN B ND2 1 
ATOM   2474 N  N   . ARG B  1 132 ? -4.099  -27.674 25.069  1.00 24.52  ? 130 ARG B N   1 
ATOM   2475 C  CA  . ARG B  1 132 ? -3.128  -27.263 24.063  1.00 23.76  ? 130 ARG B CA  1 
ATOM   2476 C  C   . ARG B  1 132 ? -3.131  -28.233 22.886  1.00 22.86  ? 130 ARG B C   1 
ATOM   2477 O  O   . ARG B  1 132 ? -3.166  -29.452 23.068  1.00 21.42  ? 130 ARG B O   1 
ATOM   2478 C  CB  . ARG B  1 132 ? -1.722  -27.198 24.667  1.00 24.47  ? 130 ARG B CB  1 
ATOM   2479 C  CG  . ARG B  1 132 ? -1.554  -26.218 25.818  1.00 26.08  ? 130 ARG B CG  1 
ATOM   2480 C  CD  . ARG B  1 132 ? -0.298  -26.528 26.635  1.00 27.05  ? 130 ARG B CD  1 
ATOM   2481 N  NE  . ARG B  1 132 ? 0.931   -26.343 25.873  1.00 26.74  ? 130 ARG B NE  1 
ATOM   2482 C  CZ  . ARG B  1 132 ? 1.440   -25.154 25.558  1.00 27.64  ? 130 ARG B CZ  1 
ATOM   2483 N  NH1 . ARG B  1 132 ? 0.840   -24.026 25.953  1.00 28.79  ? 130 ARG B NH1 1 
ATOM   2484 N  NH2 . ARG B  1 132 ? 2.556   -25.087 24.853  1.00 27.48  ? 130 ARG B NH2 1 
ATOM   2485 N  N   . GLU B  1 133 ? -3.092  -27.682 21.676  1.00 22.93  ? 131 GLU B N   1 
ATOM   2486 C  CA  . GLU B  1 133 ? -3.249  -28.468 20.462  1.00 22.48  ? 131 GLU B CA  1 
ATOM   2487 C  C   . GLU B  1 133 ? -1.882  -28.742 19.813  1.00 21.91  ? 131 GLU B C   1 
ATOM   2488 O  O   . GLU B  1 133 ? -1.242  -27.842 19.272  1.00 23.35  ? 131 GLU B O   1 
ATOM   2489 C  CB  . GLU B  1 133 ? -4.177  -27.747 19.475  1.00 23.67  ? 131 GLU B CB  1 
ATOM   2490 C  CG  . GLU B  1 133 ? -4.638  -28.610 18.307  1.00 25.41  ? 131 GLU B CG  1 
ATOM   2491 C  CD  . GLU B  1 133 ? -5.820  -28.029 17.540  1.00 28.24  ? 131 GLU B CD  1 
ATOM   2492 O  OE1 . GLU B  1 133 ? -6.487  -28.792 16.821  1.00 29.10  ? 131 GLU B OE1 1 
ATOM   2493 O  OE2 . GLU B  1 133 ? -6.108  -26.820 17.664  1.00 33.70  ? 131 GLU B OE2 1 
ATOM   2494 N  N   . TYR B  1 134 ? -1.440  -29.988 19.882  1.00 20.12  ? 132 TYR B N   1 
ATOM   2495 C  CA  . TYR B  1 134 ? -0.166  -30.393 19.307  1.00 19.08  ? 132 TYR B CA  1 
ATOM   2496 C  C   . TYR B  1 134 ? -0.391  -31.141 18.005  1.00 17.64  ? 132 TYR B C   1 
ATOM   2497 O  O   . TYR B  1 134 ? -1.358  -31.887 17.873  1.00 17.21  ? 132 TYR B O   1 
ATOM   2498 C  CB  . TYR B  1 134 ? 0.585   -31.308 20.278  1.00 18.70  ? 132 TYR B CB  1 
ATOM   2499 C  CG  . TYR B  1 134 ? 0.899   -30.674 21.615  1.00 19.75  ? 132 TYR B CG  1 
ATOM   2500 C  CD1 . TYR B  1 134 ? 0.090   -30.896 22.714  1.00 20.23  ? 132 TYR B CD1 1 
ATOM   2501 C  CD2 . TYR B  1 134 ? 2.005   -29.859 21.780  1.00 20.74  ? 132 TYR B CD2 1 
ATOM   2502 C  CE1 . TYR B  1 134 ? 0.371   -30.329 23.940  1.00 21.73  ? 132 TYR B CE1 1 
ATOM   2503 C  CE2 . TYR B  1 134 ? 2.293   -29.278 23.003  1.00 22.44  ? 132 TYR B CE2 1 
ATOM   2504 C  CZ  . TYR B  1 134 ? 1.474   -29.516 24.079  1.00 22.86  ? 132 TYR B CZ  1 
ATOM   2505 O  OH  . TYR B  1 134 ? 1.767   -28.960 25.303  1.00 24.69  ? 132 TYR B OH  1 
ATOM   2506 N  N   . PHE B  1 135 ? 0.504   -30.955 17.042  1.00 17.42  ? 133 PHE B N   1 
ATOM   2507 C  CA  . PHE B  1 135 ? 0.500   -31.805 15.860  1.00 16.30  ? 133 PHE B CA  1 
ATOM   2508 C  C   . PHE B  1 135 ? 1.897   -32.164 15.416  1.00 17.00  ? 133 PHE B C   1 
ATOM   2509 O  O   . PHE B  1 135 ? 2.855   -31.433 15.663  1.00 17.88  ? 133 PHE B O   1 
ATOM   2510 C  CB  . PHE B  1 135 ? -0.279  -31.160 14.707  1.00 16.16  ? 133 PHE B CB  1 
ATOM   2511 C  CG  . PHE B  1 135 ? 0.430   -30.004 14.041  1.00 16.29  ? 133 PHE B CG  1 
ATOM   2512 C  CD1 . PHE B  1 135 ? 0.414   -28.749 14.614  1.00 17.35  ? 133 PHE B CD1 1 
ATOM   2513 C  CD2 . PHE B  1 135 ? 1.055   -30.166 12.822  1.00 16.03  ? 133 PHE B CD2 1 
ATOM   2514 C  CE1 . PHE B  1 135 ? 1.027   -27.680 13.992  1.00 18.46  ? 133 PHE B CE1 1 
ATOM   2515 C  CE2 . PHE B  1 135 ? 1.678   -29.102 12.190  1.00 17.03  ? 133 PHE B CE2 1 
ATOM   2516 C  CZ  . PHE B  1 135 ? 1.654   -27.855 12.769  1.00 18.16  ? 133 PHE B CZ  1 
ATOM   2517 N  N   . LYS B  1 136 ? 2.004   -33.313 14.769  1.00 17.43  ? 134 LYS B N   1 
ATOM   2518 C  CA  . LYS B  1 136 ? 3.258   -33.736 14.188  1.00 18.84  ? 134 LYS B CA  1 
ATOM   2519 C  C   . LYS B  1 136 ? 3.014   -34.546 12.937  1.00 18.01  ? 134 LYS B C   1 
ATOM   2520 O  O   . LYS B  1 136 ? 1.938   -35.115 12.754  1.00 17.77  ? 134 LYS B O   1 
ATOM   2521 C  CB  . LYS B  1 136 ? 4.062   -34.557 15.187  1.00 19.91  ? 134 LYS B CB  1 
ATOM   2522 C  CG  . LYS B  1 136 ? 3.497   -35.928 15.467  1.00 19.48  ? 134 LYS B CG  1 
ATOM   2523 C  CD  . LYS B  1 136 ? 4.478   -36.791 16.245  1.00 21.14  ? 134 LYS B CD  1 
ATOM   2524 C  CE  . LYS B  1 136 ? 3.925   -38.196 16.436  1.00 22.07  ? 134 LYS B CE  1 
ATOM   2525 N  NZ  . LYS B  1 136 ? 4.583   -38.931 17.549  1.00 25.23  ? 134 LYS B NZ  1 
ATOM   2526 N  N   . ILE B  1 137 ? 4.018   -34.567 12.071  1.00 18.01  ? 135 ILE B N   1 
ATOM   2527 C  CA  . ILE B  1 137 ? 4.039   -35.450 10.922  1.00 17.87  ? 135 ILE B CA  1 
ATOM   2528 C  C   . ILE B  1 137 ? 5.242   -36.368 11.046  1.00 18.23  ? 135 ILE B C   1 
ATOM   2529 O  O   . ILE B  1 137 ? 6.353   -35.922 11.339  1.00 19.24  ? 135 ILE B O   1 
ATOM   2530 C  CB  . ILE B  1 137 ? 4.169   -34.658 9.611   1.00 18.51  ? 135 ILE B CB  1 
ATOM   2531 C  CG1 . ILE B  1 137 ? 3.169   -33.515 9.595   1.00 19.69  ? 135 ILE B CG1 1 
ATOM   2532 C  CG2 . ILE B  1 137 ? 3.927   -35.565 8.418   1.00 17.94  ? 135 ILE B CG2 1 
ATOM   2533 C  CD1 . ILE B  1 137 ? 3.759   -32.199 10.040  1.00 21.55  ? 135 ILE B CD1 1 
ATOM   2534 N  N   . THR B  1 138 ? 5.015   -37.649 10.817  1.00 18.21  ? 136 THR B N   1 
ATOM   2535 C  CA  . THR B  1 138 ? 6.075   -38.645 10.884  1.00 20.82  ? 136 THR B CA  1 
ATOM   2536 C  C   . THR B  1 138 ? 6.380   -39.168 9.478   1.00 20.02  ? 136 THR B C   1 
ATOM   2537 O  O   . THR B  1 138 ? 5.469   -39.484 8.712   1.00 19.07  ? 136 THR B O   1 
ATOM   2538 C  CB  . THR B  1 138 ? 5.664   -39.814 11.801  1.00 22.75  ? 136 THR B CB  1 
ATOM   2539 O  OG1 . THR B  1 138 ? 5.547   -39.349 13.154  1.00 25.79  ? 136 THR B OG1 1 
ATOM   2540 C  CG2 . THR B  1 138 ? 6.696   -40.888 11.765  1.00 26.41  ? 136 THR B CG2 1 
ATOM   2541 N  N   . LEU B  1 139 ? 7.663   -39.237 9.139   1.00 19.77  ? 137 LEU B N   1 
ATOM   2542 C  CA  . LEU B  1 139 ? 8.100   -39.912 7.920   1.00 18.99  ? 137 LEU B CA  1 
ATOM   2543 C  C   . LEU B  1 139 ? 8.629   -41.305 8.249   1.00 17.47  ? 137 LEU B C   1 
ATOM   2544 O  O   . LEU B  1 139 ? 9.620   -41.439 8.955   1.00 16.89  ? 137 LEU B O   1 
ATOM   2545 C  CB  . LEU B  1 139 ? 9.180   -39.090 7.217   1.00 20.68  ? 137 LEU B CB  1 
ATOM   2546 C  CG  . LEU B  1 139 ? 9.747   -39.701 5.930   1.00 22.75  ? 137 LEU B CG  1 
ATOM   2547 C  CD1 . LEU B  1 139 ? 8.684   -39.784 4.839   1.00 22.86  ? 137 LEU B CD1 1 
ATOM   2548 C  CD2 . LEU B  1 139 ? 10.949  -38.906 5.427   1.00 25.27  ? 137 LEU B CD2 1 
ATOM   2549 N  N   . TYR B  1 140 ? 7.929   -42.327 7.756   1.00 16.26  ? 138 TYR B N   1 
ATOM   2550 C  CA  . TYR B  1 140 ? 8.237   -43.729 8.046   1.00 15.25  ? 138 TYR B CA  1 
ATOM   2551 C  C   . TYR B  1 140 ? 9.024   -44.354 6.892   1.00 14.76  ? 138 TYR B C   1 
ATOM   2552 O  O   . TYR B  1 140 ? 8.689   -44.161 5.730   1.00 13.52  ? 138 TYR B O   1 
ATOM   2553 C  CB  . TYR B  1 140 ? 6.938   -44.531 8.193   1.00 14.77  ? 138 TYR B CB  1 
ATOM   2554 C  CG  . TYR B  1 140 ? 6.165   -44.360 9.477   1.00 14.44  ? 138 TYR B CG  1 
ATOM   2555 C  CD1 . TYR B  1 140 ? 6.767   -43.905 10.636  1.00 15.30  ? 138 TYR B CD1 1 
ATOM   2556 C  CD2 . TYR B  1 140 ? 4.837   -44.726 9.544   1.00 14.96  ? 138 TYR B CD2 1 
ATOM   2557 C  CE1 . TYR B  1 140 ? 6.051   -43.780 11.819  1.00 15.21  ? 138 TYR B CE1 1 
ATOM   2558 C  CE2 . TYR B  1 140 ? 4.117   -44.612 10.724  1.00 15.26  ? 138 TYR B CE2 1 
ATOM   2559 C  CZ  . TYR B  1 140 ? 4.727   -44.131 11.858  1.00 15.10  ? 138 TYR B CZ  1 
ATOM   2560 O  OH  . TYR B  1 140 ? 3.996   -44.025 13.024  1.00 14.39  ? 138 TYR B OH  1 
ATOM   2561 N  N   . GLY B  1 141 ? 10.056  -45.123 7.222   1.00 15.53  ? 139 GLY B N   1 
ATOM   2562 C  CA  . GLY B  1 141 ? 10.706  -46.004 6.251   1.00 15.21  ? 139 GLY B CA  1 
ATOM   2563 C  C   . GLY B  1 141 ? 10.679  -47.449 6.706   1.00 15.84  ? 139 GLY B C   1 
ATOM   2564 O  O   . GLY B  1 141 ? 10.729  -47.731 7.914   1.00 15.48  ? 139 GLY B O   1 
ATOM   2565 N  N   . ARG B  1 142 ? 10.579  -48.373 5.755   1.00 16.03  ? 140 ARG B N   1 
ATOM   2566 C  CA  . ARG B  1 142 ? 10.707  -49.794 6.083   1.00 17.64  ? 140 ARG B CA  1 
ATOM   2567 C  C   . ARG B  1 142 ? 12.148  -50.135 6.417   1.00 17.58  ? 140 ARG B C   1 
ATOM   2568 O  O   . ARG B  1 142 ? 12.397  -51.091 7.146   1.00 18.53  ? 140 ARG B O   1 
ATOM   2569 C  CB  . ARG B  1 142 ? 10.225  -50.692 4.940   1.00 17.50  ? 140 ARG B CB  1 
ATOM   2570 C  CG  . ARG B  1 142 ? 8.716   -50.721 4.759   1.00 18.28  ? 140 ARG B CG  1 
ATOM   2571 C  CD  . ARG B  1 142 ? 7.973   -51.202 5.998   1.00 17.35  ? 140 ARG B CD  1 
ATOM   2572 N  NE  . ARG B  1 142 ? 6.571   -51.468 5.659   1.00 18.45  ? 140 ARG B NE  1 
ATOM   2573 C  CZ  . ARG B  1 142 ? 5.650   -51.901 6.514   1.00 19.07  ? 140 ARG B CZ  1 
ATOM   2574 N  NH1 . ARG B  1 142 ? 4.404   -52.130 6.088   1.00 18.07  ? 140 ARG B NH1 1 
ATOM   2575 N  NH2 . ARG B  1 142 ? 5.970   -52.109 7.789   1.00 20.33  ? 140 ARG B NH2 1 
ATOM   2576 N  N   . THR B  1 143 ? 13.082  -49.341 5.899   1.00 18.55  ? 141 THR B N   1 
ATOM   2577 C  CA  . THR B  1 143 ? 14.465  -49.331 6.385   1.00 20.92  ? 141 THR B CA  1 
ATOM   2578 C  C   . THR B  1 143 ? 14.833  -47.976 6.978   1.00 22.53  ? 141 THR B C   1 
ATOM   2579 O  O   . THR B  1 143 ? 14.022  -47.046 6.975   1.00 23.49  ? 141 THR B O   1 
ATOM   2580 C  CB  . THR B  1 143 ? 15.475  -49.648 5.258   1.00 22.52  ? 141 THR B CB  1 
ATOM   2581 O  OG1 . THR B  1 143 ? 15.594  -48.523 4.384   1.00 24.22  ? 141 THR B OG1 1 
ATOM   2582 C  CG2 . THR B  1 143 ? 15.031  -50.860 4.461   1.00 21.62  ? 141 THR B CG2 1 
ATOM   2583 N  N   . LYS B  1 144 ? 16.059  -47.868 7.490   1.00 23.96  ? 142 LYS B N   1 
ATOM   2584 C  CA  . LYS B  1 144 ? 16.488  -46.678 8.228   1.00 25.70  ? 142 LYS B CA  1 
ATOM   2585 C  C   . LYS B  1 144 ? 16.875  -45.514 7.301   1.00 28.01  ? 142 LYS B C   1 
ATOM   2586 O  O   . LYS B  1 144 ? 17.138  -44.407 7.767   1.00 26.63  ? 142 LYS B O   1 
ATOM   2587 C  CB  . LYS B  1 144 ? 17.674  -47.014 9.132   1.00 24.88  ? 142 LYS B CB  1 
ATOM   2588 C  CG  . LYS B  1 144 ? 17.383  -48.049 10.202  1.00 24.15  ? 142 LYS B CG  1 
ATOM   2589 C  CD  . LYS B  1 144 ? 18.632  -48.352 11.005  1.00 25.47  ? 142 LYS B CD  1 
ATOM   2590 C  CE  . LYS B  1 144 ? 18.506  -49.622 11.823  1.00 25.14  ? 142 LYS B CE  1 
ATOM   2591 N  NZ  . LYS B  1 144 ? 19.780  -49.932 12.536  1.00 27.45  ? 142 LYS B NZ  1 
ATOM   2592 N  N   . GLU B  1 145 ? 16.924  -45.770 6.000   1.00 31.80  ? 143 GLU B N   1 
ATOM   2593 C  CA  . GLU B  1 145 ? 17.349  -44.757 5.046   1.00 38.45  ? 143 GLU B CA  1 
ATOM   2594 C  C   . GLU B  1 145 ? 16.221  -44.446 4.082   1.00 37.30  ? 143 GLU B C   1 
ATOM   2595 O  O   . GLU B  1 145 ? 15.431  -45.325 3.725   1.00 38.77  ? 143 GLU B O   1 
ATOM   2596 C  CB  . GLU B  1 145 ? 18.557  -45.248 4.257   1.00 50.28  ? 143 GLU B CB  1 
ATOM   2597 C  CG  . GLU B  1 145 ? 19.735  -45.676 5.122   1.00 64.69  ? 143 GLU B CG  1 
ATOM   2598 C  CD  . GLU B  1 145 ? 20.656  -44.523 5.477   1.00 77.15  ? 143 GLU B CD  1 
ATOM   2599 O  OE1 . GLU B  1 145 ? 20.398  -43.380 5.035   1.00 84.83  ? 143 GLU B OE1 1 
ATOM   2600 O  OE2 . GLU B  1 145 ? 21.646  -44.763 6.199   1.00 92.20  ? 143 GLU B OE2 1 
ATOM   2601 N  N   . LEU B  1 146 ? 16.133  -43.192 3.663   1.00 35.25  ? 144 LEU B N   1 
ATOM   2602 C  CA  . LEU B  1 146 ? 15.307  -42.849 2.515   1.00 38.40  ? 144 LEU B CA  1 
ATOM   2603 C  C   . LEU B  1 146 ? 16.035  -41.829 1.659   1.00 36.68  ? 144 LEU B C   1 
ATOM   2604 O  O   . LEU B  1 146 ? 16.984  -41.184 2.104   1.00 32.93  ? 144 LEU B O   1 
ATOM   2605 C  CB  . LEU B  1 146 ? 13.939  -42.290 2.948   1.00 40.87  ? 144 LEU B CB  1 
ATOM   2606 C  CG  . LEU B  1 146 ? 12.928  -43.218 3.654   1.00 42.77  ? 144 LEU B CG  1 
ATOM   2607 C  CD1 . LEU B  1 146 ? 11.726  -42.398 4.117   1.00 43.09  ? 144 LEU B CD1 1 
ATOM   2608 C  CD2 . LEU B  1 146 ? 12.463  -44.378 2.774   1.00 40.01  ? 144 LEU B CD2 1 
ATOM   2609 N  N   . THR B  1 147 ? 15.564  -41.680 0.431   1.00 36.83  ? 145 THR B N   1 
ATOM   2610 C  CA  . THR B  1 147 ? 16.213  -40.814 -0.546  1.00 37.12  ? 145 THR B CA  1 
ATOM   2611 C  C   . THR B  1 147 ? 16.055  -39.346 -0.164  1.00 35.91  ? 145 THR B C   1 
ATOM   2612 O  O   . THR B  1 147 ? 15.098  -38.975 0.517   1.00 36.34  ? 145 THR B O   1 
ATOM   2613 C  CB  . THR B  1 147 ? 15.600  -41.026 -1.945  1.00 40.16  ? 145 THR B CB  1 
ATOM   2614 O  OG1 . THR B  1 147 ? 14.187  -40.753 -1.906  1.00 36.90  ? 145 THR B OG1 1 
ATOM   2615 C  CG2 . THR B  1 147 ? 15.831  -42.461 -2.425  1.00 35.81  ? 145 THR B CG2 1 
ATOM   2616 N  N   . SER B  1 148 ? 16.999  -38.522 -0.604  1.00 38.13  ? 146 SER B N   1 
ATOM   2617 C  CA  . SER B  1 148 ? 16.870  -37.070 -0.530  1.00 42.74  ? 146 SER B CA  1 
ATOM   2618 C  C   . SER B  1 148 ? 15.525  -36.597 -1.068  1.00 43.68  ? 146 SER B C   1 
ATOM   2619 O  O   . SER B  1 148 ? 14.911  -35.695 -0.502  1.00 40.78  ? 146 SER B O   1 
ATOM   2620 C  CB  . SER B  1 148 ? 17.979  -36.401 -1.335  1.00 46.69  ? 146 SER B CB  1 
ATOM   2621 O  OG  . SER B  1 148 ? 19.242  -36.629 -0.740  1.00 51.03  ? 146 SER B OG  1 
ATOM   2622 N  N   . GLU B  1 149 ? 15.077  -37.203 -2.166  1.00 43.88  ? 147 GLU B N   1 
ATOM   2623 C  CA  . GLU B  1 149 ? 13.828  -36.785 -2.808  1.00 44.89  ? 147 GLU B CA  1 
ATOM   2624 C  C   . GLU B  1 149 ? 12.633  -36.950 -1.860  1.00 39.68  ? 147 GLU B C   1 
ATOM   2625 O  O   . GLU B  1 149 ? 11.827  -36.032 -1.704  1.00 34.06  ? 147 GLU B O   1 
ATOM   2626 C  CB  . GLU B  1 149 ? 13.606  -37.486 -4.157  1.00 48.05  ? 147 GLU B CB  1 
ATOM   2627 C  CG  . GLU B  1 149 ? 14.287  -36.714 -5.301  1.00 53.32  ? 147 GLU B CG  1 
ATOM   2628 C  CD  . GLU B  1 149 ? 15.644  -37.283 -5.717  1.00 60.27  ? 147 GLU B CD  1 
ATOM   2629 O  OE1 . GLU B  1 149 ? 16.219  -38.104 -4.965  1.00 58.44  ? 147 GLU B OE1 1 
ATOM   2630 O  OE2 . GLU B  1 149 ? 16.147  -36.891 -6.800  1.00 63.15  ? 147 GLU B OE2 1 
ATOM   2631 N  N   . LEU B  1 150 ? 12.553  -38.096 -1.192  1.00 38.75  ? 148 LEU B N   1 
ATOM   2632 C  CA  . LEU B  1 150 ? 11.476  -38.350 -0.239  1.00 41.97  ? 148 LEU B CA  1 
ATOM   2633 C  C   . LEU B  1 150 ? 11.567  -37.428 0.983   1.00 39.30  ? 148 LEU B C   1 
ATOM   2634 O  O   . LEU B  1 150 ? 10.552  -36.948 1.493   1.00 36.37  ? 148 LEU B O   1 
ATOM   2635 C  CB  . LEU B  1 150 ? 11.474  -39.817 0.200   1.00 43.06  ? 148 LEU B CB  1 
ATOM   2636 C  CG  . LEU B  1 150 ? 10.992  -40.811 -0.867  1.00 46.32  ? 148 LEU B CG  1 
ATOM   2637 C  CD1 . LEU B  1 150 ? 11.358  -42.239 -0.489  1.00 41.94  ? 148 LEU B CD1 1 
ATOM   2638 C  CD2 . LEU B  1 150 ? 9.489   -40.682 -1.094  1.00 49.60  ? 148 LEU B CD2 1 
ATOM   2639 N  N   . LYS B  1 151 ? 12.781  -37.150 1.428   1.00 34.84  ? 149 LYS B N   1 
ATOM   2640 C  CA  . LYS B  1 151 ? 12.958  -36.290 2.578   1.00 33.76  ? 149 LYS B CA  1 
ATOM   2641 C  C   . LYS B  1 151 ? 12.641  -34.839 2.255   1.00 34.15  ? 149 LYS B C   1 
ATOM   2642 O  O   . LYS B  1 151 ? 12.063  -34.130 3.072   1.00 36.59  ? 149 LYS B O   1 
ATOM   2643 C  CB  . LYS B  1 151 ? 14.366  -36.459 3.142   1.00 35.05  ? 149 LYS B CB  1 
ATOM   2644 C  CG  . LYS B  1 151 ? 14.570  -37.851 3.736   1.00 36.22  ? 149 LYS B CG  1 
ATOM   2645 C  CD  . LYS B  1 151 ? 15.847  -37.962 4.549   1.00 38.01  ? 149 LYS B CD  1 
ATOM   2646 C  CE  . LYS B  1 151 ? 17.063  -38.090 3.653   1.00 39.72  ? 149 LYS B CE  1 
ATOM   2647 N  NZ  . LYS B  1 151 ? 18.198  -38.733 4.365   1.00 42.06  ? 149 LYS B NZ  1 
ATOM   2648 N  N   . GLU B  1 152 ? 12.982  -34.404 1.050   1.00 36.54  ? 150 GLU B N   1 
ATOM   2649 C  CA  . GLU B  1 152 ? 12.598  -33.074 0.578   1.00 37.51  ? 150 GLU B CA  1 
ATOM   2650 C  C   . GLU B  1 152 ? 11.097  -32.931 0.444   1.00 31.85  ? 150 GLU B C   1 
ATOM   2651 O  O   . GLU B  1 152 ? 10.542  -31.878 0.748   1.00 31.88  ? 150 GLU B O   1 
ATOM   2652 C  CB  . GLU B  1 152 ? 13.243  -32.771 -0.780  1.00 41.97  ? 150 GLU B CB  1 
ATOM   2653 C  CG  . GLU B  1 152 ? 14.734  -32.512 -0.734  1.00 47.57  ? 150 GLU B CG  1 
ATOM   2654 C  CD  . GLU B  1 152 ? 15.399  -32.716 -2.088  1.00 55.34  ? 150 GLU B CD  1 
ATOM   2655 O  OE1 . GLU B  1 152 ? 14.691  -32.671 -3.127  1.00 56.08  ? 150 GLU B OE1 1 
ATOM   2656 O  OE2 . GLU B  1 152 ? 16.635  -32.920 -2.113  1.00 56.41  ? 150 GLU B OE2 1 
ATOM   2657 N  N   . ASN B  1 153 ? 10.436  -33.988 -0.017  1.00 28.13  ? 151 ASN B N   1 
ATOM   2658 C  CA  . ASN B  1 153 ? 8.997   -33.971 -0.125  1.00 25.59  ? 151 ASN B CA  1 
ATOM   2659 C  C   . ASN B  1 153 ? 8.355   -33.805 1.241   1.00 25.03  ? 151 ASN B C   1 
ATOM   2660 O  O   . ASN B  1 153 ? 7.337   -33.121 1.385   1.00 25.80  ? 151 ASN B O   1 
ATOM   2661 C  CB  . ASN B  1 153 ? 8.501   -35.251 -0.783  1.00 26.07  ? 151 ASN B CB  1 
ATOM   2662 C  CG  . ASN B  1 153 ? 7.029   -35.188 -1.124  1.00 25.92  ? 151 ASN B CG  1 
ATOM   2663 O  OD1 . ASN B  1 153 ? 6.611   -34.357 -1.927  1.00 30.16  ? 151 ASN B OD1 1 
ATOM   2664 N  ND2 . ASN B  1 153 ? 6.232   -36.033 -0.487  1.00 24.92  ? 151 ASN B ND2 1 
ATOM   2665 N  N   . PHE B  1 154 ? 8.944   -34.461 2.237   1.00 22.40  ? 152 PHE B N   1 
ATOM   2666 C  CA  . PHE B  1 154 ? 8.455   -34.406 3.610   1.00 20.76  ? 152 PHE B CA  1 
ATOM   2667 C  C   . PHE B  1 154 ? 8.654   -33.006 4.196   1.00 21.32  ? 152 PHE B C   1 
ATOM   2668 O  O   . PHE B  1 154 ? 7.781   -32.482 4.874   1.00 19.60  ? 152 PHE B O   1 
ATOM   2669 C  CB  . PHE B  1 154 ? 9.184   -35.458 4.438   1.00 20.22  ? 152 PHE B CB  1 
ATOM   2670 C  CG  . PHE B  1 154 ? 8.980   -35.333 5.913   1.00 18.66  ? 152 PHE B CG  1 
ATOM   2671 C  CD1 . PHE B  1 154 ? 10.015  -34.903 6.723   1.00 19.13  ? 152 PHE B CD1 1 
ATOM   2672 C  CD2 . PHE B  1 154 ? 7.762   -35.667 6.494   1.00 17.60  ? 152 PHE B CD2 1 
ATOM   2673 C  CE1 . PHE B  1 154 ? 9.838   -34.801 8.093   1.00 19.02  ? 152 PHE B CE1 1 
ATOM   2674 C  CE2 . PHE B  1 154 ? 7.584   -35.581 7.866   1.00 16.76  ? 152 PHE B CE2 1 
ATOM   2675 C  CZ  . PHE B  1 154 ? 8.627   -35.151 8.664   1.00 17.47  ? 152 PHE B CZ  1 
ATOM   2676 N  N   . ILE B  1 155 ? 9.787   -32.392 3.895   1.00 22.70  ? 153 ILE B N   1 
ATOM   2677 C  CA  . ILE B  1 155 ? 10.036  -31.014 4.297   1.00 24.91  ? 153 ILE B CA  1 
ATOM   2678 C  C   . ILE B  1 155 ? 9.042   -30.056 3.638   1.00 26.91  ? 153 ILE B C   1 
ATOM   2679 O  O   . ILE B  1 155 ? 8.486   -29.162 4.285   1.00 25.36  ? 153 ILE B O   1 
ATOM   2680 C  CB  . ILE B  1 155 ? 11.471  -30.589 3.932   1.00 26.42  ? 153 ILE B CB  1 
ATOM   2681 C  CG1 . ILE B  1 155 ? 12.477  -31.357 4.793   1.00 26.83  ? 153 ILE B CG1 1 
ATOM   2682 C  CG2 . ILE B  1 155 ? 11.655  -29.094 4.116   1.00 26.86  ? 153 ILE B CG2 1 
ATOM   2683 C  CD1 . ILE B  1 155 ? 13.906  -31.285 4.289   1.00 28.01  ? 153 ILE B CD1 1 
ATOM   2684 N  N   . ARG B  1 156 ? 8.806   -30.264 2.348   1.00 29.24  ? 154 ARG B N   1 
ATOM   2685 C  CA  . ARG B  1 156 ? 7.852   -29.452 1.603   1.00 29.20  ? 154 ARG B CA  1 
ATOM   2686 C  C   . ARG B  1 156 ? 6.468   -29.549 2.245   1.00 26.07  ? 154 ARG B C   1 
ATOM   2687 O  O   . ARG B  1 156 ? 5.813   -28.530 2.480   1.00 26.08  ? 154 ARG B O   1 
ATOM   2688 C  CB  . ARG B  1 156 ? 7.804   -29.917 0.147   1.00 32.74  ? 154 ARG B CB  1 
ATOM   2689 C  CG  . ARG B  1 156 ? 6.949   -29.068 -0.787  1.00 37.68  ? 154 ARG B CG  1 
ATOM   2690 C  CD  . ARG B  1 156 ? 7.229   -29.419 -2.251  1.00 42.69  ? 154 ARG B CD  1 
ATOM   2691 N  NE  . ARG B  1 156 ? 8.632   -29.798 -2.465  1.00 48.39  ? 154 ARG B NE  1 
ATOM   2692 C  CZ  . ARG B  1 156 ? 9.056   -31.012 -2.832  1.00 49.36  ? 154 ARG B CZ  1 
ATOM   2693 N  NH1 . ARG B  1 156 ? 8.194   -31.997 -3.055  1.00 49.47  ? 154 ARG B NH1 1 
ATOM   2694 N  NH2 . ARG B  1 156 ? 10.357  -31.241 -2.984  1.00 47.16  ? 154 ARG B NH2 1 
ATOM   2695 N  N   . PHE B  1 157 ? 6.035   -30.770 2.542   1.00 21.90  ? 155 PHE B N   1 
ATOM   2696 C  CA  . PHE B  1 157 ? 4.716   -30.991 3.128   1.00 20.43  ? 155 PHE B CA  1 
ATOM   2697 C  C   . PHE B  1 157 ? 4.625   -30.366 4.516   1.00 21.10  ? 155 PHE B C   1 
ATOM   2698 O  O   . PHE B  1 157 ? 3.629   -29.716 4.858   1.00 21.36  ? 155 PHE B O   1 
ATOM   2699 C  CB  . PHE B  1 157 ? 4.391   -32.483 3.195   1.00 18.66  ? 155 PHE B CB  1 
ATOM   2700 C  CG  . PHE B  1 157 ? 3.060   -32.794 3.832   1.00 17.53  ? 155 PHE B CG  1 
ATOM   2701 C  CD1 . PHE B  1 157 ? 1.872   -32.371 3.249   1.00 16.72  ? 155 PHE B CD1 1 
ATOM   2702 C  CD2 . PHE B  1 157 ? 2.994   -33.550 5.001   1.00 17.01  ? 155 PHE B CD2 1 
ATOM   2703 C  CE1 . PHE B  1 157 ? 0.648   -32.674 3.827   1.00 15.55  ? 155 PHE B CE1 1 
ATOM   2704 C  CE2 . PHE B  1 157 ? 1.769   -33.849 5.590   1.00 15.71  ? 155 PHE B CE2 1 
ATOM   2705 C  CZ  . PHE B  1 157 ? 0.598   -33.407 5.000   1.00 15.22  ? 155 PHE B CZ  1 
ATOM   2706 N  N   . SER B  1 158 ? 5.676   -30.538 5.303   1.00 22.04  ? 156 SER B N   1 
ATOM   2707 C  CA  . SER B  1 158 ? 5.711   -29.986 6.650   1.00 24.96  ? 156 SER B CA  1 
ATOM   2708 C  C   . SER B  1 158 ? 5.577   -28.467 6.623   1.00 26.20  ? 156 SER B C   1 
ATOM   2709 O  O   . SER B  1 158 ? 4.838   -27.900 7.415   1.00 25.82  ? 156 SER B O   1 
ATOM   2710 C  CB  . SER B  1 158 ? 6.997   -30.395 7.364   1.00 26.14  ? 156 SER B CB  1 
ATOM   2711 O  OG  . SER B  1 158 ? 6.989   -31.786 7.648   1.00 25.89  ? 156 SER B OG  1 
ATOM   2712 N  N   . LYS B  1 159 ? 6.266   -27.823 5.686   1.00 28.94  ? 157 LYS B N   1 
ATOM   2713 C  CA  . LYS B  1 159 ? 6.166   -26.380 5.523   1.00 31.60  ? 157 LYS B CA  1 
ATOM   2714 C  C   . LYS B  1 159 ? 4.763   -25.963 5.120   1.00 28.48  ? 157 LYS B C   1 
ATOM   2715 O  O   . LYS B  1 159 ? 4.269   -24.931 5.565   1.00 28.34  ? 157 LYS B O   1 
ATOM   2716 C  CB  . LYS B  1 159 ? 7.156   -25.875 4.468   1.00 38.29  ? 157 LYS B CB  1 
ATOM   2717 C  CG  . LYS B  1 159 ? 8.619   -25.743 4.903   1.00 44.94  ? 157 LYS B CG  1 
ATOM   2718 C  CD  . LYS B  1 159 ? 9.129   -24.315 4.733   1.00 57.20  ? 157 LYS B CD  1 
ATOM   2719 C  CE  . LYS B  1 159 ? 10.652  -24.268 4.794   1.00 60.94  ? 157 LYS B CE  1 
ATOM   2720 N  NZ  . LYS B  1 159 ? 11.173  -22.899 5.073   1.00 62.92  ? 157 LYS B NZ  1 
ATOM   2721 N  N   . SER B  1 160 ? 4.111   -26.761 4.281   1.00 25.81  ? 158 SER B N   1 
ATOM   2722 C  CA  . SER B  1 160 ? 2.768   -26.426 3.819   1.00 24.71  ? 158 SER B CA  1 
ATOM   2723 C  C   . SER B  1 160 ? 1.779   -26.405 4.998   1.00 24.88  ? 158 SER B C   1 
ATOM   2724 O  O   . SER B  1 160 ? 0.675   -25.886 4.881   1.00 24.24  ? 158 SER B O   1 
ATOM   2725 C  CB  . SER B  1 160 ? 2.298   -27.433 2.758   1.00 22.32  ? 158 SER B CB  1 
ATOM   2726 O  OG  . SER B  1 160 ? 1.745   -28.598 3.364   1.00 20.51  ? 158 SER B OG  1 
ATOM   2727 N  N   . LEU B  1 161 ? 2.166   -27.020 6.111   1.00 24.94  ? 159 LEU B N   1 
ATOM   2728 C  CA  . LEU B  1 161 ? 1.321   -27.066 7.303   1.00 23.99  ? 159 LEU B CA  1 
ATOM   2729 C  C   . LEU B  1 161 ? 1.761   -26.035 8.338   1.00 23.50  ? 159 LEU B C   1 
ATOM   2730 O  O   . LEU B  1 161 ? 1.267   -26.033 9.465   1.00 22.46  ? 159 LEU B O   1 
ATOM   2731 C  CB  . LEU B  1 161 ? 1.355   -28.466 7.930   1.00 22.86  ? 159 LEU B CB  1 
ATOM   2732 C  CG  . LEU B  1 161 ? 0.877   -29.625 7.058   1.00 22.26  ? 159 LEU B CG  1 
ATOM   2733 C  CD1 . LEU B  1 161 ? 0.887   -30.901 7.877   1.00 24.16  ? 159 LEU B CD1 1 
ATOM   2734 C  CD2 . LEU B  1 161 ? -0.515  -29.382 6.502   1.00 22.26  ? 159 LEU B CD2 1 
ATOM   2735 N  N   . GLY B  1 162 ? 2.694   -25.169 7.958   1.00 23.60  ? 160 GLY B N   1 
ATOM   2736 C  CA  . GLY B  1 162 ? 3.052   -24.021 8.783   1.00 24.50  ? 160 GLY B CA  1 
ATOM   2737 C  C   . GLY B  1 162 ? 4.339   -24.193 9.584   1.00 25.36  ? 160 GLY B C   1 
ATOM   2738 O  O   . GLY B  1 162 ? 4.707   -23.325 10.358  1.00 26.15  ? 160 GLY B O   1 
ATOM   2739 N  N   . LEU B  1 163 ? 5.044   -25.297 9.380   1.00 25.59  ? 161 LEU B N   1 
ATOM   2740 C  CA  . LEU B  1 163 ? 6.244   -25.585 10.162  1.00 27.06  ? 161 LEU B CA  1 
ATOM   2741 C  C   . LEU B  1 163 ? 7.494   -25.097 9.454   1.00 29.10  ? 161 LEU B C   1 
ATOM   2742 O  O   . LEU B  1 163 ? 7.715   -25.416 8.295   1.00 31.36  ? 161 LEU B O   1 
ATOM   2743 C  CB  . LEU B  1 163 ? 6.360   -27.086 10.408  1.00 25.55  ? 161 LEU B CB  1 
ATOM   2744 C  CG  . LEU B  1 163 ? 5.230   -27.705 11.220  1.00 24.83  ? 161 LEU B CG  1 
ATOM   2745 C  CD1 . LEU B  1 163 ? 5.356   -29.218 11.205  1.00 24.39  ? 161 LEU B CD1 1 
ATOM   2746 C  CD2 . LEU B  1 163 ? 5.232   -27.175 12.646  1.00 26.07  ? 161 LEU B CD2 1 
ATOM   2747 N  N   . PRO B  1 164 ? 8.332   -24.327 10.155  1.00 31.80  ? 162 PRO B N   1 
ATOM   2748 C  CA  . PRO B  1 164 ? 9.640   -23.960 9.622   1.00 33.68  ? 162 PRO B CA  1 
ATOM   2749 C  C   . PRO B  1 164 ? 10.693  -25.040 9.855   1.00 34.61  ? 162 PRO B C   1 
ATOM   2750 O  O   . PRO B  1 164 ? 10.425  -26.031 10.536  1.00 33.57  ? 162 PRO B O   1 
ATOM   2751 C  CB  . PRO B  1 164 ? 9.985   -22.692 10.401  1.00 35.13  ? 162 PRO B CB  1 
ATOM   2752 C  CG  . PRO B  1 164 ? 9.297   -22.865 11.711  1.00 35.01  ? 162 PRO B CG  1 
ATOM   2753 C  CD  . PRO B  1 164 ? 8.083   -23.726 11.476  1.00 32.83  ? 162 PRO B CD  1 
ATOM   2754 N  N   . GLU B  1 165 ? 11.881  -24.841 9.294   1.00 38.12  ? 163 GLU B N   1 
ATOM   2755 C  CA  . GLU B  1 165 ? 12.860  -25.911 9.142   1.00 39.38  ? 163 GLU B CA  1 
ATOM   2756 C  C   . GLU B  1 165 ? 13.342  -26.416 10.490  1.00 37.08  ? 163 GLU B C   1 
ATOM   2757 O  O   . GLU B  1 165 ? 13.659  -27.596 10.645  1.00 35.04  ? 163 GLU B O   1 
ATOM   2758 C  CB  . GLU B  1 165 ? 14.071  -25.413 8.336   1.00 47.38  ? 163 GLU B CB  1 
ATOM   2759 C  CG  . GLU B  1 165 ? 14.824  -26.514 7.585   1.00 55.37  ? 163 GLU B CG  1 
ATOM   2760 C  CD  . GLU B  1 165 ? 14.499  -26.563 6.098   1.00 61.08  ? 163 GLU B CD  1 
ATOM   2761 O  OE1 . GLU B  1 165 ? 13.540  -25.883 5.666   1.00 69.95  ? 163 GLU B OE1 1 
ATOM   2762 O  OE2 . GLU B  1 165 ? 15.217  -27.276 5.358   1.00 62.62  ? 163 GLU B OE2 1 
ATOM   2763 N  N   . ASN B  1 166 ? 13.436  -25.518 11.462  1.00 36.30  ? 164 ASN B N   1 
ATOM   2764 C  CA  . ASN B  1 166 ? 13.952  -25.898 12.775  1.00 36.56  ? 164 ASN B CA  1 
ATOM   2765 C  C   . ASN B  1 166 ? 12.922  -26.659 13.618  1.00 33.05  ? 164 ASN B C   1 
ATOM   2766 O  O   . ASN B  1 166 ? 13.212  -27.047 14.749  1.00 32.31  ? 164 ASN B O   1 
ATOM   2767 C  CB  . ASN B  1 166 ? 14.469  -24.669 13.528  1.00 39.02  ? 164 ASN B CB  1 
ATOM   2768 C  CG  . ASN B  1 166 ? 13.366  -23.694 13.880  1.00 40.35  ? 164 ASN B CG  1 
ATOM   2769 O  OD1 . ASN B  1 166 ? 12.309  -23.670 13.254  1.00 38.19  ? 164 ASN B OD1 1 
ATOM   2770 N  ND2 . ASN B  1 166 ? 13.623  -22.857 14.873  1.00 45.31  ? 164 ASN B ND2 1 
ATOM   2771 N  N   . HIS B  1 167 ? 11.726  -26.862 13.067  1.00 30.66  ? 165 HIS B N   1 
ATOM   2772 C  CA  . HIS B  1 167 ? 10.749  -27.767 13.661  1.00 29.57  ? 165 HIS B CA  1 
ATOM   2773 C  C   . HIS B  1 167 ? 10.692  -29.087 12.893  1.00 26.75  ? 165 HIS B C   1 
ATOM   2774 O  O   . HIS B  1 167 ? 9.736   -29.848 13.011  1.00 24.28  ? 165 HIS B O   1 
ATOM   2775 C  CB  . HIS B  1 167 ? 9.366   -27.111 13.705  1.00 30.59  ? 165 HIS B CB  1 
ATOM   2776 C  CG  . HIS B  1 167 ? 9.200   -26.126 14.824  1.00 34.94  ? 165 HIS B CG  1 
ATOM   2777 N  ND1 . HIS B  1 167 ? 8.510   -26.420 15.981  1.00 38.02  ? 165 HIS B ND1 1 
ATOM   2778 C  CD2 . HIS B  1 167 ? 9.628   -24.849 14.960  1.00 37.13  ? 165 HIS B CD2 1 
ATOM   2779 C  CE1 . HIS B  1 167 ? 8.534   -25.374 16.787  1.00 37.85  ? 165 HIS B CE1 1 
ATOM   2780 N  NE2 . HIS B  1 167 ? 9.203   -24.406 16.189  1.00 38.82  ? 165 HIS B NE2 1 
ATOM   2781 N  N   . ILE B  1 168 ? 11.728  -29.342 12.103  1.00 27.11  ? 166 ILE B N   1 
ATOM   2782 C  CA  . ILE B  1 168 ? 11.843  -30.575 11.343  1.00 25.79  ? 166 ILE B CA  1 
ATOM   2783 C  C   . ILE B  1 168 ? 13.177  -31.243 11.659  1.00 26.12  ? 166 ILE B C   1 
ATOM   2784 O  O   . ILE B  1 168 ? 14.229  -30.611 11.554  1.00 27.45  ? 166 ILE B O   1 
ATOM   2785 C  CB  . ILE B  1 168 ? 11.784  -30.298 9.834   1.00 26.16  ? 166 ILE B CB  1 
ATOM   2786 C  CG1 . ILE B  1 168 ? 10.483  -29.568 9.491   1.00 26.43  ? 166 ILE B CG1 1 
ATOM   2787 C  CG2 . ILE B  1 168 ? 11.875  -31.603 9.063   1.00 25.48  ? 166 ILE B CG2 1 
ATOM   2788 C  CD1 . ILE B  1 168 ? 10.393  -29.098 8.054   1.00 26.62  ? 166 ILE B CD1 1 
ATOM   2789 N  N   . VAL B  1 169 ? 13.135  -32.512 12.060  1.00 24.09  ? 167 VAL B N   1 
ATOM   2790 C  CA  . VAL B  1 169 ? 14.361  -33.243 12.362  1.00 24.12  ? 167 VAL B CA  1 
ATOM   2791 C  C   . VAL B  1 169 ? 14.394  -34.615 11.707  1.00 22.49  ? 167 VAL B C   1 
ATOM   2792 O  O   . VAL B  1 169 ? 13.361  -35.213 11.401  1.00 21.73  ? 167 VAL B O   1 
ATOM   2793 C  CB  . VAL B  1 169 ? 14.593  -33.418 13.877  1.00 24.97  ? 167 VAL B CB  1 
ATOM   2794 C  CG1 . VAL B  1 169 ? 14.509  -32.085 14.601  1.00 26.37  ? 167 VAL B CG1 1 
ATOM   2795 C  CG2 . VAL B  1 169 ? 13.602  -34.400 14.472  1.00 23.56  ? 167 VAL B CG2 1 
ATOM   2796 N  N   . PHE B  1 170 ? 15.607  -35.103 11.509  1.00 23.07  ? 168 PHE B N   1 
ATOM   2797 C  CA  . PHE B  1 170 ? 15.843  -36.407 10.939  1.00 22.27  ? 168 PHE B CA  1 
ATOM   2798 C  C   . PHE B  1 170 ? 16.664  -37.218 11.912  1.00 22.38  ? 168 PHE B C   1 
ATOM   2799 O  O   . PHE B  1 170 ? 17.872  -37.054 11.993  1.00 23.64  ? 168 PHE B O   1 
ATOM   2800 C  CB  . PHE B  1 170 ? 16.563  -36.275 9.596   1.00 23.19  ? 168 PHE B CB  1 
ATOM   2801 C  CG  . PHE B  1 170 ? 15.742  -35.571 8.566   1.00 23.12  ? 168 PHE B CG  1 
ATOM   2802 C  CD1 . PHE B  1 170 ? 15.897  -34.214 8.350   1.00 24.22  ? 168 PHE B CD1 1 
ATOM   2803 C  CD2 . PHE B  1 170 ? 14.752  -36.254 7.880   1.00 21.45  ? 168 PHE B CD2 1 
ATOM   2804 C  CE1 . PHE B  1 170 ? 15.099  -33.557 7.437   1.00 24.39  ? 168 PHE B CE1 1 
ATOM   2805 C  CE2 . PHE B  1 170 ? 13.949  -35.607 6.963   1.00 21.07  ? 168 PHE B CE2 1 
ATOM   2806 C  CZ  . PHE B  1 170 ? 14.122  -34.256 6.743   1.00 22.95  ? 168 PHE B CZ  1 
ATOM   2807 N  N   . PRO B  1 171 ? 15.991  -38.068 12.683  1.00 21.67  ? 169 PRO B N   1 
ATOM   2808 C  CA  . PRO B  1 171 ? 16.639  -38.818 13.746  1.00 22.91  ? 169 PRO B CA  1 
ATOM   2809 C  C   . PRO B  1 171 ? 17.765  -39.686 13.223  1.00 23.97  ? 169 PRO B C   1 
ATOM   2810 O  O   . PRO B  1 171 ? 17.677  -40.238 12.123  1.00 24.83  ? 169 PRO B O   1 
ATOM   2811 C  CB  . PRO B  1 171 ? 15.518  -39.684 14.303  1.00 21.42  ? 169 PRO B CB  1 
ATOM   2812 C  CG  . PRO B  1 171 ? 14.263  -38.935 13.986  1.00 20.79  ? 169 PRO B CG  1 
ATOM   2813 C  CD  . PRO B  1 171 ? 14.529  -38.247 12.679  1.00 20.61  ? 169 PRO B CD  1 
ATOM   2814 N  N   . VAL B  1 172 ? 18.840  -39.744 13.992  1.00 25.52  ? 170 VAL B N   1 
ATOM   2815 C  CA  . VAL B  1 172 ? 20.065  -40.399 13.576  1.00 26.59  ? 170 VAL B CA  1 
ATOM   2816 C  C   . VAL B  1 172 ? 19.884  -41.897 13.720  1.00 25.20  ? 170 VAL B C   1 
ATOM   2817 O  O   . VAL B  1 172 ? 19.412  -42.361 14.748  1.00 26.22  ? 170 VAL B O   1 
ATOM   2818 C  CB  . VAL B  1 172 ? 21.245  -39.920 14.450  1.00 28.78  ? 170 VAL B CB  1 
ATOM   2819 C  CG1 . VAL B  1 172 ? 22.512  -40.699 14.126  1.00 29.95  ? 170 VAL B CG1 1 
ATOM   2820 C  CG2 . VAL B  1 172 ? 21.463  -38.427 14.257  1.00 29.38  ? 170 VAL B CG2 1 
ATOM   2821 N  N   . PRO B  1 173 ? 20.205  -42.658 12.668  1.00 25.21  ? 171 PRO B N   1 
ATOM   2822 C  CA  . PRO B  1 173 ? 20.105  -44.121 12.739  1.00 24.20  ? 171 PRO B CA  1 
ATOM   2823 C  C   . PRO B  1 173 ? 20.953  -44.686 13.875  1.00 25.59  ? 171 PRO B C   1 
ATOM   2824 O  O   . PRO B  1 173 ? 22.047  -44.191 14.131  1.00 27.50  ? 171 PRO B O   1 
ATOM   2825 C  CB  . PRO B  1 173 ? 20.665  -44.579 11.395  1.00 24.09  ? 171 PRO B CB  1 
ATOM   2826 C  CG  . PRO B  1 173 ? 20.463  -43.424 10.476  1.00 24.30  ? 171 PRO B CG  1 
ATOM   2827 C  CD  . PRO B  1 173 ? 20.573  -42.187 11.320  1.00 25.36  ? 171 PRO B CD  1 
ATOM   2828 N  N   . ILE B  1 174 ? 20.422  -45.685 14.573  1.00 25.08  ? 172 ILE B N   1 
ATOM   2829 C  CA  . ILE B  1 174 ? 21.157  -46.400 15.608  1.00 25.30  ? 172 ILE B CA  1 
ATOM   2830 C  C   . ILE B  1 174 ? 20.851  -47.882 15.499  1.00 24.86  ? 172 ILE B C   1 
ATOM   2831 O  O   . ILE B  1 174 ? 19.950  -48.274 14.756  1.00 23.79  ? 172 ILE B O   1 
ATOM   2832 C  CB  . ILE B  1 174 ? 20.733  -45.944 17.010  1.00 25.79  ? 172 ILE B CB  1 
ATOM   2833 C  CG1 . ILE B  1 174 ? 19.242  -46.211 17.222  1.00 24.37  ? 172 ILE B CG1 1 
ATOM   2834 C  CG2 . ILE B  1 174 ? 21.051  -44.472 17.223  1.00 26.74  ? 172 ILE B CG2 1 
ATOM   2835 C  CD1 . ILE B  1 174 ? 18.803  -46.068 18.665  1.00 24.55  ? 172 ILE B CD1 1 
ATOM   2836 N  N   . ASP B  1 175 ? 21.596  -48.698 16.241  1.00 26.86  ? 173 ASP B N   1 
ATOM   2837 C  CA  . ASP B  1 175 ? 21.479  -50.160 16.166  1.00 28.37  ? 173 ASP B CA  1 
ATOM   2838 C  C   . ASP B  1 175 ? 20.826  -50.763 17.404  1.00 28.05  ? 173 ASP B C   1 
ATOM   2839 O  O   . ASP B  1 175 ? 20.250  -51.837 17.344  1.00 25.66  ? 173 ASP B O   1 
ATOM   2840 C  CB  . ASP B  1 175 ? 22.865  -50.796 15.983  1.00 31.72  ? 173 ASP B CB  1 
ATOM   2841 C  CG  . ASP B  1 175 ? 23.382  -50.661 14.563  1.00 33.66  ? 173 ASP B CG  1 
ATOM   2842 O  OD1 . ASP B  1 175 ? 24.616  -50.721 14.371  1.00 37.18  ? 173 ASP B OD1 1 
ATOM   2843 O  OD2 . ASP B  1 175 ? 22.544  -50.492 13.645  1.00 33.41  ? 173 ASP B OD2 1 
ATOM   2844 N  N   . GLN B  1 176 ? 20.919  -50.063 18.526  1.00 30.41  ? 174 GLN B N   1 
ATOM   2845 C  CA  . GLN B  1 176 ? 20.365  -50.555 19.774  1.00 31.16  ? 174 GLN B CA  1 
ATOM   2846 C  C   . GLN B  1 176 ? 18.838  -50.581 19.732  1.00 28.62  ? 174 GLN B C   1 
ATOM   2847 O  O   . GLN B  1 176 ? 18.207  -49.643 19.246  1.00 28.23  ? 174 GLN B O   1 
ATOM   2848 C  CB  . GLN B  1 176 ? 20.863  -49.700 20.936  1.00 33.28  ? 174 GLN B CB  1 
ATOM   2849 C  CG  . GLN B  1 176 ? 22.380  -49.711 21.087  1.00 36.64  ? 174 GLN B CG  1 
ATOM   2850 C  CD  . GLN B  1 176 ? 23.072  -48.516 20.428  1.00 39.52  ? 174 GLN B CD  1 
ATOM   2851 O  OE1 . GLN B  1 176 ? 22.507  -47.836 19.566  1.00 39.81  ? 174 GLN B OE1 1 
ATOM   2852 N  NE2 . GLN B  1 176 ? 24.298  -48.248 20.852  1.00 39.97  ? 174 GLN B NE2 1 
ATOM   2853 N  N   . CYS B  1 177 ? 18.263  -51.695 20.190  1.00 28.40  ? 175 CYS B N   1 
ATOM   2854 C  CA  . CYS B  1 177 ? 16.828  -51.817 20.495  1.00 26.71  ? 175 CYS B CA  1 
ATOM   2855 C  C   . CYS B  1 177 ? 15.897  -51.935 19.282  1.00 23.43  ? 175 CYS B C   1 
ATOM   2856 O  O   . CYS B  1 177 ? 14.931  -52.689 19.315  1.00 21.43  ? 175 CYS B O   1 
ATOM   2857 C  CB  . CYS B  1 177 ? 16.362  -50.668 21.381  1.00 28.13  ? 175 CYS B CB  1 
ATOM   2858 S  SG  . CYS B  1 177 ? 17.166  -50.647 23.007  1.00 33.10  ? 175 CYS B SG  1 
ATOM   2859 N  N   . ILE B  1 178 ? 16.159  -51.177 18.226  1.00 23.16  ? 176 ILE B N   1 
ATOM   2860 C  CA  . ILE B  1 178 ? 15.154  -50.979 17.185  1.00 23.19  ? 176 ILE B CA  1 
ATOM   2861 C  C   . ILE B  1 178 ? 15.188  -51.986 16.040  1.00 23.81  ? 176 ILE B C   1 
ATOM   2862 O  O   . ILE B  1 178 ? 14.418  -51.859 15.090  1.00 24.45  ? 176 ILE B O   1 
ATOM   2863 C  CB  . ILE B  1 178 ? 15.201  -49.540 16.622  1.00 24.27  ? 176 ILE B CB  1 
ATOM   2864 C  CG1 . ILE B  1 178 ? 16.471  -49.308 15.796  1.00 24.02  ? 176 ILE B CG1 1 
ATOM   2865 C  CG2 . ILE B  1 178 ? 15.123  -48.537 17.763  1.00 24.50  ? 176 ILE B CG2 1 
ATOM   2866 C  CD1 . ILE B  1 178 ? 16.561  -47.913 15.220  1.00 24.69  ? 176 ILE B CD1 1 
ATOM   2867 N  N   . ASP B  1 179 ? 16.055  -52.992 16.126  1.00 26.84  ? 177 ASP B N   1 
ATOM   2868 C  CA  . ASP B  1 179 ? 16.190  -53.980 15.051  1.00 26.97  ? 177 ASP B CA  1 
ATOM   2869 C  C   . ASP B  1 179 ? 15.758  -55.366 15.501  1.00 25.51  ? 177 ASP B C   1 
ATOM   2870 O  O   . ASP B  1 179 ? 15.098  -55.494 16.529  1.00 28.94  ? 177 ASP B O   1 
ATOM   2871 C  CB  . ASP B  1 179 ? 17.625  -54.007 14.540  1.00 27.89  ? 177 ASP B CB  1 
ATOM   2872 C  CG  . ASP B  1 179 ? 18.002  -52.726 13.817  1.00 29.79  ? 177 ASP B CG  1 
ATOM   2873 O  OD1 . ASP B  1 179 ? 17.086  -52.063 13.286  1.00 28.71  ? 177 ASP B OD1 1 
ATOM   2874 O  OD2 . ASP B  1 179 ? 19.207  -52.394 13.761  1.00 30.13  ? 177 ASP B OD2 1 
ATOM   2875 N  N   . SER C  1 5   ? -30.770 -59.221 -1.009  1.00 60.18  ? 3   SER C N   1 
ATOM   2876 C  CA  . SER C  1 5   ? -31.281 -57.981 -1.661  1.00 57.66  ? 3   SER C CA  1 
ATOM   2877 C  C   . SER C  1 5   ? -30.314 -57.521 -2.750  1.00 54.60  ? 3   SER C C   1 
ATOM   2878 O  O   . SER C  1 5   ? -29.161 -57.235 -2.458  1.00 50.61  ? 3   SER C O   1 
ATOM   2879 C  CB  . SER C  1 5   ? -31.462 -56.877 -0.618  1.00 53.32  ? 3   SER C CB  1 
ATOM   2880 N  N   . THR C  1 6   ? -30.795 -57.433 -3.992  1.00 53.40  ? 4   THR C N   1 
ATOM   2881 C  CA  . THR C  1 6   ? -29.931 -57.434 -5.178  1.00 52.31  ? 4   THR C CA  1 
ATOM   2882 C  C   . THR C  1 6   ? -30.015 -56.133 -5.984  1.00 48.62  ? 4   THR C C   1 
ATOM   2883 O  O   . THR C  1 6   ? -29.178 -55.883 -6.850  1.00 47.06  ? 4   THR C O   1 
ATOM   2884 C  CB  . THR C  1 6   ? -30.334 -58.558 -6.142  1.00 56.21  ? 4   THR C CB  1 
ATOM   2885 O  OG1 . THR C  1 6   ? -31.710 -58.899 -5.935  1.00 56.76  ? 4   THR C OG1 1 
ATOM   2886 C  CG2 . THR C  1 6   ? -29.457 -59.787 -5.942  1.00 58.58  ? 4   THR C CG2 1 
ATOM   2887 N  N   . SER C  1 7   ? -31.038 -55.329 -5.707  1.00 45.61  ? 5   SER C N   1 
ATOM   2888 C  CA  . SER C  1 7   ? -31.490 -54.283 -6.622  1.00 43.75  ? 5   SER C CA  1 
ATOM   2889 C  C   . SER C  1 7   ? -30.616 -53.030 -6.540  1.00 39.65  ? 5   SER C C   1 
ATOM   2890 O  O   . SER C  1 7   ? -29.861 -52.831 -5.584  1.00 36.73  ? 5   SER C O   1 
ATOM   2891 C  CB  . SER C  1 7   ? -32.946 -53.911 -6.314  1.00 44.01  ? 5   SER C CB  1 
ATOM   2892 O  OG  . SER C  1 7   ? -33.051 -53.290 -5.042  1.00 42.84  ? 5   SER C OG  1 
ATOM   2893 N  N   . ASP C  1 8   ? -30.738 -52.177 -7.548  1.00 38.48  ? 6   ASP C N   1 
ATOM   2894 C  CA  . ASP C  1 8   ? -30.029 -50.896 -7.548  1.00 36.02  ? 6   ASP C CA  1 
ATOM   2895 C  C   . ASP C  1 8   ? -30.503 -49.957 -6.439  1.00 33.89  ? 6   ASP C C   1 
ATOM   2896 O  O   . ASP C  1 8   ? -31.661 -49.973 -6.042  1.00 34.48  ? 6   ASP C O   1 
ATOM   2897 C  CB  . ASP C  1 8   ? -30.170 -50.233 -8.914  1.00 37.07  ? 6   ASP C CB  1 
ATOM   2898 C  CG  . ASP C  1 8   ? -29.754 -51.159 -10.041 1.00 39.07  ? 6   ASP C CG  1 
ATOM   2899 O  OD1 . ASP C  1 8   ? -30.139 -50.909 -11.201 1.00 40.75  ? 6   ASP C OD1 1 
ATOM   2900 O  OD2 . ASP C  1 8   ? -29.044 -52.150 -9.755  1.00 38.62  ? 6   ASP C OD2 1 
ATOM   2901 N  N   . LEU C  1 9   ? -29.576 -49.150 -5.942  1.00 31.29  ? 7   LEU C N   1 
ATOM   2902 C  CA  . LEU C  1 9   ? -29.800 -48.302 -4.781  1.00 29.02  ? 7   LEU C CA  1 
ATOM   2903 C  C   . LEU C  1 9   ? -29.508 -46.856 -5.174  1.00 28.39  ? 7   LEU C C   1 
ATOM   2904 O  O   . LEU C  1 9   ? -28.648 -46.612 -6.010  1.00 27.76  ? 7   LEU C O   1 
ATOM   2905 C  CB  . LEU C  1 9   ? -28.862 -48.722 -3.643  1.00 27.56  ? 7   LEU C CB  1 
ATOM   2906 C  CG  . LEU C  1 9   ? -29.232 -50.001 -2.895  1.00 27.72  ? 7   LEU C CG  1 
ATOM   2907 C  CD1 . LEU C  1 9   ? -28.128 -50.391 -1.935  1.00 26.86  ? 7   LEU C CD1 1 
ATOM   2908 C  CD2 . LEU C  1 9   ? -30.541 -49.839 -2.135  1.00 27.67  ? 7   LEU C CD2 1 
ATOM   2909 N  N   . ILE C  1 10  ? -30.213 -45.897 -4.568  1.00 27.65  ? 8   ILE C N   1 
ATOM   2910 C  CA  . ILE C  1 10  ? -29.824 -44.505 -4.693  1.00 27.04  ? 8   ILE C CA  1 
ATOM   2911 C  C   . ILE C  1 10  ? -28.465 -44.327 -4.035  1.00 25.92  ? 8   ILE C C   1 
ATOM   2912 O  O   . ILE C  1 10  ? -28.248 -44.825 -2.936  1.00 25.21  ? 8   ILE C O   1 
ATOM   2913 C  CB  . ILE C  1 10  ? -30.850 -43.553 -4.048  1.00 26.44  ? 8   ILE C CB  1 
ATOM   2914 C  CG1 . ILE C  1 10  ? -32.152 -43.554 -4.855  1.00 28.25  ? 8   ILE C CG1 1 
ATOM   2915 C  CG2 . ILE C  1 10  ? -30.284 -42.138 -3.965  1.00 25.62  ? 8   ILE C CG2 1 
ATOM   2916 C  CD1 . ILE C  1 10  ? -33.364 -43.113 -4.064  1.00 28.27  ? 8   ILE C CD1 1 
ATOM   2917 N  N   . PRO C  1 11  ? -27.538 -43.640 -4.720  1.00 26.42  ? 9   PRO C N   1 
ATOM   2918 C  CA  . PRO C  1 11  ? -26.164 -43.558 -4.249  1.00 25.68  ? 9   PRO C CA  1 
ATOM   2919 C  C   . PRO C  1 11  ? -26.092 -42.811 -2.943  1.00 24.92  ? 9   PRO C C   1 
ATOM   2920 O  O   . PRO C  1 11  ? -26.836 -41.850 -2.752  1.00 25.59  ? 9   PRO C O   1 
ATOM   2921 C  CB  . PRO C  1 11  ? -25.451 -42.767 -5.353  1.00 26.25  ? 9   PRO C CB  1 
ATOM   2922 C  CG  . PRO C  1 11  ? -26.295 -42.928 -6.560  1.00 28.16  ? 9   PRO C CG  1 
ATOM   2923 C  CD  . PRO C  1 11  ? -27.702 -43.061 -6.066  1.00 28.03  ? 9   PRO C CD  1 
ATOM   2924 N  N   . ALA C  1 12  ? -25.202 -43.235 -2.054  1.00 24.72  ? 10  ALA C N   1 
ATOM   2925 C  CA  . ALA C  1 12  ? -24.920 -42.453 -0.859  1.00 24.34  ? 10  ALA C CA  1 
ATOM   2926 C  C   . ALA C  1 12  ? -24.349 -41.111 -1.280  1.00 25.92  ? 10  ALA C C   1 
ATOM   2927 O  O   . ALA C  1 12  ? -23.588 -41.026 -2.234  1.00 28.30  ? 10  ALA C O   1 
ATOM   2928 C  CB  . ALA C  1 12  ? -23.931 -43.170 0.041   1.00 23.26  ? 10  ALA C CB  1 
ATOM   2929 N  N   . PRO C  1 13  ? -24.729 -40.048 -0.579  1.00 27.17  ? 11  PRO C N   1 
ATOM   2930 C  CA  . PRO C  1 13  ? -24.217 -38.728 -0.932  1.00 28.09  ? 11  PRO C CA  1 
ATOM   2931 C  C   . PRO C  1 13  ? -22.775 -38.619 -0.488  1.00 26.66  ? 11  PRO C C   1 
ATOM   2932 O  O   . PRO C  1 13  ? -22.372 -39.328 0.424   1.00 27.89  ? 11  PRO C O   1 
ATOM   2933 C  CB  . PRO C  1 13  ? -25.097 -37.788 -0.108  1.00 28.00  ? 11  PRO C CB  1 
ATOM   2934 C  CG  . PRO C  1 13  ? -25.437 -38.603 1.105   1.00 26.75  ? 11  PRO C CG  1 
ATOM   2935 C  CD  . PRO C  1 13  ? -25.566 -40.024 0.635   1.00 26.67  ? 11  PRO C CD  1 
ATOM   2936 N  N   . PRO C  1 14  ? -22.009 -37.719 -1.108  1.00 27.86  ? 12  PRO C N   1 
ATOM   2937 C  CA  . PRO C  1 14  ? -20.690 -37.401 -0.567  1.00 27.60  ? 12  PRO C CA  1 
ATOM   2938 C  C   . PRO C  1 14  ? -20.807 -36.746 0.790   1.00 27.83  ? 12  PRO C C   1 
ATOM   2939 O  O   . PRO C  1 14  ? -21.755 -35.999 1.034   1.00 26.88  ? 12  PRO C O   1 
ATOM   2940 C  CB  . PRO C  1 14  ? -20.115 -36.413 -1.582  1.00 28.39  ? 12  PRO C CB  1 
ATOM   2941 C  CG  . PRO C  1 14  ? -21.306 -35.820 -2.273  1.00 28.87  ? 12  PRO C CG  1 
ATOM   2942 C  CD  . PRO C  1 14  ? -22.361 -36.889 -2.277  1.00 28.82  ? 12  PRO C CD  1 
ATOM   2943 N  N   . LEU C  1 15  ? -19.852 -37.034 1.666   1.00 31.56  ? 13  LEU C N   1 
ATOM   2944 C  CA  . LEU C  1 15  ? -19.918 -36.588 3.046   1.00 34.06  ? 13  LEU C CA  1 
ATOM   2945 C  C   . LEU C  1 15  ? -19.878 -35.066 3.136   1.00 35.61  ? 13  LEU C C   1 
ATOM   2946 O  O   . LEU C  1 15  ? -20.328 -34.490 4.116   1.00 40.87  ? 13  LEU C O   1 
ATOM   2947 C  CB  . LEU C  1 15  ? -18.810 -37.243 3.883   1.00 34.77  ? 13  LEU C CB  1 
ATOM   2948 C  CG  . LEU C  1 15  ? -18.990 -38.759 4.082   1.00 38.10  ? 13  LEU C CG  1 
ATOM   2949 C  CD1 . LEU C  1 15  ? -17.883 -39.348 4.948   1.00 38.31  ? 13  LEU C CD1 1 
ATOM   2950 C  CD2 . LEU C  1 15  ? -20.356 -39.091 4.683   1.00 39.92  ? 13  LEU C CD2 1 
ATOM   2951 N  N   . SER C  1 16  ? -19.388 -34.415 2.089   1.00 37.43  ? 14  SER C N   1 
ATOM   2952 C  CA  . SER C  1 16  ? -19.343 -32.950 2.029   1.00 34.09  ? 14  SER C CA  1 
ATOM   2953 C  C   . SER C  1 16  ? -20.739 -32.320 1.968   1.00 34.14  ? 14  SER C C   1 
ATOM   2954 O  O   . SER C  1 16  ? -20.902 -31.124 2.204   1.00 32.82  ? 14  SER C O   1 
ATOM   2955 C  CB  . SER C  1 16  ? -18.531 -32.504 0.815   1.00 37.52  ? 14  SER C CB  1 
ATOM   2956 O  OG  . SER C  1 16  ? -19.266 -32.705 -0.384  1.00 40.75  ? 14  SER C OG  1 
ATOM   2957 N  N   . LYS C  1 17  ? -21.754 -33.123 1.682   1.00 31.48  ? 15  LYS C N   1 
ATOM   2958 C  CA  . LYS C  1 17  ? -23.118 -32.613 1.686   1.00 29.53  ? 15  LYS C CA  1 
ATOM   2959 C  C   . LYS C  1 17  ? -23.846 -32.891 3.003   1.00 25.14  ? 15  LYS C C   1 
ATOM   2960 O  O   . LYS C  1 17  ? -25.026 -32.588 3.124   1.00 23.36  ? 15  LYS C O   1 
ATOM   2961 C  CB  . LYS C  1 17  ? -23.911 -33.226 0.530   1.00 34.11  ? 15  LYS C CB  1 
ATOM   2962 C  CG  . LYS C  1 17  ? -23.594 -32.620 -0.826  1.00 35.31  ? 15  LYS C CG  1 
ATOM   2963 C  CD  . LYS C  1 17  ? -24.703 -32.902 -1.818  1.00 39.23  ? 15  LYS C CD  1 
ATOM   2964 C  CE  . LYS C  1 17  ? -24.141 -33.251 -3.187  1.00 42.72  ? 15  LYS C CE  1 
ATOM   2965 N  NZ  . LYS C  1 17  ? -25.077 -32.872 -4.277  1.00 43.58  ? 15  LYS C NZ  1 
ATOM   2966 N  N   . VAL C  1 18  ? -23.146 -33.484 3.970   1.00 22.40  ? 16  VAL C N   1 
ATOM   2967 C  CA  . VAL C  1 18  ? -23.736 -33.854 5.255   1.00 20.12  ? 16  VAL C CA  1 
ATOM   2968 C  C   . VAL C  1 18  ? -23.061 -33.080 6.371   1.00 17.97  ? 16  VAL C C   1 
ATOM   2969 O  O   . VAL C  1 18  ? -21.992 -33.443 6.841   1.00 16.82  ? 16  VAL C O   1 
ATOM   2970 C  CB  . VAL C  1 18  ? -23.571 -35.355 5.552   1.00 20.05  ? 16  VAL C CB  1 
ATOM   2971 C  CG1 . VAL C  1 18  ? -24.292 -35.737 6.835   1.00 20.44  ? 16  VAL C CG1 1 
ATOM   2972 C  CG2 . VAL C  1 18  ? -24.088 -36.191 4.401   1.00 20.76  ? 16  VAL C CG2 1 
ATOM   2973 N  N   . PRO C  1 19  ? -23.680 -31.988 6.792   1.00 18.08  ? 17  PRO C N   1 
ATOM   2974 C  CA  . PRO C  1 19  ? -23.067 -31.188 7.840   1.00 17.91  ? 17  PRO C CA  1 
ATOM   2975 C  C   . PRO C  1 19  ? -22.785 -32.008 9.102   1.00 17.49  ? 17  PRO C C   1 
ATOM   2976 O  O   . PRO C  1 19  ? -23.450 -33.016 9.373   1.00 17.10  ? 17  PRO C O   1 
ATOM   2977 C  CB  . PRO C  1 19  ? -24.113 -30.104 8.112   1.00 18.23  ? 17  PRO C CB  1 
ATOM   2978 C  CG  . PRO C  1 19  ? -24.911 -30.011 6.852   1.00 19.03  ? 17  PRO C CG  1 
ATOM   2979 C  CD  . PRO C  1 19  ? -24.924 -31.394 6.273   1.00 18.63  ? 17  PRO C CD  1 
ATOM   2980 N  N   . LEU C  1 20  ? -21.803 -31.553 9.866   1.00 17.82  ? 18  LEU C N   1 
ATOM   2981 C  CA  . LEU C  1 20  ? -21.537 -32.069 11.196  1.00 18.42  ? 18  LEU C CA  1 
ATOM   2982 C  C   . LEU C  1 20  ? -21.899 -30.995 12.208  1.00 18.47  ? 18  LEU C C   1 
ATOM   2983 O  O   . LEU C  1 20  ? -21.425 -29.866 12.116  1.00 20.33  ? 18  LEU C O   1 
ATOM   2984 C  CB  . LEU C  1 20  ? -20.060 -32.414 11.325  1.00 18.51  ? 18  LEU C CB  1 
ATOM   2985 C  CG  . LEU C  1 20  ? -19.599 -32.852 12.713  1.00 18.95  ? 18  LEU C CG  1 
ATOM   2986 C  CD1 . LEU C  1 20  ? -20.108 -34.249 13.014  1.00 18.46  ? 18  LEU C CD1 1 
ATOM   2987 C  CD2 . LEU C  1 20  ? -18.080 -32.780 12.808  1.00 19.12  ? 18  LEU C CD2 1 
ATOM   2988 N  N   . GLN C  1 21  ? -22.748 -31.338 13.166  1.00 17.95  ? 19  GLN C N   1 
ATOM   2989 C  CA  . GLN C  1 21  ? -23.049 -30.423 14.256  1.00 18.03  ? 19  GLN C CA  1 
ATOM   2990 C  C   . GLN C  1 21  ? -21.735 -29.872 14.825  1.00 19.59  ? 19  GLN C C   1 
ATOM   2991 O  O   . GLN C  1 21  ? -20.883 -30.627 15.280  1.00 18.93  ? 19  GLN C O   1 
ATOM   2992 C  CB  . GLN C  1 21  ? -23.861 -31.147 15.336  1.00 16.73  ? 19  GLN C CB  1 
ATOM   2993 C  CG  . GLN C  1 21  ? -24.110 -30.341 16.590  1.00 16.15  ? 19  GLN C CG  1 
ATOM   2994 C  CD  . GLN C  1 21  ? -24.917 -29.088 16.331  1.00 16.22  ? 19  GLN C CD  1 
ATOM   2995 O  OE1 . GLN C  1 21  ? -26.000 -29.131 15.751  1.00 15.60  ? 19  GLN C OE1 1 
ATOM   2996 N  NE2 . GLN C  1 21  ? -24.406 -27.966 16.796  1.00 17.06  ? 19  GLN C NE2 1 
ATOM   2997 N  N   . GLN C  1 22  ? -21.557 -28.555 14.778  1.00 21.92  ? 20  GLN C N   1 
ATOM   2998 C  CA  . GLN C  1 22  ? -20.371 -27.934 15.386  1.00 23.02  ? 20  GLN C CA  1 
ATOM   2999 C  C   . GLN C  1 22  ? -20.335 -28.183 16.891  1.00 20.82  ? 20  GLN C C   1 
ATOM   3000 O  O   . GLN C  1 22  ? -21.361 -28.073 17.551  1.00 20.25  ? 20  GLN C O   1 
ATOM   3001 C  CB  . GLN C  1 22  ? -20.383 -26.425 15.150  1.00 26.81  ? 20  GLN C CB  1 
ATOM   3002 C  CG  . GLN C  1 22  ? -19.927 -26.013 13.773  1.00 30.45  ? 20  GLN C CG  1 
ATOM   3003 C  CD  . GLN C  1 22  ? -19.791 -24.490 13.612  1.00 39.39  ? 20  GLN C CD  1 
ATOM   3004 O  OE1 . GLN C  1 22  ? -20.105 -23.946 12.553  1.00 45.48  ? 20  GLN C OE1 1 
ATOM   3005 N  NE2 . GLN C  1 22  ? -19.287 -23.803 14.653  1.00 35.04  ? 20  GLN C NE2 1 
ATOM   3006 N  N   . ASN C  1 23  ? -19.146 -28.441 17.427  1.00 20.89  ? 21  ASN C N   1 
ATOM   3007 C  CA  . ASN C  1 23  ? -18.911 -28.477 18.876  1.00 23.23  ? 21  ASN C CA  1 
ATOM   3008 C  C   . ASN C  1 23  ? -19.895 -29.398 19.586  1.00 21.59  ? 21  ASN C C   1 
ATOM   3009 O  O   . ASN C  1 23  ? -20.567 -29.013 20.541  1.00 20.53  ? 21  ASN C O   1 
ATOM   3010 C  CB  . ASN C  1 23  ? -18.957 -27.063 19.483  1.00 27.70  ? 21  ASN C CB  1 
ATOM   3011 C  CG  . ASN C  1 23  ? -18.380 -26.997 20.910  1.00 34.52  ? 21  ASN C CG  1 
ATOM   3012 O  OD1 . ASN C  1 23  ? -17.500 -27.776 21.282  1.00 40.17  ? 21  ASN C OD1 1 
ATOM   3013 N  ND2 . ASN C  1 23  ? -18.854 -26.031 21.700  1.00 34.60  ? 21  ASN C ND2 1 
ATOM   3014 N  N   . PHE C  1 24  ? -19.966 -30.627 19.103  1.00 20.25  ? 22  PHE C N   1 
ATOM   3015 C  CA  . PHE C  1 24  ? -20.926 -31.587 19.604  1.00 19.36  ? 22  PHE C CA  1 
ATOM   3016 C  C   . PHE C  1 24  ? -20.762 -31.837 21.096  1.00 18.76  ? 22  PHE C C   1 
ATOM   3017 O  O   . PHE C  1 24  ? -19.655 -31.984 21.584  1.00 20.50  ? 22  PHE C O   1 
ATOM   3018 C  CB  . PHE C  1 24  ? -20.781 -32.904 18.840  1.00 17.98  ? 22  PHE C CB  1 
ATOM   3019 C  CG  . PHE C  1 24  ? -21.689 -33.981 19.327  1.00 16.34  ? 22  PHE C CG  1 
ATOM   3020 C  CD1 . PHE C  1 24  ? -21.210 -34.984 20.123  1.00 17.08  ? 22  PHE C CD1 1 
ATOM   3021 C  CD2 . PHE C  1 24  ? -23.033 -33.962 19.025  1.00 16.92  ? 22  PHE C CD2 1 
ATOM   3022 C  CE1 . PHE C  1 24  ? -22.032 -35.990 20.574  1.00 16.26  ? 22  PHE C CE1 1 
ATOM   3023 C  CE2 . PHE C  1 24  ? -23.873 -34.966 19.479  1.00 16.34  ? 22  PHE C CE2 1 
ATOM   3024 C  CZ  . PHE C  1 24  ? -23.367 -35.980 20.258  1.00 15.97  ? 22  PHE C CZ  1 
ATOM   3025 N  N   . GLN C  1 25  ? -21.880 -31.879 21.813  1.00 18.92  ? 23  GLN C N   1 
ATOM   3026 C  CA  . GLN C  1 25  ? -21.869 -32.061 23.255  1.00 19.11  ? 23  GLN C CA  1 
ATOM   3027 C  C   . GLN C  1 25  ? -22.428 -33.403 23.657  1.00 18.93  ? 23  GLN C C   1 
ATOM   3028 O  O   . GLN C  1 25  ? -23.640 -33.579 23.742  1.00 19.81  ? 23  GLN C O   1 
ATOM   3029 C  CB  . GLN C  1 25  ? -22.669 -30.952 23.904  1.00 19.67  ? 23  GLN C CB  1 
ATOM   3030 C  CG  . GLN C  1 25  ? -22.005 -29.621 23.625  1.00 21.51  ? 23  GLN C CG  1 
ATOM   3031 C  CD  . GLN C  1 25  ? -22.915 -28.448 23.834  1.00 22.02  ? 23  GLN C CD  1 
ATOM   3032 O  OE1 . GLN C  1 25  ? -23.430 -27.833 22.881  1.00 22.71  ? 23  GLN C OE1 1 
ATOM   3033 N  NE2 . GLN C  1 25  ? -23.114 -28.122 25.084  1.00 21.13  ? 23  GLN C NE2 1 
ATOM   3034 N  N   . ASP C  1 26  ? -21.536 -34.353 23.899  1.00 18.98  ? 24  ASP C N   1 
ATOM   3035 C  CA  . ASP C  1 26  ? -21.943 -35.735 24.034  1.00 19.12  ? 24  ASP C CA  1 
ATOM   3036 C  C   . ASP C  1 26  ? -22.846 -35.960 25.252  1.00 18.87  ? 24  ASP C C   1 
ATOM   3037 O  O   . ASP C  1 26  ? -23.750 -36.777 25.209  1.00 19.32  ? 24  ASP C O   1 
ATOM   3038 C  CB  . ASP C  1 26  ? -20.723 -36.669 24.041  1.00 19.42  ? 24  ASP C CB  1 
ATOM   3039 C  CG  . ASP C  1 26  ? -19.725 -36.358 25.156  1.00 19.99  ? 24  ASP C CG  1 
ATOM   3040 O  OD1 . ASP C  1 26  ? -19.963 -35.453 25.984  1.00 20.02  ? 24  ASP C OD1 1 
ATOM   3041 O  OD2 . ASP C  1 26  ? -18.681 -37.046 25.196  1.00 20.45  ? 24  ASP C OD2 1 
ATOM   3042 N  N   . ASN C  1 27  ? -22.611 -35.228 26.331  1.00 19.85  ? 25  ASN C N   1 
ATOM   3043 C  CA  . ASN C  1 27  ? -23.413 -35.406 27.532  1.00 20.64  ? 25  ASN C CA  1 
ATOM   3044 C  C   . ASN C  1 27  ? -24.839 -34.903 27.309  1.00 19.33  ? 25  ASN C C   1 
ATOM   3045 O  O   . ASN C  1 27  ? -25.804 -35.534 27.746  1.00 19.05  ? 25  ASN C O   1 
ATOM   3046 C  CB  . ASN C  1 27  ? -22.783 -34.691 28.725  1.00 22.47  ? 25  ASN C CB  1 
ATOM   3047 C  CG  . ASN C  1 27  ? -23.378 -35.147 30.060  1.00 25.92  ? 25  ASN C CG  1 
ATOM   3048 O  OD1 . ASN C  1 27  ? -24.571 -34.991 30.316  1.00 28.81  ? 25  ASN C OD1 1 
ATOM   3049 N  ND2 . ASN C  1 27  ? -22.542 -35.713 30.912  1.00 28.11  ? 25  ASN C ND2 1 
ATOM   3050 N  N   . GLN C  1 28  ? -24.962 -33.777 26.610  1.00 18.60  ? 26  GLN C N   1 
ATOM   3051 C  CA  . GLN C  1 28  ? -26.270 -33.161 26.357  1.00 17.69  ? 26  GLN C CA  1 
ATOM   3052 C  C   . GLN C  1 28  ? -27.109 -33.975 25.382  1.00 17.64  ? 26  GLN C C   1 
ATOM   3053 O  O   . GLN C  1 28  ? -28.326 -33.862 25.361  1.00 17.38  ? 26  GLN C O   1 
ATOM   3054 C  CB  . GLN C  1 28  ? -26.092 -31.748 25.815  1.00 17.10  ? 26  GLN C CB  1 
ATOM   3055 C  CG  . GLN C  1 28  ? -25.551 -30.766 26.860  1.00 17.29  ? 26  GLN C CG  1 
ATOM   3056 C  CD  . GLN C  1 28  ? -26.642 -30.087 27.645  1.00 16.99  ? 26  GLN C CD  1 
ATOM   3057 O  OE1 . GLN C  1 28  ? -27.812 -30.267 27.372  1.00 16.08  ? 26  GLN C OE1 1 
ATOM   3058 N  NE2 . GLN C  1 28  ? -26.255 -29.311 28.644  1.00 18.88  ? 26  GLN C NE2 1 
ATOM   3059 N  N   . PHE C  1 29  ? -26.456 -34.822 24.598  1.00 17.73  ? 27  PHE C N   1 
ATOM   3060 C  CA  . PHE C  1 29  ? -27.154 -35.600 23.603  1.00 17.43  ? 27  PHE C CA  1 
ATOM   3061 C  C   . PHE C  1 29  ? -27.766 -36.877 24.181  1.00 18.47  ? 27  PHE C C   1 
ATOM   3062 O  O   . PHE C  1 29  ? -28.572 -37.519 23.522  1.00 20.95  ? 27  PHE C O   1 
ATOM   3063 C  CB  . PHE C  1 29  ? -26.215 -35.938 22.454  1.00 16.81  ? 27  PHE C CB  1 
ATOM   3064 C  CG  . PHE C  1 29  ? -26.923 -36.425 21.226  1.00 16.65  ? 27  PHE C CG  1 
ATOM   3065 C  CD1 . PHE C  1 29  ? -26.901 -37.756 20.889  1.00 15.11  ? 27  PHE C CD1 1 
ATOM   3066 C  CD2 . PHE C  1 29  ? -27.616 -35.542 20.414  1.00 18.65  ? 27  PHE C CD2 1 
ATOM   3067 C  CE1 . PHE C  1 29  ? -27.526 -38.204 19.761  1.00 16.04  ? 27  PHE C CE1 1 
ATOM   3068 C  CE2 . PHE C  1 29  ? -28.272 -35.989 19.284  1.00 17.92  ? 27  PHE C CE2 1 
ATOM   3069 C  CZ  . PHE C  1 29  ? -28.226 -37.329 18.963  1.00 17.57  ? 27  PHE C CZ  1 
ATOM   3070 N  N   . GLN C  1 30  ? -27.374 -37.243 25.398  1.00 20.69  ? 28  GLN C N   1 
ATOM   3071 C  CA  . GLN C  1 30  ? -27.843 -38.478 26.077  1.00 21.46  ? 28  GLN C CA  1 
ATOM   3072 C  C   . GLN C  1 30  ? -29.337 -38.523 26.274  1.00 20.54  ? 28  GLN C C   1 
ATOM   3073 O  O   . GLN C  1 30  ? -29.995 -37.486 26.273  1.00 17.39  ? 28  GLN C O   1 
ATOM   3074 C  CB  . GLN C  1 30  ? -27.287 -38.539 27.490  1.00 23.59  ? 28  GLN C CB  1 
ATOM   3075 C  CG  . GLN C  1 30  ? -25.840 -38.913 27.591  1.00 30.41  ? 28  GLN C CG  1 
ATOM   3076 C  CD  . GLN C  1 30  ? -25.466 -39.159 29.033  1.00 30.12  ? 28  GLN C CD  1 
ATOM   3077 O  OE1 . GLN C  1 30  ? -25.420 -40.294 29.484  1.00 27.53  ? 28  GLN C OE1 1 
ATOM   3078 N  NE2 . GLN C  1 30  ? -25.199 -38.083 29.760  1.00 31.70  ? 28  GLN C NE2 1 
ATOM   3079 N  N   . GLY C  1 31  ? -29.831 -39.724 26.579  1.00 19.29  ? 29  GLY C N   1 
ATOM   3080 C  CA  . GLY C  1 31  ? -31.218 -39.919 26.943  1.00 18.77  ? 29  GLY C CA  1 
ATOM   3081 C  C   . GLY C  1 31  ? -32.027 -40.507 25.802  1.00 19.18  ? 29  GLY C C   1 
ATOM   3082 O  O   . GLY C  1 31  ? -31.480 -40.996 24.805  1.00 17.54  ? 29  GLY C O   1 
ATOM   3083 N  N   . LYS C  1 32  ? -33.343 -40.428 25.942  1.00 19.01  ? 30  LYS C N   1 
ATOM   3084 C  CA  . LYS C  1 32  ? -34.244 -41.041 24.994  1.00 18.32  ? 30  LYS C CA  1 
ATOM   3085 C  C   . LYS C  1 32  ? -34.531 -40.070 23.858  1.00 16.74  ? 30  LYS C C   1 
ATOM   3086 O  O   . LYS C  1 32  ? -34.806 -38.881 24.085  1.00 15.87  ? 30  LYS C O   1 
ATOM   3087 C  CB  . LYS C  1 32  ? -35.541 -41.458 25.681  1.00 19.04  ? 30  LYS C CB  1 
ATOM   3088 C  CG  . LYS C  1 32  ? -36.541 -42.130 24.750  1.00 20.34  ? 30  LYS C CG  1 
ATOM   3089 C  CD  . LYS C  1 32  ? -37.802 -42.571 25.490  1.00 22.00  ? 30  LYS C CD  1 
ATOM   3090 C  CE  . LYS C  1 32  ? -37.609 -43.920 26.152  1.00 24.01  ? 30  LYS C CE  1 
ATOM   3091 N  NZ  . LYS C  1 32  ? -38.855 -44.370 26.834  1.00 29.43  ? 30  LYS C NZ  1 
ATOM   3092 N  N   . TRP C  1 33  ? -34.511 -40.604 22.639  1.00 15.40  ? 31  TRP C N   1 
ATOM   3093 C  CA  . TRP C  1 33  ? -35.029 -39.901 21.480  1.00 14.80  ? 31  TRP C CA  1 
ATOM   3094 C  C   . TRP C  1 33  ? -36.069 -40.780 20.771  1.00 15.90  ? 31  TRP C C   1 
ATOM   3095 O  O   . TRP C  1 33  ? -35.902 -41.993 20.641  1.00 16.47  ? 31  TRP C O   1 
ATOM   3096 C  CB  . TRP C  1 33  ? -33.900 -39.600 20.502  1.00 13.76  ? 31  TRP C CB  1 
ATOM   3097 C  CG  . TRP C  1 33  ? -32.857 -38.602 20.944  1.00 12.74  ? 31  TRP C CG  1 
ATOM   3098 C  CD1 . TRP C  1 33  ? -31.630 -38.882 21.435  1.00 12.42  ? 31  TRP C CD1 1 
ATOM   3099 C  CD2 . TRP C  1 33  ? -32.922 -37.175 20.825  1.00 12.64  ? 31  TRP C CD2 1 
ATOM   3100 N  NE1 . TRP C  1 33  ? -30.932 -37.726 21.667  1.00 12.57  ? 31  TRP C NE1 1 
ATOM   3101 C  CE2 . TRP C  1 33  ? -31.698 -36.662 21.284  1.00 12.45  ? 31  TRP C CE2 1 
ATOM   3102 C  CE3 . TRP C  1 33  ? -33.896 -36.285 20.373  1.00 12.99  ? 31  TRP C CE3 1 
ATOM   3103 C  CZ2 . TRP C  1 33  ? -31.421 -35.302 21.315  1.00 12.33  ? 31  TRP C CZ2 1 
ATOM   3104 C  CZ3 . TRP C  1 33  ? -33.615 -34.939 20.391  1.00 13.27  ? 31  TRP C CZ3 1 
ATOM   3105 C  CH2 . TRP C  1 33  ? -32.388 -34.457 20.860  1.00 12.86  ? 31  TRP C CH2 1 
ATOM   3106 N  N   . TYR C  1 34  ? -37.134 -40.159 20.283  1.00 16.66  ? 32  TYR C N   1 
ATOM   3107 C  CA  . TYR C  1 34  ? -38.126 -40.861 19.486  1.00 16.84  ? 32  TYR C CA  1 
ATOM   3108 C  C   . TYR C  1 34  ? -37.790 -40.680 18.017  1.00 16.87  ? 32  TYR C C   1 
ATOM   3109 O  O   . TYR C  1 34  ? -37.436 -39.578 17.591  1.00 16.78  ? 32  TYR C O   1 
ATOM   3110 C  CB  . TYR C  1 34  ? -39.522 -40.296 19.773  1.00 18.15  ? 32  TYR C CB  1 
ATOM   3111 C  CG  . TYR C  1 34  ? -40.047 -40.604 21.156  1.00 18.69  ? 32  TYR C CG  1 
ATOM   3112 C  CD1 . TYR C  1 34  ? -40.620 -41.844 21.447  1.00 19.60  ? 32  TYR C CD1 1 
ATOM   3113 C  CD2 . TYR C  1 34  ? -39.978 -39.652 22.171  1.00 19.06  ? 32  TYR C CD2 1 
ATOM   3114 C  CE1 . TYR C  1 34  ? -41.095 -42.137 22.717  1.00 20.29  ? 32  TYR C CE1 1 
ATOM   3115 C  CE2 . TYR C  1 34  ? -40.463 -39.925 23.437  1.00 20.06  ? 32  TYR C CE2 1 
ATOM   3116 C  CZ  . TYR C  1 34  ? -41.020 -41.169 23.706  1.00 21.07  ? 32  TYR C CZ  1 
ATOM   3117 O  OH  . TYR C  1 34  ? -41.496 -41.441 24.964  1.00 21.76  ? 32  TYR C OH  1 
ATOM   3118 N  N   . VAL C  1 35  ? -37.943 -41.739 17.228  1.00 17.13  ? 33  VAL C N   1 
ATOM   3119 C  CA  . VAL C  1 35  ? -37.725 -41.619 15.804  1.00 17.48  ? 33  VAL C CA  1 
ATOM   3120 C  C   . VAL C  1 35  ? -38.978 -41.108 15.121  1.00 18.67  ? 33  VAL C C   1 
ATOM   3121 O  O   . VAL C  1 35  ? -39.919 -41.854 14.866  1.00 20.08  ? 33  VAL C O   1 
ATOM   3122 C  CB  . VAL C  1 35  ? -37.264 -42.936 15.166  1.00 17.62  ? 33  VAL C CB  1 
ATOM   3123 C  CG1 . VAL C  1 35  ? -37.127 -42.772 13.665  1.00 17.35  ? 33  VAL C CG1 1 
ATOM   3124 C  CG2 . VAL C  1 35  ? -35.938 -43.350 15.771  1.00 17.21  ? 33  VAL C CG2 1 
ATOM   3125 N  N   . VAL C  1 36  ? -38.981 -39.809 14.854  1.00 19.32  ? 34  VAL C N   1 
ATOM   3126 C  CA  . VAL C  1 36  ? -40.173 -39.106 14.405  1.00 20.66  ? 34  VAL C CA  1 
ATOM   3127 C  C   . VAL C  1 36  ? -40.159 -39.037 12.881  1.00 21.25  ? 34  VAL C C   1 
ATOM   3128 O  O   . VAL C  1 36  ? -41.208 -38.943 12.244  1.00 23.42  ? 34  VAL C O   1 
ATOM   3129 C  CB  . VAL C  1 36  ? -40.196 -37.704 15.040  1.00 21.34  ? 34  VAL C CB  1 
ATOM   3130 C  CG1 . VAL C  1 36  ? -41.312 -36.831 14.470  1.00 23.77  ? 34  VAL C CG1 1 
ATOM   3131 C  CG2 . VAL C  1 36  ? -40.347 -37.833 16.551  1.00 21.18  ? 34  VAL C CG2 1 
ATOM   3132 N  N   . GLY C  1 37  ? -38.966 -39.137 12.295  1.00 20.29  ? 35  GLY C N   1 
ATOM   3133 C  CA  . GLY C  1 37  ? -38.823 -39.200 10.843  1.00 20.71  ? 35  GLY C CA  1 
ATOM   3134 C  C   . GLY C  1 37  ? -37.692 -40.107 10.406  1.00 19.81  ? 35  GLY C C   1 
ATOM   3135 O  O   . GLY C  1 37  ? -36.699 -40.241 11.097  1.00 18.09  ? 35  GLY C O   1 
ATOM   3136 N  N   . LEU C  1 38  ? -37.868 -40.740 9.254   1.00 21.92  ? 36  LEU C N   1 
ATOM   3137 C  CA  . LEU C  1 38  ? -36.911 -41.699 8.727   1.00 22.09  ? 36  LEU C CA  1 
ATOM   3138 C  C   . LEU C  1 38  ? -36.828 -41.495 7.237   1.00 22.11  ? 36  LEU C C   1 
ATOM   3139 O  O   . LEU C  1 38  ? -37.848 -41.508 6.555   1.00 23.59  ? 36  LEU C O   1 
ATOM   3140 C  CB  . LEU C  1 38  ? -37.419 -43.117 8.953   1.00 24.72  ? 36  LEU C CB  1 
ATOM   3141 C  CG  . LEU C  1 38  ? -36.701 -44.021 9.940   1.00 26.02  ? 36  LEU C CG  1 
ATOM   3142 C  CD1 . LEU C  1 38  ? -37.274 -45.426 9.802   1.00 27.50  ? 36  LEU C CD1 1 
ATOM   3143 C  CD2 . LEU C  1 38  ? -35.203 -44.020 9.696   1.00 25.81  ? 36  LEU C CD2 1 
ATOM   3144 N  N   . ALA C  1 39  ? -35.619 -41.351 6.717   1.00 20.99  ? 37  ALA C N   1 
ATOM   3145 C  CA  . ALA C  1 39  ? -35.429 -41.268 5.282   1.00 22.03  ? 37  ALA C CA  1 
ATOM   3146 C  C   . ALA C  1 39  ? -34.184 -42.026 4.887   1.00 21.49  ? 37  ALA C C   1 
ATOM   3147 O  O   . ALA C  1 39  ? -33.219 -42.054 5.633   1.00 20.83  ? 37  ALA C O   1 
ATOM   3148 C  CB  . ALA C  1 39  ? -35.318 -39.806 4.852   1.00 22.47  ? 37  ALA C CB  1 
ATOM   3149 N  N   . GLY C  1 40  ? -34.199 -42.656 3.719   1.00 23.47  ? 38  GLY C N   1 
ATOM   3150 C  CA  . GLY C  1 40  ? -33.011 -43.370 3.258   1.00 23.03  ? 38  GLY C CA  1 
ATOM   3151 C  C   . GLY C  1 40  ? -33.221 -44.216 2.028   1.00 24.48  ? 38  GLY C C   1 
ATOM   3152 O  O   . GLY C  1 40  ? -34.357 -44.423 1.588   1.00 25.42  ? 38  GLY C O   1 
ATOM   3153 N  N   . ASN C  1 41  ? -32.122 -44.756 1.498   1.00 24.70  ? 39  ASN C N   1 
ATOM   3154 C  CA  . ASN C  1 41  ? -32.171 -45.435 0.212   1.00 26.00  ? 39  ASN C CA  1 
ATOM   3155 C  C   . ASN C  1 41  ? -32.726 -46.854 0.282   1.00 27.26  ? 39  ASN C C   1 
ATOM   3156 O  O   . ASN C  1 41  ? -33.000 -47.467 -0.753  1.00 28.90  ? 39  ASN C O   1 
ATOM   3157 C  CB  . ASN C  1 41  ? -30.823 -45.383 -0.514  1.00 25.06  ? 39  ASN C CB  1 
ATOM   3158 C  CG  . ASN C  1 41  ? -29.708 -46.140 0.206   1.00 23.97  ? 39  ASN C CG  1 
ATOM   3159 O  OD1 . ASN C  1 41  ? -29.855 -46.595 1.340   1.00 22.61  ? 39  ASN C OD1 1 
ATOM   3160 N  ND2 . ASN C  1 41  ? -28.575 -46.286 -0.480  1.00 23.63  ? 39  ASN C ND2 1 
ATOM   3161 N  N   . ALA C  1 42  ? -32.981 -47.334 1.493   1.00 27.99  ? 40  ALA C N   1 
ATOM   3162 C  CA  . ALA C  1 42  ? -33.751 -48.568 1.688   1.00 32.05  ? 40  ALA C CA  1 
ATOM   3163 C  C   . ALA C  1 42  ? -35.056 -48.355 2.465   1.00 34.30  ? 40  ALA C C   1 
ATOM   3164 O  O   . ALA C  1 42  ? -35.751 -49.311 2.782   1.00 36.26  ? 40  ALA C O   1 
ATOM   3165 C  CB  . ALA C  1 42  ? -32.893 -49.608 2.387   1.00 31.30  ? 40  ALA C CB  1 
ATOM   3166 N  N   . ILE C  1 43  ? -35.390 -47.100 2.749   1.00 39.13  ? 41  ILE C N   1 
ATOM   3167 C  CA  . ILE C  1 43  ? -36.694 -46.741 3.311   1.00 42.73  ? 41  ILE C CA  1 
ATOM   3168 C  C   . ILE C  1 43  ? -37.735 -46.576 2.211   1.00 48.32  ? 41  ILE C C   1 
ATOM   3169 O  O   . ILE C  1 43  ? -37.538 -45.809 1.274   1.00 45.79  ? 41  ILE C O   1 
ATOM   3170 C  CB  . ILE C  1 43  ? -36.615 -45.410 4.089   1.00 44.07  ? 41  ILE C CB  1 
ATOM   3171 C  CG1 . ILE C  1 43  ? -35.725 -45.565 5.314   1.00 44.83  ? 41  ILE C CG1 1 
ATOM   3172 C  CG2 . ILE C  1 43  ? -38.001 -44.954 4.518   1.00 47.16  ? 41  ILE C CG2 1 
ATOM   3173 C  CD1 . ILE C  1 43  ? -36.220 -46.615 6.286   1.00 45.99  ? 41  ILE C CD1 1 
ATOM   3174 N  N   . LEU C  1 44  ? -38.856 -47.278 2.349   1.00 57.70  ? 42  LEU C N   1 
ATOM   3175 C  CA  . LEU C  1 44  ? -39.930 -47.230 1.356   1.00 62.27  ? 42  LEU C CA  1 
ATOM   3176 C  C   . LEU C  1 44  ? -41.294 -47.044 2.026   1.00 64.38  ? 42  LEU C C   1 
ATOM   3177 O  O   . LEU C  1 44  ? -41.710 -47.864 2.849   1.00 61.34  ? 42  LEU C O   1 
ATOM   3178 C  CB  . LEU C  1 44  ? -39.928 -48.514 0.520   1.00 66.97  ? 42  LEU C CB  1 
ATOM   3179 C  CG  . LEU C  1 44  ? -40.435 -48.409 -0.924  1.00 73.81  ? 42  LEU C CG  1 
ATOM   3180 C  CD1 . LEU C  1 44  ? -40.190 -47.023 -1.507  1.00 74.94  ? 42  LEU C CD1 1 
ATOM   3181 C  CD2 . LEU C  1 44  ? -39.773 -49.473 -1.790  1.00 77.43  ? 42  LEU C CD2 1 
ATOM   3182 N  N   . ARG C  1 45  ? -41.974 -45.952 1.687   1.00 66.41  ? 43  ARG C N   1 
ATOM   3183 C  CA  . ARG C  1 45  ? -43.318 -45.689 2.195   1.00 72.56  ? 43  ARG C CA  1 
ATOM   3184 C  C   . ARG C  1 45  ? -44.274 -46.821 1.812   1.00 74.42  ? 43  ARG C C   1 
ATOM   3185 O  O   . ARG C  1 45  ? -44.452 -47.119 0.634   1.00 73.78  ? 43  ARG C O   1 
ATOM   3186 C  CB  . ARG C  1 45  ? -43.833 -44.357 1.643   1.00 74.92  ? 43  ARG C CB  1 
ATOM   3187 C  CG  . ARG C  1 45  ? -44.804 -43.623 2.552   1.00 83.87  ? 43  ARG C CG  1 
ATOM   3188 C  CD  . ARG C  1 45  ? -44.639 -42.117 2.417   1.00 91.09  ? 43  ARG C CD  1 
ATOM   3189 N  NE  . ARG C  1 45  ? -45.825 -41.401 2.883   1.00 96.10  ? 43  ARG C NE  1 
ATOM   3190 C  CZ  . ARG C  1 45  ? -46.043 -40.105 2.683   1.00 107.57 ? 43  ARG C CZ  1 
ATOM   3191 N  NH1 . ARG C  1 45  ? -47.158 -39.540 3.135   1.00 99.11  ? 43  ARG C NH1 1 
ATOM   3192 N  NH2 . ARG C  1 45  ? -45.147 -39.369 2.034   1.00 114.50 ? 43  ARG C NH2 1 
ATOM   3193 N  N   . GLU C  1 46  ? -44.872 -47.456 2.816   1.00 80.14  ? 44  GLU C N   1 
ATOM   3194 C  CA  . GLU C  1 46  ? -45.941 -48.424 2.591   1.00 85.65  ? 44  GLU C CA  1 
ATOM   3195 C  C   . GLU C  1 46  ? -47.258 -47.898 3.169   1.00 86.84  ? 44  GLU C C   1 
ATOM   3196 O  O   . GLU C  1 46  ? -47.470 -47.918 4.388   1.00 74.30  ? 44  GLU C O   1 
ATOM   3197 C  CB  . GLU C  1 46  ? -45.583 -49.771 3.228   1.00 87.35  ? 44  GLU C CB  1 
ATOM   3198 N  N   . ASP C  1 47  ? -48.129 -47.418 2.283   1.00 89.25  ? 45  ASP C N   1 
ATOM   3199 C  CA  . ASP C  1 47  ? -49.451 -46.927 2.669   1.00 87.59  ? 45  ASP C CA  1 
ATOM   3200 C  C   . ASP C  1 47  ? -50.258 -48.008 3.393   1.00 90.51  ? 45  ASP C C   1 
ATOM   3201 O  O   . ASP C  1 47  ? -50.943 -47.727 4.379   1.00 82.21  ? 45  ASP C O   1 
ATOM   3202 C  CB  . ASP C  1 47  ? -50.216 -46.451 1.430   1.00 86.00  ? 45  ASP C CB  1 
ATOM   3203 N  N   . LYS C  1 48  ? -50.160 -49.245 2.911   1.00 94.39  ? 46  LYS C N   1 
ATOM   3204 C  CA  . LYS C  1 48  ? -50.946 -50.354 3.455   1.00 92.26  ? 46  LYS C CA  1 
ATOM   3205 C  C   . LYS C  1 48  ? -50.567 -50.685 4.904   1.00 91.05  ? 46  LYS C C   1 
ATOM   3206 O  O   . LYS C  1 48  ? -51.445 -50.871 5.747   1.00 92.81  ? 46  LYS C O   1 
ATOM   3207 C  CB  . LYS C  1 48  ? -50.788 -51.599 2.576   1.00 91.41  ? 46  LYS C CB  1 
ATOM   3208 N  N   . ASP C  1 49  ? -49.266 -50.759 5.190   1.00 84.91  ? 47  ASP C N   1 
ATOM   3209 C  CA  . ASP C  1 49  ? -48.786 -51.206 6.503   1.00 75.18  ? 47  ASP C CA  1 
ATOM   3210 C  C   . ASP C  1 49  ? -47.744 -50.250 7.090   1.00 69.30  ? 47  ASP C C   1 
ATOM   3211 O  O   . ASP C  1 49  ? -46.543 -50.504 7.000   1.00 66.62  ? 47  ASP C O   1 
ATOM   3212 C  CB  . ASP C  1 49  ? -48.185 -52.609 6.397   1.00 73.12  ? 47  ASP C CB  1 
ATOM   3213 N  N   . PRO C  1 50  ? -48.205 -49.153 7.713   1.00 61.80  ? 48  PRO C N   1 
ATOM   3214 C  CA  . PRO C  1 50  ? -47.317 -48.044 8.038   1.00 56.45  ? 48  PRO C CA  1 
ATOM   3215 C  C   . PRO C  1 50  ? -46.361 -48.404 9.171   1.00 51.94  ? 48  PRO C C   1 
ATOM   3216 O  O   . PRO C  1 50  ? -46.701 -49.166 10.070  1.00 57.57  ? 48  PRO C O   1 
ATOM   3217 C  CB  . PRO C  1 50  ? -48.279 -46.941 8.483   1.00 57.78  ? 48  PRO C CB  1 
ATOM   3218 C  CG  . PRO C  1 50  ? -49.455 -47.673 9.038   1.00 60.87  ? 48  PRO C CG  1 
ATOM   3219 C  CD  . PRO C  1 50  ? -49.557 -48.967 8.273   1.00 64.53  ? 48  PRO C CD  1 
ATOM   3220 N  N   . GLN C  1 51  ? -45.160 -47.860 9.112   1.00 48.26  ? 49  GLN C N   1 
ATOM   3221 C  CA  . GLN C  1 51  ? -44.140 -48.161 10.097  1.00 44.56  ? 49  GLN C CA  1 
ATOM   3222 C  C   . GLN C  1 51  ? -44.457 -47.495 11.443  1.00 39.59  ? 49  GLN C C   1 
ATOM   3223 O  O   . GLN C  1 51  ? -44.885 -46.341 11.497  1.00 36.88  ? 49  GLN C O   1 
ATOM   3224 C  CB  . GLN C  1 51  ? -42.774 -47.714 9.568   1.00 44.67  ? 49  GLN C CB  1 
ATOM   3225 C  CG  . GLN C  1 51  ? -41.772 -47.379 10.652  1.00 50.47  ? 49  GLN C CG  1 
ATOM   3226 C  CD  . GLN C  1 51  ? -40.450 -48.082 10.458  1.00 55.01  ? 49  GLN C CD  1 
ATOM   3227 O  OE1 . GLN C  1 51  ? -39.935 -48.165 9.343   1.00 57.91  ? 49  GLN C OE1 1 
ATOM   3228 N  NE2 . GLN C  1 51  ? -39.883 -48.581 11.552  1.00 57.83  ? 49  GLN C NE2 1 
ATOM   3229 N  N   . LYS C  1 52  ? -44.221 -48.226 12.528  1.00 35.39  ? 50  LYS C N   1 
ATOM   3230 C  CA  . LYS C  1 52  ? -44.480 -47.719 13.868  1.00 32.10  ? 50  LYS C CA  1 
ATOM   3231 C  C   . LYS C  1 52  ? -43.277 -46.992 14.449  1.00 28.58  ? 50  LYS C C   1 
ATOM   3232 O  O   . LYS C  1 52  ? -42.134 -47.367 14.204  1.00 26.95  ? 50  LYS C O   1 
ATOM   3233 C  CB  . LYS C  1 52  ? -44.870 -48.861 14.794  1.00 33.34  ? 50  LYS C CB  1 
ATOM   3234 C  CG  . LYS C  1 52  ? -46.193 -49.490 14.417  1.00 37.49  ? 50  LYS C CG  1 
ATOM   3235 C  CD  . LYS C  1 52  ? -46.553 -50.631 15.347  1.00 39.75  ? 50  LYS C CD  1 
ATOM   3236 C  CE  . LYS C  1 52  ? -47.608 -51.517 14.709  1.00 44.74  ? 50  LYS C CE  1 
ATOM   3237 N  NZ  . LYS C  1 52  ? -48.199 -52.411 15.728  1.00 49.49  ? 50  LYS C NZ  1 
ATOM   3238 N  N   . MET C  1 53  ? -43.552 -45.937 15.209  1.00 25.89  ? 51  MET C N   1 
ATOM   3239 C  CA  . MET C  1 53  ? -42.526 -45.234 15.946  1.00 23.21  ? 51  MET C CA  1 
ATOM   3240 C  C   . MET C  1 53  ? -41.801 -46.177 16.890  1.00 22.40  ? 51  MET C C   1 
ATOM   3241 O  O   . MET C  1 53  ? -42.411 -47.044 17.516  1.00 22.91  ? 51  MET C O   1 
ATOM   3242 C  CB  . MET C  1 53  ? -43.148 -44.095 16.744  1.00 22.82  ? 51  MET C CB  1 
ATOM   3243 C  CG  . MET C  1 53  ? -42.137 -43.163 17.388  1.00 21.39  ? 51  MET C CG  1 
ATOM   3244 S  SD  . MET C  1 53  ? -42.902 -41.665 18.025  1.00 21.65  ? 51  MET C SD  1 
ATOM   3245 C  CE  . MET C  1 53  ? -43.299 -40.819 16.492  1.00 22.13  ? 51  MET C CE  1 
ATOM   3246 N  N   . TYR C  1 54  ? -40.488 -46.001 16.977  1.00 21.06  ? 52  TYR C N   1 
ATOM   3247 C  CA  . TYR C  1 54  ? -39.693 -46.624 18.015  1.00 20.91  ? 52  TYR C CA  1 
ATOM   3248 C  C   . TYR C  1 54  ? -38.810 -45.558 18.662  1.00 19.96  ? 52  TYR C C   1 
ATOM   3249 O  O   . TYR C  1 54  ? -38.744 -44.426 18.184  1.00 19.33  ? 52  TYR C O   1 
ATOM   3250 C  CB  . TYR C  1 54  ? -38.840 -47.767 17.451  1.00 21.42  ? 52  TYR C CB  1 
ATOM   3251 C  CG  . TYR C  1 54  ? -37.881 -47.371 16.347  1.00 21.86  ? 52  TYR C CG  1 
ATOM   3252 C  CD1 . TYR C  1 54  ? -38.280 -47.375 15.015  1.00 22.61  ? 52  TYR C CD1 1 
ATOM   3253 C  CD2 . TYR C  1 54  ? -36.569 -47.018 16.631  1.00 21.92  ? 52  TYR C CD2 1 
ATOM   3254 C  CE1 . TYR C  1 54  ? -37.405 -47.020 14.001  1.00 22.97  ? 52  TYR C CE1 1 
ATOM   3255 C  CE2 . TYR C  1 54  ? -35.684 -46.666 15.623  1.00 21.31  ? 52  TYR C CE2 1 
ATOM   3256 C  CZ  . TYR C  1 54  ? -36.112 -46.660 14.312  1.00 21.90  ? 52  TYR C CZ  1 
ATOM   3257 O  OH  . TYR C  1 54  ? -35.253 -46.310 13.293  1.00 21.46  ? 52  TYR C OH  1 
ATOM   3258 N  N   . ALA C  1 55  ? -38.148 -45.928 19.754  1.00 18.92  ? 53  ALA C N   1 
ATOM   3259 C  CA  . ALA C  1 55  ? -37.299 -45.005 20.485  1.00 18.21  ? 53  ALA C CA  1 
ATOM   3260 C  C   . ALA C  1 55  ? -35.867 -45.510 20.547  1.00 18.17  ? 53  ALA C C   1 
ATOM   3261 O  O   . ALA C  1 55  ? -35.616 -46.724 20.524  1.00 18.78  ? 53  ALA C O   1 
ATOM   3262 C  CB  . ALA C  1 55  ? -37.832 -44.802 21.894  1.00 18.32  ? 53  ALA C CB  1 
ATOM   3263 N  N   . THR C  1 56  ? -34.925 -44.572 20.638  1.00 17.34  ? 54  THR C N   1 
ATOM   3264 C  CA  . THR C  1 56  ? -33.530 -44.926 20.747  1.00 17.57  ? 54  THR C CA  1 
ATOM   3265 C  C   . THR C  1 56  ? -32.891 -44.156 21.879  1.00 18.08  ? 54  THR C C   1 
ATOM   3266 O  O   . THR C  1 56  ? -32.984 -42.934 21.948  1.00 20.19  ? 54  THR C O   1 
ATOM   3267 C  CB  . THR C  1 56  ? -32.794 -44.679 19.421  1.00 16.87  ? 54  THR C CB  1 
ATOM   3268 O  OG1 . THR C  1 56  ? -33.341 -45.542 18.419  1.00 16.81  ? 54  THR C OG1 1 
ATOM   3269 C  CG2 . THR C  1 56  ? -31.313 -44.982 19.558  1.00 17.12  ? 54  THR C CG2 1 
ATOM   3270 N  N   . ILE C  1 57  ? -32.218 -44.880 22.758  1.00 19.08  ? 55  ILE C N   1 
ATOM   3271 C  CA  . ILE C  1 57  ? -31.704 -44.309 23.989  1.00 18.88  ? 55  ILE C CA  1 
ATOM   3272 C  C   . ILE C  1 57  ? -30.176 -44.288 23.984  1.00 18.01  ? 55  ILE C C   1 
ATOM   3273 O  O   . ILE C  1 57  ? -29.532 -45.334 23.850  1.00 16.84  ? 55  ILE C O   1 
ATOM   3274 C  CB  . ILE C  1 57  ? -32.196 -45.134 25.189  1.00 22.01  ? 55  ILE C CB  1 
ATOM   3275 C  CG1 . ILE C  1 57  ? -33.727 -45.184 25.188  1.00 24.31  ? 55  ILE C CG1 1 
ATOM   3276 C  CG2 . ILE C  1 57  ? -31.684 -44.540 26.498  1.00 21.80  ? 55  ILE C CG2 1 
ATOM   3277 C  CD1 . ILE C  1 57  ? -34.306 -46.300 26.031  1.00 27.76  ? 55  ILE C CD1 1 
ATOM   3278 N  N   . TYR C  1 58  ? -29.602 -43.102 24.174  1.00 17.44  ? 56  TYR C N   1 
ATOM   3279 C  CA  . TYR C  1 58  ? -28.145 -42.932 24.188  1.00 18.62  ? 56  TYR C CA  1 
ATOM   3280 C  C   . TYR C  1 58  ? -27.630 -42.784 25.617  1.00 20.78  ? 56  TYR C C   1 
ATOM   3281 O  O   . TYR C  1 58  ? -28.015 -41.854 26.328  1.00 22.44  ? 56  TYR C O   1 
ATOM   3282 C  CB  . TYR C  1 58  ? -27.756 -41.691 23.388  1.00 17.84  ? 56  TYR C CB  1 
ATOM   3283 C  CG  . TYR C  1 58  ? -27.911 -41.828 21.889  1.00 18.34  ? 56  TYR C CG  1 
ATOM   3284 C  CD1 . TYR C  1 58  ? -26.801 -41.923 21.068  1.00 19.49  ? 56  TYR C CD1 1 
ATOM   3285 C  CD2 . TYR C  1 58  ? -29.172 -41.849 21.294  1.00 18.61  ? 56  TYR C CD2 1 
ATOM   3286 C  CE1 . TYR C  1 58  ? -26.932 -42.045 19.694  1.00 20.48  ? 56  TYR C CE1 1 
ATOM   3287 C  CE2 . TYR C  1 58  ? -29.318 -41.975 19.925  1.00 19.15  ? 56  TYR C CE2 1 
ATOM   3288 C  CZ  . TYR C  1 58  ? -28.193 -42.071 19.124  1.00 20.31  ? 56  TYR C CZ  1 
ATOM   3289 O  OH  . TYR C  1 58  ? -28.320 -42.220 17.762  1.00 18.55  ? 56  TYR C OH  1 
ATOM   3290 N  N   . GLU C  1 59  ? -26.754 -43.691 26.033  1.00 23.49  ? 57  GLU C N   1 
ATOM   3291 C  CA  . GLU C  1 59  ? -26.139 -43.607 27.350  1.00 26.01  ? 57  GLU C CA  1 
ATOM   3292 C  C   . GLU C  1 59  ? -24.633 -43.453 27.221  1.00 25.91  ? 57  GLU C C   1 
ATOM   3293 O  O   . GLU C  1 59  ? -23.953 -44.329 26.683  1.00 24.39  ? 57  GLU C O   1 
ATOM   3294 C  CB  . GLU C  1 59  ? -26.438 -44.859 28.165  1.00 30.74  ? 57  GLU C CB  1 
ATOM   3295 C  CG  . GLU C  1 59  ? -27.767 -44.803 28.888  1.00 37.49  ? 57  GLU C CG  1 
ATOM   3296 C  CD  . GLU C  1 59  ? -28.252 -46.168 29.341  1.00 45.08  ? 57  GLU C CD  1 
ATOM   3297 O  OE1 . GLU C  1 59  ? -27.465 -47.144 29.290  1.00 45.21  ? 57  GLU C OE1 1 
ATOM   3298 O  OE2 . GLU C  1 59  ? -29.427 -46.252 29.756  1.00 50.37  ? 57  GLU C OE2 1 
ATOM   3299 N  N   . LEU C  1 60  ? -24.120 -42.339 27.732  1.00 25.57  ? 58  LEU C N   1 
ATOM   3300 C  CA  . LEU C  1 60  ? -22.703 -42.032 27.652  1.00 25.19  ? 58  LEU C CA  1 
ATOM   3301 C  C   . LEU C  1 60  ? -21.957 -42.818 28.710  1.00 27.62  ? 58  LEU C C   1 
ATOM   3302 O  O   . LEU C  1 60  ? -22.264 -42.715 29.886  1.00 29.63  ? 58  LEU C O   1 
ATOM   3303 C  CB  . LEU C  1 60  ? -22.496 -40.534 27.880  1.00 25.58  ? 58  LEU C CB  1 
ATOM   3304 C  CG  . LEU C  1 60  ? -21.110 -39.972 27.578  1.00 25.38  ? 58  LEU C CG  1 
ATOM   3305 C  CD1 . LEU C  1 60  ? -20.739 -40.235 26.123  1.00 25.02  ? 58  LEU C CD1 1 
ATOM   3306 C  CD2 . LEU C  1 60  ? -21.089 -38.481 27.881  1.00 23.91  ? 58  LEU C CD2 1 
ATOM   3307 N  N   . LYS C  1 61  ? -20.979 -43.613 28.297  1.00 31.19  ? 59  LYS C N   1 
ATOM   3308 C  CA  . LYS C  1 61  ? -20.185 -44.404 29.240  1.00 34.55  ? 59  LYS C CA  1 
ATOM   3309 C  C   . LYS C  1 61  ? -18.948 -43.647 29.720  1.00 32.94  ? 59  LYS C C   1 
ATOM   3310 O  O   . LYS C  1 61  ? -18.576 -42.631 29.148  1.00 30.94  ? 59  LYS C O   1 
ATOM   3311 C  CB  . LYS C  1 61  ? -19.747 -45.719 28.588  1.00 41.44  ? 59  LYS C CB  1 
ATOM   3312 C  CG  . LYS C  1 61  ? -20.876 -46.490 27.925  1.00 48.97  ? 59  LYS C CG  1 
ATOM   3313 C  CD  . LYS C  1 61  ? -20.640 -47.992 27.987  1.00 63.42  ? 59  LYS C CD  1 
ATOM   3314 C  CE  . LYS C  1 61  ? -19.284 -48.382 27.416  1.00 65.88  ? 59  LYS C CE  1 
ATOM   3315 N  NZ  . LYS C  1 61  ? -19.409 -49.418 26.355  1.00 64.77  ? 59  LYS C NZ  1 
ATOM   3316 N  N   . GLU C  1 62  ? -18.310 -44.168 30.764  1.00 34.95  ? 60  GLU C N   1 
ATOM   3317 C  CA  . GLU C  1 62  ? -17.062 -43.615 31.285  1.00 34.97  ? 60  GLU C CA  1 
ATOM   3318 C  C   . GLU C  1 62  ? -16.048 -43.345 30.180  1.00 34.31  ? 60  GLU C C   1 
ATOM   3319 O  O   . GLU C  1 62  ? -15.413 -42.296 30.166  1.00 37.08  ? 60  GLU C O   1 
ATOM   3320 C  CB  . GLU C  1 62  ? -16.455 -44.568 32.324  1.00 37.60  ? 60  GLU C CB  1 
ATOM   3321 N  N   . ASP C  1 63  ? -15.915 -44.279 29.242  1.00 33.67  ? 61  ASP C N   1 
ATOM   3322 C  CA  . ASP C  1 63  ? -14.927 -44.161 28.177  1.00 33.00  ? 61  ASP C CA  1 
ATOM   3323 C  C   . ASP C  1 63  ? -15.396 -43.314 26.980  1.00 31.73  ? 61  ASP C C   1 
ATOM   3324 O  O   . ASP C  1 63  ? -14.704 -43.241 25.963  1.00 31.29  ? 61  ASP C O   1 
ATOM   3325 C  CB  . ASP C  1 63  ? -14.493 -45.552 27.703  1.00 34.67  ? 61  ASP C CB  1 
ATOM   3326 C  CG  . ASP C  1 63  ? -15.552 -46.255 26.857  1.00 34.31  ? 61  ASP C CG  1 
ATOM   3327 O  OD1 . ASP C  1 63  ? -16.636 -45.678 26.616  1.00 31.16  ? 61  ASP C OD1 1 
ATOM   3328 O  OD2 . ASP C  1 63  ? -15.293 -47.405 26.438  1.00 34.79  ? 61  ASP C OD2 1 
ATOM   3329 N  N   . LYS C  1 64  ? -16.559 -42.677 27.108  1.00 30.72  ? 62  LYS C N   1 
ATOM   3330 C  CA  . LYS C  1 64  ? -17.053 -41.702 26.120  1.00 29.71  ? 62  LYS C CA  1 
ATOM   3331 C  C   . LYS C  1 64  ? -17.696 -42.338 24.890  1.00 27.63  ? 62  LYS C C   1 
ATOM   3332 O  O   . LYS C  1 64  ? -18.108 -41.640 23.966  1.00 24.35  ? 62  LYS C O   1 
ATOM   3333 C  CB  . LYS C  1 64  ? -15.943 -40.755 25.662  1.00 31.48  ? 62  LYS C CB  1 
ATOM   3334 C  CG  . LYS C  1 64  ? -15.341 -39.913 26.774  1.00 39.18  ? 62  LYS C CG  1 
ATOM   3335 C  CD  . LYS C  1 64  ? -16.393 -39.087 27.506  1.00 43.66  ? 62  LYS C CD  1 
ATOM   3336 C  CE  . LYS C  1 64  ? -15.763 -38.274 28.627  1.00 47.43  ? 62  LYS C CE  1 
ATOM   3337 N  NZ  . LYS C  1 64  ? -16.786 -37.786 29.583  1.00 49.98  ? 62  LYS C NZ  1 
ATOM   3338 N  N   . SER C  1 65  ? -17.767 -43.660 24.867  1.00 26.87  ? 63  SER C N   1 
ATOM   3339 C  CA  . SER C  1 65  ? -18.608 -44.342 23.906  1.00 25.15  ? 63  SER C CA  1 
ATOM   3340 C  C   . SER C  1 65  ? -20.048 -44.293 24.408  1.00 22.10  ? 63  SER C C   1 
ATOM   3341 O  O   . SER C  1 65  ? -20.301 -44.086 25.594  1.00 20.45  ? 63  SER C O   1 
ATOM   3342 C  CB  . SER C  1 65  ? -18.130 -45.783 23.720  1.00 27.49  ? 63  SER C CB  1 
ATOM   3343 O  OG  . SER C  1 65  ? -18.408 -46.557 24.870  1.00 33.80  ? 63  SER C OG  1 
ATOM   3344 N  N   . TYR C  1 66  ? -20.993 -44.444 23.494  1.00 21.16  ? 64  TYR C N   1 
ATOM   3345 C  CA  . TYR C  1 66  ? -22.396 -44.590 23.864  1.00 20.35  ? 64  TYR C CA  1 
ATOM   3346 C  C   . TYR C  1 66  ? -22.777 -46.061 23.858  1.00 21.48  ? 64  TYR C C   1 
ATOM   3347 O  O   . TYR C  1 66  ? -22.470 -46.800 22.913  1.00 21.54  ? 64  TYR C O   1 
ATOM   3348 C  CB  . TYR C  1 66  ? -23.302 -43.874 22.868  1.00 19.03  ? 64  TYR C CB  1 
ATOM   3349 C  CG  . TYR C  1 66  ? -23.357 -42.362 22.969  1.00 18.33  ? 64  TYR C CG  1 
ATOM   3350 C  CD1 . TYR C  1 66  ? -22.935 -41.576 21.915  1.00 17.40  ? 64  TYR C CD1 1 
ATOM   3351 C  CD2 . TYR C  1 66  ? -23.928 -41.728 24.072  1.00 18.05  ? 64  TYR C CD2 1 
ATOM   3352 C  CE1 . TYR C  1 66  ? -23.024 -40.196 21.966  1.00 17.46  ? 64  TYR C CE1 1 
ATOM   3353 C  CE2 . TYR C  1 66  ? -24.023 -40.344 24.131  1.00 17.61  ? 64  TYR C CE2 1 
ATOM   3354 C  CZ  . TYR C  1 66  ? -23.557 -39.583 23.077  1.00 17.22  ? 64  TYR C CZ  1 
ATOM   3355 O  OH  . TYR C  1 66  ? -23.630 -38.206 23.105  1.00 16.61  ? 64  TYR C OH  1 
ATOM   3356 N  N   . ASN C  1 67  ? -23.496 -46.474 24.889  1.00 22.95  ? 65  ASN C N   1 
ATOM   3357 C  CA  . ASN C  1 67  ? -24.454 -47.559 24.749  1.00 24.30  ? 65  ASN C CA  1 
ATOM   3358 C  C   . ASN C  1 67  ? -25.767 -47.084 24.167  1.00 21.14  ? 65  ASN C C   1 
ATOM   3359 O  O   . ASN C  1 67  ? -26.378 -46.139 24.662  1.00 22.55  ? 65  ASN C O   1 
ATOM   3360 C  CB  . ASN C  1 67  ? -24.644 -48.277 26.071  1.00 27.64  ? 65  ASN C CB  1 
ATOM   3361 C  CG  . ASN C  1 67  ? -23.880 -49.574 26.100  1.00 35.09  ? 65  ASN C CG  1 
ATOM   3362 O  OD1 . ASN C  1 67  ? -22.676 -49.601 25.829  1.00 42.54  ? 65  ASN C OD1 1 
ATOM   3363 N  ND2 . ASN C  1 67  ? -24.586 -50.673 26.315  1.00 42.16  ? 65  ASN C ND2 1 
ATOM   3364 N  N   . VAL C  1 68  ? -26.164 -47.699 23.066  1.00 19.64  ? 66  VAL C N   1 
ATOM   3365 C  CA  . VAL C  1 68  ? -27.318 -47.237 22.310  1.00 18.32  ? 66  VAL C CA  1 
ATOM   3366 C  C   . VAL C  1 68  ? -28.349 -48.350 22.265  1.00 18.68  ? 66  VAL C C   1 
ATOM   3367 O  O   . VAL C  1 68  ? -28.065 -49.458 21.797  1.00 19.68  ? 66  VAL C O   1 
ATOM   3368 C  CB  . VAL C  1 68  ? -26.939 -46.831 20.873  1.00 17.53  ? 66  VAL C CB  1 
ATOM   3369 C  CG1 . VAL C  1 68  ? -28.127 -46.200 20.156  1.00 17.00  ? 66  VAL C CG1 1 
ATOM   3370 C  CG2 . VAL C  1 68  ? -25.774 -45.857 20.901  1.00 17.69  ? 66  VAL C CG2 1 
ATOM   3371 N  N   . THR C  1 69  ? -29.541 -48.054 22.772  1.00 18.03  ? 67  THR C N   1 
ATOM   3372 C  CA  . THR C  1 69  ? -30.597 -49.053 22.882  1.00 19.09  ? 67  THR C CA  1 
ATOM   3373 C  C   . THR C  1 69  ? -31.831 -48.569 22.139  1.00 18.11  ? 67  THR C C   1 
ATOM   3374 O  O   . THR C  1 69  ? -32.350 -47.488 22.418  1.00 17.40  ? 67  THR C O   1 
ATOM   3375 C  CB  . THR C  1 69  ? -30.962 -49.337 24.347  1.00 19.50  ? 67  THR C CB  1 
ATOM   3376 O  OG1 . THR C  1 69  ? -29.774 -49.617 25.086  1.00 20.17  ? 67  THR C OG1 1 
ATOM   3377 C  CG2 . THR C  1 69  ? -31.912 -50.524 24.447  1.00 20.87  ? 67  THR C CG2 1 
ATOM   3378 N  N   . SER C  1 70  ? -32.283 -49.358 21.175  1.00 18.32  ? 68  SER C N   1 
ATOM   3379 C  CA  . SER C  1 70  ? -33.511 -49.036 20.475  1.00 18.61  ? 68  SER C CA  1 
ATOM   3380 C  C   . SER C  1 70  ? -34.607 -49.986 20.955  1.00 20.36  ? 68  SER C C   1 
ATOM   3381 O  O   . SER C  1 70  ? -34.393 -51.186 21.076  1.00 20.63  ? 68  SER C O   1 
ATOM   3382 C  CB  . SER C  1 70  ? -33.321 -49.149 18.957  1.00 18.64  ? 68  SER C CB  1 
ATOM   3383 O  OG  . SER C  1 70  ? -32.682 -47.999 18.435  1.00 17.37  ? 68  SER C OG  1 
ATOM   3384 N  N   . VAL C  1 71  ? -35.778 -49.426 21.229  1.00 20.36  ? 69  VAL C N   1 
ATOM   3385 C  CA  . VAL C  1 71  ? -36.907 -50.205 21.693  1.00 22.00  ? 69  VAL C CA  1 
ATOM   3386 C  C   . VAL C  1 71  ? -38.003 -50.163 20.626  1.00 22.23  ? 69  VAL C C   1 
ATOM   3387 O  O   . VAL C  1 71  ? -38.449 -49.085 20.256  1.00 20.73  ? 69  VAL C O   1 
ATOM   3388 C  CB  . VAL C  1 71  ? -37.461 -49.628 23.023  1.00 22.31  ? 69  VAL C CB  1 
ATOM   3389 C  CG1 . VAL C  1 71  ? -38.501 -50.556 23.637  1.00 23.35  ? 69  VAL C CG1 1 
ATOM   3390 C  CG2 . VAL C  1 71  ? -36.328 -49.370 23.999  1.00 22.60  ? 69  VAL C CG2 1 
ATOM   3391 N  N   . LEU C  1 72  ? -38.441 -51.336 20.173  1.00 23.39  ? 70  LEU C N   1 
ATOM   3392 C  CA  . LEU C  1 72  ? -39.460 -51.453 19.129  1.00 25.08  ? 70  LEU C CA  1 
ATOM   3393 C  C   . LEU C  1 72  ? -40.619 -52.320 19.613  1.00 26.44  ? 70  LEU C C   1 
ATOM   3394 O  O   . LEU C  1 72  ? -40.416 -53.260 20.365  1.00 26.83  ? 70  LEU C O   1 
ATOM   3395 C  CB  . LEU C  1 72  ? -38.879 -52.106 17.867  1.00 25.77  ? 70  LEU C CB  1 
ATOM   3396 C  CG  . LEU C  1 72  ? -37.854 -51.322 17.052  1.00 25.23  ? 70  LEU C CG  1 
ATOM   3397 C  CD1 . LEU C  1 72  ? -36.518 -51.285 17.772  1.00 25.18  ? 70  LEU C CD1 1 
ATOM   3398 C  CD2 . LEU C  1 72  ? -37.689 -51.963 15.682  1.00 26.11  ? 70  LEU C CD2 1 
ATOM   3399 N  N   . PHE C  1 73  ? -41.820 -52.024 19.138  1.00 26.95  ? 71  PHE C N   1 
ATOM   3400 C  CA  . PHE C  1 73  ? -42.957 -52.910 19.329  1.00 29.71  ? 71  PHE C CA  1 
ATOM   3401 C  C   . PHE C  1 73  ? -43.150 -53.770 18.088  1.00 31.80  ? 71  PHE C C   1 
ATOM   3402 O  O   . PHE C  1 73  ? -43.537 -53.268 17.044  1.00 32.52  ? 71  PHE C O   1 
ATOM   3403 C  CB  . PHE C  1 73  ? -44.217 -52.080 19.598  1.00 29.71  ? 71  PHE C CB  1 
ATOM   3404 C  CG  . PHE C  1 73  ? -45.436 -52.898 19.929  1.00 31.37  ? 71  PHE C CG  1 
ATOM   3405 C  CD1 . PHE C  1 73  ? -45.395 -53.879 20.914  1.00 32.39  ? 71  PHE C CD1 1 
ATOM   3406 C  CD2 . PHE C  1 73  ? -46.633 -52.679 19.260  1.00 32.41  ? 71  PHE C CD2 1 
ATOM   3407 C  CE1 . PHE C  1 73  ? -46.522 -54.637 21.212  1.00 33.99  ? 71  PHE C CE1 1 
ATOM   3408 C  CE2 . PHE C  1 73  ? -47.760 -53.424 19.560  1.00 33.93  ? 71  PHE C CE2 1 
ATOM   3409 C  CZ  . PHE C  1 73  ? -47.708 -54.398 20.546  1.00 34.72  ? 71  PHE C CZ  1 
ATOM   3410 N  N   . ARG C  1 74  ? -42.863 -55.063 18.192  1.00 35.60  ? 72  ARG C N   1 
ATOM   3411 C  CA  . ARG C  1 74  ? -43.008 -55.963 17.050  1.00 39.65  ? 72  ARG C CA  1 
ATOM   3412 C  C   . ARG C  1 74  ? -43.443 -57.363 17.464  1.00 40.52  ? 72  ARG C C   1 
ATOM   3413 O  O   . ARG C  1 74  ? -42.953 -57.928 18.444  1.00 39.73  ? 72  ARG C O   1 
ATOM   3414 C  CB  . ARG C  1 74  ? -41.727 -56.024 16.216  1.00 43.79  ? 72  ARG C CB  1 
ATOM   3415 C  CG  . ARG C  1 74  ? -40.537 -56.682 16.896  1.00 50.14  ? 72  ARG C CG  1 
ATOM   3416 C  CD  . ARG C  1 74  ? -39.263 -56.576 16.048  1.00 59.55  ? 72  ARG C CD  1 
ATOM   3417 N  NE  . ARG C  1 74  ? -39.208 -57.523 14.926  1.00 66.31  ? 72  ARG C NE  1 
ATOM   3418 C  CZ  . ARG C  1 74  ? -38.901 -58.817 15.040  1.00 69.78  ? 72  ARG C CZ  1 
ATOM   3419 N  NH1 . ARG C  1 74  ? -38.858 -59.588 13.958  1.00 70.79  ? 72  ARG C NH1 1 
ATOM   3420 N  NH2 . ARG C  1 74  ? -38.651 -59.352 16.232  1.00 68.31  ? 72  ARG C NH2 1 
ATOM   3421 N  N   . LYS C  1 75  ? -44.378 -57.917 16.701  1.00 41.77  ? 73  LYS C N   1 
ATOM   3422 C  CA  . LYS C  1 75  ? -44.934 -59.231 16.987  1.00 43.29  ? 73  LYS C CA  1 
ATOM   3423 C  C   . LYS C  1 75  ? -45.472 -59.286 18.413  1.00 42.50  ? 73  LYS C C   1 
ATOM   3424 O  O   . LYS C  1 75  ? -45.384 -60.307 19.079  1.00 42.77  ? 73  LYS C O   1 
ATOM   3425 C  CB  . LYS C  1 75  ? -43.875 -60.312 16.760  1.00 44.23  ? 73  LYS C CB  1 
ATOM   3426 N  N   . LYS C  1 76  ? -46.027 -58.165 18.863  1.00 41.36  ? 74  LYS C N   1 
ATOM   3427 C  CA  . LYS C  1 76  ? -46.719 -58.079 20.147  1.00 41.76  ? 74  LYS C CA  1 
ATOM   3428 C  C   . LYS C  1 76  ? -45.779 -58.122 21.343  1.00 39.80  ? 74  LYS C C   1 
ATOM   3429 O  O   . LYS C  1 76  ? -46.214 -58.354 22.470  1.00 41.25  ? 74  LYS C O   1 
ATOM   3430 C  CB  . LYS C  1 76  ? -47.780 -59.170 20.261  1.00 45.80  ? 74  LYS C CB  1 
ATOM   3431 C  CG  . LYS C  1 76  ? -48.947 -58.953 19.315  1.00 48.41  ? 74  LYS C CG  1 
ATOM   3432 C  CD  . LYS C  1 76  ? -49.967 -60.073 19.409  1.00 52.45  ? 74  LYS C CD  1 
ATOM   3433 C  CE  . LYS C  1 76  ? -51.019 -59.938 18.321  1.00 54.53  ? 74  LYS C CE  1 
ATOM   3434 N  NZ  . LYS C  1 76  ? -52.141 -60.894 18.519  1.00 58.92  ? 74  LYS C NZ  1 
ATOM   3435 N  N   . LYS C  1 77  ? -44.505 -57.832 21.103  1.00 37.69  ? 75  LYS C N   1 
ATOM   3436 C  CA  . LYS C  1 77  ? -43.510 -57.793 22.165  1.00 36.52  ? 75  LYS C CA  1 
ATOM   3437 C  C   . LYS C  1 77  ? -42.635 -56.560 22.057  1.00 33.14  ? 75  LYS C C   1 
ATOM   3438 O  O   . LYS C  1 77  ? -42.555 -55.945 21.005  1.00 31.06  ? 75  LYS C O   1 
ATOM   3439 C  CB  . LYS C  1 77  ? -42.640 -59.046 22.114  1.00 38.12  ? 75  LYS C CB  1 
ATOM   3440 C  CG  . LYS C  1 77  ? -43.433 -60.314 22.341  1.00 41.18  ? 75  LYS C CG  1 
ATOM   3441 C  CD  . LYS C  1 77  ? -42.538 -61.501 22.642  1.00 43.40  ? 75  LYS C CD  1 
ATOM   3442 C  CE  . LYS C  1 77  ? -43.365 -62.772 22.684  1.00 47.06  ? 75  LYS C CE  1 
ATOM   3443 N  NZ  . LYS C  1 77  ? -42.522 -63.946 22.994  1.00 50.09  ? 75  LYS C NZ  1 
ATOM   3444 N  N   . CYS C  1 78  ? -41.989 -56.204 23.161  1.00 32.13  ? 76  CYS C N   1 
ATOM   3445 C  CA  . CYS C  1 78  ? -40.943 -55.195 23.140  1.00 30.45  ? 76  CYS C CA  1 
ATOM   3446 C  C   . CYS C  1 78  ? -39.624 -55.826 22.711  1.00 31.08  ? 76  CYS C C   1 
ATOM   3447 O  O   . CYS C  1 78  ? -39.164 -56.801 23.300  1.00 32.37  ? 76  CYS C O   1 
ATOM   3448 C  CB  . CYS C  1 78  ? -40.791 -54.533 24.515  1.00 30.04  ? 76  CYS C CB  1 
ATOM   3449 S  SG  . CYS C  1 78  ? -42.320 -53.814 25.179  1.00 30.20  ? 76  CYS C SG  1 
ATOM   3450 N  N   . ASP C  1 79  ? -39.039 -55.269 21.663  1.00 30.86  ? 77  ASP C N   1 
ATOM   3451 C  CA  . ASP C  1 79  ? -37.822 -55.795 21.070  1.00 32.86  ? 77  ASP C CA  1 
ATOM   3452 C  C   . ASP C  1 79  ? -36.723 -54.763 21.286  1.00 30.74  ? 77  ASP C C   1 
ATOM   3453 O  O   . ASP C  1 79  ? -36.956 -53.566 21.203  1.00 28.55  ? 77  ASP C O   1 
ATOM   3454 C  CB  . ASP C  1 79  ? -38.065 -56.066 19.580  1.00 36.72  ? 77  ASP C CB  1 
ATOM   3455 C  CG  . ASP C  1 79  ? -36.812 -56.528 18.834  1.00 39.62  ? 77  ASP C CG  1 
ATOM   3456 O  OD1 . ASP C  1 79  ? -36.270 -57.620 19.134  1.00 44.01  ? 77  ASP C OD1 1 
ATOM   3457 O  OD2 . ASP C  1 79  ? -36.399 -55.811 17.899  1.00 40.18  ? 77  ASP C OD2 1 
ATOM   3458 N  N   . TYR C  1 80  ? -35.543 -55.227 21.664  1.00 32.01  ? 78  TYR C N   1 
ATOM   3459 C  CA  . TYR C  1 80  ? -34.480 -54.332 22.093  1.00 29.76  ? 78  TYR C CA  1 
ATOM   3460 C  C   . TYR C  1 80  ? -33.249 -54.623 21.251  1.00 30.86  ? 78  TYR C C   1 
ATOM   3461 O  O   . TYR C  1 80  ? -32.798 -55.762 21.184  1.00 35.44  ? 78  TYR C O   1 
ATOM   3462 C  CB  . TYR C  1 80  ? -34.157 -54.561 23.568  1.00 29.23  ? 78  TYR C CB  1 
ATOM   3463 C  CG  . TYR C  1 80  ? -35.294 -54.257 24.496  1.00 29.13  ? 78  TYR C CG  1 
ATOM   3464 C  CD1 . TYR C  1 80  ? -35.482 -52.981 24.995  1.00 27.60  ? 78  TYR C CD1 1 
ATOM   3465 C  CD2 . TYR C  1 80  ? -36.192 -55.249 24.879  1.00 31.33  ? 78  TYR C CD2 1 
ATOM   3466 C  CE1 . TYR C  1 80  ? -36.522 -52.694 25.856  1.00 27.42  ? 78  TYR C CE1 1 
ATOM   3467 C  CE2 . TYR C  1 80  ? -37.238 -54.968 25.743  1.00 31.67  ? 78  TYR C CE2 1 
ATOM   3468 C  CZ  . TYR C  1 80  ? -37.397 -53.683 26.220  1.00 29.83  ? 78  TYR C CZ  1 
ATOM   3469 O  OH  . TYR C  1 80  ? -38.427 -53.391 27.092  1.00 32.14  ? 78  TYR C OH  1 
ATOM   3470 N  N   . TRP C  1 81  ? -32.725 -53.603 20.588  1.00 29.35  ? 79  TRP C N   1 
ATOM   3471 C  CA  . TRP C  1 81  ? -31.426 -53.708 19.957  1.00 29.18  ? 79  TRP C CA  1 
ATOM   3472 C  C   . TRP C  1 81  ? -30.417 -52.817 20.665  1.00 25.94  ? 79  TRP C C   1 
ATOM   3473 O  O   . TRP C  1 81  ? -30.538 -51.602 20.676  1.00 23.61  ? 79  TRP C O   1 
ATOM   3474 C  CB  . TRP C  1 81  ? -31.490 -53.369 18.462  1.00 29.83  ? 79  TRP C CB  1 
ATOM   3475 C  CG  . TRP C  1 81  ? -30.149 -53.521 17.800  1.00 32.62  ? 79  TRP C CG  1 
ATOM   3476 C  CD1 . TRP C  1 81  ? -29.234 -54.526 18.015  1.00 33.69  ? 79  TRP C CD1 1 
ATOM   3477 C  CD2 . TRP C  1 81  ? -29.543 -52.622 16.859  1.00 31.74  ? 79  TRP C CD2 1 
ATOM   3478 N  NE1 . TRP C  1 81  ? -28.107 -54.304 17.258  1.00 33.52  ? 79  TRP C NE1 1 
ATOM   3479 C  CE2 . TRP C  1 81  ? -28.271 -53.150 16.537  1.00 32.09  ? 79  TRP C CE2 1 
ATOM   3480 C  CE3 . TRP C  1 81  ? -29.953 -51.431 16.252  1.00 29.63  ? 79  TRP C CE3 1 
ATOM   3481 C  CZ2 . TRP C  1 81  ? -27.413 -52.530 15.634  1.00 32.25  ? 79  TRP C CZ2 1 
ATOM   3482 C  CZ3 . TRP C  1 81  ? -29.092 -50.813 15.354  1.00 30.71  ? 79  TRP C CZ3 1 
ATOM   3483 C  CH2 . TRP C  1 81  ? -27.837 -51.365 15.054  1.00 30.67  ? 79  TRP C CH2 1 
ATOM   3484 N  N   . ILE C  1 82  ? -29.419 -53.452 21.255  1.00 26.95  ? 80  ILE C N   1 
ATOM   3485 C  CA  . ILE C  1 82  ? -28.360 -52.764 21.947  1.00 27.00  ? 80  ILE C CA  1 
ATOM   3486 C  C   . ILE C  1 82  ? -27.097 -52.817 21.109  1.00 26.30  ? 80  ILE C C   1 
ATOM   3487 O  O   . ILE C  1 82  ? -26.697 -53.880 20.653  1.00 27.53  ? 80  ILE C O   1 
ATOM   3488 C  CB  . ILE C  1 82  ? -28.066 -53.429 23.307  1.00 28.73  ? 80  ILE C CB  1 
ATOM   3489 C  CG1 . ILE C  1 82  ? -29.331 -53.438 24.165  1.00 29.61  ? 80  ILE C CG1 1 
ATOM   3490 C  CG2 . ILE C  1 82  ? -26.939 -52.687 24.017  1.00 28.57  ? 80  ILE C CG2 1 
ATOM   3491 C  CD1 . ILE C  1 82  ? -29.272 -54.386 25.343  1.00 32.88  ? 80  ILE C CD1 1 
ATOM   3492 N  N   . ARG C  1 83  ? -26.458 -51.672 20.925  1.00 24.82  ? 81  ARG C N   1 
ATOM   3493 C  CA  . ARG C  1 83  ? -25.147 -51.653 20.305  1.00 25.67  ? 81  ARG C CA  1 
ATOM   3494 C  C   . ARG C  1 83  ? -24.309 -50.495 20.826  1.00 23.91  ? 81  ARG C C   1 
ATOM   3495 O  O   . ARG C  1 83  ? -24.773 -49.701 21.644  1.00 23.15  ? 81  ARG C O   1 
ATOM   3496 C  CB  . ARG C  1 83  ? -25.270 -51.597 18.779  1.00 26.33  ? 81  ARG C CB  1 
ATOM   3497 C  CG  . ARG C  1 83  ? -25.800 -50.285 18.234  1.00 26.40  ? 81  ARG C CG  1 
ATOM   3498 C  CD  . ARG C  1 83  ? -27.273 -50.113 18.550  1.00 27.02  ? 81  ARG C CD  1 
ATOM   3499 N  NE  . ARG C  1 83  ? -27.890 -49.084 17.722  1.00 27.81  ? 81  ARG C NE  1 
ATOM   3500 C  CZ  . ARG C  1 83  ? -29.125 -48.626 17.898  1.00 29.03  ? 81  ARG C CZ  1 
ATOM   3501 N  NH1 . ARG C  1 83  ? -29.888 -49.126 18.866  1.00 29.34  ? 81  ARG C NH1 1 
ATOM   3502 N  NH2 . ARG C  1 83  ? -29.603 -47.675 17.102  1.00 27.18  ? 81  ARG C NH2 1 
ATOM   3503 N  N   . THR C  1 84  ? -23.066 -50.424 20.366  1.00 22.46  ? 82  THR C N   1 
ATOM   3504 C  CA  . THR C  1 84  ? -22.101 -49.497 20.922  1.00 21.71  ? 82  THR C CA  1 
ATOM   3505 C  C   . THR C  1 84  ? -21.666 -48.528 19.835  1.00 20.41  ? 82  THR C C   1 
ATOM   3506 O  O   . THR C  1 84  ? -21.308 -48.951 18.739  1.00 21.84  ? 82  THR C O   1 
ATOM   3507 C  CB  . THR C  1 84  ? -20.886 -50.264 21.481  1.00 23.42  ? 82  THR C CB  1 
ATOM   3508 O  OG1 . THR C  1 84  ? -21.315 -51.122 22.548  1.00 23.84  ? 82  THR C OG1 1 
ATOM   3509 C  CG2 . THR C  1 84  ? -19.829 -49.312 22.013  1.00 22.95  ? 82  THR C CG2 1 
ATOM   3510 N  N   . PHE C  1 85  ? -21.770 -47.232 20.108  1.00 19.14  ? 83  PHE C N   1 
ATOM   3511 C  CA  . PHE C  1 85  ? -21.204 -46.217 19.219  1.00 18.73  ? 83  PHE C CA  1 
ATOM   3512 C  C   . PHE C  1 85  ? -19.881 -45.715 19.775  1.00 19.16  ? 83  PHE C C   1 
ATOM   3513 O  O   . PHE C  1 85  ? -19.838 -45.127 20.863  1.00 19.60  ? 83  PHE C O   1 
ATOM   3514 C  CB  . PHE C  1 85  ? -22.150 -45.023 19.060  1.00 17.35  ? 83  PHE C CB  1 
ATOM   3515 C  CG  . PHE C  1 85  ? -23.336 -45.293 18.196  1.00 16.73  ? 83  PHE C CG  1 
ATOM   3516 C  CD1 . PHE C  1 85  ? -24.237 -44.279 17.912  1.00 15.55  ? 83  PHE C CD1 1 
ATOM   3517 C  CD2 . PHE C  1 85  ? -23.553 -46.554 17.669  1.00 17.94  ? 83  PHE C CD2 1 
ATOM   3518 C  CE1 . PHE C  1 85  ? -25.353 -44.519 17.133  1.00 15.89  ? 83  PHE C CE1 1 
ATOM   3519 C  CE2 . PHE C  1 85  ? -24.658 -46.800 16.882  1.00 18.01  ? 83  PHE C CE2 1 
ATOM   3520 C  CZ  . PHE C  1 85  ? -25.564 -45.783 16.620  1.00 16.90  ? 83  PHE C CZ  1 
ATOM   3521 N  N   . VAL C  1 86  ? -18.812 -45.956 19.027  1.00 19.21  ? 84  VAL C N   1 
ATOM   3522 C  CA  . VAL C  1 86  ? -17.474 -45.545 19.424  1.00 20.16  ? 84  VAL C CA  1 
ATOM   3523 C  C   . VAL C  1 86  ? -17.114 -44.215 18.750  1.00 19.52  ? 84  VAL C C   1 
ATOM   3524 O  O   . VAL C  1 86  ? -17.310 -44.047 17.550  1.00 19.08  ? 84  VAL C O   1 
ATOM   3525 C  CB  . VAL C  1 86  ? -16.430 -46.602 19.019  1.00 21.42  ? 84  VAL C CB  1 
ATOM   3526 C  CG1 . VAL C  1 86  ? -15.024 -46.153 19.407  1.00 22.42  ? 84  VAL C CG1 1 
ATOM   3527 C  CG2 . VAL C  1 86  ? -16.751 -47.942 19.655  1.00 22.20  ? 84  VAL C CG2 1 
ATOM   3528 N  N   . PRO C  1 87  ? -16.573 -43.266 19.520  1.00 19.71  ? 85  PRO C N   1 
ATOM   3529 C  CA  . PRO C  1 87  ? -16.260 -41.956 18.941  1.00 19.82  ? 85  PRO C CA  1 
ATOM   3530 C  C   . PRO C  1 87  ? -15.349 -42.092 17.734  1.00 19.73  ? 85  PRO C C   1 
ATOM   3531 O  O   . PRO C  1 87  ? -14.387 -42.842 17.778  1.00 21.72  ? 85  PRO C O   1 
ATOM   3532 C  CB  . PRO C  1 87  ? -15.539 -41.223 20.082  1.00 20.36  ? 85  PRO C CB  1 
ATOM   3533 C  CG  . PRO C  1 87  ? -16.000 -41.910 21.330  1.00 20.42  ? 85  PRO C CG  1 
ATOM   3534 C  CD  . PRO C  1 87  ? -16.230 -43.344 20.946  1.00 20.53  ? 85  PRO C CD  1 
ATOM   3535 N  N   . GLY C  1 88  ? -15.659 -41.374 16.663  1.00 18.87  ? 86  GLY C N   1 
ATOM   3536 C  CA  . GLY C  1 88  ? -14.825 -41.381 15.470  1.00 19.02  ? 86  GLY C CA  1 
ATOM   3537 C  C   . GLY C  1 88  ? -13.895 -40.186 15.427  1.00 19.41  ? 86  GLY C C   1 
ATOM   3538 O  O   . GLY C  1 88  ? -13.453 -39.695 16.466  1.00 20.95  ? 86  GLY C O   1 
ATOM   3539 N  N   . SER C  1 89  ? -13.596 -39.714 14.223  1.00 19.42  ? 87  SER C N   1 
ATOM   3540 C  CA  . SER C  1 89  ? -12.481 -38.794 14.009  1.00 20.59  ? 87  SER C CA  1 
ATOM   3541 C  C   . SER C  1 89  ? -12.764 -37.394 14.572  1.00 21.04  ? 87  SER C C   1 
ATOM   3542 O  O   . SER C  1 89  ? -11.848 -36.649 14.912  1.00 21.05  ? 87  SER C O   1 
ATOM   3543 C  CB  . SER C  1 89  ? -12.167 -38.718 12.511  1.00 19.78  ? 87  SER C CB  1 
ATOM   3544 O  OG  . SER C  1 89  ? -11.737 -39.974 12.033  1.00 18.90  ? 87  SER C OG  1 
ATOM   3545 N  N   . GLN C  1 90  ? -14.044 -37.068 14.689  1.00 22.37  ? 88  GLN C N   1 
ATOM   3546 C  CA  . GLN C  1 90  ? -14.503 -35.729 15.039  1.00 22.47  ? 88  GLN C CA  1 
ATOM   3547 C  C   . GLN C  1 90  ? -15.661 -35.876 16.006  1.00 20.68  ? 88  GLN C C   1 
ATOM   3548 O  O   . GLN C  1 90  ? -16.494 -36.769 15.835  1.00 19.64  ? 88  GLN C O   1 
ATOM   3549 C  CB  . GLN C  1 90  ? -15.003 -35.023 13.782  1.00 24.85  ? 88  GLN C CB  1 
ATOM   3550 C  CG  . GLN C  1 90  ? -13.916 -34.673 12.776  1.00 29.54  ? 88  GLN C CG  1 
ATOM   3551 C  CD  . GLN C  1 90  ? -14.357 -33.583 11.819  1.00 35.96  ? 88  GLN C CD  1 
ATOM   3552 O  OE1 . GLN C  1 90  ? -14.437 -33.789 10.605  1.00 43.99  ? 88  GLN C OE1 1 
ATOM   3553 N  NE2 . GLN C  1 90  ? -14.684 -32.420 12.368  1.00 42.18  ? 88  GLN C NE2 1 
ATOM   3554 N  N   . PRO C  1 91  ? -15.749 -34.980 17.003  1.00 19.56  ? 89  PRO C N   1 
ATOM   3555 C  CA  . PRO C  1 91  ? -16.887 -35.049 17.900  1.00 18.11  ? 89  PRO C CA  1 
ATOM   3556 C  C   . PRO C  1 91  ? -18.213 -35.003 17.146  1.00 17.15  ? 89  PRO C C   1 
ATOM   3557 O  O   . PRO C  1 91  ? -18.398 -34.181 16.242  1.00 17.44  ? 89  PRO C O   1 
ATOM   3558 C  CB  . PRO C  1 91  ? -16.701 -33.821 18.809  1.00 18.40  ? 89  PRO C CB  1 
ATOM   3559 C  CG  . PRO C  1 91  ? -15.251 -33.507 18.747  1.00 18.98  ? 89  PRO C CG  1 
ATOM   3560 C  CD  . PRO C  1 91  ? -14.865 -33.843 17.326  1.00 20.46  ? 89  PRO C CD  1 
ATOM   3561 N  N   . GLY C  1 92  ? -19.105 -35.930 17.480  1.00 17.24  ? 90  GLY C N   1 
ATOM   3562 C  CA  . GLY C  1 92  ? -20.391 -36.063 16.788  1.00 16.77  ? 90  GLY C CA  1 
ATOM   3563 C  C   . GLY C  1 92  ? -20.390 -37.122 15.705  1.00 16.89  ? 90  GLY C C   1 
ATOM   3564 O  O   . GLY C  1 92  ? -21.426 -37.422 15.116  1.00 16.51  ? 90  GLY C O   1 
ATOM   3565 N  N   . GLU C  1 93  ? -19.228 -37.709 15.452  1.00 17.82  ? 91  GLU C N   1 
ATOM   3566 C  CA  . GLU C  1 93  ? -19.144 -38.859 14.567  1.00 17.73  ? 91  GLU C CA  1 
ATOM   3567 C  C   . GLU C  1 93  ? -18.857 -40.111 15.370  1.00 17.53  ? 91  GLU C C   1 
ATOM   3568 O  O   . GLU C  1 93  ? -18.108 -40.077 16.342  1.00 19.13  ? 91  GLU C O   1 
ATOM   3569 C  CB  . GLU C  1 93  ? -18.036 -38.665 13.540  1.00 19.21  ? 91  GLU C CB  1 
ATOM   3570 C  CG  . GLU C  1 93  ? -18.290 -37.537 12.571  1.00 20.27  ? 91  GLU C CG  1 
ATOM   3571 C  CD  . GLU C  1 93  ? -17.340 -37.569 11.399  1.00 20.88  ? 91  GLU C CD  1 
ATOM   3572 O  OE1 . GLU C  1 93  ? -17.791 -37.250 10.286  1.00 21.49  ? 91  GLU C OE1 1 
ATOM   3573 O  OE2 . GLU C  1 93  ? -16.161 -37.933 11.585  1.00 22.30  ? 91  GLU C OE2 1 
ATOM   3574 N  N   . PHE C  1 94  ? -19.410 -41.226 14.923  1.00 16.79  ? 92  PHE C N   1 
ATOM   3575 C  CA  . PHE C  1 94  ? -19.190 -42.492 15.586  1.00 18.14  ? 92  PHE C CA  1 
ATOM   3576 C  C   . PHE C  1 94  ? -19.048 -43.618 14.579  1.00 19.03  ? 92  PHE C C   1 
ATOM   3577 O  O   . PHE C  1 94  ? -19.546 -43.529 13.457  1.00 19.75  ? 92  PHE C O   1 
ATOM   3578 C  CB  . PHE C  1 94  ? -20.337 -42.774 16.550  1.00 18.02  ? 92  PHE C CB  1 
ATOM   3579 C  CG  . PHE C  1 94  ? -20.614 -41.642 17.484  1.00 17.76  ? 92  PHE C CG  1 
ATOM   3580 C  CD1 . PHE C  1 94  ? -21.425 -40.587 17.089  1.00 18.22  ? 92  PHE C CD1 1 
ATOM   3581 C  CD2 . PHE C  1 94  ? -20.017 -41.593 18.731  1.00 18.52  ? 92  PHE C CD2 1 
ATOM   3582 C  CE1 . PHE C  1 94  ? -21.646 -39.510 17.928  1.00 17.25  ? 92  PHE C CE1 1 
ATOM   3583 C  CE2 . PHE C  1 94  ? -20.251 -40.529 19.584  1.00 18.05  ? 92  PHE C CE2 1 
ATOM   3584 C  CZ  . PHE C  1 94  ? -21.063 -39.486 19.183  1.00 17.17  ? 92  PHE C CZ  1 
ATOM   3585 N  N   . THR C  1 95  ? -18.357 -44.673 14.986  1.00 20.10  ? 93  THR C N   1 
ATOM   3586 C  CA  . THR C  1 95  ? -18.458 -45.947 14.309  1.00 21.59  ? 93  THR C CA  1 
ATOM   3587 C  C   . THR C  1 95  ? -19.068 -47.003 15.235  1.00 21.54  ? 93  THR C C   1 
ATOM   3588 O  O   . THR C  1 95  ? -19.194 -46.801 16.447  1.00 20.99  ? 93  THR C O   1 
ATOM   3589 C  CB  . THR C  1 95  ? -17.074 -46.426 13.842  1.00 24.06  ? 93  THR C CB  1 
ATOM   3590 O  OG1 . THR C  1 95  ? -16.190 -46.467 14.958  1.00 24.46  ? 93  THR C OG1 1 
ATOM   3591 C  CG2 . THR C  1 95  ? -16.486 -45.475 12.797  1.00 24.75  ? 93  THR C CG2 1 
ATOM   3592 N  N   . LEU C  1 96  ? -19.485 -48.116 14.647  1.00 21.28  ? 94  LEU C N   1 
ATOM   3593 C  CA  . LEU C  1 96  ? -20.086 -49.191 15.406  1.00 21.68  ? 94  LEU C CA  1 
ATOM   3594 C  C   . LEU C  1 96  ? -18.982 -49.985 16.069  1.00 22.94  ? 94  LEU C C   1 
ATOM   3595 O  O   . LEU C  1 96  ? -17.997 -50.328 15.428  1.00 24.87  ? 94  LEU C O   1 
ATOM   3596 C  CB  . LEU C  1 96  ? -20.893 -50.093 14.474  1.00 21.93  ? 94  LEU C CB  1 
ATOM   3597 C  CG  . LEU C  1 96  ? -21.918 -51.032 15.106  1.00 22.10  ? 94  LEU C CG  1 
ATOM   3598 C  CD1 . LEU C  1 96  ? -22.987 -50.244 15.839  1.00 20.57  ? 94  LEU C CD1 1 
ATOM   3599 C  CD2 . LEU C  1 96  ? -22.535 -51.883 14.011  1.00 22.48  ? 94  LEU C CD2 1 
ATOM   3600 N  N   . GLY C  1 97  ? -19.135 -50.267 17.358  1.00 23.26  ? 95  GLY C N   1 
ATOM   3601 C  CA  . GLY C  1 97  ? -18.206 -51.155 18.050  1.00 24.97  ? 95  GLY C CA  1 
ATOM   3602 C  C   . GLY C  1 97  ? -18.456 -52.621 17.687  1.00 26.72  ? 95  GLY C C   1 
ATOM   3603 O  O   . GLY C  1 97  ? -19.560 -52.985 17.308  1.00 26.87  ? 95  GLY C O   1 
ATOM   3604 N  N   . ASN C  1 98  ? -17.426 -53.453 17.801  1.00 28.74  ? 96  ASN C N   1 
ATOM   3605 C  CA  A ASN C  1 98  ? -17.544 -54.886 17.562  0.50 31.46  ? 96  ASN C CA  1 
ATOM   3606 C  CA  B ASN C  1 98  ? -17.541 -54.894 17.552  0.50 31.43  ? 96  ASN C CA  1 
ATOM   3607 C  C   . ASN C  1 98  ? -18.102 -55.242 16.174  1.00 32.07  ? 96  ASN C C   1 
ATOM   3608 O  O   . ASN C  1 98  ? -18.922 -56.163 16.032  1.00 32.85  ? 96  ASN C O   1 
ATOM   3609 C  CB  A ASN C  1 98  ? -18.411 -55.521 18.654  0.50 32.22  ? 96  ASN C CB  1 
ATOM   3610 C  CB  B ASN C  1 98  ? -18.390 -55.581 18.633  0.50 32.25  ? 96  ASN C CB  1 
ATOM   3611 C  CG  A ASN C  1 98  ? -17.921 -55.200 20.061  0.50 32.41  ? 96  ASN C CG  1 
ATOM   3612 C  CG  B ASN C  1 98  ? -18.141 -57.076 18.696  0.50 34.42  ? 96  ASN C CG  1 
ATOM   3613 O  OD1 A ASN C  1 98  ? -16.827 -55.604 20.460  0.50 33.51  ? 96  ASN C OD1 1 
ATOM   3614 O  OD1 B ASN C  1 98  ? -17.214 -57.584 18.069  0.50 35.92  ? 96  ASN C OD1 1 
ATOM   3615 N  ND2 A ASN C  1 98  ? -18.735 -54.471 20.822  0.50 31.30  ? 96  ASN C ND2 1 
ATOM   3616 N  ND2 B ASN C  1 98  ? -18.970 -57.786 19.448  0.50 35.25  ? 96  ASN C ND2 1 
ATOM   3617 N  N   . ILE C  1 99  ? -17.652 -54.524 15.152  1.00 32.82  ? 97  ILE C N   1 
ATOM   3618 C  CA  . ILE C  1 99  ? -18.194 -54.692 13.808  1.00 34.58  ? 97  ILE C CA  1 
ATOM   3619 C  C   . ILE C  1 99  ? -18.111 -56.129 13.313  1.00 36.93  ? 97  ILE C C   1 
ATOM   3620 O  O   . ILE C  1 99  ? -18.943 -56.562 12.525  1.00 35.98  ? 97  ILE C O   1 
ATOM   3621 C  CB  . ILE C  1 99  ? -17.503 -53.771 12.781  1.00 35.37  ? 97  ILE C CB  1 
ATOM   3622 C  CG1 . ILE C  1 99  ? -18.357 -52.532 12.564  1.00 35.21  ? 97  ILE C CG1 1 
ATOM   3623 C  CG2 . ILE C  1 99  ? -17.321 -54.490 11.454  1.00 38.36  ? 97  ILE C CG2 1 
ATOM   3624 C  CD1 . ILE C  1 99  ? -17.812 -51.582 11.521  1.00 36.36  ? 97  ILE C CD1 1 
ATOM   3625 N  N   . LYS C  1 100 ? -17.100 -56.861 13.758  1.00 41.19  ? 98  LYS C N   1 
ATOM   3626 C  CA  . LYS C  1 100 ? -16.888 -58.229 13.282  1.00 45.66  ? 98  LYS C CA  1 
ATOM   3627 C  C   . LYS C  1 100 ? -18.029 -59.175 13.685  1.00 44.14  ? 98  LYS C C   1 
ATOM   3628 O  O   . LYS C  1 100 ? -18.204 -60.242 13.095  1.00 46.37  ? 98  LYS C O   1 
ATOM   3629 C  CB  . LYS C  1 100 ? -15.550 -58.778 13.795  1.00 52.77  ? 98  LYS C CB  1 
ATOM   3630 C  CG  . LYS C  1 100 ? -14.502 -58.962 12.713  1.00 59.89  ? 98  LYS C CG  1 
ATOM   3631 C  CD  . LYS C  1 100 ? -13.323 -59.777 13.227  1.00 69.62  ? 98  LYS C CD  1 
ATOM   3632 C  CE  . LYS C  1 100 ? -13.755 -61.056 13.935  1.00 74.50  ? 98  LYS C CE  1 
ATOM   3633 N  NZ  . LYS C  1 100 ? -12.728 -62.132 13.839  1.00 79.17  ? 98  LYS C NZ  1 
ATOM   3634 N  N   . SER C  1 101 ? -18.790 -58.792 14.701  1.00 41.37  ? 99  SER C N   1 
ATOM   3635 C  CA  . SER C  1 101 ? -19.843 -59.653 15.223  1.00 42.02  ? 99  SER C CA  1 
ATOM   3636 C  C   . SER C  1 101 ? -21.152 -59.501 14.439  1.00 40.54  ? 99  SER C C   1 
ATOM   3637 O  O   . SER C  1 101 ? -22.135 -60.192 14.710  1.00 40.03  ? 99  SER C O   1 
ATOM   3638 C  CB  . SER C  1 101 ? -20.084 -59.347 16.701  1.00 41.72  ? 99  SER C CB  1 
ATOM   3639 O  OG  . SER C  1 101 ? -20.852 -58.173 16.848  1.00 39.48  ? 99  SER C OG  1 
ATOM   3640 N  N   . TYR C  1 102 ? -21.164 -58.596 13.467  1.00 38.60  ? 100 TYR C N   1 
ATOM   3641 C  CA  . TYR C  1 102 ? -22.284 -58.495 12.538  1.00 37.37  ? 100 TYR C CA  1 
ATOM   3642 C  C   . TYR C  1 102 ? -21.921 -59.026 11.151  1.00 38.23  ? 100 TYR C C   1 
ATOM   3643 O  O   . TYR C  1 102 ? -21.131 -58.410 10.434  1.00 38.47  ? 100 TYR C O   1 
ATOM   3644 C  CB  . TYR C  1 102 ? -22.734 -57.052 12.432  1.00 34.70  ? 100 TYR C CB  1 
ATOM   3645 C  CG  . TYR C  1 102 ? -22.994 -56.389 13.766  1.00 34.32  ? 100 TYR C CG  1 
ATOM   3646 C  CD1 . TYR C  1 102 ? -22.020 -55.608 14.373  1.00 33.39  ? 100 TYR C CD1 1 
ATOM   3647 C  CD2 . TYR C  1 102 ? -24.210 -56.528 14.412  1.00 34.72  ? 100 TYR C CD2 1 
ATOM   3648 C  CE1 . TYR C  1 102 ? -22.249 -54.978 15.582  1.00 32.67  ? 100 TYR C CE1 1 
ATOM   3649 C  CE2 . TYR C  1 102 ? -24.450 -55.900 15.628  1.00 34.48  ? 100 TYR C CE2 1 
ATOM   3650 C  CZ  . TYR C  1 102 ? -23.463 -55.120 16.208  1.00 33.49  ? 100 TYR C CZ  1 
ATOM   3651 O  OH  . TYR C  1 102 ? -23.671 -54.478 17.415  1.00 31.46  ? 100 TYR C OH  1 
ATOM   3652 N  N   . PRO C  1 103 ? -22.489 -60.185 10.770  1.00 39.35  ? 101 PRO C N   1 
ATOM   3653 C  CA  . PRO C  1 103 ? -22.037 -60.841 9.538   1.00 40.29  ? 101 PRO C CA  1 
ATOM   3654 C  C   . PRO C  1 103 ? -22.325 -59.998 8.291   1.00 38.45  ? 101 PRO C C   1 
ATOM   3655 O  O   . PRO C  1 103 ? -23.388 -59.395 8.186   1.00 36.60  ? 101 PRO C O   1 
ATOM   3656 C  CB  . PRO C  1 103 ? -22.835 -62.158 9.517   1.00 42.52  ? 101 PRO C CB  1 
ATOM   3657 C  CG  . PRO C  1 103 ? -23.323 -62.357 10.917  1.00 42.90  ? 101 PRO C CG  1 
ATOM   3658 C  CD  . PRO C  1 103 ? -23.515 -60.972 11.474  1.00 40.17  ? 101 PRO C CD  1 
ATOM   3659 N  N   . GLY C  1 104 ? -21.352 -59.916 7.387   1.00 38.14  ? 102 GLY C N   1 
ATOM   3660 C  CA  . GLY C  1 104 ? -21.498 -59.139 6.159   1.00 36.40  ? 102 GLY C CA  1 
ATOM   3661 C  C   . GLY C  1 104 ? -21.193 -57.651 6.294   1.00 33.83  ? 102 GLY C C   1 
ATOM   3662 O  O   . GLY C  1 104 ? -21.094 -56.945 5.295   1.00 32.91  ? 102 GLY C O   1 
ATOM   3663 N  N   . LEU C  1 105 ? -21.049 -57.165 7.523   1.00 32.17  ? 103 LEU C N   1 
ATOM   3664 C  CA  . LEU C  1 105 ? -20.915 -55.726 7.759   1.00 30.27  ? 103 LEU C CA  1 
ATOM   3665 C  C   . LEU C  1 105 ? -19.441 -55.300 7.671   1.00 30.39  ? 103 LEU C C   1 
ATOM   3666 O  O   . LEU C  1 105 ? -18.603 -55.833 8.380   1.00 31.73  ? 103 LEU C O   1 
ATOM   3667 C  CB  . LEU C  1 105 ? -21.504 -55.363 9.124   1.00 28.67  ? 103 LEU C CB  1 
ATOM   3668 C  CG  . LEU C  1 105 ? -21.516 -53.878 9.476   1.00 26.58  ? 103 LEU C CG  1 
ATOM   3669 C  CD1 . LEU C  1 105 ? -22.353 -53.108 8.474   1.00 25.90  ? 103 LEU C CD1 1 
ATOM   3670 C  CD2 . LEU C  1 105 ? -22.053 -53.663 10.883  1.00 25.65  ? 103 LEU C CD2 1 
ATOM   3671 N  N   . THR C  1 106 ? -19.134 -54.336 6.801   1.00 29.89  ? 104 THR C N   1 
ATOM   3672 C  CA  . THR C  1 106 ? -17.750 -53.897 6.616   1.00 29.20  ? 104 THR C CA  1 
ATOM   3673 C  C   . THR C  1 106 ? -17.503 -52.466 7.059   1.00 28.50  ? 104 THR C C   1 
ATOM   3674 O  O   . THR C  1 106 ? -16.378 -52.132 7.404   1.00 30.70  ? 104 THR C O   1 
ATOM   3675 C  CB  . THR C  1 106 ? -17.266 -54.045 5.164   1.00 29.42  ? 104 THR C CB  1 
ATOM   3676 O  OG1 . THR C  1 106 ? -18.134 -53.327 4.284   1.00 28.07  ? 104 THR C OG1 1 
ATOM   3677 C  CG2 . THR C  1 106 ? -17.224 -55.520 4.760   1.00 31.56  ? 104 THR C CG2 1 
ATOM   3678 N  N   . SER C  1 107 ? -18.525 -51.611 7.041   1.00 26.18  ? 105 SER C N   1 
ATOM   3679 C  CA  . SER C  1 107 ? -18.367 -50.285 7.603   1.00 25.02  ? 105 SER C CA  1 
ATOM   3680 C  C   . SER C  1 107 ? -19.677 -49.707 8.116   1.00 24.28  ? 105 SER C C   1 
ATOM   3681 O  O   . SER C  1 107 ? -20.764 -50.063 7.647   1.00 23.47  ? 105 SER C O   1 
ATOM   3682 C  CB  . SER C  1 107 ? -17.718 -49.315 6.610   1.00 24.41  ? 105 SER C CB  1 
ATOM   3683 O  OG  . SER C  1 107 ? -18.578 -49.020 5.535   1.00 25.25  ? 105 SER C OG  1 
ATOM   3684 N  N   . TYR C  1 108 ? -19.556 -48.795 9.073   1.00 22.33  ? 106 TYR C N   1 
ATOM   3685 C  CA  . TYR C  1 108 ? -20.716 -48.219 9.703   1.00 22.34  ? 106 TYR C CA  1 
ATOM   3686 C  C   . TYR C  1 108 ? -20.368 -46.875 10.308  1.00 21.31  ? 106 TYR C C   1 
ATOM   3687 O  O   . TYR C  1 108 ? -19.612 -46.814 11.269  1.00 23.03  ? 106 TYR C O   1 
ATOM   3688 C  CB  . TYR C  1 108 ? -21.216 -49.156 10.792  1.00 22.93  ? 106 TYR C CB  1 
ATOM   3689 C  CG  . TYR C  1 108 ? -22.620 -48.855 11.236  1.00 22.13  ? 106 TYR C CG  1 
ATOM   3690 C  CD1 . TYR C  1 108 ? -22.874 -47.859 12.159  1.00 21.03  ? 106 TYR C CD1 1 
ATOM   3691 C  CD2 . TYR C  1 108 ? -23.696 -49.580 10.733  1.00 23.02  ? 106 TYR C CD2 1 
ATOM   3692 C  CE1 . TYR C  1 108 ? -24.165 -47.593 12.578  1.00 20.45  ? 106 TYR C CE1 1 
ATOM   3693 C  CE2 . TYR C  1 108 ? -24.988 -49.312 11.128  1.00 22.69  ? 106 TYR C CE2 1 
ATOM   3694 C  CZ  . TYR C  1 108 ? -25.218 -48.318 12.057  1.00 21.69  ? 106 TYR C CZ  1 
ATOM   3695 O  OH  . TYR C  1 108 ? -26.512 -48.047 12.437  1.00 22.01  ? 106 TYR C OH  1 
ATOM   3696 N  N   . LEU C  1 109 ? -20.948 -45.812 9.761   1.00 20.23  ? 107 LEU C N   1 
ATOM   3697 C  CA  . LEU C  1 109 ? -20.620 -44.461 10.168  1.00 19.77  ? 107 LEU C CA  1 
ATOM   3698 C  C   . LEU C  1 109 ? -21.875 -43.737 10.653  1.00 19.36  ? 107 LEU C C   1 
ATOM   3699 O  O   . LEU C  1 109 ? -22.930 -43.777 10.011  1.00 19.24  ? 107 LEU C O   1 
ATOM   3700 C  CB  . LEU C  1 109 ? -20.004 -43.683 9.001   1.00 20.49  ? 107 LEU C CB  1 
ATOM   3701 C  CG  . LEU C  1 109 ? -19.678 -42.225 9.308   1.00 21.36  ? 107 LEU C CG  1 
ATOM   3702 C  CD1 . LEU C  1 109 ? -18.485 -42.139 10.253  1.00 21.18  ? 107 LEU C CD1 1 
ATOM   3703 C  CD2 . LEU C  1 109 ? -19.414 -41.432 8.029   1.00 22.92  ? 107 LEU C CD2 1 
ATOM   3704 N  N   . VAL C  1 110 ? -21.736 -43.055 11.780  1.00 17.68  ? 108 VAL C N   1 
ATOM   3705 C  CA  . VAL C  1 110 ? -22.793 -42.218 12.313  1.00 16.58  ? 108 VAL C CA  1 
ATOM   3706 C  C   . VAL C  1 110 ? -22.289 -40.780 12.333  1.00 16.48  ? 108 VAL C C   1 
ATOM   3707 O  O   . VAL C  1 110 ? -21.177 -40.528 12.780  1.00 15.83  ? 108 VAL C O   1 
ATOM   3708 C  CB  . VAL C  1 110 ? -23.144 -42.639 13.757  1.00 16.91  ? 108 VAL C CB  1 
ATOM   3709 C  CG1 . VAL C  1 110 ? -24.260 -41.769 14.306  1.00 16.60  ? 108 VAL C CG1 1 
ATOM   3710 C  CG2 . VAL C  1 110 ? -23.528 -44.111 13.810  1.00 17.04  ? 108 VAL C CG2 1 
ATOM   3711 N  N   . ARG C  1 111 ? -23.098 -39.843 11.846  1.00 16.04  ? 109 ARG C N   1 
ATOM   3712 C  CA  . ARG C  1 111 ? -22.760 -38.439 11.957  1.00 16.89  ? 109 ARG C CA  1 
ATOM   3713 C  C   . ARG C  1 111 ? -23.962 -37.631 12.416  1.00 15.32  ? 109 ARG C C   1 
ATOM   3714 O  O   . ARG C  1 111 ? -24.974 -37.561 11.727  1.00 13.64  ? 109 ARG C O   1 
ATOM   3715 C  CB  . ARG C  1 111 ? -22.244 -37.880 10.627  1.00 18.34  ? 109 ARG C CB  1 
ATOM   3716 C  CG  . ARG C  1 111 ? -21.991 -36.385 10.679  1.00 19.63  ? 109 ARG C CG  1 
ATOM   3717 C  CD  . ARG C  1 111 ? -21.474 -35.827 9.365   1.00 21.70  ? 109 ARG C CD  1 
ATOM   3718 N  NE  . ARG C  1 111 ? -20.055 -36.080 9.188   1.00 23.26  ? 109 ARG C NE  1 
ATOM   3719 C  CZ  . ARG C  1 111 ? -19.359 -35.677 8.137   1.00 26.82  ? 109 ARG C CZ  1 
ATOM   3720 N  NH1 . ARG C  1 111 ? -18.068 -35.948 8.050   1.00 26.31  ? 109 ARG C NH1 1 
ATOM   3721 N  NH2 . ARG C  1 111 ? -19.965 -35.046 7.140   1.00 30.64  ? 109 ARG C NH2 1 
ATOM   3722 N  N   . VAL C  1 112 ? -23.824 -36.978 13.560  1.00 14.74  ? 110 VAL C N   1 
ATOM   3723 C  CA  . VAL C  1 112 ? -24.856 -36.069 14.017  1.00 14.86  ? 110 VAL C CA  1 
ATOM   3724 C  C   . VAL C  1 112 ? -24.808 -34.780 13.202  1.00 15.13  ? 110 VAL C C   1 
ATOM   3725 O  O   . VAL C  1 112 ? -23.828 -34.042 13.246  1.00 14.09  ? 110 VAL C O   1 
ATOM   3726 C  CB  . VAL C  1 112 ? -24.689 -35.746 15.506  1.00 15.41  ? 110 VAL C CB  1 
ATOM   3727 C  CG1 . VAL C  1 112 ? -25.773 -34.781 15.949  1.00 16.08  ? 110 VAL C CG1 1 
ATOM   3728 C  CG2 . VAL C  1 112 ? -24.722 -37.020 16.334  1.00 15.08  ? 110 VAL C CG2 1 
ATOM   3729 N  N   . VAL C  1 113 ? -25.884 -34.521 12.462  1.00 16.30  ? 111 VAL C N   1 
ATOM   3730 C  CA  . VAL C  1 113 ? -25.938 -33.415 11.516  1.00 17.64  ? 111 VAL C CA  1 
ATOM   3731 C  C   . VAL C  1 113 ? -26.297 -32.104 12.201  1.00 18.81  ? 111 VAL C C   1 
ATOM   3732 O  O   . VAL C  1 113 ? -25.643 -31.087 11.991  1.00 19.53  ? 111 VAL C O   1 
ATOM   3733 C  CB  . VAL C  1 113 ? -26.998 -33.676 10.433  1.00 18.83  ? 111 VAL C CB  1 
ATOM   3734 C  CG1 . VAL C  1 113 ? -27.148 -32.464 9.532   1.00 19.76  ? 111 VAL C CG1 1 
ATOM   3735 C  CG2 . VAL C  1 113 ? -26.622 -34.910 9.630   1.00 18.22  ? 111 VAL C CG2 1 
ATOM   3736 N  N   . SER C  1 114 ? -27.341 -32.120 13.014  1.00 18.86  ? 112 SER C N   1 
ATOM   3737 C  CA  . SER C  1 114 ? -27.659 -30.949 13.816  1.00 20.39  ? 112 SER C CA  1 
ATOM   3738 C  C   . SER C  1 114 ? -28.586 -31.331 14.948  1.00 19.20  ? 112 SER C C   1 
ATOM   3739 O  O   . SER C  1 114 ? -29.356 -32.291 14.852  1.00 20.68  ? 112 SER C O   1 
ATOM   3740 C  CB  . SER C  1 114 ? -28.333 -29.878 12.971  1.00 21.77  ? 112 SER C CB  1 
ATOM   3741 O  OG  . SER C  1 114 ? -29.646 -30.286 12.678  1.00 26.69  ? 112 SER C OG  1 
ATOM   3742 N  N   . THR C  1 115 ? -28.505 -30.576 16.029  1.00 17.78  ? 113 THR C N   1 
ATOM   3743 C  CA  . THR C  1 115 ? -29.384 -30.803 17.159  1.00 16.96  ? 113 THR C CA  1 
ATOM   3744 C  C   . THR C  1 115 ? -29.381 -29.570 18.038  1.00 17.41  ? 113 THR C C   1 
ATOM   3745 O  O   . THR C  1 115 ? -28.427 -28.786 18.009  1.00 16.84  ? 113 THR C O   1 
ATOM   3746 C  CB  . THR C  1 115 ? -28.930 -32.028 17.969  1.00 16.05  ? 113 THR C CB  1 
ATOM   3747 O  OG1 . THR C  1 115 ? -29.856 -32.271 19.030  1.00 15.91  ? 113 THR C OG1 1 
ATOM   3748 C  CG2 . THR C  1 115 ? -27.525 -31.815 18.537  1.00 15.78  ? 113 THR C CG2 1 
ATOM   3749 N  N   . ASN C  1 116 ? -30.459 -29.392 18.796  1.00 17.30  ? 114 ASN C N   1 
ATOM   3750 C  CA  . ASN C  1 116 ? -30.459 -28.450 19.887  1.00 18.49  ? 114 ASN C CA  1 
ATOM   3751 C  C   . ASN C  1 116 ? -30.560 -29.164 21.238  1.00 16.91  ? 114 ASN C C   1 
ATOM   3752 O  O   . ASN C  1 116 ? -30.786 -28.529 22.272  1.00 16.71  ? 114 ASN C O   1 
ATOM   3753 C  CB  . ASN C  1 116 ? -31.587 -27.426 19.711  1.00 20.51  ? 114 ASN C CB  1 
ATOM   3754 C  CG  . ASN C  1 116 ? -32.971 -27.993 20.018  1.00 22.02  ? 114 ASN C CG  1 
ATOM   3755 O  OD1 . ASN C  1 116 ? -33.156 -29.198 20.182  1.00 21.97  ? 114 ASN C OD1 1 
ATOM   3756 N  ND2 . ASN C  1 116 ? -33.959 -27.110 20.072  1.00 25.32  ? 114 ASN C ND2 1 
ATOM   3757 N  N   . TYR C  1 117 ? -30.423 -30.483 21.205  1.00 15.49  ? 115 TYR C N   1 
ATOM   3758 C  CA  . TYR C  1 117 ? -30.242 -31.294 22.410  1.00 15.91  ? 115 TYR C CA  1 
ATOM   3759 C  C   . TYR C  1 117 ? -31.530 -31.523 23.229  1.00 16.41  ? 115 TYR C C   1 
ATOM   3760 O  O   . TYR C  1 117 ? -31.757 -32.627 23.724  1.00 15.53  ? 115 TYR C O   1 
ATOM   3761 C  CB  . TYR C  1 117 ? -29.105 -30.717 23.284  1.00 16.35  ? 115 TYR C CB  1 
ATOM   3762 C  CG  . TYR C  1 117 ? -27.768 -30.647 22.570  1.00 15.95  ? 115 TYR C CG  1 
ATOM   3763 C  CD1 . TYR C  1 117 ? -27.019 -31.788 22.354  1.00 16.14  ? 115 TYR C CD1 1 
ATOM   3764 C  CD2 . TYR C  1 117 ? -27.274 -29.443 22.083  1.00 17.41  ? 115 TYR C CD2 1 
ATOM   3765 C  CE1 . TYR C  1 117 ? -25.809 -31.740 21.687  1.00 16.05  ? 115 TYR C CE1 1 
ATOM   3766 C  CE2 . TYR C  1 117 ? -26.066 -29.374 21.403  1.00 16.48  ? 115 TYR C CE2 1 
ATOM   3767 C  CZ  . TYR C  1 117 ? -25.336 -30.522 21.200  1.00 16.78  ? 115 TYR C CZ  1 
ATOM   3768 O  OH  . TYR C  1 117 ? -24.124 -30.461 20.542  1.00 16.06  ? 115 TYR C OH  1 
ATOM   3769 N  N   . ASN C  1 118 ? -32.371 -30.500 23.376  1.00 18.76  ? 116 ASN C N   1 
ATOM   3770 C  CA  . ASN C  1 118 ? -33.564 -30.617 24.214  1.00 21.74  ? 116 ASN C CA  1 
ATOM   3771 C  C   . ASN C  1 118 ? -34.853 -30.874 23.485  1.00 20.09  ? 116 ASN C C   1 
ATOM   3772 O  O   . ASN C  1 118 ? -35.895 -30.924 24.112  1.00 21.59  ? 116 ASN C O   1 
ATOM   3773 C  CB  . ASN C  1 118 ? -33.837 -29.332 24.997  1.00 26.22  ? 116 ASN C CB  1 
ATOM   3774 C  CG  . ASN C  1 118 ? -32.671 -28.879 25.832  1.00 31.40  ? 116 ASN C CG  1 
ATOM   3775 O  OD1 . ASN C  1 118 ? -32.434 -27.677 25.983  1.00 37.14  ? 116 ASN C OD1 1 
ATOM   3776 N  ND2 . ASN C  1 118 ? -31.978 -29.827 26.436  1.00 31.64  ? 116 ASN C ND2 1 
ATOM   3777 N  N   . GLN C  1 119 ? -34.810 -30.903 22.170  1.00 21.16  ? 117 GLN C N   1 
ATOM   3778 C  CA  . GLN C  1 119 ? -36.032 -31.016 21.376  1.00 22.68  ? 117 GLN C CA  1 
ATOM   3779 C  C   . GLN C  1 119 ? -35.828 -31.937 20.187  1.00 20.70  ? 117 GLN C C   1 
ATOM   3780 O  O   . GLN C  1 119 ? -36.556 -32.909 20.038  1.00 19.25  ? 117 GLN C O   1 
ATOM   3781 C  CB  . GLN C  1 119 ? -36.513 -29.660 20.897  1.00 25.55  ? 117 GLN C CB  1 
ATOM   3782 C  CG  . GLN C  1 119 ? -37.114 -28.795 21.989  1.00 31.53  ? 117 GLN C CG  1 
ATOM   3783 C  CD  . GLN C  1 119 ? -37.494 -27.409 21.479  1.00 37.12  ? 117 GLN C CD  1 
ATOM   3784 O  OE1 . GLN C  1 119 ? -36.848 -26.860 20.580  1.00 34.21  ? 117 GLN C OE1 1 
ATOM   3785 N  NE2 . GLN C  1 119 ? -38.570 -26.857 22.026  1.00 40.46  ? 117 GLN C NE2 1 
ATOM   3786 N  N   . HIS C  1 120 ? -34.875 -31.599 19.322  1.00 20.25  ? 118 HIS C N   1 
ATOM   3787 C  CA  . HIS C  1 120 ? -34.768 -32.272 18.037  1.00 21.70  ? 118 HIS C CA  1 
ATOM   3788 C  C   . HIS C  1 120 ? -33.321 -32.591 17.660  1.00 18.15  ? 118 HIS C C   1 
ATOM   3789 O  O   . HIS C  1 120 ? -32.376 -31.983 18.157  1.00 17.56  ? 118 HIS C O   1 
ATOM   3790 C  CB  . HIS C  1 120 ? -35.427 -31.451 16.924  1.00 24.68  ? 118 HIS C CB  1 
ATOM   3791 C  CG  . HIS C  1 120 ? -34.861 -30.076 16.771  1.00 31.68  ? 118 HIS C CG  1 
ATOM   3792 N  ND1 . HIS C  1 120 ? -33.695 -29.824 16.075  1.00 31.91  ? 118 HIS C ND1 1 
ATOM   3793 C  CD2 . HIS C  1 120 ? -35.290 -28.876 17.236  1.00 35.28  ? 118 HIS C CD2 1 
ATOM   3794 C  CE1 . HIS C  1 120 ? -33.437 -28.528 16.109  1.00 35.44  ? 118 HIS C CE1 1 
ATOM   3795 N  NE2 . HIS C  1 120 ? -34.387 -27.932 16.811  1.00 40.01  ? 118 HIS C NE2 1 
ATOM   3796 N  N   . ALA C  1 121 ? -33.170 -33.566 16.778  1.00 16.30  ? 119 ALA C N   1 
ATOM   3797 C  CA  . ALA C  1 121 ? -31.879 -33.880 16.186  1.00 15.02  ? 119 ALA C CA  1 
ATOM   3798 C  C   . ALA C  1 121 ? -32.075 -34.530 14.818  1.00 15.22  ? 119 ALA C C   1 
ATOM   3799 O  O   . ALA C  1 121 ? -33.086 -35.201 14.580  1.00 14.64  ? 119 ALA C O   1 
ATOM   3800 C  CB  . ALA C  1 121 ? -31.092 -34.805 17.102  1.00 13.87  ? 119 ALA C CB  1 
ATOM   3801 N  N   . MET C  1 122 ? -31.106 -34.322 13.927  1.00 15.60  ? 120 MET C N   1 
ATOM   3802 C  CA  . MET C  1 122 ? -31.000 -35.123 12.724  1.00 17.42  ? 120 MET C CA  1 
ATOM   3803 C  C   . MET C  1 122 ? -29.668 -35.841 12.728  1.00 17.33  ? 120 MET C C   1 
ATOM   3804 O  O   . MET C  1 122 ? -28.625 -35.230 12.977  1.00 17.03  ? 120 MET C O   1 
ATOM   3805 C  CB  . MET C  1 122 ? -31.084 -34.260 11.475  1.00 19.35  ? 120 MET C CB  1 
ATOM   3806 C  CG  . MET C  1 122 ? -32.443 -33.629 11.239  1.00 23.35  ? 120 MET C CG  1 
ATOM   3807 S  SD  . MET C  1 122 ? -32.645 -33.012 9.561   1.00 27.06  ? 120 MET C SD  1 
ATOM   3808 C  CE  . MET C  1 122 ? -31.318 -31.816 9.448   1.00 29.71  ? 120 MET C CE  1 
ATOM   3809 N  N   . VAL C  1 123 ? -29.708 -37.137 12.424  1.00 16.41  ? 121 VAL C N   1 
ATOM   3810 C  CA  . VAL C  1 123 ? -28.515 -37.953 12.414  1.00 15.44  ? 121 VAL C CA  1 
ATOM   3811 C  C   . VAL C  1 123 ? -28.414 -38.725 11.112  1.00 15.91  ? 121 VAL C C   1 
ATOM   3812 O  O   . VAL C  1 123 ? -29.382 -39.332 10.653  1.00 14.99  ? 121 VAL C O   1 
ATOM   3813 C  CB  . VAL C  1 123 ? -28.509 -38.943 13.587  1.00 15.23  ? 121 VAL C CB  1 
ATOM   3814 C  CG1 . VAL C  1 123 ? -27.203 -39.704 13.628  1.00 15.50  ? 121 VAL C CG1 1 
ATOM   3815 C  CG2 . VAL C  1 123 ? -28.746 -38.215 14.900  1.00 15.25  ? 121 VAL C CG2 1 
ATOM   3816 N  N   . PHE C  1 124 ? -27.210 -38.728 10.547  1.00 16.24  ? 122 PHE C N   1 
ATOM   3817 C  CA  . PHE C  1 124 ? -26.935 -39.415 9.300   1.00 16.46  ? 122 PHE C CA  1 
ATOM   3818 C  C   . PHE C  1 124 ? -26.208 -40.719 9.608   1.00 16.17  ? 122 PHE C C   1 
ATOM   3819 O  O   . PHE C  1 124 ? -25.271 -40.738 10.402  1.00 15.11  ? 122 PHE C O   1 
ATOM   3820 C  CB  . PHE C  1 124 ? -26.075 -38.519 8.405   1.00 16.80  ? 122 PHE C CB  1 
ATOM   3821 C  CG  . PHE C  1 124 ? -25.593 -39.185 7.155   1.00 17.36  ? 122 PHE C CG  1 
ATOM   3822 C  CD1 . PHE C  1 124 ? -24.356 -39.809 7.113   1.00 17.00  ? 122 PHE C CD1 1 
ATOM   3823 C  CD2 . PHE C  1 124 ? -26.362 -39.147 6.006   1.00 18.05  ? 122 PHE C CD2 1 
ATOM   3824 C  CE1 . PHE C  1 124 ? -23.905 -40.411 5.956   1.00 17.51  ? 122 PHE C CE1 1 
ATOM   3825 C  CE2 . PHE C  1 124 ? -25.908 -39.725 4.846   1.00 18.50  ? 122 PHE C CE2 1 
ATOM   3826 C  CZ  . PHE C  1 124 ? -24.677 -40.356 4.815   1.00 17.96  ? 122 PHE C CZ  1 
ATOM   3827 N  N   . PHE C  1 125 ? -26.648 -41.799 8.964   1.00 16.97  ? 123 PHE C N   1 
ATOM   3828 C  CA  . PHE C  1 125 ? -26.021 -43.106 9.104   1.00 18.06  ? 123 PHE C CA  1 
ATOM   3829 C  C   . PHE C  1 125 ? -25.639 -43.622 7.738   1.00 19.44  ? 123 PHE C C   1 
ATOM   3830 O  O   . PHE C  1 125 ? -26.417 -43.514 6.794   1.00 20.09  ? 123 PHE C O   1 
ATOM   3831 C  CB  . PHE C  1 125 ? -26.992 -44.115 9.727   1.00 19.80  ? 123 PHE C CB  1 
ATOM   3832 C  CG  . PHE C  1 125 ? -27.495 -43.720 11.083  1.00 19.25  ? 123 PHE C CG  1 
ATOM   3833 C  CD1 . PHE C  1 125 ? -27.003 -44.329 12.224  1.00 20.30  ? 123 PHE C CD1 1 
ATOM   3834 C  CD2 . PHE C  1 125 ? -28.479 -42.766 11.208  1.00 19.24  ? 123 PHE C CD2 1 
ATOM   3835 C  CE1 . PHE C  1 125 ? -27.474 -43.971 13.481  1.00 21.61  ? 123 PHE C CE1 1 
ATOM   3836 C  CE2 . PHE C  1 125 ? -28.954 -42.403 12.450  1.00 20.24  ? 123 PHE C CE2 1 
ATOM   3837 C  CZ  . PHE C  1 125 ? -28.446 -42.996 13.591  1.00 20.23  ? 123 PHE C CZ  1 
ATOM   3838 N  N   . LYS C  1 126 ? -24.466 -44.233 7.645   1.00 20.54  ? 124 LYS C N   1 
ATOM   3839 C  CA  . LYS C  1 126 ? -24.053 -44.877 6.421   1.00 22.37  ? 124 LYS C CA  1 
ATOM   3840 C  C   . LYS C  1 126 ? -23.389 -46.204 6.748   1.00 21.87  ? 124 LYS C C   1 
ATOM   3841 O  O   . LYS C  1 126 ? -22.553 -46.296 7.633   1.00 22.13  ? 124 LYS C O   1 
ATOM   3842 C  CB  . LYS C  1 126 ? -23.087 -43.975 5.654   1.00 24.76  ? 124 LYS C CB  1 
ATOM   3843 C  CG  . LYS C  1 126 ? -22.518 -44.623 4.411   1.00 29.78  ? 124 LYS C CG  1 
ATOM   3844 C  CD  . LYS C  1 126 ? -21.825 -43.610 3.502   1.00 34.73  ? 124 LYS C CD  1 
ATOM   3845 C  CE  . LYS C  1 126 ? -20.343 -43.466 3.827   1.00 37.06  ? 124 LYS C CE  1 
ATOM   3846 N  NZ  . LYS C  1 126 ? -19.585 -44.721 3.544   1.00 40.57  ? 124 LYS C NZ  1 
ATOM   3847 N  N   . LYS C  1 127 ? -23.779 -47.246 6.040   1.00 22.85  ? 125 LYS C N   1 
ATOM   3848 C  CA  . LYS C  1 127 ? -23.260 -48.565 6.322   1.00 24.13  ? 125 LYS C CA  1 
ATOM   3849 C  C   . LYS C  1 127 ? -23.043 -49.312 5.015   1.00 24.72  ? 125 LYS C C   1 
ATOM   3850 O  O   . LYS C  1 127 ? -23.747 -49.084 4.033   1.00 25.02  ? 125 LYS C O   1 
ATOM   3851 C  CB  . LYS C  1 127 ? -24.196 -49.312 7.276   1.00 24.96  ? 125 LYS C CB  1 
ATOM   3852 C  CG  . LYS C  1 127 ? -25.063 -50.403 6.679   1.00 28.37  ? 125 LYS C CG  1 
ATOM   3853 C  CD  . LYS C  1 127 ? -25.767 -51.158 7.800   1.00 30.97  ? 125 LYS C CD  1 
ATOM   3854 C  CE  . LYS C  1 127 ? -26.348 -52.486 7.344   1.00 36.14  ? 125 LYS C CE  1 
ATOM   3855 N  NZ  . LYS C  1 127 ? -26.811 -53.314 8.496   1.00 38.76  ? 125 LYS C NZ  1 
ATOM   3856 N  N   . VAL C  1 128 ? -22.019 -50.153 4.993   1.00 24.75  ? 126 VAL C N   1 
ATOM   3857 C  CA  . VAL C  1 128 ? -21.773 -51.017 3.857   1.00 25.34  ? 126 VAL C CA  1 
ATOM   3858 C  C   . VAL C  1 128 ? -21.906 -52.465 4.307   1.00 26.28  ? 126 VAL C C   1 
ATOM   3859 O  O   . VAL C  1 128 ? -21.230 -52.899 5.233   1.00 25.74  ? 126 VAL C O   1 
ATOM   3860 C  CB  . VAL C  1 128 ? -20.370 -50.779 3.265   1.00 25.19  ? 126 VAL C CB  1 
ATOM   3861 C  CG1 . VAL C  1 128 ? -20.125 -51.720 2.103   1.00 26.56  ? 126 VAL C CG1 1 
ATOM   3862 C  CG2 . VAL C  1 128 ? -20.210 -49.328 2.815   1.00 23.88  ? 126 VAL C CG2 1 
ATOM   3863 N  N   . SER C  1 129 ? -22.785 -53.202 3.638   1.00 27.61  ? 127 SER C N   1 
ATOM   3864 C  CA  . SER C  1 129 ? -23.082 -54.572 4.012   1.00 29.85  ? 127 SER C CA  1 
ATOM   3865 C  C   . SER C  1 129 ? -23.286 -55.395 2.758   1.00 30.66  ? 127 SER C C   1 
ATOM   3866 O  O   . SER C  1 129 ? -24.052 -55.002 1.879   1.00 29.82  ? 127 SER C O   1 
ATOM   3867 C  CB  . SER C  1 129 ? -24.349 -54.624 4.874   1.00 30.72  ? 127 SER C CB  1 
ATOM   3868 O  OG  . SER C  1 129 ? -24.749 -55.974 5.068   1.00 32.78  ? 127 SER C OG  1 
ATOM   3869 N  N   . GLN C  1 130 ? -22.580 -56.517 2.663   1.00 32.74  ? 128 GLN C N   1 
ATOM   3870 C  CA  . GLN C  1 130 ? -22.496 -57.262 1.418   1.00 35.38  ? 128 GLN C CA  1 
ATOM   3871 C  C   . GLN C  1 130 ? -22.129 -56.334 0.262   1.00 33.13  ? 128 GLN C C   1 
ATOM   3872 O  O   . GLN C  1 130 ? -22.670 -56.451 -0.833  1.00 34.66  ? 128 GLN C O   1 
ATOM   3873 C  CB  . GLN C  1 130 ? -23.833 -57.943 1.113   1.00 39.18  ? 128 GLN C CB  1 
ATOM   3874 C  CG  . GLN C  1 130 ? -23.975 -59.337 1.704   1.00 44.76  ? 128 GLN C CG  1 
ATOM   3875 C  CD  . GLN C  1 130 ? -24.710 -59.348 3.030   1.00 49.09  ? 128 GLN C CD  1 
ATOM   3876 O  OE1 . GLN C  1 130 ? -25.244 -58.323 3.479   1.00 55.41  ? 128 GLN C OE1 1 
ATOM   3877 N  NE2 . GLN C  1 130 ? -24.731 -60.508 3.677   1.00 56.84  ? 128 GLN C NE2 1 
ATOM   3878 N  N   . ASN C  1 131 ? -21.227 -55.402 0.519   1.00 30.28  ? 129 ASN C N   1 
ATOM   3879 C  CA  . ASN C  1 131 ? -20.748 -54.490 -0.505  1.00 29.83  ? 129 ASN C CA  1 
ATOM   3880 C  C   . ASN C  1 131 ? -21.765 -53.440 -0.953  1.00 28.92  ? 129 ASN C C   1 
ATOM   3881 O  O   . ASN C  1 131 ? -21.466 -52.615 -1.818  1.00 28.49  ? 129 ASN C O   1 
ATOM   3882 C  CB  . ASN C  1 131 ? -20.251 -55.266 -1.726  1.00 31.52  ? 129 ASN C CB  1 
ATOM   3883 C  CG  . ASN C  1 131 ? -19.176 -56.269 -1.378  1.00 32.53  ? 129 ASN C CG  1 
ATOM   3884 O  OD1 . ASN C  1 131 ? -19.323 -57.466 -1.627  1.00 34.17  ? 129 ASN C OD1 1 
ATOM   3885 N  ND2 . ASN C  1 131 ? -18.089 -55.785 -0.790  1.00 31.49  ? 129 ASN C ND2 1 
ATOM   3886 N  N   . ARG C  1 132 ? -22.966 -53.481 -0.387  1.00 28.77  ? 130 ARG C N   1 
ATOM   3887 C  CA  . ARG C  1 132 ? -24.004 -52.521 -0.748  1.00 27.77  ? 130 ARG C CA  1 
ATOM   3888 C  C   . ARG C  1 132 ? -24.016 -51.373 0.241   1.00 25.90  ? 130 ARG C C   1 
ATOM   3889 O  O   . ARG C  1 132 ? -23.915 -51.582 1.447   1.00 25.15  ? 130 ARG C O   1 
ATOM   3890 C  CB  . ARG C  1 132 ? -25.382 -53.187 -0.772  1.00 28.76  ? 130 ARG C CB  1 
ATOM   3891 C  CG  . ARG C  1 132 ? -25.525 -54.319 -1.773  1.00 31.09  ? 130 ARG C CG  1 
ATOM   3892 C  CD  . ARG C  1 132 ? -26.723 -55.201 -1.441  1.00 32.55  ? 130 ARG C CD  1 
ATOM   3893 N  NE  . ARG C  1 132 ? -27.991 -54.486 -1.543  1.00 32.30  ? 130 ARG C NE  1 
ATOM   3894 C  CZ  . ARG C  1 132 ? -28.562 -54.156 -2.698  1.00 33.48  ? 130 ARG C CZ  1 
ATOM   3895 N  NH1 . ARG C  1 132 ? -27.986 -54.485 -3.852  1.00 34.62  ? 130 ARG C NH1 1 
ATOM   3896 N  NH2 . ARG C  1 132 ? -29.710 -53.496 -2.698  1.00 33.50  ? 130 ARG C NH2 1 
ATOM   3897 N  N   . GLU C  1 133 ? -24.127 -50.158 -0.283  1.00 25.30  ? 131 GLU C N   1 
ATOM   3898 C  CA  . GLU C  1 133 ? -23.978 -48.967 0.519   1.00 24.16  ? 131 GLU C CA  1 
ATOM   3899 C  C   . GLU C  1 133 ? -25.354 -48.386 0.864   1.00 23.42  ? 131 GLU C C   1 
ATOM   3900 O  O   . GLU C  1 133 ? -26.045 -47.842 0.007   1.00 23.58  ? 131 GLU C O   1 
ATOM   3901 C  CB  . GLU C  1 133 ? -23.123 -47.941 -0.223  1.00 24.83  ? 131 GLU C CB  1 
ATOM   3902 C  CG  . GLU C  1 133 ? -22.659 -46.778 0.642   1.00 24.97  ? 131 GLU C CG  1 
ATOM   3903 C  CD  . GLU C  1 133 ? -21.523 -45.981 0.023   1.00 26.43  ? 131 GLU C CD  1 
ATOM   3904 O  OE1 . GLU C  1 133 ? -20.837 -45.258 0.771   1.00 29.70  ? 131 GLU C OE1 1 
ATOM   3905 O  OE2 . GLU C  1 133 ? -21.307 -46.066 -1.204  1.00 28.60  ? 131 GLU C OE2 1 
ATOM   3906 N  N   . TYR C  1 134 ? -25.740 -48.513 2.128   1.00 22.55  ? 132 TYR C N   1 
ATOM   3907 C  CA  . TYR C  1 134 ? -27.011 -47.990 2.606   1.00 22.19  ? 132 TYR C CA  1 
ATOM   3908 C  C   . TYR C  1 134 ? -26.794 -46.695 3.374   1.00 20.40  ? 132 TYR C C   1 
ATOM   3909 O  O   . TYR C  1 134 ? -25.782 -46.529 4.054   1.00 19.78  ? 132 TYR C O   1 
ATOM   3910 C  CB  . TYR C  1 134 ? -27.680 -48.997 3.531   1.00 22.95  ? 132 TYR C CB  1 
ATOM   3911 C  CG  . TYR C  1 134 ? -27.966 -50.329 2.887   1.00 24.71  ? 132 TYR C CG  1 
ATOM   3912 C  CD1 . TYR C  1 134 ? -27.101 -51.396 3.054   1.00 25.73  ? 132 TYR C CD1 1 
ATOM   3913 C  CD2 . TYR C  1 134 ? -29.101 -50.521 2.115   1.00 26.31  ? 132 TYR C CD2 1 
ATOM   3914 C  CE1 . TYR C  1 134 ? -27.361 -52.629 2.474   1.00 27.73  ? 132 TYR C CE1 1 
ATOM   3915 C  CE2 . TYR C  1 134 ? -29.368 -51.745 1.522   1.00 28.63  ? 132 TYR C CE2 1 
ATOM   3916 C  CZ  . TYR C  1 134 ? -28.490 -52.801 1.703   1.00 29.27  ? 132 TYR C CZ  1 
ATOM   3917 O  OH  . TYR C  1 134 ? -28.743 -54.032 1.125   1.00 30.36  ? 132 TYR C OH  1 
ATOM   3918 N  N   . PHE C  1 135 ? -27.738 -45.770 3.260   1.00 19.59  ? 133 PHE C N   1 
ATOM   3919 C  CA  . PHE C  1 135 ? -27.733 -44.602 4.129   1.00 18.13  ? 133 PHE C CA  1 
ATOM   3920 C  C   . PHE C  1 135 ? -29.134 -44.217 4.553   1.00 17.85  ? 133 PHE C C   1 
ATOM   3921 O  O   . PHE C  1 135 ? -30.111 -44.466 3.848   1.00 17.94  ? 133 PHE C O   1 
ATOM   3922 C  CB  . PHE C  1 135 ? -27.025 -43.404 3.467   1.00 17.65  ? 133 PHE C CB  1 
ATOM   3923 C  CG  . PHE C  1 135 ? -27.819 -42.744 2.373   1.00 18.08  ? 133 PHE C CG  1 
ATOM   3924 C  CD1 . PHE C  1 135 ? -27.846 -43.292 1.102   1.00 19.03  ? 133 PHE C CD1 1 
ATOM   3925 C  CD2 . PHE C  1 135 ? -28.490 -41.548 2.598   1.00 17.64  ? 133 PHE C CD2 1 
ATOM   3926 C  CE1 . PHE C  1 135 ? -28.532 -42.667 0.078   1.00 20.15  ? 133 PHE C CE1 1 
ATOM   3927 C  CE2 . PHE C  1 135 ? -29.184 -40.922 1.573   1.00 18.90  ? 133 PHE C CE2 1 
ATOM   3928 C  CZ  . PHE C  1 135 ? -29.201 -41.477 0.313   1.00 19.87  ? 133 PHE C CZ  1 
ATOM   3929 N  N   . LYS C  1 136 ? -29.215 -43.608 5.724   1.00 17.31  ? 134 LYS C N   1 
ATOM   3930 C  CA  . LYS C  1 136 ? -30.468 -43.089 6.204   1.00 18.02  ? 134 LYS C CA  1 
ATOM   3931 C  C   . LYS C  1 136 ? -30.238 -41.853 7.027   1.00 17.49  ? 134 LYS C C   1 
ATOM   3932 O  O   . LYS C  1 136 ? -29.143 -41.638 7.558   1.00 16.23  ? 134 LYS C O   1 
ATOM   3933 C  CB  . LYS C  1 136 ? -31.193 -44.145 7.029   1.00 19.03  ? 134 LYS C CB  1 
ATOM   3934 C  CG  . LYS C  1 136 ? -30.549 -44.433 8.371   1.00 19.02  ? 134 LYS C CG  1 
ATOM   3935 C  CD  . LYS C  1 136 ? -31.450 -45.275 9.264   1.00 19.88  ? 134 LYS C CD  1 
ATOM   3936 C  CE  . LYS C  1 136 ? -30.823 -45.444 10.641  1.00 19.60  ? 134 LYS C CE  1 
ATOM   3937 N  NZ  . LYS C  1 136 ? -31.397 -46.567 11.416  1.00 21.29  ? 134 LYS C NZ  1 
ATOM   3938 N  N   . ILE C  1 137 ? -31.275 -41.028 7.107   1.00 18.91  ? 135 ILE C N   1 
ATOM   3939 C  CA  . ILE C  1 137 ? -31.300 -39.898 8.008   1.00 19.31  ? 135 ILE C CA  1 
ATOM   3940 C  C   . ILE C  1 137 ? -32.448 -40.080 8.970   1.00 19.72  ? 135 ILE C C   1 
ATOM   3941 O  O   . ILE C  1 137 ? -33.561 -40.417 8.567   1.00 19.99  ? 135 ILE C O   1 
ATOM   3942 C  CB  . ILE C  1 137 ? -31.505 -38.580 7.256   1.00 20.89  ? 135 ILE C CB  1 
ATOM   3943 C  CG1 . ILE C  1 137 ? -30.553 -38.501 6.079   1.00 22.63  ? 135 ILE C CG1 1 
ATOM   3944 C  CG2 . ILE C  1 137 ? -31.268 -37.395 8.180   1.00 20.78  ? 135 ILE C CG2 1 
ATOM   3945 C  CD1 . ILE C  1 137 ? -31.190 -38.938 4.782   1.00 27.33  ? 135 ILE C CD1 1 
ATOM   3946 N  N   . THR C  1 138 ? -32.161 -39.878 10.249  1.00 19.94  ? 136 THR C N   1 
ATOM   3947 C  CA  . THR C  1 138 ? -33.153 -40.019 11.283  1.00 21.74  ? 136 THR C CA  1 
ATOM   3948 C  C   . THR C  1 138 ? -33.486 -38.645 11.840  1.00 21.05  ? 136 THR C C   1 
ATOM   3949 O  O   . THR C  1 138 ? -32.595 -37.847 12.121  1.00 19.76  ? 136 THR C O   1 
ATOM   3950 C  CB  . THR C  1 138 ? -32.644 -40.938 12.414  1.00 24.68  ? 136 THR C CB  1 
ATOM   3951 O  OG1 . THR C  1 138 ? -32.501 -42.274 11.916  1.00 25.26  ? 136 THR C OG1 1 
ATOM   3952 C  CG2 . THR C  1 138 ? -33.634 -40.978 13.547  1.00 28.58  ? 136 THR C CG2 1 
ATOM   3953 N  N   . LEU C  1 139 ? -34.778 -38.373 11.989  1.00 21.10  ? 137 LEU C N   1 
ATOM   3954 C  CA  . LEU C  1 139 ? -35.239 -37.200 12.709  1.00 20.10  ? 137 LEU C CA  1 
ATOM   3955 C  C   . LEU C  1 139 ? -35.683 -37.595 14.104  1.00 19.12  ? 137 LEU C C   1 
ATOM   3956 O  O   . LEU C  1 139 ? -36.663 -38.320 14.271  1.00 19.72  ? 137 LEU C O   1 
ATOM   3957 C  CB  . LEU C  1 139 ? -36.395 -36.530 11.960  1.00 21.18  ? 137 LEU C CB  1 
ATOM   3958 C  CG  . LEU C  1 139 ? -36.996 -35.283 12.632  1.00 21.94  ? 137 LEU C CG  1 
ATOM   3959 C  CD1 . LEU C  1 139 ? -35.979 -34.151 12.709  1.00 21.33  ? 137 LEU C CD1 1 
ATOM   3960 C  CD2 . LEU C  1 139 ? -38.256 -34.821 11.910  1.00 22.63  ? 137 LEU C CD2 1 
ATOM   3961 N  N   . TYR C  1 140 ? -34.945 -37.110 15.102  1.00 19.27  ? 138 TYR C N   1 
ATOM   3962 C  CA  . TYR C  1 140 ? -35.191 -37.427 16.514  1.00 17.49  ? 138 TYR C CA  1 
ATOM   3963 C  C   . TYR C  1 140 ? -36.022 -36.331 17.170  1.00 17.53  ? 138 TYR C C   1 
ATOM   3964 O  O   . TYR C  1 140 ? -35.741 -35.148 16.995  1.00 16.85  ? 138 TYR C O   1 
ATOM   3965 C  CB  . TYR C  1 140 ? -33.868 -37.509 17.264  1.00 16.75  ? 138 TYR C CB  1 
ATOM   3966 C  CG  . TYR C  1 140 ? -33.050 -38.753 17.037  1.00 17.78  ? 138 TYR C CG  1 
ATOM   3967 C  CD1 . TYR C  1 140 ? -33.627 -39.939 16.598  1.00 19.22  ? 138 TYR C CD1 1 
ATOM   3968 C  CD2 . TYR C  1 140 ? -31.701 -38.756 17.311  1.00 17.37  ? 138 TYR C CD2 1 
ATOM   3969 C  CE1 . TYR C  1 140 ? -32.867 -41.084 16.422  1.00 18.61  ? 138 TYR C CE1 1 
ATOM   3970 C  CE2 . TYR C  1 140 ? -30.939 -39.889 17.135  1.00 18.07  ? 138 TYR C CE2 1 
ATOM   3971 C  CZ  . TYR C  1 140 ? -31.519 -41.052 16.683  1.00 18.59  ? 138 TYR C CZ  1 
ATOM   3972 O  OH  . TYR C  1 140 ? -30.737 -42.189 16.525  1.00 17.78  ? 138 TYR C OH  1 
ATOM   3973 N  N   . GLY C  1 141 ? -37.004 -36.724 17.978  1.00 17.97  ? 139 GLY C N   1 
ATOM   3974 C  CA  . GLY C  1 141 ? -37.643 -35.794 18.918  1.00 17.80  ? 139 GLY C CA  1 
ATOM   3975 C  C   . GLY C  1 141 ? -37.526 -36.264 20.354  1.00 17.30  ? 139 GLY C C   1 
ATOM   3976 O  O   . GLY C  1 141 ? -37.509 -37.470 20.625  1.00 17.16  ? 139 GLY C O   1 
ATOM   3977 N  N   . ARG C  1 142 ? -37.437 -35.320 21.282  1.00 16.91  ? 140 ARG C N   1 
ATOM   3978 C  CA  . ARG C  1 142 ? -37.495 -35.667 22.701  1.00 17.57  ? 140 ARG C CA  1 
ATOM   3979 C  C   . ARG C  1 142 ? -38.915 -36.086 23.086  1.00 18.59  ? 140 ARG C C   1 
ATOM   3980 O  O   . ARG C  1 142 ? -39.102 -36.845 24.036  1.00 19.83  ? 140 ARG C O   1 
ATOM   3981 C  CB  . ARG C  1 142 ? -37.030 -34.498 23.581  1.00 17.21  ? 140 ARG C CB  1 
ATOM   3982 C  CG  . ARG C  1 142 ? -35.541 -34.223 23.545  1.00 16.74  ? 140 ARG C CG  1 
ATOM   3983 C  CD  . ARG C  1 142 ? -34.710 -35.420 23.990  1.00 16.71  ? 140 ARG C CD  1 
ATOM   3984 N  NE  . ARG C  1 142 ? -33.318 -35.016 24.199  1.00 15.76  ? 140 ARG C NE  1 
ATOM   3985 C  CZ  . ARG C  1 142 ? -32.353 -35.834 24.582  1.00 15.87  ? 140 ARG C CZ  1 
ATOM   3986 N  NH1 . ARG C  1 142 ? -31.127 -35.359 24.753  1.00 16.19  ? 140 ARG C NH1 1 
ATOM   3987 N  NH2 . ARG C  1 142 ? -32.601 -37.129 24.771  1.00 16.71  ? 140 ARG C NH2 1 
ATOM   3988 N  N   . THR C  1 143 ? -39.904 -35.587 22.346  1.00 19.31  ? 141 THR C N   1 
ATOM   3989 C  CA  . THR C  1 143 ? -41.260 -36.127 22.385  1.00 20.76  ? 141 THR C CA  1 
ATOM   3990 C  C   . THR C  1 143 ? -41.652 -36.742 21.037  1.00 21.95  ? 141 THR C C   1 
ATOM   3991 O  O   . THR C  1 143 ? -40.885 -36.687 20.078  1.00 21.90  ? 141 THR C O   1 
ATOM   3992 C  CB  . THR C  1 143 ? -42.299 -35.045 22.748  1.00 21.40  ? 141 THR C CB  1 
ATOM   3993 O  OG1 . THR C  1 143 ? -42.499 -34.181 21.636  1.00 21.73  ? 141 THR C OG1 1 
ATOM   3994 C  CG2 . THR C  1 143 ? -41.837 -34.224 23.935  1.00 21.97  ? 141 THR C CG2 1 
ATOM   3995 N  N   . LYS C  1 144 ? -42.849 -37.325 20.980  1.00 23.23  ? 142 LYS C N   1 
ATOM   3996 C  CA  . LYS C  1 144 ? -43.302 -38.062 19.809  1.00 24.92  ? 142 LYS C CA  1 
ATOM   3997 C  C   . LYS C  1 144 ? -43.775 -37.140 18.684  1.00 26.92  ? 142 LYS C C   1 
ATOM   3998 O  O   . LYS C  1 144 ? -44.076 -37.598 17.591  1.00 26.09  ? 142 LYS C O   1 
ATOM   3999 C  CB  . LYS C  1 144 ? -44.440 -39.011 20.187  1.00 26.26  ? 142 LYS C CB  1 
ATOM   4000 C  CG  . LYS C  1 144 ? -44.070 -40.075 21.200  1.00 26.53  ? 142 LYS C CG  1 
ATOM   4001 C  CD  . LYS C  1 144 ? -45.281 -40.944 21.535  1.00 29.35  ? 142 LYS C CD  1 
ATOM   4002 C  CE  . LYS C  1 144 ? -45.071 -41.773 22.795  1.00 28.72  ? 142 LYS C CE  1 
ATOM   4003 N  NZ  . LYS C  1 144 ? -46.291 -42.547 23.149  1.00 30.91  ? 142 LYS C NZ  1 
ATOM   4004 N  N   . GLU C  1 145 ? -43.882 -35.849 18.967  1.00 29.95  ? 143 GLU C N   1 
ATOM   4005 C  CA  . GLU C  1 145 ? -44.413 -34.900 17.997  1.00 35.04  ? 143 GLU C CA  1 
ATOM   4006 C  C   . GLU C  1 145 ? -43.358 -33.869 17.669  1.00 33.57  ? 143 GLU C C   1 
ATOM   4007 O  O   . GLU C  1 145 ? -42.559 -33.483 18.527  1.00 36.09  ? 143 GLU C O   1 
ATOM   4008 C  CB  . GLU C  1 145 ? -45.642 -34.182 18.557  1.00 41.64  ? 143 GLU C CB  1 
ATOM   4009 C  CG  . GLU C  1 145 ? -46.752 -35.109 19.036  1.00 47.69  ? 143 GLU C CG  1 
ATOM   4010 C  CD  . GLU C  1 145 ? -47.705 -35.512 17.930  1.00 53.55  ? 143 GLU C CD  1 
ATOM   4011 O  OE1 . GLU C  1 145 ? -47.489 -35.102 16.765  1.00 53.41  ? 143 GLU C OE1 1 
ATOM   4012 O  OE2 . GLU C  1 145 ? -48.673 -36.245 18.230  1.00 65.10  ? 143 GLU C OE2 1 
ATOM   4013 N  N   . LEU C  1 146 ? -43.338 -33.419 16.427  1.00 32.85  ? 144 LEU C N   1 
ATOM   4014 C  CA  . LEU C  1 146 ? -42.570 -32.230 16.110  1.00 36.05  ? 144 LEU C CA  1 
ATOM   4015 C  C   . LEU C  1 146 ? -43.364 -31.360 15.173  1.00 36.27  ? 144 LEU C C   1 
ATOM   4016 O  O   . LEU C  1 146 ? -44.317 -31.806 14.544  1.00 36.13  ? 144 LEU C O   1 
ATOM   4017 C  CB  . LEU C  1 146 ? -41.209 -32.576 15.493  1.00 37.94  ? 144 LEU C CB  1 
ATOM   4018 C  CG  . LEU C  1 146 ? -40.138 -33.260 16.355  1.00 38.71  ? 144 LEU C CG  1 
ATOM   4019 C  CD1 . LEU C  1 146 ? -38.957 -33.647 15.468  1.00 41.30  ? 144 LEU C CD1 1 
ATOM   4020 C  CD2 . LEU C  1 146 ? -39.662 -32.384 17.512  1.00 38.39  ? 144 LEU C CD2 1 
ATOM   4021 N  N   . THR C  1 147 ? -42.955 -30.105 15.089  1.00 39.30  ? 145 THR C N   1 
ATOM   4022 C  CA  . THR C  1 147 ? -43.659 -29.118 14.287  1.00 42.01  ? 145 THR C CA  1 
ATOM   4023 C  C   . THR C  1 147 ? -43.537 -29.445 12.799  1.00 40.91  ? 145 THR C C   1 
ATOM   4024 O  O   . THR C  1 147 ? -42.572 -30.080 12.368  1.00 37.08  ? 145 THR C O   1 
ATOM   4025 C  CB  . THR C  1 147 ? -43.088 -27.709 14.543  1.00 43.38  ? 145 THR C CB  1 
ATOM   4026 O  OG1 . THR C  1 147 ? -41.684 -27.687 14.238  1.00 40.20  ? 145 THR C OG1 1 
ATOM   4027 C  CG2 . THR C  1 147 ? -43.301 -27.300 16.005  1.00 42.84  ? 145 THR C CG2 1 
ATOM   4028 N  N   . SER C  1 148 ? -44.520 -28.994 12.023  1.00 44.28  ? 146 SER C N   1 
ATOM   4029 C  CA  . SER C  1 148 ? -44.431 -28.998 10.565  1.00 43.71  ? 146 SER C CA  1 
ATOM   4030 C  C   . SER C  1 148 ? -43.111 -28.423 10.095  1.00 41.89  ? 146 SER C C   1 
ATOM   4031 O  O   . SER C  1 148 ? -42.507 -28.935 9.163   1.00 40.59  ? 146 SER C O   1 
ATOM   4032 C  CB  . SER C  1 148 ? -45.566 -28.174 9.965   1.00 45.95  ? 146 SER C CB  1 
ATOM   4033 O  OG  . SER C  1 148 ? -46.813 -28.794 10.193  1.00 51.22  ? 146 SER C OG  1 
ATOM   4034 N  N   . GLU C  1 149 ? -42.679 -27.340 10.732  1.00 43.77  ? 147 GLU C N   1 
ATOM   4035 C  CA  . GLU C  1 149 ? -41.468 -26.637 10.322  1.00 46.09  ? 147 GLU C CA  1 
ATOM   4036 C  C   . GLU C  1 149 ? -40.247 -27.548 10.384  1.00 37.22  ? 147 GLU C C   1 
ATOM   4037 O  O   . GLU C  1 149 ? -39.469 -27.629 9.437   1.00 31.59  ? 147 GLU C O   1 
ATOM   4038 C  CB  . GLU C  1 149 ? -41.254 -25.419 11.216  1.00 53.07  ? 147 GLU C CB  1 
ATOM   4039 C  CG  . GLU C  1 149 ? -40.075 -24.542 10.833  1.00 62.21  ? 147 GLU C CG  1 
ATOM   4040 C  CD  . GLU C  1 149 ? -40.049 -23.243 11.618  1.00 69.30  ? 147 GLU C CD  1 
ATOM   4041 O  OE1 . GLU C  1 149 ? -41.134 -22.759 12.014  1.00 82.51  ? 147 GLU C OE1 1 
ATOM   4042 O  OE2 . GLU C  1 149 ? -38.945 -22.712 11.849  1.00 66.67  ? 147 GLU C OE2 1 
ATOM   4043 N  N   . LEU C  1 150 ? -40.096 -28.251 11.499  1.00 36.39  ? 148 LEU C N   1 
ATOM   4044 C  CA  . LEU C  1 150 ? -38.978 -29.172 11.660  1.00 34.92  ? 148 LEU C CA  1 
ATOM   4045 C  C   . LEU C  1 150 ? -39.060 -30.365 10.696  1.00 34.05  ? 148 LEU C C   1 
ATOM   4046 O  O   . LEU C  1 150 ? -38.047 -30.802 10.138  1.00 32.33  ? 148 LEU C O   1 
ATOM   4047 C  CB  . LEU C  1 150 ? -38.904 -29.659 13.094  1.00 36.10  ? 148 LEU C CB  1 
ATOM   4048 C  CG  . LEU C  1 150 ? -38.385 -28.621 14.094  1.00 38.55  ? 148 LEU C CG  1 
ATOM   4049 C  CD1 . LEU C  1 150 ? -38.490 -29.173 15.509  1.00 39.78  ? 148 LEU C CD1 1 
ATOM   4050 C  CD2 . LEU C  1 150 ? -36.956 -28.197 13.791  1.00 40.91  ? 148 LEU C CD2 1 
ATOM   4051 N  N   . LYS C  1 151 ? -40.271 -30.850 10.450  1.00 33.61  ? 149 LYS C N   1 
ATOM   4052 C  CA  . LYS C  1 151 ? -40.452 -31.959 9.537   1.00 34.27  ? 149 LYS C CA  1 
ATOM   4053 C  C   . LYS C  1 151 ? -40.205 -31.568 8.082   1.00 36.29  ? 149 LYS C C   1 
ATOM   4054 O  O   . LYS C  1 151 ? -39.624 -32.338 7.320   1.00 38.83  ? 149 LYS C O   1 
ATOM   4055 C  CB  . LYS C  1 151 ? -41.832 -32.576 9.728   1.00 36.51  ? 149 LYS C CB  1 
ATOM   4056 C  CG  . LYS C  1 151 ? -41.976 -33.241 11.097  1.00 37.60  ? 149 LYS C CG  1 
ATOM   4057 C  CD  . LYS C  1 151 ? -43.231 -34.093 11.211  1.00 38.95  ? 149 LYS C CD  1 
ATOM   4058 C  CE  . LYS C  1 151 ? -44.470 -33.229 11.395  1.00 42.52  ? 149 LYS C CE  1 
ATOM   4059 N  NZ  . LYS C  1 151 ? -45.584 -33.981 12.028  1.00 44.56  ? 149 LYS C NZ  1 
ATOM   4060 N  N   . GLU C  1 152 ? -40.607 -30.361 7.710   1.00 36.90  ? 150 GLU C N   1 
ATOM   4061 C  CA  . GLU C  1 152 ? -40.294 -29.821 6.392   1.00 38.59  ? 150 GLU C CA  1 
ATOM   4062 C  C   . GLU C  1 152 ? -38.789 -29.616 6.199   1.00 35.78  ? 150 GLU C C   1 
ATOM   4063 O  O   . GLU C  1 152 ? -38.276 -29.844 5.112   1.00 34.43  ? 150 GLU C O   1 
ATOM   4064 C  CB  . GLU C  1 152 ? -41.035 -28.494 6.179   1.00 42.65  ? 150 GLU C CB  1 
ATOM   4065 C  CG  . GLU C  1 152 ? -42.537 -28.650 5.989   1.00 48.03  ? 150 GLU C CG  1 
ATOM   4066 C  CD  . GLU C  1 152 ? -43.335 -27.401 6.335   1.00 55.75  ? 150 GLU C CD  1 
ATOM   4067 O  OE1 . GLU C  1 152 ? -42.753 -26.294 6.428   1.00 60.45  ? 150 GLU C OE1 1 
ATOM   4068 O  OE2 . GLU C  1 152 ? -44.566 -27.529 6.493   1.00 59.39  ? 150 GLU C OE2 1 
ATOM   4069 N  N   . ASN C  1 153 ? -38.085 -29.187 7.248   1.00 34.69  ? 151 ASN C N   1 
ATOM   4070 C  CA  . ASN C  1 153 ? -36.631 -29.023 7.169   1.00 35.50  ? 151 ASN C CA  1 
ATOM   4071 C  C   . ASN C  1 153 ? -35.970 -30.373 6.899   1.00 31.74  ? 151 ASN C C   1 
ATOM   4072 O  O   . ASN C  1 153 ? -34.991 -30.465 6.170   1.00 29.33  ? 151 ASN C O   1 
ATOM   4073 C  CB  . ASN C  1 153 ? -36.048 -28.470 8.485   1.00 40.02  ? 151 ASN C CB  1 
ATOM   4074 C  CG  . ASN C  1 153 ? -36.366 -26.996 8.725   1.00 49.99  ? 151 ASN C CG  1 
ATOM   4075 O  OD1 . ASN C  1 153 ? -36.027 -26.447 9.783   1.00 49.28  ? 151 ASN C OD1 1 
ATOM   4076 N  ND2 . ASN C  1 153 ? -37.035 -26.356 7.769   1.00 55.11  ? 151 ASN C ND2 1 
ATOM   4077 N  N   . PHE C  1 154 ? -36.508 -31.408 7.533   1.00 28.56  ? 152 PHE C N   1 
ATOM   4078 C  CA  . PHE C  1 154 ? -35.990 -32.758 7.403   1.00 25.48  ? 152 PHE C CA  1 
ATOM   4079 C  C   . PHE C  1 154 ? -36.236 -33.307 6.005   1.00 25.85  ? 152 PHE C C   1 
ATOM   4080 O  O   . PHE C  1 154 ? -35.368 -33.941 5.413   1.00 25.18  ? 152 PHE C O   1 
ATOM   4081 C  CB  . PHE C  1 154 ? -36.657 -33.639 8.448   1.00 23.90  ? 152 PHE C CB  1 
ATOM   4082 C  CG  . PHE C  1 154 ? -36.407 -35.096 8.266   1.00 21.56  ? 152 PHE C CG  1 
ATOM   4083 C  CD1 . PHE C  1 154 ? -37.434 -35.936 7.880   1.00 22.42  ? 152 PHE C CD1 1 
ATOM   4084 C  CD2 . PHE C  1 154 ? -35.162 -35.636 8.523   1.00 20.05  ? 152 PHE C CD2 1 
ATOM   4085 C  CE1 . PHE C  1 154 ? -37.211 -37.294 7.730   1.00 21.76  ? 152 PHE C CE1 1 
ATOM   4086 C  CE2 . PHE C  1 154 ? -34.932 -36.994 8.377   1.00 19.15  ? 152 PHE C CE2 1 
ATOM   4087 C  CZ  . PHE C  1 154 ? -35.962 -37.823 7.990   1.00 19.94  ? 152 PHE C CZ  1 
ATOM   4088 N  N   . ILE C  1 155 ? -37.403 -33.015 5.459   1.00 27.06  ? 153 ILE C N   1 
ATOM   4089 C  CA  . ILE C  1 155 ? -37.703 -33.386 4.085   1.00 28.82  ? 153 ILE C CA  1 
ATOM   4090 C  C   . ILE C  1 155 ? -36.764 -32.663 3.129   1.00 29.95  ? 153 ILE C C   1 
ATOM   4091 O  O   . ILE C  1 155 ? -36.253 -33.256 2.180   1.00 30.24  ? 153 ILE C O   1 
ATOM   4092 C  CB  . ILE C  1 155 ? -39.169 -33.059 3.744   1.00 30.15  ? 153 ILE C CB  1 
ATOM   4093 C  CG1 . ILE C  1 155 ? -40.104 -33.986 4.531   1.00 29.91  ? 153 ILE C CG1 1 
ATOM   4094 C  CG2 . ILE C  1 155 ? -39.420 -33.202 2.253   1.00 31.86  ? 153 ILE C CG2 1 
ATOM   4095 C  CD1 . ILE C  1 155 ? -41.552 -33.539 4.554   1.00 31.76  ? 153 ILE C CD1 1 
ATOM   4096 N  N   . ARG C  1 156 ? -36.556 -31.373 3.374   1.00 32.06  ? 154 ARG C N   1 
ATOM   4097 C  CA  . ARG C  1 156 ? -35.685 -30.560 2.528   1.00 34.70  ? 154 ARG C CA  1 
ATOM   4098 C  C   . ARG C  1 156 ? -34.277 -31.142 2.510   1.00 30.75  ? 154 ARG C C   1 
ATOM   4099 O  O   . ARG C  1 156 ? -33.686 -31.339 1.448   1.00 29.97  ? 154 ARG C O   1 
ATOM   4100 C  CB  . ARG C  1 156 ? -35.657 -29.111 3.035   1.00 39.40  ? 154 ARG C CB  1 
ATOM   4101 C  CG  . ARG C  1 156 ? -34.880 -28.148 2.147   1.00 43.90  ? 154 ARG C CG  1 
ATOM   4102 C  CD  . ARG C  1 156 ? -35.236 -26.697 2.395   1.00 51.81  ? 154 ARG C CD  1 
ATOM   4103 N  NE  . ARG C  1 156 ? -34.760 -26.124 3.658   1.00 54.91  ? 154 ARG C NE  1 
ATOM   4104 C  CZ  . ARG C  1 156 ? -35.535 -25.809 4.702   1.00 58.34  ? 154 ARG C CZ  1 
ATOM   4105 N  NH1 . ARG C  1 156 ? -36.843 -26.040 4.681   1.00 56.06  ? 154 ARG C NH1 1 
ATOM   4106 N  NH2 . ARG C  1 156 ? -34.988 -25.281 5.793   1.00 60.29  ? 154 ARG C NH2 1 
ATOM   4107 N  N   . PHE C  1 157 ? -33.764 -31.455 3.691   1.00 27.44  ? 155 PHE C N   1 
ATOM   4108 C  CA  . PHE C  1 157 ? -32.427 -32.007 3.818   1.00 25.86  ? 155 PHE C CA  1 
ATOM   4109 C  C   . PHE C  1 157 ? -32.325 -33.386 3.156   1.00 26.10  ? 155 PHE C C   1 
ATOM   4110 O  O   . PHE C  1 157 ? -31.365 -33.669 2.435   1.00 28.14  ? 155 PHE C O   1 
ATOM   4111 C  CB  . PHE C  1 157 ? -32.041 -32.104 5.290   1.00 23.78  ? 155 PHE C CB  1 
ATOM   4112 C  CG  . PHE C  1 157 ? -30.680 -32.695 5.522   1.00 22.34  ? 155 PHE C CG  1 
ATOM   4113 C  CD1 . PHE C  1 157 ? -29.547 -32.070 5.036   1.00 22.15  ? 155 PHE C CD1 1 
ATOM   4114 C  CD2 . PHE C  1 157 ? -30.539 -33.885 6.210   1.00 21.39  ? 155 PHE C CD2 1 
ATOM   4115 C  CE1 . PHE C  1 157 ? -28.296 -32.614 5.237   1.00 21.22  ? 155 PHE C CE1 1 
ATOM   4116 C  CE2 . PHE C  1 157 ? -29.290 -34.442 6.415   1.00 21.09  ? 155 PHE C CE2 1 
ATOM   4117 C  CZ  . PHE C  1 157 ? -28.164 -33.801 5.926   1.00 21.02  ? 155 PHE C CZ  1 
ATOM   4118 N  N   . SER C  1 158 ? -33.335 -34.222 3.362   1.00 24.84  ? 156 SER C N   1 
ATOM   4119 C  CA  . SER C  1 158 ? -33.354 -35.546 2.761   1.00 24.55  ? 156 SER C CA  1 
ATOM   4120 C  C   . SER C  1 158 ? -33.294 -35.471 1.242   1.00 26.16  ? 156 SER C C   1 
ATOM   4121 O  O   . SER C  1 158 ? -32.565 -36.234 0.607   1.00 24.81  ? 156 SER C O   1 
ATOM   4122 C  CB  . SER C  1 158 ? -34.592 -36.322 3.209   1.00 24.60  ? 156 SER C CB  1 
ATOM   4123 O  OG  . SER C  1 158 ? -34.499 -36.646 4.591   1.00 22.47  ? 156 SER C OG  1 
ATOM   4124 N  N   . LYS C  1 159 ? -34.048 -34.542 0.663   1.00 28.89  ? 157 LYS C N   1 
ATOM   4125 C  CA  . LYS C  1 159 ? -34.032 -34.348 -0.780  1.00 30.84  ? 157 LYS C CA  1 
ATOM   4126 C  C   . LYS C  1 159 ? -32.682 -33.875 -1.279  1.00 29.73  ? 157 LYS C C   1 
ATOM   4127 O  O   . LYS C  1 159 ? -32.246 -34.266 -2.352  1.00 30.49  ? 157 LYS C O   1 
ATOM   4128 C  CB  . LYS C  1 159 ? -35.098 -33.356 -1.197  1.00 35.62  ? 157 LYS C CB  1 
ATOM   4129 C  CG  . LYS C  1 159 ? -36.465 -33.996 -1.329  1.00 40.02  ? 157 LYS C CG  1 
ATOM   4130 C  CD  . LYS C  1 159 ? -37.565 -32.966 -1.526  1.00 43.48  ? 157 LYS C CD  1 
ATOM   4131 C  CE  . LYS C  1 159 ? -38.926 -33.638 -1.489  1.00 47.84  ? 157 LYS C CE  1 
ATOM   4132 N  NZ  . LYS C  1 159 ? -40.002 -32.777 -2.054  1.00 53.35  ? 157 LYS C NZ  1 
ATOM   4133 N  N   . SER C  1 160 ? -32.011 -33.041 -0.498  1.00 28.46  ? 158 SER C N   1 
ATOM   4134 C  CA  . SER C  1 160 ? -30.710 -32.519 -0.903  1.00 28.30  ? 158 SER C CA  1 
ATOM   4135 C  C   . SER C  1 160 ? -29.684 -33.654 -1.008  1.00 28.58  ? 158 SER C C   1 
ATOM   4136 O  O   . SER C  1 160 ? -28.630 -33.490 -1.629  1.00 29.29  ? 158 SER C O   1 
ATOM   4137 C  CB  . SER C  1 160 ? -30.217 -31.479 0.107   1.00 27.32  ? 158 SER C CB  1 
ATOM   4138 O  OG  . SER C  1 160 ? -29.581 -32.100 1.220   1.00 24.34  ? 158 SER C OG  1 
ATOM   4139 N  N   . LEU C  1 161 ? -29.984 -34.789 -0.370  1.00 27.52  ? 159 LEU C N   1 
ATOM   4140 C  CA  . LEU C  1 161 ? -29.101 -35.956 -0.395  1.00 25.68  ? 159 LEU C CA  1 
ATOM   4141 C  C   . LEU C  1 161 ? -29.559 -36.984 -1.427  1.00 25.21  ? 159 LEU C C   1 
ATOM   4142 O  O   . LEU C  1 161 ? -29.025 -38.092 -1.475  1.00 23.62  ? 159 LEU C O   1 
ATOM   4143 C  CB  . LEU C  1 161 ? -29.050 -36.622 0.977   1.00 24.09  ? 159 LEU C CB  1 
ATOM   4144 C  CG  . LEU C  1 161 ? -28.544 -35.773 2.132   1.00 23.35  ? 159 LEU C CG  1 
ATOM   4145 C  CD1 . LEU C  1 161 ? -28.463 -36.632 3.390   1.00 22.85  ? 159 LEU C CD1 1 
ATOM   4146 C  CD2 . LEU C  1 161 ? -27.187 -35.159 1.823   1.00 23.67  ? 159 LEU C CD2 1 
ATOM   4147 N  N   . GLY C  1 162 ? -30.543 -36.609 -2.244  1.00 25.84  ? 160 GLY C N   1 
ATOM   4148 C  CA  . GLY C  1 162 ? -30.915 -37.401 -3.412  1.00 26.92  ? 160 GLY C CA  1 
ATOM   4149 C  C   . GLY C  1 162 ? -32.166 -38.240 -3.214  1.00 27.27  ? 160 GLY C C   1 
ATOM   4150 O  O   . GLY C  1 162 ? -32.538 -39.007 -4.093  1.00 28.55  ? 160 GLY C O   1 
ATOM   4151 N  N   . LEU C  1 163 ? -32.811 -38.117 -2.054  1.00 26.58  ? 161 LEU C N   1 
ATOM   4152 C  CA  . LEU C  1 163 ? -33.965 -38.953 -1.726  1.00 27.26  ? 161 LEU C CA  1 
ATOM   4153 C  C   . LEU C  1 163 ? -35.271 -38.280 -2.151  1.00 29.77  ? 161 LEU C C   1 
ATOM   4154 O  O   . LEU C  1 163 ? -35.538 -37.143 -1.775  1.00 29.39  ? 161 LEU C O   1 
ATOM   4155 C  CB  . LEU C  1 163 ? -34.004 -39.246 -0.227  1.00 25.48  ? 161 LEU C CB  1 
ATOM   4156 C  CG  . LEU C  1 163 ? -32.818 -40.029 0.331   1.00 23.91  ? 161 LEU C CG  1 
ATOM   4157 C  CD1 . LEU C  1 163 ? -32.881 -40.055 1.846   1.00 22.71  ? 161 LEU C CD1 1 
ATOM   4158 C  CD2 . LEU C  1 163 ? -32.790 -41.442 -0.236  1.00 24.96  ? 161 LEU C CD2 1 
ATOM   4159 N  N   . PRO C  1 164 ? -36.096 -38.995 -2.925  1.00 32.16  ? 162 PRO C N   1 
ATOM   4160 C  CA  . PRO C  1 164 ? -37.438 -38.523 -3.211  1.00 34.76  ? 162 PRO C CA  1 
ATOM   4161 C  C   . PRO C  1 164 ? -38.432 -38.827 -2.086  1.00 36.15  ? 162 PRO C C   1 
ATOM   4162 O  O   . PRO C  1 164 ? -38.093 -39.509 -1.109  1.00 34.34  ? 162 PRO C O   1 
ATOM   4163 C  CB  . PRO C  1 164 ? -37.806 -39.290 -4.477  1.00 36.21  ? 162 PRO C CB  1 
ATOM   4164 C  CG  . PRO C  1 164 ? -37.059 -40.573 -4.359  1.00 35.07  ? 162 PRO C CG  1 
ATOM   4165 C  CD  . PRO C  1 164 ? -35.822 -40.303 -3.545  1.00 32.47  ? 162 PRO C CD  1 
ATOM   4166 N  N   . GLU C  1 165 ? -39.644 -38.297 -2.218  1.00 39.73  ? 163 GLU C N   1 
ATOM   4167 C  CA  . GLU C  1 165 ? -40.548 -38.166 -1.076  1.00 41.71  ? 163 GLU C CA  1 
ATOM   4168 C  C   . GLU C  1 165 ? -41.067 -39.539 -0.607  1.00 39.85  ? 163 GLU C C   1 
ATOM   4169 O  O   . GLU C  1 165 ? -41.279 -39.765 0.593   1.00 38.48  ? 163 GLU C O   1 
ATOM   4170 C  CB  . GLU C  1 165 ? -41.618 -37.079 -1.315  1.00 46.52  ? 163 GLU C CB  1 
ATOM   4171 C  CG  . GLU C  1 165 ? -41.200 -35.768 -0.662  1.00 49.20  ? 163 GLU C CG  1 
ATOM   4172 C  CD  . GLU C  1 165 ? -42.331 -34.783 -0.409  1.00 54.32  ? 163 GLU C CD  1 
ATOM   4173 O  OE1 . GLU C  1 165 ? -42.564 -33.901 -1.270  1.00 59.95  ? 163 GLU C OE1 1 
ATOM   4174 O  OE2 . GLU C  1 165 ? -42.953 -34.850 0.673   1.00 53.06  ? 163 GLU C OE2 1 
ATOM   4175 N  N   . ASN C  1 166 ? -41.123 -40.502 -1.521  1.00 39.01  ? 164 ASN C N   1 
ATOM   4176 C  CA  . ASN C  1 166 ? -41.539 -41.850 -1.154  1.00 39.25  ? 164 ASN C CA  1 
ATOM   4177 C  C   . ASN C  1 166 ? -40.443 -42.675 -0.455  1.00 35.96  ? 164 ASN C C   1 
ATOM   4178 O  O   . ASN C  1 166 ? -40.666 -43.828 -0.090  1.00 35.56  ? 164 ASN C O   1 
ATOM   4179 C  CB  . ASN C  1 166 ? -42.083 -42.593 -2.387  1.00 41.90  ? 164 ASN C CB  1 
ATOM   4180 C  CG  . ASN C  1 166 ? -41.014 -42.878 -3.426  1.00 42.84  ? 164 ASN C CG  1 
ATOM   4181 O  OD1 . ASN C  1 166 ? -39.965 -42.234 -3.459  1.00 43.96  ? 164 ASN C OD1 1 
ATOM   4182 N  ND2 . ASN C  1 166 ? -41.272 -43.854 -4.275  1.00 44.22  ? 164 ASN C ND2 1 
ATOM   4183 N  N   . HIS C  1 167 ? -39.262 -42.089 -0.284  1.00 34.01  ? 165 HIS C N   1 
ATOM   4184 C  CA  . HIS C  1 167 ? -38.222 -42.676 0.563   1.00 31.94  ? 165 HIS C CA  1 
ATOM   4185 C  C   . HIS C  1 167 ? -38.124 -41.927 1.891   1.00 29.99  ? 165 HIS C C   1 
ATOM   4186 O  O   . HIS C  1 167 ? -37.129 -42.034 2.609   1.00 27.30  ? 165 HIS C O   1 
ATOM   4187 C  CB  . HIS C  1 167 ? -36.873 -42.663 -0.150  1.00 31.79  ? 165 HIS C CB  1 
ATOM   4188 C  CG  . HIS C  1 167 ? -36.715 -43.754 -1.162  1.00 35.14  ? 165 HIS C CG  1 
ATOM   4189 N  ND1 . HIS C  1 167 ? -35.977 -44.895 -0.921  1.00 38.22  ? 165 HIS C ND1 1 
ATOM   4190 C  CD2 . HIS C  1 167 ? -37.183 -43.873 -2.427  1.00 37.99  ? 165 HIS C CD2 1 
ATOM   4191 C  CE1 . HIS C  1 167 ? -36.011 -45.674 -1.988  1.00 38.52  ? 165 HIS C CE1 1 
ATOM   4192 N  NE2 . HIS C  1 167 ? -36.728 -45.072 -2.919  1.00 38.88  ? 165 HIS C NE2 1 
ATOM   4193 N  N   . ILE C  1 168 ? -39.183 -41.194 2.222   1.00 30.85  ? 166 ILE C N   1 
ATOM   4194 C  CA  . ILE C  1 168 ? -39.280 -40.482 3.489   1.00 29.42  ? 166 ILE C CA  1 
ATOM   4195 C  C   . ILE C  1 168 ? -40.573 -40.864 4.204   1.00 29.91  ? 166 ILE C C   1 
ATOM   4196 O  O   . ILE C  1 168 ? -41.661 -40.766 3.625   1.00 33.09  ? 166 ILE C O   1 
ATOM   4197 C  CB  . ILE C  1 168 ? -39.289 -38.968 3.259   1.00 30.66  ? 166 ILE C CB  1 
ATOM   4198 C  CG1 . ILE C  1 168 ? -38.039 -38.553 2.485   1.00 31.70  ? 166 ILE C CG1 1 
ATOM   4199 C  CG2 . ILE C  1 168 ? -39.356 -38.244 4.588   1.00 30.18  ? 166 ILE C CG2 1 
ATOM   4200 C  CD1 . ILE C  1 168 ? -38.026 -37.099 2.059   1.00 32.88  ? 166 ILE C CD1 1 
ATOM   4201 N  N   . VAL C  1 169 ? -40.457 -41.314 5.452   1.00 27.07  ? 167 VAL C N   1 
ATOM   4202 C  CA  . VAL C  1 169 ? -41.629 -41.693 6.227   1.00 27.08  ? 167 VAL C CA  1 
ATOM   4203 C  C   . VAL C  1 169 ? -41.631 -41.061 7.611   1.00 25.19  ? 167 VAL C C   1 
ATOM   4204 O  O   . VAL C  1 169 ? -40.590 -40.743 8.179   1.00 23.15  ? 167 VAL C O   1 
ATOM   4205 C  CB  . VAL C  1 169 ? -41.796 -43.228 6.365   1.00 27.71  ? 167 VAL C CB  1 
ATOM   4206 C  CG1 . VAL C  1 169 ? -41.739 -43.895 5.002   1.00 29.45  ? 167 VAL C CG1 1 
ATOM   4207 C  CG2 . VAL C  1 169 ? -40.748 -43.822 7.289   1.00 26.20  ? 167 VAL C CG2 1 
ATOM   4208 N  N   . PHE C  1 170 ? -42.829 -40.943 8.165   1.00 25.71  ? 168 PHE C N   1 
ATOM   4209 C  CA  . PHE C  1 170 ? -43.011 -40.447 9.506   1.00 24.40  ? 168 PHE C CA  1 
ATOM   4210 C  C   . PHE C  1 170 ? -43.754 -41.498 10.308  1.00 24.85  ? 168 PHE C C   1 
ATOM   4211 O  O   . PHE C  1 170 ? -44.967 -41.629 10.200  1.00 26.60  ? 168 PHE C O   1 
ATOM   4212 C  CB  . PHE C  1 170 ? -43.780 -39.128 9.454   1.00 25.14  ? 168 PHE C CB  1 
ATOM   4213 C  CG  . PHE C  1 170 ? -43.034 -38.045 8.745   1.00 24.47  ? 168 PHE C CG  1 
ATOM   4214 C  CD1 . PHE C  1 170 ? -43.247 -37.800 7.399   1.00 25.80  ? 168 PHE C CD1 1 
ATOM   4215 C  CD2 . PHE C  1 170 ? -42.050 -37.338 9.403   1.00 22.90  ? 168 PHE C CD2 1 
ATOM   4216 C  CE1 . PHE C  1 170 ? -42.519 -36.834 6.733   1.00 25.73  ? 168 PHE C CE1 1 
ATOM   4217 C  CE2 . PHE C  1 170 ? -41.324 -36.364 8.750   1.00 22.70  ? 168 PHE C CE2 1 
ATOM   4218 C  CZ  . PHE C  1 170 ? -41.561 -36.107 7.417   1.00 24.42  ? 168 PHE C CZ  1 
ATOM   4219 N  N   . PRO C  1 171 ? -43.012 -42.288 11.083  1.00 24.06  ? 169 PRO C N   1 
ATOM   4220 C  CA  . PRO C  1 171 ? -43.581 -43.388 11.847  1.00 24.63  ? 169 PRO C CA  1 
ATOM   4221 C  C   . PRO C  1 171 ? -44.704 -42.934 12.758  1.00 25.41  ? 169 PRO C C   1 
ATOM   4222 O  O   . PRO C  1 171 ? -44.629 -41.861 13.364  1.00 24.32  ? 169 PRO C O   1 
ATOM   4223 C  CB  . PRO C  1 171 ? -42.398 -43.905 12.666  1.00 23.27  ? 169 PRO C CB  1 
ATOM   4224 C  CG  . PRO C  1 171 ? -41.198 -43.510 11.873  1.00 22.74  ? 169 PRO C CG  1 
ATOM   4225 C  CD  . PRO C  1 171 ? -41.551 -42.210 11.222  1.00 22.85  ? 169 PRO C CD  1 
ATOM   4226 N  N   . VAL C  1 172 ? -45.726 -43.774 12.864  1.00 27.01  ? 170 VAL C N   1 
ATOM   4227 C  CA  . VAL C  1 172 ? -46.925 -43.455 13.610  1.00 28.65  ? 170 VAL C CA  1 
ATOM   4228 C  C   . VAL C  1 172 ? -46.655 -43.610 15.098  1.00 27.98  ? 170 VAL C C   1 
ATOM   4229 O  O   . VAL C  1 172 ? -46.118 -44.626 15.527  1.00 28.58  ? 170 VAL C O   1 
ATOM   4230 C  CB  . VAL C  1 172 ? -48.077 -44.383 13.184  1.00 31.17  ? 170 VAL C CB  1 
ATOM   4231 C  CG1 . VAL C  1 172 ? -49.317 -44.147 14.033  1.00 32.23  ? 170 VAL C CG1 1 
ATOM   4232 C  CG2 . VAL C  1 172 ? -48.386 -44.161 11.706  1.00 32.38  ? 170 VAL C CG2 1 
ATOM   4233 N  N   . PRO C  1 173 ? -46.997 -42.587 15.889  1.00 27.38  ? 171 PRO C N   1 
ATOM   4234 C  CA  . PRO C  1 173 ? -46.838 -42.685 17.338  1.00 26.65  ? 171 PRO C CA  1 
ATOM   4235 C  C   . PRO C  1 173 ? -47.596 -43.877 17.910  1.00 27.46  ? 171 PRO C C   1 
ATOM   4236 O  O   . PRO C  1 173 ? -48.699 -44.168 17.475  1.00 28.85  ? 171 PRO C O   1 
ATOM   4237 C  CB  . PRO C  1 173 ? -47.447 -41.373 17.854  1.00 26.74  ? 171 PRO C CB  1 
ATOM   4238 C  CG  . PRO C  1 173 ? -47.334 -40.426 16.706  1.00 27.37  ? 171 PRO C CG  1 
ATOM   4239 C  CD  . PRO C  1 173 ? -47.465 -41.257 15.461  1.00 28.01  ? 171 PRO C CD  1 
ATOM   4240 N  N   . ILE C  1 174 ? -46.997 -44.550 18.881  1.00 27.27  ? 172 ILE C N   1 
ATOM   4241 C  CA  . ILE C  1 174 ? -47.656 -45.624 19.605  1.00 29.25  ? 172 ILE C CA  1 
ATOM   4242 C  C   . ILE C  1 174 ? -47.315 -45.519 21.087  1.00 29.49  ? 172 ILE C C   1 
ATOM   4243 O  O   . ILE C  1 174 ? -46.424 -44.761 21.464  1.00 26.72  ? 172 ILE C O   1 
ATOM   4244 C  CB  . ILE C  1 174 ? -47.185 -47.003 19.114  1.00 28.99  ? 172 ILE C CB  1 
ATOM   4245 C  CG1 . ILE C  1 174 ? -45.674 -47.141 19.330  1.00 27.76  ? 172 ILE C CG1 1 
ATOM   4246 C  CG2 . ILE C  1 174 ? -47.547 -47.211 17.656  1.00 29.78  ? 172 ILE C CG2 1 
ATOM   4247 C  CD1 . ILE C  1 174 ? -45.170 -48.561 19.143  1.00 28.25  ? 172 ILE C CD1 1 
ATOM   4248 N  N   . ASP C  1 175 ? -48.009 -46.310 21.909  1.00 32.70  ? 173 ASP C N   1 
ATOM   4249 C  CA  . ASP C  1 175 ? -47.849 -46.252 23.361  1.00 34.42  ? 173 ASP C CA  1 
ATOM   4250 C  C   . ASP C  1 175 ? -47.124 -47.472 23.920  1.00 33.63  ? 173 ASP C C   1 
ATOM   4251 O  O   . ASP C  1 175 ? -46.491 -47.388 24.970  1.00 34.19  ? 173 ASP C O   1 
ATOM   4252 C  CB  . ASP C  1 175 ? -49.213 -46.128 24.037  1.00 37.31  ? 173 ASP C CB  1 
ATOM   4253 C  CG  . ASP C  1 175 ? -49.786 -44.723 23.943  1.00 39.90  ? 173 ASP C CG  1 
ATOM   4254 O  OD1 . ASP C  1 175 ? -51.011 -44.576 24.136  1.00 42.21  ? 173 ASP C OD1 1 
ATOM   4255 O  OD2 . ASP C  1 175 ? -49.006 -43.767 23.691  1.00 40.57  ? 173 ASP C OD2 1 
ATOM   4256 N  N   . GLN C  1 176 ? -47.175 -48.587 23.199  1.00 32.94  ? 174 GLN C N   1 
ATOM   4257 C  CA  . GLN C  1 176 ? -46.523 -49.811 23.646  1.00 32.61  ? 174 GLN C CA  1 
ATOM   4258 C  C   . GLN C  1 176 ? -44.989 -49.688 23.624  1.00 29.63  ? 174 GLN C C   1 
ATOM   4259 O  O   . GLN C  1 176 ? -44.410 -49.145 22.681  1.00 27.62  ? 174 GLN C O   1 
ATOM   4260 C  CB  . GLN C  1 176 ? -46.983 -50.987 22.790  1.00 35.13  ? 174 GLN C CB  1 
ATOM   4261 C  CG  . GLN C  1 176 ? -48.482 -51.234 22.840  1.00 38.68  ? 174 GLN C CG  1 
ATOM   4262 C  CD  . GLN C  1 176 ? -49.235 -50.617 21.666  1.00 41.55  ? 174 GLN C CD  1 
ATOM   4263 O  OE1 . GLN C  1 176 ? -48.758 -49.691 21.005  1.00 39.54  ? 174 GLN C OE1 1 
ATOM   4264 N  NE2 . GLN C  1 176 ? -50.432 -51.131 21.410  1.00 46.15  ? 174 GLN C NE2 1 
ATOM   4265 N  N   . CYS C  1 177 ? -44.357 -50.130 24.713  1.00 28.20  ? 175 CYS C N   1 
ATOM   4266 C  CA  . CYS C  1 177 ? -42.906 -50.353 24.779  1.00 26.49  ? 175 CYS C CA  1 
ATOM   4267 C  C   . CYS C  1 177 ? -42.047 -49.087 24.884  1.00 23.97  ? 175 CYS C C   1 
ATOM   4268 O  O   . CYS C  1 177 ? -41.059 -49.072 25.603  1.00 22.76  ? 175 CYS C O   1 
ATOM   4269 C  CB  . CYS C  1 177 ? -42.434 -51.201 23.602  1.00 26.61  ? 175 CYS C CB  1 
ATOM   4270 S  SG  . CYS C  1 177 ? -43.163 -52.854 23.572  1.00 29.94  ? 175 CYS C SG  1 
ATOM   4271 N  N   . ILE C  1 178 ? -42.390 -48.036 24.155  1.00 23.94  ? 176 ILE C N   1 
ATOM   4272 C  CA  . ILE C  1 178 ? -41.437 -46.938 23.937  1.00 23.83  ? 176 ILE C CA  1 
ATOM   4273 C  C   . ILE C  1 178 ? -41.487 -45.799 24.960  1.00 23.64  ? 176 ILE C C   1 
ATOM   4274 O  O   . ILE C  1 178 ? -40.744 -44.841 24.834  1.00 26.26  ? 176 ILE C O   1 
ATOM   4275 C  CB  . ILE C  1 178 ? -41.546 -46.369 22.508  1.00 23.41  ? 176 ILE C CB  1 
ATOM   4276 C  CG1 . ILE C  1 178 ? -42.853 -45.605 22.335  1.00 24.14  ? 176 ILE C CG1 1 
ATOM   4277 C  CG2 . ILE C  1 178 ? -41.458 -47.492 21.486  1.00 24.11  ? 176 ILE C CG2 1 
ATOM   4278 C  CD1 . ILE C  1 178 ? -43.021 -45.022 20.950  1.00 24.01  ? 176 ILE C CD1 1 
ATOM   4279 N  N   . ASP C  1 179 ? -42.292 -45.923 26.008  1.00 25.72  ? 177 ASP C N   1 
ATOM   4280 C  CA  . ASP C  1 179 ? -42.406 -44.855 27.024  1.00 25.97  ? 177 ASP C CA  1 
ATOM   4281 C  C   . ASP C  1 179 ? -41.892 -45.292 28.392  1.00 26.79  ? 177 ASP C C   1 
ATOM   4282 O  O   . ASP C  1 179 ? -41.193 -46.304 28.494  1.00 31.54  ? 177 ASP C O   1 
ATOM   4283 C  CB  . ASP C  1 179 ? -43.865 -44.389 27.141  1.00 26.85  ? 177 ASP C CB  1 
ATOM   4284 C  CG  . ASP C  1 179 ? -44.350 -43.689 25.889  1.00 26.56  ? 177 ASP C CG  1 
ATOM   4285 O  OD1 . ASP C  1 179 ? -43.492 -43.102 25.202  1.00 25.44  ? 177 ASP C OD1 1 
ATOM   4286 O  OD2 . ASP C  1 179 ? -45.565 -43.750 25.574  1.00 27.94  ? 177 ASP C OD2 1 
ATOM   4287 N  N   . ASP D  1 4   ? -28.893 -62.210 -35.975 1.00 75.90  ? 2   ASP D N   1 
ATOM   4288 C  CA  . ASP D  1 4   ? -29.038 -62.041 -37.454 1.00 80.86  ? 2   ASP D CA  1 
ATOM   4289 C  C   . ASP D  1 4   ? -28.279 -60.784 -37.894 1.00 84.60  ? 2   ASP D C   1 
ATOM   4290 O  O   . ASP D  1 4   ? -28.839 -59.687 -37.895 1.00 90.75  ? 2   ASP D O   1 
ATOM   4291 C  CB  . ASP D  1 4   ? -30.524 -61.935 -37.843 1.00 82.13  ? 2   ASP D CB  1 
ATOM   4292 C  CG  . ASP D  1 4   ? -31.054 -63.191 -38.533 1.00 82.98  ? 2   ASP D CG  1 
ATOM   4293 O  OD1 . ASP D  1 4   ? -30.532 -64.289 -38.254 1.00 80.42  ? 2   ASP D OD1 1 
ATOM   4294 O  OD2 . ASP D  1 4   ? -32.004 -63.081 -39.347 1.00 81.73  ? 2   ASP D OD2 1 
ATOM   4295 N  N   . SER D  1 5   ? -27.005 -60.945 -38.255 1.00 85.36  ? 3   SER D N   1 
ATOM   4296 C  CA  . SER D  1 5   ? -26.061 -59.820 -38.281 1.00 84.97  ? 3   SER D CA  1 
ATOM   4297 C  C   . SER D  1 5   ? -24.764 -60.104 -39.066 1.00 86.52  ? 3   SER D C   1 
ATOM   4298 O  O   . SER D  1 5   ? -24.558 -61.199 -39.615 1.00 78.91  ? 3   SER D O   1 
ATOM   4299 C  CB  . SER D  1 5   ? -25.708 -59.391 -36.844 1.00 80.09  ? 3   SER D CB  1 
ATOM   4300 O  OG  . SER D  1 5   ? -25.067 -60.436 -36.134 1.00 72.53  ? 3   SER D OG  1 
ATOM   4301 N  N   . THR D  1 6   ? -23.924 -59.070 -39.137 1.00 88.82  ? 4   THR D N   1 
ATOM   4302 C  CA  . THR D  1 6   ? -22.466 -59.205 -39.294 1.00 81.82  ? 4   THR D CA  1 
ATOM   4303 C  C   . THR D  1 6   ? -21.765 -58.297 -38.250 1.00 79.19  ? 4   THR D C   1 
ATOM   4304 O  O   . THR D  1 6   ? -22.370 -57.334 -37.777 1.00 87.87  ? 4   THR D O   1 
ATOM   4305 C  CB  . THR D  1 6   ? -22.042 -58.800 -40.731 1.00 78.32  ? 4   THR D CB  1 
ATOM   4306 O  OG1 . THR D  1 6   ? -22.838 -59.510 -41.689 1.00 76.60  ? 4   THR D OG1 1 
ATOM   4307 C  CG2 . THR D  1 6   ? -20.567 -59.097 -40.979 1.00 75.05  ? 4   THR D CG2 1 
ATOM   4308 N  N   . SER D  1 7   ? -20.511 -58.584 -37.884 1.00 68.61  ? 5   SER D N   1 
ATOM   4309 C  CA  . SER D  1 7   ? -19.728 -57.613 -37.067 1.00 64.59  ? 5   SER D CA  1 
ATOM   4310 C  C   . SER D  1 7   ? -18.289 -58.011 -36.663 1.00 55.62  ? 5   SER D C   1 
ATOM   4311 O  O   . SER D  1 7   ? -18.117 -58.754 -35.713 1.00 57.41  ? 5   SER D O   1 
ATOM   4312 C  CB  . SER D  1 7   ? -20.496 -57.230 -35.802 1.00 62.31  ? 5   SER D CB  1 
ATOM   4313 O  OG  . SER D  1 7   ? -19.972 -56.030 -35.255 1.00 60.36  ? 5   SER D OG  1 
ATOM   4314 N  N   . ASP D  1 8   ? -17.267 -57.486 -37.344 1.00 49.70  ? 6   ASP D N   1 
ATOM   4315 C  CA  . ASP D  1 8   ? -15.910 -58.039 -37.241 1.00 44.35  ? 6   ASP D CA  1 
ATOM   4316 C  C   . ASP D  1 8   ? -15.224 -57.769 -35.905 1.00 39.54  ? 6   ASP D C   1 
ATOM   4317 O  O   . ASP D  1 8   ? -15.419 -56.735 -35.270 1.00 38.97  ? 6   ASP D O   1 
ATOM   4318 C  CB  . ASP D  1 8   ? -15.006 -57.510 -38.369 1.00 45.90  ? 6   ASP D CB  1 
ATOM   4319 C  CG  . ASP D  1 8   ? -15.582 -57.759 -39.754 1.00 50.69  ? 6   ASP D CG  1 
ATOM   4320 O  OD1 . ASP D  1 8   ? -15.242 -57.003 -40.690 1.00 53.85  ? 6   ASP D OD1 1 
ATOM   4321 O  OD2 . ASP D  1 8   ? -16.358 -58.722 -39.915 1.00 52.14  ? 6   ASP D OD2 1 
ATOM   4322 N  N   . LEU D  1 9   ? -14.382 -58.710 -35.509 1.00 35.76  ? 7   LEU D N   1 
ATOM   4323 C  CA  . LEU D  1 9   ? -13.658 -58.626 -34.254 1.00 32.44  ? 7   LEU D CA  1 
ATOM   4324 C  C   . LEU D  1 9   ? -12.183 -58.887 -34.477 1.00 30.06  ? 7   LEU D C   1 
ATOM   4325 O  O   . LEU D  1 9   ? -11.801 -59.748 -35.262 1.00 30.15  ? 7   LEU D O   1 
ATOM   4326 C  CB  . LEU D  1 9   ? -14.192 -59.645 -33.250 1.00 31.11  ? 7   LEU D CB  1 
ATOM   4327 C  CG  . LEU D  1 9   ? -15.594 -59.378 -32.701 1.00 32.88  ? 7   LEU D CG  1 
ATOM   4328 C  CD1 . LEU D  1 9   ? -16.022 -60.511 -31.789 1.00 31.83  ? 7   LEU D CD1 1 
ATOM   4329 C  CD2 . LEU D  1 9   ? -15.651 -58.058 -31.944 1.00 33.04  ? 7   LEU D CD2 1 
ATOM   4330 N  N   . ILE D  1 10  ? -11.350 -58.131 -33.787 1.00 28.01  ? 8   ILE D N   1 
ATOM   4331 C  CA  . ILE D  1 10  ? -9.942  -58.451 -33.736 1.00 26.08  ? 8   ILE D CA  1 
ATOM   4332 C  C   . ILE D  1 10  ? -9.791  -59.799 -33.042 1.00 24.28  ? 8   ILE D C   1 
ATOM   4333 O  O   . ILE D  1 10  ? -10.383 -60.025 -31.996 1.00 23.32  ? 8   ILE D O   1 
ATOM   4334 C  CB  . ILE D  1 10  ? -9.146  -57.359 -32.994 1.00 25.06  ? 8   ILE D CB  1 
ATOM   4335 C  CG1 . ILE D  1 10  ? -9.115  -56.074 -33.824 1.00 26.32  ? 8   ILE D CG1 1 
ATOM   4336 C  CG2 . ILE D  1 10  ? -7.731  -57.832 -32.702 1.00 23.28  ? 8   ILE D CG2 1 
ATOM   4337 C  CD1 . ILE D  1 10  ? -8.874  -54.829 -32.999 1.00 26.34  ? 8   ILE D CD1 1 
ATOM   4338 N  N   . PRO D  1 11  ? -9.013  -60.704 -33.641 1.00 23.83  ? 9   PRO D N   1 
ATOM   4339 C  CA  . PRO D  1 11  ? -8.844  -62.041 -33.100 1.00 22.84  ? 9   PRO D CA  1 
ATOM   4340 C  C   . PRO D  1 11  ? -8.233  -62.036 -31.712 1.00 21.69  ? 9   PRO D C   1 
ATOM   4341 O  O   . PRO D  1 11  ? -7.360  -61.221 -31.416 1.00 21.36  ? 9   PRO D O   1 
ATOM   4342 C  CB  . PRO D  1 11  ? -7.876  -62.709 -34.093 1.00 22.81  ? 9   PRO D CB  1 
ATOM   4343 C  CG  . PRO D  1 11  ? -7.971  -61.902 -35.343 1.00 24.17  ? 9   PRO D CG  1 
ATOM   4344 C  CD  . PRO D  1 11  ? -8.252  -60.505 -34.888 1.00 24.62  ? 9   PRO D CD  1 
ATOM   4345 N  N   . ALA D  1 12  ? -8.680  -62.945 -30.860 1.00 21.68  ? 10  ALA D N   1 
ATOM   4346 C  CA  . ALA D  1 12  ? -8.053  -63.113 -29.556 1.00 21.89  ? 10  ALA D CA  1 
ATOM   4347 C  C   . ALA D  1 12  ? -6.598  -63.532 -29.738 1.00 22.22  ? 10  ALA D C   1 
ATOM   4348 O  O   . ALA D  1 12  ? -6.295  -64.304 -30.636 1.00 23.69  ? 10  ALA D O   1 
ATOM   4349 C  CB  . ALA D  1 12  ? -8.807  -64.153 -28.741 1.00 21.63  ? 10  ALA D CB  1 
ATOM   4350 N  N   . PRO D  1 13  ? -5.697  -63.035 -28.876 1.00 22.23  ? 11  PRO D N   1 
ATOM   4351 C  CA  . PRO D  1 13  ? -4.324  -63.503 -28.941 1.00 22.65  ? 11  PRO D CA  1 
ATOM   4352 C  C   . PRO D  1 13  ? -4.223  -64.941 -28.454 1.00 24.23  ? 11  PRO D C   1 
ATOM   4353 O  O   . PRO D  1 13  ? -5.045  -65.373 -27.647 1.00 23.15  ? 11  PRO D O   1 
ATOM   4354 C  CB  . PRO D  1 13  ? -3.603  -62.575 -27.970 1.00 22.36  ? 11  PRO D CB  1 
ATOM   4355 C  CG  . PRO D  1 13  ? -4.632  -62.279 -26.927 1.00 22.22  ? 11  PRO D CG  1 
ATOM   4356 C  CD  . PRO D  1 13  ? -5.956  -62.255 -27.654 1.00 21.89  ? 11  PRO D CD  1 
ATOM   4357 N  N   . PRO D  1 14  ? -3.200  -65.672 -28.910 1.00 25.36  ? 12  PRO D N   1 
ATOM   4358 C  CA  . PRO D  1 14  ? -2.871  -66.935 -28.254 1.00 24.79  ? 12  PRO D CA  1 
ATOM   4359 C  C   . PRO D  1 14  ? -2.469  -66.737 -26.796 1.00 24.00  ? 12  PRO D C   1 
ATOM   4360 O  O   . PRO D  1 14  ? -1.828  -65.747 -26.453 1.00 23.31  ? 12  PRO D O   1 
ATOM   4361 C  CB  . PRO D  1 14  ? -1.682  -67.461 -29.061 1.00 25.86  ? 12  PRO D CB  1 
ATOM   4362 C  CG  . PRO D  1 14  ? -1.064  -66.249 -29.670 1.00 26.85  ? 12  PRO D CG  1 
ATOM   4363 C  CD  . PRO D  1 14  ? -2.185  -65.268 -29.897 1.00 26.74  ? 12  PRO D CD  1 
ATOM   4364 N  N   . LEU D  1 15  ? -2.837  -67.691 -25.952 1.00 25.13  ? 13  LEU D N   1 
ATOM   4365 C  CA  . LEU D  1 15  ? -2.627  -67.565 -24.519 1.00 25.45  ? 13  LEU D CA  1 
ATOM   4366 C  C   . LEU D  1 15  ? -1.160  -67.505 -24.142 1.00 26.43  ? 13  LEU D C   1 
ATOM   4367 O  O   . LEU D  1 15  ? -0.795  -66.968 -23.099 1.00 27.93  ? 13  LEU D O   1 
ATOM   4368 C  CB  . LEU D  1 15  ? -3.306  -68.724 -23.804 1.00 25.53  ? 13  LEU D CB  1 
ATOM   4369 C  CG  . LEU D  1 15  ? -4.831  -68.637 -23.875 1.00 25.59  ? 13  LEU D CG  1 
ATOM   4370 C  CD1 . LEU D  1 15  ? -5.468  -69.761 -23.091 1.00 25.57  ? 13  LEU D CD1 1 
ATOM   4371 C  CD2 . LEU D  1 15  ? -5.310  -67.281 -23.359 1.00 28.73  ? 13  LEU D CD2 1 
ATOM   4372 N  N   . SER D  1 16  ? -0.315  -67.995 -25.033 1.00 28.56  ? 14  SER D N   1 
ATOM   4373 C  CA  . SER D  1 16  ? 1.117   -67.939 -24.836 1.00 27.72  ? 14  SER D CA  1 
ATOM   4374 C  C   . SER D  1 16  ? 1.639   -66.496 -24.805 1.00 27.30  ? 14  SER D C   1 
ATOM   4375 O  O   . SER D  1 16  ? 2.756   -66.252 -24.364 1.00 29.35  ? 14  SER D O   1 
ATOM   4376 C  CB  . SER D  1 16  ? 1.821   -68.747 -25.943 1.00 28.57  ? 14  SER D CB  1 
ATOM   4377 O  OG  . SER D  1 16  ? 1.769   -68.076 -27.192 1.00 29.78  ? 14  SER D OG  1 
ATOM   4378 N  N   . LYS D  1 17  ? 0.855   -65.542 -25.291 1.00 26.29  ? 15  LYS D N   1 
ATOM   4379 C  CA  . LYS D  1 17  ? 1.293   -64.144 -25.273 1.00 27.29  ? 15  LYS D CA  1 
ATOM   4380 C  C   . LYS D  1 17  ? 0.778   -63.387 -24.055 1.00 23.70  ? 15  LYS D C   1 
ATOM   4381 O  O   . LYS D  1 17  ? 0.998   -62.185 -23.926 1.00 23.04  ? 15  LYS D O   1 
ATOM   4382 C  CB  . LYS D  1 17  ? 0.834   -63.425 -26.535 1.00 32.18  ? 15  LYS D CB  1 
ATOM   4383 C  CG  . LYS D  1 17  ? 1.677   -63.727 -27.759 1.00 35.91  ? 15  LYS D CG  1 
ATOM   4384 C  CD  . LYS D  1 17  ? 1.499   -62.650 -28.812 1.00 43.43  ? 15  LYS D CD  1 
ATOM   4385 C  CE  . LYS D  1 17  ? 1.416   -63.239 -30.205 1.00 49.14  ? 15  LYS D CE  1 
ATOM   4386 N  NZ  . LYS D  1 17  ? 1.893   -62.271 -31.227 1.00 57.48  ? 15  LYS D NZ  1 
ATOM   4387 N  N   . VAL D  1 18  ? 0.097   -64.098 -23.161 1.00 21.75  ? 16  VAL D N   1 
ATOM   4388 C  CA  . VAL D  1 18  ? -0.466  -63.493 -21.959 1.00 19.33  ? 16  VAL D CA  1 
ATOM   4389 C  C   . VAL D  1 18  ? 0.212   -64.061 -20.710 1.00 16.99  ? 16  VAL D C   1 
ATOM   4390 O  O   . VAL D  1 18  ? -0.130  -65.146 -20.251 1.00 14.96  ? 16  VAL D O   1 
ATOM   4391 C  CB  . VAL D  1 18  ? -1.988  -63.752 -21.875 1.00 19.52  ? 16  VAL D CB  1 
ATOM   4392 C  CG1 . VAL D  1 18  ? -2.579  -63.015 -20.693 1.00 18.90  ? 16  VAL D CG1 1 
ATOM   4393 C  CG2 . VAL D  1 18  ? -2.680  -63.337 -23.163 1.00 19.16  ? 16  VAL D CG2 1 
ATOM   4394 N  N   . PRO D  1 19  ? 1.162   -63.311 -20.145 1.00 16.98  ? 17  PRO D N   1 
ATOM   4395 C  CA  . PRO D  1 19  ? 1.845   -63.766 -18.951 1.00 17.83  ? 17  PRO D CA  1 
ATOM   4396 C  C   . PRO D  1 19  ? 0.917   -64.029 -17.774 1.00 18.79  ? 17  PRO D C   1 
ATOM   4397 O  O   . PRO D  1 19  ? -0.196  -63.486 -17.693 1.00 18.05  ? 17  PRO D O   1 
ATOM   4398 C  CB  . PRO D  1 19  ? 2.790   -62.600 -18.602 1.00 18.72  ? 17  PRO D CB  1 
ATOM   4399 C  CG  . PRO D  1 19  ? 2.986   -61.861 -19.875 1.00 19.08  ? 17  PRO D CG  1 
ATOM   4400 C  CD  . PRO D  1 19  ? 1.691   -62.021 -20.630 1.00 19.04  ? 17  PRO D CD  1 
ATOM   4401 N  N   . LEU D  1 20  ? 1.396   -64.878 -16.877 1.00 17.93  ? 18  LEU D N   1 
ATOM   4402 C  CA  . LEU D  1 20  ? 0.731   -65.151 -15.634 1.00 19.14  ? 18  LEU D CA  1 
ATOM   4403 C  C   . LEU D  1 20  ? 1.595   -64.614 -14.487 1.00 19.62  ? 18  LEU D C   1 
ATOM   4404 O  O   . LEU D  1 20  ? 2.779   -64.929 -14.393 1.00 19.45  ? 18  LEU D O   1 
ATOM   4405 C  CB  . LEU D  1 20  ? 0.546   -66.658 -15.514 1.00 20.69  ? 18  LEU D CB  1 
ATOM   4406 C  CG  . LEU D  1 20  ? -0.059  -67.107 -14.195 1.00 23.84  ? 18  LEU D CG  1 
ATOM   4407 C  CD1 . LEU D  1 20  ? -1.547  -66.789 -14.192 1.00 22.48  ? 18  LEU D CD1 1 
ATOM   4408 C  CD2 . LEU D  1 20  ? 0.196   -68.598 -13.967 1.00 25.15  ? 18  LEU D CD2 1 
ATOM   4409 N  N   . GLN D  1 21  ? 1.013   -63.787 -13.629 1.00 19.04  ? 19  GLN D N   1 
ATOM   4410 C  CA  . GLN D  1 21  ? 1.697   -63.345 -12.420 1.00 19.72  ? 19  GLN D CA  1 
ATOM   4411 C  C   . GLN D  1 21  ? 2.316   -64.537 -11.685 1.00 21.95  ? 19  GLN D C   1 
ATOM   4412 O  O   . GLN D  1 21  ? 1.614   -65.481 -11.333 1.00 19.67  ? 19  GLN D O   1 
ATOM   4413 C  CB  . GLN D  1 21  ? 0.707   -62.624 -11.508 1.00 19.19  ? 19  GLN D CB  1 
ATOM   4414 C  CG  . GLN D  1 21  ? 1.260   -62.254 -10.137 1.00 21.02  ? 19  GLN D CG  1 
ATOM   4415 C  CD  . GLN D  1 21  ? 2.428   -61.285 -10.200 1.00 21.12  ? 19  GLN D CD  1 
ATOM   4416 O  OE1 . GLN D  1 21  ? 2.370   -60.263 -10.871 1.00 20.60  ? 19  GLN D OE1 1 
ATOM   4417 N  NE2 . GLN D  1 21  ? 3.507   -61.625 -9.516  1.00 23.02  ? 19  GLN D NE2 1 
ATOM   4418 N  N   . GLN D  1 22  ? 3.637   -64.523 -11.499 1.00 26.92  ? 20  GLN D N   1 
ATOM   4419 C  CA  . GLN D  1 22  ? 4.312   -65.626 -10.795 1.00 28.92  ? 20  GLN D CA  1 
ATOM   4420 C  C   . GLN D  1 22  ? 3.887   -65.651 -9.317  1.00 27.32  ? 20  GLN D C   1 
ATOM   4421 O  O   . GLN D  1 22  ? 3.669   -64.613 -8.687  1.00 22.06  ? 20  GLN D O   1 
ATOM   4422 C  CB  . GLN D  1 22  ? 5.849   -65.569 -10.945 1.00 32.87  ? 20  GLN D CB  1 
ATOM   4423 C  CG  . GLN D  1 22  ? 6.545   -64.487 -10.110 1.00 43.73  ? 20  GLN D CG  1 
ATOM   4424 C  CD  . GLN D  1 22  ? 7.225   -65.007 -8.836  1.00 52.09  ? 20  GLN D CD  1 
ATOM   4425 O  OE1 . GLN D  1 22  ? 7.602   -66.180 -8.733  1.00 50.34  ? 20  GLN D OE1 1 
ATOM   4426 N  NE2 . GLN D  1 22  ? 7.393   -64.116 -7.859  1.00 50.31  ? 20  GLN D NE2 1 
ATOM   4427 N  N   . ASN D  1 23  ? 3.698   -66.861 -8.805  1.00 26.64  ? 21  ASN D N   1 
ATOM   4428 C  CA  . ASN D  1 23  ? 3.390   -67.092 -7.403  1.00 27.50  ? 21  ASN D CA  1 
ATOM   4429 C  C   . ASN D  1 23  ? 2.197   -66.285 -6.914  1.00 24.26  ? 21  ASN D C   1 
ATOM   4430 O  O   . ASN D  1 23  ? 2.293   -65.571 -5.918  1.00 25.78  ? 21  ASN D O   1 
ATOM   4431 C  CB  . ASN D  1 23  ? 4.619   -66.815 -6.534  1.00 33.88  ? 21  ASN D CB  1 
ATOM   4432 C  CG  . ASN D  1 23  ? 4.482   -67.379 -5.126  1.00 42.92  ? 21  ASN D CG  1 
ATOM   4433 O  OD1 . ASN D  1 23  ? 3.847   -68.415 -4.920  1.00 49.73  ? 21  ASN D OD1 1 
ATOM   4434 N  ND2 . ASN D  1 23  ? 5.094   -66.708 -4.151  1.00 45.78  ? 21  ASN D ND2 1 
ATOM   4435 N  N   . PHE D  1 24  ? 1.069   -66.407 -7.605  1.00 20.07  ? 22  PHE D N   1 
ATOM   4436 C  CA  . PHE D  1 24  ? -0.082  -65.574 -7.316  1.00 19.32  ? 22  PHE D CA  1 
ATOM   4437 C  C   . PHE D  1 24  ? -0.554  -65.785 -5.887  1.00 20.27  ? 22  PHE D C   1 
ATOM   4438 O  O   . PHE D  1 24  ? -0.683  -66.921 -5.427  1.00 25.49  ? 22  PHE D O   1 
ATOM   4439 C  CB  . PHE D  1 24  ? -1.221  -65.877 -8.291  1.00 18.94  ? 22  PHE D CB  1 
ATOM   4440 C  CG  . PHE D  1 24  ? -2.475  -65.112 -8.012  1.00 18.26  ? 22  PHE D CG  1 
ATOM   4441 C  CD1 . PHE D  1 24  ? -3.553  -65.727 -7.413  1.00 19.09  ? 22  PHE D CD1 1 
ATOM   4442 C  CD2 . PHE D  1 24  ? -2.572  -63.779 -8.343  1.00 17.37  ? 22  PHE D CD2 1 
ATOM   4443 C  CE1 . PHE D  1 24  ? -4.710  -65.026 -7.167  1.00 18.18  ? 22  PHE D CE1 1 
ATOM   4444 C  CE2 . PHE D  1 24  ? -3.725  -63.072 -8.097  1.00 17.02  ? 22  PHE D CE2 1 
ATOM   4445 C  CZ  . PHE D  1 24  ? -4.792  -63.696 -7.502  1.00 17.40  ? 22  PHE D CZ  1 
ATOM   4446 N  N   . GLN D  1 25  ? -0.835  -64.687 -5.192  1.00 19.24  ? 23  GLN D N   1 
ATOM   4447 C  CA  . GLN D  1 25  ? -1.270  -64.739 -3.801  1.00 18.84  ? 23  GLN D CA  1 
ATOM   4448 C  C   . GLN D  1 25  ? -2.736  -64.347 -3.704  1.00 18.54  ? 23  GLN D C   1 
ATOM   4449 O  O   . GLN D  1 25  ? -3.070  -63.153 -3.657  1.00 18.72  ? 23  GLN D O   1 
ATOM   4450 C  CB  . GLN D  1 25  ? -0.429  -63.780 -2.956  1.00 19.65  ? 23  GLN D CB  1 
ATOM   4451 C  CG  . GLN D  1 25  ? 1.053   -64.106 -2.896  1.00 20.01  ? 23  GLN D CG  1 
ATOM   4452 C  CD  . GLN D  1 25  ? 1.290   -65.472 -2.277  1.00 21.66  ? 23  GLN D CD  1 
ATOM   4453 O  OE1 . GLN D  1 25  ? 0.970   -65.695 -1.118  1.00 24.43  ? 23  GLN D OE1 1 
ATOM   4454 N  NE2 . GLN D  1 25  ? 1.829   -66.400 -3.056  1.00 21.30  ? 23  GLN D NE2 1 
ATOM   4455 N  N   . ASP D  1 26  ? -3.612  -65.347 -3.641  1.00 18.55  ? 24  ASP D N   1 
ATOM   4456 C  CA  . ASP D  1 26  ? -5.046  -65.094 -3.731  1.00 19.60  ? 24  ASP D CA  1 
ATOM   4457 C  C   . ASP D  1 26  ? -5.577  -64.227 -2.586  1.00 19.92  ? 24  ASP D C   1 
ATOM   4458 O  O   . ASP D  1 26  ? -6.451  -63.382 -2.792  1.00 19.47  ? 24  ASP D O   1 
ATOM   4459 C  CB  . ASP D  1 26  ? -5.840  -66.406 -3.852  1.00 20.46  ? 24  ASP D CB  1 
ATOM   4460 C  CG  . ASP D  1 26  ? -5.610  -67.374 -2.681  1.00 22.83  ? 24  ASP D CG  1 
ATOM   4461 O  OD1 . ASP D  1 26  ? -4.895  -67.028 -1.709  1.00 23.93  ? 24  ASP D OD1 1 
ATOM   4462 O  OD2 . ASP D  1 26  ? -6.188  -68.486 -2.727  1.00 23.78  ? 24  ASP D OD2 1 
ATOM   4463 N  N   . ASN D  1 27  ? -5.039  -64.409 -1.389  1.00 20.74  ? 25  ASN D N   1 
ATOM   4464 C  CA  . ASN D  1 27  ? -5.492  -63.630 -0.249  1.00 24.80  ? 25  ASN D CA  1 
ATOM   4465 C  C   . ASN D  1 27  ? -5.117  -62.148 -0.391  1.00 21.61  ? 25  ASN D C   1 
ATOM   4466 O  O   . ASN D  1 27  ? -5.910  -61.273 -0.074  1.00 19.64  ? 25  ASN D O   1 
ATOM   4467 C  CB  . ASN D  1 27  ? -4.958  -64.221 1.063   1.00 28.63  ? 25  ASN D CB  1 
ATOM   4468 C  CG  . ASN D  1 27  ? -3.442  -64.340 1.076   1.00 34.01  ? 25  ASN D CG  1 
ATOM   4469 O  OD1 . ASN D  1 27  ? -2.841  -64.864 0.137   1.00 38.56  ? 25  ASN D OD1 1 
ATOM   4470 N  ND2 . ASN D  1 27  ? -2.818  -63.857 2.143   1.00 42.00  ? 25  ASN D ND2 1 
ATOM   4471 N  N   . GLN D  1 28  ? -3.919  -61.873 -0.894  1.00 21.61  ? 26  GLN D N   1 
ATOM   4472 C  CA  . GLN D  1 28  ? -3.437  -60.502 -1.016  1.00 21.39  ? 26  GLN D CA  1 
ATOM   4473 C  C   . GLN D  1 28  ? -4.155  -59.743 -2.127  1.00 20.26  ? 26  GLN D C   1 
ATOM   4474 O  O   . GLN D  1 28  ? -4.114  -58.508 -2.174  1.00 19.81  ? 26  GLN D O   1 
ATOM   4475 C  CB  . GLN D  1 28  ? -1.940  -60.490 -1.315  1.00 26.16  ? 26  GLN D CB  1 
ATOM   4476 C  CG  . GLN D  1 28  ? -1.042  -60.839 -0.150  1.00 28.45  ? 26  GLN D CG  1 
ATOM   4477 C  CD  . GLN D  1 28  ? 0.402   -60.496 -0.451  1.00 36.00  ? 26  GLN D CD  1 
ATOM   4478 O  OE1 . GLN D  1 28  ? 0.749   -59.329 -0.720  1.00 44.21  ? 26  GLN D OE1 1 
ATOM   4479 N  NE2 . GLN D  1 28  ? 1.255   -61.503 -0.417  1.00 36.94  ? 26  GLN D NE2 1 
ATOM   4480 N  N   . PHE D  1 29  ? -4.759  -60.481 -3.057  1.00 17.62  ? 27  PHE D N   1 
ATOM   4481 C  CA  . PHE D  1 29  ? -5.402  -59.856 -4.199  1.00 15.67  ? 27  PHE D CA  1 
ATOM   4482 C  C   . PHE D  1 29  ? -6.825  -59.388 -3.865  1.00 16.04  ? 27  PHE D C   1 
ATOM   4483 O  O   . PHE D  1 29  ? -7.413  -58.632 -4.626  1.00 14.95  ? 27  PHE D O   1 
ATOM   4484 C  CB  . PHE D  1 29  ? -5.430  -60.818 -5.375  1.00 14.86  ? 27  PHE D CB  1 
ATOM   4485 C  CG  . PHE D  1 29  ? -5.773  -60.161 -6.680  1.00 13.88  ? 27  PHE D CG  1 
ATOM   4486 C  CD1 . PHE D  1 29  ? -7.006  -60.363 -7.260  1.00 13.20  ? 27  PHE D CD1 1 
ATOM   4487 C  CD2 . PHE D  1 29  ? -4.848  -59.359 -7.337  1.00 13.07  ? 27  PHE D CD2 1 
ATOM   4488 C  CE1 . PHE D  1 29  ? -7.323  -59.771 -8.464  1.00 12.57  ? 27  PHE D CE1 1 
ATOM   4489 C  CE2 . PHE D  1 29  ? -5.154  -58.774 -8.551  1.00 12.68  ? 27  PHE D CE2 1 
ATOM   4490 C  CZ  . PHE D  1 29  ? -6.401  -58.979 -9.114  1.00 12.42  ? 27  PHE D CZ  1 
ATOM   4491 N  N   . GLN D  1 30  ? -7.337  -59.808 -2.707  1.00 16.35  ? 28  GLN D N   1 
ATOM   4492 C  CA  . GLN D  1 30  ? -8.668  -59.435 -2.228  1.00 17.30  ? 28  GLN D CA  1 
ATOM   4493 C  C   . GLN D  1 30  ? -8.868  -57.935 -2.085  1.00 17.00  ? 28  GLN D C   1 
ATOM   4494 O  O   . GLN D  1 30  ? -7.917  -57.180 -1.940  1.00 16.95  ? 28  GLN D O   1 
ATOM   4495 C  CB  . GLN D  1 30  ? -8.914  -60.026 -0.839  1.00 18.68  ? 28  GLN D CB  1 
ATOM   4496 C  CG  . GLN D  1 30  ? -9.144  -61.527 -0.817  1.00 20.95  ? 28  GLN D CG  1 
ATOM   4497 C  CD  . GLN D  1 30  ? -9.560  -62.013 0.545   1.00 21.81  ? 28  GLN D CD  1 
ATOM   4498 O  OE1 . GLN D  1 30  ? -10.739 -62.156 0.824   1.00 22.09  ? 28  GLN D OE1 1 
ATOM   4499 N  NE2 . GLN D  1 30  ? -8.594  -62.180 1.427   1.00 23.25  ? 28  GLN D NE2 1 
ATOM   4500 N  N   . GLY D  1 31  ? -10.129 -57.540 -2.010  1.00 16.60  ? 29  GLY D N   1 
ATOM   4501 C  CA  . GLY D  1 31  ? -10.481 -56.176 -1.721  1.00 17.22  ? 29  GLY D CA  1 
ATOM   4502 C  C   . GLY D  1 31  ? -10.914 -55.430 -2.964  1.00 19.71  ? 29  GLY D C   1 
ATOM   4503 O  O   . GLY D  1 31  ? -11.210 -56.040 -4.005  1.00 20.24  ? 29  GLY D O   1 
ATOM   4504 N  N   . LYS D  1 32  ? -10.945 -54.104 -2.860  1.00 19.87  ? 30  LYS D N   1 
ATOM   4505 C  CA  . LYS D  1 32  ? -11.479 -53.277 -3.919  1.00 20.89  ? 30  LYS D CA  1 
ATOM   4506 C  C   . LYS D  1 32  ? -10.396 -52.888 -4.915  1.00 19.21  ? 30  LYS D C   1 
ATOM   4507 O  O   . LYS D  1 32  ? -9.292  -52.525 -4.527  1.00 17.89  ? 30  LYS D O   1 
ATOM   4508 C  CB  . LYS D  1 32  ? -12.110 -52.015 -3.338  1.00 23.49  ? 30  LYS D CB  1 
ATOM   4509 C  CG  . LYS D  1 32  ? -12.691 -51.092 -4.397  1.00 27.53  ? 30  LYS D CG  1 
ATOM   4510 C  CD  . LYS D  1 32  ? -13.302 -49.849 -3.778  1.00 33.86  ? 30  LYS D CD  1 
ATOM   4511 C  CE  . LYS D  1 32  ? -14.714 -50.139 -3.303  1.00 39.82  ? 30  LYS D CE  1 
ATOM   4512 N  NZ  . LYS D  1 32  ? -15.320 -48.919 -2.706  1.00 45.48  ? 30  LYS D NZ  1 
ATOM   4513 N  N   . TRP D  1 33  ? -10.730 -52.963 -6.198  1.00 18.34  ? 31  TRP D N   1 
ATOM   4514 C  CA  . TRP D  1 33  ? -9.889  -52.416 -7.262  1.00 19.15  ? 31  TRP D CA  1 
ATOM   4515 C  C   . TRP D  1 33  ? -10.717 -51.490 -8.157  1.00 19.02  ? 31  TRP D C   1 
ATOM   4516 O  O   . TRP D  1 33  ? -11.862 -51.790 -8.468  1.00 18.72  ? 31  TRP D O   1 
ATOM   4517 C  CB  . TRP D  1 33  ? -9.352  -53.545 -8.149  1.00 18.68  ? 31  TRP D CB  1 
ATOM   4518 C  CG  . TRP D  1 33  ? -8.377  -54.469 -7.520  1.00 17.61  ? 31  TRP D CG  1 
ATOM   4519 C  CD1 . TRP D  1 33  ? -8.631  -55.720 -7.013  1.00 17.14  ? 31  TRP D CD1 1 
ATOM   4520 C  CD2 . TRP D  1 33  ? -6.964  -54.271 -7.410  1.00 17.48  ? 31  TRP D CD2 1 
ATOM   4521 N  NE1 . TRP D  1 33  ? -7.461  -56.305 -6.576  1.00 16.82  ? 31  TRP D NE1 1 
ATOM   4522 C  CE2 . TRP D  1 33  ? -6.425  -55.438 -6.812  1.00 17.40  ? 31  TRP D CE2 1 
ATOM   4523 C  CE3 . TRP D  1 33  ? -6.098  -53.226 -7.762  1.00 17.57  ? 31  TRP D CE3 1 
ATOM   4524 C  CZ2 . TRP D  1 33  ? -5.069  -55.578 -6.551  1.00 17.20  ? 31  TRP D CZ2 1 
ATOM   4525 C  CZ3 . TRP D  1 33  ? -4.755  -53.366 -7.502  1.00 17.97  ? 31  TRP D CZ3 1 
ATOM   4526 C  CH2 . TRP D  1 33  ? -4.249  -54.536 -6.902  1.00 17.15  ? 31  TRP D CH2 1 
ATOM   4527 N  N   . TYR D  1 34  ? -10.122 -50.385 -8.583  1.00 18.69  ? 32  TYR D N   1 
ATOM   4528 C  CA  . TYR D  1 34  ? -10.772 -49.469 -9.502  1.00 19.62  ? 32  TYR D CA  1 
ATOM   4529 C  C   . TYR D  1 34  ? -10.344 -49.818 -10.905 1.00 19.22  ? 32  TYR D C   1 
ATOM   4530 O  O   . TYR D  1 34  ? -9.172  -50.060 -11.152 1.00 18.68  ? 32  TYR D O   1 
ATOM   4531 C  CB  . TYR D  1 34  ? -10.377 -48.015 -9.189  1.00 20.65  ? 32  TYR D CB  1 
ATOM   4532 C  CG  . TYR D  1 34  ? -10.922 -47.499 -7.885  1.00 21.08  ? 32  TYR D CG  1 
ATOM   4533 C  CD1 . TYR D  1 34  ? -12.223 -47.062 -7.785  1.00 21.86  ? 32  TYR D CD1 1 
ATOM   4534 C  CD2 . TYR D  1 34  ? -10.124 -47.439 -6.750  1.00 22.53  ? 32  TYR D CD2 1 
ATOM   4535 C  CE1 . TYR D  1 34  ? -12.720 -46.564 -6.594  1.00 22.82  ? 32  TYR D CE1 1 
ATOM   4536 C  CE2 . TYR D  1 34  ? -10.624 -46.965 -5.545  1.00 23.15  ? 32  TYR D CE2 1 
ATOM   4537 C  CZ  . TYR D  1 34  ? -11.922 -46.514 -5.479  1.00 23.39  ? 32  TYR D CZ  1 
ATOM   4538 O  OH  . TYR D  1 34  ? -12.439 -46.034 -4.292  1.00 23.21  ? 32  TYR D OH  1 
ATOM   4539 N  N   . VAL D  1 35  ? -11.275 -49.775 -11.845 1.00 20.06  ? 33  VAL D N   1 
ATOM   4540 C  CA  . VAL D  1 35  ? -10.915 -49.987 -13.236 1.00 20.41  ? 33  VAL D CA  1 
ATOM   4541 C  C   . VAL D  1 35  ? -10.429 -48.694 -13.877 1.00 21.24  ? 33  VAL D C   1 
ATOM   4542 O  O   . VAL D  1 35  ? -11.216 -47.833 -14.275 1.00 23.89  ? 33  VAL D O   1 
ATOM   4543 C  CB  . VAL D  1 35  ? -12.075 -50.581 -14.031 1.00 21.31  ? 33  VAL D CB  1 
ATOM   4544 C  CG1 . VAL D  1 35  ? -11.697 -50.728 -15.491 1.00 22.08  ? 33  VAL D CG1 1 
ATOM   4545 C  CG2 . VAL D  1 35  ? -12.455 -51.926 -13.445 1.00 21.19  ? 33  VAL D CG2 1 
ATOM   4546 N  N   . VAL D  1 36  ? -9.114  -48.563 -13.944 1.00 21.39  ? 34  VAL D N   1 
ATOM   4547 C  CA  . VAL D  1 36  ? -8.462  -47.322 -14.351 1.00 22.06  ? 34  VAL D CA  1 
ATOM   4548 C  C   . VAL D  1 36  ? -8.204  -47.352 -15.852 1.00 21.85  ? 34  VAL D C   1 
ATOM   4549 O  O   . VAL D  1 36  ? -8.075  -46.312 -16.492 1.00 22.16  ? 34  VAL D O   1 
ATOM   4550 C  CB  . VAL D  1 36  ? -7.131  -47.159 -13.589 1.00 23.94  ? 34  VAL D CB  1 
ATOM   4551 C  CG1 . VAL D  1 36  ? -6.254  -46.087 -14.225 1.00 27.80  ? 34  VAL D CG1 1 
ATOM   4552 C  CG2 . VAL D  1 36  ? -7.407  -46.820 -12.132 1.00 24.89  ? 34  VAL D CG2 1 
ATOM   4553 N  N   . GLY D  1 37  ? -8.117  -48.558 -16.409 1.00 21.13  ? 35  GLY D N   1 
ATOM   4554 C  CA  . GLY D  1 37  ? -7.946  -48.732 -17.845 1.00 21.14  ? 35  GLY D CA  1 
ATOM   4555 C  C   . GLY D  1 37  ? -8.679  -49.945 -18.364 1.00 20.88  ? 35  GLY D C   1 
ATOM   4556 O  O   . GLY D  1 37  ? -8.802  -50.946 -17.670 1.00 19.20  ? 35  GLY D O   1 
ATOM   4557 N  N   . LEU D  1 38  ? -9.136  -49.862 -19.605 1.00 22.83  ? 36  LEU D N   1 
ATOM   4558 C  CA  . LEU D  1 38  ? -9.886  -50.934 -20.237 1.00 23.45  ? 36  LEU D CA  1 
ATOM   4559 C  C   . LEU D  1 38  ? -9.436  -51.036 -21.682 1.00 23.72  ? 36  LEU D C   1 
ATOM   4560 O  O   . LEU D  1 38  ? -9.487  -50.055 -22.416 1.00 24.41  ? 36  LEU D O   1 
ATOM   4561 C  CB  . LEU D  1 38  ? -11.370 -50.578 -20.235 1.00 28.37  ? 36  LEU D CB  1 
ATOM   4562 C  CG  . LEU D  1 38  ? -12.339 -51.363 -19.358 1.00 30.77  ? 36  LEU D CG  1 
ATOM   4563 C  CD1 . LEU D  1 38  ? -13.756 -50.942 -19.727 1.00 35.25  ? 36  LEU D CD1 1 
ATOM   4564 C  CD2 . LEU D  1 38  ? -12.156 -52.856 -19.566 1.00 30.51  ? 36  LEU D CD2 1 
ATOM   4565 N  N   . ALA D  1 39  ? -9.069  -52.231 -22.120 1.00 23.26  ? 37  ALA D N   1 
ATOM   4566 C  CA  . ALA D  1 39  ? -8.774  -52.447 -23.527 1.00 23.66  ? 37  ALA D CA  1 
ATOM   4567 C  C   . ALA D  1 39  ? -9.368  -53.761 -23.987 1.00 22.50  ? 37  ALA D C   1 
ATOM   4568 O  O   . ALA D  1 39  ? -9.398  -54.721 -23.222 1.00 21.50  ? 37  ALA D O   1 
ATOM   4569 C  CB  . ALA D  1 39  ? -7.275  -52.441 -23.739 1.00 23.99  ? 37  ALA D CB  1 
ATOM   4570 N  N   . GLY D  1 40  ? -9.839  -53.812 -25.233 1.00 21.93  ? 38  GLY D N   1 
ATOM   4571 C  CA  . GLY D  1 40  ? -10.350 -55.055 -25.770 1.00 21.29  ? 38  GLY D CA  1 
ATOM   4572 C  C   . GLY D  1 40  ? -11.030 -54.941 -27.111 1.00 21.82  ? 38  GLY D C   1 
ATOM   4573 O  O   . GLY D  1 40  ? -11.216 -53.855 -27.631 1.00 22.95  ? 38  GLY D O   1 
ATOM   4574 N  N   . ASN D  1 41  ? -11.359 -56.082 -27.699 1.00 21.52  ? 39  ASN D N   1 
ATOM   4575 C  CA  . ASN D  1 41  ? -11.783 -56.104 -29.086 1.00 22.74  ? 39  ASN D CA  1 
ATOM   4576 C  C   . ASN D  1 41  ? -13.229 -55.655 -29.274 1.00 25.06  ? 39  ASN D C   1 
ATOM   4577 O  O   . ASN D  1 41  ? -13.679 -55.450 -30.395 1.00 26.62  ? 39  ASN D O   1 
ATOM   4578 C  CB  . ASN D  1 41  ? -11.493 -57.454 -29.747 1.00 21.75  ? 39  ASN D CB  1 
ATOM   4579 C  CG  . ASN D  1 41  ? -12.262 -58.610 -29.132 1.00 20.99  ? 39  ASN D CG  1 
ATOM   4580 O  OD1 . ASN D  1 41  ? -12.869 -58.495 -28.071 1.00 20.20  ? 39  ASN D OD1 1 
ATOM   4581 N  ND2 . ASN D  1 41  ? -12.219 -59.753 -29.810 1.00 20.85  ? 39  ASN D ND2 1 
ATOM   4582 N  N   . ALA D  1 42  ? -13.935 -55.448 -28.171 1.00 26.30  ? 40  ALA D N   1 
ATOM   4583 C  CA  . ALA D  1 42  ? -15.248 -54.802 -28.215 1.00 29.80  ? 40  ALA D CA  1 
ATOM   4584 C  C   . ALA D  1 42  ? -15.269 -53.456 -27.512 1.00 32.51  ? 40  ALA D C   1 
ATOM   4585 O  O   . ALA D  1 42  ? -16.322 -52.828 -27.409 1.00 33.87  ? 40  ALA D O   1 
ATOM   4586 C  CB  . ALA D  1 42  ? -16.302 -55.703 -27.602 1.00 29.70  ? 40  ALA D CB  1 
ATOM   4587 N  N   . ILE D  1 43  ? -14.121 -53.038 -26.990 1.00 34.35  ? 41  ILE D N   1 
ATOM   4588 C  CA  . ILE D  1 43  ? -13.990 -51.723 -26.385 1.00 39.69  ? 41  ILE D CA  1 
ATOM   4589 C  C   . ILE D  1 43  ? -13.743 -50.690 -27.485 1.00 45.80  ? 41  ILE D C   1 
ATOM   4590 O  O   . ILE D  1 43  ? -12.828 -50.840 -28.291 1.00 45.36  ? 41  ILE D O   1 
ATOM   4591 C  CB  . ILE D  1 43  ? -12.807 -51.679 -25.398 1.00 40.65  ? 41  ILE D CB  1 
ATOM   4592 C  CG1 . ILE D  1 43  ? -13.069 -52.572 -24.178 1.00 41.28  ? 41  ILE D CG1 1 
ATOM   4593 C  CG2 . ILE D  1 43  ? -12.558 -50.255 -24.944 1.00 40.91  ? 41  ILE D CG2 1 
ATOM   4594 C  CD1 . ILE D  1 43  ? -14.299 -52.164 -23.391 1.00 43.57  ? 41  ILE D CD1 1 
ATOM   4595 N  N   . LEU D  1 44  ? -14.556 -49.642 -27.502 1.00 52.81  ? 42  LEU D N   1 
ATOM   4596 C  CA  . LEU D  1 44  ? -14.451 -48.609 -28.527 1.00 62.01  ? 42  LEU D CA  1 
ATOM   4597 C  C   . LEU D  1 44  ? -14.508 -47.221 -27.886 1.00 67.98  ? 42  LEU D C   1 
ATOM   4598 O  O   . LEU D  1 44  ? -15.486 -46.868 -27.227 1.00 68.85  ? 42  LEU D O   1 
ATOM   4599 C  CB  . LEU D  1 44  ? -15.572 -48.759 -29.562 1.00 63.87  ? 42  LEU D CB  1 
ATOM   4600 C  CG  . LEU D  1 44  ? -15.280 -48.284 -30.992 1.00 66.75  ? 42  LEU D CG  1 
ATOM   4601 C  CD1 . LEU D  1 44  ? -13.800 -48.402 -31.339 1.00 65.80  ? 42  LEU D CD1 1 
ATOM   4602 C  CD2 . LEU D  1 44  ? -16.121 -49.070 -31.987 1.00 67.19  ? 42  LEU D CD2 1 
ATOM   4603 N  N   . ARG D  1 45  ? -13.440 -46.451 -28.067 1.00 67.91  ? 43  ARG D N   1 
ATOM   4604 C  CA  . ARG D  1 45  ? -13.384 -45.085 -27.565 1.00 74.66  ? 43  ARG D CA  1 
ATOM   4605 C  C   . ARG D  1 45  ? -14.508 -44.235 -28.156 1.00 76.72  ? 43  ARG D C   1 
ATOM   4606 O  O   . ARG D  1 45  ? -14.615 -44.093 -29.374 1.00 72.92  ? 43  ARG D O   1 
ATOM   4607 C  CB  . ARG D  1 45  ? -12.027 -44.467 -27.905 1.00 76.73  ? 43  ARG D CB  1 
ATOM   4608 C  CG  . ARG D  1 45  ? -11.531 -43.432 -26.908 1.00 79.06  ? 43  ARG D CG  1 
ATOM   4609 C  CD  . ARG D  1 45  ? -10.017 -43.517 -26.769 1.00 81.41  ? 43  ARG D CD  1 
ATOM   4610 N  NE  . ARG D  1 45  ? -9.460  -42.387 -26.035 1.00 91.98  ? 43  ARG D NE  1 
ATOM   4611 C  CZ  . ARG D  1 45  ? -8.161  -42.111 -25.961 1.00 99.48  ? 43  ARG D CZ  1 
ATOM   4612 N  NH1 . ARG D  1 45  ? -7.748  -41.067 -25.256 1.00 101.78 ? 43  ARG D NH1 1 
ATOM   4613 N  NH2 . ARG D  1 45  ? -7.277  -42.868 -26.599 1.00 98.92  ? 43  ARG D NH2 1 
ATOM   4614 N  N   . GLU D  1 46  ? -15.350 -43.692 -27.280 1.00 80.18  ? 44  GLU D N   1 
ATOM   4615 C  CA  . GLU D  1 46  ? -16.338 -42.691 -27.668 1.00 85.14  ? 44  GLU D CA  1 
ATOM   4616 C  C   . GLU D  1 46  ? -16.019 -41.355 -26.987 1.00 85.74  ? 44  GLU D C   1 
ATOM   4617 O  O   . GLU D  1 46  ? -16.276 -41.171 -25.785 1.00 80.46  ? 44  GLU D O   1 
ATOM   4618 C  CB  . GLU D  1 46  ? -17.752 -43.156 -27.292 1.00 83.77  ? 44  GLU D CB  1 
ATOM   4619 N  N   . ASP D  1 47  ? -15.434 -40.440 -27.755 0.50 83.10  ? 45  ASP D N   1 
ATOM   4620 C  CA  . ASP D  1 47  ? -15.121 -39.099 -27.261 0.50 82.19  ? 45  ASP D CA  1 
ATOM   4621 C  C   . ASP D  1 47  ? -16.377 -38.388 -26.764 0.50 81.46  ? 45  ASP D C   1 
ATOM   4622 O  O   . ASP D  1 47  ? -16.342 -37.681 -25.759 0.50 75.97  ? 45  ASP D O   1 
ATOM   4623 C  CB  . ASP D  1 47  ? -14.457 -38.265 -28.359 1.00 83.16  ? 45  ASP D CB  1 
ATOM   4624 N  N   . LYS D  1 48  ? -17.484 -38.579 -27.476 1.00 87.46  ? 46  LYS D N   1 
ATOM   4625 C  CA  . LYS D  1 48  ? -18.726 -37.872 -27.178 1.00 96.30  ? 46  LYS D CA  1 
ATOM   4626 C  C   . LYS D  1 48  ? -19.296 -38.270 -25.817 1.00 96.89  ? 46  LYS D C   1 
ATOM   4627 O  O   . LYS D  1 48  ? -19.721 -37.408 -25.047 1.00 100.31 ? 46  LYS D O   1 
ATOM   4628 C  CB  . LYS D  1 48  ? -19.765 -38.125 -28.277 1.00 94.42  ? 46  LYS D CB  1 
ATOM   4629 N  N   . ASP D  1 49  ? -19.313 -39.569 -25.525 1.00 92.91  ? 47  ASP D N   1 
ATOM   4630 C  CA  . ASP D  1 49  ? -19.964 -40.071 -24.312 1.00 94.06  ? 47  ASP D CA  1 
ATOM   4631 C  C   . ASP D  1 49  ? -19.064 -41.022 -23.513 1.00 85.15  ? 47  ASP D C   1 
ATOM   4632 O  O   . ASP D  1 49  ? -19.197 -42.242 -23.611 1.00 84.04  ? 47  ASP D O   1 
ATOM   4633 C  CB  . ASP D  1 49  ? -21.271 -40.782 -24.676 1.00 96.20  ? 47  ASP D CB  1 
ATOM   4634 C  CG  . ASP D  1 49  ? -21.975 -41.363 -23.467 1.00 95.23  ? 47  ASP D CG  1 
ATOM   4635 O  OD1 . ASP D  1 49  ? -21.996 -40.699 -22.409 1.00 85.59  ? 47  ASP D OD1 1 
ATOM   4636 O  OD2 . ASP D  1 49  ? -22.503 -42.489 -23.578 1.00 94.20  ? 47  ASP D OD2 1 
ATOM   4637 N  N   . PRO D  1 50  ? -18.162 -40.460 -22.690 1.00 72.57  ? 48  PRO D N   1 
ATOM   4638 C  CA  . PRO D  1 50  ? -17.057 -41.242 -22.141 1.00 62.89  ? 48  PRO D CA  1 
ATOM   4639 C  C   . PRO D  1 50  ? -17.501 -42.217 -21.045 1.00 56.70  ? 48  PRO D C   1 
ATOM   4640 O  O   . PRO D  1 50  ? -18.419 -41.936 -20.284 1.00 57.69  ? 48  PRO D O   1 
ATOM   4641 C  CB  . PRO D  1 50  ? -16.131 -40.171 -21.564 1.00 62.51  ? 48  PRO D CB  1 
ATOM   4642 C  CG  . PRO D  1 50  ? -17.045 -39.053 -21.180 1.00 66.39  ? 48  PRO D CG  1 
ATOM   4643 C  CD  . PRO D  1 50  ? -18.195 -39.086 -22.151 1.00 67.72  ? 48  PRO D CD  1 
ATOM   4644 N  N   . GLN D  1 51  ? -16.839 -43.359 -20.971 1.00 51.90  ? 49  GLN D N   1 
ATOM   4645 C  CA  . GLN D  1 51  ? -17.171 -44.377 -19.984 1.00 48.17  ? 49  GLN D CA  1 
ATOM   4646 C  C   . GLN D  1 51  ? -16.731 -43.966 -18.566 1.00 43.00  ? 49  GLN D C   1 
ATOM   4647 O  O   . GLN D  1 51  ? -15.656 -43.404 -18.373 1.00 41.95  ? 49  GLN D O   1 
ATOM   4648 C  CB  . GLN D  1 51  ? -16.529 -45.701 -20.394 1.00 47.91  ? 49  GLN D CB  1 
ATOM   4649 C  CG  . GLN D  1 51  ? -16.254 -46.635 -19.238 1.00 53.23  ? 49  GLN D CG  1 
ATOM   4650 C  CD  . GLN D  1 51  ? -16.782 -48.031 -19.481 1.00 59.82  ? 49  GLN D CD  1 
ATOM   4651 O  OE1 . GLN D  1 51  ? -16.658 -48.571 -20.582 1.00 63.01  ? 49  GLN D OE1 1 
ATOM   4652 N  NE2 . GLN D  1 51  ? -17.381 -48.623 -18.454 1.00 61.69  ? 49  GLN D NE2 1 
ATOM   4653 N  N   . LYS D  1 52  ? -17.580 -44.239 -17.582 1.00 37.71  ? 50  LYS D N   1 
ATOM   4654 C  CA  . LYS D  1 52  ? -17.286 -43.886 -16.200 1.00 35.57  ? 50  LYS D CA  1 
ATOM   4655 C  C   . LYS D  1 52  ? -16.546 -45.001 -15.482 1.00 31.24  ? 50  LYS D C   1 
ATOM   4656 O  O   . LYS D  1 52  ? -16.787 -46.177 -15.732 1.00 30.38  ? 50  LYS D O   1 
ATOM   4657 C  CB  . LYS D  1 52  ? -18.573 -43.569 -15.451 1.00 36.38  ? 50  LYS D CB  1 
ATOM   4658 C  CG  . LYS D  1 52  ? -19.259 -42.321 -15.960 1.00 38.82  ? 50  LYS D CG  1 
ATOM   4659 C  CD  . LYS D  1 52  ? -20.539 -42.059 -15.191 1.00 40.39  ? 50  LYS D CD  1 
ATOM   4660 C  CE  . LYS D  1 52  ? -21.434 -41.102 -15.949 1.00 42.85  ? 50  LYS D CE  1 
ATOM   4661 N  NZ  . LYS D  1 52  ? -22.494 -40.584 -15.049 1.00 45.06  ? 50  LYS D NZ  1 
ATOM   4662 N  N   . MET D  1 53  ? -15.630 -44.617 -14.604 1.00 28.91  ? 51  MET D N   1 
ATOM   4663 C  CA  . MET D  1 53  ? -14.944 -45.566 -13.746 1.00 26.54  ? 51  MET D CA  1 
ATOM   4664 C  C   . MET D  1 53  ? -15.947 -46.361 -12.920 1.00 25.57  ? 51  MET D C   1 
ATOM   4665 O  O   . MET D  1 53  ? -16.939 -45.826 -12.436 1.00 25.76  ? 51  MET D O   1 
ATOM   4666 C  CB  . MET D  1 53  ? -13.986 -44.824 -12.821 1.00 26.29  ? 51  MET D CB  1 
ATOM   4667 C  CG  . MET D  1 53  ? -13.059 -45.729 -12.026 1.00 25.38  ? 51  MET D CG  1 
ATOM   4668 S  SD  . MET D  1 53  ? -11.747 -44.789 -11.202 1.00 26.61  ? 51  MET D SD  1 
ATOM   4669 C  CE  . MET D  1 53  ? -10.735 -44.339 -12.612 1.00 25.92  ? 51  MET D CE  1 
ATOM   4670 N  N   . TYR D  1 54  ? -15.674 -47.651 -12.771 1.00 24.27  ? 52  TYR D N   1 
ATOM   4671 C  CA  . TYR D  1 54  ? -16.373 -48.486 -11.808 1.00 22.94  ? 52  TYR D CA  1 
ATOM   4672 C  C   . TYR D  1 54  ? -15.352 -49.251 -11.003 1.00 20.87  ? 52  TYR D C   1 
ATOM   4673 O  O   . TYR D  1 54  ? -14.161 -49.204 -11.303 1.00 20.31  ? 52  TYR D O   1 
ATOM   4674 C  CB  . TYR D  1 54  ? -17.334 -49.453 -12.512 1.00 23.86  ? 52  TYR D CB  1 
ATOM   4675 C  CG  . TYR D  1 54  ? -16.685 -50.387 -13.531 1.00 24.12  ? 52  TYR D CG  1 
ATOM   4676 C  CD1 . TYR D  1 54  ? -16.527 -50.005 -14.864 1.00 24.96  ? 52  TYR D CD1 1 
ATOM   4677 C  CD2 . TYR D  1 54  ? -16.263 -51.655 -13.166 1.00 23.49  ? 52  TYR D CD2 1 
ATOM   4678 C  CE1 . TYR D  1 54  ? -15.953 -50.857 -15.797 1.00 24.73  ? 52  TYR D CE1 1 
ATOM   4679 C  CE2 . TYR D  1 54  ? -15.689 -52.516 -14.088 1.00 22.85  ? 52  TYR D CE2 1 
ATOM   4680 C  CZ  . TYR D  1 54  ? -15.530 -52.110 -15.399 1.00 24.04  ? 52  TYR D CZ  1 
ATOM   4681 O  OH  . TYR D  1 54  ? -14.947 -52.952 -16.323 1.00 25.27  ? 52  TYR D OH  1 
ATOM   4682 N  N   . ALA D  1 55  ? -15.814 -49.940 -9.967  1.00 20.84  ? 53  ALA D N   1 
ATOM   4683 C  CA  . ALA D  1 55  ? -14.930 -50.691 -9.076  1.00 19.19  ? 53  ALA D CA  1 
ATOM   4684 C  C   . ALA D  1 55  ? -15.316 -52.161 -9.035  1.00 19.36  ? 53  ALA D C   1 
ATOM   4685 O  O   . ALA D  1 55  ? -16.470 -52.519 -9.241  1.00 19.55  ? 53  ALA D O   1 
ATOM   4686 C  CB  . ALA D  1 55  ? -14.973 -50.114 -7.673  1.00 19.18  ? 53  ALA D CB  1 
ATOM   4687 N  N   . THR D  1 56  ? -14.335 -53.014 -8.765  1.00 18.43  ? 54  THR D N   1 
ATOM   4688 C  CA  . THR D  1 56  ? -14.583 -54.434 -8.680  1.00 18.68  ? 54  THR D CA  1 
ATOM   4689 C  C   . THR D  1 56  ? -13.944 -55.006 -7.429  1.00 18.09  ? 54  THR D C   1 
ATOM   4690 O  O   . THR D  1 56  ? -12.777 -54.760 -7.159  1.00 18.83  ? 54  THR D O   1 
ATOM   4691 C  CB  . THR D  1 56  ? -14.055 -55.157 -9.930  1.00 18.70  ? 54  THR D CB  1 
ATOM   4692 O  OG1 . THR D  1 56  ? -14.761 -54.694 -11.079 1.00 20.64  ? 54  THR D OG1 1 
ATOM   4693 C  CG2 . THR D  1 56  ? -14.245 -56.649 -9.805  1.00 18.98  ? 54  THR D CG2 1 
ATOM   4694 N  N   . ILE D  1 57  ? -14.726 -55.759 -6.666  1.00 18.66  ? 55  ILE D N   1 
ATOM   4695 C  CA  . ILE D  1 57  ? -14.338 -56.165 -5.323  1.00 18.29  ? 55  ILE D CA  1 
ATOM   4696 C  C   . ILE D  1 57  ? -14.204 -57.684 -5.249  1.00 17.51  ? 55  ILE D C   1 
ATOM   4697 O  O   . ILE D  1 57  ? -15.135 -58.420 -5.569  1.00 17.35  ? 55  ILE D O   1 
ATOM   4698 C  CB  . ILE D  1 57  ? -15.381 -55.705 -4.288  1.00 19.49  ? 55  ILE D CB  1 
ATOM   4699 C  CG1 . ILE D  1 57  ? -15.537 -54.184 -4.335  1.00 19.66  ? 55  ILE D CG1 1 
ATOM   4700 C  CG2 . ILE D  1 57  ? -14.971 -56.150 -2.892  1.00 19.97  ? 55  ILE D CG2 1 
ATOM   4701 C  CD1 . ILE D  1 57  ? -16.819 -53.688 -3.702  1.00 21.06  ? 55  ILE D CD1 1 
ATOM   4702 N  N   . TYR D  1 58  ? -13.017 -58.141 -4.874  1.00 18.05  ? 56  TYR D N   1 
ATOM   4703 C  CA  . TYR D  1 58  ? -12.707 -59.570 -4.839  1.00 19.04  ? 56  TYR D CA  1 
ATOM   4704 C  C   . TYR D  1 58  ? -12.741 -60.076 -3.394  1.00 20.86  ? 56  TYR D C   1 
ATOM   4705 O  O   . TYR D  1 58  ? -12.001 -59.585 -2.539  1.00 18.02  ? 56  TYR D O   1 
ATOM   4706 C  CB  . TYR D  1 58  ? -11.323 -59.824 -5.423  1.00 17.20  ? 56  TYR D CB  1 
ATOM   4707 C  CG  . TYR D  1 58  ? -11.241 -59.702 -6.921  1.00 17.11  ? 56  TYR D CG  1 
ATOM   4708 C  CD1 . TYR D  1 58  ? -11.095 -60.835 -7.727  1.00 17.69  ? 56  TYR D CD1 1 
ATOM   4709 C  CD2 . TYR D  1 58  ? -11.292 -58.466 -7.540  1.00 16.65  ? 56  TYR D CD2 1 
ATOM   4710 C  CE1 . TYR D  1 58  ? -11.008 -60.731 -9.104  1.00 16.63  ? 56  TYR D CE1 1 
ATOM   4711 C  CE2 . TYR D  1 58  ? -11.213 -58.354 -8.916  1.00 16.51  ? 56  TYR D CE2 1 
ATOM   4712 C  CZ  . TYR D  1 58  ? -11.073 -59.492 -9.690  1.00 16.39  ? 56  TYR D CZ  1 
ATOM   4713 O  OH  . TYR D  1 58  ? -10.984 -59.386 -11.059 1.00 16.53  ? 56  TYR D OH  1 
ATOM   4714 N  N   . GLU D  1 59  ? -13.605 -61.052 -3.133  1.00 24.21  ? 57  GLU D N   1 
ATOM   4715 C  CA  . GLU D  1 59  ? -13.699 -61.652 -1.812  1.00 27.50  ? 57  GLU D CA  1 
ATOM   4716 C  C   . GLU D  1 59  ? -13.384 -63.144 -1.902  1.00 25.86  ? 57  GLU D C   1 
ATOM   4717 O  O   . GLU D  1 59  ? -14.075 -63.906 -2.573  1.00 25.77  ? 57  GLU D O   1 
ATOM   4718 C  CB  . GLU D  1 59  ? -15.097 -61.451 -1.237  1.00 31.77  ? 57  GLU D CB  1 
ATOM   4719 C  CG  . GLU D  1 59  ? -15.288 -60.107 -0.557  1.00 40.28  ? 57  GLU D CG  1 
ATOM   4720 C  CD  . GLU D  1 59  ? -16.747 -59.726 -0.373  1.00 45.90  ? 57  GLU D CD  1 
ATOM   4721 O  OE1 . GLU D  1 59  ? -17.640 -60.549 -0.661  1.00 49.34  ? 57  GLU D OE1 1 
ATOM   4722 O  OE2 . GLU D  1 59  ? -16.992 -58.591 0.072   1.00 58.80  ? 57  GLU D OE2 1 
ATOM   4723 N  N   . LEU D  1 60  ? -12.336 -63.551 -1.213  1.00 24.57  ? 58  LEU D N   1 
ATOM   4724 C  CA  . LEU D  1 60  ? -11.908 -64.937 -1.220  1.00 24.80  ? 58  LEU D CA  1 
ATOM   4725 C  C   . LEU D  1 60  ? -12.805 -65.741 -0.288  1.00 25.70  ? 58  LEU D C   1 
ATOM   4726 O  O   . LEU D  1 60  ? -12.906 -65.440 0.896   1.00 25.18  ? 58  LEU D O   1 
ATOM   4727 C  CB  . LEU D  1 60  ? -10.459 -65.011 -0.751  1.00 24.73  ? 58  LEU D CB  1 
ATOM   4728 C  CG  . LEU D  1 60  ? -9.721  -66.332 -0.936  1.00 25.38  ? 58  LEU D CG  1 
ATOM   4729 C  CD1 . LEU D  1 60  ? -9.692  -66.737 -2.407  1.00 25.79  ? 58  LEU D CD1 1 
ATOM   4730 C  CD2 . LEU D  1 60  ? -8.308  -66.207 -0.385  1.00 23.81  ? 58  LEU D CD2 1 
ATOM   4731 N  N   . LYS D  1 61  ? -13.447 -66.769 -0.816  1.00 28.87  ? 59  LYS D N   1 
ATOM   4732 C  CA  . LYS D  1 61  ? -14.307 -67.620 0.004   1.00 33.54  ? 59  LYS D CA  1 
ATOM   4733 C  C   . LYS D  1 61  ? -13.527 -68.772 0.630   1.00 34.96  ? 59  LYS D C   1 
ATOM   4734 O  O   . LYS D  1 61  ? -12.398 -69.068 0.233   1.00 33.40  ? 59  LYS D O   1 
ATOM   4735 C  CB  . LYS D  1 61  ? -15.444 -68.189 -0.840  1.00 37.94  ? 59  LYS D CB  1 
ATOM   4736 C  CG  . LYS D  1 61  ? -16.178 -67.146 -1.659  1.00 40.20  ? 59  LYS D CG  1 
ATOM   4737 C  CD  . LYS D  1 61  ? -17.638 -67.512 -1.856  1.00 45.22  ? 59  LYS D CD  1 
ATOM   4738 C  CE  . LYS D  1 61  ? -17.802 -68.903 -2.439  1.00 48.81  ? 59  LYS D CE  1 
ATOM   4739 N  NZ  . LYS D  1 61  ? -18.634 -68.894 -3.670  1.00 51.25  ? 59  LYS D NZ  1 
ATOM   4740 N  N   . GLU D  1 62  ? -14.154 -69.435 1.594   1.00 38.63  ? 60  GLU D N   1 
ATOM   4741 C  CA  . GLU D  1 62  ? -13.566 -70.604 2.237   1.00 41.03  ? 60  GLU D CA  1 
ATOM   4742 C  C   . GLU D  1 62  ? -13.032 -71.608 1.222   1.00 36.91  ? 60  GLU D C   1 
ATOM   4743 O  O   . GLU D  1 62  ? -11.949 -72.151 1.399   1.00 39.36  ? 60  GLU D O   1 
ATOM   4744 C  CB  . GLU D  1 62  ? -14.596 -71.281 3.135   1.00 48.79  ? 60  GLU D CB  1 
ATOM   4745 C  CG  . GLU D  1 62  ? -14.170 -72.654 3.628   1.00 61.28  ? 60  GLU D CG  1 
ATOM   4746 C  CD  . GLU D  1 62  ? -14.595 -72.923 5.064   1.00 72.72  ? 60  GLU D CD  1 
ATOM   4747 O  OE1 . GLU D  1 62  ? -14.851 -71.954 5.815   1.00 74.05  ? 60  GLU D OE1 1 
ATOM   4748 O  OE2 . GLU D  1 62  ? -14.665 -74.110 5.445   1.00 71.89  ? 60  GLU D OE2 1 
ATOM   4749 N  N   . ASP D  1 63  ? -13.783 -71.846 0.153   1.00 34.13  ? 61  ASP D N   1 
ATOM   4750 C  CA  . ASP D  1 63  ? -13.397 -72.845 -0.839  1.00 32.53  ? 61  ASP D CA  1 
ATOM   4751 C  C   . ASP D  1 63  ? -12.402 -72.317 -1.890  1.00 30.19  ? 61  ASP D C   1 
ATOM   4752 O  O   . ASP D  1 63  ? -12.103 -73.008 -2.864  1.00 29.84  ? 61  ASP D O   1 
ATOM   4753 C  CB  . ASP D  1 63  ? -14.642 -73.420 -1.517  1.00 32.28  ? 61  ASP D CB  1 
ATOM   4754 C  CG  . ASP D  1 63  ? -15.299 -72.442 -2.486  1.00 32.81  ? 61  ASP D CG  1 
ATOM   4755 O  OD1 . ASP D  1 63  ? -14.783 -71.319 -2.697  1.00 29.61  ? 61  ASP D OD1 1 
ATOM   4756 O  OD2 . ASP D  1 63  ? -16.342 -72.808 -3.061  1.00 34.52  ? 61  ASP D OD2 1 
ATOM   4757 N  N   . LYS D  1 64  ? -11.911 -71.094 -1.698  1.00 28.62  ? 62  LYS D N   1 
ATOM   4758 C  CA  . LYS D  1 64  ? -10.832 -70.522 -2.522  1.00 28.66  ? 62  LYS D CA  1 
ATOM   4759 C  C   . LYS D  1 64  ? -11.306 -69.970 -3.866  1.00 25.59  ? 62  LYS D C   1 
ATOM   4760 O  O   . LYS D  1 64  ? -10.500 -69.519 -4.676  1.00 26.19  ? 62  LYS D O   1 
ATOM   4761 C  CB  . LYS D  1 64  ? -9.717  -71.536 -2.774  1.00 33.07  ? 62  LYS D CB  1 
ATOM   4762 C  CG  . LYS D  1 64  ? -9.032  -72.042 -1.513  1.00 38.43  ? 62  LYS D CG  1 
ATOM   4763 C  CD  . LYS D  1 64  ? -8.438  -70.915 -0.692  1.00 37.29  ? 62  LYS D CD  1 
ATOM   4764 C  CE  . LYS D  1 64  ? -7.791  -71.452 0.576   1.00 42.13  ? 62  LYS D CE  1 
ATOM   4765 N  NZ  . LYS D  1 64  ? -7.560  -70.372 1.570   1.00 40.23  ? 62  LYS D NZ  1 
ATOM   4766 N  N   . SER D  1 65  ? -12.606 -70.008 -4.108  1.00 24.11  ? 63  SER D N   1 
ATOM   4767 C  CA  . SER D  1 65  ? -13.176 -69.236 -5.187  1.00 22.19  ? 63  SER D CA  1 
ATOM   4768 C  C   . SER D  1 65  ? -13.319 -67.793 -4.729  1.00 20.89  ? 63  SER D C   1 
ATOM   4769 O  O   . SER D  1 65  ? -13.370 -67.525 -3.529  1.00 19.42  ? 63  SER D O   1 
ATOM   4770 C  CB  . SER D  1 65  ? -14.532 -69.813 -5.586  1.00 23.25  ? 63  SER D CB  1 
ATOM   4771 O  OG  . SER D  1 65  ? -14.350 -71.049 -6.247  1.00 24.44  ? 63  SER D OG  1 
ATOM   4772 N  N   . TYR D  1 66  ? -13.383 -66.870 -5.688  1.00 19.98  ? 64  TYR D N   1 
ATOM   4773 C  CA  . TYR D  1 66  ? -13.724 -65.489 -5.383  1.00 20.44  ? 64  TYR D CA  1 
ATOM   4774 C  C   . TYR D  1 66  ? -15.203 -65.248 -5.626  1.00 22.39  ? 64  TYR D C   1 
ATOM   4775 O  O   . TYR D  1 66  ? -15.744 -65.626 -6.666  1.00 21.89  ? 64  TYR D O   1 
ATOM   4776 C  CB  . TYR D  1 66  ? -12.941 -64.524 -6.264  1.00 19.98  ? 64  TYR D CB  1 
ATOM   4777 C  CG  . TYR D  1 66  ? -11.483 -64.323 -5.917  1.00 19.47  ? 64  TYR D CG  1 
ATOM   4778 C  CD1 . TYR D  1 66  ? -10.488 -64.698 -6.811  1.00 19.13  ? 64  TYR D CD1 1 
ATOM   4779 C  CD2 . TYR D  1 66  ? -11.100 -63.705 -4.732  1.00 19.80  ? 64  TYR D CD2 1 
ATOM   4780 C  CE1 . TYR D  1 66  ? -9.157  -64.482 -6.528  1.00 18.98  ? 64  TYR D CE1 1 
ATOM   4781 C  CE2 . TYR D  1 66  ? -9.764  -63.489 -4.438  1.00 18.66  ? 64  TYR D CE2 1 
ATOM   4782 C  CZ  . TYR D  1 66  ? -8.798  -63.877 -5.341  1.00 18.68  ? 64  TYR D CZ  1 
ATOM   4783 O  OH  . TYR D  1 66  ? -7.463  -63.660 -5.089  1.00 17.98  ? 64  TYR D OH  1 
ATOM   4784 N  N   . ASN D  1 67  ? -15.844 -64.564 -4.686  1.00 23.96  ? 65  ASN D N   1 
ATOM   4785 C  CA  . ASN D  1 67  ? -16.951 -63.705 -5.024  1.00 24.30  ? 65  ASN D CA  1 
ATOM   4786 C  C   . ASN D  1 67  ? -16.455 -62.393 -5.573  1.00 21.85  ? 65  ASN D C   1 
ATOM   4787 O  O   . ASN D  1 67  ? -15.699 -61.683 -4.908  1.00 20.54  ? 65  ASN D O   1 
ATOM   4788 C  CB  . ASN D  1 67  ? -17.783 -63.394 -3.803  1.00 27.37  ? 65  ASN D CB  1 
ATOM   4789 C  CG  . ASN D  1 67  ? -19.226 -63.751 -4.000  1.00 31.87  ? 65  ASN D CG  1 
ATOM   4790 O  OD1 . ASN D  1 67  ? -19.579 -64.919 -4.141  1.00 35.99  ? 65  ASN D OD1 1 
ATOM   4791 N  ND2 . ASN D  1 67  ? -20.073 -62.736 -4.058  1.00 35.07  ? 65  ASN D ND2 1 
ATOM   4792 N  N   . VAL D  1 68  ? -16.954 -62.034 -6.747  1.00 20.17  ? 66  VAL D N   1 
ATOM   4793 C  CA  . VAL D  1 68  ? -16.512 -60.828 -7.411  1.00 18.58  ? 66  VAL D CA  1 
ATOM   4794 C  C   . VAL D  1 68  ? -17.696 -59.908 -7.653  1.00 19.38  ? 66  VAL D C   1 
ATOM   4795 O  O   . VAL D  1 68  ? -18.682 -60.291 -8.290  1.00 20.11  ? 66  VAL D O   1 
ATOM   4796 C  CB  . VAL D  1 68  ? -15.845 -61.163 -8.744  1.00 18.36  ? 66  VAL D CB  1 
ATOM   4797 C  CG1 . VAL D  1 68  ? -15.226 -59.920 -9.350  1.00 17.86  ? 66  VAL D CG1 1 
ATOM   4798 C  CG2 . VAL D  1 68  ? -14.788 -62.241 -8.545  1.00 17.57  ? 66  VAL D CG2 1 
ATOM   4799 N  N   . THR D  1 69  ? -17.613 -58.704 -7.096  1.00 18.91  ? 67  THR D N   1 
ATOM   4800 C  CA  . THR D  1 69  ? -18.710 -57.754 -7.168  1.00 19.86  ? 67  THR D CA  1 
ATOM   4801 C  C   . THR D  1 69  ? -18.230 -56.468 -7.823  1.00 19.14  ? 67  THR D C   1 
ATOM   4802 O  O   . THR D  1 69  ? -17.262 -55.843 -7.378  1.00 18.40  ? 67  THR D O   1 
ATOM   4803 C  CB  . THR D  1 69  ? -19.268 -57.441 -5.769  1.00 20.39  ? 67  THR D CB  1 
ATOM   4804 O  OG1 . THR D  1 69  ? -19.563 -58.674 -5.090  1.00 20.98  ? 67  THR D OG1 1 
ATOM   4805 C  CG2 . THR D  1 69  ? -20.525 -56.607 -5.876  1.00 21.14  ? 67  THR D CG2 1 
ATOM   4806 N  N   . SER D  1 70  ? -18.885 -56.091 -8.906  1.00 19.66  ? 68  SER D N   1 
ATOM   4807 C  CA  . SER D  1 70  ? -18.571 -54.836 -9.560  1.00 19.55  ? 68  SER D CA  1 
ATOM   4808 C  C   . SER D  1 70  ? -19.662 -53.835 -9.241  1.00 20.47  ? 68  SER D C   1 
ATOM   4809 O  O   . SER D  1 70  ? -20.851 -54.158 -9.284  1.00 21.83  ? 68  SER D O   1 
ATOM   4810 C  CB  . SER D  1 70  ? -18.434 -55.039 -11.068 1.00 19.82  ? 68  SER D CB  1 
ATOM   4811 O  OG  . SER D  1 70  ? -17.157 -55.566 -11.392 1.00 18.80  ? 68  SER D OG  1 
ATOM   4812 N  N   . VAL D  1 71  ? -19.248 -52.622 -8.914  1.00 20.45  ? 69  VAL D N   1 
ATOM   4813 C  CA  . VAL D  1 71  ? -20.183 -51.557 -8.592  1.00 22.41  ? 69  VAL D CA  1 
ATOM   4814 C  C   . VAL D  1 71  ? -20.096 -50.464 -9.649  1.00 22.93  ? 69  VAL D C   1 
ATOM   4815 O  O   . VAL D  1 71  ? -19.015 -49.920 -9.887  1.00 22.01  ? 69  VAL D O   1 
ATOM   4816 C  CB  . VAL D  1 71  ? -19.838 -50.957 -7.219  1.00 22.12  ? 69  VAL D CB  1 
ATOM   4817 C  CG1 . VAL D  1 71  ? -20.922 -50.003 -6.758  1.00 23.68  ? 69  VAL D CG1 1 
ATOM   4818 C  CG2 . VAL D  1 71  ? -19.636 -52.069 -6.207  1.00 21.68  ? 69  VAL D CG2 1 
ATOM   4819 N  N   . LEU D  1 72  ? -21.227 -50.157 -10.285 1.00 24.80  ? 70  LEU D N   1 
ATOM   4820 C  CA  . LEU D  1 72  ? -21.275 -49.164 -11.359 1.00 26.17  ? 70  LEU D CA  1 
ATOM   4821 C  C   . LEU D  1 72  ? -22.289 -48.085 -11.037 1.00 26.73  ? 70  LEU D C   1 
ATOM   4822 O  O   . LEU D  1 72  ? -23.307 -48.357 -10.417 1.00 26.94  ? 70  LEU D O   1 
ATOM   4823 C  CB  . LEU D  1 72  ? -21.688 -49.813 -12.682 1.00 28.44  ? 70  LEU D CB  1 
ATOM   4824 C  CG  . LEU D  1 72  ? -20.709 -50.770 -13.356 1.00 29.10  ? 70  LEU D CG  1 
ATOM   4825 C  CD1 . LEU D  1 72  ? -20.655 -52.090 -12.605 1.00 29.65  ? 70  LEU D CD1 1 
ATOM   4826 C  CD2 . LEU D  1 72  ? -21.143 -51.015 -14.798 1.00 31.01  ? 70  LEU D CD2 1 
ATOM   4827 N  N   . PHE D  1 73  ? -22.032 -46.872 -11.515 1.00 26.71  ? 71  PHE D N   1 
ATOM   4828 C  CA  . PHE D  1 73  ? -23.019 -45.803 -11.477 1.00 27.91  ? 71  PHE D CA  1 
ATOM   4829 C  C   . PHE D  1 73  ? -23.733 -45.711 -12.827 1.00 29.52  ? 71  PHE D C   1 
ATOM   4830 O  O   . PHE D  1 73  ? -23.134 -45.304 -13.807 1.00 29.48  ? 71  PHE D O   1 
ATOM   4831 C  CB  . PHE D  1 73  ? -22.326 -44.473 -11.129 1.00 27.61  ? 71  PHE D CB  1 
ATOM   4832 C  CG  . PHE D  1 73  ? -23.267 -43.315 -10.925 1.00 29.16  ? 71  PHE D CG  1 
ATOM   4833 C  CD1 . PHE D  1 73  ? -24.340 -43.418 -10.063 1.00 29.98  ? 71  PHE D CD1 1 
ATOM   4834 C  CD2 . PHE D  1 73  ? -23.042 -42.106 -11.556 1.00 30.20  ? 71  PHE D CD2 1 
ATOM   4835 C  CE1 . PHE D  1 73  ? -25.190 -42.342 -9.855  1.00 31.90  ? 71  PHE D CE1 1 
ATOM   4836 C  CE2 . PHE D  1 73  ? -23.887 -41.021 -11.353 1.00 32.16  ? 71  PHE D CE2 1 
ATOM   4837 C  CZ  . PHE D  1 73  ? -24.969 -41.142 -10.505 1.00 32.86  ? 71  PHE D CZ  1 
ATOM   4838 N  N   . ARG D  1 74  ? -25.012 -46.087 -12.860 1.00 31.05  ? 72  ARG D N   1 
ATOM   4839 C  CA  . ARG D  1 74  ? -25.784 -46.135 -14.092 1.00 32.96  ? 72  ARG D CA  1 
ATOM   4840 C  C   . ARG D  1 74  ? -27.218 -45.668 -13.860 1.00 35.62  ? 72  ARG D C   1 
ATOM   4841 O  O   . ARG D  1 74  ? -27.897 -46.148 -12.948 1.00 36.01  ? 72  ARG D O   1 
ATOM   4842 C  CB  . ARG D  1 74  ? -25.809 -47.562 -14.637 1.00 32.37  ? 72  ARG D CB  1 
ATOM   4843 N  N   . LYS D  1 75  ? -27.679 -44.743 -14.699 1.00 37.73  ? 73  LYS D N   1 
ATOM   4844 C  CA  . LYS D  1 75  ? -29.042 -44.225 -14.617 1.00 40.35  ? 73  LYS D CA  1 
ATOM   4845 C  C   . LYS D  1 75  ? -29.316 -43.715 -13.201 1.00 40.17  ? 73  LYS D C   1 
ATOM   4846 O  O   . LYS D  1 75  ? -30.421 -43.849 -12.672 1.00 41.44  ? 73  LYS D O   1 
ATOM   4847 C  CB  . LYS D  1 75  ? -30.058 -45.296 -15.030 1.00 41.69  ? 73  LYS D CB  1 
ATOM   4848 N  N   . LYS D  1 76  ? -28.289 -43.113 -12.605 1.00 38.67  ? 74  LYS D N   1 
ATOM   4849 C  CA  . LYS D  1 76  ? -28.406 -42.387 -11.336 1.00 38.66  ? 74  LYS D CA  1 
ATOM   4850 C  C   . LYS D  1 76  ? -28.536 -43.285 -10.110 1.00 37.14  ? 74  LYS D C   1 
ATOM   4851 O  O   . LYS D  1 76  ? -28.919 -42.825 -9.041  1.00 37.29  ? 74  LYS D O   1 
ATOM   4852 C  CB  . LYS D  1 76  ? -29.562 -41.386 -11.392 1.00 41.77  ? 74  LYS D CB  1 
ATOM   4853 C  CG  . LYS D  1 76  ? -29.291 -40.219 -12.321 1.00 43.43  ? 74  LYS D CG  1 
ATOM   4854 C  CD  . LYS D  1 76  ? -30.470 -39.265 -12.381 1.00 47.16  ? 74  LYS D CD  1 
ATOM   4855 C  CE  . LYS D  1 76  ? -30.268 -38.210 -13.461 1.00 49.34  ? 74  LYS D CE  1 
ATOM   4856 N  NZ  . LYS D  1 76  ? -31.312 -37.147 -13.398 1.00 52.76  ? 74  LYS D NZ  1 
ATOM   4857 N  N   . LYS D  1 77  ? -28.178 -44.553 -10.263 1.00 35.81  ? 75  LYS D N   1 
ATOM   4858 C  CA  . LYS D  1 77  ? -28.206 -45.497 -9.157  1.00 34.64  ? 75  LYS D CA  1 
ATOM   4859 C  C   . LYS D  1 77  ? -26.945 -46.326 -9.146  1.00 32.13  ? 75  LYS D C   1 
ATOM   4860 O  O   . LYS D  1 77  ? -26.228 -46.393 -10.137 1.00 31.58  ? 75  LYS D O   1 
ATOM   4861 C  CB  . LYS D  1 77  ? -29.423 -46.406 -9.274  1.00 36.45  ? 75  LYS D CB  1 
ATOM   4862 C  CG  . LYS D  1 77  ? -30.733 -45.656 -9.142  1.00 39.26  ? 75  LYS D CG  1 
ATOM   4863 C  CD  . LYS D  1 77  ? -31.893 -46.585 -8.842  1.00 40.98  ? 75  LYS D CD  1 
ATOM   4864 C  CE  . LYS D  1 77  ? -33.193 -45.808 -8.859  1.00 44.33  ? 75  LYS D CE  1 
ATOM   4865 N  NZ  . LYS D  1 77  ? -34.351 -46.682 -8.545  1.00 46.67  ? 75  LYS D NZ  1 
ATOM   4866 N  N   . CYS D  1 78  ? -26.668 -46.950 -8.010  1.00 31.30  ? 76  CYS D N   1 
ATOM   4867 C  CA  . CYS D  1 78  ? -25.598 -47.933 -7.913  1.00 29.46  ? 76  CYS D CA  1 
ATOM   4868 C  C   . CYS D  1 78  ? -26.082 -49.292 -8.380  1.00 29.91  ? 76  CYS D C   1 
ATOM   4869 O  O   . CYS D  1 78  ? -27.103 -49.799 -7.910  1.00 30.89  ? 76  CYS D O   1 
ATOM   4870 C  CB  . CYS D  1 78  ? -25.096 -48.037 -6.480  1.00 28.72  ? 76  CYS D CB  1 
ATOM   4871 S  SG  . CYS D  1 78  ? -24.572 -46.443 -5.814  1.00 29.61  ? 76  CYS D SG  1 
ATOM   4872 N  N   . ASP D  1 79  ? -25.353 -49.850 -9.339  1.00 29.15  ? 77  ASP D N   1 
ATOM   4873 C  CA  A ASP D  1 79  ? -25.715 -51.116 -9.947  0.50 29.82  ? 77  ASP D CA  1 
ATOM   4874 C  CA  B ASP D  1 79  ? -25.710 -51.113 -9.963  0.50 29.61  ? 77  ASP D CA  1 
ATOM   4875 C  C   . ASP D  1 79  ? -24.649 -52.125 -9.563  1.00 27.93  ? 77  ASP D C   1 
ATOM   4876 O  O   . ASP D  1 79  ? -23.457 -51.811 -9.541  1.00 26.44  ? 77  ASP D O   1 
ATOM   4877 C  CB  A ASP D  1 79  ? -25.800 -50.982 -11.473 0.50 30.85  ? 77  ASP D CB  1 
ATOM   4878 C  CB  B ASP D  1 79  ? -25.772 -50.937 -11.493 0.50 30.40  ? 77  ASP D CB  1 
ATOM   4879 C  CG  A ASP D  1 79  ? -27.095 -50.320 -11.942 0.50 33.56  ? 77  ASP D CG  1 
ATOM   4880 C  CG  B ASP D  1 79  ? -26.014 -52.243 -12.239 0.50 30.57  ? 77  ASP D CG  1 
ATOM   4881 O  OD1 A ASP D  1 79  ? -27.482 -50.537 -13.111 0.50 34.49  ? 77  ASP D OD1 1 
ATOM   4882 O  OD1 B ASP D  1 79  ? -27.113 -52.822 -12.099 0.50 32.24  ? 77  ASP D OD1 1 
ATOM   4883 O  OD2 A ASP D  1 79  ? -27.717 -49.567 -11.156 0.50 34.88  ? 77  ASP D OD2 1 
ATOM   4884 O  OD2 B ASP D  1 79  ? -25.125 -52.663 -13.010 0.50 29.04  ? 77  ASP D OD2 1 
ATOM   4885 N  N   . TYR D  1 80  ? -25.076 -53.332 -9.240  1.00 28.99  ? 78  TYR D N   1 
ATOM   4886 C  CA  . TYR D  1 80  ? -24.156 -54.331 -8.718  1.00 29.05  ? 78  TYR D CA  1 
ATOM   4887 C  C   . TYR D  1 80  ? -24.191 -55.585 -9.606  1.00 30.29  ? 78  TYR D C   1 
ATOM   4888 O  O   . TYR D  1 80  ? -25.261 -56.133 -9.837  1.00 33.00  ? 78  TYR D O   1 
ATOM   4889 C  CB  . TYR D  1 80  ? -24.552 -54.666 -7.277  1.00 29.21  ? 78  TYR D CB  1 
ATOM   4890 C  CG  . TYR D  1 80  ? -24.457 -53.487 -6.313  1.00 28.89  ? 78  TYR D CG  1 
ATOM   4891 C  CD1 . TYR D  1 80  ? -23.276 -53.203 -5.652  1.00 27.91  ? 78  TYR D CD1 1 
ATOM   4892 C  CD2 . TYR D  1 80  ? -25.551 -52.660 -6.072  1.00 31.29  ? 78  TYR D CD2 1 
ATOM   4893 C  CE1 . TYR D  1 80  ? -23.180 -52.129 -4.776  1.00 27.48  ? 78  TYR D CE1 1 
ATOM   4894 C  CE2 . TYR D  1 80  ? -25.470 -51.584 -5.193  1.00 30.53  ? 78  TYR D CE2 1 
ATOM   4895 C  CZ  . TYR D  1 80  ? -24.279 -51.320 -4.546  1.00 29.02  ? 78  TYR D CZ  1 
ATOM   4896 O  OH  . TYR D  1 80  ? -24.164 -50.239 -3.674  1.00 28.17  ? 78  TYR D OH  1 
ATOM   4897 N  N   . TRP D  1 81  ? -23.042 -55.999 -10.149 1.00 29.71  ? 79  TRP D N   1 
ATOM   4898 C  CA  . TRP D  1 81  ? -22.934 -57.304 -10.819 1.00 30.86  ? 79  TRP D CA  1 
ATOM   4899 C  C   . TRP D  1 81  ? -22.076 -58.257 -9.987  1.00 27.47  ? 79  TRP D C   1 
ATOM   4900 O  O   . TRP D  1 81  ? -20.880 -58.036 -9.783  1.00 23.82  ? 79  TRP D O   1 
ATOM   4901 C  CB  . TRP D  1 81  ? -22.357 -57.198 -12.242 1.00 31.91  ? 79  TRP D CB  1 
ATOM   4902 C  CG  . TRP D  1 81  ? -22.262 -58.550 -12.920 1.00 36.11  ? 79  TRP D CG  1 
ATOM   4903 C  CD1 . TRP D  1 81  ? -23.199 -59.552 -12.879 1.00 40.21  ? 79  TRP D CD1 1 
ATOM   4904 C  CD2 . TRP D  1 81  ? -21.159 -59.074 -13.687 1.00 39.34  ? 79  TRP D CD2 1 
ATOM   4905 N  NE1 . TRP D  1 81  ? -22.754 -60.653 -13.575 1.00 43.21  ? 79  TRP D NE1 1 
ATOM   4906 C  CE2 . TRP D  1 81  ? -21.509 -60.390 -14.083 1.00 42.76  ? 79  TRP D CE2 1 
ATOM   4907 C  CE3 . TRP D  1 81  ? -19.924 -58.559 -14.091 1.00 40.24  ? 79  TRP D CE3 1 
ATOM   4908 C  CZ2 . TRP D  1 81  ? -20.659 -61.199 -14.857 1.00 41.81  ? 79  TRP D CZ2 1 
ATOM   4909 C  CZ3 . TRP D  1 81  ? -19.078 -59.364 -14.863 1.00 42.12  ? 79  TRP D CZ3 1 
ATOM   4910 C  CH2 . TRP D  1 81  ? -19.455 -60.670 -15.234 1.00 42.44  ? 79  TRP D CH2 1 
ATOM   4911 N  N   . ILE D  1 82  ? -22.706 -59.323 -9.518  1.00 27.70  ? 80  ILE D N   1 
ATOM   4912 C  CA  . ILE D  1 82  ? -22.025 -60.323 -8.717  1.00 26.92  ? 80  ILE D CA  1 
ATOM   4913 C  C   . ILE D  1 82  ? -21.802 -61.575 -9.544  1.00 26.27  ? 80  ILE D C   1 
ATOM   4914 O  O   . ILE D  1 82  ? -22.721 -62.079 -10.176 1.00 27.21  ? 80  ILE D O   1 
ATOM   4915 C  CB  . ILE D  1 82  ? -22.866 -60.692 -7.487  1.00 28.01  ? 80  ILE D CB  1 
ATOM   4916 C  CG1 . ILE D  1 82  ? -23.140 -59.436 -6.645  1.00 28.48  ? 80  ILE D CG1 1 
ATOM   4917 C  CG2 . ILE D  1 82  ? -22.152 -61.750 -6.662  1.00 27.08  ? 80  ILE D CG2 1 
ATOM   4918 C  CD1 . ILE D  1 82  ? -24.272 -59.603 -5.653  1.00 30.05  ? 80  ILE D CD1 1 
ATOM   4919 N  N   . ARG D  1 83  ? -20.582 -62.091 -9.518  1.00 25.11  ? 81  ARG D N   1 
ATOM   4920 C  CA  . ARG D  1 83  ? -20.327 -63.403 -10.082 1.00 25.97  ? 81  ARG D CA  1 
ATOM   4921 C  C   . ARG D  1 83  ? -19.197 -64.123 -9.340  1.00 23.50  ? 81  ARG D C   1 
ATOM   4922 O  O   . ARG D  1 83  ? -18.597 -63.581 -8.416  1.00 21.67  ? 81  ARG D O   1 
ATOM   4923 C  CB  . ARG D  1 83  ? -20.025 -63.281 -11.583 1.00 26.43  ? 81  ARG D CB  1 
ATOM   4924 C  CG  . ARG D  1 83  ? -18.698 -62.635 -11.908 1.00 24.88  ? 81  ARG D CG  1 
ATOM   4925 C  CD  . ARG D  1 83  ? -18.722 -61.158 -11.580 1.00 26.11  ? 81  ARG D CD  1 
ATOM   4926 N  NE  . ARG D  1 83  ? -17.618 -60.436 -12.211 1.00 26.54  ? 81  ARG D NE  1 
ATOM   4927 C  CZ  . ARG D  1 83  ? -17.328 -59.156 -11.974 1.00 27.03  ? 81  ARG D CZ  1 
ATOM   4928 N  NH1 . ARG D  1 83  ? -18.068 -58.442 -11.127 1.00 26.62  ? 81  ARG D NH1 1 
ATOM   4929 N  NH2 . ARG D  1 83  ? -16.307 -58.586 -12.600 1.00 26.01  ? 81  ARG D NH2 1 
ATOM   4930 N  N   . THR D  1 84  ? -18.919 -65.349 -9.763  1.00 22.95  ? 82  THR D N   1 
ATOM   4931 C  CA  . THR D  1 84  ? -17.995 -66.220 -9.070  1.00 22.07  ? 82  THR D CA  1 
ATOM   4932 C  C   . THR D  1 84  ? -16.809 -66.552 -9.986  1.00 21.15  ? 82  THR D C   1 
ATOM   4933 O  O   . THR D  1 84  ? -17.002 -66.979 -11.123 1.00 21.63  ? 82  THR D O   1 
ATOM   4934 C  CB  . THR D  1 84  ? -18.718 -67.504 -8.642  1.00 23.55  ? 82  THR D CB  1 
ATOM   4935 O  OG1 . THR D  1 84  ? -19.781 -67.160 -7.754  1.00 24.83  ? 82  THR D OG1 1 
ATOM   4936 C  CG2 . THR D  1 84  ? -17.778 -68.461 -7.930  1.00 23.83  ? 82  THR D CG2 1 
ATOM   4937 N  N   . PHE D  1 85  ? -15.585 -66.339 -9.501  1.00 18.98  ? 83  PHE D N   1 
ATOM   4938 C  CA  . PHE D  1 85  ? -14.388 -66.842 -10.195 1.00 18.49  ? 83  PHE D CA  1 
ATOM   4939 C  C   . PHE D  1 85  ? -13.859 -68.123 -9.541  1.00 18.76  ? 83  PHE D C   1 
ATOM   4940 O  O   . PHE D  1 85  ? -13.469 -68.112 -8.370  1.00 17.64  ? 83  PHE D O   1 
ATOM   4941 C  CB  . PHE D  1 85  ? -13.283 -65.790 -10.195 1.00 16.93  ? 83  PHE D CB  1 
ATOM   4942 C  CG  . PHE D  1 85  ? -13.536 -64.626 -11.122 1.00 16.58  ? 83  PHE D CG  1 
ATOM   4943 C  CD1 . PHE D  1 85  ? -12.607 -63.610 -11.230 1.00 16.44  ? 83  PHE D CD1 1 
ATOM   4944 C  CD2 . PHE D  1 85  ? -14.699 -64.531 -11.858 1.00 17.85  ? 83  PHE D CD2 1 
ATOM   4945 C  CE1 . PHE D  1 85  ? -12.845 -62.512 -12.036 1.00 16.36  ? 83  PHE D CE1 1 
ATOM   4946 C  CE2 . PHE D  1 85  ? -14.938 -63.446 -12.682 1.00 17.85  ? 83  PHE D CE2 1 
ATOM   4947 C  CZ  . PHE D  1 85  ? -14.011 -62.431 -12.767 1.00 16.65  ? 83  PHE D CZ  1 
ATOM   4948 N  N   . VAL D  1 86  ? -13.869 -69.220 -10.304 1.00 19.65  ? 84  VAL D N   1 
ATOM   4949 C  CA  . VAL D  1 86  ? -13.419 -70.525 -9.821  1.00 19.93  ? 84  VAL D CA  1 
ATOM   4950 C  C   . VAL D  1 86  ? -11.976 -70.793 -10.248 1.00 18.94  ? 84  VAL D C   1 
ATOM   4951 O  O   . VAL D  1 86  ? -11.631 -70.593 -11.403 1.00 18.52  ? 84  VAL D O   1 
ATOM   4952 C  CB  . VAL D  1 86  ? -14.313 -71.658 -10.371 1.00 22.01  ? 84  VAL D CB  1 
ATOM   4953 C  CG1 . VAL D  1 86  ? -13.833 -73.017 -9.870  1.00 23.29  ? 84  VAL D CG1 1 
ATOM   4954 C  CG2 . VAL D  1 86  ? -15.761 -71.441 -9.956  1.00 23.20  ? 84  VAL D CG2 1 
ATOM   4955 N  N   . PRO D  1 87  ? -11.120 -71.224 -9.309  1.00 18.85  ? 85  PRO D N   1 
ATOM   4956 C  CA  . PRO D  1 87  ? -9.708  -71.439 -9.632  1.00 18.64  ? 85  PRO D CA  1 
ATOM   4957 C  C   . PRO D  1 87  ? -9.557  -72.398 -10.797 1.00 18.44  ? 85  PRO D C   1 
ATOM   4958 O  O   . PRO D  1 87  ? -10.242 -73.402 -10.849 1.00 19.87  ? 85  PRO D O   1 
ATOM   4959 C  CB  . PRO D  1 87  ? -9.141  -72.063 -8.361  1.00 19.17  ? 85  PRO D CB  1 
ATOM   4960 C  CG  . PRO D  1 87  ? -10.072 -71.645 -7.273  1.00 19.77  ? 85  PRO D CG  1 
ATOM   4961 C  CD  . PRO D  1 87  ? -11.429 -71.551 -7.910  1.00 20.17  ? 85  PRO D CD  1 
ATOM   4962 N  N   . GLY D  1 88  ? -8.706  -72.052 -11.750 1.00 18.29  ? 86  GLY D N   1 
ATOM   4963 C  CA  . GLY D  1 88  ? -8.491  -72.865 -12.937 1.00 19.26  ? 86  GLY D CA  1 
ATOM   4964 C  C   . GLY D  1 88  ? -7.187  -73.648 -12.867 1.00 20.46  ? 86  GLY D C   1 
ATOM   4965 O  O   . GLY D  1 88  ? -6.822  -74.181 -11.816 1.00 21.16  ? 86  GLY D O   1 
ATOM   4966 N  N   . SER D  1 89  ? -6.473  -73.670 -13.986 1.00 20.13  ? 87  SER D N   1 
ATOM   4967 C  CA  . SER D  1 89  ? -5.408  -74.627 -14.224 1.00 21.78  ? 87  SER D CA  1 
ATOM   4968 C  C   . SER D  1 89  ? -4.097  -74.276 -13.519 1.00 23.27  ? 87  SER D C   1 
ATOM   4969 O  O   . SER D  1 89  ? -3.221  -75.121 -13.397 1.00 23.98  ? 87  SER D O   1 
ATOM   4970 C  CB  . SER D  1 89  ? -5.136  -74.733 -15.717 1.00 20.22  ? 87  SER D CB  1 
ATOM   4971 O  OG  . SER D  1 89  ? -4.447  -73.585 -16.152 1.00 19.73  ? 87  SER D OG  1 
ATOM   4972 N  N   . GLN D  1 90  ? -3.948  -73.022 -13.114 1.00 23.24  ? 88  GLN D N   1 
ATOM   4973 C  CA  . GLN D  1 90  ? -2.759  -72.586 -12.369 1.00 23.93  ? 88  GLN D CA  1 
ATOM   4974 C  C   . GLN D  1 90  ? -3.092  -71.320 -11.539 1.00 24.25  ? 88  GLN D C   1 
ATOM   4975 O  O   . GLN D  1 90  ? -4.059  -70.605 -11.826 1.00 24.81  ? 88  GLN D O   1 
ATOM   4976 C  CB  . GLN D  1 90  ? -1.587  -72.306 -13.321 1.00 23.27  ? 88  GLN D CB  1 
ATOM   4977 C  CG  . GLN D  1 90  ? -1.934  -71.301 -14.410 1.00 24.05  ? 88  GLN D CG  1 
ATOM   4978 C  CD  . GLN D  1 90  ? -0.997  -71.310 -15.620 1.00 24.17  ? 88  GLN D CD  1 
ATOM   4979 O  OE1 . GLN D  1 90  ? 0.115   -71.843 -15.581 1.00 22.69  ? 88  GLN D OE1 1 
ATOM   4980 N  NE2 . GLN D  1 90  ? -1.455  -70.694 -16.710 1.00 23.72  ? 88  GLN D NE2 1 
ATOM   4981 N  N   . PRO D  1 91  ? -2.316  -71.058 -10.481 1.00 23.54  ? 89  PRO D N   1 
ATOM   4982 C  CA  . PRO D  1 91  ? -2.720  -69.995 -9.569  1.00 21.13  ? 89  PRO D CA  1 
ATOM   4983 C  C   . PRO D  1 91  ? -2.759  -68.668 -10.303 1.00 18.87  ? 89  PRO D C   1 
ATOM   4984 O  O   . PRO D  1 91  ? -1.823  -68.334 -11.018 1.00 16.54  ? 89  PRO D O   1 
ATOM   4985 C  CB  . PRO D  1 91  ? -1.633  -70.025 -8.487  1.00 20.83  ? 89  PRO D CB  1 
ATOM   4986 C  CG  . PRO D  1 91  ? -1.091  -71.412 -8.529  1.00 21.94  ? 89  PRO D CG  1 
ATOM   4987 C  CD  . PRO D  1 91  ? -1.142  -71.796 -9.984  1.00 23.58  ? 89  PRO D CD  1 
ATOM   4988 N  N   . GLY D  1 92  ? -3.843  -67.922 -10.126 1.00 18.36  ? 90  GLY D N   1 
ATOM   4989 C  CA  . GLY D  1 92  ? -4.005  -66.652 -10.824 1.00 17.97  ? 90  GLY D CA  1 
ATOM   4990 C  C   . GLY D  1 92  ? -4.877  -66.773 -12.058 1.00 17.09  ? 90  GLY D C   1 
ATOM   4991 O  O   . GLY D  1 92  ? -5.173  -65.786 -12.714 1.00 15.60  ? 90  GLY D O   1 
ATOM   4992 N  N   . GLU D  1 93  ? -5.284  -67.995 -12.374 1.00 18.10  ? 91  GLU D N   1 
ATOM   4993 C  CA  . GLU D  1 93  ? -6.192  -68.250 -13.482 1.00 18.36  ? 91  GLU D CA  1 
ATOM   4994 C  C   . GLU D  1 93  ? -7.541  -68.768 -12.977 1.00 17.01  ? 91  GLU D C   1 
ATOM   4995 O  O   . GLU D  1 93  ? -7.611  -69.499 -11.999 1.00 16.37  ? 91  GLU D O   1 
ATOM   4996 C  CB  . GLU D  1 93  ? -5.533  -69.252 -14.437 1.00 21.54  ? 91  GLU D CB  1 
ATOM   4997 C  CG  . GLU D  1 93  ? -6.196  -69.354 -15.801 1.00 25.28  ? 91  GLU D CG  1 
ATOM   4998 C  CD  . GLU D  1 93  ? -5.303  -70.009 -16.852 1.00 27.33  ? 91  GLU D CD  1 
ATOM   4999 O  OE1 . GLU D  1 93  ? -4.217  -69.457 -17.186 1.00 26.32  ? 91  GLU D OE1 1 
ATOM   5000 O  OE2 . GLU D  1 93  ? -5.708  -71.075 -17.366 1.00 26.53  ? 91  GLU D OE2 1 
ATOM   5001 N  N   . PHE D  1 94  ? -8.619  -68.317 -13.600 1.00 17.30  ? 92  PHE D N   1 
ATOM   5002 C  CA  . PHE D  1 94  ? -9.959  -68.633 -13.128 1.00 17.82  ? 92  PHE D CA  1 
ATOM   5003 C  C   . PHE D  1 94  ? -10.886 -68.888 -14.308 1.00 18.84  ? 92  PHE D C   1 
ATOM   5004 O  O   . PHE D  1 94  ? -10.679 -68.358 -15.392 1.00 17.85  ? 92  PHE D O   1 
ATOM   5005 C  CB  . PHE D  1 94  ? -10.495 -67.488 -12.245 1.00 17.33  ? 92  PHE D CB  1 
ATOM   5006 C  CG  . PHE D  1 94  ? -9.552  -67.092 -11.137 1.00 16.06  ? 92  PHE D CG  1 
ATOM   5007 C  CD1 . PHE D  1 94  ? -8.569  -66.157 -11.352 1.00 15.81  ? 92  PHE D CD1 1 
ATOM   5008 C  CD2 . PHE D  1 94  ? -9.639  -67.679 -9.898  1.00 15.90  ? 92  PHE D CD2 1 
ATOM   5009 C  CE1 . PHE D  1 94  ? -7.686  -65.806 -10.347 1.00 15.19  ? 92  PHE D CE1 1 
ATOM   5010 C  CE2 . PHE D  1 94  ? -8.762  -67.341 -8.888  1.00 15.42  ? 92  PHE D CE2 1 
ATOM   5011 C  CZ  . PHE D  1 94  ? -7.787  -66.399 -9.109  1.00 15.40  ? 92  PHE D CZ  1 
ATOM   5012 N  N   . THR D  1 95  ? -11.946 -69.651 -14.070 1.00 20.12  ? 93  THR D N   1 
ATOM   5013 C  CA  . THR D  1 95  ? -13.124 -69.630 -14.939 1.00 21.02  ? 93  THR D CA  1 
ATOM   5014 C  C   . THR D  1 95  ? -14.316 -69.054 -14.203 1.00 20.60  ? 93  THR D C   1 
ATOM   5015 O  O   . THR D  1 95  ? -14.303 -68.925 -12.984 1.00 21.21  ? 93  THR D O   1 
ATOM   5016 C  CB  . THR D  1 95  ? -13.458 -71.043 -15.481 1.00 22.10  ? 93  THR D CB  1 
ATOM   5017 O  OG1 . THR D  1 95  ? -13.692 -71.943 -14.402 1.00 22.85  ? 93  THR D OG1 1 
ATOM   5018 C  CG2 . THR D  1 95  ? -12.299 -71.565 -16.310 1.00 23.50  ? 93  THR D CG2 1 
ATOM   5019 N  N   . LEU D  1 96  ? -15.350 -68.704 -14.955 1.00 21.63  ? 94  LEU D N   1 
ATOM   5020 C  CA  . LEU D  1 96  ? -16.587 -68.217 -14.379 1.00 22.46  ? 94  LEU D CA  1 
ATOM   5021 C  C   . LEU D  1 96  ? -17.335 -69.405 -13.821 1.00 23.60  ? 94  LEU D C   1 
ATOM   5022 O  O   . LEU D  1 96  ? -17.469 -70.427 -14.487 1.00 25.63  ? 94  LEU D O   1 
ATOM   5023 C  CB  . LEU D  1 96  ? -17.436 -67.527 -15.450 1.00 23.69  ? 94  LEU D CB  1 
ATOM   5024 C  CG  . LEU D  1 96  ? -18.569 -66.604 -14.995 1.00 24.75  ? 94  LEU D CG  1 
ATOM   5025 C  CD1 . LEU D  1 96  ? -18.010 -65.436 -14.203 1.00 23.56  ? 94  LEU D CD1 1 
ATOM   5026 C  CD2 . LEU D  1 96  ? -19.327 -66.110 -16.210 1.00 26.35  ? 94  LEU D CD2 1 
ATOM   5027 N  N   . GLY D  1 97  ? -17.844 -69.274 -12.606 1.00 24.31  ? 95  GLY D N   1 
ATOM   5028 C  CA  . GLY D  1 97  ? -18.729 -70.286 -12.052 1.00 26.23  ? 95  GLY D CA  1 
ATOM   5029 C  C   . GLY D  1 97  ? -20.131 -70.192 -12.624 1.00 29.03  ? 95  GLY D C   1 
ATOM   5030 O  O   . GLY D  1 97  ? -20.561 -69.125 -13.060 1.00 30.23  ? 95  GLY D O   1 
ATOM   5031 N  N   . ASN D  1 98  ? -20.851 -71.311 -12.601 1.00 30.82  ? 96  ASN D N   1 
ATOM   5032 C  CA  A ASN D  1 98  ? -22.241 -71.361 -13.029 0.50 33.39  ? 96  ASN D CA  1 
ATOM   5033 C  CA  B ASN D  1 98  ? -22.251 -71.334 -13.019 0.50 32.34  ? 96  ASN D CA  1 
ATOM   5034 C  C   . ASN D  1 98  ? -22.440 -70.839 -14.449 1.00 33.22  ? 96  ASN D C   1 
ATOM   5035 O  O   . ASN D  1 98  ? -23.408 -70.131 -14.743 1.00 35.10  ? 96  ASN D O   1 
ATOM   5036 C  CB  A ASN D  1 98  ? -23.114 -70.586 -12.055 0.50 34.95  ? 96  ASN D CB  1 
ATOM   5037 C  CB  B ASN D  1 98  ? -23.102 -70.481 -12.067 0.50 32.44  ? 96  ASN D CB  1 
ATOM   5038 C  CG  A ASN D  1 98  ? -22.960 -71.074 -10.623 0.50 35.94  ? 96  ASN D CG  1 
ATOM   5039 C  CG  B ASN D  1 98  ? -24.557 -70.911 -12.038 0.50 34.22  ? 96  ASN D CG  1 
ATOM   5040 O  OD1 A ASN D  1 98  ? -23.314 -72.210 -10.293 0.50 36.97  ? 96  ASN D OD1 1 
ATOM   5041 O  OD1 B ASN D  1 98  ? -24.947 -71.870 -12.701 0.50 35.18  ? 96  ASN D OD1 1 
ATOM   5042 N  ND2 A ASN D  1 98  ? -22.428 -70.215 -9.764  0.50 35.28  ? 96  ASN D ND2 1 
ATOM   5043 N  ND2 B ASN D  1 98  ? -25.368 -70.199 -11.265 0.50 34.47  ? 96  ASN D ND2 1 
ATOM   5044 N  N   . ILE D  1 99  ? -21.533 -71.221 -15.339 1.00 32.72  ? 97  ILE D N   1 
ATOM   5045 C  CA  . ILE D  1 99  ? -21.564 -70.740 -16.715 1.00 32.53  ? 97  ILE D CA  1 
ATOM   5046 C  C   . ILE D  1 99  ? -22.888 -71.021 -17.412 1.00 34.04  ? 97  ILE D C   1 
ATOM   5047 O  O   . ILE D  1 99  ? -23.295 -70.264 -18.289 1.00 34.46  ? 97  ILE D O   1 
ATOM   5048 C  CB  . ILE D  1 99  ? -20.422 -71.333 -17.575 1.00 31.58  ? 97  ILE D CB  1 
ATOM   5049 C  CG1 . ILE D  1 99  ? -19.266 -70.343 -17.620 1.00 30.69  ? 97  ILE D CG1 1 
ATOM   5050 C  CG2 . ILE D  1 99  ? -20.909 -71.608 -18.992 1.00 32.76  ? 97  ILE D CG2 1 
ATOM   5051 C  CD1 . ILE D  1 99  ? -18.116 -70.782 -18.489 1.00 30.81  ? 97  ILE D CD1 1 
ATOM   5052 N  N   . LYS D  1 100 ? -23.547 -72.111 -17.033 1.00 35.53  ? 98  LYS D N   1 
ATOM   5053 C  CA  . LYS D  1 100 ? -24.788 -72.527 -17.693 1.00 38.44  ? 98  LYS D CA  1 
ATOM   5054 C  C   . LYS D  1 100 ? -25.909 -71.521 -17.462 1.00 39.80  ? 98  LYS D C   1 
ATOM   5055 O  O   . LYS D  1 100 ? -26.888 -71.503 -18.205 1.00 42.44  ? 98  LYS D O   1 
ATOM   5056 C  CB  . LYS D  1 100 ? -25.239 -73.915 -17.202 1.00 39.45  ? 98  LYS D CB  1 
ATOM   5057 N  N   . SER D  1 101 ? -25.775 -70.695 -16.430 1.00 38.53  ? 99  SER D N   1 
ATOM   5058 C  CA  . SER D  1 101 ? -26.833 -69.765 -16.079 1.00 40.32  ? 99  SER D CA  1 
ATOM   5059 C  C   . SER D  1 101 ? -26.760 -68.482 -16.911 1.00 40.48  ? 99  SER D C   1 
ATOM   5060 O  O   . SER D  1 101 ? -27.638 -67.631 -16.809 1.00 41.24  ? 99  SER D O   1 
ATOM   5061 C  CB  . SER D  1 101 ? -26.778 -69.431 -14.585 1.00 39.65  ? 99  SER D CB  1 
ATOM   5062 O  OG  . SER D  1 101 ? -25.749 -68.498 -14.309 1.00 38.58  ? 99  SER D OG  1 
ATOM   5063 N  N   . TYR D  1 102 ? -25.706 -68.334 -17.714 1.00 39.29  ? 100 TYR D N   1 
ATOM   5064 C  CA  . TYR D  1 102 ? -25.594 -67.197 -18.622 1.00 39.18  ? 100 TYR D CA  1 
ATOM   5065 C  C   . TYR D  1 102 ? -25.862 -67.623 -20.056 1.00 40.56  ? 100 TYR D C   1 
ATOM   5066 O  O   . TYR D  1 102 ? -25.057 -68.329 -20.660 1.00 39.65  ? 100 TYR D O   1 
ATOM   5067 C  CB  . TYR D  1 102 ? -24.207 -66.570 -18.542 1.00 36.34  ? 100 TYR D CB  1 
ATOM   5068 C  CG  . TYR D  1 102 ? -23.773 -66.185 -17.161 1.00 34.68  ? 100 TYR D CG  1 
ATOM   5069 C  CD1 . TYR D  1 102 ? -22.999 -67.045 -16.398 1.00 33.25  ? 100 TYR D CD1 1 
ATOM   5070 C  CD2 . TYR D  1 102 ? -24.105 -64.944 -16.625 1.00 35.38  ? 100 TYR D CD2 1 
ATOM   5071 C  CE1 . TYR D  1 102 ? -22.566 -66.681 -15.137 1.00 31.92  ? 100 TYR D CE1 1 
ATOM   5072 C  CE2 . TYR D  1 102 ? -23.680 -64.573 -15.359 1.00 33.59  ? 100 TYR D CE2 1 
ATOM   5073 C  CZ  . TYR D  1 102 ? -22.905 -65.446 -14.625 1.00 31.67  ? 100 TYR D CZ  1 
ATOM   5074 O  OH  . TYR D  1 102 ? -22.497 -65.110 -13.361 1.00 29.44  ? 100 TYR D OH  1 
ATOM   5075 N  N   . PRO D  1 103 ? -27.007 -67.206 -20.609 1.00 44.07  ? 101 PRO D N   1 
ATOM   5076 C  CA  . PRO D  1 103 ? -27.403 -67.748 -21.911 1.00 45.45  ? 101 PRO D CA  1 
ATOM   5077 C  C   . PRO D  1 103 ? -26.419 -67.309 -22.992 1.00 44.36  ? 101 PRO D C   1 
ATOM   5078 O  O   . PRO D  1 103 ? -25.959 -66.162 -22.987 1.00 42.23  ? 101 PRO D O   1 
ATOM   5079 C  CB  . PRO D  1 103 ? -28.793 -67.140 -22.146 1.00 48.02  ? 101 PRO D CB  1 
ATOM   5080 C  CG  . PRO D  1 103 ? -29.262 -66.675 -20.803 1.00 48.32  ? 101 PRO D CG  1 
ATOM   5081 C  CD  . PRO D  1 103 ? -28.015 -66.284 -20.059 1.00 45.48  ? 101 PRO D CD  1 
ATOM   5082 N  N   . GLY D  1 104 ? -26.070 -68.229 -23.885 1.00 45.17  ? 102 GLY D N   1 
ATOM   5083 C  CA  . GLY D  1 104 ? -25.165 -67.923 -24.987 1.00 43.78  ? 102 GLY D CA  1 
ATOM   5084 C  C   . GLY D  1 104 ? -23.692 -68.071 -24.645 1.00 40.98  ? 102 GLY D C   1 
ATOM   5085 O  O   . GLY D  1 104 ? -22.845 -68.079 -25.531 1.00 40.79  ? 102 GLY D O   1 
ATOM   5086 N  N   . LEU D  1 105 ? -23.379 -68.188 -23.361 1.00 38.93  ? 103 LEU D N   1 
ATOM   5087 C  CA  . LEU D  1 105 ? -21.992 -68.167 -22.910 1.00 36.25  ? 103 LEU D CA  1 
ATOM   5088 C  C   . LEU D  1 105 ? -21.420 -69.578 -22.894 1.00 35.03  ? 103 LEU D C   1 
ATOM   5089 O  O   . LEU D  1 105 ? -21.969 -70.472 -22.253 1.00 36.83  ? 103 LEU D O   1 
ATOM   5090 C  CB  . LEU D  1 105 ? -21.903 -67.556 -21.515 1.00 35.93  ? 103 LEU D CB  1 
ATOM   5091 C  CG  . LEU D  1 105 ? -20.496 -67.388 -20.945 1.00 34.28  ? 103 LEU D CG  1 
ATOM   5092 C  CD1 . LEU D  1 105 ? -19.670 -66.470 -21.828 1.00 34.27  ? 103 LEU D CD1 1 
ATOM   5093 C  CD2 . LEU D  1 105 ? -20.563 -66.825 -19.532 1.00 34.26  ? 103 LEU D CD2 1 
ATOM   5094 N  N   . THR D  1 106 ? -20.314 -69.783 -23.598 1.00 33.59  ? 104 THR D N   1 
ATOM   5095 C  CA  . THR D  1 106 ? -19.737 -71.121 -23.694 1.00 32.46  ? 104 THR D CA  1 
ATOM   5096 C  C   . THR D  1 106 ? -18.383 -71.233 -23.013 1.00 29.80  ? 104 THR D C   1 
ATOM   5097 O  O   . THR D  1 106 ? -18.000 -72.314 -22.575 1.00 31.04  ? 104 THR D O   1 
ATOM   5098 C  CB  . THR D  1 106 ? -19.648 -71.632 -25.151 1.00 33.56  ? 104 THR D CB  1 
ATOM   5099 O  OG1 . THR D  1 106 ? -18.920 -70.702 -25.952 1.00 32.87  ? 104 THR D OG1 1 
ATOM   5100 C  CG2 . THR D  1 106 ? -21.049 -71.826 -25.749 1.00 35.59  ? 104 THR D CG2 1 
ATOM   5101 N  N   . SER D  1 107 ? -17.635 -70.140 -22.937 1.00 27.20  ? 105 SER D N   1 
ATOM   5102 C  CA  A SER D  1 107 ? -16.371 -70.165 -22.226 0.50 25.12  ? 105 SER D CA  1 
ATOM   5103 C  CA  B SER D  1 107 ? -16.378 -70.167 -22.207 0.50 24.80  ? 105 SER D CA  1 
ATOM   5104 C  C   . SER D  1 107 ? -16.000 -68.797 -21.665 1.00 23.85  ? 105 SER D C   1 
ATOM   5105 O  O   . SER D  1 107 ? -16.417 -67.771 -22.187 1.00 23.83  ? 105 SER D O   1 
ATOM   5106 C  CB  A SER D  1 107 ? -15.274 -70.684 -23.157 0.50 24.32  ? 105 SER D CB  1 
ATOM   5107 C  CB  B SER D  1 107 ? -15.252 -70.735 -23.081 0.50 23.64  ? 105 SER D CB  1 
ATOM   5108 O  OG  A SER D  1 107 ? -14.020 -70.735 -22.502 0.50 23.07  ? 105 SER D OG  1 
ATOM   5109 O  OG  B SER D  1 107 ? -14.972 -69.904 -24.188 0.50 23.01  ? 105 SER D OG  1 
ATOM   5110 N  N   . TYR D  1 108 ? -15.212 -68.802 -20.596 1.00 22.91  ? 106 TYR D N   1 
ATOM   5111 C  CA  . TYR D  1 108 ? -14.871 -67.579 -19.884 1.00 22.81  ? 106 TYR D CA  1 
ATOM   5112 C  C   . TYR D  1 108 ? -13.620 -67.782 -19.039 1.00 21.67  ? 106 TYR D C   1 
ATOM   5113 O  O   . TYR D  1 108 ? -13.632 -68.522 -18.070 1.00 23.14  ? 106 TYR D O   1 
ATOM   5114 C  CB  . TYR D  1 108 ? -16.012 -67.166 -18.968 1.00 24.08  ? 106 TYR D CB  1 
ATOM   5115 C  CG  . TYR D  1 108 ? -15.922 -65.738 -18.507 1.00 23.82  ? 106 TYR D CG  1 
ATOM   5116 C  CD1 . TYR D  1 108 ? -15.083 -65.377 -17.465 1.00 22.52  ? 106 TYR D CD1 1 
ATOM   5117 C  CD2 . TYR D  1 108 ? -16.673 -64.753 -19.111 1.00 24.83  ? 106 TYR D CD2 1 
ATOM   5118 C  CE1 . TYR D  1 108 ? -15.000 -64.074 -17.039 1.00 22.34  ? 106 TYR D CE1 1 
ATOM   5119 C  CE2 . TYR D  1 108 ? -16.601 -63.445 -18.687 1.00 24.69  ? 106 TYR D CE2 1 
ATOM   5120 C  CZ  . TYR D  1 108 ? -15.760 -63.111 -17.655 1.00 23.83  ? 106 TYR D CZ  1 
ATOM   5121 O  OH  . TYR D  1 108 ? -15.682 -61.801 -17.239 1.00 25.69  ? 106 TYR D OH  1 
ATOM   5122 N  N   . LEU D  1 109 ? -12.542 -67.118 -19.410 1.00 20.99  ? 107 LEU D N   1 
ATOM   5123 C  CA  . LEU D  1 109 ? -11.256 -67.335 -18.773 1.00 20.48  ? 107 LEU D CA  1 
ATOM   5124 C  C   . LEU D  1 109 ? -10.743 -66.033 -18.205 1.00 18.82  ? 107 LEU D C   1 
ATOM   5125 O  O   . LEU D  1 109 ? -10.825 -64.992 -18.859 1.00 20.14  ? 107 LEU D O   1 
ATOM   5126 C  CB  . LEU D  1 109 ? -10.253 -67.875 -19.784 1.00 21.81  ? 107 LEU D CB  1 
ATOM   5127 C  CG  . LEU D  1 109 ? -8.836  -68.037 -19.230 1.00 22.52  ? 107 LEU D CG  1 
ATOM   5128 C  CD1 . LEU D  1 109 ? -8.768  -69.235 -18.289 1.00 22.88  ? 107 LEU D CD1 1 
ATOM   5129 C  CD2 . LEU D  1 109 ? -7.846  -68.211 -20.359 1.00 23.36  ? 107 LEU D CD2 1 
ATOM   5130 N  N   . VAL D  1 110 ? -10.216 -66.101 -16.990 1.00 16.84  ? 108 VAL D N   1 
ATOM   5131 C  CA  . VAL D  1 110 ? -9.581  -64.966 -16.344 1.00 15.31  ? 108 VAL D CA  1 
ATOM   5132 C  C   . VAL D  1 110 ? -8.137  -65.326 -16.040 1.00 14.59  ? 108 VAL D C   1 
ATOM   5133 O  O   . VAL D  1 110 ? -7.846  -66.393 -15.516 1.00 14.45  ? 108 VAL D O   1 
ATOM   5134 C  CB  . VAL D  1 110 ? -10.263 -64.646 -15.005 1.00 16.05  ? 108 VAL D CB  1 
ATOM   5135 C  CG1 . VAL D  1 110 ? -9.610  -63.442 -14.338 1.00 15.46  ? 108 VAL D CG1 1 
ATOM   5136 C  CG2 . VAL D  1 110 ? -11.751 -64.408 -15.197 1.00 16.62  ? 108 VAL D CG2 1 
ATOM   5137 N  N   . ARG D  1 111 ? -7.219  -64.435 -16.366 1.00 15.17  ? 109 ARG D N   1 
ATOM   5138 C  CA  . ARG D  1 111 ? -5.829  -64.631 -15.999 1.00 14.87  ? 109 ARG D CA  1 
ATOM   5139 C  C   . ARG D  1 111 ? -5.236  -63.351 -15.463 1.00 14.05  ? 109 ARG D C   1 
ATOM   5140 O  O   . ARG D  1 111 ? -5.157  -62.355 -16.164 1.00 14.32  ? 109 ARG D O   1 
ATOM   5141 C  CB  . ARG D  1 111 ? -5.015  -65.118 -17.194 1.00 16.30  ? 109 ARG D CB  1 
ATOM   5142 C  CG  . ARG D  1 111 ? -3.530  -65.236 -16.898 1.00 18.37  ? 109 ARG D CG  1 
ATOM   5143 C  CD  . ARG D  1 111 ? -2.768  -65.768 -18.097 1.00 21.08  ? 109 ARG D CD  1 
ATOM   5144 N  NE  . ARG D  1 111 ? -3.061  -67.183 -18.330 1.00 20.05  ? 109 ARG D NE  1 
ATOM   5145 C  CZ  . ARG D  1 111 ? -2.590  -67.880 -19.358 1.00 19.89  ? 109 ARG D CZ  1 
ATOM   5146 N  NH1 . ARG D  1 111 ? -2.908  -69.157 -19.485 1.00 22.08  ? 109 ARG D NH1 1 
ATOM   5147 N  NH2 . ARG D  1 111 ? -1.801  -67.304 -20.248 1.00 20.23  ? 109 ARG D NH2 1 
ATOM   5148 N  N   . VAL D  1 112 ? -4.754  -63.398 -14.231 1.00 13.77  ? 110 VAL D N   1 
ATOM   5149 C  CA  . VAL D  1 112 ? -4.031  -62.268 -13.665 1.00 13.92  ? 110 VAL D CA  1 
ATOM   5150 C  C   . VAL D  1 112 ? -2.624  -62.194 -14.255 1.00 15.07  ? 110 VAL D C   1 
ATOM   5151 O  O   . VAL D  1 112 ? -1.801  -63.085 -14.040 1.00 16.27  ? 110 VAL D O   1 
ATOM   5152 C  CB  . VAL D  1 112 ? -3.939  -62.364 -12.130 1.00 12.88  ? 110 VAL D CB  1 
ATOM   5153 C  CG1 . VAL D  1 112 ? -3.171  -61.179 -11.573 1.00 13.14  ? 110 VAL D CG1 1 
ATOM   5154 C  CG2 . VAL D  1 112 ? -5.324  -62.444 -11.525 1.00 12.39  ? 110 VAL D CG2 1 
ATOM   5155 N  N   . VAL D  1 113 ? -2.360  -61.121 -14.996 1.00 15.50  ? 111 VAL D N   1 
ATOM   5156 C  CA  . VAL D  1 113 ? -1.124  -60.969 -15.746 1.00 14.53  ? 111 VAL D CA  1 
ATOM   5157 C  C   . VAL D  1 113 ? 0.012   -60.448 -14.875 1.00 15.59  ? 111 VAL D C   1 
ATOM   5158 O  O   . VAL D  1 113 ? 1.122   -60.975 -14.905 1.00 16.72  ? 111 VAL D O   1 
ATOM   5159 C  CB  . VAL D  1 113 ? -1.322  -59.997 -16.916 1.00 14.77  ? 111 VAL D CB  1 
ATOM   5160 C  CG1 . VAL D  1 113 ? -0.003  -59.767 -17.637 1.00 15.17  ? 111 VAL D CG1 1 
ATOM   5161 C  CG2 . VAL D  1 113 ? -2.375  -60.526 -17.880 1.00 14.62  ? 111 VAL D CG2 1 
ATOM   5162 N  N   . SER D  1 114 ? -0.255  -59.396 -14.111 1.00 16.04  ? 112 SER D N   1 
ATOM   5163 C  CA  . SER D  1 114 ? 0.711   -58.910 -13.131 1.00 16.39  ? 112 SER D CA  1 
ATOM   5164 C  C   . SER D  1 114 ? 0.054   -58.050 -12.075 1.00 16.00  ? 112 SER D C   1 
ATOM   5165 O  O   . SER D  1 114 ? -0.955  -57.395 -12.343 1.00 15.29  ? 112 SER D O   1 
ATOM   5166 C  CB  . SER D  1 114 ? 1.798   -58.095 -13.814 1.00 18.30  ? 112 SER D CB  1 
ATOM   5167 O  OG  . SER D  1 114 ? 1.292   -56.823 -14.176 1.00 19.56  ? 112 SER D OG  1 
ATOM   5168 N  N   . THR D  1 115 ? 0.649   -58.029 -10.882 1.00 15.49  ? 113 THR D N   1 
ATOM   5169 C  CA  . THR D  1 115 ? 0.165   -57.177 -9.808  1.00 15.59  ? 113 THR D CA  1 
ATOM   5170 C  C   . THR D  1 115 ? 1.221   -57.049 -8.723  1.00 16.33  ? 113 THR D C   1 
ATOM   5171 O  O   . THR D  1 115 ? 2.084   -57.916 -8.589  1.00 17.32  ? 113 THR D O   1 
ATOM   5172 C  CB  . THR D  1 115 ? -1.124  -57.744 -9.189  1.00 15.02  ? 113 THR D CB  1 
ATOM   5173 O  OG1 . THR D  1 115 ? -1.624  -56.846 -8.202  1.00 14.23  ? 113 THR D OG1 1 
ATOM   5174 C  CG2 . THR D  1 115 ? -0.864  -59.101 -8.544  1.00 14.75  ? 113 THR D CG2 1 
ATOM   5175 N  N   . ASN D  1 116 ? 1.173   -55.945 -7.981  1.00 16.40  ? 114 ASN D N   1 
ATOM   5176 C  CA  . ASN D  1 116 ? 1.938   -55.811 -6.754  1.00 17.57  ? 114 ASN D CA  1 
ATOM   5177 C  C   . ASN D  1 116 ? 1.018   -55.713 -5.536  1.00 17.45  ? 114 ASN D C   1 
ATOM   5178 O  O   . ASN D  1 116 ? 1.462   -55.419 -4.426  1.00 17.11  ? 114 ASN D O   1 
ATOM   5179 C  CB  . ASN D  1 116 ? 2.875   -54.611 -6.831  1.00 19.52  ? 114 ASN D CB  1 
ATOM   5180 C  CG  . ASN D  1 116 ? 2.149   -53.276 -6.692  1.00 21.39  ? 114 ASN D CG  1 
ATOM   5181 O  OD1 . ASN D  1 116 ? 0.919   -53.198 -6.752  1.00 18.95  ? 114 ASN D OD1 1 
ATOM   5182 N  ND2 . ASN D  1 116 ? 2.927   -52.207 -6.514  1.00 22.45  ? 114 ASN D ND2 1 
ATOM   5183 N  N   . TYR D  1 117 ? -0.264  -56.004 -5.769  1.00 16.50  ? 115 TYR D N   1 
ATOM   5184 C  CA  . TYR D  1 117 ? -1.234  -56.291 -4.718  1.00 15.36  ? 115 TYR D CA  1 
ATOM   5185 C  C   . TYR D  1 117 ? -1.732  -55.041 -4.008  1.00 15.46  ? 115 TYR D C   1 
ATOM   5186 O  O   . TYR D  1 117 ? -2.925  -54.934 -3.712  1.00 15.44  ? 115 TYR D O   1 
ATOM   5187 C  CB  . TYR D  1 117 ? -0.710  -57.334 -3.725  1.00 16.15  ? 115 TYR D CB  1 
ATOM   5188 C  CG  . TYR D  1 117 ? -0.390  -58.664 -4.375  1.00 16.49  ? 115 TYR D CG  1 
ATOM   5189 C  CD1 . TYR D  1 117 ? -1.409  -59.557 -4.733  1.00 16.13  ? 115 TYR D CD1 1 
ATOM   5190 C  CD2 . TYR D  1 117 ? 0.922   -59.036 -4.632  1.00 17.13  ? 115 TYR D CD2 1 
ATOM   5191 C  CE1 . TYR D  1 117 ? -1.128  -60.763 -5.350  1.00 16.11  ? 115 TYR D CE1 1 
ATOM   5192 C  CE2 . TYR D  1 117 ? 1.208   -60.259 -5.228  1.00 17.41  ? 115 TYR D CE2 1 
ATOM   5193 C  CZ  . TYR D  1 117 ? 0.179   -61.110 -5.579  1.00 16.57  ? 115 TYR D CZ  1 
ATOM   5194 O  OH  . TYR D  1 117 ? 0.460   -62.299 -6.198  1.00 18.39  ? 115 TYR D OH  1 
ATOM   5195 N  N   . ASN D  1 118 ? -0.851  -54.089 -3.740  1.00 16.08  ? 116 ASN D N   1 
ATOM   5196 C  CA  . ASN D  1 118 ? -1.237  -52.918 -2.958  1.00 17.02  ? 116 ASN D CA  1 
ATOM   5197 C  C   . ASN D  1 118 ? -1.318  -51.604 -3.775  1.00 18.16  ? 116 ASN D C   1 
ATOM   5198 O  O   . ASN D  1 118 ? -1.591  -50.542 -3.208  1.00 19.02  ? 116 ASN D O   1 
ATOM   5199 C  CB  . ASN D  1 118 ? -0.299  -52.757 -1.773  1.00 17.69  ? 116 ASN D CB  1 
ATOM   5200 C  CG  . ASN D  1 118 ? 1.137   -52.638 -2.198  1.00 18.30  ? 116 ASN D CG  1 
ATOM   5201 O  OD1 . ASN D  1 118 ? 1.434   -52.158 -3.287  1.00 18.44  ? 116 ASN D OD1 1 
ATOM   5202 N  ND2 . ASN D  1 118 ? 2.038   -53.088 -1.348  1.00 19.73  ? 116 ASN D ND2 1 
ATOM   5203 N  N   . GLN D  1 119 ? -1.158  -51.688 -5.097  1.00 17.98  ? 117 GLN D N   1 
ATOM   5204 C  CA  . GLN D  1 119 ? -1.283  -50.516 -5.980  1.00 18.80  ? 117 GLN D CA  1 
ATOM   5205 C  C   . GLN D  1 119 ? -1.959  -50.824 -7.312  1.00 18.96  ? 117 GLN D C   1 
ATOM   5206 O  O   . GLN D  1 119 ? -2.954  -50.214 -7.655  1.00 19.07  ? 117 GLN D O   1 
ATOM   5207 C  CB  . GLN D  1 119 ? 0.070   -49.892 -6.258  1.00 19.97  ? 117 GLN D CB  1 
ATOM   5208 C  CG  . GLN D  1 119 ? 0.664   -49.170 -5.064  1.00 22.32  ? 117 GLN D CG  1 
ATOM   5209 C  CD  . GLN D  1 119 ? 2.065   -48.677 -5.345  1.00 23.76  ? 117 GLN D CD  1 
ATOM   5210 O  OE1 . GLN D  1 119 ? 2.800   -49.278 -6.129  1.00 23.60  ? 117 GLN D OE1 1 
ATOM   5211 N  NE2 . GLN D  1 119 ? 2.438   -47.571 -4.722  1.00 25.34  ? 117 GLN D NE2 1 
ATOM   5212 N  N   . HIS D  1 120 ? -1.401  -51.752 -8.080  1.00 20.77  ? 118 HIS D N   1 
ATOM   5213 C  CA  . HIS D  1 120 ? -1.848  -51.959 -9.455  1.00 21.89  ? 118 HIS D CA  1 
ATOM   5214 C  C   . HIS D  1 120 ? -2.011  -53.440 -9.795  1.00 20.43  ? 118 HIS D C   1 
ATOM   5215 O  O   . HIS D  1 120 ? -1.440  -54.313 -9.140  1.00 21.68  ? 118 HIS D O   1 
ATOM   5216 C  CB  . HIS D  1 120 ? -0.898  -51.268 -10.448 1.00 24.59  ? 118 HIS D CB  1 
ATOM   5217 C  CG  . HIS D  1 120 ? 0.525   -51.706 -10.325 1.00 30.33  ? 118 HIS D CG  1 
ATOM   5218 N  ND1 . HIS D  1 120 ? 0.996   -52.866 -10.906 1.00 37.38  ? 118 HIS D ND1 1 
ATOM   5219 C  CD2 . HIS D  1 120 ? 1.585   -51.143 -9.697  1.00 31.66  ? 118 HIS D CD2 1 
ATOM   5220 C  CE1 . HIS D  1 120 ? 2.285   -52.996 -10.644 1.00 36.04  ? 118 HIS D CE1 1 
ATOM   5221 N  NE2 . HIS D  1 120 ? 2.667   -51.966 -9.911  1.00 32.93  ? 118 HIS D NE2 1 
ATOM   5222 N  N   . ALA D  1 121 ? -2.793  -53.708 -10.836 1.00 20.33  ? 119 ALA D N   1 
ATOM   5223 C  CA  . ALA D  1 121 ? -2.889  -55.033 -11.427 1.00 19.50  ? 119 ALA D CA  1 
ATOM   5224 C  C   . ALA D  1 121 ? -3.318  -54.929 -12.894 1.00 20.88  ? 119 ALA D C   1 
ATOM   5225 O  O   . ALA D  1 121 ? -4.001  -53.975 -13.290 1.00 21.66  ? 119 ALA D O   1 
ATOM   5226 C  CB  . ALA D  1 121 ? -3.879  -55.884 -10.647 1.00 19.84  ? 119 ALA D CB  1 
ATOM   5227 N  N   . MET D  1 122 ? -2.896  -55.898 -13.707 1.00 20.47  ? 120 MET D N   1 
ATOM   5228 C  CA  . MET D  1 122 ? -3.482  -56.106 -15.027 1.00 20.55  ? 120 MET D CA  1 
ATOM   5229 C  C   . MET D  1 122 ? -4.075  -57.498 -15.091 1.00 19.27  ? 120 MET D C   1 
ATOM   5230 O  O   . MET D  1 122 ? -3.425  -58.466 -14.699 1.00 18.37  ? 120 MET D O   1 
ATOM   5231 C  CB  . MET D  1 122 ? -2.450  -55.974 -16.137 1.00 21.60  ? 120 MET D CB  1 
ATOM   5232 C  CG  . MET D  1 122 ? -1.924  -54.575 -16.365 1.00 25.56  ? 120 MET D CG  1 
ATOM   5233 S  SD  . MET D  1 122 ? -1.136  -54.419 -17.986 1.00 29.66  ? 120 MET D SD  1 
ATOM   5234 C  CE  . MET D  1 122 ? 0.218   -55.588 -17.842 1.00 27.96  ? 120 MET D CE  1 
ATOM   5235 N  N   . VAL D  1 123 ? -5.299  -57.589 -15.606 1.00 17.44  ? 121 VAL D N   1 
ATOM   5236 C  CA  . VAL D  1 123 ? -5.999  -58.859 -15.695 1.00 16.87  ? 121 VAL D CA  1 
ATOM   5237 C  C   . VAL D  1 123 ? -6.554  -59.074 -17.097 1.00 16.89  ? 121 VAL D C   1 
ATOM   5238 O  O   . VAL D  1 123 ? -7.128  -58.160 -17.697 1.00 16.73  ? 121 VAL D O   1 
ATOM   5239 C  CB  . VAL D  1 123 ? -7.161  -58.920 -14.691 1.00 16.60  ? 121 VAL D CB  1 
ATOM   5240 C  CG1 . VAL D  1 123 ? -7.789  -60.294 -14.717 1.00 16.43  ? 121 VAL D CG1 1 
ATOM   5241 C  CG2 . VAL D  1 123 ? -6.662  -58.587 -13.291 1.00 16.38  ? 121 VAL D CG2 1 
ATOM   5242 N  N   . PHE D  1 124 ? -6.350  -60.284 -17.617 1.00 15.06  ? 122 PHE D N   1 
ATOM   5243 C  CA  . PHE D  1 124 ? -6.783  -60.644 -18.959 1.00 14.17  ? 122 PHE D CA  1 
ATOM   5244 C  C   . PHE D  1 124 ? -8.048  -61.481 -18.861 1.00 14.38  ? 122 PHE D C   1 
ATOM   5245 O  O   . PHE D  1 124 ? -8.126  -62.376 -18.035 1.00 13.60  ? 122 PHE D O   1 
ATOM   5246 C  CB  . PHE D  1 124 ? -5.681  -61.436 -19.668 1.00 13.36  ? 122 PHE D CB  1 
ATOM   5247 C  CG  . PHE D  1 124 ? -6.094  -62.002 -21.001 1.00 13.33  ? 122 PHE D CG  1 
ATOM   5248 C  CD1 . PHE D  1 124 ? -6.620  -63.283 -21.097 1.00 13.43  ? 122 PHE D CD1 1 
ATOM   5249 C  CD2 . PHE D  1 124 ? -5.956  -61.259 -22.156 1.00 13.41  ? 122 PHE D CD2 1 
ATOM   5250 C  CE1 . PHE D  1 124 ? -6.989  -63.812 -22.321 1.00 13.49  ? 122 PHE D CE1 1 
ATOM   5251 C  CE2 . PHE D  1 124 ? -6.327  -61.780 -23.385 1.00 14.12  ? 122 PHE D CE2 1 
ATOM   5252 C  CZ  . PHE D  1 124 ? -6.844  -63.057 -23.469 1.00 14.14  ? 122 PHE D CZ  1 
ATOM   5253 N  N   . PHE D  1 125 ? -9.039  -61.157 -19.691 1.00 15.21  ? 123 PHE D N   1 
ATOM   5254 C  CA  . PHE D  1 125 ? -10.294 -61.889 -19.750 1.00 15.46  ? 123 PHE D CA  1 
ATOM   5255 C  C   . PHE D  1 125 ? -10.546 -62.338 -21.182 1.00 16.61  ? 123 PHE D C   1 
ATOM   5256 O  O   . PHE D  1 125 ? -10.350 -61.578 -22.120 1.00 16.87  ? 123 PHE D O   1 
ATOM   5257 C  CB  . PHE D  1 125 ? -11.461 -61.003 -19.329 1.00 16.15  ? 123 PHE D CB  1 
ATOM   5258 C  CG  . PHE D  1 125 ? -11.335 -60.433 -17.947 1.00 16.49  ? 123 PHE D CG  1 
ATOM   5259 C  CD1 . PHE D  1 125 ? -12.055 -60.973 -16.892 1.00 17.01  ? 123 PHE D CD1 1 
ATOM   5260 C  CD2 . PHE D  1 125 ? -10.514 -59.348 -17.700 1.00 16.00  ? 123 PHE D CD2 1 
ATOM   5261 C  CE1 . PHE D  1 125 ? -11.944 -60.446 -15.612 1.00 17.17  ? 123 PHE D CE1 1 
ATOM   5262 C  CE2 . PHE D  1 125 ? -10.392 -58.826 -16.426 1.00 16.39  ? 123 PHE D CE2 1 
ATOM   5263 C  CZ  . PHE D  1 125 ? -11.122 -59.362 -15.376 1.00 16.26  ? 123 PHE D CZ  1 
ATOM   5264 N  N   . LYS D  1 126 ? -11.024 -63.564 -21.347 1.00 17.36  ? 124 LYS D N   1 
ATOM   5265 C  CA  . LYS D  1 126 ? -11.443 -64.050 -22.657 1.00 18.58  ? 124 LYS D CA  1 
ATOM   5266 C  C   . LYS D  1 126 ? -12.743 -64.824 -22.527 1.00 19.24  ? 124 LYS D C   1 
ATOM   5267 O  O   . LYS D  1 126 ? -12.887 -65.672 -21.669 1.00 18.79  ? 124 LYS D O   1 
ATOM   5268 C  CB  . LYS D  1 126 ? -10.370 -64.947 -23.264 1.00 18.91  ? 124 LYS D CB  1 
ATOM   5269 C  CG  . LYS D  1 126 ? -10.785 -65.580 -24.580 1.00 21.77  ? 124 LYS D CG  1 
ATOM   5270 C  CD  . LYS D  1 126 ? -9.600  -66.202 -25.314 1.00 22.38  ? 124 LYS D CD  1 
ATOM   5271 C  CE  . LYS D  1 126 ? -9.402  -67.662 -24.931 1.00 21.86  ? 124 LYS D CE  1 
ATOM   5272 N  NZ  . LYS D  1 126 ? -10.536 -68.513 -25.379 1.00 23.74  ? 124 LYS D NZ  1 
ATOM   5273 N  N   . LYS D  1 127 ? -13.696 -64.523 -23.383 1.00 21.08  ? 125 LYS D N   1 
ATOM   5274 C  CA  . LYS D  1 127 ? -14.990 -65.148 -23.294 1.00 22.90  ? 125 LYS D CA  1 
ATOM   5275 C  C   . LYS D  1 127 ? -15.527 -65.433 -24.688 1.00 24.07  ? 125 LYS D C   1 
ATOM   5276 O  O   . LYS D  1 127 ? -15.217 -64.717 -25.634 1.00 24.44  ? 125 LYS D O   1 
ATOM   5277 C  CB  . LYS D  1 127 ? -15.932 -64.264 -22.474 1.00 24.79  ? 125 LYS D CB  1 
ATOM   5278 C  CG  . LYS D  1 127 ? -16.995 -63.502 -23.238 1.00 27.58  ? 125 LYS D CG  1 
ATOM   5279 C  CD  . LYS D  1 127 ? -17.964 -62.873 -22.251 1.00 29.86  ? 125 LYS D CD  1 
ATOM   5280 C  CE  . LYS D  1 127 ? -19.255 -62.414 -22.896 1.00 34.21  ? 125 LYS D CE  1 
ATOM   5281 N  NZ  . LYS D  1 127 ? -20.298 -62.048 -21.892 1.00 36.69  ? 125 LYS D NZ  1 
ATOM   5282 N  N   . VAL D  1 128 ? -16.244 -66.541 -24.831 1.00 25.04  ? 126 VAL D N   1 
ATOM   5283 C  CA  . VAL D  1 128 ? -16.918 -66.865 -26.083 1.00 26.25  ? 126 VAL D CA  1 
ATOM   5284 C  C   . VAL D  1 128 ? -18.411 -66.859 -25.846 1.00 28.24  ? 126 VAL D C   1 
ATOM   5285 O  O   . VAL D  1 128 ? -18.913 -67.588 -24.994 1.00 28.14  ? 126 VAL D O   1 
ATOM   5286 C  CB  . VAL D  1 128 ? -16.494 -68.244 -26.634 1.00 26.51  ? 126 VAL D CB  1 
ATOM   5287 C  CG1 . VAL D  1 128 ? -17.248 -68.562 -27.924 1.00 28.19  ? 126 VAL D CG1 1 
ATOM   5288 C  CG2 . VAL D  1 128 ? -14.993 -68.284 -26.870 1.00 24.82  ? 126 VAL D CG2 1 
ATOM   5289 N  N   . SER D  1 129 ? -19.112 -66.024 -26.600 1.00 30.74  ? 127 SER D N   1 
ATOM   5290 C  CA  . SER D  1 129 ? -20.539 -65.830 -26.417 1.00 33.86  ? 127 SER D CA  1 
ATOM   5291 C  C   . SER D  1 129 ? -21.194 -65.668 -27.770 1.00 37.00  ? 127 SER D C   1 
ATOM   5292 O  O   . SER D  1 129 ? -20.739 -64.879 -28.594 1.00 37.08  ? 127 SER D O   1 
ATOM   5293 C  CB  . SER D  1 129 ? -20.803 -64.584 -25.581 1.00 33.82  ? 127 SER D CB  1 
ATOM   5294 O  OG  . SER D  1 129 ? -22.186 -64.284 -25.520 1.00 37.19  ? 127 SER D OG  1 
ATOM   5295 N  N   . GLN D  1 130 ? -22.253 -66.432 -28.007 1.00 40.94  ? 128 GLN D N   1 
ATOM   5296 C  CA  . GLN D  1 130 ? -22.836 -66.535 -29.330 1.00 45.06  ? 128 GLN D CA  1 
ATOM   5297 C  C   . GLN D  1 130 ? -21.754 -66.844 -30.357 1.00 43.14  ? 128 GLN D C   1 
ATOM   5298 O  O   . GLN D  1 130 ? -21.784 -66.317 -31.463 1.00 44.12  ? 128 GLN D O   1 
ATOM   5299 C  CB  . GLN D  1 130 ? -23.554 -65.231 -29.699 1.00 48.42  ? 128 GLN D CB  1 
ATOM   5300 C  CG  . GLN D  1 130 ? -25.011 -65.179 -29.274 1.00 52.88  ? 128 GLN D CG  1 
ATOM   5301 C  CD  . GLN D  1 130 ? -25.214 -64.506 -27.932 1.00 53.93  ? 128 GLN D CD  1 
ATOM   5302 O  OE1 . GLN D  1 130 ? -24.287 -63.925 -27.361 1.00 51.79  ? 128 GLN D OE1 1 
ATOM   5303 N  NE2 . GLN D  1 130 ? -26.436 -64.590 -27.415 1.00 57.64  ? 128 GLN D NE2 1 
ATOM   5304 N  N   . ASN D  1 131 ? -20.803 -67.697 -29.988 1.00 40.68  ? 129 ASN D N   1 
ATOM   5305 C  CA  . ASN D  1 131 ? -19.765 -68.133 -30.913 1.00 40.25  ? 129 ASN D CA  1 
ATOM   5306 C  C   . ASN D  1 131 ? -18.761 -67.037 -31.277 1.00 39.17  ? 129 ASN D C   1 
ATOM   5307 O  O   . ASN D  1 131 ? -17.831 -67.274 -32.050 1.00 37.50  ? 129 ASN D O   1 
ATOM   5308 C  CB  . ASN D  1 131 ? -20.396 -68.682 -32.192 1.00 42.71  ? 129 ASN D CB  1 
ATOM   5309 C  CG  . ASN D  1 131 ? -21.347 -69.823 -31.924 1.00 45.30  ? 129 ASN D CG  1 
ATOM   5310 O  OD1 . ASN D  1 131 ? -22.521 -69.766 -32.278 1.00 47.94  ? 129 ASN D OD1 1 
ATOM   5311 N  ND2 . ASN D  1 131 ? -20.842 -70.871 -31.290 1.00 45.45  ? 129 ASN D ND2 1 
ATOM   5312 N  N   . ARG D  1 132 ? -18.927 -65.853 -30.691 1.00 39.34  ? 130 ARG D N   1 
ATOM   5313 C  CA  . ARG D  1 132 ? -17.983 -64.760 -30.899 1.00 38.13  ? 130 ARG D CA  1 
ATOM   5314 C  C   . ARG D  1 132 ? -16.965 -64.684 -29.755 1.00 33.89  ? 130 ARG D C   1 
ATOM   5315 O  O   . ARG D  1 132 ? -17.318 -64.788 -28.587 1.00 32.99  ? 130 ARG D O   1 
ATOM   5316 C  CB  . ARG D  1 132 ? -18.731 -63.428 -31.011 1.00 41.23  ? 130 ARG D CB  1 
ATOM   5317 C  CG  . ARG D  1 132 ? -19.741 -63.347 -32.150 1.00 46.19  ? 130 ARG D CG  1 
ATOM   5318 C  CD  . ARG D  1 132 ? -20.745 -62.220 -31.946 1.00 51.13  ? 130 ARG D CD  1 
ATOM   5319 N  NE  . ARG D  1 132 ? -20.124 -60.901 -31.956 1.00 54.95  ? 130 ARG D NE  1 
ATOM   5320 C  CZ  . ARG D  1 132 ? -19.692 -60.287 -33.055 1.00 60.26  ? 130 ARG D CZ  1 
ATOM   5321 N  NH1 . ARG D  1 132 ? -19.820 -60.866 -34.247 1.00 63.18  ? 130 ARG D NH1 1 
ATOM   5322 N  NH2 . ARG D  1 132 ? -19.144 -59.082 -32.962 1.00 57.71  ? 130 ARG D NH2 1 
ATOM   5323 N  N   . GLU D  1 133 ? -15.700 -64.483 -30.105 1.00 31.17  ? 131 GLU D N   1 
ATOM   5324 C  CA  . GLU D  1 133 ? -14.622 -64.529 -29.138 1.00 27.88  ? 131 GLU D CA  1 
ATOM   5325 C  C   . GLU D  1 133 ? -14.210 -63.115 -28.739 1.00 25.58  ? 131 GLU D C   1 
ATOM   5326 O  O   . GLU D  1 133 ? -13.622 -62.398 -29.521 1.00 24.78  ? 131 GLU D O   1 
ATOM   5327 C  CB  . GLU D  1 133 ? -13.426 -65.317 -29.698 1.00 27.47  ? 131 GLU D CB  1 
ATOM   5328 C  CG  . GLU D  1 133 ? -12.371 -65.675 -28.660 1.00 27.14  ? 131 GLU D CG  1 
ATOM   5329 C  CD  . GLU D  1 133 ? -11.401 -66.755 -29.124 1.00 29.78  ? 131 GLU D CD  1 
ATOM   5330 O  OE1 . GLU D  1 133 ? -10.749 -67.373 -28.249 1.00 31.37  ? 131 GLU D OE1 1 
ATOM   5331 O  OE2 . GLU D  1 133 ? -11.280 -66.989 -30.351 1.00 29.41  ? 131 GLU D OE2 1 
ATOM   5332 N  N   . TYR D  1 134 ? -14.516 -62.737 -27.501 1.00 24.41  ? 132 TYR D N   1 
ATOM   5333 C  CA  . TYR D  1 134 ? -14.167 -61.429 -26.970 1.00 22.83  ? 132 TYR D CA  1 
ATOM   5334 C  C   . TYR D  1 134 ? -12.981 -61.547 -26.036 1.00 20.37  ? 132 TYR D C   1 
ATOM   5335 O  O   . TYR D  1 134 ? -12.852 -62.515 -25.298 1.00 19.50  ? 132 TYR D O   1 
ATOM   5336 C  CB  . TYR D  1 134 ? -15.348 -60.833 -26.205 1.00 23.54  ? 132 TYR D CB  1 
ATOM   5337 C  CG  . TYR D  1 134 ? -16.597 -60.662 -27.034 1.00 25.96  ? 132 TYR D CG  1 
ATOM   5338 C  CD1 . TYR D  1 134 ? -17.609 -61.611 -27.010 1.00 27.34  ? 132 TYR D CD1 1 
ATOM   5339 C  CD2 . TYR D  1 134 ? -16.790 -59.538 -27.817 1.00 27.58  ? 132 TYR D CD2 1 
ATOM   5340 C  CE1 . TYR D  1 134 ? -18.773 -61.441 -27.740 1.00 29.12  ? 132 TYR D CE1 1 
ATOM   5341 C  CE2 . TYR D  1 134 ? -17.950 -59.367 -28.563 1.00 29.33  ? 132 TYR D CE2 1 
ATOM   5342 C  CZ  . TYR D  1 134 ? -18.934 -60.323 -28.514 1.00 30.15  ? 132 TYR D CZ  1 
ATOM   5343 O  OH  . TYR D  1 134 ? -20.081 -60.163 -29.252 1.00 32.73  ? 132 TYR D OH  1 
ATOM   5344 N  N   . PHE D  1 135 ? -12.123 -60.543 -26.039 1.00 19.49  ? 133 PHE D N   1 
ATOM   5345 C  CA  . PHE D  1 135 ? -11.116 -60.432 -24.993 1.00 17.88  ? 133 PHE D CA  1 
ATOM   5346 C  C   . PHE D  1 135 ? -10.921 -59.000 -24.539 1.00 18.41  ? 133 PHE D C   1 
ATOM   5347 O  O   . PHE D  1 135 ? -11.183 -58.056 -25.285 1.00 18.69  ? 133 PHE D O   1 
ATOM   5348 C  CB  . PHE D  1 135 ? -9.800  -61.047 -25.440 1.00 16.72  ? 133 PHE D CB  1 
ATOM   5349 C  CG  . PHE D  1 135 ? -9.055  -60.243 -26.458 1.00 16.76  ? 133 PHE D CG  1 
ATOM   5350 C  CD1 . PHE D  1 135 ? -9.405  -60.287 -27.788 1.00 17.46  ? 133 PHE D CD1 1 
ATOM   5351 C  CD2 . PHE D  1 135 ? -7.952  -59.492 -26.076 1.00 16.09  ? 133 PHE D CD2 1 
ATOM   5352 C  CE1 . PHE D  1 135 ? -8.691  -59.572 -28.724 1.00 17.93  ? 133 PHE D CE1 1 
ATOM   5353 C  CE2 . PHE D  1 135 ? -7.242  -58.770 -27.002 1.00 16.41  ? 133 PHE D CE2 1 
ATOM   5354 C  CZ  . PHE D  1 135 ? -7.611  -58.809 -28.328 1.00 17.49  ? 133 PHE D CZ  1 
ATOM   5355 N  N   . LYS D  1 136 ? -10.510 -58.850 -23.287 1.00 18.65  ? 134 LYS D N   1 
ATOM   5356 C  CA  . LYS D  1 136 ? -10.212 -57.541 -22.749 1.00 19.41  ? 134 LYS D CA  1 
ATOM   5357 C  C   . LYS D  1 136 ? -9.100  -57.643 -21.727 1.00 18.16  ? 134 LYS D C   1 
ATOM   5358 O  O   . LYS D  1 136 ? -8.858  -58.704 -21.155 1.00 17.06  ? 134 LYS D O   1 
ATOM   5359 C  CB  . LYS D  1 136 ? -11.458 -56.906 -22.124 1.00 21.05  ? 134 LYS D CB  1 
ATOM   5360 C  CG  . LYS D  1 136 ? -11.893 -57.538 -20.820 1.00 21.53  ? 134 LYS D CG  1 
ATOM   5361 C  CD  . LYS D  1 136 ? -12.953 -56.708 -20.101 1.00 23.99  ? 134 LYS D CD  1 
ATOM   5362 C  CE  . LYS D  1 136 ? -13.293 -57.317 -18.748 1.00 24.37  ? 134 LYS D CE  1 
ATOM   5363 N  NZ  . LYS D  1 136 ? -14.594 -56.850 -18.204 1.00 26.31  ? 134 LYS D NZ  1 
ATOM   5364 N  N   . ILE D  1 137 ? -8.417  -56.526 -21.529 1.00 18.02  ? 135 ILE D N   1 
ATOM   5365 C  CA  . ILE D  1 137 ? -7.460  -56.377 -20.468 1.00 17.68  ? 135 ILE D CA  1 
ATOM   5366 C  C   . ILE D  1 137 ? -7.910  -55.230 -19.589 1.00 19.12  ? 135 ILE D C   1 
ATOM   5367 O  O   . ILE D  1 137 ? -8.270  -54.154 -20.074 1.00 20.04  ? 135 ILE D O   1 
ATOM   5368 C  CB  . ILE D  1 137 ? -6.061  -56.059 -21.019 1.00 18.24  ? 135 ILE D CB  1 
ATOM   5369 C  CG1 . ILE D  1 137 ? -5.698  -57.021 -22.149 1.00 18.52  ? 135 ILE D CG1 1 
ATOM   5370 C  CG2 . ILE D  1 137 ? -5.013  -56.155 -19.917 1.00 17.29  ? 135 ILE D CG2 1 
ATOM   5371 C  CD1 . ILE D  1 137 ? -5.988  -56.469 -23.521 1.00 19.90  ? 135 ILE D CD1 1 
ATOM   5372 N  N   . THR D  1 138 ? -7.898  -55.469 -18.291 1.00 19.68  ? 136 THR D N   1 
ATOM   5373 C  CA  . THR D  1 138 ? -8.282  -54.456 -17.325 1.00 22.31  ? 136 THR D CA  1 
ATOM   5374 C  C   . THR D  1 138 ? -7.040  -53.979 -16.560 1.00 21.80  ? 136 THR D C   1 
ATOM   5375 O  O   . THR D  1 138 ? -6.218  -54.784 -16.119 1.00 20.53  ? 136 THR D O   1 
ATOM   5376 C  CB  . THR D  1 138 ? -9.312  -55.019 -16.335 1.00 24.56  ? 136 THR D CB  1 
ATOM   5377 O  OG1 . THR D  1 138 ? -10.533 -55.300 -17.028 1.00 27.35  ? 136 THR D OG1 1 
ATOM   5378 C  CG2 . THR D  1 138 ? -9.609  -54.021 -15.254 1.00 28.32  ? 136 THR D CG2 1 
ATOM   5379 N  N   . LEU D  1 139 ? -6.894  -52.664 -16.442 1.00 20.67  ? 137 LEU D N   1 
ATOM   5380 C  CA  . LEU D  1 139 ? -5.893  -52.082 -15.563 1.00 19.40  ? 137 LEU D CA  1 
ATOM   5381 C  C   . LEU D  1 139 ? -6.554  -51.664 -14.242 1.00 19.23  ? 137 LEU D C   1 
ATOM   5382 O  O   . LEU D  1 139 ? -7.386  -50.760 -14.229 1.00 19.22  ? 137 LEU D O   1 
ATOM   5383 C  CB  . LEU D  1 139 ? -5.230  -50.873 -16.247 1.00 19.78  ? 137 LEU D CB  1 
ATOM   5384 C  CG  . LEU D  1 139 ? -4.148  -50.149 -15.438 1.00 19.72  ? 137 LEU D CG  1 
ATOM   5385 C  CD1 . LEU D  1 139 ? -2.955  -51.064 -15.159 1.00 19.44  ? 137 LEU D CD1 1 
ATOM   5386 C  CD2 . LEU D  1 139 ? -3.690  -48.881 -16.141 1.00 20.60  ? 137 LEU D CD2 1 
ATOM   5387 N  N   . TYR D  1 140 ? -6.147  -52.309 -13.148 1.00 18.11  ? 138 TYR D N   1 
ATOM   5388 C  CA  . TYR D  1 140 ? -6.703  -52.076 -11.818 1.00 17.79  ? 138 TYR D CA  1 
ATOM   5389 C  C   . TYR D  1 140 ? -5.804  -51.142 -11.013 1.00 18.97  ? 138 TYR D C   1 
ATOM   5390 O  O   . TYR D  1 140 ? -4.578  -51.296 -11.019 1.00 20.19  ? 138 TYR D O   1 
ATOM   5391 C  CB  . TYR D  1 140 ? -6.781  -53.391 -11.048 1.00 17.09  ? 138 TYR D CB  1 
ATOM   5392 C  CG  . TYR D  1 140 ? -7.900  -54.339 -11.437 1.00 17.38  ? 138 TYR D CG  1 
ATOM   5393 C  CD1 . TYR D  1 140 ? -9.037  -53.894 -12.091 1.00 18.26  ? 138 TYR D CD1 1 
ATOM   5394 C  CD2 . TYR D  1 140 ? -7.833  -55.680 -11.098 1.00 17.31  ? 138 TYR D CD2 1 
ATOM   5395 C  CE1 . TYR D  1 140 ? -10.070 -54.766 -12.405 1.00 17.94  ? 138 TYR D CE1 1 
ATOM   5396 C  CE2 . TYR D  1 140 ? -8.856  -56.555 -11.407 1.00 17.22  ? 138 TYR D CE2 1 
ATOM   5397 C  CZ  . TYR D  1 140 ? -9.970  -56.096 -12.066 1.00 17.03  ? 138 TYR D CZ  1 
ATOM   5398 O  OH  . TYR D  1 140 ? -10.984 -56.970 -12.357 1.00 15.56  ? 138 TYR D OH  1 
ATOM   5399 N  N   . GLY D  1 141 ? -6.406  -50.194 -10.298 1.00 18.16  ? 139 GLY D N   1 
ATOM   5400 C  CA  . GLY D  1 141 ? -5.690  -49.441 -9.277  1.00 18.58  ? 139 GLY D CA  1 
ATOM   5401 C  C   . GLY D  1 141 ? -6.352  -49.592 -7.924  1.00 18.73  ? 139 GLY D C   1 
ATOM   5402 O  O   . GLY D  1 141 ? -7.569  -49.735 -7.842  1.00 20.03  ? 139 GLY D O   1 
ATOM   5403 N  N   . ARG D  1 142 ? -5.567  -49.590 -6.851  1.00 18.69  ? 140 ARG D N   1 
ATOM   5404 C  CA  . ARG D  1 142 ? -6.150  -49.552 -5.510  1.00 18.89  ? 140 ARG D CA  1 
ATOM   5405 C  C   . ARG D  1 142 ? -6.708  -48.157 -5.253  1.00 19.17  ? 140 ARG D C   1 
ATOM   5406 O  O   . ARG D  1 142 ? -7.607  -48.000 -4.451  1.00 18.70  ? 140 ARG D O   1 
ATOM   5407 C  CB  . ARG D  1 142 ? -5.123  -49.888 -4.431  1.00 18.79  ? 140 ARG D CB  1 
ATOM   5408 C  CG  . ARG D  1 142 ? -4.737  -51.352 -4.353  1.00 18.51  ? 140 ARG D CG  1 
ATOM   5409 C  CD  . ARG D  1 142 ? -5.911  -52.271 -4.072  1.00 18.41  ? 140 ARG D CD  1 
ATOM   5410 N  NE  . ARG D  1 142 ? -5.448  -53.615 -3.736  1.00 19.88  ? 140 ARG D NE  1 
ATOM   5411 C  CZ  . ARG D  1 142 ? -6.235  -54.661 -3.470  1.00 21.46  ? 140 ARG D CZ  1 
ATOM   5412 N  NH1 . ARG D  1 142 ? -5.697  -55.858 -3.196  1.00 20.91  ? 140 ARG D NH1 1 
ATOM   5413 N  NH2 . ARG D  1 142 ? -7.555  -54.528 -3.493  1.00 20.88  ? 140 ARG D NH2 1 
ATOM   5414 N  N   . THR D  1 143 ? -6.166  -47.163 -5.948  1.00 19.08  ? 141 THR D N   1 
ATOM   5415 C  CA  . THR D  1 143 ? -6.784  -45.856 -6.049  1.00 20.83  ? 141 THR D CA  1 
ATOM   5416 C  C   . THR D  1 143 ? -7.209  -45.538 -7.485  1.00 22.27  ? 141 THR D C   1 
ATOM   5417 O  O   . THR D  1 143 ? -6.959  -46.312 -8.400  1.00 20.14  ? 141 THR D O   1 
ATOM   5418 C  CB  . THR D  1 143 ? -5.812  -44.745 -5.592  1.00 21.45  ? 141 THR D CB  1 
ATOM   5419 O  OG1 . THR D  1 143 ? -4.797  -44.563 -6.579  1.00 20.64  ? 141 THR D OG1 1 
ATOM   5420 C  CG2 . THR D  1 143 ? -5.159  -45.099 -4.261  1.00 21.67  ? 141 THR D CG2 1 
ATOM   5421 N  N   . LYS D  1 144 ? -7.836  -44.379 -7.668  1.00 25.42  ? 142 LYS D N   1 
ATOM   5422 C  CA  . LYS D  1 144 ? -8.448  -44.016 -8.940  1.00 29.43  ? 142 LYS D CA  1 
ATOM   5423 C  C   . LYS D  1 144 ? -7.433  -43.457 -9.927  1.00 32.86  ? 142 LYS D C   1 
ATOM   5424 O  O   . LYS D  1 144 ? -7.760  -43.230 -11.092 1.00 31.48  ? 142 LYS D O   1 
ATOM   5425 C  CB  . LYS D  1 144 ? -9.537  -42.970 -8.733  1.00 30.21  ? 142 LYS D CB  1 
ATOM   5426 C  CG  . LYS D  1 144 ? -10.699 -43.430 -7.875  1.00 31.21  ? 142 LYS D CG  1 
ATOM   5427 C  CD  . LYS D  1 144 ? -11.693 -42.293 -7.694  1.00 32.43  ? 142 LYS D CD  1 
ATOM   5428 C  CE  . LYS D  1 144 ? -12.660 -42.570 -6.561  1.00 33.22  ? 142 LYS D CE  1 
ATOM   5429 N  NZ  . LYS D  1 144 ? -13.575 -41.419 -6.348  1.00 35.33  ? 142 LYS D NZ  1 
ATOM   5430 N  N   . GLU D  1 145 ? -6.212  -43.225 -9.463  1.00 38.00  ? 143 GLU D N   1 
ATOM   5431 C  CA  . GLU D  1 145 ? -5.183  -42.630 -10.309 1.00 46.56  ? 143 GLU D CA  1 
ATOM   5432 C  C   . GLU D  1 145 ? -4.043  -43.616 -10.477 1.00 43.86  ? 143 GLU D C   1 
ATOM   5433 O  O   . GLU D  1 145 ? -3.718  -44.366 -9.557  1.00 48.33  ? 143 GLU D O   1 
ATOM   5434 C  CB  . GLU D  1 145 ? -4.650  -41.347 -9.677  1.00 54.63  ? 143 GLU D CB  1 
ATOM   5435 C  CG  . GLU D  1 145 ? -5.722  -40.302 -9.399  1.00 68.15  ? 143 GLU D CG  1 
ATOM   5436 C  CD  . GLU D  1 145 ? -5.980  -39.386 -10.591 1.00 78.67  ? 143 GLU D CD  1 
ATOM   5437 O  OE1 . GLU D  1 145 ? -5.310  -39.542 -11.639 1.00 67.94  ? 143 GLU D OE1 1 
ATOM   5438 O  OE2 . GLU D  1 145 ? -6.865  -38.510 -10.482 1.00 87.05  ? 143 GLU D OE2 1 
ATOM   5439 N  N   . LEU D  1 146 ? -3.424  -43.609 -11.648 1.00 42.18  ? 144 LEU D N   1 
ATOM   5440 C  CA  . LEU D  1 146 ? -2.123  -44.243 -11.803 1.00 45.59  ? 144 LEU D CA  1 
ATOM   5441 C  C   . LEU D  1 146 ? -1.231  -43.378 -12.691 1.00 41.10  ? 144 LEU D C   1 
ATOM   5442 O  O   . LEU D  1 146 ? -1.707  -42.482 -13.383 1.00 37.22  ? 144 LEU D O   1 
ATOM   5443 C  CB  . LEU D  1 146 ? -2.258  -45.650 -12.406 1.00 49.30  ? 144 LEU D CB  1 
ATOM   5444 C  CG  . LEU D  1 146 ? -2.951  -46.768 -11.602 1.00 46.07  ? 144 LEU D CG  1 
ATOM   5445 C  CD1 . LEU D  1 146 ? -3.089  -48.004 -12.485 1.00 48.76  ? 144 LEU D CD1 1 
ATOM   5446 C  CD2 . LEU D  1 146 ? -2.222  -47.128 -10.316 1.00 43.84  ? 144 LEU D CD2 1 
ATOM   5447 N  N   . THR D  1 147 ? 0.067   -43.645 -12.636 1.00 38.97  ? 145 THR D N   1 
ATOM   5448 C  CA  . THR D  1 147 ? 1.063   -42.826 -13.320 1.00 39.24  ? 145 THR D CA  1 
ATOM   5449 C  C   . THR D  1 147 ? 0.947   -43.000 -14.822 1.00 40.12  ? 145 THR D C   1 
ATOM   5450 O  O   . THR D  1 147 ? 0.490   -44.036 -15.295 1.00 46.46  ? 145 THR D O   1 
ATOM   5451 C  CB  . THR D  1 147 ? 2.492   -43.213 -12.887 1.00 40.20  ? 145 THR D CB  1 
ATOM   5452 O  OG1 . THR D  1 147 ? 2.720   -44.607 -13.152 1.00 42.11  ? 145 THR D OG1 1 
ATOM   5453 C  CG2 . THR D  1 147 ? 2.691   -42.947 -11.396 1.00 41.08  ? 145 THR D CG2 1 
ATOM   5454 N  N   . SER D  1 148 ? 1.368   -41.980 -15.560 1.00 42.26  ? 146 SER D N   1 
ATOM   5455 C  CA  . SER D  1 148 ? 1.562   -42.077 -17.000 1.00 42.46  ? 146 SER D CA  1 
ATOM   5456 C  C   . SER D  1 148 ? 2.357   -43.313 -17.380 1.00 41.78  ? 146 SER D C   1 
ATOM   5457 O  O   . SER D  1 148 ? 2.040   -43.984 -18.356 1.00 42.97  ? 146 SER D O   1 
ATOM   5458 C  CB  . SER D  1 148 ? 2.298   -40.845 -17.518 1.00 42.99  ? 146 SER D CB  1 
ATOM   5459 O  OG  . SER D  1 148 ? 1.498   -39.691 -17.382 1.00 48.45  ? 146 SER D OG  1 
ATOM   5460 N  N   . GLU D  1 149 ? 3.397   -43.601 -16.612 1.00 42.27  ? 147 GLU D N   1 
ATOM   5461 C  CA  . GLU D  1 149 ? 4.272   -44.724 -16.898 1.00 43.95  ? 147 GLU D CA  1 
ATOM   5462 C  C   . GLU D  1 149 ? 3.494   -46.041 -16.894 1.00 40.22  ? 147 GLU D C   1 
ATOM   5463 O  O   . GLU D  1 149 ? 3.632   -46.844 -17.811 1.00 36.68  ? 147 GLU D O   1 
ATOM   5464 C  CB  . GLU D  1 149 ? 5.399   -44.783 -15.866 1.00 47.58  ? 147 GLU D CB  1 
ATOM   5465 C  CG  . GLU D  1 149 ? 6.460   -45.835 -16.136 1.00 52.34  ? 147 GLU D CG  1 
ATOM   5466 C  CD  . GLU D  1 149 ? 7.693   -45.664 -15.263 1.00 59.62  ? 147 GLU D CD  1 
ATOM   5467 O  OE1 . GLU D  1 149 ? 7.966   -44.529 -14.814 1.00 70.44  ? 147 GLU D OE1 1 
ATOM   5468 O  OE2 . GLU D  1 149 ? 8.389   -46.665 -15.013 1.00 55.75  ? 147 GLU D OE2 1 
ATOM   5469 N  N   . LEU D  1 150 ? 2.686   -46.264 -15.862 1.00 38.69  ? 148 LEU D N   1 
ATOM   5470 C  CA  . LEU D  1 150 ? 1.890   -47.480 -15.774 1.00 42.50  ? 148 LEU D CA  1 
ATOM   5471 C  C   . LEU D  1 150 ? 0.859   -47.541 -16.903 1.00 35.78  ? 148 LEU D C   1 
ATOM   5472 O  O   . LEU D  1 150 ? 0.591   -48.598 -17.460 1.00 29.99  ? 148 LEU D O   1 
ATOM   5473 C  CB  . LEU D  1 150 ? 1.201   -47.593 -14.406 1.00 52.40  ? 148 LEU D CB  1 
ATOM   5474 C  CG  . LEU D  1 150 ? 2.134   -47.946 -13.238 1.00 64.46  ? 148 LEU D CG  1 
ATOM   5475 C  CD1 . LEU D  1 150 ? 1.470   -47.666 -11.895 1.00 62.60  ? 148 LEU D CD1 1 
ATOM   5476 C  CD2 . LEU D  1 150 ? 2.576   -49.407 -13.312 1.00 72.11  ? 148 LEU D CD2 1 
ATOM   5477 N  N   . LYS D  1 151 ? 0.270   -46.406 -17.235 1.00 35.53  ? 149 LYS D N   1 
ATOM   5478 C  CA  . LYS D  1 151 ? -0.757  -46.389 -18.257 1.00 35.49  ? 149 LYS D CA  1 
ATOM   5479 C  C   . LYS D  1 151 ? -0.164  -46.608 -19.649 1.00 34.63  ? 149 LYS D C   1 
ATOM   5480 O  O   . LYS D  1 151 ? -0.742  -47.314 -20.457 1.00 31.59  ? 149 LYS D O   1 
ATOM   5481 C  CB  . LYS D  1 151 ? -1.551  -45.095 -18.180 1.00 41.05  ? 149 LYS D CB  1 
ATOM   5482 C  CG  . LYS D  1 151 ? -2.391  -45.014 -16.903 1.00 46.45  ? 149 LYS D CG  1 
ATOM   5483 C  CD  . LYS D  1 151 ? -3.393  -43.868 -16.931 1.00 48.66  ? 149 LYS D CD  1 
ATOM   5484 C  CE  . LYS D  1 151 ? -2.718  -42.533 -16.671 1.00 50.01  ? 149 LYS D CE  1 
ATOM   5485 N  NZ  . LYS D  1 151 ? -3.679  -41.517 -16.160 1.00 49.89  ? 149 LYS D NZ  1 
ATOM   5486 N  N   . GLU D  1 152 ? 1.024   -46.073 -19.893 1.00 32.02  ? 150 GLU D N   1 
ATOM   5487 C  CA  . GLU D  1 152 ? 1.763   -46.380 -21.107 1.00 32.31  ? 150 GLU D CA  1 
ATOM   5488 C  C   . GLU D  1 152 ? 2.182   -47.847 -21.204 1.00 29.50  ? 150 GLU D C   1 
ATOM   5489 O  O   . GLU D  1 152 ? 2.162   -48.434 -22.279 1.00 27.55  ? 150 GLU D O   1 
ATOM   5490 C  CB  . GLU D  1 152 ? 2.976   -45.465 -21.229 1.00 34.07  ? 150 GLU D CB  1 
ATOM   5491 C  CG  . GLU D  1 152 ? 3.716   -45.603 -22.540 1.00 35.98  ? 150 GLU D CG  1 
ATOM   5492 C  CD  . GLU D  1 152 ? 3.034   -44.896 -23.703 1.00 38.87  ? 150 GLU D CD  1 
ATOM   5493 O  OE1 . GLU D  1 152 ? 2.533   -43.755 -23.522 1.00 42.20  ? 150 GLU D OE1 1 
ATOM   5494 O  OE2 . GLU D  1 152 ? 3.038   -45.468 -24.813 1.00 37.56  ? 150 GLU D OE2 1 
ATOM   5495 N  N   . ASN D  1 153 ? 2.559   -48.446 -20.084 1.00 29.61  ? 151 ASN D N   1 
ATOM   5496 C  CA  . ASN D  1 153 ? 2.885   -49.861 -20.075 1.00 28.87  ? 151 ASN D CA  1 
ATOM   5497 C  C   . ASN D  1 153 ? 1.677   -50.692 -20.448 1.00 24.68  ? 151 ASN D C   1 
ATOM   5498 O  O   . ASN D  1 153 ? 1.805   -51.713 -21.124 1.00 24.14  ? 151 ASN D O   1 
ATOM   5499 C  CB  . ASN D  1 153 ? 3.388   -50.285 -18.706 1.00 34.28  ? 151 ASN D CB  1 
ATOM   5500 C  CG  . ASN D  1 153 ? 4.727   -49.660 -18.368 1.00 49.26  ? 151 ASN D CG  1 
ATOM   5501 O  OD1 . ASN D  1 153 ? 5.461   -49.202 -19.253 1.00 63.22  ? 151 ASN D OD1 1 
ATOM   5502 N  ND2 . ASN D  1 153 ? 5.046   -49.608 -17.077 1.00 61.20  ? 151 ASN D ND2 1 
ATOM   5503 N  N   . PHE D  1 154 ? 0.511   -50.266 -19.970 1.00 22.03  ? 152 PHE D N   1 
ATOM   5504 C  CA  . PHE D  1 154 ? -0.742  -50.965 -20.224 1.00 20.52  ? 152 PHE D CA  1 
ATOM   5505 C  C   . PHE D  1 154 ? -1.088  -50.841 -21.705 1.00 21.24  ? 152 PHE D C   1 
ATOM   5506 O  O   . PHE D  1 154 ? -1.543  -51.796 -22.322 1.00 20.21  ? 152 PHE D O   1 
ATOM   5507 C  CB  . PHE D  1 154 ? -1.845  -50.377 -19.339 1.00 19.50  ? 152 PHE D CB  1 
ATOM   5508 C  CG  . PHE D  1 154 ? -3.244  -50.796 -19.715 1.00 18.77  ? 152 PHE D CG  1 
ATOM   5509 C  CD1 . PHE D  1 154 ? -4.128  -49.876 -20.248 1.00 19.33  ? 152 PHE D CD1 1 
ATOM   5510 C  CD2 . PHE D  1 154 ? -3.699  -52.086 -19.468 1.00 17.62  ? 152 PHE D CD2 1 
ATOM   5511 C  CE1 . PHE D  1 154 ? -5.427  -50.233 -20.570 1.00 19.60  ? 152 PHE D CE1 1 
ATOM   5512 C  CE2 . PHE D  1 154 ? -5.000  -52.453 -19.784 1.00 17.44  ? 152 PHE D CE2 1 
ATOM   5513 C  CZ  . PHE D  1 154 ? -5.866  -51.520 -20.326 1.00 18.78  ? 152 PHE D CZ  1 
ATOM   5514 N  N   . ILE D  1 155 ? -0.856  -49.665 -22.270 1.00 22.29  ? 153 ILE D N   1 
ATOM   5515 C  CA  . ILE D  1 155 ? -1.085  -49.450 -23.680 1.00 24.97  ? 153 ILE D CA  1 
ATOM   5516 C  C   . ILE D  1 155 ? -0.137  -50.316 -24.520 1.00 27.85  ? 153 ILE D C   1 
ATOM   5517 O  O   . ILE D  1 155 ? -0.544  -50.966 -25.487 1.00 27.87  ? 153 ILE D O   1 
ATOM   5518 C  CB  . ILE D  1 155 ? -0.890  -47.968 -24.040 1.00 26.27  ? 153 ILE D CB  1 
ATOM   5519 C  CG1 . ILE D  1 155 ? -2.012  -47.115 -23.435 1.00 27.05  ? 153 ILE D CG1 1 
ATOM   5520 C  CG2 . ILE D  1 155 ? -0.843  -47.794 -25.540 1.00 26.81  ? 153 ILE D CG2 1 
ATOM   5521 C  CD1 . ILE D  1 155 ? -1.748  -45.624 -23.435 1.00 28.94  ? 153 ILE D CD1 1 
ATOM   5522 N  N   . ARG D  1 156 ? 1.126   -50.355 -24.118 1.00 30.65  ? 154 ARG D N   1 
ATOM   5523 C  CA  . ARG D  1 156 ? 2.115   -51.204 -24.776 1.00 32.04  ? 154 ARG D CA  1 
ATOM   5524 C  C   . ARG D  1 156 ? 1.679   -52.679 -24.763 1.00 26.50  ? 154 ARG D C   1 
ATOM   5525 O  O   . ARG D  1 156 ? 1.725   -53.360 -25.787 1.00 28.79  ? 154 ARG D O   1 
ATOM   5526 C  CB  . ARG D  1 156 ? 3.477   -51.034 -24.092 1.00 38.44  ? 154 ARG D CB  1 
ATOM   5527 C  CG  . ARG D  1 156 ? 4.642   -51.733 -24.782 1.00 43.91  ? 154 ARG D CG  1 
ATOM   5528 C  CD  . ARG D  1 156 ? 5.996   -51.228 -24.274 1.00 49.76  ? 154 ARG D CD  1 
ATOM   5529 N  NE  . ARG D  1 156 ? 6.004   -49.797 -23.952 1.00 49.84  ? 154 ARG D NE  1 
ATOM   5530 C  CZ  . ARG D  1 156 ? 6.144   -49.309 -22.720 1.00 53.02  ? 154 ARG D CZ  1 
ATOM   5531 N  NH1 . ARG D  1 156 ? 6.148   -47.995 -22.517 1.00 49.80  ? 154 ARG D NH1 1 
ATOM   5532 N  NH2 . ARG D  1 156 ? 6.278   -50.132 -21.682 1.00 47.35  ? 154 ARG D NH2 1 
ATOM   5533 N  N   . PHE D  1 157 ? 1.257   -53.171 -23.607 1.00 21.93  ? 155 PHE D N   1 
ATOM   5534 C  CA  . PHE D  1 157 ? 0.860   -54.577 -23.480 1.00 19.82  ? 155 PHE D CA  1 
ATOM   5535 C  C   . PHE D  1 157 ? -0.369  -54.857 -24.344 1.00 19.39  ? 155 PHE D C   1 
ATOM   5536 O  O   . PHE D  1 157 ? -0.446  -55.877 -25.022 1.00 19.75  ? 155 PHE D O   1 
ATOM   5537 C  CB  . PHE D  1 157 ? 0.580   -54.933 -22.006 1.00 18.23  ? 155 PHE D CB  1 
ATOM   5538 C  CG  . PHE D  1 157 ? 0.083   -56.363 -21.796 1.00 17.04  ? 155 PHE D CG  1 
ATOM   5539 C  CD1 . PHE D  1 157 ? 0.885   -57.457 -22.115 1.00 16.99  ? 155 PHE D CD1 1 
ATOM   5540 C  CD2 . PHE D  1 157 ? -1.182  -56.607 -21.299 1.00 15.63  ? 155 PHE D CD2 1 
ATOM   5541 C  CE1 . PHE D  1 157 ? 0.430   -58.759 -21.939 1.00 15.54  ? 155 PHE D CE1 1 
ATOM   5542 C  CE2 . PHE D  1 157 ? -1.643  -57.900 -21.127 1.00 14.95  ? 155 PHE D CE2 1 
ATOM   5543 C  CZ  . PHE D  1 157 ? -0.836  -58.976 -21.446 1.00 15.04  ? 155 PHE D CZ  1 
ATOM   5544 N  N   . SER D  1 158 ? -1.332  -53.945 -24.303 1.00 19.48  ? 156 SER D N   1 
ATOM   5545 C  CA  . SER D  1 158 ? -2.554  -54.079 -25.070 1.00 20.31  ? 156 SER D CA  1 
ATOM   5546 C  C   . SER D  1 158 ? -2.231  -54.207 -26.554 1.00 21.51  ? 156 SER D C   1 
ATOM   5547 O  O   . SER D  1 158 ? -2.818  -55.034 -27.238 1.00 20.07  ? 156 SER D O   1 
ATOM   5548 C  CB  . SER D  1 158 ? -3.510  -52.891 -24.796 1.00 21.16  ? 156 SER D CB  1 
ATOM   5549 O  OG  . SER D  1 158 ? -4.054  -52.952 -23.478 1.00 19.34  ? 156 SER D OG  1 
ATOM   5550 N  N   . LYS D  1 159 ? -1.304  -53.389 -27.049 1.00 24.94  ? 157 LYS D N   1 
ATOM   5551 C  CA  . LYS D  1 159 ? -0.871  -53.470 -28.460 1.00 28.06  ? 157 LYS D CA  1 
ATOM   5552 C  C   . LYS D  1 159 ? -0.210  -54.812 -28.774 1.00 26.19  ? 157 LYS D C   1 
ATOM   5553 O  O   . LYS D  1 159 ? -0.389  -55.353 -29.861 1.00 25.82  ? 157 LYS D O   1 
ATOM   5554 C  CB  . LYS D  1 159 ? 0.115   -52.357 -28.816 1.00 31.85  ? 157 LYS D CB  1 
ATOM   5555 C  CG  . LYS D  1 159 ? -0.476  -51.047 -29.304 1.00 37.92  ? 157 LYS D CG  1 
ATOM   5556 C  CD  . LYS D  1 159 ? -1.433  -50.379 -28.336 1.00 37.63  ? 157 LYS D CD  1 
ATOM   5557 C  CE  . LYS D  1 159 ? -1.632  -48.942 -28.770 1.00 43.41  ? 157 LYS D CE  1 
ATOM   5558 N  NZ  . LYS D  1 159 ? -0.400  -48.330 -29.351 1.00 41.90  ? 157 LYS D NZ  1 
ATOM   5559 N  N   . SER D  1 160 ? 0.556   -55.348 -27.828 1.00 24.46  ? 158 SER D N   1 
ATOM   5560 C  CA  . SER D  1 160 ? 1.244   -56.626 -28.048 1.00 23.04  ? 158 SER D CA  1 
ATOM   5561 C  C   . SER D  1 160 ? 0.225   -57.752 -28.228 1.00 23.00  ? 158 SER D C   1 
ATOM   5562 O  O   . SER D  1 160 ? 0.560   -58.823 -28.727 1.00 23.02  ? 158 SER D O   1 
ATOM   5563 C  CB  . SER D  1 160 ? 2.165   -56.955 -26.874 1.00 21.03  ? 158 SER D CB  1 
ATOM   5564 O  OG  . SER D  1 160 ? 1.426   -57.580 -25.843 1.00 19.81  ? 158 SER D OG  1 
ATOM   5565 N  N   . LEU D  1 161 ? -1.024  -57.496 -27.843 1.00 22.19  ? 159 LEU D N   1 
ATOM   5566 C  CA  . LEU D  1 161 ? -2.093  -58.462 -28.049 1.00 21.37  ? 159 LEU D CA  1 
ATOM   5567 C  C   . LEU D  1 161 ? -2.978  -58.128 -29.242 1.00 21.94  ? 159 LEU D C   1 
ATOM   5568 O  O   . LEU D  1 161 ? -4.010  -58.758 -29.440 1.00 21.81  ? 159 LEU D O   1 
ATOM   5569 C  CB  . LEU D  1 161 ? -2.964  -58.543 -26.803 1.00 21.23  ? 159 LEU D CB  1 
ATOM   5570 C  CG  . LEU D  1 161 ? -2.250  -58.947 -25.514 1.00 20.68  ? 159 LEU D CG  1 
ATOM   5571 C  CD1 . LEU D  1 161 ? -3.277  -59.052 -24.407 1.00 21.18  ? 159 LEU D CD1 1 
ATOM   5572 C  CD2 . LEU D  1 161 ? -1.493  -60.254 -25.667 1.00 19.67  ? 159 LEU D CD2 1 
ATOM   5573 N  N   . GLY D  1 162 ? -2.582  -57.141 -30.037 1.00 22.12  ? 160 GLY D N   1 
ATOM   5574 C  CA  . GLY D  1 162 ? -3.254  -56.868 -31.306 1.00 23.06  ? 160 GLY D CA  1 
ATOM   5575 C  C   . GLY D  1 162 ? -4.202  -55.679 -31.277 1.00 24.60  ? 160 GLY D C   1 
ATOM   5576 O  O   . GLY D  1 162 ? -4.835  -55.371 -32.282 1.00 26.37  ? 160 GLY D O   1 
ATOM   5577 N  N   . LEU D  1 163 ? -4.280  -54.981 -30.150 1.00 24.41  ? 161 LEU D N   1 
ATOM   5578 C  CA  . LEU D  1 163 ? -5.231  -53.874 -30.007 1.00 26.52  ? 161 LEU D CA  1 
ATOM   5579 C  C   . LEU D  1 163 ? -4.605  -52.520 -30.332 1.00 28.88  ? 161 LEU D C   1 
ATOM   5580 O  O   . LEU D  1 163 ? -3.585  -52.164 -29.770 1.00 28.88  ? 161 LEU D O   1 
ATOM   5581 C  CB  . LEU D  1 163 ? -5.779  -53.825 -28.582 1.00 24.38  ? 161 LEU D CB  1 
ATOM   5582 C  CG  . LEU D  1 163 ? -6.547  -55.064 -28.136 1.00 23.44  ? 161 LEU D CG  1 
ATOM   5583 C  CD1 . LEU D  1 163 ? -6.824  -54.972 -26.640 1.00 23.05  ? 161 LEU D CD1 1 
ATOM   5584 C  CD2 . LEU D  1 163 ? -7.839  -55.213 -28.923 1.00 23.70  ? 161 LEU D CD2 1 
ATOM   5585 N  N   . PRO D  1 164 ? -5.244  -51.744 -31.214 1.00 32.51  ? 162 PRO D N   1 
ATOM   5586 C  CA  . PRO D  1 164 ? -4.836  -50.366 -31.456 1.00 34.93  ? 162 PRO D CA  1 
ATOM   5587 C  C   . PRO D  1 164 ? -5.433  -49.380 -30.440 1.00 37.87  ? 162 PRO D C   1 
ATOM   5588 O  O   . PRO D  1 164 ? -6.262  -49.759 -29.612 1.00 34.13  ? 162 PRO D O   1 
ATOM   5589 C  CB  . PRO D  1 164 ? -5.377  -50.090 -32.856 1.00 35.08  ? 162 PRO D CB  1 
ATOM   5590 C  CG  . PRO D  1 164 ? -6.591  -50.946 -32.957 1.00 36.04  ? 162 PRO D CG  1 
ATOM   5591 C  CD  . PRO D  1 164 ? -6.381  -52.142 -32.065 1.00 34.04  ? 162 PRO D CD  1 
ATOM   5592 N  N   . GLU D  1 165 ? -5.027  -48.117 -30.539 1.00 41.78  ? 163 GLU D N   1 
ATOM   5593 C  CA  . GLU D  1 165 ? -5.238  -47.147 -29.476 1.00 43.02  ? 163 GLU D CA  1 
ATOM   5594 C  C   . GLU D  1 165 ? -6.714  -46.870 -29.247 1.00 40.27  ? 163 GLU D C   1 
ATOM   5595 O  O   . GLU D  1 165 ? -7.134  -46.594 -28.122 1.00 38.52  ? 163 GLU D O   1 
ATOM   5596 C  CB  . GLU D  1 165 ? -4.542  -45.821 -29.827 1.00 50.86  ? 163 GLU D CB  1 
ATOM   5597 C  CG  . GLU D  1 165 ? -4.076  -45.026 -28.614 1.00 55.12  ? 163 GLU D CG  1 
ATOM   5598 C  CD  . GLU D  1 165 ? -2.586  -45.173 -28.358 1.00 58.92  ? 163 GLU D CD  1 
ATOM   5599 O  OE1 . GLU D  1 165 ? -1.947  -46.081 -28.950 1.00 63.76  ? 163 GLU D OE1 1 
ATOM   5600 O  OE2 . GLU D  1 165 ? -2.050  -44.367 -27.573 1.00 58.19  ? 163 GLU D OE2 1 
ATOM   5601 N  N   . ASN D  1 166 ? -7.496  -46.899 -30.319 1.00 38.88  ? 164 ASN D N   1 
ATOM   5602 C  CA  . ASN D  1 166 ? -8.908  -46.579 -30.218 1.00 39.80  ? 164 ASN D CA  1 
ATOM   5603 C  C   . ASN D  1 166 ? -9.732  -47.734 -29.651 1.00 36.29  ? 164 ASN D C   1 
ATOM   5604 O  O   . ASN D  1 166 ? -10.938 -47.610 -29.476 1.00 36.44  ? 164 ASN D O   1 
ATOM   5605 C  CB  . ASN D  1 166 ? -9.458  -46.135 -31.570 1.00 44.92  ? 164 ASN D CB  1 
ATOM   5606 C  CG  . ASN D  1 166 ? -9.434  -47.244 -32.608 1.00 47.59  ? 164 ASN D CG  1 
ATOM   5607 O  OD1 . ASN D  1 166 ? -8.665  -48.200 -32.509 1.00 45.71  ? 164 ASN D OD1 1 
ATOM   5608 N  ND2 . ASN D  1 166 ? -10.286 -47.116 -33.613 1.00 52.01  ? 164 ASN D ND2 1 
ATOM   5609 N  N   . HIS D  1 167 ? -9.070  -48.838 -29.323 1.00 33.12  ? 165 HIS D N   1 
ATOM   5610 C  CA  . HIS D  1 167 ? -9.683  -49.895 -28.533 1.00 30.82  ? 165 HIS D CA  1 
ATOM   5611 C  C   . HIS D  1 167 ? -9.192  -49.883 -27.084 1.00 27.53  ? 165 HIS D C   1 
ATOM   5612 O  O   . HIS D  1 167 ? -9.314  -50.871 -26.354 1.00 24.99  ? 165 HIS D O   1 
ATOM   5613 C  CB  . HIS D  1 167 ? -9.405  -51.250 -29.184 1.00 30.96  ? 165 HIS D CB  1 
ATOM   5614 C  CG  . HIS D  1 167 ? -10.281 -51.538 -30.360 1.00 33.38  ? 165 HIS D CG  1 
ATOM   5615 N  ND1 . HIS D  1 167 ? -11.383 -52.360 -30.279 1.00 35.34  ? 165 HIS D ND1 1 
ATOM   5616 C  CD2 . HIS D  1 167 ? -10.222 -51.115 -31.643 1.00 36.32  ? 165 HIS D CD2 1 
ATOM   5617 C  CE1 . HIS D  1 167 ? -11.973 -52.424 -31.461 1.00 37.02  ? 165 HIS D CE1 1 
ATOM   5618 N  NE2 . HIS D  1 167 ? -11.286 -51.680 -32.308 1.00 38.05  ? 165 HIS D NE2 1 
ATOM   5619 N  N   . ILE D  1 168 ? -8.635  -48.753 -26.675 1.00 27.01  ? 166 ILE D N   1 
ATOM   5620 C  CA  . ILE D  1 168 ? -8.161  -48.578 -25.313 1.00 25.67  ? 166 ILE D CA  1 
ATOM   5621 C  C   . ILE D  1 168 ? -8.805  -47.332 -24.712 1.00 27.01  ? 166 ILE D C   1 
ATOM   5622 O  O   . ILE D  1 168 ? -8.721  -46.255 -25.294 1.00 29.44  ? 166 ILE D O   1 
ATOM   5623 C  CB  . ILE D  1 168 ? -6.636  -48.432 -25.303 1.00 25.31  ? 166 ILE D CB  1 
ATOM   5624 C  CG1 . ILE D  1 168 ? -5.976  -49.658 -25.960 1.00 24.38  ? 166 ILE D CG1 1 
ATOM   5625 C  CG2 . ILE D  1 168 ? -6.139  -48.265 -23.882 1.00 24.11  ? 166 ILE D CG2 1 
ATOM   5626 C  CD1 . ILE D  1 168 ? -4.485  -49.543 -26.155 1.00 24.24  ? 166 ILE D CD1 1 
ATOM   5627 N  N   . VAL D  1 169 ? -9.436  -47.469 -23.548 1.00 25.94  ? 167 VAL D N   1 
ATOM   5628 C  CA  . VAL D  1 169 ? -10.038 -46.319 -22.873 1.00 26.61  ? 167 VAL D CA  1 
ATOM   5629 C  C   . VAL D  1 169 ? -9.655  -46.220 -21.401 1.00 24.91  ? 167 VAL D C   1 
ATOM   5630 O  O   . VAL D  1 169 ? -9.264  -47.199 -20.762 1.00 23.43  ? 167 VAL D O   1 
ATOM   5631 C  CB  . VAL D  1 169 ? -11.577 -46.298 -22.971 1.00 28.05  ? 167 VAL D CB  1 
ATOM   5632 C  CG1 . VAL D  1 169 ? -12.010 -46.445 -24.412 1.00 29.96  ? 167 VAL D CG1 1 
ATOM   5633 C  CG2 . VAL D  1 169 ? -12.184 -47.386 -22.107 1.00 27.22  ? 167 VAL D CG2 1 
ATOM   5634 N  N   . PHE D  1 170 ? -9.759  -45.008 -20.881 1.00 25.49  ? 168 PHE D N   1 
ATOM   5635 C  CA  . PHE D  1 170 ? -9.432  -44.737 -19.503 1.00 24.82  ? 168 PHE D CA  1 
ATOM   5636 C  C   . PHE D  1 170 ? -10.634 -44.079 -18.862 1.00 25.04  ? 168 PHE D C   1 
ATOM   5637 O  O   . PHE D  1 170 ? -10.864 -42.894 -19.029 1.00 25.95  ? 168 PHE D O   1 
ATOM   5638 C  CB  . PHE D  1 170 ? -8.187  -43.852 -19.422 1.00 25.32  ? 168 PHE D CB  1 
ATOM   5639 C  CG  . PHE D  1 170 ? -6.948  -44.525 -19.943 1.00 24.66  ? 168 PHE D CG  1 
ATOM   5640 C  CD1 . PHE D  1 170 ? -6.539  -44.336 -21.249 1.00 25.54  ? 168 PHE D CD1 1 
ATOM   5641 C  CD2 . PHE D  1 170 ? -6.235  -45.408 -19.145 1.00 23.55  ? 168 PHE D CD2 1 
ATOM   5642 C  CE1 . PHE D  1 170 ? -5.412  -44.971 -21.737 1.00 25.33  ? 168 PHE D CE1 1 
ATOM   5643 C  CE2 . PHE D  1 170 ? -5.110  -46.067 -19.631 1.00 23.05  ? 168 PHE D CE2 1 
ATOM   5644 C  CZ  . PHE D  1 170 ? -4.694  -45.837 -20.927 1.00 23.86  ? 168 PHE D CZ  1 
ATOM   5645 N  N   . PRO D  1 171 ? -11.435 -44.880 -18.161 1.00 24.40  ? 169 PRO D N   1 
ATOM   5646 C  CA  . PRO D  1 171 ? -12.681 -44.413 -17.572 1.00 25.37  ? 169 PRO D CA  1 
ATOM   5647 C  C   . PRO D  1 171 ? -12.465 -43.233 -16.626 1.00 26.24  ? 169 PRO D C   1 
ATOM   5648 O  O   . PRO D  1 171 ? -11.471 -43.176 -15.898 1.00 24.87  ? 169 PRO D O   1 
ATOM   5649 C  CB  . PRO D  1 171 ? -13.186 -45.637 -16.803 1.00 23.95  ? 169 PRO D CB  1 
ATOM   5650 C  CG  . PRO D  1 171 ? -12.564 -46.805 -17.496 1.00 22.59  ? 169 PRO D CG  1 
ATOM   5651 C  CD  . PRO D  1 171 ? -11.225 -46.327 -17.963 1.00 22.54  ? 169 PRO D CD  1 
ATOM   5652 N  N   . VAL D  1 172 ? -13.390 -42.289 -16.673 1.00 28.85  ? 170 VAL D N   1 
ATOM   5653 C  CA  . VAL D  1 172 ? -13.261 -41.037 -15.952 1.00 29.89  ? 170 VAL D CA  1 
ATOM   5654 C  C   . VAL D  1 172 ? -13.579 -41.300 -14.487 1.00 28.75  ? 170 VAL D C   1 
ATOM   5655 O  O   . VAL D  1 172 ? -14.592 -41.917 -14.177 1.00 28.51  ? 170 VAL D O   1 
ATOM   5656 C  CB  . VAL D  1 172 ? -14.226 -39.993 -16.542 1.00 33.07  ? 170 VAL D CB  1 
ATOM   5657 C  CG1 . VAL D  1 172 ? -14.215 -38.711 -15.722 1.00 34.56  ? 170 VAL D CG1 1 
ATOM   5658 C  CG2 . VAL D  1 172 ? -13.853 -39.706 -17.993 1.00 34.74  ? 170 VAL D CG2 1 
ATOM   5659 N  N   . PRO D  1 173 ? -12.698 -40.859 -13.580 1.00 28.59  ? 171 PRO D N   1 
ATOM   5660 C  CA  . PRO D  1 173 ? -12.980 -40.987 -12.143 1.00 28.11  ? 171 PRO D CA  1 
ATOM   5661 C  C   . PRO D  1 173 ? -14.299 -40.327 -11.760 1.00 28.33  ? 171 PRO D C   1 
ATOM   5662 O  O   . PRO D  1 173 ? -14.630 -39.265 -12.276 1.00 28.53  ? 171 PRO D O   1 
ATOM   5663 C  CB  . PRO D  1 173 ? -11.811 -40.244 -11.483 1.00 27.73  ? 171 PRO D CB  1 
ATOM   5664 C  CG  . PRO D  1 173 ? -10.709 -40.287 -12.492 1.00 27.39  ? 171 PRO D CG  1 
ATOM   5665 C  CD  . PRO D  1 173 ? -11.376 -40.266 -13.839 1.00 28.25  ? 171 PRO D CD  1 
ATOM   5666 N  N   . ILE D  1 174 ? -15.044 -40.981 -10.878 1.00 27.54  ? 172 ILE D N   1 
ATOM   5667 C  CA  . ILE D  1 174 ? -16.264 -40.414 -10.313 1.00 28.61  ? 172 ILE D CA  1 
ATOM   5668 C  C   . ILE D  1 174 ? -16.305 -40.733 -8.823  1.00 28.94  ? 172 ILE D C   1 
ATOM   5669 O  O   . ILE D  1 174 ? -15.518 -41.549 -8.338  1.00 27.21  ? 172 ILE D O   1 
ATOM   5670 C  CB  . ILE D  1 174 ? -17.517 -41.026 -10.967 1.00 29.18  ? 172 ILE D CB  1 
ATOM   5671 C  CG1 . ILE D  1 174 ? -17.550 -42.548 -10.746 1.00 26.99  ? 172 ILE D CG1 1 
ATOM   5672 C  CG2 . ILE D  1 174 ? -17.562 -40.701 -12.456 1.00 30.02  ? 172 ILE D CG2 1 
ATOM   5673 C  CD1 . ILE D  1 174 ? -18.874 -43.185 -11.107 1.00 27.55  ? 172 ILE D CD1 1 
ATOM   5674 N  N   . ASP D  1 175 ? -17.261 -40.139 -8.118  1.00 31.20  ? 173 ASP D N   1 
ATOM   5675 C  CA  . ASP D  1 175 ? -17.378 -40.302 -6.660  1.00 31.36  ? 173 ASP D CA  1 
ATOM   5676 C  C   . ASP D  1 175 ? -18.580 -41.152 -6.256  1.00 29.91  ? 173 ASP D C   1 
ATOM   5677 O  O   . ASP D  1 175 ? -18.581 -41.753 -5.192  1.00 30.52  ? 173 ASP D O   1 
ATOM   5678 C  CB  . ASP D  1 175 ? -17.485 -38.931 -5.981  1.00 33.66  ? 173 ASP D CB  1 
ATOM   5679 C  CG  . ASP D  1 175 ? -16.162 -38.203 -5.945  1.00 35.45  ? 173 ASP D CG  1 
ATOM   5680 O  OD1 . ASP D  1 175 ? -16.165 -36.957 -5.894  1.00 42.54  ? 173 ASP D OD1 1 
ATOM   5681 O  OD2 . ASP D  1 175 ? -15.116 -38.875 -5.986  1.00 35.80  ? 173 ASP D OD2 1 
ATOM   5682 N  N   . GLN D  1 176 ? -19.600 -41.195 -7.104  1.00 29.43  ? 174 GLN D N   1 
ATOM   5683 C  CA  . GLN D  1 176 ? -20.808 -41.954 -6.805  1.00 29.03  ? 174 GLN D CA  1 
ATOM   5684 C  C   . GLN D  1 176 ? -20.537 -43.463 -6.790  1.00 26.99  ? 174 GLN D C   1 
ATOM   5685 O  O   . GLN D  1 176 ? -19.844 -43.982 -7.655  1.00 25.34  ? 174 GLN D O   1 
ATOM   5686 C  CB  . GLN D  1 176 ? -21.895 -41.606 -7.822  1.00 31.05  ? 174 GLN D CB  1 
ATOM   5687 C  CG  . GLN D  1 176 ? -22.284 -40.132 -7.801  1.00 32.70  ? 174 GLN D CG  1 
ATOM   5688 C  CD  . GLN D  1 176 ? -21.591 -39.305 -8.875  1.00 33.82  ? 174 GLN D CD  1 
ATOM   5689 O  OE1 . GLN D  1 176 ? -20.566 -39.703 -9.440  1.00 33.80  ? 174 GLN D OE1 1 
ATOM   5690 N  NE2 . GLN D  1 176 ? -22.150 -38.141 -9.159  1.00 35.55  ? 174 GLN D NE2 1 
ATOM   5691 N  N   . CYS D  1 177 ? -21.060 -44.137 -5.766  1.00 26.33  ? 175 CYS D N   1 
ATOM   5692 C  CA  . CYS D  1 177 ? -21.188 -45.596 -5.719  1.00 25.00  ? 175 CYS D CA  1 
ATOM   5693 C  C   . CYS D  1 177 ? -19.902 -46.334 -5.410  1.00 23.79  ? 175 CYS D C   1 
ATOM   5694 O  O   . CYS D  1 177 ? -19.912 -47.322 -4.674  1.00 23.16  ? 175 CYS D O   1 
ATOM   5695 C  CB  . CYS D  1 177 ? -21.786 -46.152 -7.006  1.00 25.43  ? 175 CYS D CB  1 
ATOM   5696 S  SG  . CYS D  1 177 ? -23.452 -45.629 -7.338  1.00 28.28  ? 175 CYS D SG  1 
ATOM   5697 N  N   . ILE D  1 178 ? -18.800 -45.883 -5.986  1.00 24.64  ? 176 ILE D N   1 
ATOM   5698 C  CA  . ILE D  1 178 ? -17.604 -46.702 -6.043  1.00 24.50  ? 176 ILE D CA  1 
ATOM   5699 C  C   . ILE D  1 178 ? -16.601 -46.391 -4.931  1.00 25.44  ? 176 ILE D C   1 
ATOM   5700 O  O   . ILE D  1 178 ? -15.596 -47.089 -4.799  1.00 24.90  ? 176 ILE D O   1 
ATOM   5701 C  CB  . ILE D  1 178 ? -16.869 -46.550 -7.387  1.00 24.75  ? 176 ILE D CB  1 
ATOM   5702 C  CG1 . ILE D  1 178 ? -16.215 -45.169 -7.490  1.00 25.07  ? 176 ILE D CG1 1 
ATOM   5703 C  CG2 . ILE D  1 178 ? -17.831 -46.778 -8.549  1.00 26.16  ? 176 ILE D CG2 1 
ATOM   5704 C  CD1 . ILE D  1 178 ? -15.466 -44.958 -8.786  1.00 25.51  ? 176 ILE D CD1 1 
ATOM   5705 N  N   . ASP D  1 179 ? -16.863 -45.341 -4.158  1.00 29.78  ? 177 ASP D N   1 
ATOM   5706 C  CA  . ASP D  1 179 ? -16.056 -45.011 -2.975  1.00 33.49  ? 177 ASP D CA  1 
ATOM   5707 C  C   . ASP D  1 179 ? -16.621 -45.632 -1.699  1.00 34.20  ? 177 ASP D C   1 
ATOM   5708 O  O   . ASP D  1 179 ? -16.214 -45.271 -0.599  1.00 37.39  ? 177 ASP D O   1 
ATOM   5709 C  CB  . ASP D  1 179 ? -15.979 -43.491 -2.788  1.00 36.43  ? 177 ASP D CB  1 
ATOM   5710 C  CG  . ASP D  1 179 ? -15.128 -42.810 -3.854  1.00 40.78  ? 177 ASP D CG  1 
ATOM   5711 O  OD1 . ASP D  1 179 ? -14.305 -43.496 -4.496  1.00 37.77  ? 177 ASP D OD1 1 
ATOM   5712 O  OD2 . ASP D  1 179 ? -15.270 -41.581 -4.036  1.00 44.82  ? 177 ASP D OD2 1 
ATOM   5713 N  N   . GLY D  1 180 ? -17.556 -46.564 -1.843  1.00 37.44  ? 178 GLY D N   1 
ATOM   5714 C  CA  . GLY D  1 180 ? -18.109 -47.266 -0.691  1.00 42.64  ? 178 GLY D CA  1 
ATOM   5715 C  C   . GLY D  1 180 ? -17.151 -48.316 -0.163  1.00 45.95  ? 178 GLY D C   1 
ATOM   5716 O  O   . GLY D  1 180 ? -16.634 -48.190 0.945   1.00 47.12  ? 178 GLY D O   1 
ATOM   5717 N  N   . ASP E  1 4   ? -12.194 -22.965 -62.945 1.00 93.76  ? 2   ASP E N   1 
ATOM   5718 C  CA  . ASP E  1 4   ? -11.564 -24.264 -62.568 1.00 96.33  ? 2   ASP E CA  1 
ATOM   5719 C  C   . ASP E  1 4   ? -12.568 -25.198 -61.882 1.00 99.16  ? 2   ASP E C   1 
ATOM   5720 O  O   . ASP E  1 4   ? -12.894 -26.261 -62.419 1.00 105.38 ? 2   ASP E O   1 
ATOM   5721 C  CB  . ASP E  1 4   ? -10.350 -24.038 -61.656 1.00 89.77  ? 2   ASP E CB  1 
ATOM   5722 N  N   . SER E  1 5   ? -13.047 -24.819 -60.696 1.00 92.27  ? 3   SER E N   1 
ATOM   5723 C  CA  . SER E  1 5   ? -13.440 -25.816 -59.699 1.00 88.83  ? 3   SER E CA  1 
ATOM   5724 C  C   . SER E  1 5   ? -14.297 -25.275 -58.538 1.00 86.38  ? 3   SER E C   1 
ATOM   5725 O  O   . SER E  1 5   ? -14.509 -24.061 -58.390 1.00 79.00  ? 3   SER E O   1 
ATOM   5726 C  CB  . SER E  1 5   ? -12.181 -26.515 -59.159 1.00 81.76  ? 3   SER E CB  1 
ATOM   5727 O  OG  . SER E  1 5   ? -11.310 -25.588 -58.536 1.00 71.26  ? 3   SER E OG  1 
ATOM   5728 N  N   . THR E  1 6   ? -14.817 -26.216 -57.752 1.00 83.77  ? 4   THR E N   1 
ATOM   5729 C  CA  . THR E  1 6   ? -15.431 -25.948 -56.449 1.00 77.99  ? 4   THR E CA  1 
ATOM   5730 C  C   . THR E  1 6   ? -14.738 -26.838 -55.408 1.00 73.29  ? 4   THR E C   1 
ATOM   5731 O  O   . THR E  1 6   ? -14.140 -27.855 -55.759 1.00 74.90  ? 4   THR E O   1 
ATOM   5732 C  CB  . THR E  1 6   ? -16.951 -26.262 -56.467 1.00 79.94  ? 4   THR E CB  1 
ATOM   5733 O  OG1 . THR E  1 6   ? -17.574 -25.585 -57.565 1.00 80.99  ? 4   THR E OG1 1 
ATOM   5734 C  CG2 . THR E  1 6   ? -17.623 -25.827 -55.159 1.00 77.84  ? 4   THR E CG2 1 
ATOM   5735 N  N   . SER E  1 7   ? -14.791 -26.446 -54.139 1.00 67.39  ? 5   SER E N   1 
ATOM   5736 C  CA  . SER E  1 7   ? -14.355 -27.322 -53.049 1.00 64.36  ? 5   SER E CA  1 
ATOM   5737 C  C   . SER E  1 7   ? -14.724 -26.724 -51.680 1.00 54.63  ? 5   SER E C   1 
ATOM   5738 O  O   . SER E  1 7   ? -15.012 -25.530 -51.571 1.00 50.90  ? 5   SER E O   1 
ATOM   5739 C  CB  . SER E  1 7   ? -12.844 -27.552 -53.133 1.00 62.59  ? 5   SER E CB  1 
ATOM   5740 O  OG  . SER E  1 7   ? -12.144 -26.331 -52.993 1.00 57.14  ? 5   SER E OG  1 
ATOM   5741 N  N   . ASP E  1 8   ? -14.744 -27.569 -50.651 1.00 44.90  ? 6   ASP E N   1 
ATOM   5742 C  CA  . ASP E  1 8   ? -15.188 -27.153 -49.335 1.00 40.48  ? 6   ASP E CA  1 
ATOM   5743 C  C   . ASP E  1 8   ? -14.153 -27.530 -48.302 1.00 36.42  ? 6   ASP E C   1 
ATOM   5744 O  O   . ASP E  1 8   ? -13.742 -28.683 -48.222 1.00 36.21  ? 6   ASP E O   1 
ATOM   5745 C  CB  . ASP E  1 8   ? -16.532 -27.777 -48.987 1.00 41.97  ? 6   ASP E CB  1 
ATOM   5746 C  CG  . ASP E  1 8   ? -17.705 -27.038 -49.626 1.00 45.24  ? 6   ASP E CG  1 
ATOM   5747 O  OD1 . ASP E  1 8   ? -18.372 -26.219 -48.951 1.00 46.82  ? 6   ASP E OD1 1 
ATOM   5748 O  OD2 . ASP E  1 8   ? -17.964 -27.279 -50.817 1.00 46.23  ? 6   ASP E OD2 1 
ATOM   5749 N  N   . LEU E  1 9   ? -13.723 -26.546 -47.520 1.00 32.95  ? 7   LEU E N   1 
ATOM   5750 C  CA  . LEU E  1 9   ? -12.606 -26.725 -46.621 1.00 30.67  ? 7   LEU E CA  1 
ATOM   5751 C  C   . LEU E  1 9   ? -12.932 -26.233 -45.217 1.00 28.52  ? 7   LEU E C   1 
ATOM   5752 O  O   . LEU E  1 9   ? -13.595 -25.215 -45.036 1.00 28.72  ? 7   LEU E O   1 
ATOM   5753 C  CB  . LEU E  1 9   ? -11.394 -25.967 -47.143 1.00 30.55  ? 7   LEU E CB  1 
ATOM   5754 C  CG  . LEU E  1 9   ? -10.754 -26.493 -48.425 1.00 32.08  ? 7   LEU E CG  1 
ATOM   5755 C  CD1 . LEU E  1 9   ? -9.627  -25.564 -48.852 1.00 31.99  ? 7   LEU E CD1 1 
ATOM   5756 C  CD2 . LEU E  1 9   ? -10.232 -27.906 -48.233 1.00 31.46  ? 7   LEU E CD2 1 
ATOM   5757 N  N   . ILE E  1 10  ? -12.463 -26.966 -44.222 1.00 26.13  ? 8   ILE E N   1 
ATOM   5758 C  CA  . ILE E  1 10  ? -12.494 -26.471 -42.864 1.00 24.67  ? 8   ILE E CA  1 
ATOM   5759 C  C   . ILE E  1 10  ? -11.602 -25.243 -42.793 1.00 23.74  ? 8   ILE E C   1 
ATOM   5760 O  O   . ILE E  1 10  ? -10.487 -25.257 -43.309 1.00 22.99  ? 8   ILE E O   1 
ATOM   5761 C  CB  . ILE E  1 10  ? -12.020 -27.546 -41.862 1.00 23.30  ? 8   ILE E CB  1 
ATOM   5762 C  CG1 . ILE E  1 10  ? -13.061 -28.670 -41.777 1.00 25.01  ? 8   ILE E CG1 1 
ATOM   5763 C  CG2 . ILE E  1 10  ? -11.796 -26.937 -40.486 1.00 21.29  ? 8   ILE E CG2 1 
ATOM   5764 C  CD1 . ILE E  1 10  ? -12.503 -29.981 -41.284 1.00 24.71  ? 8   ILE E CD1 1 
ATOM   5765 N  N   . PRO E  1 11  ? -12.098 -24.167 -42.169 1.00 24.14  ? 9   PRO E N   1 
ATOM   5766 C  CA  . PRO E  1 11  ? -11.362 -22.902 -42.134 1.00 23.63  ? 9   PRO E CA  1 
ATOM   5767 C  C   . PRO E  1 11  ? -10.054 -23.039 -41.383 1.00 22.87  ? 9   PRO E C   1 
ATOM   5768 O  O   . PRO E  1 11  ? -9.984  -23.780 -40.391 1.00 22.31  ? 9   PRO E O   1 
ATOM   5769 C  CB  . PRO E  1 11  ? -12.304 -21.962 -41.372 1.00 23.87  ? 9   PRO E CB  1 
ATOM   5770 C  CG  . PRO E  1 11  ? -13.659 -22.570 -41.497 1.00 25.33  ? 9   PRO E CG  1 
ATOM   5771 C  CD  . PRO E  1 11  ? -13.431 -24.054 -41.553 1.00 25.16  ? 9   PRO E CD  1 
ATOM   5772 N  N   . ALA E  1 12  ? -9.013  -22.364 -41.862 1.00 23.03  ? 10  ALA E N   1 
ATOM   5773 C  CA  . ALA E  1 12  ? -7.752  -22.309 -41.126 1.00 23.73  ? 10  ALA E CA  1 
ATOM   5774 C  C   . ALA E  1 12  ? -8.014  -21.647 -39.787 1.00 23.42  ? 10  ALA E C   1 
ATOM   5775 O  O   . ALA E  1 12  ? -8.797  -20.717 -39.697 1.00 25.39  ? 10  ALA E O   1 
ATOM   5776 C  CB  . ALA E  1 12  ? -6.695  -21.527 -41.898 1.00 23.28  ? 10  ALA E CB  1 
ATOM   5777 N  N   . PRO E  1 13  ? -7.348  -22.121 -38.745 1.00 23.66  ? 11  PRO E N   1 
ATOM   5778 C  CA  . PRO E  1 13  ? -7.457  -21.418 -37.483 1.00 24.52  ? 11  PRO E CA  1 
ATOM   5779 C  C   . PRO E  1 13  ? -6.741  -20.073 -37.553 1.00 23.25  ? 11  PRO E C   1 
ATOM   5780 O  O   . PRO E  1 13  ? -5.805  -19.921 -38.330 1.00 25.68  ? 11  PRO E O   1 
ATOM   5781 C  CB  . PRO E  1 13  ? -6.734  -22.361 -36.519 1.00 23.65  ? 11  PRO E CB  1 
ATOM   5782 C  CG  . PRO E  1 13  ? -5.659  -22.980 -37.361 1.00 22.51  ? 11  PRO E CG  1 
ATOM   5783 C  CD  . PRO E  1 13  ? -6.254  -23.109 -38.742 1.00 22.85  ? 11  PRO E CD  1 
ATOM   5784 N  N   . PRO E  1 14  ? -7.122  -19.124 -36.693 1.00 22.23  ? 12  PRO E N   1 
ATOM   5785 C  CA  . PRO E  1 14  ? -6.255  -17.961 -36.476 1.00 22.62  ? 12  PRO E CA  1 
ATOM   5786 C  C   . PRO E  1 14  ? -4.893  -18.346 -35.901 1.00 22.02  ? 12  PRO E C   1 
ATOM   5787 O  O   . PRO E  1 14  ? -4.800  -19.265 -35.080 1.00 23.63  ? 12  PRO E O   1 
ATOM   5788 C  CB  . PRO E  1 14  ? -7.044  -17.110 -35.475 1.00 21.63  ? 12  PRO E CB  1 
ATOM   5789 C  CG  . PRO E  1 14  ? -7.921  -18.075 -34.765 1.00 22.78  ? 12  PRO E CG  1 
ATOM   5790 C  CD  . PRO E  1 14  ? -8.248  -19.168 -35.748 1.00 22.87  ? 12  PRO E CD  1 
ATOM   5791 N  N   . LEU E  1 15  ? -3.851  -17.630 -36.309 1.00 21.30  ? 13  LEU E N   1 
ATOM   5792 C  CA  . LEU E  1 15  ? -2.492  -17.948 -35.891 1.00 22.82  ? 13  LEU E CA  1 
ATOM   5793 C  C   . LEU E  1 15  ? -2.298  -17.848 -34.396 1.00 21.91  ? 13  LEU E C   1 
ATOM   5794 O  O   . LEU E  1 15  ? -1.376  -18.448 -33.841 1.00 22.54  ? 13  LEU E O   1 
ATOM   5795 C  CB  . LEU E  1 15  ? -1.493  -17.034 -36.601 1.00 26.51  ? 13  LEU E CB  1 
ATOM   5796 C  CG  . LEU E  1 15  ? -1.412  -17.331 -38.098 1.00 28.61  ? 13  LEU E CG  1 
ATOM   5797 C  CD1 . LEU E  1 15  ? -0.373  -16.435 -38.758 1.00 29.23  ? 13  LEU E CD1 1 
ATOM   5798 C  CD2 . LEU E  1 15  ? -1.089  -18.808 -38.318 1.00 26.77  ? 13  LEU E CD2 1 
ATOM   5799 N  N   . SER E  1 16  ? -3.160  -17.077 -33.747 1.00 23.05  ? 14  SER E N   1 
ATOM   5800 C  CA  . SER E  1 16  ? -3.097  -16.909 -32.314 1.00 24.82  ? 14  SER E CA  1 
ATOM   5801 C  C   . SER E  1 16  ? -3.384  -18.223 -31.582 1.00 24.60  ? 14  SER E C   1 
ATOM   5802 O  O   . SER E  1 16  ? -3.094  -18.347 -30.396 1.00 27.16  ? 14  SER E O   1 
ATOM   5803 C  CB  . SER E  1 16  ? -4.090  -15.830 -31.874 1.00 27.31  ? 14  SER E CB  1 
ATOM   5804 O  OG  . SER E  1 16  ? -5.426  -16.297 -31.953 1.00 29.16  ? 14  SER E OG  1 
ATOM   5805 N  N   . LYS E  1 17  ? -3.949  -19.208 -32.272 1.00 24.64  ? 15  LYS E N   1 
ATOM   5806 C  CA  . LYS E  1 17  ? -4.215  -20.506 -31.635 1.00 23.83  ? 15  LYS E CA  1 
ATOM   5807 C  C   . LYS E  1 17  ? -3.104  -21.513 -31.894 1.00 21.04  ? 15  LYS E C   1 
ATOM   5808 O  O   . LYS E  1 17  ? -3.221  -22.670 -31.497 1.00 20.36  ? 15  LYS E O   1 
ATOM   5809 C  CB  . LYS E  1 17  ? -5.543  -21.082 -32.116 1.00 27.69  ? 15  LYS E CB  1 
ATOM   5810 C  CG  . LYS E  1 17  ? -6.760  -20.450 -31.471 1.00 32.61  ? 15  LYS E CG  1 
ATOM   5811 C  CD  . LYS E  1 17  ? -7.986  -21.341 -31.616 1.00 39.18  ? 15  LYS E CD  1 
ATOM   5812 C  CE  . LYS E  1 17  ? -9.227  -20.516 -31.939 1.00 44.70  ? 15  LYS E CE  1 
ATOM   5813 N  NZ  . LYS E  1 17  ? -10.466 -21.164 -31.441 1.00 47.55  ? 15  LYS E NZ  1 
ATOM   5814 N  N   . VAL E  1 18  ? -2.035  -21.068 -32.558 1.00 17.87  ? 16  VAL E N   1 
ATOM   5815 C  CA  . VAL E  1 18  ? -0.900  -21.929 -32.891 1.00 16.64  ? 16  VAL E CA  1 
ATOM   5816 C  C   . VAL E  1 18  ? 0.382   -21.463 -32.180 1.00 16.50  ? 16  VAL E C   1 
ATOM   5817 O  O   . VAL E  1 18  ? 1.072   -20.555 -32.639 1.00 15.80  ? 16  VAL E O   1 
ATOM   5818 C  CB  . VAL E  1 18  ? -0.644  -21.942 -34.411 1.00 15.58  ? 16  VAL E CB  1 
ATOM   5819 C  CG1 . VAL E  1 18  ? 0.447   -22.935 -34.764 1.00 15.38  ? 16  VAL E CG1 1 
ATOM   5820 C  CG2 . VAL E  1 18  ? -1.923  -22.254 -35.163 1.00 15.99  ? 16  VAL E CG2 1 
ATOM   5821 N  N   . PRO E  1 19  ? 0.710   -22.089 -31.054 1.00 16.99  ? 17  PRO E N   1 
ATOM   5822 C  CA  . PRO E  1 19  ? 1.935   -21.730 -30.325 1.00 17.30  ? 17  PRO E CA  1 
ATOM   5823 C  C   . PRO E  1 19  ? 3.212   -21.809 -31.160 1.00 16.56  ? 17  PRO E C   1 
ATOM   5824 O  O   . PRO E  1 19  ? 3.286   -22.569 -32.139 1.00 15.64  ? 17  PRO E O   1 
ATOM   5825 C  CB  . PRO E  1 19  ? 1.996   -22.767 -29.193 1.00 16.82  ? 17  PRO E CB  1 
ATOM   5826 C  CG  . PRO E  1 19  ? 0.588   -23.245 -29.031 1.00 17.52  ? 17  PRO E CG  1 
ATOM   5827 C  CD  . PRO E  1 19  ? -0.030  -23.184 -30.404 1.00 18.07  ? 17  PRO E CD  1 
ATOM   5828 N  N   . LEU E  1 20  ? 4.214   -21.044 -30.741 1.00 16.83  ? 18  LEU E N   1 
ATOM   5829 C  CA  . LEU E  1 20  ? 5.555   -21.117 -31.310 1.00 17.89  ? 18  LEU E CA  1 
ATOM   5830 C  C   . LEU E  1 20  ? 6.532   -21.654 -30.272 1.00 18.81  ? 18  LEU E C   1 
ATOM   5831 O  O   . LEU E  1 20  ? 6.629   -21.125 -29.170 1.00 19.96  ? 18  LEU E O   1 
ATOM   5832 C  CB  . LEU E  1 20  ? 5.992   -19.729 -31.749 1.00 17.78  ? 18  LEU E CB  1 
ATOM   5833 C  CG  . LEU E  1 20  ? 7.418   -19.612 -32.272 1.00 19.14  ? 18  LEU E CG  1 
ATOM   5834 C  CD1 . LEU E  1 20  ? 7.534   -20.234 -33.651 1.00 18.78  ? 18  LEU E CD1 1 
ATOM   5835 C  CD2 . LEU E  1 20  ? 7.838   -18.145 -32.287 1.00 19.87  ? 18  LEU E CD2 1 
ATOM   5836 N  N   . GLN E  1 21  ? 7.255   -22.707 -30.620 1.00 19.01  ? 19  GLN E N   1 
ATOM   5837 C  CA  . GLN E  1 21  ? 8.298   -23.228 -29.740 1.00 20.80  ? 19  GLN E CA  1 
ATOM   5838 C  C   . GLN E  1 21  ? 9.185   -22.083 -29.241 1.00 21.70  ? 19  GLN E C   1 
ATOM   5839 O  O   . GLN E  1 21  ? 9.754   -21.336 -30.030 1.00 19.83  ? 19  GLN E O   1 
ATOM   5840 C  CB  . GLN E  1 21  ? 9.128   -24.276 -30.482 1.00 20.06  ? 19  GLN E CB  1 
ATOM   5841 C  CG  . GLN E  1 21  ? 10.347  -24.785 -29.723 1.00 23.00  ? 19  GLN E CG  1 
ATOM   5842 C  CD  . GLN E  1 21  ? 10.009  -25.534 -28.440 1.00 23.79  ? 19  GLN E CD  1 
ATOM   5843 O  OE1 . GLN E  1 21  ? 9.150   -26.413 -28.419 1.00 20.94  ? 19  GLN E OE1 1 
ATOM   5844 N  NE2 . GLN E  1 21  ? 10.677  -25.165 -27.355 1.00 27.89  ? 19  GLN E NE2 1 
ATOM   5845 N  N   . GLN E  1 22  ? 9.292   -21.953 -27.923 1.00 24.36  ? 20  GLN E N   1 
ATOM   5846 C  CA  . GLN E  1 22  ? 10.175  -20.958 -27.318 1.00 24.18  ? 20  GLN E CA  1 
ATOM   5847 C  C   . GLN E  1 22  ? 11.628  -21.231 -27.675 1.00 24.00  ? 20  GLN E C   1 
ATOM   5848 O  O   . GLN E  1 22  ? 12.061  -22.383 -27.669 1.00 23.55  ? 20  GLN E O   1 
ATOM   5849 C  CB  . GLN E  1 22  ? 10.036  -20.985 -25.798 1.00 25.10  ? 20  GLN E CB  1 
ATOM   5850 C  CG  . GLN E  1 22  ? 8.754   -20.386 -25.241 1.00 25.98  ? 20  GLN E CG  1 
ATOM   5851 C  CD  . GLN E  1 22  ? 8.358   -21.030 -23.921 1.00 28.81  ? 20  GLN E CD  1 
ATOM   5852 O  OE1 . GLN E  1 22  ? 9.165   -21.726 -23.288 1.00 28.69  ? 20  GLN E OE1 1 
ATOM   5853 N  NE2 . GLN E  1 22  ? 7.112   -20.821 -23.507 1.00 28.77  ? 20  GLN E NE2 1 
ATOM   5854 N  N   . ASN E  1 23  ? 12.373  -20.166 -27.959 1.00 23.90  ? 21  ASN E N   1 
ATOM   5855 C  CA  . ASN E  1 23  ? 13.821  -20.233 -28.107 1.00 25.62  ? 21  ASN E CA  1 
ATOM   5856 C  C   . ASN E  1 23  ? 14.246  -21.343 -29.052 1.00 25.90  ? 21  ASN E C   1 
ATOM   5857 O  O   . ASN E  1 23  ? 15.045  -22.208 -28.697 1.00 26.35  ? 21  ASN E O   1 
ATOM   5858 C  CB  . ASN E  1 23  ? 14.479  -20.420 -26.748 1.00 28.81  ? 21  ASN E CB  1 
ATOM   5859 C  CG  . ASN E  1 23  ? 15.975  -20.174 -26.786 1.00 31.43  ? 21  ASN E CG  1 
ATOM   5860 O  OD1 . ASN E  1 23  ? 16.472  -19.401 -27.603 1.00 33.78  ? 21  ASN E OD1 1 
ATOM   5861 N  ND2 . ASN E  1 23  ? 16.701  -20.817 -25.882 1.00 34.06  ? 21  ASN E ND2 1 
ATOM   5862 N  N   . PHE E  1 24  ? 13.697  -21.320 -30.262 1.00 24.68  ? 22  PHE E N   1 
ATOM   5863 C  CA  . PHE E  1 24  ? 13.927  -22.395 -31.219 1.00 23.88  ? 22  PHE E CA  1 
ATOM   5864 C  C   . PHE E  1 24  ? 15.416  -22.574 -31.520 1.00 25.43  ? 22  PHE E C   1 
ATOM   5865 O  O   . PHE E  1 24  ? 16.133  -21.606 -31.749 1.00 26.80  ? 22  PHE E O   1 
ATOM   5866 C  CB  . PHE E  1 24  ? 13.149  -22.126 -32.505 1.00 21.10  ? 22  PHE E CB  1 
ATOM   5867 C  CG  . PHE E  1 24  ? 13.367  -23.157 -33.572 1.00 19.62  ? 22  PHE E CG  1 
ATOM   5868 C  CD1 . PHE E  1 24  ? 14.184  -22.889 -34.652 1.00 20.39  ? 22  PHE E CD1 1 
ATOM   5869 C  CD2 . PHE E  1 24  ? 12.758  -24.389 -33.494 1.00 18.03  ? 22  PHE E CD2 1 
ATOM   5870 C  CE1 . PHE E  1 24  ? 14.401  -23.842 -35.624 1.00 20.51  ? 22  PHE E CE1 1 
ATOM   5871 C  CE2 . PHE E  1 24  ? 12.966  -25.345 -34.462 1.00 17.74  ? 22  PHE E CE2 1 
ATOM   5872 C  CZ  . PHE E  1 24  ? 13.783  -25.073 -35.530 1.00 18.91  ? 22  PHE E CZ  1 
ATOM   5873 N  N   . GLN E  1 25  ? 15.866  -23.824 -31.523 1.00 26.61  ? 23  GLN E N   1 
ATOM   5874 C  CA  . GLN E  1 25  ? 17.274  -24.151 -31.733 1.00 28.88  ? 23  GLN E CA  1 
ATOM   5875 C  C   . GLN E  1 25  ? 17.453  -24.843 -33.089 1.00 28.93  ? 23  GLN E C   1 
ATOM   5876 O  O   . GLN E  1 25  ? 17.264  -26.058 -33.212 1.00 29.67  ? 23  GLN E O   1 
ATOM   5877 C  CB  . GLN E  1 25  ? 17.777  -25.082 -30.619 1.00 29.89  ? 23  GLN E CB  1 
ATOM   5878 C  CG  . GLN E  1 25  ? 17.672  -24.561 -29.184 1.00 31.46  ? 23  GLN E CG  1 
ATOM   5879 C  CD  . GLN E  1 25  ? 18.594  -23.403 -28.882 1.00 36.24  ? 23  GLN E CD  1 
ATOM   5880 O  OE1 . GLN E  1 25  ? 19.797  -23.596 -28.710 1.00 40.04  ? 23  GLN E OE1 1 
ATOM   5881 N  NE2 . GLN E  1 25  ? 18.035  -22.194 -28.781 1.00 35.42  ? 23  GLN E NE2 1 
ATOM   5882 N  N   . ASP E  1 26  ? 17.827  -24.073 -34.104 1.00 29.49  ? 24  ASP E N   1 
ATOM   5883 C  CA  . ASP E  1 26  ? 17.803  -24.567 -35.474 1.00 28.99  ? 24  ASP E CA  1 
ATOM   5884 C  C   . ASP E  1 26  ? 18.772  -25.735 -35.687 1.00 30.31  ? 24  ASP E C   1 
ATOM   5885 O  O   . ASP E  1 26  ? 18.483  -26.657 -36.448 1.00 29.57  ? 24  ASP E O   1 
ATOM   5886 C  CB  . ASP E  1 26  ? 18.043  -23.438 -36.485 1.00 28.82  ? 24  ASP E CB  1 
ATOM   5887 C  CG  . ASP E  1 26  ? 19.359  -22.707 -36.270 1.00 33.33  ? 24  ASP E CG  1 
ATOM   5888 O  OD1 . ASP E  1 26  ? 20.158  -23.095 -35.382 1.00 35.19  ? 24  ASP E OD1 1 
ATOM   5889 O  OD2 . ASP E  1 26  ? 19.599  -21.730 -37.010 1.00 34.44  ? 24  ASP E OD2 1 
ATOM   5890 N  N   . ASN E  1 27  ? 19.915  -25.704 -35.013 1.00 33.69  ? 25  ASN E N   1 
ATOM   5891 C  CA  A ASN E  1 27  ? 20.913  -26.753 -35.180 0.50 35.42  ? 25  ASN E CA  1 
ATOM   5892 C  CA  B ASN E  1 27  ? 20.927  -26.754 -35.159 0.50 33.67  ? 25  ASN E CA  1 
ATOM   5893 C  C   . ASN E  1 27  ? 20.433  -28.069 -34.572 1.00 32.36  ? 25  ASN E C   1 
ATOM   5894 O  O   . ASN E  1 27  ? 20.623  -29.127 -35.148 1.00 33.85  ? 25  ASN E O   1 
ATOM   5895 C  CB  A ASN E  1 27  ? 22.255  -26.323 -34.575 0.50 38.77  ? 25  ASN E CB  1 
ATOM   5896 C  CB  B ASN E  1 27  ? 22.240  -26.334 -34.474 0.50 34.68  ? 25  ASN E CB  1 
ATOM   5897 C  CG  A ASN E  1 27  ? 22.135  -25.924 -33.116 0.50 39.89  ? 25  ASN E CG  1 
ATOM   5898 C  CG  B ASN E  1 27  ? 23.390  -27.303 -34.743 0.50 34.57  ? 25  ASN E CG  1 
ATOM   5899 O  OD1 A ASN E  1 27  ? 21.265  -25.137 -32.750 0.50 38.29  ? 25  ASN E OD1 1 
ATOM   5900 O  OD1 B ASN E  1 27  ? 23.186  -28.427 -35.189 0.50 32.01  ? 25  ASN E OD1 1 
ATOM   5901 N  ND2 A ASN E  1 27  ? 23.000  -26.479 -32.272 0.50 44.99  ? 25  ASN E ND2 1 
ATOM   5902 N  ND2 B ASN E  1 27  ? 24.605  -26.869 -34.451 0.50 36.64  ? 25  ASN E ND2 1 
ATOM   5903 N  N   . GLN E  1 28  ? 19.771  -27.993 -33.430 1.00 33.30  ? 26  GLN E N   1 
ATOM   5904 C  CA  . GLN E  1 28  ? 19.255  -29.187 -32.777 1.00 34.79  ? 26  GLN E CA  1 
ATOM   5905 C  C   . GLN E  1 28  ? 18.072  -29.802 -33.540 1.00 31.06  ? 26  GLN E C   1 
ATOM   5906 O  O   . GLN E  1 28  ? 17.753  -30.963 -33.346 1.00 30.44  ? 26  GLN E O   1 
ATOM   5907 C  CB  . GLN E  1 28  ? 18.813  -28.860 -31.353 1.00 37.39  ? 26  GLN E CB  1 
ATOM   5908 C  CG  . GLN E  1 28  ? 19.931  -28.603 -30.364 1.00 44.13  ? 26  GLN E CG  1 
ATOM   5909 C  CD  . GLN E  1 28  ? 19.430  -28.614 -28.932 1.00 51.80  ? 26  GLN E CD  1 
ATOM   5910 O  OE1 . GLN E  1 28  ? 18.919  -29.626 -28.447 1.00 57.30  ? 26  GLN E OE1 1 
ATOM   5911 N  NE2 . GLN E  1 28  ? 19.559  -27.485 -28.252 1.00 53.71  ? 26  GLN E NE2 1 
ATOM   5912 N  N   . PHE E  1 29  ? 17.404  -29.018 -34.377 1.00 28.87  ? 27  PHE E N   1 
ATOM   5913 C  CA  . PHE E  1 29  ? 16.201  -29.482 -35.062 1.00 24.77  ? 27  PHE E CA  1 
ATOM   5914 C  C   . PHE E  1 29  ? 16.534  -30.240 -36.327 1.00 24.55  ? 27  PHE E C   1 
ATOM   5915 O  O   . PHE E  1 29  ? 15.682  -30.892 -36.926 1.00 21.78  ? 27  PHE E O   1 
ATOM   5916 C  CB  . PHE E  1 29  ? 15.279  -28.312 -35.403 1.00 22.90  ? 27  PHE E CB  1 
ATOM   5917 C  CG  . PHE E  1 29  ? 13.898  -28.731 -35.823 1.00 20.54  ? 27  PHE E CG  1 
ATOM   5918 C  CD1 . PHE E  1 29  ? 13.510  -28.678 -37.151 1.00 20.04  ? 27  PHE E CD1 1 
ATOM   5919 C  CD2 . PHE E  1 29  ? 13.001  -29.210 -34.890 1.00 19.10  ? 27  PHE E CD2 1 
ATOM   5920 C  CE1 . PHE E  1 29  ? 12.253  -29.104 -37.534 1.00 19.12  ? 27  PHE E CE1 1 
ATOM   5921 C  CE2 . PHE E  1 29  ? 11.745  -29.627 -35.264 1.00 17.71  ? 27  PHE E CE2 1 
ATOM   5922 C  CZ  . PHE E  1 29  ? 11.372  -29.573 -36.588 1.00 17.72  ? 27  PHE E CZ  1 
ATOM   5923 N  N   . GLN E  1 30  ? 17.771  -30.149 -36.768 1.00 27.49  ? 28  GLN E N   1 
ATOM   5924 C  CA  . GLN E  1 30  ? 18.082  -30.742 -38.053 1.00 29.25  ? 28  GLN E CA  1 
ATOM   5925 C  C   . GLN E  1 30  ? 18.186  -32.272 -37.990 1.00 26.57  ? 28  GLN E C   1 
ATOM   5926 O  O   . GLN E  1 30  ? 18.096  -32.864 -36.913 1.00 23.13  ? 28  GLN E O   1 
ATOM   5927 C  CB  . GLN E  1 30  ? 19.312  -30.091 -38.674 1.00 32.24  ? 28  GLN E CB  1 
ATOM   5928 C  CG  . GLN E  1 30  ? 20.643  -30.674 -38.250 1.00 34.95  ? 28  GLN E CG  1 
ATOM   5929 C  CD  . GLN E  1 30  ? 21.795  -29.794 -38.690 1.00 38.71  ? 28  GLN E CD  1 
ATOM   5930 O  OE1 . GLN E  1 30  ? 21.949  -29.506 -39.881 1.00 39.99  ? 28  GLN E OE1 1 
ATOM   5931 N  NE2 . GLN E  1 30  ? 22.562  -29.300 -37.729 1.00 40.17  ? 28  GLN E NE2 1 
ATOM   5932 N  N   . GLY E  1 31  ? 18.310  -32.902 -39.160 1.00 26.61  ? 29  GLY E N   1 
ATOM   5933 C  CA  . GLY E  1 31  ? 18.351  -34.356 -39.275 1.00 26.57  ? 29  GLY E CA  1 
ATOM   5934 C  C   . GLY E  1 31  ? 17.031  -34.933 -39.749 1.00 26.37  ? 29  GLY E C   1 
ATOM   5935 O  O   . GLY E  1 31  ? 16.168  -34.218 -40.277 1.00 28.42  ? 29  GLY E O   1 
ATOM   5936 N  N   . LYS E  1 32  ? 16.880  -36.241 -39.581 1.00 24.93  ? 30  LYS E N   1 
ATOM   5937 C  CA  . LYS E  1 32  ? 15.746  -36.951 -40.125 1.00 24.96  ? 30  LYS E CA  1 
ATOM   5938 C  C   . LYS E  1 32  ? 14.634  -36.970 -39.103 1.00 24.76  ? 30  LYS E C   1 
ATOM   5939 O  O   . LYS E  1 32  ? 14.869  -37.202 -37.902 1.00 22.64  ? 30  LYS E O   1 
ATOM   5940 C  CB  . LYS E  1 32  ? 16.127  -38.381 -40.500 1.00 27.16  ? 30  LYS E CB  1 
ATOM   5941 C  CG  . LYS E  1 32  ? 14.964  -39.187 -41.056 1.00 28.69  ? 30  LYS E CG  1 
ATOM   5942 C  CD  . LYS E  1 32  ? 15.388  -40.587 -41.450 1.00 30.91  ? 30  LYS E CD  1 
ATOM   5943 C  CE  . LYS E  1 32  ? 15.989  -40.623 -42.838 1.00 35.20  ? 30  LYS E CE  1 
ATOM   5944 N  NZ  . LYS E  1 32  ? 16.367  -42.011 -43.230 1.00 38.67  ? 30  LYS E NZ  1 
ATOM   5945 N  N   . TRP E  1 33  ? 13.422  -36.700 -39.582 1.00 23.17  ? 31  TRP E N   1 
ATOM   5946 C  CA  . TRP E  1 33  ? 12.221  -36.878 -38.785 1.00 22.27  ? 31  TRP E CA  1 
ATOM   5947 C  C   . TRP E  1 33  ? 11.253  -37.771 -39.555 1.00 22.93  ? 31  TRP E C   1 
ATOM   5948 O  O   . TRP E  1 33  ? 11.098  -37.637 -40.775 1.00 23.44  ? 31  TRP E O   1 
ATOM   5949 C  CB  . TRP E  1 33  ? 11.531  -35.539 -38.534 1.00 21.39  ? 31  TRP E CB  1 
ATOM   5950 C  CG  . TRP E  1 33  ? 12.242  -34.576 -37.629 1.00 20.97  ? 31  TRP E CG  1 
ATOM   5951 C  CD1 . TRP E  1 33  ? 12.977  -33.501 -38.009 1.00 21.27  ? 31  TRP E CD1 1 
ATOM   5952 C  CD2 . TRP E  1 33  ? 12.176  -34.528 -36.197 1.00 20.88  ? 31  TRP E CD2 1 
ATOM   5953 N  NE1 . TRP E  1 33  ? 13.406  -32.806 -36.906 1.00 21.29  ? 31  TRP E NE1 1 
ATOM   5954 C  CE2 . TRP E  1 33  ? 12.931  -33.421 -35.781 1.00 20.91  ? 31  TRP E CE2 1 
ATOM   5955 C  CE3 . TRP E  1 33  ? 11.561  -35.323 -35.227 1.00 20.94  ? 31  TRP E CE3 1 
ATOM   5956 C  CZ2 . TRP E  1 33  ? 13.095  -33.094 -34.438 1.00 20.95  ? 31  TRP E CZ2 1 
ATOM   5957 C  CZ3 . TRP E  1 33  ? 11.722  -34.991 -33.897 1.00 21.68  ? 31  TRP E CZ3 1 
ATOM   5958 C  CH2 . TRP E  1 33  ? 12.483  -33.889 -33.515 1.00 21.07  ? 31  TRP E CH2 1 
ATOM   5959 N  N   . TYR E  1 34  ? 10.571  -38.653 -38.832 1.00 21.95  ? 32  TYR E N   1 
ATOM   5960 C  CA  . TYR E  1 34  ? 9.555   -39.501 -39.428 1.00 21.20  ? 32  TYR E CA  1 
ATOM   5961 C  C   . TYR E  1 34  ? 8.207   -38.876 -39.203 1.00 20.51  ? 32  TYR E C   1 
ATOM   5962 O  O   . TYR E  1 34  ? 7.937   -38.341 -38.136 1.00 21.53  ? 32  TYR E O   1 
ATOM   5963 C  CB  . TYR E  1 34  ? 9.578   -40.881 -38.781 1.00 21.43  ? 32  TYR E CB  1 
ATOM   5964 C  CG  . TYR E  1 34  ? 10.803  -41.687 -39.105 1.00 21.71  ? 32  TYR E CG  1 
ATOM   5965 C  CD1 . TYR E  1 34  ? 10.904  -42.360 -40.313 1.00 22.72  ? 32  TYR E CD1 1 
ATOM   5966 C  CD2 . TYR E  1 34  ? 11.869  -41.765 -38.210 1.00 22.77  ? 32  TYR E CD2 1 
ATOM   5967 C  CE1 . TYR E  1 34  ? 12.023  -43.098 -40.623 1.00 24.90  ? 32  TYR E CE1 1 
ATOM   5968 C  CE2 . TYR E  1 34  ? 12.999  -42.510 -38.498 1.00 23.40  ? 32  TYR E CE2 1 
ATOM   5969 C  CZ  . TYR E  1 34  ? 13.078  -43.165 -39.709 1.00 24.91  ? 32  TYR E CZ  1 
ATOM   5970 O  OH  . TYR E  1 34  ? 14.179  -43.925 -40.004 1.00 26.93  ? 32  TYR E OH  1 
ATOM   5971 N  N   . VAL E  1 35  ? 7.352   -38.926 -40.208 1.00 20.78  ? 33  VAL E N   1 
ATOM   5972 C  CA  . VAL E  1 35  ? 6.025   -38.377 -40.049 1.00 19.97  ? 33  VAL E CA  1 
ATOM   5973 C  C   . VAL E  1 35  ? 5.136   -39.431 -39.408 1.00 20.58  ? 33  VAL E C   1 
ATOM   5974 O  O   . VAL E  1 35  ? 4.620   -40.315 -40.071 1.00 19.98  ? 33  VAL E O   1 
ATOM   5975 C  CB  . VAL E  1 35  ? 5.439   -37.875 -41.376 1.00 18.96  ? 33  VAL E CB  1 
ATOM   5976 C  CG1 . VAL E  1 35  ? 4.015   -37.404 -41.176 1.00 19.75  ? 33  VAL E CG1 1 
ATOM   5977 C  CG2 . VAL E  1 35  ? 6.282   -36.739 -41.917 1.00 19.38  ? 33  VAL E CG2 1 
ATOM   5978 N  N   . VAL E  1 36  ? 4.939   -39.284 -38.107 1.00 21.62  ? 34  VAL E N   1 
ATOM   5979 C  CA  . VAL E  1 36  ? 4.245   -40.271 -37.294 1.00 22.85  ? 34  VAL E CA  1 
ATOM   5980 C  C   . VAL E  1 36  ? 2.762   -39.912 -37.191 1.00 21.19  ? 34  VAL E C   1 
ATOM   5981 O  O   . VAL E  1 36  ? 1.920   -40.778 -36.963 1.00 19.17  ? 34  VAL E O   1 
ATOM   5982 C  CB  . VAL E  1 36  ? 4.877   -40.337 -35.883 1.00 24.01  ? 34  VAL E CB  1 
ATOM   5983 C  CG1 . VAL E  1 36  ? 3.990   -41.095 -34.905 1.00 26.22  ? 34  VAL E CG1 1 
ATOM   5984 C  CG2 . VAL E  1 36  ? 6.266   -40.963 -35.949 1.00 23.46  ? 34  VAL E CG2 1 
ATOM   5985 N  N   . GLY E  1 37  ? 2.451   -38.633 -37.377 1.00 21.35  ? 35  GLY E N   1 
ATOM   5986 C  CA  . GLY E  1 37  ? 1.066   -38.172 -37.398 1.00 21.23  ? 35  GLY E CA  1 
ATOM   5987 C  C   . GLY E  1 37  ? 0.854   -37.047 -38.402 1.00 21.34  ? 35  GLY E C   1 
ATOM   5988 O  O   . GLY E  1 37  ? 1.735   -36.242 -38.631 1.00 20.67  ? 35  GLY E O   1 
ATOM   5989 N  N   . LEU E  1 38  ? -0.340  -36.984 -38.975 1.00 22.08  ? 36  LEU E N   1 
ATOM   5990 C  CA  . LEU E  1 38  ? -0.684  -35.987 -39.974 1.00 22.08  ? 36  LEU E CA  1 
ATOM   5991 C  C   . LEU E  1 38  ? -2.111  -35.560 -39.744 1.00 20.86  ? 36  LEU E C   1 
ATOM   5992 O  O   . LEU E  1 38  ? -3.005  -36.404 -39.689 1.00 20.70  ? 36  LEU E O   1 
ATOM   5993 C  CB  . LEU E  1 38  ? -0.635  -36.617 -41.364 1.00 26.69  ? 36  LEU E CB  1 
ATOM   5994 C  CG  . LEU E  1 38  ? 0.444   -36.194 -42.341 1.00 28.78  ? 36  LEU E CG  1 
ATOM   5995 C  CD1 . LEU E  1 38  ? 0.125   -36.821 -43.685 1.00 31.00  ? 36  LEU E CD1 1 
ATOM   5996 C  CD2 . LEU E  1 38  ? 0.526   -34.681 -42.442 1.00 28.76  ? 36  LEU E CD2 1 
ATOM   5997 N  N   . ALA E  1 39  ? -2.348  -34.258 -39.665 1.00 19.16  ? 37  ALA E N   1 
ATOM   5998 C  CA  . ALA E  1 39  ? -3.707  -33.759 -39.570 1.00 19.02  ? 37  ALA E CA  1 
ATOM   5999 C  C   . ALA E  1 39  ? -3.859  -32.507 -40.418 1.00 19.16  ? 37  ALA E C   1 
ATOM   6000 O  O   . ALA E  1 39  ? -2.939  -31.701 -40.502 1.00 20.38  ? 37  ALA E O   1 
ATOM   6001 C  CB  . ALA E  1 39  ? -4.050  -33.473 -38.116 1.00 18.00  ? 37  ALA E CB  1 
ATOM   6002 N  N   . GLY E  1 40  ? -5.022  -32.316 -41.021 1.00 19.73  ? 38  GLY E N   1 
ATOM   6003 C  CA  . GLY E  1 40  ? -5.265  -31.082 -41.764 1.00 19.66  ? 38  GLY E CA  1 
ATOM   6004 C  C   . GLY E  1 40  ? -6.539  -31.069 -42.572 1.00 20.42  ? 38  GLY E C   1 
ATOM   6005 O  O   . GLY E  1 40  ? -7.208  -32.103 -42.703 1.00 20.83  ? 38  GLY E O   1 
ATOM   6006 N  N   . ASN E  1 41  ? -6.856  -29.913 -43.157 1.00 19.35  ? 39  ASN E N   1 
ATOM   6007 C  CA  . ASN E  1 41  ? -8.149  -29.749 -43.797 1.00 20.79  ? 39  ASN E CA  1 
ATOM   6008 C  C   . ASN E  1 41  ? -8.239  -30.371 -45.183 1.00 22.57  ? 39  ASN E C   1 
ATOM   6009 O  O   . ASN E  1 41  ? -9.325  -30.469 -45.754 1.00 24.92  ? 39  ASN E O   1 
ATOM   6010 C  CB  . ASN E  1 41  ? -8.610  -28.287 -43.794 1.00 20.37  ? 39  ASN E CB  1 
ATOM   6011 C  CG  . ASN E  1 41  ? -7.725  -27.370 -44.630 1.00 19.68  ? 39  ASN E CG  1 
ATOM   6012 O  OD1 . ASN E  1 41  ? -6.638  -27.738 -45.080 1.00 18.73  ? 39  ASN E OD1 1 
ATOM   6013 N  ND2 . ASN E  1 41  ? -8.187  -26.147 -44.803 1.00 19.75  ? 39  ASN E ND2 1 
ATOM   6014 N  N   . ALA E  1 42  ? -7.117  -30.865 -45.683 1.00 23.29  ? 40  ALA E N   1 
ATOM   6015 C  CA  . ALA E  1 42  ? -7.114  -31.700 -46.880 1.00 27.16  ? 40  ALA E CA  1 
ATOM   6016 C  C   . ALA E  1 42  ? -6.593  -33.128 -46.615 1.00 29.43  ? 40  ALA E C   1 
ATOM   6017 O  O   . ALA E  1 42  ? -6.446  -33.911 -47.550 1.00 31.69  ? 40  ALA E O   1 
ATOM   6018 C  CB  . ALA E  1 42  ? -6.291  -31.034 -47.981 1.00 27.21  ? 40  ALA E CB  1 
ATOM   6019 N  N   . ILE E  1 43  ? -6.337  -33.459 -45.351 1.00 30.78  ? 41  ILE E N   1 
ATOM   6020 C  CA  . ILE E  1 43  ? -6.055  -34.834 -44.932 1.00 35.82  ? 41  ILE E CA  1 
ATOM   6021 C  C   . ILE E  1 43  ? -7.331  -35.630 -44.694 1.00 41.22  ? 41  ILE E C   1 
ATOM   6022 O  O   . ILE E  1 43  ? -8.185  -35.220 -43.907 1.00 43.92  ? 41  ILE E O   1 
ATOM   6023 C  CB  . ILE E  1 43  ? -5.242  -34.862 -43.618 1.00 38.26  ? 41  ILE E CB  1 
ATOM   6024 C  CG1 . ILE E  1 43  ? -3.865  -34.251 -43.842 1.00 40.05  ? 41  ILE E CG1 1 
ATOM   6025 C  CG2 . ILE E  1 43  ? -5.094  -36.289 -43.097 1.00 39.56  ? 41  ILE E CG2 1 
ATOM   6026 C  CD1 . ILE E  1 43  ? -3.055  -34.991 -44.881 1.00 43.74  ? 41  ILE E CD1 1 
ATOM   6027 N  N   . LEU E  1 44  ? -7.436  -36.786 -45.341 1.00 46.11  ? 42  LEU E N   1 
ATOM   6028 C  CA  . LEU E  1 44  ? -8.615  -37.632 -45.214 1.00 52.49  ? 42  LEU E CA  1 
ATOM   6029 C  C   . LEU E  1 44  ? -8.215  -39.095 -44.966 1.00 56.57  ? 42  LEU E C   1 
ATOM   6030 O  O   . LEU E  1 44  ? -7.541  -39.713 -45.795 1.00 54.83  ? 42  LEU E O   1 
ATOM   6031 C  CB  . LEU E  1 44  ? -9.476  -37.513 -46.477 1.00 55.71  ? 42  LEU E CB  1 
ATOM   6032 C  CG  . LEU E  1 44  ? -10.989 -37.703 -46.316 1.00 60.85  ? 42  LEU E CG  1 
ATOM   6033 C  CD1 . LEU E  1 44  ? -11.469 -37.297 -44.930 1.00 56.81  ? 42  LEU E CD1 1 
ATOM   6034 C  CD2 . LEU E  1 44  ? -11.738 -36.921 -47.388 1.00 61.67  ? 42  LEU E CD2 1 
ATOM   6035 N  N   . ARG E  1 45  ? -8.635  -39.639 -43.823 1.00 59.60  ? 43  ARG E N   1 
ATOM   6036 C  CA  . ARG E  1 45  ? -8.401  -41.049 -43.498 1.00 56.91  ? 43  ARG E CA  1 
ATOM   6037 C  C   . ARG E  1 45  ? -9.049  -41.938 -44.559 1.00 57.90  ? 43  ARG E C   1 
ATOM   6038 O  O   . ARG E  1 45  ? -10.246 -41.842 -44.811 1.00 56.94  ? 43  ARG E O   1 
ATOM   6039 C  CB  . ARG E  1 45  ? -8.966  -41.392 -42.114 1.00 54.34  ? 43  ARG E CB  1 
ATOM   6040 N  N   . GLU E  1 46  ? -8.246  -42.783 -45.198 1.00 57.01  ? 44  GLU E N   1 
ATOM   6041 C  CA  . GLU E  1 46  ? -8.768  -43.813 -46.091 1.00 63.22  ? 44  GLU E CA  1 
ATOM   6042 C  C   . GLU E  1 46  ? -8.549  -45.196 -45.473 1.00 63.26  ? 44  GLU E C   1 
ATOM   6043 O  O   . GLU E  1 46  ? -7.435  -45.718 -45.465 1.00 61.41  ? 44  GLU E O   1 
ATOM   6044 C  CB  . GLU E  1 46  ? -8.099  -43.719 -47.467 1.00 63.31  ? 44  GLU E CB  1 
ATOM   6045 N  N   . ASP E  1 47  ? -9.620  -45.767 -44.927 1.00 66.78  ? 45  ASP E N   1 
ATOM   6046 C  CA  . ASP E  1 47  ? -9.581  -47.103 -44.336 1.00 64.86  ? 45  ASP E CA  1 
ATOM   6047 C  C   . ASP E  1 47  ? -9.113  -48.137 -45.355 1.00 64.93  ? 45  ASP E C   1 
ATOM   6048 O  O   . ASP E  1 47  ? -8.352  -49.041 -45.018 1.00 63.78  ? 45  ASP E O   1 
ATOM   6049 C  CB  . ASP E  1 47  ? -10.967 -47.491 -43.804 1.00 64.32  ? 45  ASP E CB  1 
ATOM   6050 N  N   . LYS E  1 48  ? -9.572  -48.002 -46.597 1.00 69.13  ? 46  LYS E N   1 
ATOM   6051 C  CA  . LYS E  1 48  ? -9.270  -48.979 -47.639 1.00 71.90  ? 46  LYS E CA  1 
ATOM   6052 C  C   . LYS E  1 48  ? -7.769  -49.029 -47.929 1.00 72.07  ? 46  LYS E C   1 
ATOM   6053 O  O   . LYS E  1 48  ? -7.179  -50.108 -47.986 1.00 72.04  ? 46  LYS E O   1 
ATOM   6054 C  CB  . LYS E  1 48  ? -10.049 -48.652 -48.919 1.00 70.50  ? 46  LYS E CB  1 
ATOM   6055 N  N   . ASP E  1 49  ? -7.154  -47.864 -48.107 1.00 71.11  ? 47  ASP E N   1 
ATOM   6056 C  CA  . ASP E  1 49  ? -5.761  -47.795 -48.550 1.00 69.51  ? 47  ASP E CA  1 
ATOM   6057 C  C   . ASP E  1 49  ? -4.930  -46.843 -47.683 1.00 62.95  ? 47  ASP E C   1 
ATOM   6058 O  O   . ASP E  1 49  ? -4.713  -45.682 -48.053 1.00 55.51  ? 47  ASP E O   1 
ATOM   6059 C  CB  . ASP E  1 49  ? -5.697  -47.352 -50.010 1.00 76.06  ? 47  ASP E CB  1 
ATOM   6060 C  CG  . ASP E  1 49  ? -4.278  -47.261 -50.523 1.00 76.23  ? 47  ASP E CG  1 
ATOM   6061 O  OD1 . ASP E  1 49  ? -4.036  -46.440 -51.428 1.00 74.88  ? 47  ASP E OD1 1 
ATOM   6062 O  OD2 . ASP E  1 49  ? -3.407  -48.004 -50.015 1.00 78.02  ? 47  ASP E OD2 1 
ATOM   6063 N  N   . PRO E  1 50  ? -4.450  -47.340 -46.533 1.00 56.26  ? 48  PRO E N   1 
ATOM   6064 C  CA  . PRO E  1 50  ? -3.925  -46.459 -45.499 1.00 56.39  ? 48  PRO E CA  1 
ATOM   6065 C  C   . PRO E  1 50  ? -2.638  -45.785 -45.940 1.00 53.95  ? 48  PRO E C   1 
ATOM   6066 O  O   . PRO E  1 50  ? -1.845  -46.372 -46.678 1.00 61.49  ? 48  PRO E O   1 
ATOM   6067 C  CB  . PRO E  1 50  ? -3.668  -47.403 -44.321 1.00 56.75  ? 48  PRO E CB  1 
ATOM   6068 C  CG  . PRO E  1 50  ? -3.415  -48.729 -44.955 1.00 58.64  ? 48  PRO E CG  1 
ATOM   6069 C  CD  . PRO E  1 50  ? -4.222  -48.762 -46.225 1.00 57.84  ? 48  PRO E CD  1 
ATOM   6070 N  N   . GLN E  1 51  ? -2.445  -44.553 -45.491 1.00 47.07  ? 49  GLN E N   1 
ATOM   6071 C  CA  . GLN E  1 51  ? -1.285  -43.775 -45.873 1.00 41.83  ? 49  GLN E CA  1 
ATOM   6072 C  C   . GLN E  1 51  ? -0.012  -44.322 -45.215 1.00 36.58  ? 49  GLN E C   1 
ATOM   6073 O  O   . GLN E  1 51  ? 0.008   -44.671 -44.032 1.00 30.90  ? 49  GLN E O   1 
ATOM   6074 C  CB  . GLN E  1 51  ? -1.498  -42.309 -45.497 1.00 42.67  ? 49  GLN E CB  1 
ATOM   6075 C  CG  . GLN E  1 51  ? -0.214  -41.537 -45.282 1.00 47.65  ? 49  GLN E CG  1 
ATOM   6076 C  CD  . GLN E  1 51  ? -0.171  -40.254 -46.081 1.00 50.51  ? 49  GLN E CD  1 
ATOM   6077 O  OE1 . GLN E  1 51  ? -1.155  -39.516 -46.141 1.00 53.96  ? 49  GLN E OE1 1 
ATOM   6078 N  NE2 . GLN E  1 51  ? 0.982   -39.969 -46.679 1.00 50.43  ? 49  GLN E NE2 1 
ATOM   6079 N  N   . LYS E  1 52  ? 1.053   -44.385 -46.000 1.00 35.04  ? 50  LYS E N   1 
ATOM   6080 C  CA  . LYS E  1 52  ? 2.321   -44.897 -45.524 1.00 31.71  ? 50  LYS E CA  1 
ATOM   6081 C  C   . LYS E  1 52  ? 3.173   -43.792 -44.910 1.00 27.71  ? 50  LYS E C   1 
ATOM   6082 O  O   . LYS E  1 52  ? 3.156   -42.649 -45.365 1.00 27.15  ? 50  LYS E O   1 
ATOM   6083 C  CB  . LYS E  1 52  ? 3.070   -45.557 -46.671 1.00 33.55  ? 50  LYS E CB  1 
ATOM   6084 C  CG  . LYS E  1 52  ? 2.389   -46.810 -47.175 1.00 36.38  ? 50  LYS E CG  1 
ATOM   6085 C  CD  . LYS E  1 52  ? 3.157   -47.434 -48.325 1.00 39.32  ? 50  LYS E CD  1 
ATOM   6086 C  CE  . LYS E  1 52  ? 2.281   -48.401 -49.099 1.00 42.17  ? 50  LYS E CE  1 
ATOM   6087 N  NZ  . LYS E  1 52  ? 3.121   -49.245 -49.983 1.00 45.85  ? 50  LYS E NZ  1 
ATOM   6088 N  N   . MET E  1 53  ? 3.915   -44.148 -43.871 1.00 25.02  ? 51  MET E N   1 
ATOM   6089 C  CA  . MET E  1 53  ? 4.908   -43.259 -43.293 1.00 23.64  ? 51  MET E CA  1 
ATOM   6090 C  C   . MET E  1 53  ? 5.930   -42.805 -44.330 1.00 23.59  ? 51  MET E C   1 
ATOM   6091 O  O   . MET E  1 53  ? 6.360   -43.581 -45.189 1.00 24.55  ? 51  MET E O   1 
ATOM   6092 C  CB  . MET E  1 53  ? 5.629   -43.966 -42.153 1.00 23.41  ? 51  MET E CB  1 
ATOM   6093 C  CG  . MET E  1 53  ? 6.529   -43.061 -41.336 1.00 22.51  ? 51  MET E CG  1 
ATOM   6094 S  SD  . MET E  1 53  ? 7.083   -43.842 -39.808 1.00 24.75  ? 51  MET E SD  1 
ATOM   6095 C  CE  . MET E  1 53  ? 5.554   -43.858 -38.877 1.00 24.21  ? 51  MET E CE  1 
ATOM   6096 N  N   . TYR E  1 54  ? 6.302   -41.535 -44.247 1.00 22.28  ? 52  TYR E N   1 
ATOM   6097 C  CA  . TYR E  1 54  ? 7.439   -41.026 -44.979 1.00 22.74  ? 52  TYR E CA  1 
ATOM   6098 C  C   . TYR E  1 54  ? 8.328   -40.260 -44.025 1.00 21.86  ? 52  TYR E C   1 
ATOM   6099 O  O   . TYR E  1 54  ? 7.955   -40.044 -42.880 1.00 20.60  ? 52  TYR E O   1 
ATOM   6100 C  CB  . TYR E  1 54  ? 6.988   -40.141 -46.147 1.00 23.87  ? 52  TYR E CB  1 
ATOM   6101 C  CG  . TYR E  1 54  ? 6.139   -38.947 -45.771 1.00 22.41  ? 52  TYR E CG  1 
ATOM   6102 C  CD1 . TYR E  1 54  ? 4.765   -39.048 -45.691 1.00 22.90  ? 52  TYR E CD1 1 
ATOM   6103 C  CD2 . TYR E  1 54  ? 6.715   -37.704 -45.556 1.00 23.29  ? 52  TYR E CD2 1 
ATOM   6104 C  CE1 . TYR E  1 54  ? 3.988   -37.948 -45.387 1.00 22.88  ? 52  TYR E CE1 1 
ATOM   6105 C  CE2 . TYR E  1 54  ? 5.949   -36.595 -45.242 1.00 22.53  ? 52  TYR E CE2 1 
ATOM   6106 C  CZ  . TYR E  1 54  ? 4.585   -36.724 -45.149 1.00 22.64  ? 52  TYR E CZ  1 
ATOM   6107 O  OH  . TYR E  1 54  ? 3.834   -35.624 -44.819 1.00 21.23  ? 52  TYR E OH  1 
ATOM   6108 N  N   . ALA E  1 55  ? 9.498   -39.843 -44.505 1.00 23.23  ? 53  ALA E N   1 
ATOM   6109 C  CA  . ALA E  1 55  ? 10.455  -39.110 -43.685 1.00 22.60  ? 53  ALA E CA  1 
ATOM   6110 C  C   . ALA E  1 55  ? 10.774  -37.757 -44.295 1.00 23.00  ? 53  ALA E C   1 
ATOM   6111 O  O   . ALA E  1 55  ? 10.715  -37.574 -45.510 1.00 25.59  ? 53  ALA E O   1 
ATOM   6112 C  CB  . ALA E  1 55  ? 11.732  -39.914 -43.522 1.00 23.80  ? 53  ALA E CB  1 
ATOM   6113 N  N   . THR E  1 56  ? 11.135  -36.810 -43.442 1.00 22.55  ? 54  THR E N   1 
ATOM   6114 C  CA  . THR E  1 56  ? 11.513  -35.489 -43.904 1.00 22.85  ? 54  THR E CA  1 
ATOM   6115 C  C   . THR E  1 56  ? 12.802  -35.063 -43.224 1.00 23.18  ? 54  THR E C   1 
ATOM   6116 O  O   . THR E  1 56  ? 12.933  -35.144 -42.001 1.00 25.97  ? 54  THR E O   1 
ATOM   6117 C  CB  . THR E  1 56  ? 10.401  -34.470 -43.633 1.00 21.50  ? 54  THR E CB  1 
ATOM   6118 O  OG1 . THR E  1 56  ? 9.242   -34.825 -44.388 1.00 21.52  ? 54  THR E OG1 1 
ATOM   6119 C  CG2 . THR E  1 56  ? 10.835  -33.082 -44.032 1.00 22.10  ? 54  THR E CG2 1 
ATOM   6120 N  N   . ILE E  1 57  ? 13.764  -34.644 -44.027 1.00 23.62  ? 55  ILE E N   1 
ATOM   6121 C  CA  . ILE E  1 57  ? 15.115  -34.425 -43.546 1.00 25.43  ? 55  ILE E CA  1 
ATOM   6122 C  C   . ILE E  1 57  ? 15.454  -32.950 -43.619 1.00 25.79  ? 55  ILE E C   1 
ATOM   6123 O  O   . ILE E  1 57  ? 15.371  -32.350 -44.685 1.00 26.37  ? 55  ILE E O   1 
ATOM   6124 C  CB  . ILE E  1 57  ? 16.127  -35.210 -44.388 1.00 28.70  ? 55  ILE E CB  1 
ATOM   6125 C  CG1 . ILE E  1 57  ? 15.790  -36.699 -44.334 1.00 30.96  ? 55  ILE E CG1 1 
ATOM   6126 C  CG2 . ILE E  1 57  ? 17.543  -34.982 -43.882 1.00 29.14  ? 55  ILE E CG2 1 
ATOM   6127 C  CD1 . ILE E  1 57  ? 16.403  -37.501 -45.460 1.00 33.02  ? 55  ILE E CD1 1 
ATOM   6128 N  N   . TYR E  1 58  ? 15.834  -32.381 -42.477 1.00 24.83  ? 56  TYR E N   1 
ATOM   6129 C  CA  . TYR E  1 58  ? 16.162  -30.968 -42.385 1.00 25.80  ? 56  TYR E CA  1 
ATOM   6130 C  C   . TYR E  1 58  ? 17.669  -30.794 -42.302 1.00 27.20  ? 56  TYR E C   1 
ATOM   6131 O  O   . TYR E  1 58  ? 18.306  -31.276 -41.380 1.00 27.69  ? 56  TYR E O   1 
ATOM   6132 C  CB  . TYR E  1 58  ? 15.520  -30.347 -41.139 1.00 24.28  ? 56  TYR E CB  1 
ATOM   6133 C  CG  . TYR E  1 58  ? 14.023  -30.170 -41.219 1.00 23.21  ? 56  TYR E CG  1 
ATOM   6134 C  CD1 . TYR E  1 58  ? 13.470  -28.911 -41.327 1.00 25.66  ? 56  TYR E CD1 1 
ATOM   6135 C  CD2 . TYR E  1 58  ? 13.169  -31.253 -41.161 1.00 21.71  ? 56  TYR E CD2 1 
ATOM   6136 C  CE1 . TYR E  1 58  ? 12.100  -28.729 -41.384 1.00 23.50  ? 56  TYR E CE1 1 
ATOM   6137 C  CE2 . TYR E  1 58  ? 11.802  -31.085 -41.234 1.00 21.00  ? 56  TYR E CE2 1 
ATOM   6138 C  CZ  . TYR E  1 58  ? 11.274  -29.819 -41.353 1.00 21.11  ? 56  TYR E CZ  1 
ATOM   6139 O  OH  . TYR E  1 58  ? 9.916   -29.621 -41.418 1.00 20.47  ? 56  TYR E OH  1 
ATOM   6140 N  N   . GLU E  1 59  ? 18.242  -30.101 -43.266 1.00 30.51  ? 57  GLU E N   1 
ATOM   6141 C  CA  . GLU E  1 59  ? 19.677  -29.819 -43.244 1.00 36.02  ? 57  GLU E CA  1 
ATOM   6142 C  C   . GLU E  1 59  ? 19.920  -28.334 -43.139 1.00 33.54  ? 57  GLU E C   1 
ATOM   6143 O  O   . GLU E  1 59  ? 19.489  -27.579 -44.008 1.00 31.05  ? 57  GLU E O   1 
ATOM   6144 C  CB  . GLU E  1 59  ? 20.348  -30.348 -44.509 1.00 43.24  ? 57  GLU E CB  1 
ATOM   6145 C  CG  . GLU E  1 59  ? 20.764  -31.800 -44.395 1.00 52.01  ? 57  GLU E CG  1 
ATOM   6146 C  CD  . GLU E  1 59  ? 21.045  -32.439 -45.737 1.00 60.78  ? 57  GLU E CD  1 
ATOM   6147 O  OE1 . GLU E  1 59  ? 21.120  -31.702 -46.747 1.00 72.20  ? 57  GLU E OE1 1 
ATOM   6148 O  OE2 . GLU E  1 59  ? 21.198  -33.678 -45.772 1.00 55.02  ? 57  GLU E OE2 1 
ATOM   6149 N  N   . LEU E  1 60  ? 20.592  -27.924 -42.068 1.00 34.12  ? 58  LEU E N   1 
ATOM   6150 C  CA  . LEU E  1 60  ? 20.855  -26.510 -41.820 1.00 36.81  ? 58  LEU E CA  1 
ATOM   6151 C  C   . LEU E  1 60  ? 22.021  -26.065 -42.677 1.00 38.24  ? 58  LEU E C   1 
ATOM   6152 O  O   . LEU E  1 60  ? 23.091  -26.642 -42.599 1.00 38.77  ? 58  LEU E O   1 
ATOM   6153 C  CB  . LEU E  1 60  ? 21.180  -26.290 -40.343 1.00 36.01  ? 58  LEU E CB  1 
ATOM   6154 C  CG  . LEU E  1 60  ? 21.225  -24.846 -39.860 1.00 39.03  ? 58  LEU E CG  1 
ATOM   6155 C  CD1 . LEU E  1 60  ? 19.897  -24.145 -40.102 1.00 37.30  ? 58  LEU E CD1 1 
ATOM   6156 C  CD2 . LEU E  1 60  ? 21.597  -24.809 -38.384 1.00 40.25  ? 58  LEU E CD2 1 
ATOM   6157 N  N   . LYS E  1 61  ? 21.799  -25.073 -43.531 1.00 44.61  ? 59  LYS E N   1 
ATOM   6158 C  CA  . LYS E  1 61  ? 22.858  -24.581 -44.411 1.00 48.73  ? 59  LYS E CA  1 
ATOM   6159 C  C   . LYS E  1 61  ? 23.651  -23.468 -43.735 1.00 48.41  ? 59  LYS E C   1 
ATOM   6160 O  O   . LYS E  1 61  ? 23.236  -22.917 -42.715 1.00 44.63  ? 59  LYS E O   1 
ATOM   6161 C  CB  . LYS E  1 61  ? 22.268  -24.066 -45.723 1.00 51.56  ? 59  LYS E CB  1 
ATOM   6162 C  CG  . LYS E  1 61  ? 21.321  -25.042 -46.401 1.00 52.76  ? 59  LYS E CG  1 
ATOM   6163 C  CD  . LYS E  1 61  ? 21.358  -24.896 -47.915 1.00 58.96  ? 59  LYS E CD  1 
ATOM   6164 C  CE  . LYS E  1 61  ? 21.099  -23.463 -48.359 1.00 62.17  ? 59  LYS E CE  1 
ATOM   6165 N  NZ  . LYS E  1 61  ? 19.977  -23.371 -49.337 1.00 65.13  ? 59  LYS E NZ  1 
ATOM   6166 N  N   . GLU E  1 62  ? 24.785  -23.127 -44.333 1.00 58.04  ? 60  GLU E N   1 
ATOM   6167 C  CA  . GLU E  1 62  ? 25.611  -22.019 -43.863 1.00 60.94  ? 60  GLU E CA  1 
ATOM   6168 C  C   . GLU E  1 62  ? 24.788  -20.758 -43.605 1.00 55.85  ? 60  GLU E C   1 
ATOM   6169 O  O   . GLU E  1 62  ? 24.989  -20.080 -42.596 1.00 55.20  ? 60  GLU E O   1 
ATOM   6170 C  CB  . GLU E  1 62  ? 26.715  -21.725 -44.880 1.00 70.84  ? 60  GLU E CB  1 
ATOM   6171 C  CG  . GLU E  1 62  ? 27.442  -20.409 -44.641 1.00 83.12  ? 60  GLU E CG  1 
ATOM   6172 C  CD  . GLU E  1 62  ? 28.917  -20.480 -44.981 1.00 89.09  ? 60  GLU E CD  1 
ATOM   6173 O  OE1 . GLU E  1 62  ? 29.492  -21.591 -44.936 1.00 91.61  ? 60  GLU E OE1 1 
ATOM   6174 O  OE2 . GLU E  1 62  ? 29.500  -19.420 -45.289 1.00 95.89  ? 60  GLU E OE2 1 
ATOM   6175 N  N   . ASP E  1 63  ? 23.863  -20.450 -44.514 1.00 51.36  ? 61  ASP E N   1 
ATOM   6176 C  CA  . ASP E  1 63  ? 23.080  -19.213 -44.432 1.00 48.43  ? 61  ASP E CA  1 
ATOM   6177 C  C   . ASP E  1 63  ? 21.853  -19.326 -43.518 1.00 43.71  ? 61  ASP E C   1 
ATOM   6178 O  O   . ASP E  1 63  ? 21.037  -18.406 -43.457 1.00 42.18  ? 61  ASP E O   1 
ATOM   6179 C  CB  . ASP E  1 63  ? 22.665  -18.756 -45.835 1.00 47.92  ? 61  ASP E CB  1 
ATOM   6180 C  CG  . ASP E  1 63  ? 21.575  -19.625 -46.446 1.00 45.51  ? 61  ASP E CG  1 
ATOM   6181 O  OD1 . ASP E  1 63  ? 21.093  -20.570 -45.789 1.00 41.55  ? 61  ASP E OD1 1 
ATOM   6182 O  OD2 . ASP E  1 63  ? 21.184  -19.344 -47.592 1.00 48.15  ? 61  ASP E OD2 1 
ATOM   6183 N  N   . LYS E  1 64  ? 21.730  -20.453 -42.818 1.00 41.36  ? 62  LYS E N   1 
ATOM   6184 C  CA  . LYS E  1 64  ? 20.705  -20.642 -41.782 1.00 40.72  ? 62  LYS E CA  1 
ATOM   6185 C  C   . LYS E  1 64  ? 19.322  -20.994 -42.329 1.00 36.94  ? 62  LYS E C   1 
ATOM   6186 O  O   . LYS E  1 64  ? 18.370  -21.149 -41.573 1.00 34.82  ? 62  LYS E O   1 
ATOM   6187 C  CB  . LYS E  1 64  ? 20.578  -19.404 -40.889 1.00 43.85  ? 62  LYS E CB  1 
ATOM   6188 C  CG  . LYS E  1 64  ? 21.838  -19.038 -40.124 1.00 47.73  ? 62  LYS E CG  1 
ATOM   6189 C  CD  . LYS E  1 64  ? 22.324  -20.179 -39.250 1.00 51.39  ? 62  LYS E CD  1 
ATOM   6190 C  CE  . LYS E  1 64  ? 23.596  -19.794 -38.513 1.00 51.06  ? 62  LYS E CE  1 
ATOM   6191 N  NZ  . LYS E  1 64  ? 24.293  -20.998 -37.983 1.00 52.83  ? 62  LYS E NZ  1 
ATOM   6192 N  N   . SER E  1 65  ? 19.214  -21.128 -43.640 1.00 37.37  ? 63  SER E N   1 
ATOM   6193 C  CA  . SER E  1 65  ? 18.057  -21.764 -44.233 1.00 36.80  ? 63  SER E CA  1 
ATOM   6194 C  C   . SER E  1 65  ? 18.207  -23.284 -44.146 1.00 34.76  ? 63  SER E C   1 
ATOM   6195 O  O   . SER E  1 65  ? 19.312  -23.797 -43.952 1.00 33.07  ? 63  SER E O   1 
ATOM   6196 C  CB  . SER E  1 65  ? 17.918  -21.331 -45.686 1.00 39.11  ? 63  SER E CB  1 
ATOM   6197 O  OG  . SER E  1 65  ? 18.928  -21.935 -46.479 1.00 44.97  ? 63  SER E OG  1 
ATOM   6198 N  N   . TYR E  1 66  ? 17.082  -23.991 -44.226 1.00 32.87  ? 64  TYR E N   1 
ATOM   6199 C  CA  . TYR E  1 66  ? 17.091  -25.451 -44.292 1.00 31.34  ? 64  TYR E CA  1 
ATOM   6200 C  C   . TYR E  1 66  ? 16.900  -25.903 -45.733 1.00 33.42  ? 64  TYR E C   1 
ATOM   6201 O  O   . TYR E  1 66  ? 16.017  -25.407 -46.446 1.00 36.24  ? 64  TYR E O   1 
ATOM   6202 C  CB  . TYR E  1 66  ? 15.947  -26.044 -43.486 1.00 28.47  ? 64  TYR E CB  1 
ATOM   6203 C  CG  . TYR E  1 66  ? 16.117  -26.049 -41.979 1.00 27.52  ? 64  TYR E CG  1 
ATOM   6204 C  CD1 . TYR E  1 66  ? 15.243  -25.333 -41.174 1.00 25.99  ? 64  TYR E CD1 1 
ATOM   6205 C  CD2 . TYR E  1 66  ? 17.088  -26.829 -41.356 1.00 26.68  ? 64  TYR E CD2 1 
ATOM   6206 C  CE1 . TYR E  1 66  ? 15.358  -25.347 -39.801 1.00 25.02  ? 64  TYR E CE1 1 
ATOM   6207 C  CE2 . TYR E  1 66  ? 17.203  -26.859 -39.975 1.00 25.68  ? 64  TYR E CE2 1 
ATOM   6208 C  CZ  . TYR E  1 66  ? 16.331  -26.117 -39.206 1.00 25.71  ? 64  TYR E CZ  1 
ATOM   6209 O  OH  . TYR E  1 66  ? 16.424  -26.119 -37.833 1.00 26.82  ? 64  TYR E OH  1 
ATOM   6210 N  N   . ASN E  1 67  ? 17.728  -26.843 -46.161 1.00 34.38  ? 65  ASN E N   1 
ATOM   6211 C  CA  . ASN E  1 67  ? 17.333  -27.769 -47.212 1.00 35.64  ? 65  ASN E CA  1 
ATOM   6212 C  C   . ASN E  1 67  ? 16.479  -28.895 -46.642 1.00 30.69  ? 65  ASN E C   1 
ATOM   6213 O  O   . ASN E  1 67  ? 16.860  -29.541 -45.670 1.00 28.69  ? 65  ASN E O   1 
ATOM   6214 C  CB  . ASN E  1 67  ? 18.573  -28.302 -47.927 1.00 41.58  ? 65  ASN E CB  1 
ATOM   6215 C  CG  . ASN E  1 67  ? 18.924  -27.492 -49.151 1.00 48.10  ? 65  ASN E CG  1 
ATOM   6216 O  OD1 . ASN E  1 67  ? 20.081  -27.451 -49.560 1.00 55.26  ? 65  ASN E OD1 1 
ATOM   6217 N  ND2 . ASN E  1 67  ? 17.943  -26.785 -49.701 1.00 50.41  ? 65  ASN E ND2 1 
ATOM   6218 N  N   . VAL E  1 68  ? 15.275  -29.044 -47.184 1.00 28.53  ? 66  VAL E N   1 
ATOM   6219 C  CA  . VAL E  1 68  ? 14.289  -29.952 -46.622 1.00 26.27  ? 66  VAL E CA  1 
ATOM   6220 C  C   . VAL E  1 68  ? 13.932  -30.985 -47.672 1.00 26.66  ? 66  VAL E C   1 
ATOM   6221 O  O   . VAL E  1 68  ? 13.472  -30.654 -48.765 1.00 28.16  ? 66  VAL E O   1 
ATOM   6222 C  CB  . VAL E  1 68  ? 13.006  -29.220 -46.170 1.00 24.66  ? 66  VAL E CB  1 
ATOM   6223 C  CG1 . VAL E  1 68  ? 12.063  -30.178 -45.452 1.00 22.98  ? 66  VAL E CG1 1 
ATOM   6224 C  CG2 . VAL E  1 68  ? 13.346  -28.054 -45.259 1.00 23.92  ? 66  VAL E CG2 1 
ATOM   6225 N  N   . THR E  1 69  ? 14.163  -32.243 -47.340 1.00 25.85  ? 67  THR E N   1 
ATOM   6226 C  CA  . THR E  1 69  ? 13.952  -33.321 -48.287 1.00 26.45  ? 67  THR E CA  1 
ATOM   6227 C  C   . THR E  1 69  ? 12.979  -34.322 -47.684 1.00 25.30  ? 67  THR E C   1 
ATOM   6228 O  O   . THR E  1 69  ? 13.219  -34.853 -46.605 1.00 25.34  ? 67  THR E O   1 
ATOM   6229 C  CB  . THR E  1 69  ? 15.275  -34.035 -48.627 1.00 27.26  ? 67  THR E CB  1 
ATOM   6230 O  OG1 . THR E  1 69  ? 16.262  -33.073 -49.018 1.00 28.19  ? 67  THR E OG1 1 
ATOM   6231 C  CG2 . THR E  1 69  ? 15.062  -35.047 -49.754 1.00 28.37  ? 67  THR E CG2 1 
ATOM   6232 N  N   . SER E  1 70  ? 11.892  -34.590 -48.391 1.00 25.24  ? 68  SER E N   1 
ATOM   6233 C  CA  . SER E  1 70  ? 10.957  -35.616 -47.968 1.00 24.26  ? 68  SER E CA  1 
ATOM   6234 C  C   . SER E  1 70  ? 11.102  -36.822 -48.864 1.00 25.90  ? 68  SER E C   1 
ATOM   6235 O  O   . SER E  1 70  ? 11.177  -36.692 -50.086 1.00 26.39  ? 68  SER E O   1 
ATOM   6236 C  CB  . SER E  1 70  ? 9.521   -35.088 -48.020 1.00 24.41  ? 68  SER E CB  1 
ATOM   6237 O  OG  . SER E  1 70  ? 9.236   -34.293 -46.875 1.00 21.76  ? 68  SER E OG  1 
ATOM   6238 N  N   . VAL E  1 71  ? 11.168  -37.999 -48.248 1.00 26.79  ? 69  VAL E N   1 
ATOM   6239 C  CA  . VAL E  1 71  ? 11.346  -39.241 -48.994 1.00 29.08  ? 69  VAL E CA  1 
ATOM   6240 C  C   . VAL E  1 71  ? 10.117  -40.132 -48.786 1.00 28.48  ? 69  VAL E C   1 
ATOM   6241 O  O   . VAL E  1 71  ? 9.731   -40.418 -47.652 1.00 26.40  ? 69  VAL E O   1 
ATOM   6242 C  CB  . VAL E  1 71  ? 12.676  -39.945 -48.621 1.00 31.25  ? 69  VAL E CB  1 
ATOM   6243 C  CG1 . VAL E  1 71  ? 12.804  -40.092 -47.121 1.00 33.16  ? 69  VAL E CG1 1 
ATOM   6244 C  CG2 . VAL E  1 71  ? 12.814  -41.303 -49.305 1.00 32.24  ? 69  VAL E CG2 1 
ATOM   6245 N  N   . LEU E  1 72  ? 9.478   -40.518 -49.891 1.00 29.83  ? 70  LEU E N   1 
ATOM   6246 C  CA  . LEU E  1 72  ? 8.239   -41.303 -49.858 1.00 30.07  ? 70  LEU E CA  1 
ATOM   6247 C  C   . LEU E  1 72  ? 8.399   -42.585 -50.664 1.00 30.98  ? 70  LEU E C   1 
ATOM   6248 O  O   . LEU E  1 72  ? 9.115   -42.604 -51.669 1.00 32.71  ? 70  LEU E O   1 
ATOM   6249 C  CB  . LEU E  1 72  ? 7.072   -40.510 -50.461 1.00 31.69  ? 70  LEU E CB  1 
ATOM   6250 C  CG  . LEU E  1 72  ? 6.550   -39.295 -49.696 1.00 32.23  ? 70  LEU E CG  1 
ATOM   6251 C  CD1 . LEU E  1 72  ? 7.525   -38.132 -49.808 1.00 32.88  ? 70  LEU E CD1 1 
ATOM   6252 C  CD2 . LEU E  1 72  ? 5.187   -38.886 -50.247 1.00 33.72  ? 70  LEU E CD2 1 
ATOM   6253 N  N   . PHE E  1 73  ? 7.693   -43.639 -50.259 1.00 29.66  ? 71  PHE E N   1 
ATOM   6254 C  CA  . PHE E  1 73  ? 7.614   -44.860 -51.060 1.00 32.27  ? 71  PHE E CA  1 
ATOM   6255 C  C   . PHE E  1 73  ? 6.305   -44.852 -51.842 1.00 34.60  ? 71  PHE E C   1 
ATOM   6256 O  O   . PHE E  1 73  ? 5.238   -44.991 -51.263 1.00 35.46  ? 71  PHE E O   1 
ATOM   6257 C  CB  . PHE E  1 73  ? 7.696   -46.093 -50.149 1.00 30.94  ? 71  PHE E CB  1 
ATOM   6258 C  CG  . PHE E  1 73  ? 7.738   -47.407 -50.880 1.00 31.77  ? 71  PHE E CG  1 
ATOM   6259 C  CD1 . PHE E  1 73  ? 8.662   -47.638 -51.883 1.00 33.38  ? 71  PHE E CD1 1 
ATOM   6260 C  CD2 . PHE E  1 73  ? 6.878   -48.435 -50.522 1.00 32.13  ? 71  PHE E CD2 1 
ATOM   6261 C  CE1 . PHE E  1 73  ? 8.710   -48.863 -52.543 1.00 35.61  ? 71  PHE E CE1 1 
ATOM   6262 C  CE2 . PHE E  1 73  ? 6.920   -49.662 -51.169 1.00 33.94  ? 71  PHE E CE2 1 
ATOM   6263 C  CZ  . PHE E  1 73  ? 7.837   -49.879 -52.183 1.00 35.45  ? 71  PHE E CZ  1 
ATOM   6264 N  N   . ARG E  1 74  ? 6.390   -44.657 -53.153 1.00 37.51  ? 72  ARG E N   1 
ATOM   6265 C  CA  . ARG E  1 74  ? 5.206   -44.487 -53.986 1.00 39.49  ? 72  ARG E CA  1 
ATOM   6266 C  C   . ARG E  1 74  ? 5.382   -45.264 -55.278 1.00 43.29  ? 72  ARG E C   1 
ATOM   6267 O  O   . ARG E  1 74  ? 6.386   -45.098 -55.958 1.00 46.01  ? 72  ARG E O   1 
ATOM   6268 C  CB  . ARG E  1 74  ? 4.977   -43.007 -54.305 1.00 39.30  ? 72  ARG E CB  1 
ATOM   6269 N  N   . LYS E  1 75  ? 4.420   -46.129 -55.600 1.00 44.19  ? 73  LYS E N   1 
ATOM   6270 C  CA  . LYS E  1 75  ? 4.449   -46.884 -56.848 1.00 46.77  ? 73  LYS E CA  1 
ATOM   6271 C  C   . LYS E  1 75  ? 5.765   -47.652 -56.975 1.00 46.86  ? 73  LYS E C   1 
ATOM   6272 O  O   . LYS E  1 75  ? 6.340   -47.753 -58.058 1.00 48.53  ? 73  LYS E O   1 
ATOM   6273 C  CB  . LYS E  1 75  ? 4.245   -45.951 -58.047 1.00 47.84  ? 73  LYS E CB  1 
ATOM   6274 N  N   . LYS E  1 76  ? 6.222   -48.196 -55.853 1.00 45.18  ? 74  LYS E N   1 
ATOM   6275 C  CA  . LYS E  1 76  ? 7.367   -49.110 -55.815 1.00 45.91  ? 74  LYS E CA  1 
ATOM   6276 C  C   . LYS E  1 76  ? 8.717   -48.418 -56.015 1.00 44.67  ? 74  LYS E C   1 
ATOM   6277 O  O   . LYS E  1 76  ? 9.721   -49.069 -56.311 1.00 44.96  ? 74  LYS E O   1 
ATOM   6278 C  CB  . LYS E  1 76  ? 7.195   -50.241 -56.827 1.00 50.25  ? 74  LYS E CB  1 
ATOM   6279 C  CG  . LYS E  1 76  ? 6.083   -51.204 -56.458 1.00 53.60  ? 74  LYS E CG  1 
ATOM   6280 C  CD  . LYS E  1 76  ? 5.899   -52.283 -57.517 1.00 59.36  ? 74  LYS E CD  1 
ATOM   6281 C  CE  . LYS E  1 76  ? 4.646   -53.110 -57.256 1.00 61.58  ? 74  LYS E CE  1 
ATOM   6282 N  NZ  . LYS E  1 76  ? 4.557   -54.288 -58.163 1.00 65.03  ? 74  LYS E NZ  1 
ATOM   6283 N  N   . LYS E  1 77  ? 8.742   -47.101 -55.834 1.00 41.76  ? 75  LYS E N   1 
ATOM   6284 C  CA  . LYS E  1 77  ? 9.969   -46.334 -55.995 1.00 40.53  ? 75  LYS E CA  1 
ATOM   6285 C  C   . LYS E  1 77  ? 10.119  -45.364 -54.861 1.00 37.20  ? 75  LYS E C   1 
ATOM   6286 O  O   . LYS E  1 77  ? 9.152   -45.051 -54.179 1.00 35.87  ? 75  LYS E O   1 
ATOM   6287 C  CB  . LYS E  1 77  ? 9.963   -45.569 -57.316 1.00 42.15  ? 75  LYS E CB  1 
ATOM   6288 C  CG  . LYS E  1 77  ? 9.917   -46.472 -58.529 1.00 44.70  ? 75  LYS E CG  1 
ATOM   6289 C  CD  . LYS E  1 77  ? 10.250  -45.721 -59.803 1.00 46.85  ? 75  LYS E CD  1 
ATOM   6290 C  CE  . LYS E  1 77  ? 9.998   -46.602 -61.006 1.00 50.56  ? 75  LYS E CE  1 
ATOM   6291 N  NZ  . LYS E  1 77  ? 10.318  -45.894 -62.268 1.00 54.21  ? 75  LYS E NZ  1 
ATOM   6292 N  N   . CYS E  1 78  ? 11.340  -44.888 -54.659 1.00 36.95  ? 76  CYS E N   1 
ATOM   6293 C  CA  . CYS E  1 78  ? 11.579  -43.787 -53.737 1.00 35.29  ? 76  CYS E CA  1 
ATOM   6294 C  C   . CYS E  1 78  ? 11.346  -42.467 -54.445 1.00 35.43  ? 76  CYS E C   1 
ATOM   6295 O  O   . CYS E  1 78  ? 11.924  -42.200 -55.490 1.00 36.93  ? 76  CYS E O   1 
ATOM   6296 C  CB  . CYS E  1 78  ? 13.000  -43.851 -53.176 1.00 34.96  ? 76  CYS E CB  1 
ATOM   6297 S  SG  . CYS E  1 78  ? 13.408  -45.415 -52.372 1.00 35.92  ? 76  CYS E SG  1 
ATOM   6298 N  N   . ASP E  1 79  ? 10.482  -41.652 -53.863 1.00 35.11  ? 77  ASP E N   1 
ATOM   6299 C  CA  . ASP E  1 79  ? 10.100  -40.362 -54.432 1.00 36.62  ? 77  ASP E CA  1 
ATOM   6300 C  C   . ASP E  1 79  ? 10.603  -39.257 -53.501 1.00 32.53  ? 77  ASP E C   1 
ATOM   6301 O  O   . ASP E  1 79  ? 10.567  -39.391 -52.285 1.00 29.50  ? 77  ASP E O   1 
ATOM   6302 C  CB  . ASP E  1 79  ? 8.577   -40.315 -54.584 1.00 40.21  ? 77  ASP E CB  1 
ATOM   6303 C  CG  . ASP E  1 79  ? 8.065   -38.973 -55.086 1.00 46.23  ? 77  ASP E CG  1 
ATOM   6304 O  OD1 . ASP E  1 79  ? 8.360   -38.592 -56.244 1.00 55.38  ? 77  ASP E OD1 1 
ATOM   6305 O  OD2 . ASP E  1 79  ? 7.317   -38.312 -54.330 1.00 49.56  ? 77  ASP E OD2 1 
ATOM   6306 N  N   . TYR E  1 80  ? 11.166  -38.207 -54.073 1.00 33.04  ? 78  TYR E N   1 
ATOM   6307 C  CA  . TYR E  1 80  ? 11.868  -37.198 -53.287 1.00 31.93  ? 78  TYR E CA  1 
ATOM   6308 C  C   . TYR E  1 80  ? 11.296  -35.831 -53.620 1.00 32.27  ? 78  TYR E C   1 
ATOM   6309 O  O   . TYR E  1 80  ? 11.262  -35.442 -54.780 1.00 34.20  ? 78  TYR E O   1 
ATOM   6310 C  CB  . TYR E  1 80  ? 13.363  -37.208 -53.613 1.00 32.98  ? 78  TYR E CB  1 
ATOM   6311 C  CG  . TYR E  1 80  ? 14.066  -38.503 -53.295 1.00 33.21  ? 78  TYR E CG  1 
ATOM   6312 C  CD1 . TYR E  1 80  ? 14.624  -38.719 -52.039 1.00 31.74  ? 78  TYR E CD1 1 
ATOM   6313 C  CD2 . TYR E  1 80  ? 14.195  -39.504 -54.249 1.00 34.63  ? 78  TYR E CD2 1 
ATOM   6314 C  CE1 . TYR E  1 80  ? 15.280  -39.900 -51.737 1.00 31.78  ? 78  TYR E CE1 1 
ATOM   6315 C  CE2 . TYR E  1 80  ? 14.860  -40.687 -53.957 1.00 35.26  ? 78  TYR E CE2 1 
ATOM   6316 C  CZ  . TYR E  1 80  ? 15.404  -40.880 -52.699 1.00 33.38  ? 78  TYR E CZ  1 
ATOM   6317 O  OH  . TYR E  1 80  ? 16.080  -42.044 -52.390 1.00 33.02  ? 78  TYR E OH  1 
ATOM   6318 N  N   . TRP E  1 81  ? 10.861  -35.102 -52.602 1.00 31.44  ? 79  TRP E N   1 
ATOM   6319 C  CA  . TRP E  1 81  ? 10.606  -33.674 -52.745 1.00 33.60  ? 79  TRP E CA  1 
ATOM   6320 C  C   . TRP E  1 81  ? 11.602  -32.819 -51.955 1.00 33.45  ? 79  TRP E C   1 
ATOM   6321 O  O   . TRP E  1 81  ? 11.657  -32.880 -50.727 1.00 29.90  ? 79  TRP E O   1 
ATOM   6322 C  CB  . TRP E  1 81  ? 9.185   -33.327 -52.319 1.00 33.08  ? 79  TRP E CB  1 
ATOM   6323 C  CG  . TRP E  1 81  ? 8.882   -31.864 -52.500 1.00 35.68  ? 79  TRP E CG  1 
ATOM   6324 C  CD1 . TRP E  1 81  ? 9.229   -31.073 -53.569 1.00 37.82  ? 79  TRP E CD1 1 
ATOM   6325 C  CD2 . TRP E  1 81  ? 8.152   -31.019 -51.603 1.00 35.86  ? 79  TRP E CD2 1 
ATOM   6326 N  NE1 . TRP E  1 81  ? 8.762   -29.793 -53.388 1.00 37.95  ? 79  TRP E NE1 1 
ATOM   6327 C  CE2 . TRP E  1 81  ? 8.103   -29.728 -52.188 1.00 35.97  ? 79  TRP E CE2 1 
ATOM   6328 C  CE3 . TRP E  1 81  ? 7.535   -31.227 -50.366 1.00 34.59  ? 79  TRP E CE3 1 
ATOM   6329 C  CZ2 . TRP E  1 81  ? 7.479   -28.652 -51.569 1.00 34.93  ? 79  TRP E CZ2 1 
ATOM   6330 C  CZ3 . TRP E  1 81  ? 6.909   -30.157 -49.754 1.00 35.12  ? 79  TRP E CZ3 1 
ATOM   6331 C  CH2 . TRP E  1 81  ? 6.886   -28.884 -50.358 1.00 35.15  ? 79  TRP E CH2 1 
ATOM   6332 N  N   . ILE E  1 82  ? 12.376  -32.014 -52.681 1.00 36.80  ? 80  ILE E N   1 
ATOM   6333 C  CA  . ILE E  1 82  ? 13.340  -31.103 -52.080 1.00 37.41  ? 80  ILE E CA  1 
ATOM   6334 C  C   . ILE E  1 82  ? 12.831  -29.666 -52.169 1.00 37.52  ? 80  ILE E C   1 
ATOM   6335 O  O   . ILE E  1 82  ? 12.435  -29.207 -53.236 1.00 37.35  ? 80  ILE E O   1 
ATOM   6336 C  CB  . ILE E  1 82  ? 14.698  -31.174 -52.807 1.00 41.05  ? 80  ILE E CB  1 
ATOM   6337 C  CG1 . ILE E  1 82  ? 15.230  -32.608 -52.783 1.00 43.75  ? 80  ILE E CG1 1 
ATOM   6338 C  CG2 . ILE E  1 82  ? 15.696  -30.215 -52.171 1.00 39.92  ? 80  ILE E CG2 1 
ATOM   6339 C  CD1 . ILE E  1 82  ? 16.327  -32.882 -53.796 1.00 47.03  ? 80  ILE E CD1 1 
ATOM   6340 N  N   . ARG E  1 83  ? 12.856  -28.955 -51.047 1.00 35.46  ? 81  ARG E N   1 
ATOM   6341 C  CA  . ARG E  1 83  ? 12.575  -27.529 -51.056 1.00 34.30  ? 81  ARG E CA  1 
ATOM   6342 C  C   . ARG E  1 83  ? 13.358  -26.815 -49.970 1.00 32.60  ? 81  ARG E C   1 
ATOM   6343 O  O   . ARG E  1 83  ? 14.073  -27.441 -49.188 1.00 32.44  ? 81  ARG E O   1 
ATOM   6344 C  CB  . ARG E  1 83  ? 11.071  -27.270 -50.908 1.00 34.20  ? 81  ARG E CB  1 
ATOM   6345 C  CG  . ARG E  1 83  ? 10.494  -27.613 -49.544 1.00 33.18  ? 81  ARG E CG  1 
ATOM   6346 C  CD  . ARG E  1 83  ? 10.474  -29.121 -49.315 1.00 33.90  ? 81  ARG E CD  1 
ATOM   6347 N  NE  . ARG E  1 83  ? 9.604   -29.493 -48.202 1.00 34.88  ? 81  ARG E NE  1 
ATOM   6348 C  CZ  . ARG E  1 83  ? 9.501   -30.724 -47.702 1.00 34.62  ? 81  ARG E CZ  1 
ATOM   6349 N  NH1 . ARG E  1 83  ? 10.217  -31.720 -48.209 1.00 33.11  ? 81  ARG E NH1 1 
ATOM   6350 N  NH2 . ARG E  1 83  ? 8.673   -30.961 -46.691 1.00 35.87  ? 81  ARG E NH2 1 
ATOM   6351 N  N   . THR E  1 84  ? 13.210  -25.496 -49.923 1.00 31.45  ? 82  THR E N   1 
ATOM   6352 C  CA  . THR E  1 84  ? 14.020  -24.667 -49.054 1.00 29.80  ? 82  THR E CA  1 
ATOM   6353 C  C   . THR E  1 84  ? 13.109  -23.946 -48.067 1.00 27.47  ? 82  THR E C   1 
ATOM   6354 O  O   . THR E  1 84  ? 12.117  -23.342 -48.463 1.00 26.46  ? 82  THR E O   1 
ATOM   6355 C  CB  . THR E  1 84  ? 14.819  -23.657 -49.889 1.00 32.20  ? 82  THR E CB  1 
ATOM   6356 O  OG1 . THR E  1 84  ? 15.699  -24.371 -50.759 1.00 33.43  ? 82  THR E OG1 1 
ATOM   6357 C  CG2 . THR E  1 84  ? 15.642  -22.731 -49.010 1.00 32.37  ? 82  THR E CG2 1 
ATOM   6358 N  N   . PHE E  1 85  ? 13.426  -24.049 -46.777 1.00 25.83  ? 83  PHE E N   1 
ATOM   6359 C  CA  . PHE E  1 85  ? 12.771  -23.234 -45.764 1.00 24.88  ? 83  PHE E CA  1 
ATOM   6360 C  C   . PHE E  1 85  ? 13.657  -22.061 -45.363 1.00 25.38  ? 83  PHE E C   1 
ATOM   6361 O  O   . PHE E  1 85  ? 14.732  -22.251 -44.803 1.00 25.91  ? 83  PHE E O   1 
ATOM   6362 C  CB  . PHE E  1 85  ? 12.444  -24.060 -44.521 1.00 22.98  ? 83  PHE E CB  1 
ATOM   6363 C  CG  . PHE E  1 85  ? 11.295  -25.008 -44.699 1.00 21.96  ? 83  PHE E CG  1 
ATOM   6364 C  CD1 . PHE E  1 85  ? 10.866  -25.777 -43.640 1.00 20.49  ? 83  PHE E CD1 1 
ATOM   6365 C  CD2 . PHE E  1 85  ? 10.656  -25.140 -45.916 1.00 22.20  ? 83  PHE E CD2 1 
ATOM   6366 C  CE1 . PHE E  1 85  ? 9.824   -26.664 -43.795 1.00 20.80  ? 83  PHE E CE1 1 
ATOM   6367 C  CE2 . PHE E  1 85  ? 9.601   -26.016 -46.070 1.00 21.54  ? 83  PHE E CE2 1 
ATOM   6368 C  CZ  . PHE E  1 85  ? 9.190   -26.783 -45.014 1.00 20.42  ? 83  PHE E CZ  1 
ATOM   6369 N  N   . VAL E  1 86  ? 13.172  -20.856 -45.620 1.00 26.29  ? 84  VAL E N   1 
ATOM   6370 C  CA  . VAL E  1 86  ? 13.894  -19.633 -45.269 1.00 29.08  ? 84  VAL E CA  1 
ATOM   6371 C  C   . VAL E  1 86  ? 13.387  -19.086 -43.937 1.00 27.26  ? 84  VAL E C   1 
ATOM   6372 O  O   . VAL E  1 86  ? 12.186  -18.960 -43.734 1.00 27.27  ? 84  VAL E O   1 
ATOM   6373 C  CB  . VAL E  1 86  ? 13.711  -18.553 -46.362 1.00 30.49  ? 84  VAL E CB  1 
ATOM   6374 C  CG1 . VAL E  1 86  ? 14.454  -17.274 -46.004 1.00 32.32  ? 84  VAL E CG1 1 
ATOM   6375 C  CG2 . VAL E  1 86  ? 14.201  -19.077 -47.700 1.00 31.32  ? 84  VAL E CG2 1 
ATOM   6376 N  N   . PRO E  1 87  ? 14.306  -18.750 -43.023 1.00 28.83  ? 85  PRO E N   1 
ATOM   6377 C  CA  . PRO E  1 87  ? 13.905  -18.221 -41.721 1.00 27.26  ? 85  PRO E CA  1 
ATOM   6378 C  C   . PRO E  1 87  ? 13.001  -17.011 -41.844 1.00 27.26  ? 85  PRO E C   1 
ATOM   6379 O  O   . PRO E  1 87  ? 13.239  -16.140 -42.676 1.00 28.18  ? 85  PRO E O   1 
ATOM   6380 C  CB  . PRO E  1 87  ? 15.227  -17.792 -41.082 1.00 29.60  ? 85  PRO E CB  1 
ATOM   6381 C  CG  . PRO E  1 87  ? 16.278  -18.556 -41.805 1.00 30.60  ? 85  PRO E CG  1 
ATOM   6382 C  CD  . PRO E  1 87  ? 15.769  -18.742 -43.203 1.00 30.09  ? 85  PRO E CD  1 
ATOM   6383 N  N   . GLY E  1 88  ? 11.948  -16.981 -41.041 1.00 26.99  ? 86  GLY E N   1 
ATOM   6384 C  CA  . GLY E  1 88  ? 11.031  -15.867 -41.040 1.00 29.44  ? 86  GLY E CA  1 
ATOM   6385 C  C   . GLY E  1 88  ? 11.357  -14.896 -39.927 1.00 32.51  ? 86  GLY E C   1 
ATOM   6386 O  O   . GLY E  1 88  ? 12.508  -14.758 -39.522 1.00 31.73  ? 86  GLY E O   1 
ATOM   6387 N  N   . SER E  1 89  ? 10.334  -14.227 -39.417 1.00 36.10  ? 87  SER E N   1 
ATOM   6388 C  CA  . SER E  1 89  ? 10.552  -13.091 -38.538 1.00 42.09  ? 87  SER E CA  1 
ATOM   6389 C  C   . SER E  1 89  ? 10.825  -13.520 -37.102 1.00 42.96  ? 87  SER E C   1 
ATOM   6390 O  O   . SER E  1 89  ? 11.292  -12.715 -36.297 1.00 45.73  ? 87  SER E O   1 
ATOM   6391 C  CB  . SER E  1 89  ? 9.336   -12.179 -38.554 1.00 41.02  ? 87  SER E CB  1 
ATOM   6392 O  OG  . SER E  1 89  ? 8.290   -12.760 -37.805 1.00 39.69  ? 87  SER E OG  1 
ATOM   6393 N  N   . GLN E  1 90  ? 10.500  -14.768 -36.780 1.00 36.05  ? 88  GLN E N   1 
ATOM   6394 C  CA  . GLN E  1 90  ? 10.702  -15.290 -35.446 1.00 35.37  ? 88  GLN E CA  1 
ATOM   6395 C  C   . GLN E  1 90  ? 11.374  -16.633 -35.581 1.00 29.37  ? 88  GLN E C   1 
ATOM   6396 O  O   . GLN E  1 90  ? 11.019  -17.409 -36.464 1.00 25.80  ? 88  GLN E O   1 
ATOM   6397 C  CB  . GLN E  1 90  ? 9.373   -15.468 -34.723 1.00 43.18  ? 88  GLN E CB  1 
ATOM   6398 C  CG  . GLN E  1 90  ? 8.643   -14.179 -34.382 1.00 53.83  ? 88  GLN E CG  1 
ATOM   6399 C  CD  . GLN E  1 90  ? 7.721   -14.368 -33.193 1.00 67.34  ? 88  GLN E CD  1 
ATOM   6400 O  OE1 . GLN E  1 90  ? 8.161   -14.256 -32.053 1.00 78.84  ? 88  GLN E OE1 1 
ATOM   6401 N  NE2 . GLN E  1 90  ? 6.452   -14.701 -33.447 1.00 62.56  ? 88  GLN E NE2 1 
ATOM   6402 N  N   . PRO E  1 91  ? 12.343  -16.919 -34.704 1.00 25.76  ? 89  PRO E N   1 
ATOM   6403 C  CA  . PRO E  1 91  ? 12.980  -18.223 -34.774 1.00 23.88  ? 89  PRO E CA  1 
ATOM   6404 C  C   . PRO E  1 91  ? 11.961  -19.359 -34.642 1.00 22.57  ? 89  PRO E C   1 
ATOM   6405 O  O   . PRO E  1 91  ? 11.077  -19.313 -33.770 1.00 20.12  ? 89  PRO E O   1 
ATOM   6406 C  CB  . PRO E  1 91  ? 13.950  -18.208 -33.589 1.00 24.74  ? 89  PRO E CB  1 
ATOM   6407 C  CG  . PRO E  1 91  ? 14.199  -16.764 -33.310 1.00 27.07  ? 89  PRO E CG  1 
ATOM   6408 C  CD  . PRO E  1 91  ? 12.886  -16.090 -33.611 1.00 26.43  ? 89  PRO E CD  1 
ATOM   6409 N  N   . GLY E  1 92  ? 12.050  -20.329 -35.548 1.00 20.53  ? 90  GLY E N   1 
ATOM   6410 C  CA  . GLY E  1 92  ? 11.081  -21.412 -35.600 1.00 21.08  ? 90  GLY E CA  1 
ATOM   6411 C  C   . GLY E  1 92  ? 9.985   -21.204 -36.633 1.00 21.37  ? 90  GLY E C   1 
ATOM   6412 O  O   . GLY E  1 92  ? 9.150   -22.088 -36.855 1.00 19.93  ? 90  GLY E O   1 
ATOM   6413 N  N   . GLU E  1 93  ? 9.970   -20.029 -37.254 1.00 21.29  ? 91  GLU E N   1 
ATOM   6414 C  CA  . GLU E  1 93  ? 9.057   -19.775 -38.359 1.00 20.85  ? 91  GLU E CA  1 
ATOM   6415 C  C   . GLU E  1 93  ? 9.828   -19.736 -39.648 1.00 19.71  ? 91  GLU E C   1 
ATOM   6416 O  O   . GLU E  1 93  ? 10.955  -19.264 -39.686 1.00 20.07  ? 91  GLU E O   1 
ATOM   6417 C  CB  . GLU E  1 93  ? 8.320   -18.448 -38.177 1.00 21.64  ? 91  GLU E CB  1 
ATOM   6418 C  CG  . GLU E  1 93  ? 7.371   -18.460 -36.999 1.00 22.65  ? 91  GLU E CG  1 
ATOM   6419 C  CD  . GLU E  1 93  ? 6.439   -17.281 -37.001 1.00 24.40  ? 91  GLU E CD  1 
ATOM   6420 O  OE1 . GLU E  1 93  ? 5.299   -17.449 -36.550 1.00 27.90  ? 91  GLU E OE1 1 
ATOM   6421 O  OE2 . GLU E  1 93  ? 6.828   -16.202 -37.485 1.00 29.39  ? 91  GLU E OE2 1 
ATOM   6422 N  N   . PHE E  1 94  ? 9.200   -20.204 -40.717 1.00 19.38  ? 92  PHE E N   1 
ATOM   6423 C  CA  . PHE E  1 94  ? 9.859   -20.221 -42.023 1.00 20.88  ? 92  PHE E CA  1 
ATOM   6424 C  C   . PHE E  1 94  ? 8.853   -19.929 -43.110 1.00 20.97  ? 92  PHE E C   1 
ATOM   6425 O  O   . PHE E  1 94  ? 7.639   -20.115 -42.929 1.00 19.69  ? 92  PHE E O   1 
ATOM   6426 C  CB  . PHE E  1 94  ? 10.500  -21.587 -42.274 1.00 19.57  ? 92  PHE E CB  1 
ATOM   6427 C  CG  . PHE E  1 94  ? 11.390  -22.033 -41.164 1.00 18.52  ? 92  PHE E CG  1 
ATOM   6428 C  CD1 . PHE E  1 94  ? 10.867  -22.673 -40.067 1.00 17.82  ? 92  PHE E CD1 1 
ATOM   6429 C  CD2 . PHE E  1 94  ? 12.746  -21.747 -41.189 1.00 19.57  ? 92  PHE E CD2 1 
ATOM   6430 C  CE1 . PHE E  1 94  ? 11.697  -23.049 -39.018 1.00 18.23  ? 92  PHE E CE1 1 
ATOM   6431 C  CE2 . PHE E  1 94  ? 13.579  -22.125 -40.154 1.00 19.39  ? 92  PHE E CE2 1 
ATOM   6432 C  CZ  . PHE E  1 94  ? 13.053  -22.770 -39.064 1.00 18.62  ? 92  PHE E CZ  1 
ATOM   6433 N  N   . THR E  1 95  ? 9.350   -19.442 -44.231 1.00 23.54  ? 93  THR E N   1 
ATOM   6434 C  CA  . THR E  1 95  ? 8.590   -19.558 -45.449 1.00 27.63  ? 93  THR E CA  1 
ATOM   6435 C  C   . THR E  1 95  ? 9.339   -20.340 -46.484 1.00 28.21  ? 93  THR E C   1 
ATOM   6436 O  O   . THR E  1 95  ? 10.513  -20.687 -46.327 1.00 29.16  ? 93  THR E O   1 
ATOM   6437 C  CB  . THR E  1 95  ? 8.195   -18.211 -46.078 1.00 34.50  ? 93  THR E CB  1 
ATOM   6438 O  OG1 . THR E  1 95  ? 7.356   -18.457 -47.227 1.00 40.00  ? 93  THR E OG1 1 
ATOM   6439 C  CG2 . THR E  1 95  ? 9.432   -17.441 -46.522 1.00 35.27  ? 93  THR E CG2 1 
ATOM   6440 N  N   . LEU E  1 96  ? 8.640   -20.576 -47.576 1.00 28.39  ? 94  LEU E N   1 
ATOM   6441 C  CA  . LEU E  1 96  ? 9.180   -21.359 -48.651 1.00 28.99  ? 94  LEU E CA  1 
ATOM   6442 C  C   . LEU E  1 96  ? 10.070  -20.476 -49.523 1.00 30.53  ? 94  LEU E C   1 
ATOM   6443 O  O   . LEU E  1 96  ? 9.680   -19.381 -49.903 1.00 31.06  ? 94  LEU E O   1 
ATOM   6444 C  CB  . LEU E  1 96  ? 8.008   -21.923 -49.431 1.00 29.46  ? 94  LEU E CB  1 
ATOM   6445 C  CG  . LEU E  1 96  ? 8.287   -23.114 -50.319 1.00 31.56  ? 94  LEU E CG  1 
ATOM   6446 C  CD1 . LEU E  1 96  ? 8.786   -24.302 -49.514 1.00 30.81  ? 94  LEU E CD1 1 
ATOM   6447 C  CD2 . LEU E  1 96  ? 7.003   -23.459 -51.056 1.00 33.45  ? 94  LEU E CD2 1 
ATOM   6448 N  N   . GLY E  1 97  ? 11.285  -20.933 -49.800 1.00 32.02  ? 95  GLY E N   1 
ATOM   6449 C  CA  . GLY E  1 97  ? 12.190  -20.202 -50.677 1.00 32.88  ? 95  GLY E CA  1 
ATOM   6450 C  C   . GLY E  1 97  ? 11.807  -20.334 -52.117 1.00 35.53  ? 95  GLY E C   1 
ATOM   6451 O  O   . GLY E  1 97  ? 11.274  -21.363 -52.532 1.00 35.31  ? 95  GLY E O   1 
ATOM   6452 N  N   . ASN E  1 98  ? 12.091  -19.286 -52.886 1.00 39.47  ? 96  ASN E N   1 
ATOM   6453 C  CA  . ASN E  1 98  ? 11.649  -19.208 -54.268 1.00 43.06  ? 96  ASN E CA  1 
ATOM   6454 C  C   . ASN E  1 98  ? 10.151  -19.482 -54.400 1.00 40.46  ? 96  ASN E C   1 
ATOM   6455 O  O   . ASN E  1 98  ? 9.714   -20.184 -55.309 1.00 41.41  ? 96  ASN E O   1 
ATOM   6456 C  CB  . ASN E  1 98  ? 12.442  -20.179 -55.141 1.00 47.09  ? 96  ASN E CB  1 
ATOM   6457 C  CG  . ASN E  1 98  ? 13.929  -19.901 -55.122 1.00 52.69  ? 96  ASN E CG  1 
ATOM   6458 O  OD1 . ASN E  1 98  ? 14.374  -18.840 -55.566 1.00 58.59  ? 96  ASN E OD1 1 
ATOM   6459 N  ND2 . ASN E  1 98  ? 14.712  -20.859 -54.627 1.00 55.44  ? 96  ASN E ND2 1 
ATOM   6460 N  N   . ILE E  1 99  ? 9.372   -18.926 -53.481 1.00 38.21  ? 97  ILE E N   1 
ATOM   6461 C  CA  . ILE E  1 99  ? 7.936   -19.157 -53.444 1.00 38.08  ? 97  ILE E CA  1 
ATOM   6462 C  C   . ILE E  1 99  ? 7.230   -18.756 -54.737 1.00 40.75  ? 97  ILE E C   1 
ATOM   6463 O  O   . ILE E  1 99  ? 6.236   -19.363 -55.110 1.00 40.80  ? 97  ILE E O   1 
ATOM   6464 C  CB  . ILE E  1 99  ? 7.307   -18.492 -52.200 1.00 36.83  ? 97  ILE E CB  1 
ATOM   6465 C  CG1 . ILE E  1 99  ? 5.802   -18.762 -52.091 1.00 35.18  ? 97  ILE E CG1 1 
ATOM   6466 C  CG2 . ILE E  1 99  ? 7.551   -16.992 -52.177 1.00 37.57  ? 97  ILE E CG2 1 
ATOM   6467 C  CD1 . ILE E  1 99  ? 5.184   -18.181 -50.838 1.00 32.45  ? 97  ILE E CD1 1 
ATOM   6468 N  N   . LYS E  1 100 ? 7.791   -17.801 -55.468 1.00 45.41  ? 98  LYS E N   1 
ATOM   6469 C  CA  . LYS E  1 100 ? 7.197   -17.353 -56.717 1.00 48.05  ? 98  LYS E CA  1 
ATOM   6470 C  C   . LYS E  1 100 ? 7.281   -18.394 -57.841 1.00 49.95  ? 98  LYS E C   1 
ATOM   6471 O  O   . LYS E  1 100 ? 6.548   -18.312 -58.822 1.00 52.40  ? 98  LYS E O   1 
ATOM   6472 C  CB  . LYS E  1 100 ? 7.881   -16.068 -57.145 1.00 53.27  ? 98  LYS E CB  1 
ATOM   6473 C  CG  . LYS E  1 100 ? 7.754   -14.950 -56.126 1.00 53.67  ? 98  LYS E CG  1 
ATOM   6474 C  CD  . LYS E  1 100 ? 6.325   -14.442 -56.018 1.00 53.93  ? 98  LYS E CD  1 
ATOM   6475 C  CE  . LYS E  1 100 ? 6.226   -13.370 -54.952 1.00 55.37  ? 98  LYS E CE  1 
ATOM   6476 N  NZ  . LYS E  1 100 ? 5.182   -12.358 -55.264 1.00 58.79  ? 98  LYS E NZ  1 
ATOM   6477 N  N   . SER E  1 101 ? 8.161   -19.377 -57.691 1.00 47.80  ? 99  SER E N   1 
ATOM   6478 C  CA  . SER E  1 101 ? 8.378   -20.367 -58.728 1.00 50.28  ? 99  SER E CA  1 
ATOM   6479 C  C   . SER E  1 101 ? 7.366   -21.509 -58.665 1.00 49.26  ? 99  SER E C   1 
ATOM   6480 O  O   . SER E  1 101 ? 7.350   -22.366 -59.543 1.00 53.73  ? 99  SER E O   1 
ATOM   6481 C  CB  . SER E  1 101 ? 9.786   -20.954 -58.616 1.00 51.90  ? 99  SER E CB  1 
ATOM   6482 O  OG  . SER E  1 101 ? 9.834   -21.939 -57.589 1.00 51.47  ? 99  SER E OG  1 
ATOM   6483 N  N   . TYR E  1 102 ? 6.546   -21.547 -57.621 1.00 45.58  ? 100 TYR E N   1 
ATOM   6484 C  CA  . TYR E  1 102 ? 5.505   -22.574 -57.520 1.00 44.09  ? 100 TYR E CA  1 
ATOM   6485 C  C   . TYR E  1 102 ? 4.187   -22.000 -58.015 1.00 44.58  ? 100 TYR E C   1 
ATOM   6486 O  O   . TYR E  1 102 ? 3.623   -21.122 -57.373 1.00 42.37  ? 100 TYR E O   1 
ATOM   6487 C  CB  . TYR E  1 102 ? 5.330   -23.046 -56.073 1.00 41.25  ? 100 TYR E CB  1 
ATOM   6488 C  CG  . TYR E  1 102 ? 6.563   -23.661 -55.451 1.00 39.44  ? 100 TYR E CG  1 
ATOM   6489 C  CD1 . TYR E  1 102 ? 7.446   -22.888 -54.719 1.00 38.44  ? 100 TYR E CD1 1 
ATOM   6490 C  CD2 . TYR E  1 102 ? 6.830   -25.018 -55.584 1.00 38.80  ? 100 TYR E CD2 1 
ATOM   6491 C  CE1 . TYR E  1 102 ? 8.567   -23.445 -54.140 1.00 37.68  ? 100 TYR E CE1 1 
ATOM   6492 C  CE2 . TYR E  1 102 ? 7.952   -25.583 -55.018 1.00 37.93  ? 100 TYR E CE2 1 
ATOM   6493 C  CZ  . TYR E  1 102 ? 8.815   -24.794 -54.288 1.00 38.28  ? 100 TYR E CZ  1 
ATOM   6494 O  OH  . TYR E  1 102 ? 9.940   -25.359 -53.715 1.00 39.44  ? 100 TYR E OH  1 
ATOM   6495 N  N   . PRO E  1 103 ? 3.696   -22.482 -59.171 1.00 47.62  ? 101 PRO E N   1 
ATOM   6496 C  CA  . PRO E  1 103 ? 2.551   -21.805 -59.785 1.00 49.00  ? 101 PRO E CA  1 
ATOM   6497 C  C   . PRO E  1 103 ? 1.310   -21.940 -58.917 1.00 45.06  ? 101 PRO E C   1 
ATOM   6498 O  O   . PRO E  1 103 ? 1.075   -22.997 -58.347 1.00 43.54  ? 101 PRO E O   1 
ATOM   6499 C  CB  . PRO E  1 103 ? 2.373   -22.538 -61.128 1.00 52.55  ? 101 PRO E CB  1 
ATOM   6500 C  CG  . PRO E  1 103 ? 3.657   -23.269 -61.362 1.00 52.65  ? 101 PRO E CG  1 
ATOM   6501 C  CD  . PRO E  1 103 ? 4.184   -23.601 -59.996 1.00 49.17  ? 101 PRO E CD  1 
ATOM   6502 N  N   . GLY E  1 104 ? 0.548   -20.861 -58.786 1.00 44.55  ? 102 GLY E N   1 
ATOM   6503 C  CA  . GLY E  1 104 ? -0.676  -20.878 -57.984 1.00 42.41  ? 102 GLY E CA  1 
ATOM   6504 C  C   . GLY E  1 104 ? -0.472  -20.552 -56.515 1.00 38.72  ? 102 GLY E C   1 
ATOM   6505 O  O   . GLY E  1 104 ? -1.433  -20.238 -55.802 1.00 38.38  ? 102 GLY E O   1 
ATOM   6506 N  N   . LEU E  1 105 ? 0.775   -20.595 -56.059 1.00 36.36  ? 103 LEU E N   1 
ATOM   6507 C  CA  . LEU E  1 105 ? 1.065   -20.490 -54.635 1.00 33.24  ? 103 LEU E CA  1 
ATOM   6508 C  C   . LEU E  1 105 ? 1.271   -19.037 -54.209 1.00 32.41  ? 103 LEU E C   1 
ATOM   6509 O  O   . LEU E  1 105 ? 2.104   -18.333 -54.761 1.00 33.58  ? 103 LEU E O   1 
ATOM   6510 C  CB  . LEU E  1 105 ? 2.313   -21.301 -54.309 1.00 32.36  ? 103 LEU E CB  1 
ATOM   6511 C  CG  . LEU E  1 105 ? 2.688   -21.362 -52.836 1.00 30.60  ? 103 LEU E CG  1 
ATOM   6512 C  CD1 . LEU E  1 105 ? 1.547   -21.953 -52.030 1.00 29.50  ? 103 LEU E CD1 1 
ATOM   6513 C  CD2 . LEU E  1 105 ? 3.958   -22.177 -52.657 1.00 30.84  ? 103 LEU E CD2 1 
ATOM   6514 N  N   . THR E  1 106 ? 0.464   -18.579 -53.262 1.00 30.86  ? 104 THR E N   1 
ATOM   6515 C  CA  . THR E  1 106 ? 0.400   -17.171 -52.912 1.00 30.77  ? 104 THR E CA  1 
ATOM   6516 C  C   . THR E  1 106 ? 1.058   -16.941 -51.560 1.00 27.93  ? 104 THR E C   1 
ATOM   6517 O  O   . THR E  1 106 ? 1.766   -15.963 -51.365 1.00 27.53  ? 104 THR E O   1 
ATOM   6518 C  CB  . THR E  1 106 ? -1.077  -16.714 -52.894 1.00 31.48  ? 104 THR E CB  1 
ATOM   6519 O  OG1 . THR E  1 106 ? -1.463  -16.357 -54.225 1.00 35.19  ? 104 THR E OG1 1 
ATOM   6520 C  CG2 . THR E  1 106 ? -1.321  -15.513 -51.964 1.00 31.71  ? 104 THR E CG2 1 
ATOM   6521 N  N   . SER E  1 107 ? 0.861   -17.875 -50.642 1.00 26.04  ? 105 SER E N   1 
ATOM   6522 C  CA  . SER E  1 107 ? 1.528   -17.800 -49.362 1.00 24.67  ? 105 SER E CA  1 
ATOM   6523 C  C   . SER E  1 107 ? 1.776   -19.158 -48.726 1.00 22.96  ? 105 SER E C   1 
ATOM   6524 O  O   . SER E  1 107 ? 1.103   -20.133 -49.013 1.00 22.77  ? 105 SER E O   1 
ATOM   6525 C  CB  . SER E  1 107 ? 0.760   -16.880 -48.414 1.00 24.27  ? 105 SER E CB  1 
ATOM   6526 O  OG  . SER E  1 107 ? -0.487  -17.424 -48.075 1.00 24.42  ? 105 SER E OG  1 
ATOM   6527 N  N   . TYR E  1 108 ? 2.818   -19.226 -47.916 1.00 22.95  ? 106 TYR E N   1 
ATOM   6528 C  CA  . TYR E  1 108 ? 3.264   -20.483 -47.321 1.00 22.53  ? 106 TYR E CA  1 
ATOM   6529 C  C   . TYR E  1 108 ? 3.923   -20.118 -46.021 1.00 21.14  ? 106 TYR E C   1 
ATOM   6530 O  O   . TYR E  1 108 ? 4.829   -19.302 -45.992 1.00 23.54  ? 106 TYR E O   1 
ATOM   6531 C  CB  . TYR E  1 108 ? 4.250   -21.237 -48.231 1.00 23.45  ? 106 TYR E CB  1 
ATOM   6532 C  CG  . TYR E  1 108 ? 4.377   -22.694 -47.905 1.00 23.65  ? 106 TYR E CG  1 
ATOM   6533 C  CD1 . TYR E  1 108 ? 5.303   -23.137 -46.976 1.00 24.19  ? 106 TYR E CD1 1 
ATOM   6534 C  CD2 . TYR E  1 108 ? 3.594   -23.646 -48.554 1.00 24.88  ? 106 TYR E CD2 1 
ATOM   6535 C  CE1 . TYR E  1 108 ? 5.430   -24.494 -46.683 1.00 25.44  ? 106 TYR E CE1 1 
ATOM   6536 C  CE2 . TYR E  1 108 ? 3.715   -24.995 -48.271 1.00 25.23  ? 106 TYR E CE2 1 
ATOM   6537 C  CZ  . TYR E  1 108 ? 4.634   -25.407 -47.338 1.00 24.88  ? 106 TYR E CZ  1 
ATOM   6538 O  OH  . TYR E  1 108 ? 4.755   -26.732 -47.046 1.00 30.63  ? 106 TYR E OH  1 
ATOM   6539 N  N   . LEU E  1 109 ? 3.435   -20.691 -44.941 1.00 20.41  ? 107 LEU E N   1 
ATOM   6540 C  CA  . LEU E  1 109 ? 4.004   -20.439 -43.638 1.00 20.82  ? 107 LEU E CA  1 
ATOM   6541 C  C   . LEU E  1 109 ? 4.247   -21.742 -42.889 1.00 18.81  ? 107 LEU E C   1 
ATOM   6542 O  O   . LEU E  1 109 ? 3.396   -22.624 -42.861 1.00 18.76  ? 107 LEU E O   1 
ATOM   6543 C  CB  . LEU E  1 109 ? 3.042   -19.566 -42.834 1.00 23.14  ? 107 LEU E CB  1 
ATOM   6544 C  CG  . LEU E  1 109 ? 3.492   -19.284 -41.400 1.00 23.55  ? 107 LEU E CG  1 
ATOM   6545 C  CD1 . LEU E  1 109 ? 4.671   -18.324 -41.395 1.00 25.15  ? 107 LEU E CD1 1 
ATOM   6546 C  CD2 . LEU E  1 109 ? 2.333   -18.725 -40.600 1.00 24.72  ? 107 LEU E CD2 1 
ATOM   6547 N  N   . VAL E  1 110 ? 5.420   -21.837 -42.274 1.00 18.14  ? 108 VAL E N   1 
ATOM   6548 C  CA  . VAL E  1 110 ? 5.780   -22.951 -41.420 1.00 16.53  ? 108 VAL E CA  1 
ATOM   6549 C  C   . VAL E  1 110 ? 6.006   -22.395 -40.025 1.00 16.20  ? 108 VAL E C   1 
ATOM   6550 O  O   . VAL E  1 110 ? 6.738   -21.420 -39.850 1.00 14.85  ? 108 VAL E O   1 
ATOM   6551 C  CB  . VAL E  1 110 ? 7.092   -23.617 -41.886 1.00 17.42  ? 108 VAL E CB  1 
ATOM   6552 C  CG1 . VAL E  1 110 ? 7.433   -24.798 -40.996 1.00 17.35  ? 108 VAL E CG1 1 
ATOM   6553 C  CG2 . VAL E  1 110 ? 6.987   -24.058 -43.333 1.00 18.86  ? 108 VAL E CG2 1 
ATOM   6554 N  N   . ARG E  1 111 ? 5.413   -23.039 -39.028 1.00 16.20  ? 109 ARG E N   1 
ATOM   6555 C  CA  . ARG E  1 111 ? 5.688   -22.686 -37.644 1.00 16.06  ? 109 ARG E CA  1 
ATOM   6556 C  C   . ARG E  1 111 ? 5.901   -23.917 -36.794 1.00 14.34  ? 109 ARG E C   1 
ATOM   6557 O  O   . ARG E  1 111 ? 5.023   -24.767 -36.698 1.00 14.50  ? 109 ARG E O   1 
ATOM   6558 C  CB  . ARG E  1 111 ? 4.536   -21.880 -37.067 1.00 16.26  ? 109 ARG E CB  1 
ATOM   6559 C  CG  . ARG E  1 111 ? 4.708   -21.591 -35.592 1.00 16.61  ? 109 ARG E CG  1 
ATOM   6560 C  CD  . ARG E  1 111 ? 3.556   -20.757 -35.047 1.00 17.30  ? 109 ARG E CD  1 
ATOM   6561 N  NE  . ARG E  1 111 ? 3.617   -19.377 -35.502 1.00 18.04  ? 109 ARG E NE  1 
ATOM   6562 C  CZ  . ARG E  1 111 ? 2.694   -18.458 -35.241 1.00 18.81  ? 109 ARG E CZ  1 
ATOM   6563 N  NH1 . ARG E  1 111 ? 2.829   -17.234 -35.734 1.00 19.02  ? 109 ARG E NH1 1 
ATOM   6564 N  NH2 . ARG E  1 111 ? 1.623   -18.763 -34.516 1.00 19.45  ? 109 ARG E NH2 1 
ATOM   6565 N  N   . VAL E  1 112 ? 7.077   -24.020 -36.189 1.00 14.29  ? 110 VAL E N   1 
ATOM   6566 C  CA  . VAL E  1 112 ? 7.353   -25.114 -35.271 1.00 14.12  ? 110 VAL E CA  1 
ATOM   6567 C  C   . VAL E  1 112 ? 6.645   -24.856 -33.951 1.00 14.13  ? 110 VAL E C   1 
ATOM   6568 O  O   . VAL E  1 112 ? 6.926   -23.886 -33.269 1.00 15.83  ? 110 VAL E O   1 
ATOM   6569 C  CB  . VAL E  1 112 ? 8.858   -25.282 -35.018 1.00 14.78  ? 110 VAL E CB  1 
ATOM   6570 C  CG1 . VAL E  1 112 ? 9.098   -26.395 -34.013 1.00 14.52  ? 110 VAL E CG1 1 
ATOM   6571 C  CG2 . VAL E  1 112 ? 9.596   -25.560 -36.323 1.00 14.91  ? 110 VAL E CG2 1 
ATOM   6572 N  N   . VAL E  1 113 ? 5.695   -25.718 -33.623 1.00 14.98  ? 111 VAL E N   1 
ATOM   6573 C  CA  . VAL E  1 113 ? 4.816   -25.510 -32.485 1.00 15.64  ? 111 VAL E CA  1 
ATOM   6574 C  C   . VAL E  1 113 ? 5.465   -25.957 -31.190 1.00 16.78  ? 111 VAL E C   1 
ATOM   6575 O  O   . VAL E  1 113 ? 5.445   -25.236 -30.191 1.00 16.97  ? 111 VAL E O   1 
ATOM   6576 C  CB  . VAL E  1 113 ? 3.502   -26.288 -32.665 1.00 15.20  ? 111 VAL E CB  1 
ATOM   6577 C  CG1 . VAL E  1 113 ? 2.634   -26.155 -31.421 1.00 15.30  ? 111 VAL E CG1 1 
ATOM   6578 C  CG2 . VAL E  1 113 ? 2.749   -25.786 -33.895 1.00 15.13  ? 111 VAL E CG2 1 
ATOM   6579 N  N   . SER E  1 114 ? 6.018   -27.162 -31.190 1.00 19.05  ? 112 SER E N   1 
ATOM   6580 C  CA  . SER E  1 114 ? 6.781   -27.630 -30.033 1.00 21.53  ? 112 SER E CA  1 
ATOM   6581 C  C   . SER E  1 114 ? 7.659   -28.805 -30.388 1.00 20.75  ? 112 SER E C   1 
ATOM   6582 O  O   . SER E  1 114 ? 7.355   -29.582 -31.291 1.00 23.07  ? 112 SER E O   1 
ATOM   6583 C  CB  . SER E  1 114 ? 5.849   -28.049 -28.907 1.00 21.96  ? 112 SER E CB  1 
ATOM   6584 O  OG  . SER E  1 114 ? 5.238   -29.270 -29.239 1.00 26.30  ? 112 SER E OG  1 
ATOM   6585 N  N   . THR E  1 115 ? 8.776   -28.909 -29.694 1.00 20.84  ? 113 THR E N   1 
ATOM   6586 C  CA  . THR E  1 115 ? 9.702   -30.004 -29.916 1.00 20.57  ? 113 THR E CA  1 
ATOM   6587 C  C   . THR E  1 115 ? 10.631  -30.139 -28.717 1.00 21.13  ? 113 THR E C   1 
ATOM   6588 O  O   . THR E  1 115 ? 10.856  -29.175 -27.989 1.00 20.40  ? 113 THR E O   1 
ATOM   6589 C  CB  . THR E  1 115 ? 10.529  -29.791 -31.191 1.00 19.10  ? 113 THR E CB  1 
ATOM   6590 O  OG1 . THR E  1 115 ? 11.359  -30.933 -31.422 1.00 20.06  ? 113 THR E OG1 1 
ATOM   6591 C  CG2 . THR E  1 115 ? 11.397  -28.546 -31.082 1.00 19.16  ? 113 THR E CG2 1 
ATOM   6592 N  N   . ASN E  1 116 ? 11.157  -31.340 -28.510 1.00 22.54  ? 114 ASN E N   1 
ATOM   6593 C  CA  . ASN E  1 116 ? 12.263  -31.528 -27.591 1.00 24.51  ? 114 ASN E CA  1 
ATOM   6594 C  C   . ASN E  1 116 ? 13.507  -31.982 -28.334 1.00 24.62  ? 114 ASN E C   1 
ATOM   6595 O  O   . ASN E  1 116 ? 14.500  -32.363 -27.722 1.00 23.95  ? 114 ASN E O   1 
ATOM   6596 C  CB  . ASN E  1 116 ? 11.877  -32.510 -26.485 1.00 26.50  ? 114 ASN E CB  1 
ATOM   6597 C  CG  . ASN E  1 116 ? 11.816  -33.942 -26.969 1.00 28.63  ? 114 ASN E CG  1 
ATOM   6598 O  OD1 . ASN E  1 116 ? 11.899  -34.222 -28.173 1.00 29.47  ? 114 ASN E OD1 1 
ATOM   6599 N  ND2 . ASN E  1 116 ? 11.682  -34.866 -26.028 1.00 28.86  ? 114 ASN E ND2 1 
ATOM   6600 N  N   . TYR E  1 117 ? 13.439  -31.918 -29.665 1.00 24.61  ? 115 TYR E N   1 
ATOM   6601 C  CA  . TYR E  1 117 ? 14.615  -32.032 -30.542 1.00 23.23  ? 115 TYR E CA  1 
ATOM   6602 C  C   . TYR E  1 117 ? 15.118  -33.457 -30.739 1.00 23.68  ? 115 TYR E C   1 
ATOM   6603 O  O   . TYR E  1 117 ? 15.502  -33.830 -31.855 1.00 21.73  ? 115 TYR E O   1 
ATOM   6604 C  CB  . TYR E  1 117 ? 15.744  -31.116 -30.072 1.00 23.44  ? 115 TYR E CB  1 
ATOM   6605 C  CG  . TYR E  1 117 ? 15.348  -29.657 -30.060 1.00 22.42  ? 115 TYR E CG  1 
ATOM   6606 C  CD1 . TYR E  1 117 ? 15.229  -28.939 -31.243 1.00 20.77  ? 115 TYR E CD1 1 
ATOM   6607 C  CD2 . TYR E  1 117 ? 15.062  -29.007 -28.868 1.00 22.88  ? 115 TYR E CD2 1 
ATOM   6608 C  CE1 . TYR E  1 117 ? 14.861  -27.609 -31.243 1.00 20.87  ? 115 TYR E CE1 1 
ATOM   6609 C  CE2 . TYR E  1 117 ? 14.688  -27.673 -28.856 1.00 24.27  ? 115 TYR E CE2 1 
ATOM   6610 C  CZ  . TYR E  1 117 ? 14.583  -26.980 -30.050 1.00 22.12  ? 115 TYR E CZ  1 
ATOM   6611 O  OH  . TYR E  1 117 ? 14.204  -25.661 -30.041 1.00 20.28  ? 115 TYR E OH  1 
ATOM   6612 N  N   . ASN E  1 118 ? 15.127  -34.257 -29.677 1.00 26.07  ? 116 ASN E N   1 
ATOM   6613 C  CA  . ASN E  1 118 ? 15.729  -35.595 -29.772 1.00 30.08  ? 116 ASN E CA  1 
ATOM   6614 C  C   . ASN E  1 118 ? 14.707  -36.722 -29.805 1.00 29.93  ? 116 ASN E C   1 
ATOM   6615 O  O   . ASN E  1 118 ? 15.075  -37.889 -29.805 1.00 30.39  ? 116 ASN E O   1 
ATOM   6616 C  CB  . ASN E  1 118 ? 16.782  -35.831 -28.678 1.00 32.09  ? 116 ASN E CB  1 
ATOM   6617 C  CG  . ASN E  1 118 ? 16.197  -35.879 -27.281 1.00 35.33  ? 116 ASN E CG  1 
ATOM   6618 O  OD1 . ASN E  1 118 ? 15.006  -35.668 -27.069 1.00 37.53  ? 116 ASN E OD1 1 
ATOM   6619 N  ND2 . ASN E  1 118 ? 17.047  -36.183 -26.314 1.00 40.58  ? 116 ASN E ND2 1 
ATOM   6620 N  N   . GLN E  1 119 ? 13.425  -36.364 -29.850 1.00 29.48  ? 117 GLN E N   1 
ATOM   6621 C  CA  . GLN E  1 119 ? 12.354  -37.342 -29.807 1.00 28.57  ? 117 GLN E CA  1 
ATOM   6622 C  C   . GLN E  1 119 ? 11.183  -36.947 -30.707 1.00 25.46  ? 117 GLN E C   1 
ATOM   6623 O  O   . GLN E  1 119 ? 10.848  -37.667 -31.647 1.00 23.54  ? 117 GLN E O   1 
ATOM   6624 C  CB  . GLN E  1 119 ? 11.857  -37.400 -28.365 1.00 34.44  ? 117 GLN E CB  1 
ATOM   6625 C  CG  . GLN E  1 119 ? 11.201  -38.692 -27.926 1.00 38.79  ? 117 GLN E CG  1 
ATOM   6626 C  CD  . GLN E  1 119 ? 10.346  -38.481 -26.683 1.00 47.13  ? 117 GLN E CD  1 
ATOM   6627 O  OE1 . GLN E  1 119 ? 10.608  -37.573 -25.881 1.00 45.88  ? 117 GLN E OE1 1 
ATOM   6628 N  NE2 . GLN E  1 119 ? 9.312   -39.301 -26.524 1.00 43.92  ? 117 GLN E NE2 1 
ATOM   6629 N  N   . HIS E  1 120 ? 10.560  -35.803 -30.416 1.00 23.37  ? 118 HIS E N   1 
ATOM   6630 C  CA  . HIS E  1 120 ? 9.306   -35.426 -31.065 1.00 21.01  ? 118 HIS E CA  1 
ATOM   6631 C  C   . HIS E  1 120 ? 9.248   -33.969 -31.486 1.00 19.84  ? 118 HIS E C   1 
ATOM   6632 O  O   . HIS E  1 120 ? 9.992   -33.143 -30.965 1.00 18.50  ? 118 HIS E O   1 
ATOM   6633 C  CB  . HIS E  1 120 ? 8.108   -35.712 -30.161 1.00 20.02  ? 118 HIS E CB  1 
ATOM   6634 C  CG  . HIS E  1 120 ? 8.160   -35.026 -28.826 1.00 21.58  ? 118 HIS E CG  1 
ATOM   6635 N  ND1 . HIS E  1 120 ? 7.714   -33.734 -28.624 1.00 21.82  ? 118 HIS E ND1 1 
ATOM   6636 C  CD2 . HIS E  1 120 ? 8.569   -35.473 -27.615 1.00 22.20  ? 118 HIS E CD2 1 
ATOM   6637 C  CE1 . HIS E  1 120 ? 7.868   -33.407 -27.351 1.00 20.98  ? 118 HIS E CE1 1 
ATOM   6638 N  NE2 . HIS E  1 120 ? 8.381   -34.446 -26.717 1.00 22.73  ? 118 HIS E NE2 1 
ATOM   6639 N  N   . ALA E  1 121 ? 8.348   -33.675 -32.429 1.00 16.90  ? 119 ALA E N   1 
ATOM   6640 C  CA  . ALA E  1 121 ? 8.036   -32.315 -32.812 1.00 17.88  ? 119 ALA E CA  1 
ATOM   6641 C  C   . ALA E  1 121 ? 6.640   -32.228 -33.391 1.00 19.00  ? 119 ALA E C   1 
ATOM   6642 O  O   . ALA E  1 121 ? 6.148   -33.185 -33.983 1.00 21.94  ? 119 ALA E O   1 
ATOM   6643 C  CB  . ALA E  1 121 ? 9.052   -31.806 -33.814 1.00 19.94  ? 119 ALA E CB  1 
ATOM   6644 N  N   . MET E  1 122 ? 5.999   -31.077 -33.221 1.00 19.45  ? 120 MET E N   1 
ATOM   6645 C  CA  . MET E  1 122 ? 4.808   -30.742 -33.996 1.00 19.24  ? 120 MET E CA  1 
ATOM   6646 C  C   . MET E  1 122 ? 5.073   -29.491 -34.788 1.00 17.20  ? 120 MET E C   1 
ATOM   6647 O  O   . MET E  1 122 ? 5.570   -28.507 -34.245 1.00 16.16  ? 120 MET E O   1 
ATOM   6648 C  CB  . MET E  1 122 ? 3.604   -30.483 -33.098 1.00 19.72  ? 120 MET E CB  1 
ATOM   6649 C  CG  . MET E  1 122 ? 3.078   -31.706 -32.390 1.00 23.04  ? 120 MET E CG  1 
ATOM   6650 S  SD  . MET E  1 122 ? 1.400   -31.426 -31.813 1.00 28.29  ? 120 MET E SD  1 
ATOM   6651 C  CE  . MET E  1 122 ? 1.614   -30.116 -30.622 1.00 32.91  ? 120 MET E CE  1 
ATOM   6652 N  N   . VAL E  1 123 ? 4.695   -29.521 -36.060 1.00 17.18  ? 121 VAL E N   1 
ATOM   6653 C  CA  . VAL E  1 123 ? 4.909   -28.388 -36.938 1.00 17.69  ? 121 VAL E CA  1 
ATOM   6654 C  C   . VAL E  1 123 ? 3.631   -28.032 -37.673 1.00 17.17  ? 121 VAL E C   1 
ATOM   6655 O  O   . VAL E  1 123 ? 2.935   -28.907 -38.188 1.00 16.75  ? 121 VAL E O   1 
ATOM   6656 C  CB  . VAL E  1 123 ? 5.999   -28.695 -37.969 1.00 19.65  ? 121 VAL E CB  1 
ATOM   6657 C  CG1 . VAL E  1 123 ? 6.283   -27.458 -38.808 1.00 21.00  ? 121 VAL E CG1 1 
ATOM   6658 C  CG2 . VAL E  1 123 ? 7.258   -29.184 -37.276 1.00 19.11  ? 121 VAL E CG2 1 
ATOM   6659 N  N   . PHE E  1 124 ? 3.332   -26.737 -37.708 1.00 17.48  ? 122 PHE E N   1 
ATOM   6660 C  CA  . PHE E  1 124 ? 2.116   -26.225 -38.342 1.00 16.16  ? 122 PHE E CA  1 
ATOM   6661 C  C   . PHE E  1 124 ? 2.493   -25.642 -39.694 1.00 16.06  ? 122 PHE E C   1 
ATOM   6662 O  O   . PHE E  1 124 ? 3.475   -24.916 -39.815 1.00 14.22  ? 122 PHE E O   1 
ATOM   6663 C  CB  . PHE E  1 124 ? 1.473   -25.147 -37.451 1.00 15.59  ? 122 PHE E CB  1 
ATOM   6664 C  CG  . PHE E  1 124 ? 0.294   -24.438 -38.077 1.00 15.77  ? 122 PHE E CG  1 
ATOM   6665 C  CD1 . PHE E  1 124 ? 0.476   -23.256 -38.761 1.00 15.46  ? 122 PHE E CD1 1 
ATOM   6666 C  CD2 . PHE E  1 124 ? -0.995  -24.946 -37.959 1.00 15.10  ? 122 PHE E CD2 1 
ATOM   6667 C  CE1 . PHE E  1 124 ? -0.600  -22.596 -39.319 1.00 16.41  ? 122 PHE E CE1 1 
ATOM   6668 C  CE2 . PHE E  1 124 ? -2.076  -24.288 -38.521 1.00 15.96  ? 122 PHE E CE2 1 
ATOM   6669 C  CZ  . PHE E  1 124 ? -1.878  -23.112 -39.202 1.00 16.12  ? 122 PHE E CZ  1 
ATOM   6670 N  N   . PHE E  1 125 ? 1.705   -25.974 -40.707 1.00 17.37  ? 123 PHE E N   1 
ATOM   6671 C  CA  . PHE E  1 125 ? 1.905   -25.439 -42.045 1.00 18.05  ? 123 PHE E CA  1 
ATOM   6672 C  C   . PHE E  1 125 ? 0.606   -24.794 -42.515 1.00 18.57  ? 123 PHE E C   1 
ATOM   6673 O  O   . PHE E  1 125 ? -0.471  -25.360 -42.364 1.00 17.61  ? 123 PHE E O   1 
ATOM   6674 C  CB  . PHE E  1 125 ? 2.264   -26.563 -43.014 1.00 19.14  ? 123 PHE E CB  1 
ATOM   6675 C  CG  . PHE E  1 125 ? 3.495   -27.332 -42.640 1.00 18.48  ? 123 PHE E CG  1 
ATOM   6676 C  CD1 . PHE E  1 125 ? 4.677   -27.115 -43.305 1.00 19.37  ? 123 PHE E CD1 1 
ATOM   6677 C  CD2 . PHE E  1 125 ? 3.450   -28.311 -41.660 1.00 18.61  ? 123 PHE E CD2 1 
ATOM   6678 C  CE1 . PHE E  1 125 ? 5.809   -27.835 -42.979 1.00 20.12  ? 123 PHE E CE1 1 
ATOM   6679 C  CE2 . PHE E  1 125 ? 4.578   -29.036 -41.325 1.00 18.69  ? 123 PHE E CE2 1 
ATOM   6680 C  CZ  . PHE E  1 125 ? 5.761   -28.800 -41.990 1.00 19.39  ? 123 PHE E CZ  1 
ATOM   6681 N  N   . LYS E  1 126 ? 0.715   -23.630 -43.130 1.00 19.87  ? 124 LYS E N   1 
ATOM   6682 C  CA  . LYS E  1 126 ? -0.437  -22.995 -43.751 1.00 22.63  ? 124 LYS E CA  1 
ATOM   6683 C  C   . LYS E  1 126 ? -0.042  -22.468 -45.114 1.00 23.26  ? 124 LYS E C   1 
ATOM   6684 O  O   . LYS E  1 126 ? 1.015   -21.865 -45.272 1.00 21.61  ? 124 LYS E O   1 
ATOM   6685 C  CB  . LYS E  1 126 ? -0.951  -21.846 -42.891 1.00 25.63  ? 124 LYS E CB  1 
ATOM   6686 C  CG  . LYS E  1 126 ? -2.099  -21.069 -43.525 1.00 32.23  ? 124 LYS E CG  1 
ATOM   6687 C  CD  . LYS E  1 126 ? -2.819  -20.176 -42.521 1.00 37.73  ? 124 LYS E CD  1 
ATOM   6688 C  CE  . LYS E  1 126 ? -2.192  -18.792 -42.457 1.00 41.46  ? 124 LYS E CE  1 
ATOM   6689 N  NZ  . LYS E  1 126 ? -2.395  -18.029 -43.712 1.00 46.06  ? 124 LYS E NZ  1 
ATOM   6690 N  N   . LYS E  1 127 ? -0.894  -22.700 -46.103 1.00 23.01  ? 125 LYS E N   1 
ATOM   6691 C  CA  . LYS E  1 127 ? -0.594  -22.280 -47.441 1.00 23.95  ? 125 LYS E CA  1 
ATOM   6692 C  C   . LYS E  1 127 ? -1.860  -21.803 -48.123 1.00 23.62  ? 125 LYS E C   1 
ATOM   6693 O  O   . LYS E  1 127 ? -2.945  -22.291 -47.845 1.00 22.72  ? 125 LYS E O   1 
ATOM   6694 C  CB  . LYS E  1 127 ? 0.110   -23.416 -48.188 1.00 26.52  ? 125 LYS E CB  1 
ATOM   6695 C  CG  . LYS E  1 127 ? -0.693  -24.156 -49.234 1.00 30.18  ? 125 LYS E CG  1 
ATOM   6696 C  CD  . LYS E  1 127 ? 0.227   -25.084 -50.010 1.00 33.69  ? 125 LYS E CD  1 
ATOM   6697 C  CE  . LYS E  1 127 ? -0.396  -25.577 -51.307 1.00 39.64  ? 125 LYS E CE  1 
ATOM   6698 N  NZ  . LYS E  1 127 ? 0.607   -26.269 -52.176 1.00 43.17  ? 125 LYS E NZ  1 
ATOM   6699 N  N   . VAL E  1 128 ? -1.720  -20.790 -48.962 1.00 24.36  ? 126 VAL E N   1 
ATOM   6700 C  CA  . VAL E  1 128 ? -2.814  -20.333 -49.792 1.00 26.39  ? 126 VAL E CA  1 
ATOM   6701 C  C   . VAL E  1 128 ? -2.471  -20.585 -51.249 1.00 29.50  ? 126 VAL E C   1 
ATOM   6702 O  O   . VAL E  1 128 ? -1.433  -20.159 -51.749 1.00 28.61  ? 126 VAL E O   1 
ATOM   6703 C  CB  . VAL E  1 128 ? -3.094  -18.839 -49.583 1.00 26.37  ? 126 VAL E CB  1 
ATOM   6704 C  CG1 . VAL E  1 128 ? -4.224  -18.376 -50.483 1.00 27.86  ? 126 VAL E CG1 1 
ATOM   6705 C  CG2 . VAL E  1 128 ? -3.434  -18.565 -48.129 1.00 24.52  ? 126 VAL E CG2 1 
ATOM   6706 N  N   . SER E  1 129 ? -3.338  -21.323 -51.920 1.00 34.75  ? 127 SER E N   1 
ATOM   6707 C  CA  . SER E  1 129 ? -3.094  -21.726 -53.293 1.00 42.34  ? 127 SER E CA  1 
ATOM   6708 C  C   . SER E  1 129 ? -4.418  -21.630 -54.038 1.00 45.74  ? 127 SER E C   1 
ATOM   6709 O  O   . SER E  1 129 ? -5.427  -22.173 -53.591 1.00 45.33  ? 127 SER E O   1 
ATOM   6710 C  CB  . SER E  1 129 ? -2.533  -23.154 -53.338 1.00 43.57  ? 127 SER E CB  1 
ATOM   6711 O  OG  . SER E  1 129 ? -2.487  -23.623 -54.672 1.00 53.79  ? 127 SER E OG  1 
ATOM   6712 N  N   . GLN E  1 130 ? -4.413  -20.921 -55.161 1.00 51.41  ? 128 GLN E N   1 
ATOM   6713 C  CA  . GLN E  1 130 ? -5.655  -20.595 -55.871 1.00 53.44  ? 128 GLN E CA  1 
ATOM   6714 C  C   . GLN E  1 130 ? -6.687  -19.978 -54.931 1.00 51.03  ? 128 GLN E C   1 
ATOM   6715 O  O   . GLN E  1 130 ? -7.873  -20.266 -55.020 1.00 52.97  ? 128 GLN E O   1 
ATOM   6716 C  CB  . GLN E  1 130 ? -6.242  -21.859 -56.517 1.00 57.78  ? 128 GLN E CB  1 
ATOM   6717 C  CG  . GLN E  1 130 ? -5.731  -22.150 -57.922 1.00 63.79  ? 128 GLN E CG  1 
ATOM   6718 C  CD  . GLN E  1 130 ? -4.575  -23.138 -57.943 1.00 67.66  ? 128 GLN E CD  1 
ATOM   6719 O  OE1 . GLN E  1 130 ? -4.217  -23.726 -56.917 1.00 66.69  ? 128 GLN E OE1 1 
ATOM   6720 N  NE2 . GLN E  1 130 ? -3.973  -23.315 -59.114 1.00 70.40  ? 128 GLN E NE2 1 
ATOM   6721 N  N   . ASN E  1 131 ? -6.219  -19.153 -54.008 1.00 48.91  ? 129 ASN E N   1 
ATOM   6722 C  CA  . ASN E  1 131 ? -7.091  -18.475 -53.047 1.00 47.50  ? 129 ASN E CA  1 
ATOM   6723 C  C   . ASN E  1 131 ? -7.719  -19.393 -51.992 1.00 46.61  ? 129 ASN E C   1 
ATOM   6724 O  O   . ASN E  1 131 ? -8.486  -18.940 -51.145 1.00 44.62  ? 129 ASN E O   1 
ATOM   6725 C  CB  . ASN E  1 131 ? -8.192  -17.714 -53.772 1.00 52.24  ? 129 ASN E CB  1 
ATOM   6726 C  CG  . ASN E  1 131 ? -7.648  -16.618 -54.666 1.00 54.97  ? 129 ASN E CG  1 
ATOM   6727 O  OD1 . ASN E  1 131 ? -7.797  -16.666 -55.889 1.00 55.37  ? 129 ASN E OD1 1 
ATOM   6728 N  ND2 . ASN E  1 131 ? -6.998  -15.629 -54.058 1.00 51.56  ? 129 ASN E ND2 1 
ATOM   6729 N  N   . ARG E  1 132 ? -7.392  -20.678 -52.038 1.00 44.17  ? 130 ARG E N   1 
ATOM   6730 C  CA  . ARG E  1 132 ? -7.883  -21.620 -51.041 1.00 41.55  ? 130 ARG E CA  1 
ATOM   6731 C  C   . ARG E  1 132 ? -6.853  -21.795 -49.944 1.00 38.63  ? 130 ARG E C   1 
ATOM   6732 O  O   . ARG E  1 132 ? -5.651  -21.930 -50.207 1.00 35.28  ? 130 ARG E O   1 
ATOM   6733 C  CB  . ARG E  1 132 ? -8.205  -22.973 -51.683 1.00 43.72  ? 130 ARG E CB  1 
ATOM   6734 C  CG  . ARG E  1 132 ? -9.316  -22.878 -52.713 1.00 48.63  ? 130 ARG E CG  1 
ATOM   6735 C  CD  . ARG E  1 132 ? -9.532  -24.183 -53.459 1.00 53.24  ? 130 ARG E CD  1 
ATOM   6736 N  NE  . ARG E  1 132 ? -8.378  -24.589 -54.258 1.00 59.51  ? 130 ARG E NE  1 
ATOM   6737 C  CZ  . ARG E  1 132 ? -8.470  -25.200 -55.438 1.00 65.04  ? 130 ARG E CZ  1 
ATOM   6738 N  NH1 . ARG E  1 132 ? -9.659  -25.465 -55.970 1.00 66.12  ? 130 ARG E NH1 1 
ATOM   6739 N  NH2 . ARG E  1 132 ? -7.367  -25.537 -56.092 1.00 67.62  ? 130 ARG E NH2 1 
ATOM   6740 N  N   . GLU E  1 133 ? -7.336  -21.825 -48.710 1.00 34.82  ? 131 GLU E N   1 
ATOM   6741 C  CA  . GLU E  1 133 ? -6.462  -21.800 -47.576 1.00 31.57  ? 131 GLU E CA  1 
ATOM   6742 C  C   . GLU E  1 133 ? -6.353  -23.201 -46.958 1.00 28.12  ? 131 GLU E C   1 
ATOM   6743 O  O   . GLU E  1 133 ? -7.305  -23.713 -46.386 1.00 27.02  ? 131 GLU E O   1 
ATOM   6744 C  CB  . GLU E  1 133 ? -6.986  -20.781 -46.576 1.00 34.94  ? 131 GLU E CB  1 
ATOM   6745 C  CG  . GLU E  1 133 ? -5.990  -20.464 -45.481 1.00 41.28  ? 131 GLU E CG  1 
ATOM   6746 C  CD  . GLU E  1 133 ? -6.331  -19.204 -44.706 1.00 48.58  ? 131 GLU E CD  1 
ATOM   6747 O  OE1 . GLU E  1 133 ? -5.416  -18.679 -44.024 1.00 57.20  ? 131 GLU E OE1 1 
ATOM   6748 O  OE2 . GLU E  1 133 ? -7.495  -18.747 -44.776 1.00 44.33  ? 131 GLU E OE2 1 
ATOM   6749 N  N   . TYR E  1 134 ? -5.189  -23.828 -47.119 1.00 25.22  ? 132 TYR E N   1 
ATOM   6750 C  CA  . TYR E  1 134 ? -4.940  -25.160 -46.583 1.00 22.66  ? 132 TYR E CA  1 
ATOM   6751 C  C   . TYR E  1 134 ? -4.109  -25.053 -45.321 1.00 20.22  ? 132 TYR E C   1 
ATOM   6752 O  O   . TYR E  1 134 ? -3.230  -24.210 -45.230 1.00 19.63  ? 132 TYR E O   1 
ATOM   6753 C  CB  . TYR E  1 134 ? -4.199  -26.026 -47.603 1.00 22.70  ? 132 TYR E CB  1 
ATOM   6754 C  CG  . TYR E  1 134 ? -4.948  -26.220 -48.893 1.00 24.13  ? 132 TYR E CG  1 
ATOM   6755 C  CD1 . TYR E  1 134 ? -4.715  -25.390 -49.982 1.00 24.90  ? 132 TYR E CD1 1 
ATOM   6756 C  CD2 . TYR E  1 134 ? -5.882  -27.238 -49.035 1.00 24.46  ? 132 TYR E CD2 1 
ATOM   6757 C  CE1 . TYR E  1 134 ? -5.378  -25.571 -51.180 1.00 26.71  ? 132 TYR E CE1 1 
ATOM   6758 C  CE2 . TYR E  1 134 ? -6.561  -27.415 -50.231 1.00 26.24  ? 132 TYR E CE2 1 
ATOM   6759 C  CZ  . TYR E  1 134 ? -6.307  -26.575 -51.302 1.00 27.27  ? 132 TYR E CZ  1 
ATOM   6760 O  OH  . TYR E  1 134 ? -6.980  -26.711 -52.497 1.00 28.89  ? 132 TYR E OH  1 
ATOM   6761 N  N   . PHE E  1 135 ? -4.355  -25.940 -44.365 1.00 19.41  ? 133 PHE E N   1 
ATOM   6762 C  CA  . PHE E  1 135 ? -3.446  -26.087 -43.244 1.00 17.77  ? 133 PHE E CA  1 
ATOM   6763 C  C   . PHE E  1 135 ? -3.280  -27.535 -42.810 1.00 17.54  ? 133 PHE E C   1 
ATOM   6764 O  O   . PHE E  1 135 ? -4.150  -28.365 -43.026 1.00 18.69  ? 133 PHE E O   1 
ATOM   6765 C  CB  . PHE E  1 135 ? -3.903  -25.215 -42.077 1.00 17.36  ? 133 PHE E CB  1 
ATOM   6766 C  CG  . PHE E  1 135 ? -5.127  -25.727 -41.357 1.00 17.24  ? 133 PHE E CG  1 
ATOM   6767 C  CD1 . PHE E  1 135 ? -6.394  -25.532 -41.869 1.00 18.10  ? 133 PHE E CD1 1 
ATOM   6768 C  CD2 . PHE E  1 135 ? -4.999  -26.349 -40.126 1.00 16.48  ? 133 PHE E CD2 1 
ATOM   6769 C  CE1 . PHE E  1 135 ? -7.517  -25.986 -41.186 1.00 19.12  ? 133 PHE E CE1 1 
ATOM   6770 C  CE2 . PHE E  1 135 ? -6.111  -26.820 -39.448 1.00 17.11  ? 133 PHE E CE2 1 
ATOM   6771 C  CZ  . PHE E  1 135 ? -7.371  -26.640 -39.974 1.00 18.06  ? 133 PHE E CZ  1 
ATOM   6772 N  N   . LYS E  1 136 ? -2.125  -27.838 -42.239 1.00 17.89  ? 134 LYS E N   1 
ATOM   6773 C  CA  . LYS E  1 136 ? -1.868  -29.149 -41.687 1.00 17.73  ? 134 LYS E CA  1 
ATOM   6774 C  C   . LYS E  1 136 ? -0.942  -29.041 -40.499 1.00 16.34  ? 134 LYS E C   1 
ATOM   6775 O  O   . LYS E  1 136 ? -0.203  -28.071 -40.361 1.00 15.37  ? 134 LYS E O   1 
ATOM   6776 C  CB  . LYS E  1 136 ? -1.267  -30.092 -42.727 1.00 19.39  ? 134 LYS E CB  1 
ATOM   6777 C  CG  . LYS E  1 136 ? 0.164   -29.784 -43.092 1.00 20.61  ? 134 LYS E CG  1 
ATOM   6778 C  CD  . LYS E  1 136 ? 0.789   -30.933 -43.876 1.00 22.38  ? 134 LYS E CD  1 
ATOM   6779 C  CE  . LYS E  1 136 ? 2.251   -30.628 -44.170 1.00 24.01  ? 134 LYS E CE  1 
ATOM   6780 N  NZ  . LYS E  1 136 ? 2.787   -31.428 -45.305 1.00 26.66  ? 134 LYS E NZ  1 
ATOM   6781 N  N   . ILE E  1 137 ? -1.028  -30.043 -39.626 1.00 16.61  ? 135 ILE E N   1 
ATOM   6782 C  CA  . ILE E  1 137 ? -0.101  -30.222 -38.536 1.00 15.63  ? 135 ILE E CA  1 
ATOM   6783 C  C   . ILE E  1 137 ? 0.574   -31.582 -38.695 1.00 17.11  ? 135 ILE E C   1 
ATOM   6784 O  O   . ILE E  1 137 ? -0.085  -32.610 -38.931 1.00 16.32  ? 135 ILE E O   1 
ATOM   6785 C  CB  . ILE E  1 137 ? -0.828  -30.196 -37.190 1.00 16.48  ? 135 ILE E CB  1 
ATOM   6786 C  CG1 . ILE E  1 137 ? -1.800  -29.014 -37.122 1.00 18.55  ? 135 ILE E CG1 1 
ATOM   6787 C  CG2 . ILE E  1 137 ? 0.166   -30.101 -36.062 1.00 15.57  ? 135 ILE E CG2 1 
ATOM   6788 C  CD1 . ILE E  1 137 ? -3.225  -29.383 -37.480 1.00 20.17  ? 135 ILE E CD1 1 
ATOM   6789 N  N   . THR E  1 138 ? 1.896   -31.580 -38.583 1.00 17.25  ? 136 THR E N   1 
ATOM   6790 C  CA  . THR E  1 138 ? 2.684   -32.801 -38.684 1.00 17.06  ? 136 THR E CA  1 
ATOM   6791 C  C   . THR E  1 138 ? 3.239   -33.170 -37.317 1.00 15.87  ? 136 THR E C   1 
ATOM   6792 O  O   . THR E  1 138 ? 3.743   -32.310 -36.594 1.00 14.66  ? 136 THR E O   1 
ATOM   6793 C  CB  . THR E  1 138 ? 3.843   -32.614 -39.668 1.00 18.94  ? 136 THR E CB  1 
ATOM   6794 O  OG1 . THR E  1 138 ? 3.316   -32.426 -40.979 1.00 21.08  ? 136 THR E OG1 1 
ATOM   6795 C  CG2 . THR E  1 138 ? 4.721   -33.829 -39.688 1.00 22.40  ? 136 THR E CG2 1 
ATOM   6796 N  N   . LEU E  1 139 ? 3.108   -34.441 -36.952 1.00 15.19  ? 137 LEU E N   1 
ATOM   6797 C  CA  . LEU E  1 139 ? 3.768   -34.973 -35.769 1.00 15.06  ? 137 LEU E CA  1 
ATOM   6798 C  C   . LEU E  1 139 ? 5.018   -35.746 -36.174 1.00 15.33  ? 137 LEU E C   1 
ATOM   6799 O  O   . LEU E  1 139 ? 4.930   -36.776 -36.837 1.00 14.86  ? 137 LEU E O   1 
ATOM   6800 C  CB  . LEU E  1 139 ? 2.820   -35.877 -34.976 1.00 14.81  ? 137 LEU E CB  1 
ATOM   6801 C  CG  . LEU E  1 139 ? 3.405   -36.515 -33.710 1.00 15.10  ? 137 LEU E CG  1 
ATOM   6802 C  CD1 . LEU E  1 139 ? 3.748   -35.472 -32.663 1.00 14.35  ? 137 LEU E CD1 1 
ATOM   6803 C  CD2 . LEU E  1 139 ? 2.454   -37.545 -33.115 1.00 15.70  ? 137 LEU E CD2 1 
ATOM   6804 N  N   . TYR E  1 140 ? 6.176   -35.231 -35.762 1.00 15.75  ? 138 TYR E N   1 
ATOM   6805 C  CA  . TYR E  1 140 ? 7.479   -35.797 -36.130 1.00 16.81  ? 138 TYR E CA  1 
ATOM   6806 C  C   . TYR E  1 140 ? 8.015   -36.673 -35.000 1.00 17.02  ? 138 TYR E C   1 
ATOM   6807 O  O   . TYR E  1 140 ? 7.949   -36.294 -33.837 1.00 15.60  ? 138 TYR E O   1 
ATOM   6808 C  CB  . TYR E  1 140 ? 8.483   -34.681 -36.345 1.00 17.53  ? 138 TYR E CB  1 
ATOM   6809 C  CG  . TYR E  1 140 ? 8.370   -33.912 -37.636 1.00 20.38  ? 138 TYR E CG  1 
ATOM   6810 C  CD1 . TYR E  1 140 ? 7.761   -34.445 -38.756 1.00 21.96  ? 138 TYR E CD1 1 
ATOM   6811 C  CD2 . TYR E  1 140 ? 8.926   -32.645 -37.742 1.00 24.30  ? 138 TYR E CD2 1 
ATOM   6812 C  CE1 . TYR E  1 140 ? 7.684   -33.729 -39.941 1.00 22.33  ? 138 TYR E CE1 1 
ATOM   6813 C  CE2 . TYR E  1 140 ? 8.855   -31.921 -38.916 1.00 24.14  ? 138 TYR E CE2 1 
ATOM   6814 C  CZ  . TYR E  1 140 ? 8.233   -32.466 -40.016 1.00 23.37  ? 138 TYR E CZ  1 
ATOM   6815 O  OH  . TYR E  1 140 ? 8.171   -31.731 -41.180 1.00 21.69  ? 138 TYR E OH  1 
ATOM   6816 N  N   . GLY E  1 141 ? 8.563   -37.833 -35.346 1.00 19.57  ? 139 GLY E N   1 
ATOM   6817 C  CA  . GLY E  1 141 ? 9.387   -38.610 -34.413 1.00 20.83  ? 139 GLY E CA  1 
ATOM   6818 C  C   . GLY E  1 141 ? 10.795  -38.834 -34.940 1.00 20.67  ? 139 GLY E C   1 
ATOM   6819 O  O   . GLY E  1 141 ? 11.004  -38.945 -36.148 1.00 20.39  ? 139 GLY E O   1 
ATOM   6820 N  N   . ARG E  1 142 ? 11.766  -38.896 -34.038 1.00 21.05  ? 140 ARG E N   1 
ATOM   6821 C  CA  . ARG E  1 142 ? 13.117  -39.286 -34.432 1.00 23.03  ? 140 ARG E CA  1 
ATOM   6822 C  C   . ARG E  1 142 ? 13.180  -40.759 -34.761 1.00 22.96  ? 140 ARG E C   1 
ATOM   6823 O  O   . ARG E  1 142 ? 14.038  -41.185 -35.529 1.00 25.70  ? 140 ARG E O   1 
ATOM   6824 C  CB  . ARG E  1 142 ? 14.134  -38.975 -33.329 1.00 23.47  ? 140 ARG E CB  1 
ATOM   6825 C  CG  . ARG E  1 142 ? 14.432  -37.500 -33.164 1.00 22.68  ? 140 ARG E CG  1 
ATOM   6826 C  CD  . ARG E  1 142 ? 14.965  -36.873 -34.440 1.00 22.05  ? 140 ARG E CD  1 
ATOM   6827 N  NE  . ARG E  1 142 ? 15.485  -35.547 -34.160 1.00 24.94  ? 140 ARG E NE  1 
ATOM   6828 C  CZ  . ARG E  1 142 ? 15.995  -34.725 -35.071 1.00 25.74  ? 140 ARG E CZ  1 
ATOM   6829 N  NH1 . ARG E  1 142 ? 16.430  -33.541 -34.685 1.00 23.98  ? 140 ARG E NH1 1 
ATOM   6830 N  NH2 . ARG E  1 142 ? 16.069  -35.080 -36.356 1.00 25.98  ? 140 ARG E NH2 1 
ATOM   6831 N  N   . THR E  1 143 ? 12.272  -41.531 -34.174 1.00 22.68  ? 141 THR E N   1 
ATOM   6832 C  CA  . THR E  1 143 ? 12.011  -42.898 -34.623 1.00 25.21  ? 141 THR E CA  1 
ATOM   6833 C  C   . THR E  1 143 ? 10.588  -43.012 -35.156 1.00 26.78  ? 141 THR E C   1 
ATOM   6834 O  O   . THR E  1 143 ? 9.822   -42.041 -35.139 1.00 29.49  ? 141 THR E O   1 
ATOM   6835 C  CB  . THR E  1 143 ? 12.154  -43.909 -33.472 1.00 25.10  ? 141 THR E CB  1 
ATOM   6836 O  OG1 . THR E  1 143 ? 11.054  -43.744 -32.576 1.00 26.19  ? 141 THR E OG1 1 
ATOM   6837 C  CG2 . THR E  1 143 ? 13.453  -43.688 -32.708 1.00 25.16  ? 141 THR E CG2 1 
ATOM   6838 N  N   . LYS E  1 144 ? 10.227  -44.205 -35.606 1.00 26.30  ? 142 LYS E N   1 
ATOM   6839 C  CA  . LYS E  1 144 ? 8.943   -44.416 -36.258 1.00 25.99  ? 142 LYS E CA  1 
ATOM   6840 C  C   . LYS E  1 144 ? 7.788   -44.548 -35.263 1.00 26.74  ? 142 LYS E C   1 
ATOM   6841 O  O   . LYS E  1 144 ? 6.633   -44.654 -35.664 1.00 24.68  ? 142 LYS E O   1 
ATOM   6842 C  CB  . LYS E  1 144 ? 9.016   -45.662 -37.139 1.00 26.53  ? 142 LYS E CB  1 
ATOM   6843 C  CG  . LYS E  1 144 ? 10.032  -45.575 -38.265 1.00 26.55  ? 142 LYS E CG  1 
ATOM   6844 C  CD  . LYS E  1 144 ? 10.061  -46.868 -39.054 1.00 28.66  ? 142 LYS E CD  1 
ATOM   6845 C  CE  . LYS E  1 144 ? 11.288  -46.956 -39.944 1.00 30.97  ? 142 LYS E CE  1 
ATOM   6846 N  NZ  . LYS E  1 144 ? 11.341  -48.268 -40.645 1.00 35.24  ? 142 LYS E NZ  1 
ATOM   6847 N  N   . GLU E  1 145 ? 8.100   -44.563 -33.971 1.00 29.49  ? 143 GLU E N   1 
ATOM   6848 C  CA  . GLU E  1 145 ? 7.084   -44.760 -32.929 1.00 32.57  ? 143 GLU E CA  1 
ATOM   6849 C  C   . GLU E  1 145 ? 7.083   -43.580 -31.957 1.00 30.49  ? 143 GLU E C   1 
ATOM   6850 O  O   . GLU E  1 145 ? 8.124   -42.993 -31.695 1.00 26.48  ? 143 GLU E O   1 
ATOM   6851 C  CB  . GLU E  1 145 ? 7.367   -46.053 -32.150 1.00 38.74  ? 143 GLU E CB  1 
ATOM   6852 C  CG  . GLU E  1 145 ? 7.506   -47.318 -33.004 1.00 46.99  ? 143 GLU E CG  1 
ATOM   6853 C  CD  . GLU E  1 145 ? 6.182   -48.023 -33.250 1.00 53.59  ? 143 GLU E CD  1 
ATOM   6854 O  OE1 . GLU E  1 145 ? 5.128   -47.478 -32.841 1.00 57.79  ? 143 GLU E OE1 1 
ATOM   6855 O  OE2 . GLU E  1 145 ? 6.194   -49.123 -33.851 1.00 52.54  ? 143 GLU E OE2 1 
ATOM   6856 N  N   . LEU E  1 146 ? 5.918   -43.266 -31.396 1.00 27.11  ? 144 LEU E N   1 
ATOM   6857 C  CA  . LEU E  1 146 ? 5.840   -42.383 -30.241 1.00 24.42  ? 144 LEU E CA  1 
ATOM   6858 C  C   . LEU E  1 146 ? 4.807   -42.875 -29.242 1.00 23.99  ? 144 LEU E C   1 
ATOM   6859 O  O   . LEU E  1 146 ? 3.958   -43.700 -29.565 1.00 24.10  ? 144 LEU E O   1 
ATOM   6860 C  CB  . LEU E  1 146 ? 5.466   -40.968 -30.687 1.00 25.38  ? 144 LEU E CB  1 
ATOM   6861 C  CG  . LEU E  1 146 ? 6.482   -40.198 -31.531 1.00 27.06  ? 144 LEU E CG  1 
ATOM   6862 C  CD1 . LEU E  1 146 ? 5.839   -38.901 -32.001 1.00 26.49  ? 144 LEU E CD1 1 
ATOM   6863 C  CD2 . LEU E  1 146 ? 7.768   -39.921 -30.762 1.00 25.00  ? 144 LEU E CD2 1 
ATOM   6864 N  N   . THR E  1 147 ? 4.854   -42.316 -28.040 1.00 25.23  ? 145 THR E N   1 
ATOM   6865 C  CA  . THR E  1 147 ? 3.977   -42.734 -26.955 1.00 27.32  ? 145 THR E CA  1 
ATOM   6866 C  C   . THR E  1 147 ? 2.540   -42.324 -27.239 1.00 28.50  ? 145 THR E C   1 
ATOM   6867 O  O   . THR E  1 147 ? 2.287   -41.349 -27.953 1.00 25.76  ? 145 THR E O   1 
ATOM   6868 C  CB  . THR E  1 147 ? 4.414   -42.103 -25.609 1.00 27.53  ? 145 THR E CB  1 
ATOM   6869 O  OG1 . THR E  1 147 ? 4.389   -40.672 -25.707 1.00 24.02  ? 145 THR E OG1 1 
ATOM   6870 C  CG2 . THR E  1 147 ? 5.812   -42.574 -25.229 1.00 26.44  ? 145 THR E CG2 1 
ATOM   6871 N  N   . SER E  1 148 ? 1.605   -43.068 -26.656 1.00 28.97  ? 146 SER E N   1 
ATOM   6872 C  CA  . SER E  1 148 ? 0.207   -42.670 -26.629 1.00 28.40  ? 146 SER E CA  1 
ATOM   6873 C  C   . SER E  1 148 ? 0.037   -41.235 -26.183 1.00 28.54  ? 146 SER E C   1 
ATOM   6874 O  O   . SER E  1 148 ? -0.794  -40.505 -26.718 1.00 31.08  ? 146 SER E O   1 
ATOM   6875 C  CB  . SER E  1 148 ? -0.572  -43.572 -25.678 1.00 30.88  ? 146 SER E CB  1 
ATOM   6876 O  OG  . SER E  1 148 ? -1.904  -43.104 -25.534 1.00 32.56  ? 146 SER E OG  1 
ATOM   6877 N  N   . GLU E  1 149 ? 0.791   -40.848 -25.166 1.00 28.64  ? 147 GLU E N   1 
ATOM   6878 C  CA  . GLU E  1 149 ? 0.641   -39.531 -24.567 1.00 30.65  ? 147 GLU E CA  1 
ATOM   6879 C  C   . GLU E  1 149 ? 0.929   -38.424 -25.589 1.00 27.85  ? 147 GLU E C   1 
ATOM   6880 O  O   . GLU E  1 149 ? 0.167   -37.469 -25.717 1.00 24.72  ? 147 GLU E O   1 
ATOM   6881 C  CB  . GLU E  1 149 ? 1.603   -39.408 -23.393 1.00 35.81  ? 147 GLU E CB  1 
ATOM   6882 C  CG  . GLU E  1 149 ? 1.488   -38.121 -22.605 1.00 41.17  ? 147 GLU E CG  1 
ATOM   6883 C  CD  . GLU E  1 149 ? 2.247   -38.186 -21.286 1.00 50.27  ? 147 GLU E CD  1 
ATOM   6884 O  OE1 . GLU E  1 149 ? 2.439   -39.300 -20.746 1.00 58.98  ? 147 GLU E OE1 1 
ATOM   6885 O  OE2 . GLU E  1 149 ? 2.655   -37.121 -20.786 1.00 51.73  ? 147 GLU E OE2 1 
ATOM   6886 N  N   . LEU E  1 150 ? 2.014   -38.580 -26.337 1.00 25.18  ? 148 LEU E N   1 
ATOM   6887 C  CA  . LEU E  1 150 ? 2.364   -37.614 -27.371 1.00 23.19  ? 148 LEU E CA  1 
ATOM   6888 C  C   . LEU E  1 150 ? 1.345   -37.604 -28.514 1.00 23.52  ? 148 LEU E C   1 
ATOM   6889 O  O   . LEU E  1 150 ? 0.997   -36.540 -29.047 1.00 21.49  ? 148 LEU E O   1 
ATOM   6890 C  CB  . LEU E  1 150 ? 3.758   -37.911 -27.914 1.00 23.15  ? 148 LEU E CB  1 
ATOM   6891 C  CG  . LEU E  1 150 ? 4.901   -37.595 -26.944 1.00 24.54  ? 148 LEU E CG  1 
ATOM   6892 C  CD1 . LEU E  1 150 ? 6.199   -38.227 -27.422 1.00 24.24  ? 148 LEU E CD1 1 
ATOM   6893 C  CD2 . LEU E  1 150 ? 5.055   -36.089 -26.762 1.00 26.07  ? 148 LEU E CD2 1 
ATOM   6894 N  N   . LYS E  1 151 ? 0.847   -38.781 -28.881 1.00 23.32  ? 149 LYS E N   1 
ATOM   6895 C  CA  . LYS E  1 151 ? -0.121  -38.868 -29.955 1.00 23.97  ? 149 LYS E CA  1 
ATOM   6896 C  C   . LYS E  1 151 ? -1.452  -38.269 -29.549 1.00 24.78  ? 149 LYS E C   1 
ATOM   6897 O  O   . LYS E  1 151 ? -2.136  -37.649 -30.368 1.00 26.18  ? 149 LYS E O   1 
ATOM   6898 C  CB  . LYS E  1 151 ? -0.269  -40.308 -30.428 1.00 24.66  ? 149 LYS E CB  1 
ATOM   6899 C  CG  . LYS E  1 151 ? 0.991   -40.802 -31.118 1.00 24.82  ? 149 LYS E CG  1 
ATOM   6900 C  CD  . LYS E  1 151 ? 0.794   -42.121 -31.846 1.00 26.63  ? 149 LYS E CD  1 
ATOM   6901 C  CE  . LYS E  1 151 ? 0.773   -43.288 -30.867 1.00 27.94  ? 149 LYS E CE  1 
ATOM   6902 N  NZ  . LYS E  1 151 ? 1.123   -44.567 -31.543 1.00 28.72  ? 149 LYS E NZ  1 
ATOM   6903 N  N   . GLU E  1 152 ? -1.828  -38.457 -28.291 1.00 26.43  ? 150 GLU E N   1 
ATOM   6904 C  CA  . GLU E  1 152 ? -3.045  -37.855 -27.782 1.00 27.79  ? 150 GLU E CA  1 
ATOM   6905 C  C   . GLU E  1 152 ? -2.908  -36.344 -27.732 1.00 26.46  ? 150 GLU E C   1 
ATOM   6906 O  O   . GLU E  1 152 ? -3.870  -35.642 -27.996 1.00 27.74  ? 150 GLU E O   1 
ATOM   6907 C  CB  . GLU E  1 152 ? -3.384  -38.382 -26.386 1.00 31.38  ? 150 GLU E CB  1 
ATOM   6908 C  CG  . GLU E  1 152 ? -3.989  -39.782 -26.389 1.00 35.36  ? 150 GLU E CG  1 
ATOM   6909 C  CD  . GLU E  1 152 ? -5.234  -39.925 -27.264 1.00 39.56  ? 150 GLU E CD  1 
ATOM   6910 O  OE1 . GLU E  1 152 ? -6.060  -38.977 -27.333 1.00 37.73  ? 150 GLU E OE1 1 
ATOM   6911 O  OE2 . GLU E  1 152 ? -5.397  -41.020 -27.862 1.00 42.38  ? 150 GLU E OE2 1 
ATOM   6912 N  N   . ASN E  1 153 ? -1.740  -35.842 -27.345 1.00 28.20  ? 151 ASN E N   1 
ATOM   6913 C  CA  . ASN E  1 153 ? -1.532  -34.392 -27.296 1.00 29.66  ? 151 ASN E CA  1 
ATOM   6914 C  C   . ASN E  1 153 ? -1.736  -33.827 -28.691 1.00 26.68  ? 151 ASN E C   1 
ATOM   6915 O  O   . ASN E  1 153 ? -2.273  -32.744 -28.846 1.00 25.44  ? 151 ASN E O   1 
ATOM   6916 C  CB  . ASN E  1 153 ? -0.102  -34.013 -26.850 1.00 35.78  ? 151 ASN E CB  1 
ATOM   6917 C  CG  . ASN E  1 153 ? 0.094   -34.045 -25.340 1.00 48.54  ? 151 ASN E CG  1 
ATOM   6918 O  OD1 . ASN E  1 153 ? -0.766  -33.596 -24.584 1.00 72.03  ? 151 ASN E OD1 1 
ATOM   6919 N  ND2 . ASN E  1 153 ? 1.260   -34.524 -24.893 1.00 48.31  ? 151 ASN E ND2 1 
ATOM   6920 N  N   . PHE E  1 154 ? -1.270  -34.567 -29.696 1.00 23.56  ? 152 PHE E N   1 
ATOM   6921 C  CA  . PHE E  1 154 ? -1.379  -34.173 -31.093 1.00 21.22  ? 152 PHE E CA  1 
ATOM   6922 C  C   . PHE E  1 154 ? -2.831  -34.171 -31.571 1.00 20.12  ? 152 PHE E C   1 
ATOM   6923 O  O   . PHE E  1 154 ? -3.261  -33.251 -32.261 1.00 19.11  ? 152 PHE E O   1 
ATOM   6924 C  CB  . PHE E  1 154 ? -0.526  -35.124 -31.953 1.00 22.14  ? 152 PHE E CB  1 
ATOM   6925 C  CG  . PHE E  1 154 ? -0.723  -34.963 -33.427 1.00 20.45  ? 152 PHE E CG  1 
ATOM   6926 C  CD1 . PHE E  1 154 ? -1.346  -35.944 -34.168 1.00 20.73  ? 152 PHE E CD1 1 
ATOM   6927 C  CD2 . PHE E  1 154 ? -0.250  -33.843 -34.072 1.00 20.66  ? 152 PHE E CD2 1 
ATOM   6928 C  CE1 . PHE E  1 154 ? -1.514  -35.795 -35.531 1.00 21.38  ? 152 PHE E CE1 1 
ATOM   6929 C  CE2 . PHE E  1 154 ? -0.408  -33.683 -35.429 1.00 20.68  ? 152 PHE E CE2 1 
ATOM   6930 C  CZ  . PHE E  1 154 ? -1.032  -34.668 -36.166 1.00 22.37  ? 152 PHE E CZ  1 
ATOM   6931 N  N   . ILE E  1 155 ? -3.590  -35.190 -31.179 1.00 19.83  ? 153 ILE E N   1 
ATOM   6932 C  CA  . ILE E  1 155 ? -5.015  -35.248 -31.481 1.00 20.70  ? 153 ILE E CA  1 
ATOM   6933 C  C   . ILE E  1 155 ? -5.753  -34.102 -30.801 1.00 22.53  ? 153 ILE E C   1 
ATOM   6934 O  O   . ILE E  1 155 ? -6.593  -33.445 -31.422 1.00 24.09  ? 153 ILE E O   1 
ATOM   6935 C  CB  . ILE E  1 155 ? -5.619  -36.578 -31.021 1.00 20.88  ? 153 ILE E CB  1 
ATOM   6936 C  CG1 . ILE E  1 155 ? -5.084  -37.708 -31.898 1.00 21.61  ? 153 ILE E CG1 1 
ATOM   6937 C  CG2 . ILE E  1 155 ? -7.135  -36.545 -31.113 1.00 21.91  ? 153 ILE E CG2 1 
ATOM   6938 C  CD1 . ILE E  1 155 ? -5.317  -39.083 -31.314 1.00 23.04  ? 153 ILE E CD1 1 
ATOM   6939 N  N   . ARG E  1 156 ? -5.413  -33.848 -29.542 1.00 23.48  ? 154 ARG E N   1 
ATOM   6940 C  CA  . ARG E  1 156 ? -6.021  -32.770 -28.776 1.00 27.45  ? 154 ARG E CA  1 
ATOM   6941 C  C   . ARG E  1 156 ? -5.777  -31.445 -29.470 1.00 22.56  ? 154 ARG E C   1 
ATOM   6942 O  O   . ARG E  1 156 ? -6.705  -30.665 -29.678 1.00 23.08  ? 154 ARG E O   1 
ATOM   6943 C  CB  . ARG E  1 156 ? -5.437  -32.724 -27.360 1.00 32.83  ? 154 ARG E CB  1 
ATOM   6944 C  CG  . ARG E  1 156 ? -6.106  -31.728 -26.416 1.00 45.01  ? 154 ARG E CG  1 
ATOM   6945 C  CD  . ARG E  1 156 ? -5.718  -31.986 -24.953 1.00 51.74  ? 154 ARG E CD  1 
ATOM   6946 N  NE  . ARG E  1 156 ? -5.529  -33.417 -24.687 1.00 58.12  ? 154 ARG E NE  1 
ATOM   6947 C  CZ  . ARG E  1 156 ? -4.364  -33.988 -24.372 1.00 57.64  ? 154 ARG E CZ  1 
ATOM   6948 N  NH1 . ARG E  1 156 ? -3.257  -33.259 -24.249 1.00 52.31  ? 154 ARG E NH1 1 
ATOM   6949 N  NH2 . ARG E  1 156 ? -4.304  -35.299 -24.177 1.00 56.50  ? 154 ARG E NH2 1 
ATOM   6950 N  N   . PHE E  1 157 ? -4.537  -31.209 -29.863 1.00 18.76  ? 155 PHE E N   1 
ATOM   6951 C  CA  . PHE E  1 157 ? -4.169  -29.956 -30.508 1.00 18.13  ? 155 PHE E CA  1 
ATOM   6952 C  C   . PHE E  1 157 ? -4.858  -29.807 -31.869 1.00 18.56  ? 155 PHE E C   1 
ATOM   6953 O  O   . PHE E  1 157 ? -5.377  -28.745 -32.189 1.00 18.16  ? 155 PHE E O   1 
ATOM   6954 C  CB  . PHE E  1 157 ? -2.656  -29.890 -30.676 1.00 16.76  ? 155 PHE E CB  1 
ATOM   6955 C  CG  . PHE E  1 157 ? -2.173  -28.656 -31.358 1.00 16.88  ? 155 PHE E CG  1 
ATOM   6956 C  CD1 . PHE E  1 157 ? -2.352  -27.411 -30.774 1.00 17.10  ? 155 PHE E CD1 1 
ATOM   6957 C  CD2 . PHE E  1 157 ? -1.496  -28.743 -32.562 1.00 16.48  ? 155 PHE E CD2 1 
ATOM   6958 C  CE1 . PHE E  1 157 ? -1.878  -26.275 -31.391 1.00 16.89  ? 155 PHE E CE1 1 
ATOM   6959 C  CE2 . PHE E  1 157 ? -1.013  -27.611 -33.182 1.00 16.89  ? 155 PHE E CE2 1 
ATOM   6960 C  CZ  . PHE E  1 157 ? -1.207  -26.374 -32.598 1.00 16.75  ? 155 PHE E CZ  1 
ATOM   6961 N  N   . SER E  1 158 ? -4.893  -30.892 -32.636 1.00 18.20  ? 156 SER E N   1 
ATOM   6962 C  CA  . SER E  1 158 ? -5.529  -30.886 -33.945 1.00 19.04  ? 156 SER E CA  1 
ATOM   6963 C  C   . SER E  1 158 ? -7.000  -30.531 -33.832 1.00 21.28  ? 156 SER E C   1 
ATOM   6964 O  O   . SER E  1 158 ? -7.506  -29.725 -34.607 1.00 25.14  ? 156 SER E O   1 
ATOM   6965 C  CB  . SER E  1 158 ? -5.370  -32.246 -34.640 1.00 17.47  ? 156 SER E CB  1 
ATOM   6966 O  OG  . SER E  1 158 ? -4.027  -32.460 -35.011 1.00 15.15  ? 156 SER E OG  1 
ATOM   6967 N  N   . LYS E  1 159 ? -7.674  -31.090 -32.835 1.00 23.27  ? 157 LYS E N   1 
ATOM   6968 C  CA  . LYS E  1 159 ? -9.076  -30.759 -32.594 1.00 25.51  ? 157 LYS E CA  1 
ATOM   6969 C  C   . LYS E  1 159 ? -9.259  -29.306 -32.197 1.00 23.78  ? 157 LYS E C   1 
ATOM   6970 O  O   . LYS E  1 159 ? -10.244 -28.684 -32.574 1.00 24.96  ? 157 LYS E O   1 
ATOM   6971 C  CB  . LYS E  1 159 ? -9.669  -31.660 -31.514 1.00 27.23  ? 157 LYS E CB  1 
ATOM   6972 C  CG  . LYS E  1 159 ? -10.090 -33.001 -32.060 1.00 29.65  ? 157 LYS E CG  1 
ATOM   6973 C  CD  . LYS E  1 159 ? -10.458 -33.987 -30.968 1.00 32.54  ? 157 LYS E CD  1 
ATOM   6974 C  CE  . LYS E  1 159 ? -10.718 -35.364 -31.567 1.00 35.38  ? 157 LYS E CE  1 
ATOM   6975 N  NZ  . LYS E  1 159 ? -11.455 -36.254 -30.629 1.00 41.28  ? 157 LYS E NZ  1 
ATOM   6976 N  N   . SER E  1 160 ? -8.326  -28.770 -31.421 1.00 22.62  ? 158 SER E N   1 
ATOM   6977 C  CA  . SER E  1 160 ? -8.439  -27.388 -30.962 1.00 23.98  ? 158 SER E CA  1 
ATOM   6978 C  C   . SER E  1 160 ? -8.379  -26.437 -32.151 1.00 24.02  ? 158 SER E C   1 
ATOM   6979 O  O   . SER E  1 160 ? -8.732  -25.261 -32.030 1.00 24.30  ? 158 SER E O   1 
ATOM   6980 C  CB  . SER E  1 160 ? -7.315  -27.052 -29.975 1.00 23.05  ? 158 SER E CB  1 
ATOM   6981 O  OG  . SER E  1 160 ? -6.123  -26.697 -30.657 1.00 21.64  ? 158 SER E OG  1 
ATOM   6982 N  N   . LEU E  1 161 ? -7.875  -26.935 -33.286 1.00 24.09  ? 159 LEU E N   1 
ATOM   6983 C  CA  . LEU E  1 161 ? -7.756  -26.116 -34.489 1.00 23.95  ? 159 LEU E CA  1 
ATOM   6984 C  C   . LEU E  1 161 ? -8.913  -26.391 -35.444 1.00 22.27  ? 159 LEU E C   1 
ATOM   6985 O  O   . LEU E  1 161 ? -8.910  -25.901 -36.562 1.00 21.78  ? 159 LEU E O   1 
ATOM   6986 C  CB  . LEU E  1 161 ? -6.415  -26.370 -35.198 1.00 24.53  ? 159 LEU E CB  1 
ATOM   6987 C  CG  . LEU E  1 161 ? -5.135  -26.073 -34.414 1.00 23.73  ? 159 LEU E CG  1 
ATOM   6988 C  CD1 . LEU E  1 161 ? -3.919  -26.309 -35.292 1.00 24.62  ? 159 LEU E CD1 1 
ATOM   6989 C  CD2 . LEU E  1 161 ? -5.110  -24.657 -33.867 1.00 24.65  ? 159 LEU E CD2 1 
ATOM   6990 N  N   . GLY E  1 162 ? -9.884  -27.190 -35.008 1.00 22.35  ? 160 GLY E N   1 
ATOM   6991 C  CA  . GLY E  1 162 ? -11.132 -27.386 -35.754 1.00 24.04  ? 160 GLY E CA  1 
ATOM   6992 C  C   . GLY E  1 162 ? -11.230 -28.700 -36.520 1.00 24.95  ? 160 GLY E C   1 
ATOM   6993 O  O   . GLY E  1 162 ? -12.195 -28.933 -37.239 1.00 27.21  ? 160 GLY E O   1 
ATOM   6994 N  N   . LEU E  1 163 ? -10.223 -29.557 -36.387 1.00 24.41  ? 161 LEU E N   1 
ATOM   6995 C  CA  . LEU E  1 163 ? -10.168 -30.795 -37.169 1.00 24.79  ? 161 LEU E CA  1 
ATOM   6996 C  C   . LEU E  1 163 ? -10.802 -31.957 -36.423 1.00 26.41  ? 161 LEU E C   1 
ATOM   6997 O  O   . LEU E  1 163 ? -10.462 -32.202 -35.269 1.00 27.04  ? 161 LEU E O   1 
ATOM   6998 C  CB  . LEU E  1 163 ? -8.716  -31.144 -37.498 1.00 22.34  ? 161 LEU E CB  1 
ATOM   6999 C  CG  . LEU E  1 163 ? -7.974  -30.129 -38.360 1.00 21.14  ? 161 LEU E CG  1 
ATOM   7000 C  CD1 . LEU E  1 163 ? -6.497  -30.485 -38.419 1.00 20.08  ? 161 LEU E CD1 1 
ATOM   7001 C  CD2 . LEU E  1 163 ? -8.578  -30.070 -39.757 1.00 21.92  ? 161 LEU E CD2 1 
ATOM   7002 N  N   . PRO E  1 164 ? -11.721 -32.685 -37.081 1.00 28.58  ? 162 PRO E N   1 
ATOM   7003 C  CA  . PRO E  1 164 ? -12.284 -33.907 -36.503 1.00 29.84  ? 162 PRO E CA  1 
ATOM   7004 C  C   . PRO E  1 164 ? -11.415 -35.122 -36.799 1.00 30.07  ? 162 PRO E C   1 
ATOM   7005 O  O   . PRO E  1 164 ? -10.414 -35.005 -37.511 1.00 27.03  ? 162 PRO E O   1 
ATOM   7006 C  CB  . PRO E  1 164 ? -13.632 -34.042 -37.210 1.00 31.40  ? 162 PRO E CB  1 
ATOM   7007 C  CG  . PRO E  1 164 ? -13.416 -33.405 -38.539 1.00 31.73  ? 162 PRO E CG  1 
ATOM   7008 C  CD  . PRO E  1 164 ? -12.356 -32.341 -38.364 1.00 29.76  ? 162 PRO E CD  1 
ATOM   7009 N  N   . GLU E  1 165 ? -11.775 -36.260 -36.215 1.00 31.90  ? 163 GLU E N   1 
ATOM   7010 C  CA  . GLU E  1 165 ? -10.848 -37.380 -36.082 1.00 35.51  ? 163 GLU E CA  1 
ATOM   7011 C  C   . GLU E  1 165 ? -10.501 -37.956 -37.455 1.00 31.81  ? 163 GLU E C   1 
ATOM   7012 O  O   . GLU E  1 165 ? -9.407  -38.459 -37.662 1.00 27.03  ? 163 GLU E O   1 
ATOM   7013 C  CB  . GLU E  1 165 ? -11.470 -38.481 -35.210 1.00 44.12  ? 163 GLU E CB  1 
ATOM   7014 C  CG  . GLU E  1 165 ? -10.453 -39.393 -34.518 1.00 58.05  ? 163 GLU E CG  1 
ATOM   7015 C  CD  . GLU E  1 165 ? -10.216 -39.051 -33.051 1.00 71.17  ? 163 GLU E CD  1 
ATOM   7016 O  OE1 . GLU E  1 165 ? -10.720 -38.007 -32.585 1.00 87.33  ? 163 GLU E OE1 1 
ATOM   7017 O  OE2 . GLU E  1 165 ? -9.500  -39.817 -32.366 1.00 75.23  ? 163 GLU E OE2 1 
ATOM   7018 N  N   . ASN E  1 166 ? -11.444 -37.888 -38.388 1.00 32.05  ? 164 ASN E N   1 
ATOM   7019 C  CA  . ASN E  1 166 ? -11.230 -38.455 -39.716 1.00 33.04  ? 164 ASN E CA  1 
ATOM   7020 C  C   . ASN E  1 166 ? -10.393 -37.550 -40.618 1.00 31.43  ? 164 ASN E C   1 
ATOM   7021 O  O   . ASN E  1 166 ? -10.086 -37.919 -41.757 1.00 30.61  ? 164 ASN E O   1 
ATOM   7022 C  CB  . ASN E  1 166 ? -12.560 -38.780 -40.391 1.00 37.29  ? 164 ASN E CB  1 
ATOM   7023 C  CG  . ASN E  1 166 ? -13.370 -37.543 -40.710 1.00 39.42  ? 164 ASN E CG  1 
ATOM   7024 O  OD1 . ASN E  1 166 ? -13.201 -36.496 -40.090 1.00 46.63  ? 164 ASN E OD1 1 
ATOM   7025 N  ND2 . ASN E  1 166 ? -14.278 -37.667 -41.659 1.00 42.81  ? 164 ASN E ND2 1 
ATOM   7026 N  N   . HIS E  1 167 ? -9.975  -36.401 -40.088 1.00 27.46  ? 165 HIS E N   1 
ATOM   7027 C  CA  . HIS E  1 167 ? -8.933  -35.601 -40.717 1.00 25.77  ? 165 HIS E CA  1 
ATOM   7028 C  C   . HIS E  1 167 ? -7.599  -35.733 -39.981 1.00 24.35  ? 165 HIS E C   1 
ATOM   7029 O  O   . HIS E  1 167 ? -6.692  -34.911 -40.172 1.00 23.52  ? 165 HIS E O   1 
ATOM   7030 C  CB  . HIS E  1 167 ? -9.351  -34.144 -40.775 1.00 25.56  ? 165 HIS E CB  1 
ATOM   7031 C  CG  . HIS E  1 167 ? -10.340 -33.848 -41.860 1.00 28.52  ? 165 HIS E CG  1 
ATOM   7032 N  ND1 . HIS E  1 167 ? -9.990  -33.236 -43.047 1.00 29.60  ? 165 HIS E ND1 1 
ATOM   7033 C  CD2 . HIS E  1 167 ? -11.673 -34.068 -41.932 1.00 29.94  ? 165 HIS E CD2 1 
ATOM   7034 C  CE1 . HIS E  1 167 ? -11.063 -33.094 -43.801 1.00 30.52  ? 165 HIS E CE1 1 
ATOM   7035 N  NE2 . HIS E  1 167 ? -12.097 -33.591 -43.149 1.00 31.43  ? 165 HIS E NE2 1 
ATOM   7036 N  N   . ILE E  1 168 ? -7.469  -36.790 -39.180 1.00 23.19  ? 166 ILE E N   1 
ATOM   7037 C  CA  . ILE E  1 168 ? -6.232  -37.095 -38.463 1.00 21.90  ? 166 ILE E CA  1 
ATOM   7038 C  C   . ILE E  1 168 ? -5.792  -38.531 -38.731 1.00 21.98  ? 166 ILE E C   1 
ATOM   7039 O  O   . ILE E  1 168 ? -6.552  -39.474 -38.565 1.00 22.86  ? 166 ILE E O   1 
ATOM   7040 C  CB  . ILE E  1 168 ? -6.407  -36.966 -36.947 1.00 21.76  ? 166 ILE E CB  1 
ATOM   7041 C  CG1 . ILE E  1 168 ? -6.895  -35.567 -36.609 1.00 22.23  ? 166 ILE E CG1 1 
ATOM   7042 C  CG2 . ILE E  1 168 ? -5.086  -37.252 -36.240 1.00 21.67  ? 166 ILE E CG2 1 
ATOM   7043 C  CD1 . ILE E  1 168 ? -7.248  -35.385 -35.147 1.00 23.34  ? 166 ILE E CD1 1 
ATOM   7044 N  N   . VAL E  1 169 ? -4.567  -38.682 -39.201 1.00 21.24  ? 167 VAL E N   1 
ATOM   7045 C  CA  . VAL E  1 169 ? -4.090  -39.957 -39.633 1.00 21.40  ? 167 VAL E CA  1 
ATOM   7046 C  C   . VAL E  1 169 ? -2.748  -40.257 -39.002 1.00 19.99  ? 167 VAL E C   1 
ATOM   7047 O  O   . VAL E  1 169 ? -1.957  -39.349 -38.730 1.00 18.15  ? 167 VAL E O   1 
ATOM   7048 C  CB  . VAL E  1 169 ? -3.982  -39.951 -41.166 1.00 22.93  ? 167 VAL E CB  1 
ATOM   7049 C  CG1 . VAL E  1 169 ? -3.039  -41.032 -41.650 1.00 24.50  ? 167 VAL E CG1 1 
ATOM   7050 C  CG2 . VAL E  1 169 ? -5.360  -40.122 -41.777 1.00 24.21  ? 167 VAL E CG2 1 
ATOM   7051 N  N   . PHE E  1 170 ? -2.501  -41.540 -38.769 1.00 20.00  ? 168 PHE E N   1 
ATOM   7052 C  CA  . PHE E  1 170 ? -1.227  -42.001 -38.286 1.00 19.63  ? 168 PHE E CA  1 
ATOM   7053 C  C   . PHE E  1 170 ? -0.663  -42.967 -39.292 1.00 21.09  ? 168 PHE E C   1 
ATOM   7054 O  O   . PHE E  1 170 ? -1.031  -44.141 -39.317 1.00 23.29  ? 168 PHE E O   1 
ATOM   7055 C  CB  . PHE E  1 170 ? -1.379  -42.649 -36.917 1.00 19.84  ? 168 PHE E CB  1 
ATOM   7056 C  CG  . PHE E  1 170 ? -1.834  -41.691 -35.870 1.00 19.20  ? 168 PHE E CG  1 
ATOM   7057 C  CD1 . PHE E  1 170 ? -3.180  -41.568 -35.574 1.00 20.24  ? 168 PHE E CD1 1 
ATOM   7058 C  CD2 . PHE E  1 170 ? -0.926  -40.853 -35.236 1.00 18.39  ? 168 PHE E CD2 1 
ATOM   7059 C  CE1 . PHE E  1 170 ? -3.613  -40.647 -34.636 1.00 20.04  ? 168 PHE E CE1 1 
ATOM   7060 C  CE2 . PHE E  1 170 ? -1.346  -39.942 -34.284 1.00 18.06  ? 168 PHE E CE2 1 
ATOM   7061 C  CZ  . PHE E  1 170 ? -2.695  -39.838 -33.988 1.00 19.11  ? 168 PHE E CZ  1 
ATOM   7062 N  N   . PRO E  1 171 ? 0.224   -42.464 -40.155 1.00 21.59  ? 169 PRO E N   1 
ATOM   7063 C  CA  . PRO E  1 171 ? 0.810   -43.273 -41.214 1.00 22.94  ? 169 PRO E CA  1 
ATOM   7064 C  C   . PRO E  1 171 ? 1.476   -44.545 -40.693 1.00 23.56  ? 169 PRO E C   1 
ATOM   7065 O  O   . PRO E  1 171 ? 2.145   -44.534 -39.662 1.00 21.65  ? 169 PRO E O   1 
ATOM   7066 C  CB  . PRO E  1 171 ? 1.840   -42.336 -41.852 1.00 21.46  ? 169 PRO E CB  1 
ATOM   7067 C  CG  . PRO E  1 171 ? 1.347   -40.971 -41.537 1.00 20.56  ? 169 PRO E CG  1 
ATOM   7068 C  CD  . PRO E  1 171 ? 0.716   -41.079 -40.182 1.00 20.29  ? 169 PRO E CD  1 
ATOM   7069 N  N   . VAL E  1 172 ? 1.301   -45.619 -41.446 1.00 25.68  ? 170 VAL E N   1 
ATOM   7070 C  CA  . VAL E  1 172 ? 1.793   -46.921 -41.070 1.00 27.59  ? 170 VAL E CA  1 
ATOM   7071 C  C   . VAL E  1 172 ? 3.300   -46.991 -41.322 1.00 27.80  ? 170 VAL E C   1 
ATOM   7072 O  O   . VAL E  1 172 ? 3.764   -46.651 -42.403 1.00 29.94  ? 170 VAL E O   1 
ATOM   7073 C  CB  . VAL E  1 172 ? 1.064   -48.009 -41.884 1.00 30.58  ? 170 VAL E CB  1 
ATOM   7074 C  CG1 . VAL E  1 172 ? 1.638   -49.387 -41.586 1.00 32.64  ? 170 VAL E CG1 1 
ATOM   7075 C  CG2 . VAL E  1 172 ? -0.431  -47.962 -41.585 1.00 28.83  ? 170 VAL E CG2 1 
ATOM   7076 N  N   . PRO E  1 173 ? 4.077   -47.398 -40.303 1.00 27.10  ? 171 PRO E N   1 
ATOM   7077 C  CA  . PRO E  1 173 ? 5.513   -47.593 -40.484 1.00 26.71  ? 171 PRO E CA  1 
ATOM   7078 C  C   . PRO E  1 173 ? 5.836   -48.532 -41.640 1.00 27.11  ? 171 PRO E C   1 
ATOM   7079 O  O   . PRO E  1 173 ? 5.145   -49.532 -41.829 1.00 28.34  ? 171 PRO E O   1 
ATOM   7080 C  CB  . PRO E  1 173 ? 5.960   -48.213 -39.155 1.00 26.70  ? 171 PRO E CB  1 
ATOM   7081 C  CG  . PRO E  1 173 ? 4.929   -47.791 -38.164 1.00 25.81  ? 171 PRO E CG  1 
ATOM   7082 C  CD  . PRO E  1 173 ? 3.641   -47.686 -38.923 1.00 26.46  ? 171 PRO E CD  1 
ATOM   7083 N  N   . ILE E  1 174 ? 6.875   -48.191 -42.404 1.00 26.25  ? 172 ILE E N   1 
ATOM   7084 C  CA  . ILE E  1 174 ? 7.403   -49.052 -43.457 1.00 27.21  ? 172 ILE E CA  1 
ATOM   7085 C  C   . ILE E  1 174 ? 8.922   -48.994 -43.442 1.00 27.41  ? 172 ILE E C   1 
ATOM   7086 O  O   . ILE E  1 174 ? 9.506   -48.167 -42.749 1.00 25.40  ? 172 ILE E O   1 
ATOM   7087 C  CB  . ILE E  1 174 ? 6.939   -48.585 -44.844 1.00 28.18  ? 172 ILE E CB  1 
ATOM   7088 C  CG1 . ILE E  1 174 ? 7.437   -47.157 -45.108 1.00 27.52  ? 172 ILE E CG1 1 
ATOM   7089 C  CG2 . ILE E  1 174 ? 5.422   -48.660 -44.956 1.00 27.98  ? 172 ILE E CG2 1 
ATOM   7090 C  CD1 . ILE E  1 174 ? 7.269   -46.720 -46.551 1.00 29.45  ? 172 ILE E CD1 1 
ATOM   7091 N  N   . ASP E  1 175 ? 9.555   -49.859 -44.233 1.00 30.80  ? 173 ASP E N   1 
ATOM   7092 C  CA  . ASP E  1 175 ? 11.015  -49.985 -44.247 1.00 32.53  ? 173 ASP E CA  1 
ATOM   7093 C  C   . ASP E  1 175 ? 11.642  -49.449 -45.531 1.00 32.33  ? 173 ASP E C   1 
ATOM   7094 O  O   . ASP E  1 175 ? 12.804  -49.061 -45.546 1.00 32.71  ? 173 ASP E O   1 
ATOM   7095 C  CB  . ASP E  1 175 ? 11.408  -51.452 -44.051 1.00 34.81  ? 173 ASP E CB  1 
ATOM   7096 C  CG  . ASP E  1 175 ? 11.181  -51.923 -42.628 1.00 35.40  ? 173 ASP E CG  1 
ATOM   7097 O  OD1 . ASP E  1 175 ? 10.932  -53.129 -42.427 1.00 35.59  ? 173 ASP E OD1 1 
ATOM   7098 O  OD2 . ASP E  1 175 ? 11.240  -51.075 -41.708 1.00 35.14  ? 173 ASP E OD2 1 
ATOM   7099 N  N   . GLN E  1 176 ? 10.872  -49.438 -46.610 1.00 31.86  ? 174 GLN E N   1 
ATOM   7100 C  CA  . GLN E  1 176 ? 11.382  -49.014 -47.910 1.00 32.76  ? 174 GLN E CA  1 
ATOM   7101 C  C   . GLN E  1 176 ? 11.665  -47.503 -47.918 1.00 31.50  ? 174 GLN E C   1 
ATOM   7102 O  O   . GLN E  1 176 ? 10.871  -46.714 -47.398 1.00 29.03  ? 174 GLN E O   1 
ATOM   7103 C  CB  . GLN E  1 176 ? 10.370  -49.380 -49.003 1.00 34.90  ? 174 GLN E CB  1 
ATOM   7104 C  CG  . GLN E  1 176 ? 10.101  -50.879 -49.118 1.00 36.16  ? 174 GLN E CG  1 
ATOM   7105 C  CD  . GLN E  1 176 ? 8.840   -51.339 -48.387 1.00 36.12  ? 174 GLN E CD  1 
ATOM   7106 O  OE1 . GLN E  1 176 ? 8.329   -50.660 -47.498 1.00 35.28  ? 174 GLN E OE1 1 
ATOM   7107 N  NE2 . GLN E  1 176 ? 8.348   -52.514 -48.750 1.00 37.37  ? 174 GLN E NE2 1 
ATOM   7108 N  N   . CYS E  1 177 ? 12.824  -47.132 -48.466 1.00 31.57  ? 175 CYS E N   1 
ATOM   7109 C  CA  . CYS E  1 177 ? 13.161  -45.750 -48.826 1.00 30.74  ? 175 CYS E CA  1 
ATOM   7110 C  C   . CYS E  1 177 ? 13.518  -44.853 -47.636 1.00 29.27  ? 175 CYS E C   1 
ATOM   7111 O  O   . CYS E  1 177 ? 14.434  -44.037 -47.735 1.00 27.56  ? 175 CYS E O   1 
ATOM   7112 C  CB  . CYS E  1 177 ? 12.041  -45.097 -49.640 1.00 31.12  ? 175 CYS E CB  1 
ATOM   7113 S  SG  . CYS E  1 177 ? 11.755  -45.872 -51.246 1.00 33.11  ? 175 CYS E SG  1 
ATOM   7114 N  N   . ILE E  1 178 ? 12.793  -44.980 -46.526 1.00 28.82  ? 176 ILE E N   1 
ATOM   7115 C  CA  . ILE E  1 178 ? 12.838  -43.957 -45.481 1.00 28.90  ? 176 ILE E CA  1 
ATOM   7116 C  C   . ILE E  1 178 ? 13.890  -44.200 -44.400 1.00 30.87  ? 176 ILE E C   1 
ATOM   7117 O  O   . ILE E  1 178 ? 13.975  -43.433 -43.438 1.00 31.87  ? 176 ILE E O   1 
ATOM   7118 C  CB  . ILE E  1 178 ? 11.458  -43.746 -44.830 1.00 27.50  ? 176 ILE E CB  1 
ATOM   7119 C  CG1 . ILE E  1 178 ? 11.058  -44.949 -43.969 1.00 27.68  ? 176 ILE E CG1 1 
ATOM   7120 C  CG2 . ILE E  1 178 ? 10.411  -43.496 -45.904 1.00 28.26  ? 176 ILE E CG2 1 
ATOM   7121 C  CD1 . ILE E  1 178 ? 9.705   -44.790 -43.297 1.00 27.38  ? 176 ILE E CD1 1 
ATOM   7122 N  N   . ASP E  1 179 ? 14.727  -45.217 -44.588 1.00 33.54  ? 177 ASP E N   1 
ATOM   7123 C  CA  . ASP E  1 179 ? 15.667  -45.643 -43.551 1.00 38.33  ? 177 ASP E CA  1 
ATOM   7124 C  C   . ASP E  1 179 ? 17.126  -45.427 -43.953 1.00 37.59  ? 177 ASP E C   1 
ATOM   7125 O  O   . ASP E  1 179 ? 17.408  -44.914 -45.033 1.00 39.95  ? 177 ASP E O   1 
ATOM   7126 C  CB  . ASP E  1 179 ? 15.431  -47.119 -43.205 1.00 39.23  ? 177 ASP E CB  1 
ATOM   7127 C  CG  . ASP E  1 179 ? 14.164  -47.328 -42.398 1.00 40.49  ? 177 ASP E CG  1 
ATOM   7128 O  OD1 . ASP E  1 179 ? 13.569  -46.324 -41.956 1.00 40.38  ? 177 ASP E OD1 1 
ATOM   7129 O  OD2 . ASP E  1 179 ? 13.756  -48.491 -42.203 1.00 45.50  ? 177 ASP E OD2 1 
ATOM   7130 N  N   . SER F  1 5   ? 40.387  -88.338 4.041   1.00 66.33  ? 3   SER F N   1 
ATOM   7131 C  CA  . SER F  1 5   ? 40.190  -86.981 3.426   1.00 67.22  ? 3   SER F CA  1 
ATOM   7132 C  C   . SER F  1 5   ? 41.282  -85.975 3.826   1.00 70.22  ? 3   SER F C   1 
ATOM   7133 O  O   . SER F  1 5   ? 41.709  -85.929 4.983   1.00 67.32  ? 3   SER F O   1 
ATOM   7134 C  CB  . SER F  1 5   ? 38.812  -86.409 3.776   1.00 60.90  ? 3   SER F CB  1 
ATOM   7135 N  N   . THR F  1 6   ? 41.733  -85.186 2.850   1.00 71.95  ? 4   THR F N   1 
ATOM   7136 C  CA  . THR F  1 6   ? 42.368  -83.894 3.105   1.00 69.87  ? 4   THR F CA  1 
ATOM   7137 C  C   . THR F  1 6   ? 41.695  -82.837 2.220   1.00 68.45  ? 4   THR F C   1 
ATOM   7138 O  O   . THR F  1 6   ? 41.093  -83.165 1.193   1.00 67.73  ? 4   THR F O   1 
ATOM   7139 C  CB  . THR F  1 6   ? 43.887  -83.944 2.804   1.00 71.70  ? 4   THR F CB  1 
ATOM   7140 O  OG1 . THR F  1 6   ? 44.482  -85.046 3.504   1.00 74.02  ? 4   THR F OG1 1 
ATOM   7141 C  CG2 . THR F  1 6   ? 44.583  -82.644 3.222   1.00 69.00  ? 4   THR F CG2 1 
ATOM   7142 N  N   . SER F  1 7   ? 41.765  -81.577 2.636   1.00 66.35  ? 5   SER F N   1 
ATOM   7143 C  CA  . SER F  1 7   ? 41.321  -80.472 1.798   1.00 65.46  ? 5   SER F CA  1 
ATOM   7144 C  C   . SER F  1 7   ? 41.731  -79.133 2.426   1.00 58.53  ? 5   SER F C   1 
ATOM   7145 O  O   . SER F  1 7   ? 42.049  -79.066 3.614   1.00 54.73  ? 5   SER F O   1 
ATOM   7146 C  CB  . SER F  1 7   ? 39.801  -80.538 1.617   1.00 68.36  ? 5   SER F CB  1 
ATOM   7147 O  OG  . SER F  1 7   ? 39.134  -80.435 2.866   1.00 66.56  ? 5   SER F OG  1 
ATOM   7148 N  N   . ASP F  1 8   ? 41.728  -78.076 1.619   1.00 51.32  ? 6   ASP F N   1 
ATOM   7149 C  CA  . ASP F  1 8   ? 42.165  -76.763 2.070   1.00 47.49  ? 6   ASP F CA  1 
ATOM   7150 C  C   . ASP F  1 8   ? 41.128  -75.715 1.711   1.00 41.49  ? 6   ASP F C   1 
ATOM   7151 O  O   . ASP F  1 8   ? 40.702  -75.627 0.562   1.00 40.65  ? 6   ASP F O   1 
ATOM   7152 C  CB  . ASP F  1 8   ? 43.516  -76.398 1.459   1.00 49.11  ? 6   ASP F CB  1 
ATOM   7153 C  CG  . ASP F  1 8   ? 44.690  -77.072 2.174   1.00 53.92  ? 6   ASP F CG  1 
ATOM   7154 O  OD1 . ASP F  1 8   ? 45.359  -76.441 3.027   1.00 56.25  ? 6   ASP F OD1 1 
ATOM   7155 O  OD2 . ASP F  1 8   ? 44.952  -78.249 1.873   1.00 55.84  ? 6   ASP F OD2 1 
ATOM   7156 N  N   . LEU F  1 9   ? 40.713  -74.934 2.702   1.00 36.78  ? 7   LEU F N   1 
ATOM   7157 C  CA  . LEU F  1 9   ? 39.582  -74.039 2.543   1.00 33.37  ? 7   LEU F CA  1 
ATOM   7158 C  C   . LEU F  1 9   ? 39.914  -72.647 3.037   1.00 31.87  ? 7   LEU F C   1 
ATOM   7159 O  O   . LEU F  1 9   ? 40.565  -72.472 4.068   1.00 35.40  ? 7   LEU F O   1 
ATOM   7160 C  CB  . LEU F  1 9   ? 38.369  -74.557 3.312   1.00 31.60  ? 7   LEU F CB  1 
ATOM   7161 C  CG  . LEU F  1 9   ? 37.721  -75.837 2.782   1.00 32.33  ? 7   LEU F CG  1 
ATOM   7162 C  CD1 . LEU F  1 9   ? 36.593  -76.264 3.704   1.00 31.83  ? 7   LEU F CD1 1 
ATOM   7163 C  CD2 . LEU F  1 9   ? 37.196  -75.640 1.371   1.00 31.89  ? 7   LEU F CD2 1 
ATOM   7164 N  N   . ILE F  1 10  ? 39.466  -71.651 2.296   1.00 29.31  ? 8   ILE F N   1 
ATOM   7165 C  CA  . ILE F  1 10  ? 39.508  -70.289 2.781   1.00 27.12  ? 8   ILE F CA  1 
ATOM   7166 C  C   . ILE F  1 10  ? 38.625  -70.199 4.012   1.00 25.14  ? 8   ILE F C   1 
ATOM   7167 O  O   . ILE F  1 10  ? 37.509  -70.699 4.006   1.00 23.64  ? 8   ILE F O   1 
ATOM   7168 C  CB  . ILE F  1 10  ? 39.033  -69.285 1.702   1.00 25.84  ? 8   ILE F CB  1 
ATOM   7169 C  CG1 . ILE F  1 10  ? 40.069  -69.220 0.575   1.00 27.81  ? 8   ILE F CG1 1 
ATOM   7170 C  CG2 . ILE F  1 10  ? 38.831  -67.905 2.308   1.00 23.71  ? 8   ILE F CG2 1 
ATOM   7171 C  CD1 . ILE F  1 10  ? 39.512  -68.727 -0.735  1.00 27.09  ? 8   ILE F CD1 1 
ATOM   7172 N  N   . PRO F  1 11  ? 39.144  -69.585 5.086   1.00 25.56  ? 9   PRO F N   1 
ATOM   7173 C  CA  . PRO F  1 11  ? 38.415  -69.521 6.343   1.00 24.82  ? 9   PRO F CA  1 
ATOM   7174 C  C   . PRO F  1 11  ? 37.102  -68.773 6.185   1.00 23.57  ? 9   PRO F C   1 
ATOM   7175 O  O   . PRO F  1 11  ? 37.036  -67.789 5.455   1.00 23.48  ? 9   PRO F O   1 
ATOM   7176 C  CB  . PRO F  1 11  ? 39.371  -68.751 7.269   1.00 24.53  ? 9   PRO F CB  1 
ATOM   7177 C  CG  . PRO F  1 11  ? 40.716  -68.908 6.663   1.00 25.88  ? 9   PRO F CG  1 
ATOM   7178 C  CD  . PRO F  1 11  ? 40.484  -68.981 5.191   1.00 26.17  ? 9   PRO F CD  1 
ATOM   7179 N  N   . ALA F  1 12  ? 36.065  -69.230 6.870   1.00 23.25  ? 10  ALA F N   1 
ATOM   7180 C  CA  . ALA F  1 12  ? 34.823  -68.468 6.936   1.00 22.15  ? 10  ALA F CA  1 
ATOM   7181 C  C   . ALA F  1 12  ? 35.104  -67.124 7.581   1.00 21.04  ? 10  ALA F C   1 
ATOM   7182 O  O   . ALA F  1 12  ? 35.906  -67.032 8.498   1.00 21.37  ? 10  ALA F O   1 
ATOM   7183 C  CB  . ALA F  1 12  ? 33.772  -69.225 7.730   1.00 22.13  ? 10  ALA F CB  1 
ATOM   7184 N  N   . PRO F  1 13  ? 34.433  -66.073 7.103   1.00 20.32  ? 11  PRO F N   1 
ATOM   7185 C  CA  . PRO F  1 13  ? 34.541  -64.803 7.789   1.00 20.40  ? 11  PRO F CA  1 
ATOM   7186 C  C   . PRO F  1 13  ? 33.816  -64.851 9.131   1.00 19.18  ? 11  PRO F C   1 
ATOM   7187 O  O   . PRO F  1 13  ? 32.874  -65.614 9.284   1.00 18.29  ? 11  PRO F O   1 
ATOM   7188 C  CB  . PRO F  1 13  ? 33.827  -63.852 6.838   1.00 20.12  ? 11  PRO F CB  1 
ATOM   7189 C  CG  . PRO F  1 13  ? 32.748  -64.693 6.232   1.00 19.19  ? 11  PRO F CG  1 
ATOM   7190 C  CD  . PRO F  1 13  ? 33.333  -66.078 6.123   1.00 19.84  ? 11  PRO F CD  1 
ATOM   7191 N  N   . PRO F  1 14  ? 34.237  -64.025 10.094  1.00 20.50  ? 12  PRO F N   1 
ATOM   7192 C  CA  . PRO F  1 14  ? 33.376  -63.791 11.258  1.00 21.08  ? 12  PRO F CA  1 
ATOM   7193 C  C   . PRO F  1 14  ? 32.014  -63.200 10.883  1.00 20.58  ? 12  PRO F C   1 
ATOM   7194 O  O   . PRO F  1 14  ? 31.923  -62.379 9.969   1.00 24.44  ? 12  PRO F O   1 
ATOM   7195 C  CB  . PRO F  1 14  ? 34.178  -62.793 12.095  1.00 21.33  ? 12  PRO F CB  1 
ATOM   7196 C  CG  . PRO F  1 14  ? 35.053  -62.078 11.115  1.00 22.19  ? 12  PRO F CG  1 
ATOM   7197 C  CD  . PRO F  1 14  ? 35.361  -63.074 10.025  1.00 22.42  ? 12  PRO F CD  1 
ATOM   7198 N  N   . LEU F  1 15  ? 30.970  -63.599 11.599  1.00 20.57  ? 13  LEU F N   1 
ATOM   7199 C  CA  . LEU F  1 15  ? 29.616  -63.169 11.294  1.00 22.46  ? 13  LEU F CA  1 
ATOM   7200 C  C   . LEU F  1 15  ? 29.426  -61.668 11.395  1.00 23.85  ? 13  LEU F C   1 
ATOM   7201 O  O   . LEU F  1 15  ? 28.516  -61.096 10.776  1.00 25.78  ? 13  LEU F O   1 
ATOM   7202 C  CB  . LEU F  1 15  ? 28.619  -63.869 12.212  1.00 23.68  ? 13  LEU F CB  1 
ATOM   7203 C  CG  . LEU F  1 15  ? 28.519  -65.364 11.916  1.00 28.03  ? 13  LEU F CG  1 
ATOM   7204 C  CD1 . LEU F  1 15  ? 27.489  -66.032 12.814  1.00 29.25  ? 13  LEU F CD1 1 
ATOM   7205 C  CD2 . LEU F  1 15  ? 28.185  -65.594 10.444  1.00 30.07  ? 13  LEU F CD2 1 
ATOM   7206 N  N   . SER F  1 16  ? 30.295  -61.026 12.160  1.00 25.50  ? 14  SER F N   1 
ATOM   7207 C  CA  . SER F  1 16  ? 30.240  -59.588 12.325  1.00 25.57  ? 14  SER F CA  1 
ATOM   7208 C  C   . SER F  1 16  ? 30.530  -58.860 11.007  1.00 24.03  ? 14  SER F C   1 
ATOM   7209 O  O   . SER F  1 16  ? 30.258  -57.673 10.884  1.00 30.29  ? 14  SER F O   1 
ATOM   7210 C  CB  . SER F  1 16  ? 31.236  -59.157 13.416  1.00 27.14  ? 14  SER F CB  1 
ATOM   7211 O  OG  . SER F  1 16  ? 32.576  -59.261 12.956  1.00 31.17  ? 14  SER F OG  1 
ATOM   7212 N  N   . LYS F  1 17  ? 31.078  -59.558 10.019  1.00 22.92  ? 15  LYS F N   1 
ATOM   7213 C  CA  . LYS F  1 17  ? 31.335  -58.940 8.716   1.00 24.34  ? 15  LYS F CA  1 
ATOM   7214 C  C   . LYS F  1 17  ? 30.219  -59.173 7.700   1.00 21.91  ? 15  LYS F C   1 
ATOM   7215 O  O   . LYS F  1 17  ? 30.349  -58.782 6.532   1.00 20.76  ? 15  LYS F O   1 
ATOM   7216 C  CB  . LYS F  1 17  ? 32.661  -59.447 8.134   1.00 27.63  ? 15  LYS F CB  1 
ATOM   7217 C  CG  . LYS F  1 17  ? 33.888  -58.802 8.749   1.00 33.04  ? 15  LYS F CG  1 
ATOM   7218 C  CD  . LYS F  1 17  ? 35.104  -58.952 7.843   1.00 39.69  ? 15  LYS F CD  1 
ATOM   7219 C  CE  . LYS F  1 17  ? 36.351  -59.265 8.650   1.00 43.17  ? 15  LYS F CE  1 
ATOM   7220 N  NZ  . LYS F  1 17  ? 37.579  -58.766 7.977   1.00 48.19  ? 15  LYS F NZ  1 
ATOM   7221 N  N   . VAL F  1 18  ? 29.149  -59.836 8.138   1.00 18.10  ? 16  VAL F N   1 
ATOM   7222 C  CA  . VAL F  1 18  ? 28.034  -60.171 7.267   1.00 16.15  ? 16  VAL F CA  1 
ATOM   7223 C  C   . VAL F  1 18  ? 26.758  -59.442 7.715   1.00 15.49  ? 16  VAL F C   1 
ATOM   7224 O  O   . VAL F  1 18  ? 26.080  -59.869 8.643   1.00 14.94  ? 16  VAL F O   1 
ATOM   7225 C  CB  . VAL F  1 18  ? 27.760  -61.686 7.278   1.00 16.69  ? 16  VAL F CB  1 
ATOM   7226 C  CG1 . VAL F  1 18  ? 26.663  -62.033 6.291   1.00 16.91  ? 16  VAL F CG1 1 
ATOM   7227 C  CG2 . VAL F  1 18  ? 29.033  -62.464 6.963   1.00 17.60  ? 16  VAL F CG2 1 
ATOM   7228 N  N   . PRO F  1 19  ? 26.419  -58.336 7.043   1.00 15.22  ? 17  PRO F N   1 
ATOM   7229 C  CA  . PRO F  1 19  ? 25.237  -57.572 7.423   1.00 14.87  ? 17  PRO F CA  1 
ATOM   7230 C  C   . PRO F  1 19  ? 23.950  -58.387 7.345   1.00 15.30  ? 17  PRO F C   1 
ATOM   7231 O  O   . PRO F  1 19  ? 23.867  -59.370 6.613   1.00 14.69  ? 17  PRO F O   1 
ATOM   7232 C  CB  . PRO F  1 19  ? 25.199  -56.438 6.388   1.00 14.51  ? 17  PRO F CB  1 
ATOM   7233 C  CG  . PRO F  1 19  ? 26.603  -56.300 5.905   1.00 14.50  ? 17  PRO F CG  1 
ATOM   7234 C  CD  . PRO F  1 19  ? 27.194  -57.679 5.972   1.00 15.22  ? 17  PRO F CD  1 
ATOM   7235 N  N   . LEU F  1 20  ? 22.956  -57.955 8.109   1.00 16.92  ? 18  LEU F N   1 
ATOM   7236 C  CA  . LEU F  1 20  ? 21.619  -58.504 8.050   1.00 16.97  ? 18  LEU F CA  1 
ATOM   7237 C  C   . LEU F  1 20  ? 20.673  -57.453 7.496   1.00 17.74  ? 18  LEU F C   1 
ATOM   7238 O  O   . LEU F  1 20  ? 20.615  -56.331 7.994   1.00 20.38  ? 18  LEU F O   1 
ATOM   7239 C  CB  . LEU F  1 20  ? 21.185  -58.900 9.454   1.00 17.75  ? 18  LEU F CB  1 
ATOM   7240 C  CG  . LEU F  1 20  ? 19.753  -59.399 9.594   1.00 19.26  ? 18  LEU F CG  1 
ATOM   7241 C  CD1 . LEU F  1 20  ? 19.625  -60.789 8.998   1.00 18.82  ? 18  LEU F CD1 1 
ATOM   7242 C  CD2 . LEU F  1 20  ? 19.340  -59.384 11.064  1.00 18.17  ? 18  LEU F CD2 1 
ATOM   7243 N  N   . GLN F  1 21  ? 19.935  -57.804 6.454   1.00 18.66  ? 19  GLN F N   1 
ATOM   7244 C  CA  . GLN F  1 21  ? 18.895  -56.915 5.938   1.00 20.02  ? 19  GLN F CA  1 
ATOM   7245 C  C   . GLN F  1 21  ? 18.027  -56.376 7.079   1.00 19.78  ? 19  GLN F C   1 
ATOM   7246 O  O   . GLN F  1 21  ? 17.457  -57.142 7.849   1.00 20.63  ? 19  GLN F O   1 
ATOM   7247 C  CB  . GLN F  1 21  ? 18.040  -57.655 4.915   1.00 19.32  ? 19  GLN F CB  1 
ATOM   7248 C  CG  . GLN F  1 21  ? 16.829  -56.887 4.406   1.00 20.61  ? 19  GLN F CG  1 
ATOM   7249 C  CD  . GLN F  1 21  ? 17.182  -55.618 3.643   1.00 21.07  ? 19  GLN F CD  1 
ATOM   7250 O  OE1 . GLN F  1 21  ? 18.052  -55.609 2.774   1.00 19.79  ? 19  GLN F OE1 1 
ATOM   7251 N  NE2 . GLN F  1 21  ? 16.516  -54.533 3.989   1.00 23.59  ? 19  GLN F NE2 1 
ATOM   7252 N  N   . GLN F  1 22  ? 17.956  -55.055 7.198   1.00 20.90  ? 20  GLN F N   1 
ATOM   7253 C  CA  . GLN F  1 22  ? 17.110  -54.415 8.203   1.00 21.96  ? 20  GLN F CA  1 
ATOM   7254 C  C   . GLN F  1 22  ? 15.641  -54.749 7.960   1.00 20.70  ? 20  GLN F C   1 
ATOM   7255 O  O   . GLN F  1 22  ? 15.180  -54.726 6.813   1.00 17.87  ? 20  GLN F O   1 
ATOM   7256 C  CB  . GLN F  1 22  ? 17.262  -52.897 8.127   1.00 24.62  ? 20  GLN F CB  1 
ATOM   7257 C  CG  . GLN F  1 22  ? 18.558  -52.309 8.669   1.00 25.77  ? 20  GLN F CG  1 
ATOM   7258 C  CD  . GLN F  1 22  ? 18.845  -50.942 8.057   1.00 27.42  ? 20  GLN F CD  1 
ATOM   7259 O  OE1 . GLN F  1 22  ? 17.987  -50.365 7.377   1.00 23.46  ? 20  GLN F OE1 1 
ATOM   7260 N  NE2 . GLN F  1 22  ? 20.059  -50.432 8.271   1.00 26.16  ? 20  GLN F NE2 1 
ATOM   7261 N  N   . ASN F  1 23  ? 14.916  -55.042 9.039   1.00 18.06  ? 21  ASN F N   1 
ATOM   7262 C  CA  . ASN F  1 23  ? 13.469  -55.179 8.984   1.00 19.53  ? 21  ASN F CA  1 
ATOM   7263 C  C   . ASN F  1 23  ? 13.028  -56.110 7.857   1.00 19.46  ? 21  ASN F C   1 
ATOM   7264 O  O   . ASN F  1 23  ? 12.205  -55.752 7.014   1.00 19.84  ? 21  ASN F O   1 
ATOM   7265 C  CB  . ASN F  1 23  ? 12.814  -53.806 8.827   1.00 20.82  ? 21  ASN F CB  1 
ATOM   7266 C  CG  . ASN F  1 23  ? 11.320  -53.838 9.088   1.00 22.36  ? 21  ASN F CG  1 
ATOM   7267 O  OD1 . ASN F  1 23  ? 10.826  -54.667 9.847   1.00 23.72  ? 21  ASN F OD1 1 
ATOM   7268 N  ND2 . ASN F  1 23  ? 10.590  -52.920 8.460   1.00 23.39  ? 21  ASN F ND2 1 
ATOM   7269 N  N   . PHE F  1 24  ? 13.553  -57.326 7.878   1.00 18.49  ? 22  PHE F N   1 
ATOM   7270 C  CA  . PHE F  1 24  ? 13.274  -58.287 6.829   1.00 18.30  ? 22  PHE F CA  1 
ATOM   7271 C  C   . PHE F  1 24  ? 11.771  -58.551 6.682   1.00 20.17  ? 22  PHE F C   1 
ATOM   7272 O  O   . PHE F  1 24  ? 11.073  -58.776 7.661   1.00 20.51  ? 22  PHE F O   1 
ATOM   7273 C  CB  . PHE F  1 24  ? 14.026  -59.589 7.112   1.00 17.54  ? 22  PHE F CB  1 
ATOM   7274 C  CG  . PHE F  1 24  ? 13.778  -60.666 6.101   1.00 16.04  ? 22  PHE F CG  1 
ATOM   7275 C  CD1 . PHE F  1 24  ? 12.955  -61.723 6.392   1.00 16.11  ? 22  PHE F CD1 1 
ATOM   7276 C  CD2 . PHE F  1 24  ? 14.376  -60.618 4.865   1.00 15.02  ? 22  PHE F CD2 1 
ATOM   7277 C  CE1 . PHE F  1 24  ? 12.733  -62.719 5.466   1.00 16.64  ? 22  PHE F CE1 1 
ATOM   7278 C  CE2 . PHE F  1 24  ? 14.163  -61.614 3.934   1.00 14.68  ? 22  PHE F CE2 1 
ATOM   7279 C  CZ  . PHE F  1 24  ? 13.335  -62.663 4.232   1.00 15.01  ? 22  PHE F CZ  1 
ATOM   7280 N  N   . GLN F  1 25  ? 11.296  -58.561 5.439   1.00 22.19  ? 23  GLN F N   1 
ATOM   7281 C  CA  . GLN F  1 25  ? 9.883   -58.777 5.141   1.00 23.63  ? 23  GLN F CA  1 
ATOM   7282 C  C   . GLN F  1 25  ? 9.685   -60.151 4.475   1.00 24.72  ? 23  GLN F C   1 
ATOM   7283 O  O   . GLN F  1 25  ? 9.868   -60.303 3.259   1.00 22.88  ? 23  GLN F O   1 
ATOM   7284 C  CB  . GLN F  1 25  ? 9.380   -57.685 4.194   1.00 25.45  ? 23  GLN F CB  1 
ATOM   7285 C  CG  . GLN F  1 25  ? 9.486   -56.254 4.704   1.00 27.61  ? 23  GLN F CG  1 
ATOM   7286 C  CD  . GLN F  1 25  ? 8.587   -55.972 5.890   1.00 32.82  ? 23  GLN F CD  1 
ATOM   7287 O  OE1 . GLN F  1 25  ? 7.373   -55.891 5.739   1.00 36.22  ? 23  GLN F OE1 1 
ATOM   7288 N  NE2 . GLN F  1 25  ? 9.182   -55.806 7.077   1.00 34.17  ? 23  GLN F NE2 1 
ATOM   7289 N  N   . ASP F  1 26  ? 9.311   -61.150 5.269   1.00 24.94  ? 24  ASP F N   1 
ATOM   7290 C  CA  . ASP F  1 26  ? 9.313   -62.530 4.790   1.00 24.41  ? 24  ASP F CA  1 
ATOM   7291 C  C   . ASP F  1 26  ? 8.331   -62.753 3.638   1.00 24.35  ? 24  ASP F C   1 
ATOM   7292 O  O   . ASP F  1 26  ? 8.594   -63.538 2.721   1.00 26.12  ? 24  ASP F O   1 
ATOM   7293 C  CB  . ASP F  1 26  ? 9.072   -63.517 5.939   1.00 24.79  ? 24  ASP F CB  1 
ATOM   7294 C  CG  . ASP F  1 26  ? 7.763   -63.274 6.676   1.00 26.66  ? 24  ASP F CG  1 
ATOM   7295 O  OD1 . ASP F  1 26  ? 6.977   -62.384 6.294   1.00 27.98  ? 24  ASP F OD1 1 
ATOM   7296 O  OD2 . ASP F  1 26  ? 7.511   -64.000 7.656   1.00 27.65  ? 24  ASP F OD2 1 
ATOM   7297 N  N   . ASN F  1 27  ? 7.212   -62.048 3.663   1.00 25.83  ? 25  ASN F N   1 
ATOM   7298 C  CA  . ASN F  1 27  ? 6.198   -62.210 2.627   1.00 29.06  ? 25  ASN F CA  1 
ATOM   7299 C  C   . ASN F  1 27  ? 6.678   -61.655 1.287   1.00 27.12  ? 25  ASN F C   1 
ATOM   7300 O  O   . ASN F  1 27  ? 6.466   -62.254 0.244   1.00 26.74  ? 25  ASN F O   1 
ATOM   7301 C  CB  . ASN F  1 27  ? 4.898   -61.527 3.052   1.00 31.24  ? 25  ASN F CB  1 
ATOM   7302 C  CG  . ASN F  1 27  ? 3.708   -61.980 2.232   1.00 36.70  ? 25  ASN F CG  1 
ATOM   7303 O  OD1 . ASN F  1 27  ? 2.841   -62.714 2.722   1.00 41.74  ? 25  ASN F OD1 1 
ATOM   7304 N  ND2 . ASN F  1 27  ? 3.658   -61.550 0.982   1.00 34.72  ? 25  ASN F ND2 1 
ATOM   7305 N  N   . GLN F  1 28  ? 7.343   -60.514 1.328   1.00 27.29  ? 26  GLN F N   1 
ATOM   7306 C  CA  . GLN F  1 28  ? 7.835   -59.880 0.112   1.00 27.44  ? 26  GLN F CA  1 
ATOM   7307 C  C   . GLN F  1 28  ? 9.000   -60.661 -0.493  1.00 24.66  ? 26  GLN F C   1 
ATOM   7308 O  O   . GLN F  1 28  ? 9.299   -60.503 -1.664  1.00 23.87  ? 26  GLN F O   1 
ATOM   7309 C  CB  . GLN F  1 28  ? 8.308   -58.462 0.415   1.00 30.67  ? 26  GLN F CB  1 
ATOM   7310 C  CG  . GLN F  1 28  ? 7.212   -57.443 0.668   1.00 33.54  ? 26  GLN F CG  1 
ATOM   7311 C  CD  . GLN F  1 28  ? 7.750   -56.019 0.649   1.00 35.77  ? 26  GLN F CD  1 
ATOM   7312 O  OE1 . GLN F  1 28  ? 8.281   -55.550 -0.366  1.00 31.73  ? 26  GLN F OE1 1 
ATOM   7313 N  NE2 . GLN F  1 28  ? 7.623   -55.326 1.776   1.00 37.42  ? 26  GLN F NE2 1 
ATOM   7314 N  N   . PHE F  1 29  ? 9.668   -61.498 0.304   1.00 24.03  ? 27  PHE F N   1 
ATOM   7315 C  CA  . PHE F  1 29  ? 10.855  -62.222 -0.168  1.00 22.21  ? 27  PHE F CA  1 
ATOM   7316 C  C   . PHE F  1 29  ? 10.504  -63.493 -0.915  1.00 20.80  ? 27  PHE F C   1 
ATOM   7317 O  O   . PHE F  1 29  ? 11.340  -64.094 -1.568  1.00 19.70  ? 27  PHE F O   1 
ATOM   7318 C  CB  . PHE F  1 29  ? 11.789  -62.558 0.993   1.00 20.88  ? 27  PHE F CB  1 
ATOM   7319 C  CG  . PHE F  1 29  ? 13.158  -62.997 0.562   1.00 18.44  ? 27  PHE F CG  1 
ATOM   7320 C  CD1 . PHE F  1 29  ? 13.533  -64.327 0.636   1.00 18.95  ? 27  PHE F CD1 1 
ATOM   7321 C  CD2 . PHE F  1 29  ? 14.066  -62.080 0.066   1.00 17.43  ? 27  PHE F CD2 1 
ATOM   7322 C  CE1 . PHE F  1 29  ? 14.794  -64.729 0.219   1.00 18.62  ? 27  PHE F CE1 1 
ATOM   7323 C  CE2 . PHE F  1 29  ? 15.318  -62.476 -0.353  1.00 16.31  ? 27  PHE F CE2 1 
ATOM   7324 C  CZ  . PHE F  1 29  ? 15.688  -63.801 -0.268  1.00 16.17  ? 27  PHE F CZ  1 
ATOM   7325 N  N   . GLN F  1 30  ? 9.262   -63.920 -0.817  1.00 22.10  ? 28  GLN F N   1 
ATOM   7326 C  CA  . GLN F  1 30  ? 8.933   -65.200 -1.386  1.00 23.49  ? 28  GLN F CA  1 
ATOM   7327 C  C   . GLN F  1 30  ? 8.808   -65.161 -2.925  1.00 23.25  ? 28  GLN F C   1 
ATOM   7328 O  O   . GLN F  1 30  ? 8.905   -64.097 -3.540  1.00 22.14  ? 28  GLN F O   1 
ATOM   7329 C  CB  . GLN F  1 30  ? 7.714   -65.799 -0.698  1.00 26.09  ? 28  GLN F CB  1 
ATOM   7330 C  CG  . GLN F  1 30  ? 6.384   -65.366 -1.256  1.00 29.34  ? 28  GLN F CG  1 
ATOM   7331 C  CD  . GLN F  1 30  ? 5.250   -65.774 -0.335  1.00 32.76  ? 28  GLN F CD  1 
ATOM   7332 O  OE1 . GLN F  1 30  ? 5.063   -66.961 -0.050  1.00 31.57  ? 28  GLN F OE1 1 
ATOM   7333 N  NE2 . GLN F  1 30  ? 4.501   -64.791 0.154   1.00 34.99  ? 28  GLN F NE2 1 
ATOM   7334 N  N   . GLY F  1 31  ? 8.680   -66.339 -3.536  1.00 22.21  ? 29  GLY F N   1 
ATOM   7335 C  CA  . GLY F  1 31  ? 8.641   -66.478 -4.982  1.00 21.80  ? 29  GLY F CA  1 
ATOM   7336 C  C   . GLY F  1 31  ? 9.954   -66.979 -5.560  1.00 22.48  ? 29  GLY F C   1 
ATOM   7337 O  O   . GLY F  1 31  ? 10.810  -67.507 -4.844  1.00 21.96  ? 29  GLY F O   1 
ATOM   7338 N  N   . LYS F  1 32  ? 10.101  -66.833 -6.872  1.00 21.76  ? 30  LYS F N   1 
ATOM   7339 C  CA  . LYS F  1 32  ? 11.231  -67.401 -7.571  1.00 22.07  ? 30  LYS F CA  1 
ATOM   7340 C  C   . LYS F  1 32  ? 12.371  -66.389 -7.603  1.00 21.20  ? 30  LYS F C   1 
ATOM   7341 O  O   . LYS F  1 32  ? 12.159  -65.205 -7.865  1.00 20.52  ? 30  LYS F O   1 
ATOM   7342 C  CB  . LYS F  1 32  ? 10.836  -67.807 -8.989  1.00 24.02  ? 30  LYS F CB  1 
ATOM   7343 C  CG  . LYS F  1 32  ? 11.983  -68.403 -9.786  1.00 26.81  ? 30  LYS F CG  1 
ATOM   7344 C  CD  . LYS F  1 32  ? 11.546  -68.817 -11.175 1.00 28.96  ? 30  LYS F CD  1 
ATOM   7345 C  CE  . LYS F  1 32  ? 10.920  -70.195 -11.174 1.00 32.70  ? 30  LYS F CE  1 
ATOM   7346 N  NZ  . LYS F  1 32  ? 10.537  -70.611 -12.553 1.00 35.02  ? 30  LYS F NZ  1 
ATOM   7347 N  N   . TRP F  1 33  ? 13.578  -66.871 -7.321  1.00 19.91  ? 31  TRP F N   1 
ATOM   7348 C  CA  . TRP F  1 33  ? 14.786  -66.104 -7.529  1.00 17.55  ? 31  TRP F CA  1 
ATOM   7349 C  C   . TRP F  1 33  ? 15.735  -66.905 -8.413  1.00 18.95  ? 31  TRP F C   1 
ATOM   7350 O  O   . TRP F  1 33  ? 15.870  -68.124 -8.269  1.00 19.80  ? 31  TRP F O   1 
ATOM   7351 C  CB  . TRP F  1 33  ? 15.485  -65.839 -6.206  1.00 17.49  ? 31  TRP F CB  1 
ATOM   7352 C  CG  . TRP F  1 33  ? 14.792  -64.907 -5.254  1.00 16.35  ? 31  TRP F CG  1 
ATOM   7353 C  CD1 . TRP F  1 33  ? 14.050  -65.260 -4.169  1.00 16.64  ? 31  TRP F CD1 1 
ATOM   7354 C  CD2 . TRP F  1 33  ? 14.876  -63.474 -5.230  1.00 15.71  ? 31  TRP F CD2 1 
ATOM   7355 N  NE1 . TRP F  1 33  ? 13.629  -64.140 -3.500  1.00 16.94  ? 31  TRP F NE1 1 
ATOM   7356 C  CE2 . TRP F  1 33  ? 14.118  -63.030 -4.136  1.00 15.62  ? 31  TRP F CE2 1 
ATOM   7357 C  CE3 . TRP F  1 33  ? 15.486  -62.524 -6.050  1.00 15.07  ? 31  TRP F CE3 1 
ATOM   7358 C  CZ2 . TRP F  1 33  ? 13.965  -61.682 -3.835  1.00 15.20  ? 31  TRP F CZ2 1 
ATOM   7359 C  CZ3 . TRP F  1 33  ? 15.341  -61.185 -5.742  1.00 14.58  ? 31  TRP F CZ3 1 
ATOM   7360 C  CH2 . TRP F  1 33  ? 14.594  -60.777 -4.640  1.00 14.81  ? 31  TRP F CH2 1 
ATOM   7361 N  N   . TYR F  1 34  ? 16.419  -66.213 -9.319  1.00 19.47  ? 32  TYR F N   1 
ATOM   7362 C  CA  . TYR F  1 34  ? 17.425  -66.844 -10.158 1.00 18.42  ? 32  TYR F CA  1 
ATOM   7363 C  C   . TYR F  1 34  ? 18.782  -66.624 -9.546  1.00 18.22  ? 32  TYR F C   1 
ATOM   7364 O  O   . TYR F  1 34  ? 19.079  -65.541 -9.053  1.00 17.66  ? 32  TYR F O   1 
ATOM   7365 C  CB  . TYR F  1 34  ? 17.406  -66.229 -11.551 1.00 20.01  ? 32  TYR F CB  1 
ATOM   7366 C  CG  . TYR F  1 34  ? 16.172  -66.558 -12.350 1.00 20.42  ? 32  TYR F CG  1 
ATOM   7367 C  CD1 . TYR F  1 34  ? 16.053  -67.777 -12.993 1.00 22.19  ? 32  TYR F CD1 1 
ATOM   7368 C  CD2 . TYR F  1 34  ? 15.126  -65.650 -12.460 1.00 21.50  ? 32  TYR F CD2 1 
ATOM   7369 C  CE1 . TYR F  1 34  ? 14.924  -68.094 -13.721 1.00 22.80  ? 32  TYR F CE1 1 
ATOM   7370 C  CE2 . TYR F  1 34  ? 13.993  -65.950 -13.192 1.00 21.07  ? 32  TYR F CE2 1 
ATOM   7371 C  CZ  . TYR F  1 34  ? 13.903  -67.177 -13.819 1.00 22.54  ? 32  TYR F CZ  1 
ATOM   7372 O  OH  . TYR F  1 34  ? 12.794  -67.512 -14.554 1.00 24.44  ? 32  TYR F OH  1 
ATOM   7373 N  N   . VAL F  1 35  ? 19.626  -67.648 -9.570  1.00 19.69  ? 33  VAL F N   1 
ATOM   7374 C  CA  . VAL F  1 35  ? 20.957  -67.485 -9.032  1.00 19.70  ? 33  VAL F CA  1 
ATOM   7375 C  C   . VAL F  1 35  ? 21.852  -66.879 -10.092 1.00 19.62  ? 33  VAL F C   1 
ATOM   7376 O  O   . VAL F  1 35  ? 22.348  -67.571 -10.967 1.00 22.45  ? 33  VAL F O   1 
ATOM   7377 C  CB  . VAL F  1 35  ? 21.528  -68.802 -8.498  1.00 20.49  ? 33  VAL F CB  1 
ATOM   7378 C  CG1 . VAL F  1 35  ? 22.961  -68.604 -8.033  1.00 20.96  ? 33  VAL F CG1 1 
ATOM   7379 C  CG2 . VAL F  1 35  ? 20.676  -69.311 -7.352  1.00 20.71  ? 33  VAL F CG2 1 
ATOM   7380 N  N   . VAL F  1 36  ? 22.066  -65.575 -9.980  1.00 19.03  ? 34  VAL F N   1 
ATOM   7381 C  CA  . VAL F  1 36  ? 22.766  -64.799 -10.992 1.00 18.73  ? 34  VAL F CA  1 
ATOM   7382 C  C   . VAL F  1 36  ? 24.253  -64.691 -10.641 1.00 19.26  ? 34  VAL F C   1 
ATOM   7383 O  O   . VAL F  1 36  ? 25.094  -64.504 -11.518 1.00 18.91  ? 34  VAL F O   1 
ATOM   7384 C  CB  . VAL F  1 36  ? 22.158  -63.379 -11.080 1.00 19.40  ? 34  VAL F CB  1 
ATOM   7385 C  CG1 . VAL F  1 36  ? 23.062  -62.432 -11.851 1.00 20.22  ? 34  VAL F CG1 1 
ATOM   7386 C  CG2 . VAL F  1 36  ? 20.772  -63.439 -11.719 1.00 19.14  ? 34  VAL F CG2 1 
ATOM   7387 N  N   . GLY F  1 37  ? 24.570  -64.815 -9.354  1.00 18.85  ? 35  GLY F N   1 
ATOM   7388 C  CA  . GLY F  1 37  ? 25.955  -64.854 -8.900  1.00 19.13  ? 35  GLY F CA  1 
ATOM   7389 C  C   . GLY F  1 37  ? 26.169  -65.821 -7.743  1.00 19.37  ? 35  GLY F C   1 
ATOM   7390 O  O   . GLY F  1 37  ? 25.280  -66.042 -6.936  1.00 18.32  ? 35  GLY F O   1 
ATOM   7391 N  N   . LEU F  1 38  ? 27.348  -66.425 -7.697  1.00 21.14  ? 36  LEU F N   1 
ATOM   7392 C  CA  . LEU F  1 38  ? 27.685  -67.426 -6.688  1.00 22.12  ? 36  LEU F CA  1 
ATOM   7393 C  C   . LEU F  1 38  ? 29.124  -67.204 -6.276  1.00 21.91  ? 36  LEU F C   1 
ATOM   7394 O  O   . LEU F  1 38  ? 30.015  -67.156 -7.126  1.00 22.44  ? 36  LEU F O   1 
ATOM   7395 C  CB  . LEU F  1 38  ? 27.609  -68.820 -7.293  1.00 25.03  ? 36  LEU F CB  1 
ATOM   7396 C  CG  . LEU F  1 38  ? 26.523  -69.784 -6.842  1.00 27.13  ? 36  LEU F CG  1 
ATOM   7397 C  CD1 . LEU F  1 38  ? 26.816  -71.151 -7.438  1.00 27.92  ? 36  LEU F CD1 1 
ATOM   7398 C  CD2 . LEU F  1 38  ? 26.453  -69.858 -5.326  1.00 27.82  ? 36  LEU F CD2 1 
ATOM   7399 N  N   . ALA F  1 39  ? 29.368  -67.102 -4.981  1.00 20.37  ? 37  ALA F N   1 
ATOM   7400 C  CA  . ALA F  1 39  ? 30.736  -66.993 -4.494  1.00 22.11  ? 37  ALA F CA  1 
ATOM   7401 C  C   . ALA F  1 39  ? 30.881  -67.816 -3.225  1.00 22.54  ? 37  ALA F C   1 
ATOM   7402 O  O   . ALA F  1 39  ? 29.962  -67.878 -2.411  1.00 22.41  ? 37  ALA F O   1 
ATOM   7403 C  CB  . ALA F  1 39  ? 31.089  -65.531 -4.228  1.00 21.31  ? 37  ALA F CB  1 
ATOM   7404 N  N   . GLY F  1 40  ? 32.035  -68.440 -3.038  1.00 23.19  ? 38  GLY F N   1 
ATOM   7405 C  CA  . GLY F  1 40  ? 32.268  -69.168 -1.797  1.00 22.33  ? 38  GLY F CA  1 
ATOM   7406 C  C   . GLY F  1 40  ? 33.520  -69.995 -1.807  1.00 22.67  ? 38  GLY F C   1 
ATOM   7407 O  O   . GLY F  1 40  ? 34.182  -70.118 -2.835  1.00 23.14  ? 38  GLY F O   1 
ATOM   7408 N  N   . ASN F  1 41  ? 33.850  -70.566 -0.651  1.00 22.41  ? 39  ASN F N   1 
ATOM   7409 C  CA  . ASN F  1 41  ? 35.148  -71.201 -0.485  1.00 23.70  ? 39  ASN F CA  1 
ATOM   7410 C  C   . ASN F  1 41  ? 35.236  -72.589 -1.114  1.00 25.06  ? 39  ASN F C   1 
ATOM   7411 O  O   . ASN F  1 41  ? 36.322  -73.166 -1.213  1.00 26.62  ? 39  ASN F O   1 
ATOM   7412 C  CB  . ASN F  1 41  ? 35.607  -71.184 0.982   1.00 23.54  ? 39  ASN F CB  1 
ATOM   7413 C  CG  . ASN F  1 41  ? 34.718  -71.996 1.908   1.00 22.75  ? 39  ASN F CG  1 
ATOM   7414 O  OD1 . ASN F  1 41  ? 33.635  -72.455 1.533   1.00 22.98  ? 39  ASN F OD1 1 
ATOM   7415 N  ND2 . ASN F  1 41  ? 35.185  -72.179 3.139   1.00 22.26  ? 39  ASN F ND2 1 
ATOM   7416 N  N   . ALA F  1 42  ? 34.104  -73.093 -1.588  1.00 25.33  ? 40  ALA F N   1 
ATOM   7417 C  CA  . ALA F  1 42  ? 34.087  -74.303 -2.406  1.00 28.30  ? 40  ALA F CA  1 
ATOM   7418 C  C   . ALA F  1 42  ? 33.561  -74.046 -3.823  1.00 29.92  ? 40  ALA F C   1 
ATOM   7419 O  O   . ALA F  1 42  ? 33.403  -74.980 -4.595  1.00 31.64  ? 40  ALA F O   1 
ATOM   7420 C  CB  . ALA F  1 42  ? 33.250  -75.379 -1.731  1.00 28.54  ? 40  ALA F CB  1 
ATOM   7421 N  N   . ILE F  1 43  ? 33.312  -72.784 -4.159  1.00 31.41  ? 41  ILE F N   1 
ATOM   7422 C  CA  . ILE F  1 43  ? 33.024  -72.379 -5.531  1.00 34.02  ? 41  ILE F CA  1 
ATOM   7423 C  C   . ILE F  1 43  ? 34.301  -72.149 -6.319  1.00 39.27  ? 41  ILE F C   1 
ATOM   7424 O  O   . ILE F  1 43  ? 35.158  -71.366 -5.915  1.00 43.04  ? 41  ILE F O   1 
ATOM   7425 C  CB  . ILE F  1 43  ? 32.220  -71.068 -5.563  1.00 34.21  ? 41  ILE F CB  1 
ATOM   7426 C  CG1 . ILE F  1 43  ? 30.847  -71.279 -4.938  1.00 32.85  ? 41  ILE F CG1 1 
ATOM   7427 C  CG2 . ILE F  1 43  ? 32.071  -70.561 -6.991  1.00 35.57  ? 41  ILE F CG2 1 
ATOM   7428 C  CD1 . ILE F  1 43  ? 30.026  -72.321 -5.658  1.00 34.82  ? 41  ILE F CD1 1 
ATOM   7429 N  N   . LEU F  1 44  ? 34.414  -72.815 -7.461  1.00 45.64  ? 42  LEU F N   1 
ATOM   7430 C  CA  . LEU F  1 44  ? 35.605  -72.703 -8.295  1.00 52.69  ? 42  LEU F CA  1 
ATOM   7431 C  C   . LEU F  1 44  ? 35.214  -72.462 -9.759  1.00 54.56  ? 42  LEU F C   1 
ATOM   7432 O  O   . LEU F  1 44  ? 34.524  -73.280 -10.365 1.00 50.57  ? 42  LEU F O   1 
ATOM   7433 C  CB  . LEU F  1 44  ? 36.446  -73.974 -8.160  1.00 60.30  ? 42  LEU F CB  1 
ATOM   7434 C  CG  . LEU F  1 44  ? 37.962  -73.836 -8.345  1.00 73.40  ? 42  LEU F CG  1 
ATOM   7435 C  CD1 . LEU F  1 44  ? 38.462  -72.450 -7.956  1.00 73.89  ? 42  LEU F CD1 1 
ATOM   7436 C  CD2 . LEU F  1 44  ? 38.691  -74.908 -7.548  1.00 74.89  ? 42  LEU F CD2 1 
ATOM   7437 N  N   . ARG F  1 45  ? 35.662  -71.337 -10.318 1.00 57.77  ? 43  ARG F N   1 
ATOM   7438 C  CA  . ARG F  1 45  ? 35.448  -71.032 -11.734 1.00 57.44  ? 43  ARG F CA  1 
ATOM   7439 C  C   . ARG F  1 45  ? 36.053  -72.129 -12.609 1.00 57.86  ? 43  ARG F C   1 
ATOM   7440 O  O   . ARG F  1 45  ? 37.244  -72.423 -12.518 1.00 52.04  ? 43  ARG F O   1 
ATOM   7441 C  CB  . ARG F  1 45  ? 36.078  -69.682 -12.094 1.00 58.92  ? 43  ARG F CB  1 
ATOM   7442 C  CG  . ARG F  1 45  ? 35.405  -68.948 -13.246 1.00 60.46  ? 43  ARG F CG  1 
ATOM   7443 C  CD  . ARG F  1 45  ? 35.639  -67.448 -13.160 1.00 60.68  ? 43  ARG F CD  1 
ATOM   7444 N  NE  . ARG F  1 45  ? 37.059  -67.115 -13.261 1.00 62.12  ? 43  ARG F NE  1 
ATOM   7445 C  CZ  . ARG F  1 45  ? 37.577  -65.925 -12.967 1.00 59.57  ? 43  ARG F CZ  1 
ATOM   7446 N  NH1 . ARG F  1 45  ? 38.884  -65.724 -13.081 1.00 60.16  ? 43  ARG F NH1 1 
ATOM   7447 N  NH2 . ARG F  1 45  ? 36.794  -64.935 -12.553 1.00 54.94  ? 43  ARG F NH2 1 
ATOM   7448 N  N   . GLU F  1 46  ? 35.218  -72.745 -13.441 1.00 59.64  ? 44  GLU F N   1 
ATOM   7449 C  CA  . GLU F  1 46  ? 35.694  -73.682 -14.455 1.00 69.32  ? 44  GLU F CA  1 
ATOM   7450 C  C   . GLU F  1 46  ? 35.455  -73.101 -15.856 1.00 68.08  ? 44  GLU F C   1 
ATOM   7451 O  O   . GLU F  1 46  ? 34.335  -73.103 -16.355 1.00 59.10  ? 44  GLU F O   1 
ATOM   7452 C  CB  . GLU F  1 46  ? 34.989  -75.039 -14.291 1.00 69.21  ? 44  GLU F CB  1 
ATOM   7453 C  CG  . GLU F  1 46  ? 35.269  -76.045 -15.399 1.00 74.95  ? 44  GLU F CG  1 
ATOM   7454 C  CD  . GLU F  1 46  ? 36.474  -76.931 -15.131 1.00 76.76  ? 44  GLU F CD  1 
ATOM   7455 O  OE1 . GLU F  1 46  ? 37.175  -76.706 -14.125 1.00 82.04  ? 44  GLU F OE1 1 
ATOM   7456 O  OE2 . GLU F  1 46  ? 36.727  -77.850 -15.938 1.00 71.61  ? 44  GLU F OE2 1 
ATOM   7457 N  N   . ASP F  1 47  ? 36.522  -72.595 -16.473 1.00 74.18  ? 45  ASP F N   1 
ATOM   7458 C  CA  . ASP F  1 47  ? 36.468  -72.070 -17.841 1.00 75.23  ? 45  ASP F CA  1 
ATOM   7459 C  C   . ASP F  1 47  ? 35.969  -73.127 -18.834 1.00 73.43  ? 45  ASP F C   1 
ATOM   7460 O  O   . ASP F  1 47  ? 35.177  -72.822 -19.725 1.00 65.59  ? 45  ASP F O   1 
ATOM   7461 C  CB  . ASP F  1 47  ? 37.853  -71.563 -18.268 1.00 70.83  ? 45  ASP F CB  1 
ATOM   7462 N  N   . LYS F  1 48  ? 36.425  -74.368 -18.667 1.00 75.12  ? 46  LYS F N   1 
ATOM   7463 C  CA  . LYS F  1 48  ? 36.093  -75.452 -19.602 1.00 74.96  ? 46  LYS F CA  1 
ATOM   7464 C  C   . LYS F  1 48  ? 34.600  -75.795 -19.579 1.00 72.61  ? 46  LYS F C   1 
ATOM   7465 O  O   . LYS F  1 48  ? 33.976  -75.940 -20.630 1.00 67.30  ? 46  LYS F O   1 
ATOM   7466 C  CB  . LYS F  1 48  ? 36.928  -76.704 -19.304 1.00 72.93  ? 46  LYS F CB  1 
ATOM   7467 N  N   . ASP F  1 49  ? 34.028  -75.905 -18.381 1.00 74.67  ? 47  ASP F N   1 
ATOM   7468 C  CA  . ASP F  1 49  ? 32.639  -76.353 -18.217 1.00 75.80  ? 47  ASP F CA  1 
ATOM   7469 C  C   . ASP F  1 49  ? 31.833  -75.424 -17.293 1.00 65.67  ? 47  ASP F C   1 
ATOM   7470 O  O   . ASP F  1 49  ? 31.651  -75.722 -16.111 1.00 53.55  ? 47  ASP F O   1 
ATOM   7471 C  CB  . ASP F  1 49  ? 32.618  -77.777 -17.657 1.00 79.33  ? 47  ASP F CB  1 
ATOM   7472 C  CG  . ASP F  1 49  ? 31.214  -78.275 -17.379 1.00 80.20  ? 47  ASP F CG  1 
ATOM   7473 O  OD1 . ASP F  1 49  ? 30.298  -77.969 -18.173 1.00 80.51  ? 47  ASP F OD1 1 
ATOM   7474 O  OD2 . ASP F  1 49  ? 31.029  -78.974 -16.363 1.00 80.29  ? 47  ASP F OD2 1 
ATOM   7475 N  N   . PRO F  1 50  ? 31.331  -74.307 -17.843 1.00 61.51  ? 48  PRO F N   1 
ATOM   7476 C  CA  . PRO F  1 50  ? 30.801  -73.235 -17.007 1.00 56.76  ? 48  PRO F CA  1 
ATOM   7477 C  C   . PRO F  1 50  ? 29.515  -73.646 -16.313 1.00 50.36  ? 48  PRO F C   1 
ATOM   7478 O  O   . PRO F  1 50  ? 28.727  -74.411 -16.863 1.00 58.03  ? 48  PRO F O   1 
ATOM   7479 C  CB  . PRO F  1 50  ? 30.533  -72.107 -18.004 1.00 58.88  ? 48  PRO F CB  1 
ATOM   7480 C  CG  . PRO F  1 50  ? 30.263  -72.802 -19.298 1.00 62.46  ? 48  PRO F CG  1 
ATOM   7481 C  CD  . PRO F  1 50  ? 31.068  -74.077 -19.278 1.00 62.81  ? 48  PRO F CD  1 
ATOM   7482 N  N   . GLN F  1 51  ? 29.319  -73.153 -15.101 1.00 43.49  ? 49  GLN F N   1 
ATOM   7483 C  CA  . GLN F  1 51  ? 28.161  -73.523 -14.319 1.00 41.67  ? 49  GLN F CA  1 
ATOM   7484 C  C   . GLN F  1 51  ? 26.900  -72.861 -14.875 1.00 38.10  ? 49  GLN F C   1 
ATOM   7485 O  O   . GLN F  1 51  ? 26.902  -71.686 -15.255 1.00 36.60  ? 49  GLN F O   1 
ATOM   7486 C  CB  . GLN F  1 51  ? 28.368  -73.136 -12.856 1.00 43.86  ? 49  GLN F CB  1 
ATOM   7487 C  CG  . GLN F  1 51  ? 27.083  -72.888 -12.095 1.00 46.74  ? 49  GLN F CG  1 
ATOM   7488 C  CD  . GLN F  1 51  ? 27.017  -73.663 -10.797 1.00 48.32  ? 49  GLN F CD  1 
ATOM   7489 O  OE1 . GLN F  1 51  ? 27.995  -73.741 -10.057 1.00 55.82  ? 49  GLN F OE1 1 
ATOM   7490 N  NE2 . GLN F  1 51  ? 25.854  -74.221 -10.505 1.00 50.72  ? 49  GLN F NE2 1 
ATOM   7491 N  N   . LYS F  1 52  ? 25.822  -73.635 -14.925 1.00 35.26  ? 50  LYS F N   1 
ATOM   7492 C  CA  . LYS F  1 52  ? 24.559  -73.156 -15.447 1.00 30.36  ? 50  LYS F CA  1 
ATOM   7493 C  C   . LYS F  1 52  ? 23.731  -72.504 -14.357 1.00 25.87  ? 50  LYS F C   1 
ATOM   7494 O  O   . LYS F  1 52  ? 23.728  -72.943 -13.219 1.00 27.93  ? 50  LYS F O   1 
ATOM   7495 C  CB  . LYS F  1 52  ? 23.789  -74.311 -16.084 1.00 31.11  ? 50  LYS F CB  1 
ATOM   7496 C  CG  . LYS F  1 52  ? 24.461  -74.848 -17.330 1.00 33.61  ? 50  LYS F CG  1 
ATOM   7497 C  CD  . LYS F  1 52  ? 23.682  -75.998 -17.935 1.00 35.27  ? 50  LYS F CD  1 
ATOM   7498 C  CE  . LYS F  1 52  ? 24.542  -76.791 -18.902 1.00 36.83  ? 50  LYS F CE  1 
ATOM   7499 N  NZ  . LYS F  1 52  ? 23.686  -77.676 -19.733 1.00 39.06  ? 50  LYS F NZ  1 
ATOM   7500 N  N   . MET F  1 53  ? 23.006  -71.462 -14.725 1.00 23.57  ? 51  MET F N   1 
ATOM   7501 C  CA  . MET F  1 53  ? 22.016  -70.855 -13.848 1.00 21.56  ? 51  MET F CA  1 
ATOM   7502 C  C   . MET F  1 53  ? 20.981  -71.872 -13.375 1.00 21.12  ? 51  MET F C   1 
ATOM   7503 O  O   . MET F  1 53  ? 20.534  -72.734 -14.137 1.00 21.80  ? 51  MET F O   1 
ATOM   7504 C  CB  . MET F  1 53  ? 21.305  -69.724 -14.578 1.00 21.39  ? 51  MET F CB  1 
ATOM   7505 C  CG  . MET F  1 53  ? 20.416  -68.874 -13.696 1.00 21.83  ? 51  MET F CG  1 
ATOM   7506 S  SD  . MET F  1 53  ? 19.870  -67.367 -14.528 1.00 23.94  ? 51  MET F SD  1 
ATOM   7507 C  CE  . MET F  1 53  ? 21.423  -66.448 -14.554 1.00 23.30  ? 51  MET F CE  1 
ATOM   7508 N  N   . TYR F  1 54  ? 20.606  -71.760 -12.109 1.00 19.57  ? 52  TYR F N   1 
ATOM   7509 C  CA  . TYR F  1 54  ? 19.457  -72.464 -11.584 1.00 19.57  ? 52  TYR F CA  1 
ATOM   7510 C  C   . TYR F  1 54  ? 18.592  -71.484 -10.822 1.00 17.97  ? 52  TYR F C   1 
ATOM   7511 O  O   . TYR F  1 54  ? 18.984  -70.337 -10.639 1.00 17.05  ? 52  TYR F O   1 
ATOM   7512 C  CB  . TYR F  1 54  ? 19.897  -73.619 -10.675 1.00 20.91  ? 52  TYR F CB  1 
ATOM   7513 C  CG  . TYR F  1 54  ? 20.751  -73.226 -9.492  1.00 20.55  ? 52  TYR F CG  1 
ATOM   7514 C  CD1 . TYR F  1 54  ? 22.130  -73.158 -9.601  1.00 20.80  ? 52  TYR F CD1 1 
ATOM   7515 C  CD2 . TYR F  1 54  ? 20.182  -72.980 -8.254  1.00 20.20  ? 52  TYR F CD2 1 
ATOM   7516 C  CE1 . TYR F  1 54  ? 22.916  -72.819 -8.519  1.00 20.36  ? 52  TYR F CE1 1 
ATOM   7517 C  CE2 . TYR F  1 54  ? 20.961  -72.651 -7.160  1.00 20.34  ? 52  TYR F CE2 1 
ATOM   7518 C  CZ  . TYR F  1 54  ? 22.328  -72.569 -7.301  1.00 20.10  ? 52  TYR F CZ  1 
ATOM   7519 O  OH  . TYR F  1 54  ? 23.095  -72.233 -6.217  1.00 20.15  ? 52  TYR F OH  1 
ATOM   7520 N  N   . ALA F  1 55  ? 17.419  -71.937 -10.390 1.00 17.79  ? 53  ALA F N   1 
ATOM   7521 C  CA  . ALA F  1 55  ? 16.480  -71.087 -9.679  1.00 17.77  ? 53  ALA F CA  1 
ATOM   7522 C  C   . ALA F  1 55  ? 16.163  -71.660 -8.315  1.00 17.66  ? 53  ALA F C   1 
ATOM   7523 O  O   . ALA F  1 55  ? 16.196  -72.871 -8.113  1.00 18.51  ? 53  ALA F O   1 
ATOM   7524 C  CB  . ALA F  1 55  ? 15.191  -70.924 -10.479 1.00 18.52  ? 53  ALA F CB  1 
ATOM   7525 N  N   . THR F  1 56  ? 15.811  -70.778 -7.387  1.00 17.45  ? 54  THR F N   1 
ATOM   7526 C  CA  . THR F  1 56  ? 15.415  -71.205 -6.064  1.00 18.59  ? 54  THR F CA  1 
ATOM   7527 C  C   . THR F  1 56  ? 14.131  -70.496 -5.645  1.00 19.69  ? 54  THR F C   1 
ATOM   7528 O  O   . THR F  1 56  ? 14.018  -69.271 -5.749  1.00 18.52  ? 54  THR F O   1 
ATOM   7529 C  CB  . THR F  1 56  ? 16.531  -70.931 -5.056  1.00 18.20  ? 54  THR F CB  1 
ATOM   7530 O  OG1 . THR F  1 56  ? 17.668  -71.727 -5.402  1.00 20.97  ? 54  THR F OG1 1 
ATOM   7531 C  CG2 . THR F  1 56  ? 16.098  -71.293 -3.655  1.00 19.15  ? 54  THR F CG2 1 
ATOM   7532 N  N   . ILE F  1 57  ? 13.160  -71.282 -5.188  1.00 20.34  ? 55  ILE F N   1 
ATOM   7533 C  CA  . ILE F  1 57  ? 11.806  -70.792 -4.983  1.00 21.01  ? 55  ILE F CA  1 
ATOM   7534 C  C   . ILE F  1 57  ? 11.442  -70.846 -3.524  1.00 21.50  ? 55  ILE F C   1 
ATOM   7535 O  O   . ILE F  1 57  ? 11.503  -71.907 -2.905  1.00 21.53  ? 55  ILE F O   1 
ATOM   7536 C  CB  . ILE F  1 57  ? 10.788  -71.640 -5.763  1.00 23.82  ? 55  ILE F CB  1 
ATOM   7537 C  CG1 . ILE F  1 57  ? 11.133  -71.612 -7.252  1.00 24.07  ? 55  ILE F CG1 1 
ATOM   7538 C  CG2 . ILE F  1 57  ? 9.370   -71.111 -5.550  1.00 24.40  ? 55  ILE F CG2 1 
ATOM   7539 C  CD1 . ILE F  1 57  ? 10.507  -72.746 -8.029  1.00 26.72  ? 55  ILE F CD1 1 
ATOM   7540 N  N   . TYR F  1 58  ? 11.089  -69.687 -2.974  1.00 22.40  ? 56  TYR F N   1 
ATOM   7541 C  CA  . TYR F  1 58  ? 10.783  -69.563 -1.552  1.00 23.81  ? 56  TYR F CA  1 
ATOM   7542 C  C   . TYR F  1 58  ? 9.274   -69.454 -1.355  1.00 25.31  ? 56  TYR F C   1 
ATOM   7543 O  O   . TYR F  1 58  ? 8.644   -68.539 -1.864  1.00 25.64  ? 56  TYR F O   1 
ATOM   7544 C  CB  . TYR F  1 58  ? 11.452  -68.316 -0.962  1.00 22.17  ? 56  TYR F CB  1 
ATOM   7545 C  CG  . TYR F  1 58  ? 12.941  -68.415 -0.790  1.00 22.08  ? 56  TYR F CG  1 
ATOM   7546 C  CD1 . TYR F  1 58  ? 13.502  -68.512 0.478   1.00 23.10  ? 56  TYR F CD1 1 
ATOM   7547 C  CD2 . TYR F  1 58  ? 13.793  -68.383 -1.883  1.00 21.10  ? 56  TYR F CD2 1 
ATOM   7548 C  CE1 . TYR F  1 58  ? 14.876  -68.591 0.655   1.00 23.15  ? 56  TYR F CE1 1 
ATOM   7549 C  CE2 . TYR F  1 58  ? 15.169  -68.449 -1.717  1.00 21.91  ? 56  TYR F CE2 1 
ATOM   7550 C  CZ  . TYR F  1 58  ? 15.707  -68.560 -0.445  1.00 21.46  ? 56  TYR F CZ  1 
ATOM   7551 O  OH  . TYR F  1 58  ? 17.073  -68.626 -0.265  1.00 19.36  ? 56  TYR F OH  1 
ATOM   7552 N  N   . GLU F  1 59  ? 8.694   -70.389 -0.625  1.00 27.96  ? 57  GLU F N   1 
ATOM   7553 C  CA  . GLU F  1 59  ? 7.259   -70.348 -0.346  1.00 31.48  ? 57  GLU F CA  1 
ATOM   7554 C  C   . GLU F  1 59  ? 7.023   -70.228 1.136   1.00 29.52  ? 57  GLU F C   1 
ATOM   7555 O  O   . GLU F  1 59  ? 7.439   -71.099 1.898   1.00 27.57  ? 57  GLU F O   1 
ATOM   7556 C  CB  . GLU F  1 59  ? 6.579   -71.611 -0.867  1.00 37.22  ? 57  GLU F CB  1 
ATOM   7557 C  CG  . GLU F  1 59  ? 6.158   -71.501 -2.319  1.00 46.33  ? 57  GLU F CG  1 
ATOM   7558 C  CD  . GLU F  1 59  ? 5.865   -72.840 -2.954  1.00 53.00  ? 57  GLU F CD  1 
ATOM   7559 O  OE1 . GLU F  1 59  ? 5.837   -73.856 -2.227  1.00 63.29  ? 57  GLU F OE1 1 
ATOM   7560 O  OE2 . GLU F  1 59  ? 5.656   -72.865 -4.183  1.00 55.76  ? 57  GLU F OE2 1 
ATOM   7561 N  N   . LEU F  1 60  ? 6.381   -69.135 1.537   1.00 30.26  ? 58  LEU F N   1 
ATOM   7562 C  CA  . LEU F  1 60  ? 6.140   -68.860 2.941   1.00 33.48  ? 58  LEU F CA  1 
ATOM   7563 C  C   . LEU F  1 60  ? 4.964   -69.693 3.415   1.00 35.80  ? 58  LEU F C   1 
ATOM   7564 O  O   . LEU F  1 60  ? 3.884   -69.605 2.852   1.00 38.56  ? 58  LEU F O   1 
ATOM   7565 C  CB  . LEU F  1 60  ? 5.843   -67.373 3.141   1.00 32.67  ? 58  LEU F CB  1 
ATOM   7566 C  CG  . LEU F  1 60  ? 5.820   -66.863 4.586   1.00 34.51  ? 58  LEU F CG  1 
ATOM   7567 C  CD1 . LEU F  1 60  ? 7.152   -67.113 5.284   1.00 32.11  ? 58  LEU F CD1 1 
ATOM   7568 C  CD2 . LEU F  1 60  ? 5.471   -65.384 4.605   1.00 32.95  ? 58  LEU F CD2 1 
ATOM   7569 N  N   . LYS F  1 61  ? 5.182   -70.519 4.433   1.00 41.08  ? 59  LYS F N   1 
ATOM   7570 C  CA  . LYS F  1 61  ? 4.122   -71.373 4.959   1.00 45.44  ? 59  LYS F CA  1 
ATOM   7571 C  C   . LYS F  1 61  ? 3.354   -70.670 6.072   1.00 49.17  ? 59  LYS F C   1 
ATOM   7572 O  O   . LYS F  1 61  ? 3.795   -69.650 6.600   1.00 49.51  ? 59  LYS F O   1 
ATOM   7573 C  CB  . LYS F  1 61  ? 4.702   -72.681 5.493   1.00 49.32  ? 59  LYS F CB  1 
ATOM   7574 C  CG  . LYS F  1 61  ? 5.622   -73.399 4.524   1.00 53.77  ? 59  LYS F CG  1 
ATOM   7575 C  CD  . LYS F  1 61  ? 5.559   -74.910 4.702   1.00 65.09  ? 59  LYS F CD  1 
ATOM   7576 C  CE  . LYS F  1 61  ? 5.823   -75.333 6.141   1.00 65.07  ? 59  LYS F CE  1 
ATOM   7577 N  NZ  . LYS F  1 61  ? 6.922   -76.333 6.229   1.00 69.63  ? 59  LYS F NZ  1 
ATOM   7578 N  N   . GLU F  1 62  ? 2.211   -71.240 6.437   1.00 53.09  ? 60  GLU F N   1 
ATOM   7579 C  CA  . GLU F  1 62  ? 1.413   -70.747 7.553   1.00 52.79  ? 60  GLU F CA  1 
ATOM   7580 C  C   . GLU F  1 62  ? 2.263   -70.477 8.792   1.00 47.87  ? 60  GLU F C   1 
ATOM   7581 O  O   . GLU F  1 62  ? 2.083   -69.461 9.456   1.00 43.04  ? 60  GLU F O   1 
ATOM   7582 C  CB  . GLU F  1 62  ? 0.311   -71.754 7.884   1.00 60.40  ? 60  GLU F CB  1 
ATOM   7583 C  CG  . GLU F  1 62  ? -0.392  -71.501 9.207   1.00 68.82  ? 60  GLU F CG  1 
ATOM   7584 C  CD  . GLU F  1 62  ? -1.862  -71.879 9.170   1.00 76.81  ? 60  GLU F CD  1 
ATOM   7585 O  OE1 . GLU F  1 62  ? -2.468  -71.841 8.076   1.00 81.31  ? 60  GLU F OE1 1 
ATOM   7586 O  OE2 . GLU F  1 62  ? -2.413  -72.213 10.240  1.00 84.79  ? 60  GLU F OE2 1 
ATOM   7587 N  N   . ASP F  1 63  ? 3.178   -71.394 9.107   1.00 46.06  ? 61  ASP F N   1 
ATOM   7588 C  CA  . ASP F  1 63  ? 3.977   -71.300 10.335  1.00 42.49  ? 61  ASP F CA  1 
ATOM   7589 C  C   . ASP F  1 63  ? 5.218   -70.411 10.183  1.00 39.89  ? 61  ASP F C   1 
ATOM   7590 O  O   . ASP F  1 63  ? 6.044   -70.340 11.098  1.00 37.22  ? 61  ASP F O   1 
ATOM   7591 C  CB  . ASP F  1 63  ? 4.384   -72.699 10.824  1.00 41.83  ? 61  ASP F CB  1 
ATOM   7592 C  CG  . ASP F  1 63  ? 5.470   -73.338 9.966   1.00 42.09  ? 61  ASP F CG  1 
ATOM   7593 O  OD1 . ASP F  1 63  ? 5.935   -72.708 8.985   1.00 41.38  ? 61  ASP F OD1 1 
ATOM   7594 O  OD2 . ASP F  1 63  ? 5.851   -74.488 10.265  1.00 40.41  ? 61  ASP F OD2 1 
ATOM   7595 N  N   . LYS F  1 64  ? 5.338   -69.737 9.036   1.00 38.09  ? 62  LYS F N   1 
ATOM   7596 C  CA  . LYS F  1 64  ? 6.365   -68.710 8.808   1.00 35.98  ? 62  LYS F CA  1 
ATOM   7597 C  C   . LYS F  1 64  ? 7.723   -69.284 8.437   1.00 32.65  ? 62  LYS F C   1 
ATOM   7598 O  O   . LYS F  1 64  ? 8.699   -68.547 8.282   1.00 32.61  ? 62  LYS F O   1 
ATOM   7599 C  CB  . LYS F  1 64  ? 6.525   -67.797 10.030  1.00 40.46  ? 62  LYS F CB  1 
ATOM   7600 C  CG  . LYS F  1 64  ? 5.277   -67.009 10.398  1.00 47.02  ? 62  LYS F CG  1 
ATOM   7601 C  CD  . LYS F  1 64  ? 4.776   -66.160 9.238   1.00 50.44  ? 62  LYS F CD  1 
ATOM   7602 C  CE  . LYS F  1 64  ? 3.514   -65.406 9.626   1.00 50.43  ? 62  LYS F CE  1 
ATOM   7603 N  NZ  . LYS F  1 64  ? 2.806   -64.891 8.433   1.00 48.23  ? 62  LYS F NZ  1 
ATOM   7604 N  N   . SER F  1 65  ? 7.805   -70.598 8.327   1.00 31.82  ? 63  SER F N   1 
ATOM   7605 C  CA  . SER F  1 65  ? 8.957   -71.222 7.702   1.00 30.24  ? 63  SER F CA  1 
ATOM   7606 C  C   . SER F  1 65  ? 8.797   -71.145 6.190   1.00 28.82  ? 63  SER F C   1 
ATOM   7607 O  O   . SER F  1 65  ? 7.692   -70.951 5.680   1.00 28.04  ? 63  SER F O   1 
ATOM   7608 C  CB  . SER F  1 65  ? 9.078   -72.675 8.152   1.00 30.14  ? 63  SER F CB  1 
ATOM   7609 O  OG  . SER F  1 65  ? 8.050   -73.456 7.572   1.00 31.98  ? 63  SER F OG  1 
ATOM   7610 N  N   . TYR F  1 66  ? 9.912   -71.259 5.479   1.00 27.35  ? 64  TYR F N   1 
ATOM   7611 C  CA  . TYR F  1 66  ? 9.870   -71.371 4.029   1.00 26.60  ? 64  TYR F CA  1 
ATOM   7612 C  C   . TYR F  1 66  ? 10.008  -72.827 3.611   1.00 26.83  ? 64  TYR F C   1 
ATOM   7613 O  O   . TYR F  1 66  ? 10.882  -73.548 4.101   1.00 27.98  ? 64  TYR F O   1 
ATOM   7614 C  CB  . TYR F  1 66  ? 11.018  -70.595 3.398   1.00 25.06  ? 64  TYR F CB  1 
ATOM   7615 C  CG  . TYR F  1 66  ? 10.871  -69.086 3.372   1.00 24.52  ? 64  TYR F CG  1 
ATOM   7616 C  CD1 . TYR F  1 66  ? 11.759  -68.283 4.079   1.00 22.87  ? 64  TYR F CD1 1 
ATOM   7617 C  CD2 . TYR F  1 66  ? 9.907   -68.460 2.586   1.00 22.54  ? 64  TYR F CD2 1 
ATOM   7618 C  CE1 . TYR F  1 66  ? 11.674  -66.905 4.039   1.00 21.86  ? 64  TYR F CE1 1 
ATOM   7619 C  CE2 . TYR F  1 66  ? 9.818   -67.074 2.537   1.00 22.32  ? 64  TYR F CE2 1 
ATOM   7620 C  CZ  . TYR F  1 66  ? 10.701  -66.300 3.277   1.00 22.09  ? 64  TYR F CZ  1 
ATOM   7621 O  OH  . TYR F  1 66  ? 10.643  -64.916 3.263   1.00 20.36  ? 64  TYR F OH  1 
ATOM   7622 N  N   . ASN F  1 67  ? 9.172   -73.246 2.670   1.00 26.64  ? 65  ASN F N   1 
ATOM   7623 C  CA  A ASN F  1 67  ? 9.570   -74.281 1.730   0.50 27.05  ? 65  ASN F CA  1 
ATOM   7624 C  CA  B ASN F  1 67  ? 9.545   -74.285 1.719   0.50 27.52  ? 65  ASN F CA  1 
ATOM   7625 C  C   . ASN F  1 67  ? 10.454  -73.716 0.639   1.00 25.36  ? 65  ASN F C   1 
ATOM   7626 O  O   . ASN F  1 67  ? 10.064  -72.783 -0.055  1.00 25.64  ? 65  ASN F O   1 
ATOM   7627 C  CB  A ASN F  1 67  ? 8.354   -74.880 1.051   0.50 28.83  ? 65  ASN F CB  1 
ATOM   7628 C  CB  B ASN F  1 67  ? 8.298   -74.859 1.052   0.50 30.02  ? 65  ASN F CB  1 
ATOM   7629 C  CG  A ASN F  1 67  ? 8.295   -76.382 1.190   0.50 30.42  ? 65  ASN F CG  1 
ATOM   7630 C  CG  B ASN F  1 67  ? 7.664   -75.962 1.861   0.50 32.75  ? 65  ASN F CG  1 
ATOM   7631 O  OD1 A ASN F  1 67  ? 8.028   -76.905 2.266   0.50 33.33  ? 65  ASN F OD1 1 
ATOM   7632 O  OD1 B ASN F  1 67  ? 8.341   -76.657 2.616   0.50 36.13  ? 65  ASN F OD1 1 
ATOM   7633 N  ND2 A ASN F  1 67  ? 8.561   -77.085 0.099   0.50 30.90  ? 65  ASN F ND2 1 
ATOM   7634 N  ND2 B ASN F  1 67  ? 6.356   -76.126 1.714   0.50 34.05  ? 65  ASN F ND2 1 
ATOM   7635 N  N   . VAL F  1 68  ? 11.636  -74.300 0.481   1.00 24.50  ? 66  VAL F N   1 
ATOM   7636 C  CA  . VAL F  1 68  ? 12.618  -73.792 -0.464  1.00 23.82  ? 66  VAL F CA  1 
ATOM   7637 C  C   . VAL F  1 68  ? 12.951  -74.874 -1.484  1.00 23.99  ? 66  VAL F C   1 
ATOM   7638 O  O   . VAL F  1 68  ? 13.397  -75.969 -1.135  1.00 26.10  ? 66  VAL F O   1 
ATOM   7639 C  CB  . VAL F  1 68  ? 13.908  -73.347 0.249   1.00 23.19  ? 66  VAL F CB  1 
ATOM   7640 C  CG1 . VAL F  1 68  ? 14.849  -72.656 -0.719  1.00 23.66  ? 66  VAL F CG1 1 
ATOM   7641 C  CG2 . VAL F  1 68  ? 13.583  -72.418 1.404   1.00 23.17  ? 66  VAL F CG2 1 
ATOM   7642 N  N   . THR F  1 69  ? 12.710  -74.570 -2.749  1.00 23.13  ? 67  THR F N   1 
ATOM   7643 C  CA  . THR F  1 69  ? 12.916  -75.542 -3.817  1.00 23.31  ? 67  THR F CA  1 
ATOM   7644 C  C   . THR F  1 69  ? 13.882  -74.979 -4.841  1.00 22.90  ? 67  THR F C   1 
ATOM   7645 O  O   . THR F  1 69  ? 13.666  -73.885 -5.374  1.00 22.40  ? 67  THR F O   1 
ATOM   7646 C  CB  . THR F  1 69  ? 11.602  -75.871 -4.521  1.00 23.87  ? 67  THR F CB  1 
ATOM   7647 O  OG1 . THR F  1 69  ? 10.622  -76.229 -3.545  1.00 23.38  ? 67  THR F OG1 1 
ATOM   7648 C  CG2 . THR F  1 69  ? 11.798  -77.014 -5.518  1.00 25.11  ? 67  THR F CG2 1 
ATOM   7649 N  N   . SER F  1 70  ? 14.967  -75.707 -5.085  1.00 23.15  ? 68  SER F N   1 
ATOM   7650 C  CA  . SER F  1 70  ? 15.910  -75.311 -6.106  1.00 22.56  ? 68  SER F CA  1 
ATOM   7651 C  C   . SER F  1 70  ? 15.757  -76.232 -7.302  1.00 24.55  ? 68  SER F C   1 
ATOM   7652 O  O   . SER F  1 70  ? 15.676  -77.458 -7.149  1.00 25.53  ? 68  SER F O   1 
ATOM   7653 C  CB  . SER F  1 70  ? 17.336  -75.364 -5.572  1.00 22.67  ? 68  SER F CB  1 
ATOM   7654 O  OG  . SER F  1 70  ? 17.627  -74.201 -4.807  1.00 21.96  ? 68  SER F OG  1 
ATOM   7655 N  N   . VAL F  1 71  ? 15.700  -75.635 -8.490  1.00 23.79  ? 69  VAL F N   1 
ATOM   7656 C  CA  . VAL F  1 71  ? 15.528  -76.391 -9.724  1.00 24.84  ? 69  VAL F CA  1 
ATOM   7657 C  C   . VAL F  1 71  ? 16.762  -76.233 -10.598 1.00 24.19  ? 69  VAL F C   1 
ATOM   7658 O  O   . VAL F  1 71  ? 17.144  -75.108 -10.918 1.00 21.73  ? 69  VAL F O   1 
ATOM   7659 C  CB  . VAL F  1 71  ? 14.313  -75.875 -10.517 1.00 26.26  ? 69  VAL F CB  1 
ATOM   7660 C  CG1 . VAL F  1 71  ? 14.061  -76.717 -11.760 1.00 27.30  ? 69  VAL F CG1 1 
ATOM   7661 C  CG2 . VAL F  1 71  ? 13.092  -75.867 -9.614  1.00 27.80  ? 69  VAL F CG2 1 
ATOM   7662 N  N   . LEU F  1 72  ? 17.377  -77.357 -10.971 1.00 24.92  ? 70  LEU F N   1 
ATOM   7663 C  CA  . LEU F  1 72  ? 18.612  -77.352 -11.751 1.00 26.01  ? 70  LEU F CA  1 
ATOM   7664 C  C   . LEU F  1 72  ? 18.435  -78.179 -13.009 1.00 26.28  ? 70  LEU F C   1 
ATOM   7665 O  O   . LEU F  1 72  ? 17.704  -79.161 -12.997 1.00 27.49  ? 70  LEU F O   1 
ATOM   7666 C  CB  . LEU F  1 72  ? 19.783  -77.937 -10.949 1.00 27.34  ? 70  LEU F CB  1 
ATOM   7667 C  CG  . LEU F  1 72  ? 20.301  -77.146 -9.744  1.00 27.56  ? 70  LEU F CG  1 
ATOM   7668 C  CD1 . LEU F  1 72  ? 19.321  -77.231 -8.580  1.00 27.77  ? 70  LEU F CD1 1 
ATOM   7669 C  CD2 . LEU F  1 72  ? 21.671  -77.639 -9.298  1.00 29.85  ? 70  LEU F CD2 1 
ATOM   7670 N  N   . PHE F  1 73  ? 19.132  -77.798 -14.079 1.00 25.80  ? 71  PHE F N   1 
ATOM   7671 C  CA  . PHE F  1 73  ? 19.214  -78.623 -15.285 1.00 27.76  ? 71  PHE F CA  1 
ATOM   7672 C  C   . PHE F  1 73  ? 20.521  -79.407 -15.276 1.00 30.35  ? 71  PHE F C   1 
ATOM   7673 O  O   . PHE F  1 73  ? 21.591  -78.844 -15.431 1.00 31.00  ? 71  PHE F O   1 
ATOM   7674 C  CB  . PHE F  1 73  ? 19.132  -77.744 -16.536 1.00 26.16  ? 71  PHE F CB  1 
ATOM   7675 C  CG  . PHE F  1 73  ? 19.068  -78.514 -17.840 1.00 26.87  ? 71  PHE F CG  1 
ATOM   7676 C  CD1 . PHE F  1 73  ? 18.128  -79.514 -18.038 1.00 27.58  ? 71  PHE F CD1 1 
ATOM   7677 C  CD2 . PHE F  1 73  ? 19.926  -78.191 -18.886 1.00 26.89  ? 71  PHE F CD2 1 
ATOM   7678 C  CE1 . PHE F  1 73  ? 18.058  -80.196 -19.248 1.00 29.05  ? 71  PHE F CE1 1 
ATOM   7679 C  CE2 . PHE F  1 73  ? 19.865  -78.860 -20.093 1.00 28.30  ? 71  PHE F CE2 1 
ATOM   7680 C  CZ  . PHE F  1 73  ? 18.930  -79.871 -20.278 1.00 29.40  ? 71  PHE F CZ  1 
ATOM   7681 N  N   . ARG F  1 74  ? 20.425  -80.708 -15.066 1.00 34.35  ? 72  ARG F N   1 
ATOM   7682 C  CA  . ARG F  1 74  ? 21.595  -81.549 -14.869 1.00 38.44  ? 72  ARG F CA  1 
ATOM   7683 C  C   . ARG F  1 74  ? 21.388  -82.841 -15.645 1.00 38.68  ? 72  ARG F C   1 
ATOM   7684 O  O   . ARG F  1 74  ? 20.374  -83.496 -15.474 1.00 38.45  ? 72  ARG F O   1 
ATOM   7685 C  CB  . ARG F  1 74  ? 21.763  -81.826 -13.365 1.00 42.70  ? 72  ARG F CB  1 
ATOM   7686 C  CG  . ARG F  1 74  ? 22.687  -82.979 -13.010 1.00 49.80  ? 72  ARG F CG  1 
ATOM   7687 C  CD  . ARG F  1 74  ? 22.233  -83.686 -11.744 1.00 56.72  ? 72  ARG F CD  1 
ATOM   7688 N  NE  . ARG F  1 74  ? 22.829  -85.023 -11.648 1.00 66.32  ? 72  ARG F NE  1 
ATOM   7689 C  CZ  . ARG F  1 74  ? 22.230  -86.101 -11.138 1.00 71.44  ? 72  ARG F CZ  1 
ATOM   7690 N  NH1 . ARG F  1 74  ? 21.003  -86.027 -10.628 1.00 74.73  ? 72  ARG F NH1 1 
ATOM   7691 N  NH2 . ARG F  1 74  ? 22.869  -87.266 -11.124 1.00 72.01  ? 72  ARG F NH2 1 
ATOM   7692 N  N   . LYS F  1 75  ? 22.337  -83.196 -16.508 1.00 39.51  ? 73  LYS F N   1 
ATOM   7693 C  CA  . LYS F  1 75  ? 22.292  -84.479 -17.228 1.00 42.16  ? 73  LYS F CA  1 
ATOM   7694 C  C   . LYS F  1 75  ? 20.981  -84.621 -17.999 1.00 42.12  ? 73  LYS F C   1 
ATOM   7695 O  O   . LYS F  1 75  ? 20.390  -85.698 -18.056 1.00 44.14  ? 73  LYS F O   1 
ATOM   7696 C  CB  . LYS F  1 75  ? 22.484  -85.666 -16.270 1.00 42.51  ? 73  LYS F CB  1 
ATOM   7697 N  N   . LYS F  1 76  ? 20.530  -83.509 -18.570 1.00 40.64  ? 74  LYS F N   1 
ATOM   7698 C  CA  . LYS F  1 76  ? 19.364  -83.482 -19.451 1.00 40.11  ? 74  LYS F CA  1 
ATOM   7699 C  C   . LYS F  1 76  ? 18.029  -83.665 -18.722 1.00 37.99  ? 74  LYS F C   1 
ATOM   7700 O  O   . LYS F  1 76  ? 17.018  -83.964 -19.342 1.00 38.43  ? 74  LYS F O   1 
ATOM   7701 C  CB  . LYS F  1 76  ? 19.512  -84.513 -20.567 1.00 43.14  ? 74  LYS F CB  1 
ATOM   7702 C  CG  . LYS F  1 76  ? 20.615  -84.171 -21.551 1.00 44.51  ? 74  LYS F CG  1 
ATOM   7703 C  CD  . LYS F  1 76  ? 20.776  -85.256 -22.595 1.00 50.17  ? 74  LYS F CD  1 
ATOM   7704 C  CE  . LYS F  1 76  ? 22.017  -85.030 -23.445 1.00 52.83  ? 74  LYS F CE  1 
ATOM   7705 N  NZ  . LYS F  1 76  ? 22.073  -85.980 -24.597 1.00 55.78  ? 74  LYS F NZ  1 
ATOM   7706 N  N   . LYS F  1 77  ? 18.029  -83.457 -17.410 1.00 36.19  ? 75  LYS F N   1 
ATOM   7707 C  CA  . LYS F  1 77  ? 16.819  -83.583 -16.607 1.00 35.06  ? 75  LYS F CA  1 
ATOM   7708 C  C   . LYS F  1 77  ? 16.683  -82.416 -15.647 1.00 32.86  ? 75  LYS F C   1 
ATOM   7709 O  O   . LYS F  1 77  ? 17.658  -81.728 -15.354 1.00 30.76  ? 75  LYS F O   1 
ATOM   7710 C  CB  . LYS F  1 77  ? 16.835  -84.881 -15.811 1.00 36.34  ? 75  LYS F CB  1 
ATOM   7711 C  CG  . LYS F  1 77  ? 16.873  -86.117 -16.681 1.00 39.18  ? 75  LYS F CG  1 
ATOM   7712 C  CD  . LYS F  1 77  ? 16.558  -87.373 -15.888 1.00 41.05  ? 75  LYS F CD  1 
ATOM   7713 C  CE  . LYS F  1 77  ? 16.786  -88.604 -16.742 1.00 44.30  ? 75  LYS F CE  1 
ATOM   7714 N  NZ  . LYS F  1 77  ? 16.491  -89.847 -15.988 1.00 47.10  ? 75  LYS F NZ  1 
ATOM   7715 N  N   . CYS F  1 78  ? 15.461  -82.185 -15.179 1.00 32.76  ? 76  CYS F N   1 
ATOM   7716 C  CA  . CYS F  1 78  ? 15.224  -81.224 -14.109 1.00 31.35  ? 76  CYS F CA  1 
ATOM   7717 C  C   . CYS F  1 78  ? 15.465  -81.908 -12.783 1.00 32.21  ? 76  CYS F C   1 
ATOM   7718 O  O   . CYS F  1 78  ? 14.881  -82.948 -12.492 1.00 32.94  ? 76  CYS F O   1 
ATOM   7719 C  CB  . CYS F  1 78  ? 13.798  -80.666 -14.167 1.00 30.34  ? 76  CYS F CB  1 
ATOM   7720 S  SG  . CYS F  1 78  ? 13.379  -79.865 -15.723 1.00 30.15  ? 76  CYS F SG  1 
ATOM   7721 N  N   . ASP F  1 79  ? 16.341  -81.308 -11.988 1.00 32.49  ? 77  ASP F N   1 
ATOM   7722 C  CA  . ASP F  1 79  ? 16.746  -81.863 -10.707 1.00 34.45  ? 77  ASP F CA  1 
ATOM   7723 C  C   . ASP F  1 79  ? 16.267  -80.914 -9.604  1.00 30.91  ? 77  ASP F C   1 
ATOM   7724 O  O   . ASP F  1 79  ? 16.344  -79.700 -9.737  1.00 28.24  ? 77  ASP F O   1 
ATOM   7725 C  CB  . ASP F  1 79  ? 18.272  -82.038 -10.687 1.00 37.59  ? 77  ASP F CB  1 
ATOM   7726 C  CG  . ASP F  1 79  ? 18.805  -82.512 -9.341  1.00 43.21  ? 77  ASP F CG  1 
ATOM   7727 O  OD1 . ASP F  1 79  ? 18.484  -83.642 -8.905  1.00 50.11  ? 77  ASP F OD1 1 
ATOM   7728 O  OD2 . ASP F  1 79  ? 19.590  -81.760 -8.731  1.00 43.99  ? 77  ASP F OD2 1 
ATOM   7729 N  N   . TYR F  1 80  ? 15.685  -81.475 -8.555  1.00 31.03  ? 78  TYR F N   1 
ATOM   7730 C  CA  . TYR F  1 80  ? 14.974  -80.675 -7.568  1.00 29.70  ? 78  TYR F CA  1 
ATOM   7731 C  C   . TYR F  1 80  ? 15.554  -80.981 -6.201  1.00 29.79  ? 78  TYR F C   1 
ATOM   7732 O  O   . TYR F  1 80  ? 15.625  -82.139 -5.803  1.00 31.84  ? 78  TYR F O   1 
ATOM   7733 C  CB  . TYR F  1 80  ? 13.489  -81.011 -7.561  1.00 30.08  ? 78  TYR F CB  1 
ATOM   7734 C  CG  . TYR F  1 80  ? 12.771  -80.730 -8.847  1.00 30.90  ? 78  TYR F CG  1 
ATOM   7735 C  CD1 . TYR F  1 80  ? 12.187  -79.491 -9.076  1.00 31.04  ? 78  TYR F CD1 1 
ATOM   7736 C  CD2 . TYR F  1 80  ? 12.624  -81.710 -9.817  1.00 32.09  ? 78  TYR F CD2 1 
ATOM   7737 C  CE1 . TYR F  1 80  ? 11.506  -79.223 -10.251 1.00 31.18  ? 78  TYR F CE1 1 
ATOM   7738 C  CE2 . TYR F  1 80  ? 11.929  -81.453 -10.985 1.00 32.39  ? 78  TYR F CE2 1 
ATOM   7739 C  CZ  . TYR F  1 80  ? 11.369  -80.207 -11.195 1.00 31.02  ? 78  TYR F CZ  1 
ATOM   7740 O  OH  . TYR F  1 80  ? 10.666  -79.928 -12.352 1.00 30.99  ? 78  TYR F OH  1 
ATOM   7741 N  N   . TRP F  1 81  ? 15.963  -79.942 -5.486  1.00 28.56  ? 79  TRP F N   1 
ATOM   7742 C  CA  . TRP F  1 81  ? 16.223  -80.060 -4.063  1.00 28.67  ? 79  TRP F CA  1 
ATOM   7743 C  C   . TRP F  1 81  ? 15.239  -79.240 -3.236  1.00 27.87  ? 79  TRP F C   1 
ATOM   7744 O  O   . TRP F  1 81  ? 15.200  -78.001 -3.320  1.00 25.10  ? 79  TRP F O   1 
ATOM   7745 C  CB  . TRP F  1 81  ? 17.644  -79.624 -3.735  1.00 28.79  ? 79  TRP F CB  1 
ATOM   7746 C  CG  . TRP F  1 81  ? 17.947  -79.774 -2.280  1.00 30.95  ? 79  TRP F CG  1 
ATOM   7747 C  CD1 . TRP F  1 81  ? 17.574  -80.815 -1.466  1.00 32.68  ? 79  TRP F CD1 1 
ATOM   7748 C  CD2 . TRP F  1 81  ? 18.680  -78.864 -1.455  1.00 29.15  ? 79  TRP F CD2 1 
ATOM   7749 N  NE1 . TRP F  1 81  ? 18.035  -80.603 -0.188  1.00 32.62  ? 79  TRP F NE1 1 
ATOM   7750 C  CE2 . TRP F  1 81  ? 18.725  -79.421 -0.157  1.00 30.08  ? 79  TRP F CE2 1 
ATOM   7751 C  CE3 . TRP F  1 81  ? 19.322  -77.644 -1.691  1.00 28.15  ? 79  TRP F CE3 1 
ATOM   7752 C  CZ2 . TRP F  1 81  ? 19.370  -78.798 0.897   1.00 30.20  ? 79  TRP F CZ2 1 
ATOM   7753 C  CZ3 . TRP F  1 81  ? 19.969  -77.023 -0.638  1.00 28.45  ? 79  TRP F CZ3 1 
ATOM   7754 C  CH2 . TRP F  1 81  ? 19.982  -77.599 0.644   1.00 29.45  ? 79  TRP F CH2 1 
ATOM   7755 N  N   . ILE F  1 82  ? 14.447  -79.943 -2.436  1.00 29.32  ? 80  ILE F N   1 
ATOM   7756 C  CA  . ILE F  1 82  ? 13.484  -79.304 -1.549  1.00 30.43  ? 80  ILE F CA  1 
ATOM   7757 C  C   . ILE F  1 82  ? 13.977  -79.374 -0.115  1.00 29.80  ? 80  ILE F C   1 
ATOM   7758 O  O   . ILE F  1 82  ? 14.365  -80.434 0.358   1.00 30.29  ? 80  ILE F O   1 
ATOM   7759 C  CB  . ILE F  1 82  ? 12.117  -80.007 -1.614  1.00 33.00  ? 80  ILE F CB  1 
ATOM   7760 C  CG1 . ILE F  1 82  ? 11.591  -79.995 -3.044  1.00 33.62  ? 80  ILE F CG1 1 
ATOM   7761 C  CG2 . ILE F  1 82  ? 11.130  -79.338 -0.665  1.00 33.12  ? 80  ILE F CG2 1 
ATOM   7762 C  CD1 . ILE F  1 82  ? 10.473  -80.987 -3.299  1.00 37.30  ? 80  ILE F CD1 1 
ATOM   7763 N  N   . ARG F  1 83  ? 13.968  -78.241 0.574   1.00 28.83  ? 81  ARG F N   1 
ATOM   7764 C  CA  . ARG F  1 83  ? 14.261  -78.235 2.000   1.00 28.93  ? 81  ARG F CA  1 
ATOM   7765 C  C   . ARG F  1 83  ? 13.493  -77.126 2.706   1.00 27.80  ? 81  ARG F C   1 
ATOM   7766 O  O   . ARG F  1 83  ? 12.777  -76.339 2.078   1.00 28.06  ? 81  ARG F O   1 
ATOM   7767 C  CB  . ARG F  1 83  ? 15.771  -78.099 2.245   1.00 28.06  ? 81  ARG F CB  1 
ATOM   7768 C  CG  . ARG F  1 83  ? 16.364  -76.746 1.892   1.00 27.13  ? 81  ARG F CG  1 
ATOM   7769 C  CD  . ARG F  1 83  ? 16.383  -76.519 0.396   1.00 28.31  ? 81  ARG F CD  1 
ATOM   7770 N  NE  . ARG F  1 83  ? 17.262  -75.412 0.013   1.00 27.63  ? 81  ARG F NE  1 
ATOM   7771 C  CZ  . ARG F  1 83  ? 17.370  -74.935 -1.226  1.00 27.62  ? 81  ARG F CZ  1 
ATOM   7772 N  NH1 . ARG F  1 83  ? 16.647  -75.458 -2.210  1.00 28.69  ? 81  ARG F NH1 1 
ATOM   7773 N  NH2 . ARG F  1 83  ? 18.210  -73.942 -1.487  1.00 26.72  ? 81  ARG F NH2 1 
ATOM   7774 N  N   . THR F  1 84  ? 13.652  -77.066 4.017   1.00 27.20  ? 82  THR F N   1 
ATOM   7775 C  CA  . THR F  1 84  ? 12.857  -76.170 4.840   1.00 26.63  ? 82  THR F CA  1 
ATOM   7776 C  C   . THR F  1 84  ? 13.793  -75.193 5.534   1.00 23.40  ? 82  THR F C   1 
ATOM   7777 O  O   . THR F  1 84  ? 14.793  -75.597 6.128   1.00 22.94  ? 82  THR F O   1 
ATOM   7778 C  CB  . THR F  1 84  ? 12.057  -76.984 5.866   1.00 29.86  ? 82  THR F CB  1 
ATOM   7779 O  OG1 . THR F  1 84  ? 11.149  -77.844 5.169   1.00 31.97  ? 82  THR F OG1 1 
ATOM   7780 C  CG2 . THR F  1 84  ? 11.259  -76.083 6.793   1.00 31.34  ? 82  THR F CG2 1 
ATOM   7781 N  N   . PHE F  1 85  ? 13.497  -73.905 5.413   1.00 21.92  ? 83  PHE F N   1 
ATOM   7782 C  CA  . PHE F  1 85  ? 14.182  -72.884 6.203   1.00 20.74  ? 83  PHE F CA  1 
ATOM   7783 C  C   . PHE F  1 85  ? 13.317  -72.452 7.383   1.00 21.46  ? 83  PHE F C   1 
ATOM   7784 O  O   . PHE F  1 85  ? 12.241  -71.881 7.195   1.00 20.67  ? 83  PHE F O   1 
ATOM   7785 C  CB  . PHE F  1 85  ? 14.519  -71.654 5.361   1.00 18.98  ? 83  PHE F CB  1 
ATOM   7786 C  CG  . PHE F  1 85  ? 15.658  -71.857 4.407   1.00 18.89  ? 83  PHE F CG  1 
ATOM   7787 C  CD1 . PHE F  1 85  ? 16.110  -70.809 3.628   1.00 17.82  ? 83  PHE F CD1 1 
ATOM   7788 C  CD2 . PHE F  1 85  ? 16.276  -73.089 4.286   1.00 20.18  ? 83  PHE F CD2 1 
ATOM   7789 C  CE1 . PHE F  1 85  ? 17.159  -70.976 2.748   1.00 17.62  ? 83  PHE F CE1 1 
ATOM   7790 C  CE2 . PHE F  1 85  ? 17.323  -73.264 3.401   1.00 20.33  ? 83  PHE F CE2 1 
ATOM   7791 C  CZ  . PHE F  1 85  ? 17.767  -72.206 2.632   1.00 18.54  ? 83  PHE F CZ  1 
ATOM   7792 N  N   . VAL F  1 86  ? 13.824  -72.687 8.590   1.00 22.07  ? 84  VAL F N   1 
ATOM   7793 C  CA  . VAL F  1 86  ? 13.124  -72.307 9.816   1.00 23.73  ? 84  VAL F CA  1 
ATOM   7794 C  C   . VAL F  1 86  ? 13.658  -70.983 10.364  1.00 21.70  ? 84  VAL F C   1 
ATOM   7795 O  O   . VAL F  1 86  ? 14.867  -70.796 10.472  1.00 21.14  ? 84  VAL F O   1 
ATOM   7796 C  CB  . VAL F  1 86  ? 13.290  -73.394 10.896  1.00 25.72  ? 84  VAL F CB  1 
ATOM   7797 C  CG1 . VAL F  1 86  ? 12.566  -73.006 12.181  1.00 27.45  ? 84  VAL F CG1 1 
ATOM   7798 C  CG2 . VAL F  1 86  ? 12.771  -74.733 10.388  1.00 27.47  ? 84  VAL F CG2 1 
ATOM   7799 N  N   . PRO F  1 87  ? 12.756  -70.060 10.720  1.00 21.98  ? 85  PRO F N   1 
ATOM   7800 C  CA  . PRO F  1 87  ? 13.186  -68.752 11.212  1.00 21.08  ? 85  PRO F CA  1 
ATOM   7801 C  C   . PRO F  1 87  ? 14.107  -68.878 12.399  1.00 21.62  ? 85  PRO F C   1 
ATOM   7802 O  O   . PRO F  1 87  ? 13.866  -69.692 13.282  1.00 23.27  ? 85  PRO F O   1 
ATOM   7803 C  CB  . PRO F  1 87  ? 11.879  -68.084 11.646  1.00 21.84  ? 85  PRO F CB  1 
ATOM   7804 C  CG  . PRO F  1 87  ? 10.809  -68.787 10.887  1.00 22.87  ? 85  PRO F CG  1 
ATOM   7805 C  CD  . PRO F  1 87  ? 11.289  -70.197 10.703  1.00 23.22  ? 85  PRO F CD  1 
ATOM   7806 N  N   . GLY F  1 88  ? 15.179  -68.098 12.403  1.00 22.08  ? 86  GLY F N   1 
ATOM   7807 C  CA  . GLY F  1 88  ? 16.104  -68.091 13.517  1.00 23.86  ? 86  GLY F CA  1 
ATOM   7808 C  C   . GLY F  1 88  ? 15.807  -66.977 14.507  1.00 27.34  ? 86  GLY F C   1 
ATOM   7809 O  O   . GLY F  1 88  ? 14.667  -66.554 14.669  1.00 25.73  ? 86  GLY F O   1 
ATOM   7810 N  N   . SER F  1 89  ? 16.846  -66.474 15.153  1.00 32.15  ? 87  SER F N   1 
ATOM   7811 C  CA  . SER F  1 89  ? 16.653  -65.572 16.270  1.00 36.65  ? 87  SER F CA  1 
ATOM   7812 C  C   . SER F  1 89  ? 16.410  -64.121 15.830  1.00 36.39  ? 87  SER F C   1 
ATOM   7813 O  O   . SER F  1 89  ? 15.999  -63.301 16.640  1.00 40.78  ? 87  SER F O   1 
ATOM   7814 C  CB  . SER F  1 89  ? 17.868  -65.634 17.181  1.00 38.35  ? 87  SER F CB  1 
ATOM   7815 O  OG  . SER F  1 89  ? 18.951  -64.919 16.616  1.00 36.36  ? 87  SER F OG  1 
ATOM   7816 N  N   . GLN F  1 90  ? 16.691  -63.809 14.565  1.00 31.15  ? 88  GLN F N   1 
ATOM   7817 C  CA  . GLN F  1 90  ? 16.476  -62.476 14.024  1.00 26.62  ? 88  GLN F CA  1 
ATOM   7818 C  C   . GLN F  1 90  ? 15.797  -62.633 12.687  1.00 23.78  ? 88  GLN F C   1 
ATOM   7819 O  O   . GLN F  1 90  ? 16.158  -63.516 11.908  1.00 22.35  ? 88  GLN F O   1 
ATOM   7820 C  CB  . GLN F  1 90  ? 17.803  -61.753 13.807  1.00 29.00  ? 88  GLN F CB  1 
ATOM   7821 C  CG  . GLN F  1 90  ? 18.539  -61.353 15.070  1.00 35.64  ? 88  GLN F CG  1 
ATOM   7822 C  CD  . GLN F  1 90  ? 17.746  -60.377 15.912  1.00 41.49  ? 88  GLN F CD  1 
ATOM   7823 O  OE1 . GLN F  1 90  ? 17.588  -60.568 17.120  1.00 47.34  ? 88  GLN F OE1 1 
ATOM   7824 N  NE2 . GLN F  1 90  ? 17.230  -59.330 15.277  1.00 43.71  ? 88  GLN F NE2 1 
ATOM   7825 N  N   . PRO F  1 91  ? 14.826  -61.764 12.393  1.00 22.22  ? 89  PRO F N   1 
ATOM   7826 C  CA  . PRO F  1 91  ? 14.198  -61.844 11.080  1.00 21.49  ? 89  PRO F CA  1 
ATOM   7827 C  C   . PRO F  1 91  ? 15.227  -61.757 9.946   1.00 21.11  ? 89  PRO F C   1 
ATOM   7828 O  O   . PRO F  1 91  ? 16.108  -60.879 9.948   1.00 18.03  ? 89  PRO F O   1 
ATOM   7829 C  CB  . PRO F  1 91  ? 13.240  -60.641 11.069  1.00 22.78  ? 89  PRO F CB  1 
ATOM   7830 C  CG  . PRO F  1 91  ? 12.991  -60.338 12.515  1.00 23.57  ? 89  PRO F CG  1 
ATOM   7831 C  CD  . PRO F  1 91  ? 14.289  -60.651 13.200  1.00 23.14  ? 89  PRO F CD  1 
ATOM   7832 N  N   . GLY F  1 92  ? 15.111  -62.668 8.987   1.00 19.57  ? 90  GLY F N   1 
ATOM   7833 C  CA  . GLY F  1 92  ? 16.062  -62.729 7.883   1.00 20.22  ? 90  GLY F CA  1 
ATOM   7834 C  C   . GLY F  1 92  ? 17.158  -63.761 8.107   1.00 18.97  ? 90  GLY F C   1 
ATOM   7835 O  O   . GLY F  1 92  ? 17.984  -63.992 7.228   1.00 16.84  ? 90  GLY F O   1 
ATOM   7836 N  N   . GLU F  1 93  ? 17.164  -64.371 9.292   1.00 18.35  ? 91  GLU F N   1 
ATOM   7837 C  CA  . GLU F  1 93  ? 18.058  -65.485 9.572   1.00 17.73  ? 91  GLU F CA  1 
ATOM   7838 C  C   . GLU F  1 93  ? 17.265  -66.772 9.648   1.00 17.88  ? 91  GLU F C   1 
ATOM   7839 O  O   . GLU F  1 93  ? 16.133  -66.777 10.123  1.00 18.20  ? 91  GLU F O   1 
ATOM   7840 C  CB  . GLU F  1 93  ? 18.795  -65.279 10.892  1.00 17.21  ? 91  GLU F CB  1 
ATOM   7841 C  CG  . GLU F  1 93  ? 19.754  -64.106 10.845  1.00 18.31  ? 91  GLU F CG  1 
ATOM   7842 C  CD  . GLU F  1 93  ? 20.685  -64.085 12.013  1.00 19.23  ? 91  GLU F CD  1 
ATOM   7843 O  OE1 . GLU F  1 93  ? 21.818  -63.627 11.823  1.00 21.63  ? 91  GLU F OE1 1 
ATOM   7844 O  OE2 . GLU F  1 93  ? 20.309  -64.579 13.097  1.00 21.81  ? 91  GLU F OE2 1 
ATOM   7845 N  N   . PHE F  1 94  ? 17.870  -67.862 9.181   1.00 17.08  ? 92  PHE F N   1 
ATOM   7846 C  CA  . PHE F  1 94  ? 17.197  -69.152 9.175   1.00 18.78  ? 92  PHE F CA  1 
ATOM   7847 C  C   . PHE F  1 94  ? 18.185  -70.245 9.471   1.00 19.35  ? 92  PHE F C   1 
ATOM   7848 O  O   . PHE F  1 94  ? 19.394  -70.071 9.291   1.00 19.09  ? 92  PHE F O   1 
ATOM   7849 C  CB  . PHE F  1 94  ? 16.536  -69.404 7.824   1.00 17.91  ? 92  PHE F CB  1 
ATOM   7850 C  CG  . PHE F  1 94  ? 15.662  -68.282 7.381   1.00 17.08  ? 92  PHE F CG  1 
ATOM   7851 C  CD1 . PHE F  1 94  ? 16.201  -67.189 6.738   1.00 16.57  ? 92  PHE F CD1 1 
ATOM   7852 C  CD2 . PHE F  1 94  ? 14.304  -68.295 7.653   1.00 17.90  ? 92  PHE F CD2 1 
ATOM   7853 C  CE1 . PHE F  1 94  ? 15.382  -66.146 6.336   1.00 17.00  ? 92  PHE F CE1 1 
ATOM   7854 C  CE2 . PHE F  1 94  ? 13.485  -67.254 7.272   1.00 17.07  ? 92  PHE F CE2 1 
ATOM   7855 C  CZ  . PHE F  1 94  ? 14.022  -66.178 6.617   1.00 16.68  ? 92  PHE F CZ  1 
ATOM   7856 N  N   . THR F  1 95  ? 17.674  -71.361 9.972   1.00 21.95  ? 93  THR F N   1 
ATOM   7857 C  CA  . THR F  1 95  ? 18.407  -72.597 9.852   1.00 25.00  ? 93  THR F CA  1 
ATOM   7858 C  C   . THR F  1 95  ? 17.627  -73.636 9.089   1.00 24.62  ? 93  THR F C   1 
ATOM   7859 O  O   . THR F  1 95  ? 16.449  -73.471 8.755   1.00 22.27  ? 93  THR F O   1 
ATOM   7860 C  CB  . THR F  1 95  ? 18.807  -73.218 11.198  1.00 31.03  ? 93  THR F CB  1 
ATOM   7861 O  OG1 . THR F  1 95  ? 19.636  -74.374 10.946  1.00 39.87  ? 93  THR F OG1 1 
ATOM   7862 C  CG2 . THR F  1 95  ? 17.574  -73.649 11.970  1.00 31.65  ? 93  THR F CG2 1 
ATOM   7863 N  N   . LEU F  1 96  ? 18.314  -74.730 8.842   1.00 24.95  ? 94  LEU F N   1 
ATOM   7864 C  CA  . LEU F  1 96  ? 17.751  -75.808 8.082   1.00 26.78  ? 94  LEU F CA  1 
ATOM   7865 C  C   . LEU F  1 96  ? 16.847  -76.665 8.979   1.00 27.61  ? 94  LEU F C   1 
ATOM   7866 O  O   . LEU F  1 96  ? 17.246  -77.054 10.067  1.00 28.24  ? 94  LEU F O   1 
ATOM   7867 C  CB  . LEU F  1 96  ? 18.914  -76.614 7.528   1.00 27.80  ? 94  LEU F CB  1 
ATOM   7868 C  CG  . LEU F  1 96  ? 18.616  -77.508 6.351   1.00 30.46  ? 94  LEU F CG  1 
ATOM   7869 C  CD1 . LEU F  1 96  ? 18.112  -76.704 5.169   1.00 28.86  ? 94  LEU F CD1 1 
ATOM   7870 C  CD2 . LEU F  1 96  ? 19.891  -78.271 6.003   1.00 32.40  ? 94  LEU F CD2 1 
ATOM   7871 N  N   . GLY F  1 97  ? 15.617  -76.915 8.540   1.00 27.50  ? 95  GLY F N   1 
ATOM   7872 C  CA  . GLY F  1 97  ? 14.705  -77.784 9.277   1.00 28.41  ? 95  GLY F CA  1 
ATOM   7873 C  C   . GLY F  1 97  ? 15.045  -79.246 9.133   1.00 29.98  ? 95  GLY F C   1 
ATOM   7874 O  O   . GLY F  1 97  ? 15.585  -79.679 8.112   1.00 29.96  ? 95  GLY F O   1 
ATOM   7875 N  N   . ASN F  1 98  ? 14.752  -80.003 10.183  1.00 31.98  ? 96  ASN F N   1 
ATOM   7876 C  CA  A ASN F  1 98  ? 15.160  -81.391 10.264  0.50 33.47  ? 96  ASN F CA  1 
ATOM   7877 C  CA  B ASN F  1 98  ? 15.165  -81.395 10.271  0.50 33.85  ? 96  ASN F CA  1 
ATOM   7878 C  C   . ASN F  1 98  ? 16.660  -81.554 9.992   1.00 33.55  ? 96  ASN F C   1 
ATOM   7879 O  O   . ASN F  1 98  ? 17.084  -82.487 9.297   1.00 36.06  ? 96  ASN F O   1 
ATOM   7880 C  CB  A ASN F  1 98  ? 14.345  -82.244 9.293   0.50 34.42  ? 96  ASN F CB  1 
ATOM   7881 C  CB  B ASN F  1 98  ? 14.343  -82.249 9.304   0.50 35.24  ? 96  ASN F CB  1 
ATOM   7882 C  CG  A ASN F  1 98  ? 12.849  -82.157 9.547   0.50 34.75  ? 96  ASN F CG  1 
ATOM   7883 C  CG  B ASN F  1 98  ? 13.942  -83.585 9.902   0.50 38.00  ? 96  ASN F CG  1 
ATOM   7884 O  OD1 A ASN F  1 98  ? 12.371  -82.529 10.618  0.50 36.11  ? 96  ASN F OD1 1 
ATOM   7885 O  OD1 B ASN F  1 98  ? 14.145  -83.833 11.094  0.50 39.10  ? 96  ASN F OD1 1 
ATOM   7886 N  ND2 A ASN F  1 98  ? 12.103  -81.688 8.555   0.50 33.58  ? 96  ASN F ND2 1 
ATOM   7887 N  ND2 B ASN F  1 98  ? 13.378  -84.455 9.075   0.50 38.92  ? 96  ASN F ND2 1 
ATOM   7888 N  N   . ILE F  1 99  ? 17.460  -80.645 10.543  1.00 30.98  ? 97  ILE F N   1 
ATOM   7889 C  CA  . ILE F  1 99  ? 18.903  -80.651 10.323  1.00 30.55  ? 97  ILE F CA  1 
ATOM   7890 C  C   . ILE F  1 99  ? 19.547  -81.974 10.734  1.00 33.51  ? 97  ILE F C   1 
ATOM   7891 O  O   . ILE F  1 99  ? 20.543  -82.391 10.152  1.00 34.54  ? 97  ILE F O   1 
ATOM   7892 C  CB  . ILE F  1 99  ? 19.580  -79.416 10.978  1.00 28.26  ? 97  ILE F CB  1 
ATOM   7893 C  CG1 . ILE F  1 99  ? 21.087  -79.340 10.695  1.00 27.86  ? 97  ILE F CG1 1 
ATOM   7894 C  CG2 . ILE F  1 99  ? 19.349  -79.364 12.476  1.00 28.28  ? 97  ILE F CG2 1 
ATOM   7895 C  CD1 . ILE F  1 99  ? 21.735  -78.083 11.244  1.00 26.36  ? 97  ILE F CD1 1 
ATOM   7896 N  N   . LYS F  1 100 ? 18.950  -82.664 11.697  1.00 36.03  ? 98  LYS F N   1 
ATOM   7897 C  CA  . LYS F  1 100 ? 19.502  -83.909 12.197  1.00 39.11  ? 98  LYS F CA  1 
ATOM   7898 C  C   . LYS F  1 100 ? 19.413  -85.046 11.180  1.00 40.33  ? 98  LYS F C   1 
ATOM   7899 O  O   . LYS F  1 100 ? 20.104  -86.048 11.312  1.00 41.67  ? 98  LYS F O   1 
ATOM   7900 C  CB  . LYS F  1 100 ? 18.771  -84.295 13.473  1.00 41.98  ? 98  LYS F CB  1 
ATOM   7901 C  CG  . LYS F  1 100 ? 18.889  -83.255 14.573  1.00 41.85  ? 98  LYS F CG  1 
ATOM   7902 C  CD  . LYS F  1 100 ? 20.298  -83.172 15.137  1.00 42.01  ? 98  LYS F CD  1 
ATOM   7903 C  CE  . LYS F  1 100 ? 20.379  -82.070 16.171  1.00 41.78  ? 98  LYS F CE  1 
ATOM   7904 N  NZ  . LYS F  1 100 ? 21.373  -82.366 17.236  1.00 45.35  ? 98  LYS F NZ  1 
ATOM   7905 N  N   . SER F  1 101 ? 18.576  -84.884 10.162  1.00 39.54  ? 99  SER F N   1 
ATOM   7906 C  CA  . SER F  1 101 ? 18.362  -85.933 9.173   1.00 40.52  ? 99  SER F CA  1 
ATOM   7907 C  C   . SER F  1 101 ? 19.406  -85.895 8.055   1.00 39.26  ? 99  SER F C   1 
ATOM   7908 O  O   . SER F  1 101 ? 19.444  -86.794 7.233   1.00 39.89  ? 99  SER F O   1 
ATOM   7909 C  CB  . SER F  1 101 ? 16.974  -85.797 8.549   1.00 41.20  ? 99  SER F CB  1 
ATOM   7910 O  OG  . SER F  1 101 ? 16.970  -84.758 7.569   1.00 40.98  ? 99  SER F OG  1 
ATOM   7911 N  N   . TYR F  1 102 ? 20.248  -84.865 8.020   1.00 37.03  ? 100 TYR F N   1 
ATOM   7912 C  CA  . TYR F  1 102 ? 21.310  -84.797 7.011   1.00 37.42  ? 100 TYR F CA  1 
ATOM   7913 C  C   . TYR F  1 102 ? 22.632  -85.313 7.589   1.00 39.26  ? 100 TYR F C   1 
ATOM   7914 O  O   . TYR F  1 102 ? 23.225  -84.662 8.447   1.00 38.86  ? 100 TYR F O   1 
ATOM   7915 C  CB  . TYR F  1 102 ? 21.500  -83.356 6.510   1.00 35.12  ? 100 TYR F CB  1 
ATOM   7916 C  CG  . TYR F  1 102 ? 20.265  -82.725 5.888   1.00 34.16  ? 100 TYR F CG  1 
ATOM   7917 C  CD1 . TYR F  1 102 ? 19.418  -81.938 6.644   1.00 33.72  ? 100 TYR F CD1 1 
ATOM   7918 C  CD2 . TYR F  1 102 ? 19.978  -82.880 4.531   1.00 33.84  ? 100 TYR F CD2 1 
ATOM   7919 C  CE1 . TYR F  1 102 ? 18.309  -81.329 6.080   1.00 34.26  ? 100 TYR F CE1 1 
ATOM   7920 C  CE2 . TYR F  1 102 ? 18.860  -82.288 3.957   1.00 33.28  ? 100 TYR F CE2 1 
ATOM   7921 C  CZ  . TYR F  1 102 ? 18.029  -81.504 4.737   1.00 33.49  ? 100 TYR F CZ  1 
ATOM   7922 O  OH  . TYR F  1 102 ? 16.905  -80.902 4.191   1.00 33.03  ? 100 TYR F OH  1 
ATOM   7923 N  N   . PRO F  1 103 ? 23.113  -86.474 7.108   1.00 41.58  ? 101 PRO F N   1 
ATOM   7924 C  CA  . PRO F  1 103 ? 24.294  -87.074 7.729   1.00 43.02  ? 101 PRO F CA  1 
ATOM   7925 C  C   . PRO F  1 103 ? 25.540  -86.207 7.562   1.00 41.41  ? 101 PRO F C   1 
ATOM   7926 O  O   . PRO F  1 103 ? 25.759  -85.643 6.492   1.00 41.17  ? 101 PRO F O   1 
ATOM   7927 C  CB  . PRO F  1 103 ? 24.462  -88.407 6.980   1.00 46.07  ? 101 PRO F CB  1 
ATOM   7928 C  CG  . PRO F  1 103 ? 23.164  -88.639 6.276   1.00 46.48  ? 101 PRO F CG  1 
ATOM   7929 C  CD  . PRO F  1 103 ? 22.625  -87.273 5.973   1.00 43.79  ? 101 PRO F CD  1 
ATOM   7930 N  N   . GLY F  1 104 ? 26.340  -86.094 8.615   1.00 40.73  ? 102 GLY F N   1 
ATOM   7931 C  CA  . GLY F  1 104 ? 27.575  -85.317 8.556   1.00 39.92  ? 102 GLY F CA  1 
ATOM   7932 C  C   . GLY F  1 104 ? 27.395  -83.843 8.863   1.00 36.69  ? 102 GLY F C   1 
ATOM   7933 O  O   . GLY F  1 104 ? 28.376  -83.141 9.128   1.00 34.72  ? 102 GLY F O   1 
ATOM   7934 N  N   . LEU F  1 105 ? 26.150  -83.371 8.828   1.00 35.99  ? 103 LEU F N   1 
ATOM   7935 C  CA  . LEU F  1 105 ? 25.876  -81.942 8.916   1.00 34.69  ? 103 LEU F CA  1 
ATOM   7936 C  C   . LEU F  1 105 ? 25.714  -81.542 10.370  1.00 34.53  ? 103 LEU F C   1 
ATOM   7937 O  O   . LEU F  1 105 ? 24.870  -82.077 11.078  1.00 37.30  ? 103 LEU F O   1 
ATOM   7938 C  CB  . LEU F  1 105 ? 24.598  -81.602 8.141   1.00 35.49  ? 103 LEU F CB  1 
ATOM   7939 C  CG  . LEU F  1 105 ? 24.230  -80.120 8.071   1.00 35.05  ? 103 LEU F CG  1 
ATOM   7940 C  CD1 . LEU F  1 105 ? 25.377  -79.330 7.463   1.00 35.89  ? 103 LEU F CD1 1 
ATOM   7941 C  CD2 . LEU F  1 105 ? 22.950  -79.924 7.261   1.00 33.95  ? 103 LEU F CD2 1 
ATOM   7942 N  N   . THR F  1 106 ? 26.531  -80.614 10.845  1.00 33.45  ? 104 THR F N   1 
ATOM   7943 C  CA  . THR F  1 106 ? 26.439  -80.255 12.247  1.00 32.67  ? 104 THR F CA  1 
ATOM   7944 C  C   . THR F  1 106 ? 25.833  -78.876 12.422  1.00 28.58  ? 104 THR F C   1 
ATOM   7945 O  O   . THR F  1 106 ? 25.151  -78.636 13.402  1.00 28.19  ? 104 THR F O   1 
ATOM   7946 C  CB  . THR F  1 106 ? 27.774  -80.381 13.009  1.00 34.16  ? 104 THR F CB  1 
ATOM   7947 O  OG1 . THR F  1 106 ? 28.769  -79.563 12.403  1.00 34.80  ? 104 THR F OG1 1 
ATOM   7948 C  CG2 . THR F  1 106 ? 28.244  -81.833 13.039  1.00 37.59  ? 104 THR F CG2 1 
ATOM   7949 N  N   . SER F  1 107 ? 26.064  -77.974 11.477  1.00 26.12  ? 105 SER F N   1 
ATOM   7950 C  CA  . SER F  1 107 ? 25.433  -76.667 11.553  1.00 24.43  ? 105 SER F CA  1 
ATOM   7951 C  C   . SER F  1 107 ? 25.177  -76.042 10.203  1.00 22.60  ? 105 SER F C   1 
ATOM   7952 O  O   . SER F  1 107 ? 25.866  -76.323 9.238   1.00 22.52  ? 105 SER F O   1 
ATOM   7953 C  CB  . SER F  1 107 ? 26.230  -75.717 12.455  1.00 23.07  ? 105 SER F CB  1 
ATOM   7954 O  OG  . SER F  1 107 ? 27.468  -75.366 11.887  1.00 22.31  ? 105 SER F OG  1 
ATOM   7955 N  N   . TYR F  1 108 ? 24.139  -75.219 10.147  1.00 21.61  ? 106 TYR F N   1 
ATOM   7956 C  CA  . TYR F  1 108 ? 23.700  -74.597 8.911   1.00 20.62  ? 106 TYR F CA  1 
ATOM   7957 C  C   . TYR F  1 108 ? 23.071  -73.274 9.293   1.00 19.64  ? 106 TYR F C   1 
ATOM   7958 O  O   . TYR F  1 108 ? 22.169  -73.229 10.114  1.00 20.23  ? 106 TYR F O   1 
ATOM   7959 C  CB  . TYR F  1 108 ? 22.692  -75.490 8.165   1.00 21.79  ? 106 TYR F CB  1 
ATOM   7960 C  CG  . TYR F  1 108 ? 22.560  -75.169 6.696   1.00 21.81  ? 106 TYR F CG  1 
ATOM   7961 C  CD1 . TYR F  1 108 ? 21.656  -74.210 6.251   1.00 20.41  ? 106 TYR F CD1 1 
ATOM   7962 C  CD2 . TYR F  1 108 ? 23.323  -75.844 5.747   1.00 23.18  ? 106 TYR F CD2 1 
ATOM   7963 C  CE1 . TYR F  1 108 ? 21.522  -73.920 4.901   1.00 20.52  ? 106 TYR F CE1 1 
ATOM   7964 C  CE2 . TYR F  1 108 ? 23.208  -75.548 4.400   1.00 23.92  ? 106 TYR F CE2 1 
ATOM   7965 C  CZ  . TYR F  1 108 ? 22.302  -74.584 3.991   1.00 22.79  ? 106 TYR F CZ  1 
ATOM   7966 O  OH  . TYR F  1 108 ? 22.174  -74.290 2.662   1.00 27.43  ? 106 TYR F OH  1 
ATOM   7967 N  N   . LEU F  1 109 ? 23.570  -72.197 8.709   1.00 19.80  ? 107 LEU F N   1 
ATOM   7968 C  CA  . LEU F  1 109 ? 23.013  -70.885 8.924   1.00 19.17  ? 107 LEU F CA  1 
ATOM   7969 C  C   . LEU F  1 109 ? 22.774  -70.146 7.604   1.00 18.35  ? 107 LEU F C   1 
ATOM   7970 O  O   . LEU F  1 109 ? 23.631  -70.137 6.706   1.00 15.69  ? 107 LEU F O   1 
ATOM   7971 C  CB  . LEU F  1 109 ? 23.982  -70.079 9.778   1.00 20.38  ? 107 LEU F CB  1 
ATOM   7972 C  CG  . LEU F  1 109 ? 23.554  -68.640 10.051  1.00 21.11  ? 107 LEU F CG  1 
ATOM   7973 C  CD1 . LEU F  1 109 ? 22.382  -68.601 11.018  1.00 21.74  ? 107 LEU F CD1 1 
ATOM   7974 C  CD2 . LEU F  1 109 ? 24.729  -67.833 10.579  1.00 21.68  ? 107 LEU F CD2 1 
ATOM   7975 N  N   . VAL F  1 110 ? 21.611  -69.495 7.525   1.00 18.16  ? 108 VAL F N   1 
ATOM   7976 C  CA  . VAL F  1 110 ? 21.259  -68.632 6.404   1.00 17.29  ? 108 VAL F CA  1 
ATOM   7977 C  C   . VAL F  1 110 ? 21.063  -67.225 6.938   1.00 16.62  ? 108 VAL F C   1 
ATOM   7978 O  O   . VAL F  1 110 ? 20.343  -67.025 7.917   1.00 15.60  ? 108 VAL F O   1 
ATOM   7979 C  CB  . VAL F  1 110 ? 19.934  -69.082 5.743   1.00 17.45  ? 108 VAL F CB  1 
ATOM   7980 C  CG1 . VAL F  1 110 ? 19.593  -68.198 4.553   1.00 16.39  ? 108 VAL F CG1 1 
ATOM   7981 C  CG2 . VAL F  1 110 ? 20.026  -70.540 5.312   1.00 19.23  ? 108 VAL F CG2 1 
ATOM   7982 N  N   . ARG F  1 111 ? 21.665  -66.248 6.271   1.00 16.20  ? 109 ARG F N   1 
ATOM   7983 C  CA  . ARG F  1 111 ? 21.407  -64.858 6.605   1.00 16.64  ? 109 ARG F CA  1 
ATOM   7984 C  C   . ARG F  1 111 ? 21.195  -64.022 5.354   1.00 15.38  ? 109 ARG F C   1 
ATOM   7985 O  O   . ARG F  1 111 ? 22.074  -63.926 4.507   1.00 15.15  ? 109 ARG F O   1 
ATOM   7986 C  CB  . ARG F  1 111 ? 22.570  -64.282 7.400   1.00 16.33  ? 109 ARG F CB  1 
ATOM   7987 C  CG  . ARG F  1 111 ? 22.415  -62.800 7.666   1.00 16.41  ? 109 ARG F CG  1 
ATOM   7988 C  CD  . ARG F  1 111 ? 23.577  -62.259 8.485   1.00 17.39  ? 109 ARG F CD  1 
ATOM   7989 N  NE  . ARG F  1 111 ? 23.531  -62.737 9.865   1.00 17.69  ? 109 ARG F NE  1 
ATOM   7990 C  CZ  . ARG F  1 111 ? 24.457  -62.487 10.781  1.00 16.88  ? 109 ARG F CZ  1 
ATOM   7991 N  NH1 . ARG F  1 111 ? 24.322  -62.980 11.995  1.00 18.49  ? 109 ARG F NH1 1 
ATOM   7992 N  NH2 . ARG F  1 111 ? 25.524  -61.763 10.481  1.00 18.16  ? 109 ARG F NH2 1 
ATOM   7993 N  N   . VAL F  1 112 ? 20.027  -63.405 5.251   1.00 16.17  ? 110 VAL F N   1 
ATOM   7994 C  CA  . VAL F  1 112 ? 19.760  -62.492 4.150   1.00 16.09  ? 110 VAL F CA  1 
ATOM   7995 C  C   . VAL F  1 112 ? 20.506  -61.189 4.397   1.00 15.42  ? 110 VAL F C   1 
ATOM   7996 O  O   . VAL F  1 112 ? 20.221  -60.479 5.350   1.00 14.50  ? 110 VAL F O   1 
ATOM   7997 C  CB  . VAL F  1 112 ? 18.257  -62.221 3.986   1.00 16.21  ? 110 VAL F CB  1 
ATOM   7998 C  CG1 . VAL F  1 112 ? 18.017  -61.234 2.858   1.00 16.55  ? 110 VAL F CG1 1 
ATOM   7999 C  CG2 . VAL F  1 112 ? 17.503  -63.521 3.733   1.00 17.04  ? 110 VAL F CG2 1 
ATOM   8000 N  N   . VAL F  1 113 ? 21.456  -60.885 3.518   1.00 15.73  ? 111 VAL F N   1 
ATOM   8001 C  CA  . VAL F  1 113 ? 22.337  -59.748 3.690   1.00 15.12  ? 111 VAL F CA  1 
ATOM   8002 C  C   . VAL F  1 113 ? 21.672  -58.458 3.221   1.00 15.97  ? 111 VAL F C   1 
ATOM   8003 O  O   . VAL F  1 113 ? 21.720  -57.440 3.917   1.00 16.83  ? 111 VAL F O   1 
ATOM   8004 C  CB  . VAL F  1 113 ? 23.642  -59.945 2.916   1.00 14.59  ? 111 VAL F CB  1 
ATOM   8005 C  CG1 . VAL F  1 113 ? 24.514  -58.712 3.027   1.00 15.50  ? 111 VAL F CG1 1 
ATOM   8006 C  CG2 . VAL F  1 113 ? 24.382  -61.167 3.429   1.00 15.67  ? 111 VAL F CG2 1 
ATOM   8007 N  N   . SER F  1 114 ? 21.093  -58.474 2.026   1.00 16.41  ? 112 SER F N   1 
ATOM   8008 C  CA  . SER F  1 114 ? 20.362  -57.302 1.544   1.00 18.02  ? 112 SER F CA  1 
ATOM   8009 C  C   . SER F  1 114 ? 19.475  -57.647 0.386   1.00 16.43  ? 112 SER F C   1 
ATOM   8010 O  O   . SER F  1 114 ? 19.751  -58.573 -0.368  1.00 20.12  ? 112 SER F O   1 
ATOM   8011 C  CB  . SER F  1 114 ? 21.312  -56.177 1.117   1.00 18.51  ? 112 SER F CB  1 
ATOM   8012 O  OG  . SER F  1 114 ? 21.917  -56.506 -0.098  1.00 20.26  ? 112 SER F OG  1 
ATOM   8013 N  N   . THR F  1 115 ? 18.373  -56.929 0.273   1.00 15.98  ? 113 THR F N   1 
ATOM   8014 C  CA  . THR F  1 115 ? 17.435  -57.163 -0.812  1.00 16.86  ? 113 THR F CA  1 
ATOM   8015 C  C   . THR F  1 115 ? 16.526  -55.956 -0.961  1.00 16.41  ? 113 THR F C   1 
ATOM   8016 O  O   . THR F  1 115 ? 16.310  -55.221 -0.010  1.00 15.07  ? 113 THR F O   1 
ATOM   8017 C  CB  . THR F  1 115 ? 16.583  -58.432 -0.571  1.00 16.69  ? 113 THR F CB  1 
ATOM   8018 O  OG1 . THR F  1 115 ? 15.733  -58.667 -1.703  1.00 17.40  ? 113 THR F OG1 1 
ATOM   8019 C  CG2 . THR F  1 115 ? 15.729  -58.293 0.673   1.00 16.53  ? 113 THR F CG2 1 
ATOM   8020 N  N   . ASN F  1 116 ? 16.000  -55.766 -2.164  1.00 16.81  ? 114 ASN F N   1 
ATOM   8021 C  CA  . ASN F  1 116 ? 14.899  -54.844 -2.376  1.00 17.50  ? 114 ASN F CA  1 
ATOM   8022 C  C   . ASN F  1 116 ? 13.638  -55.592 -2.823  1.00 18.26  ? 114 ASN F C   1 
ATOM   8023 O  O   . ASN F  1 116 ? 12.651  -54.973 -3.229  1.00 19.31  ? 114 ASN F O   1 
ATOM   8024 C  CB  . ASN F  1 116 ? 15.292  -53.764 -3.382  1.00 16.90  ? 114 ASN F CB  1 
ATOM   8025 C  CG  . ASN F  1 116 ? 15.367  -54.280 -4.811  1.00 16.41  ? 114 ASN F CG  1 
ATOM   8026 O  OD1 . ASN F  1 116 ? 15.287  -55.479 -5.072  1.00 15.21  ? 114 ASN F OD1 1 
ATOM   8027 N  ND2 . ASN F  1 116 ? 15.487  -53.359 -5.748  1.00 17.50  ? 114 ASN F ND2 1 
ATOM   8028 N  N   . TYR F  1 117 ? 13.686  -56.920 -2.725  1.00 16.36  ? 115 TYR F N   1 
ATOM   8029 C  CA  . TYR F  1 117 ? 12.496  -57.773 -2.817  1.00 17.52  ? 115 TYR F CA  1 
ATOM   8030 C  C   . TYR F  1 117 ? 11.960  -57.976 -4.234  1.00 18.56  ? 115 TYR F C   1 
ATOM   8031 O  O   . TYR F  1 117 ? 11.572  -59.090 -4.594  1.00 17.18  ? 115 TYR F O   1 
ATOM   8032 C  CB  . TYR F  1 117 ? 11.384  -57.274 -1.897  1.00 18.56  ? 115 TYR F CB  1 
ATOM   8033 C  CG  . TYR F  1 117 ? 11.789  -57.240 -0.440  1.00 17.85  ? 115 TYR F CG  1 
ATOM   8034 C  CD1 . TYR F  1 117 ? 11.901  -58.412 0.297   1.00 17.08  ? 115 TYR F CD1 1 
ATOM   8035 C  CD2 . TYR F  1 117 ? 12.088  -56.031 0.191   1.00 17.80  ? 115 TYR F CD2 1 
ATOM   8036 C  CE1 . TYR F  1 117 ? 12.302  -58.387 1.623   1.00 17.71  ? 115 TYR F CE1 1 
ATOM   8037 C  CE2 . TYR F  1 117 ? 12.487  -55.994 1.520   1.00 18.38  ? 115 TYR F CE2 1 
ATOM   8038 C  CZ  . TYR F  1 117 ? 12.591  -57.174 2.232   1.00 17.72  ? 115 TYR F CZ  1 
ATOM   8039 O  OH  . TYR F  1 117 ? 12.962  -57.139 3.550   1.00 16.96  ? 115 TYR F OH  1 
ATOM   8040 N  N   . ASN F  1 118 ? 11.957  -56.926 -5.053  1.00 21.50  ? 116 ASN F N   1 
ATOM   8041 C  CA  . ASN F  1 118 ? 11.365  -57.038 -6.394  1.00 23.44  ? 116 ASN F CA  1 
ATOM   8042 C  C   . ASN F  1 118 ? 12.388  -57.096 -7.523  1.00 23.33  ? 116 ASN F C   1 
ATOM   8043 O  O   . ASN F  1 118 ? 12.013  -57.128 -8.694  1.00 22.12  ? 116 ASN F O   1 
ATOM   8044 C  CB  . ASN F  1 118 ? 10.342  -55.933 -6.643  1.00 24.46  ? 116 ASN F CB  1 
ATOM   8045 C  CG  . ASN F  1 118 ? 10.960  -54.556 -6.668  1.00 27.36  ? 116 ASN F CG  1 
ATOM   8046 O  OD1 . ASN F  1 118 ? 12.165  -54.393 -6.511  1.00 26.23  ? 116 ASN F OD1 1 
ATOM   8047 N  ND2 . ASN F  1 118 ? 10.127  -53.549 -6.876  1.00 30.96  ? 116 ASN F ND2 1 
ATOM   8048 N  N   . GLN F  1 119 ? 13.674  -57.154 -7.171  1.00 22.72  ? 117 GLN F N   1 
ATOM   8049 C  CA  . GLN F  1 119 ? 14.738  -57.144 -8.154  1.00 24.00  ? 117 GLN F CA  1 
ATOM   8050 C  C   . GLN F  1 119 ? 15.903  -58.049 -7.748  1.00 21.91  ? 117 GLN F C   1 
ATOM   8051 O  O   . GLN F  1 119 ? 16.243  -58.995 -8.465  1.00 24.29  ? 117 GLN F O   1 
ATOM   8052 C  CB  . GLN F  1 119 ? 15.254  -55.711 -8.245  1.00 29.54  ? 117 GLN F CB  1 
ATOM   8053 C  CG  . GLN F  1 119 ? 15.907  -55.307 -9.548  1.00 40.12  ? 117 GLN F CG  1 
ATOM   8054 C  CD  . GLN F  1 119 ? 16.774  -54.069 -9.365  1.00 50.99  ? 117 GLN F CD  1 
ATOM   8055 O  OE1 . GLN F  1 119 ? 16.502  -53.235 -8.496  1.00 51.01  ? 117 GLN F OE1 1 
ATOM   8056 N  NE2 . GLN F  1 119 ? 17.826  -53.948 -10.174 1.00 52.27  ? 117 GLN F NE2 1 
ATOM   8057 N  N   . HIS F  1 120 ? 16.533  -57.747 -6.614  1.00 18.54  ? 118 HIS F N   1 
ATOM   8058 C  CA  . HIS F  1 120 ? 17.783  -58.401 -6.232  1.00 18.27  ? 118 HIS F CA  1 
ATOM   8059 C  C   . HIS F  1 120 ? 17.841  -58.816 -4.764  1.00 16.70  ? 118 HIS F C   1 
ATOM   8060 O  O   . HIS F  1 120 ? 17.119  -58.276 -3.937  1.00 15.95  ? 118 HIS F O   1 
ATOM   8061 C  CB  . HIS F  1 120 ? 18.988  -57.526 -6.551  1.00 17.60  ? 118 HIS F CB  1 
ATOM   8062 C  CG  . HIS F  1 120 ? 18.955  -56.174 -5.910  1.00 20.38  ? 118 HIS F CG  1 
ATOM   8063 N  ND1 . HIS F  1 120 ? 19.375  -55.951 -4.619  1.00 21.52  ? 118 HIS F ND1 1 
ATOM   8064 C  CD2 . HIS F  1 120 ? 18.591  -54.963 -6.399  1.00 24.09  ? 118 HIS F CD2 1 
ATOM   8065 C  CE1 . HIS F  1 120 ? 19.251  -54.666 -4.330  1.00 22.06  ? 118 HIS F CE1 1 
ATOM   8066 N  NE2 . HIS F  1 120 ? 18.780  -54.043 -5.395  1.00 22.62  ? 118 HIS F NE2 1 
ATOM   8067 N  N   . ALA F  1 121 ? 18.727  -59.769 -4.461  1.00 14.67  ? 119 ALA F N   1 
ATOM   8068 C  CA  . ALA F  1 121 ? 19.039  -60.133 -3.092  1.00 14.86  ? 119 ALA F CA  1 
ATOM   8069 C  C   . ALA F  1 121 ? 20.429  -60.753 -2.999  1.00 15.38  ? 119 ALA F C   1 
ATOM   8070 O  O   . ALA F  1 121 ? 20.913  -61.354 -3.946  1.00 15.87  ? 119 ALA F O   1 
ATOM   8071 C  CB  . ALA F  1 121 ? 18.002  -61.106 -2.566  1.00 15.37  ? 119 ALA F CB  1 
ATOM   8072 N  N   . MET F  1 122 ? 21.089  -60.553 -1.866  1.00 16.48  ? 120 MET F N   1 
ATOM   8073 C  CA  . MET F  1 122 ? 22.281  -61.311 -1.525  1.00 17.76  ? 120 MET F CA  1 
ATOM   8074 C  C   . MET F  1 122 ? 22.014  -62.082 -0.249  1.00 16.20  ? 120 MET F C   1 
ATOM   8075 O  O   . MET F  1 122 ? 21.518  -61.521 0.728   1.00 14.03  ? 120 MET F O   1 
ATOM   8076 C  CB  . MET F  1 122 ? 23.489  -60.408 -1.288  1.00 18.83  ? 120 MET F CB  1 
ATOM   8077 C  CG  . MET F  1 122 ? 24.014  -59.719 -2.518  1.00 24.52  ? 120 MET F CG  1 
ATOM   8078 S  SD  . MET F  1 122 ? 25.708  -59.124 -2.281  1.00 29.12  ? 120 MET F SD  1 
ATOM   8079 C  CE  . MET F  1 122 ? 25.512  -57.941 -0.965  1.00 31.04  ? 120 MET F CE  1 
ATOM   8080 N  N   . VAL F  1 123 ? 22.391  -63.354 -0.255  1.00 14.72  ? 121 VAL F N   1 
ATOM   8081 C  CA  . VAL F  1 123 ? 22.173  -64.208 0.887   1.00 14.26  ? 121 VAL F CA  1 
ATOM   8082 C  C   . VAL F  1 123 ? 23.452  -64.954 1.240   1.00 14.49  ? 121 VAL F C   1 
ATOM   8083 O  O   . VAL F  1 123 ? 24.138  -65.471 0.365   1.00 13.18  ? 121 VAL F O   1 
ATOM   8084 C  CB  . VAL F  1 123 ? 21.067  -65.228 0.601   1.00 14.61  ? 121 VAL F CB  1 
ATOM   8085 C  CG1 . VAL F  1 123 ? 20.774  -66.043 1.848   1.00 15.21  ? 121 VAL F CG1 1 
ATOM   8086 C  CG2 . VAL F  1 123 ? 19.812  -64.530 0.101   1.00 14.37  ? 121 VAL F CG2 1 
ATOM   8087 N  N   . PHE F  1 124 ? 23.757  -64.998 2.538   1.00 14.46  ? 122 PHE F N   1 
ATOM   8088 C  CA  . PHE F  1 124 ? 24.959  -65.639 3.053   1.00 13.72  ? 122 PHE F CA  1 
ATOM   8089 C  C   . PHE F  1 124 ? 24.562  -66.976 3.658   1.00 14.95  ? 122 PHE F C   1 
ATOM   8090 O  O   . PHE F  1 124 ? 23.563  -67.077 4.375   1.00 14.06  ? 122 PHE F O   1 
ATOM   8091 C  CB  . PHE F  1 124 ? 25.620  -64.750 4.110   1.00 13.40  ? 122 PHE F CB  1 
ATOM   8092 C  CG  . PHE F  1 124 ? 26.789  -65.387 4.811   1.00 13.96  ? 122 PHE F CG  1 
ATOM   8093 C  CD1 . PHE F  1 124 ? 26.602  -66.062 6.005   1.00 14.91  ? 122 PHE F CD1 1 
ATOM   8094 C  CD2 . PHE F  1 124 ? 28.072  -65.293 4.296   1.00 13.89  ? 122 PHE F CD2 1 
ATOM   8095 C  CE1 . PHE F  1 124 ? 27.675  -66.648 6.663   1.00 15.16  ? 122 PHE F CE1 1 
ATOM   8096 C  CE2 . PHE F  1 124 ? 29.145  -65.872 4.951   1.00 14.74  ? 122 PHE F CE2 1 
ATOM   8097 C  CZ  . PHE F  1 124 ? 28.950  -66.547 6.138   1.00 14.80  ? 122 PHE F CZ  1 
ATOM   8098 N  N   . PHE F  1 125 ? 25.346  -68.001 3.346   1.00 16.32  ? 123 PHE F N   1 
ATOM   8099 C  CA  . PHE F  1 125 ? 25.128  -69.327 3.885   1.00 17.75  ? 123 PHE F CA  1 
ATOM   8100 C  C   . PHE F  1 125 ? 26.422  -69.810 4.522   1.00 19.94  ? 123 PHE F C   1 
ATOM   8101 O  O   . PHE F  1 125 ? 27.495  -69.631 3.965   1.00 20.72  ? 123 PHE F O   1 
ATOM   8102 C  CB  . PHE F  1 125 ? 24.747  -70.292 2.776   1.00 18.74  ? 123 PHE F CB  1 
ATOM   8103 C  CG  . PHE F  1 125 ? 23.515  -69.907 2.021   1.00 17.23  ? 123 PHE F CG  1 
ATOM   8104 C  CD1 . PHE F  1 125 ? 22.319  -70.555 2.254   1.00 17.49  ? 123 PHE F CD1 1 
ATOM   8105 C  CD2 . PHE F  1 125 ? 23.567  -68.937 1.039   1.00 17.27  ? 123 PHE F CD2 1 
ATOM   8106 C  CE1 . PHE F  1 125 ? 21.189  -70.225 1.542   1.00 17.49  ? 123 PHE F CE1 1 
ATOM   8107 C  CE2 . PHE F  1 125 ? 22.432  -68.600 0.318   1.00 17.60  ? 123 PHE F CE2 1 
ATOM   8108 C  CZ  . PHE F  1 125 ? 21.243  -69.246 0.566   1.00 17.02  ? 123 PHE F CZ  1 
ATOM   8109 N  N   . LYS F  1 126 ? 26.313  -70.437 5.688   1.00 22.47  ? 124 LYS F N   1 
ATOM   8110 C  CA  . LYS F  1 126 ? 27.464  -71.069 6.331   1.00 22.91  ? 124 LYS F CA  1 
ATOM   8111 C  C   . LYS F  1 126 ? 27.052  -72.422 6.864   1.00 22.28  ? 124 LYS F C   1 
ATOM   8112 O  O   . LYS F  1 126 ? 26.014  -72.563 7.496   1.00 22.33  ? 124 LYS F O   1 
ATOM   8113 C  CB  . LYS F  1 126 ? 27.984  -70.205 7.483   1.00 25.03  ? 124 LYS F CB  1 
ATOM   8114 C  CG  . LYS F  1 126 ? 29.154  -70.818 8.245   1.00 29.20  ? 124 LYS F CG  1 
ATOM   8115 C  CD  . LYS F  1 126 ? 29.909  -69.801 9.093   1.00 35.21  ? 124 LYS F CD  1 
ATOM   8116 C  CE  . LYS F  1 126 ? 29.534  -69.859 10.572  1.00 43.25  ? 124 LYS F CE  1 
ATOM   8117 N  NZ  . LYS F  1 126 ? 30.183  -71.002 11.280  1.00 44.91  ? 124 LYS F NZ  1 
ATOM   8118 N  N   . LYS F  1 127 ? 27.880  -73.422 6.625   1.00 22.90  ? 125 LYS F N   1 
ATOM   8119 C  CA  . LYS F  1 127 ? 27.562  -74.745 7.076   1.00 24.08  ? 125 LYS F CA  1 
ATOM   8120 C  C   . LYS F  1 127 ? 28.830  -75.435 7.544   1.00 25.19  ? 125 LYS F C   1 
ATOM   8121 O  O   . LYS F  1 127 ? 29.912  -75.162 7.033   1.00 24.99  ? 125 LYS F O   1 
ATOM   8122 C  CB  . LYS F  1 127 ? 26.833  -75.501 5.962   1.00 26.34  ? 125 LYS F CB  1 
ATOM   8123 C  CG  . LYS F  1 127 ? 27.616  -76.555 5.213   1.00 30.26  ? 125 LYS F CG  1 
ATOM   8124 C  CD  . LYS F  1 127 ? 26.674  -77.333 4.304   1.00 32.32  ? 125 LYS F CD  1 
ATOM   8125 C  CE  . LYS F  1 127 ? 27.282  -78.636 3.804   1.00 37.12  ? 125 LYS F CE  1 
ATOM   8126 N  NZ  . LYS F  1 127 ? 26.266  -79.503 3.120   1.00 38.73  ? 125 LYS F NZ  1 
ATOM   8127 N  N   . VAL F  1 128 ? 28.695  -76.288 8.557   1.00 25.43  ? 126 VAL F N   1 
ATOM   8128 C  CA  . VAL F  1 128 ? 29.788  -77.116 9.004   1.00 27.31  ? 126 VAL F CA  1 
ATOM   8129 C  C   . VAL F  1 128 ? 29.445  -78.568 8.766   1.00 30.54  ? 126 VAL F C   1 
ATOM   8130 O  O   . VAL F  1 128 ? 28.404  -79.062 9.204   1.00 32.68  ? 126 VAL F O   1 
ATOM   8131 C  CB  . VAL F  1 128 ? 30.086  -76.901 10.490  1.00 27.66  ? 126 VAL F CB  1 
ATOM   8132 C  CG1 . VAL F  1 128 ? 31.222  -77.802 10.943  1.00 29.54  ? 126 VAL F CG1 1 
ATOM   8133 C  CG2 . VAL F  1 128 ? 30.437  -75.447 10.747  1.00 25.92  ? 126 VAL F CG2 1 
ATOM   8134 N  N   . SER F  1 129 ? 30.301  -79.243 8.018   1.00 33.23  ? 127 SER F N   1 
ATOM   8135 C  CA  . SER F  1 129 ? 30.035  -80.606 7.620   1.00 37.90  ? 127 SER F CA  1 
ATOM   8136 C  C   . SER F  1 129 ? 31.349  -81.365 7.691   1.00 41.23  ? 127 SER F C   1 
ATOM   8137 O  O   . SER F  1 129 ? 32.354  -80.923 7.143   1.00 40.96  ? 127 SER F O   1 
ATOM   8138 C  CB  . SER F  1 129 ? 29.449  -80.649 6.206   1.00 37.91  ? 127 SER F CB  1 
ATOM   8139 O  OG  . SER F  1 129 ? 29.390  -81.980 5.752   1.00 45.15  ? 127 SER F OG  1 
ATOM   8140 N  N   . GLN F  1 130 ? 31.345  -82.492 8.396   1.00 45.81  ? 128 GLN F N   1 
ATOM   8141 C  CA  . GLN F  1 130 ? 32.584  -83.209 8.699   1.00 49.07  ? 128 GLN F CA  1 
ATOM   8142 C  C   . GLN F  1 130 ? 33.637  -82.274 9.296   1.00 48.37  ? 128 GLN F C   1 
ATOM   8143 O  O   . GLN F  1 130 ? 34.823  -82.392 9.010   1.00 53.47  ? 128 GLN F O   1 
ATOM   8144 C  CB  . GLN F  1 130 ? 33.140  -83.863 7.429   1.00 52.74  ? 128 GLN F CB  1 
ATOM   8145 C  CG  . GLN F  1 130 ? 32.606  -85.261 7.152   1.00 59.83  ? 128 GLN F CG  1 
ATOM   8146 C  CD  . GLN F  1 130 ? 31.424  -85.267 6.199   1.00 62.41  ? 128 GLN F CD  1 
ATOM   8147 O  OE1 . GLN F  1 130 ? 31.067  -84.242 5.619   1.00 62.37  ? 128 GLN F OE1 1 
ATOM   8148 N  NE2 . GLN F  1 130 ? 30.807  -86.430 6.037   1.00 70.27  ? 128 GLN F NE2 1 
ATOM   8149 N  N   . ASN F  1 131 ? 33.191  -81.346 10.127  1.00 44.54  ? 129 ASN F N   1 
ATOM   8150 C  CA  . ASN F  1 131 ? 34.083  -80.399 10.800  1.00 44.32  ? 129 ASN F CA  1 
ATOM   8151 C  C   . ASN F  1 131 ? 34.702  -79.358 9.876   1.00 40.90  ? 129 ASN F C   1 
ATOM   8152 O  O   . ASN F  1 131 ? 35.481  -78.519 10.319  1.00 38.24  ? 129 ASN F O   1 
ATOM   8153 C  CB  . ASN F  1 131 ? 35.195  -81.128 11.549  1.00 47.77  ? 129 ASN F CB  1 
ATOM   8154 C  CG  . ASN F  1 131 ? 34.664  -82.018 12.652  1.00 50.14  ? 129 ASN F CG  1 
ATOM   8155 O  OD1 . ASN F  1 131 ? 34.812  -83.239 12.604  1.00 53.10  ? 129 ASN F OD1 1 
ATOM   8156 N  ND2 . ASN F  1 131 ? 34.024  -81.411 13.644  1.00 48.82  ? 129 ASN F ND2 1 
ATOM   8157 N  N   . ARG F  1 132 ? 34.352  -79.409 8.598   1.00 39.05  ? 130 ARG F N   1 
ATOM   8158 C  CA  . ARG F  1 132 ? 34.836  -78.423 7.647   1.00 36.74  ? 130 ARG F CA  1 
ATOM   8159 C  C   . ARG F  1 132 ? 33.811  -77.311 7.481   1.00 34.99  ? 130 ARG F C   1 
ATOM   8160 O  O   . ARG F  1 132 ? 32.604  -77.551 7.365   1.00 32.79  ? 130 ARG F O   1 
ATOM   8161 C  CB  . ARG F  1 132 ? 35.142  -79.076 6.298   1.00 37.90  ? 130 ARG F CB  1 
ATOM   8162 C  CG  . ARG F  1 132 ? 36.248  -80.118 6.377   1.00 41.16  ? 130 ARG F CG  1 
ATOM   8163 C  CD  . ARG F  1 132 ? 36.443  -80.870 5.073   1.00 43.99  ? 130 ARG F CD  1 
ATOM   8164 N  NE  . ARG F  1 132 ? 35.270  -81.650 4.691   1.00 47.95  ? 130 ARG F NE  1 
ATOM   8165 C  CZ  . ARG F  1 132 ? 35.320  -82.800 4.022   1.00 53.09  ? 130 ARG F CZ  1 
ATOM   8166 N  NH1 . ARG F  1 132 ? 36.488  -83.332 3.674   1.00 54.28  ? 130 ARG F NH1 1 
ATOM   8167 N  NH2 . ARG F  1 132 ? 34.196  -83.430 3.716   1.00 56.84  ? 130 ARG F NH2 1 
ATOM   8168 N  N   . GLU F  1 133 ? 34.306  -76.084 7.445   1.00 33.94  ? 131 GLU F N   1 
ATOM   8169 C  CA  . GLU F  1 133 ? 33.440  -74.934 7.472   1.00 33.04  ? 131 GLU F CA  1 
ATOM   8170 C  C   . GLU F  1 133 ? 33.315  -74.322 6.068   1.00 29.43  ? 131 GLU F C   1 
ATOM   8171 O  O   . GLU F  1 133 ? 34.272  -73.785 5.529   1.00 30.07  ? 131 GLU F O   1 
ATOM   8172 C  CB  . GLU F  1 133 ? 34.006  -73.936 8.466   1.00 36.28  ? 131 GLU F CB  1 
ATOM   8173 C  CG  . GLU F  1 133 ? 33.041  -72.821 8.799   1.00 43.92  ? 131 GLU F CG  1 
ATOM   8174 C  CD  . GLU F  1 133 ? 33.445  -72.052 10.044  1.00 50.82  ? 131 GLU F CD  1 
ATOM   8175 O  OE1 . GLU F  1 133 ? 32.564  -71.348 10.596  1.00 57.72  ? 131 GLU F OE1 1 
ATOM   8176 O  OE2 . GLU F  1 133 ? 34.623  -72.158 10.468  1.00 46.15  ? 131 GLU F OE2 1 
ATOM   8177 N  N   . TYR F  1 134 ? 32.144  -74.463 5.457   1.00 26.43  ? 132 TYR F N   1 
ATOM   8178 C  CA  . TYR F  1 134 ? 31.902  -73.937 4.112   1.00 23.26  ? 132 TYR F CA  1 
ATOM   8179 C  C   . TYR F  1 134 ? 31.097  -72.670 4.227   1.00 21.37  ? 132 TYR F C   1 
ATOM   8180 O  O   . TYR F  1 134 ? 30.212  -72.574 5.079   1.00 21.33  ? 132 TYR F O   1 
ATOM   8181 C  CB  . TYR F  1 134 ? 31.131  -74.950 3.265   1.00 22.72  ? 132 TYR F CB  1 
ATOM   8182 C  CG  . TYR F  1 134 ? 31.858  -76.253 3.075   1.00 24.57  ? 132 TYR F CG  1 
ATOM   8183 C  CD1 . TYR F  1 134 ? 31.623  -77.330 3.920   1.00 25.42  ? 132 TYR F CD1 1 
ATOM   8184 C  CD2 . TYR F  1 134 ? 32.806  -76.410 2.066   1.00 25.23  ? 132 TYR F CD2 1 
ATOM   8185 C  CE1 . TYR F  1 134 ? 32.278  -78.536 3.743   1.00 27.05  ? 132 TYR F CE1 1 
ATOM   8186 C  CE2 . TYR F  1 134 ? 33.468  -77.614 1.890   1.00 26.96  ? 132 TYR F CE2 1 
ATOM   8187 C  CZ  . TYR F  1 134 ? 33.199  -78.674 2.736   1.00 28.14  ? 132 TYR F CZ  1 
ATOM   8188 O  OH  . TYR F  1 134 ? 33.860  -79.885 2.599   1.00 30.65  ? 132 TYR F OH  1 
ATOM   8189 N  N   . PHE F  1 135 ? 31.365  -71.705 3.352   1.00 20.11  ? 133 PHE F N   1 
ATOM   8190 C  CA  . PHE F  1 135 ? 30.465  -70.570 3.210   1.00 18.11  ? 133 PHE F CA  1 
ATOM   8191 C  C   . PHE F  1 135 ? 30.292  -70.138 1.769   1.00 19.03  ? 133 PHE F C   1 
ATOM   8192 O  O   . PHE F  1 135 ? 31.158  -70.378 0.922   1.00 20.71  ? 133 PHE F O   1 
ATOM   8193 C  CB  . PHE F  1 135 ? 30.934  -69.404 4.066   1.00 16.57  ? 133 PHE F CB  1 
ATOM   8194 C  CG  . PHE F  1 135 ? 32.152  -68.699 3.538   1.00 16.35  ? 133 PHE F CG  1 
ATOM   8195 C  CD1 . PHE F  1 135 ? 33.418  -69.220 3.734   1.00 17.32  ? 133 PHE F CD1 1 
ATOM   8196 C  CD2 . PHE F  1 135 ? 32.031  -67.480 2.882   1.00 15.30  ? 133 PHE F CD2 1 
ATOM   8197 C  CE1 . PHE F  1 135 ? 34.540  -68.554 3.265   1.00 17.83  ? 133 PHE F CE1 1 
ATOM   8198 C  CE2 . PHE F  1 135 ? 33.149  -66.817 2.404   1.00 15.60  ? 133 PHE F CE2 1 
ATOM   8199 C  CZ  . PHE F  1 135 ? 34.404  -67.343 2.608   1.00 16.77  ? 133 PHE F CZ  1 
ATOM   8200 N  N   . LYS F  1 136 ? 29.134  -69.560 1.478   1.00 19.07  ? 134 LYS F N   1 
ATOM   8201 C  CA  . LYS F  1 136 ? 28.876  -69.024 0.153   1.00 20.59  ? 134 LYS F CA  1 
ATOM   8202 C  C   . LYS F  1 136 ? 27.975  -67.820 0.236   1.00 18.45  ? 134 LYS F C   1 
ATOM   8203 O  O   . LYS F  1 136 ? 27.229  -67.660 1.193   1.00 18.66  ? 134 LYS F O   1 
ATOM   8204 C  CB  . LYS F  1 136 ? 28.258  -70.077 -0.775  1.00 22.00  ? 134 LYS F CB  1 
ATOM   8205 C  CG  . LYS F  1 136 ? 26.828  -70.429 -0.450  1.00 22.72  ? 134 LYS F CG  1 
ATOM   8206 C  CD  . LYS F  1 136 ? 26.188  -71.242 -1.571  1.00 23.83  ? 134 LYS F CD  1 
ATOM   8207 C  CE  . LYS F  1 136 ? 24.726  -71.498 -1.248  1.00 25.35  ? 134 LYS F CE  1 
ATOM   8208 N  NZ  . LYS F  1 136 ? 24.159  -72.640 -2.012  1.00 29.17  ? 134 LYS F NZ  1 
ATOM   8209 N  N   . ILE F  1 137 ? 28.074  -66.972 -0.777  1.00 18.19  ? 135 ILE F N   1 
ATOM   8210 C  CA  . ILE F  1 137 ? 27.156  -65.877 -0.963  1.00 16.91  ? 135 ILE F CA  1 
ATOM   8211 C  C   . ILE F  1 137 ? 26.463  -66.058 -2.302  1.00 17.25  ? 135 ILE F C   1 
ATOM   8212 O  O   . ILE F  1 137 ? 27.101  -66.324 -3.324  1.00 18.42  ? 135 ILE F O   1 
ATOM   8213 C  CB  . ILE F  1 137 ? 27.891  -64.531 -0.956  1.00 16.32  ? 135 ILE F CB  1 
ATOM   8214 C  CG1 . ILE F  1 137 ? 28.863  -64.459 0.226   1.00 17.48  ? 135 ILE F CG1 1 
ATOM   8215 C  CG2 . ILE F  1 137 ? 26.900  -63.395 -0.874  1.00 15.12  ? 135 ILE F CG2 1 
ATOM   8216 C  CD1 . ILE F  1 137 ? 30.290  -64.829 -0.140  1.00 18.87  ? 135 ILE F CD1 1 
ATOM   8217 N  N   . THR F  1 138 ? 25.148  -65.912 -2.289  1.00 17.50  ? 136 THR F N   1 
ATOM   8218 C  CA  . THR F  1 138 ? 24.350  -66.031 -3.495  1.00 19.51  ? 136 THR F CA  1 
ATOM   8219 C  C   . THR F  1 138 ? 23.812  -64.663 -3.891  1.00 17.84  ? 136 THR F C   1 
ATOM   8220 O  O   . THR F  1 138 ? 23.309  -63.928 -3.047  1.00 17.23  ? 136 THR F O   1 
ATOM   8221 C  CB  . THR F  1 138 ? 23.179  -67.003 -3.279  1.00 22.60  ? 136 THR F CB  1 
ATOM   8222 O  OG1 . THR F  1 138 ? 23.691  -68.319 -3.071  1.00 23.43  ? 136 THR F OG1 1 
ATOM   8223 C  CG2 . THR F  1 138 ? 22.289  -67.034 -4.502  1.00 27.49  ? 136 THR F CG2 1 
ATOM   8224 N  N   . LEU F  1 139 ? 23.951  -64.314 -5.169  1.00 17.50  ? 137 LEU F N   1 
ATOM   8225 C  CA  . LEU F  1 139 ? 23.296  -63.132 -5.722  1.00 16.52  ? 137 LEU F CA  1 
ATOM   8226 C  C   . LEU F  1 139 ? 22.041  -63.536 -6.495  1.00 16.03  ? 137 LEU F C   1 
ATOM   8227 O  O   . LEU F  1 139 ? 22.115  -64.229 -7.507  1.00 16.36  ? 137 LEU F O   1 
ATOM   8228 C  CB  . LEU F  1 139 ? 24.252  -62.372 -6.638  1.00 16.04  ? 137 LEU F CB  1 
ATOM   8229 C  CG  . LEU F  1 139 ? 23.678  -61.118 -7.305  1.00 15.70  ? 137 LEU F CG  1 
ATOM   8230 C  CD1 . LEU F  1 139 ? 23.352  -60.047 -6.272  1.00 15.22  ? 137 LEU F CD1 1 
ATOM   8231 C  CD2 . LEU F  1 139 ? 24.626  -60.563 -8.349  1.00 16.28  ? 137 LEU F CD2 1 
ATOM   8232 N  N   . TYR F  1 140 ? 20.892  -63.115 -5.987  1.00 15.90  ? 138 TYR F N   1 
ATOM   8233 C  CA  . TYR F  1 140 ? 19.585  -63.486 -6.539  1.00 16.60  ? 138 TYR F CA  1 
ATOM   8234 C  C   . TYR F  1 140 ? 19.071  -62.361 -7.436  1.00 16.55  ? 138 TYR F C   1 
ATOM   8235 O  O   . TYR F  1 140 ? 19.133  -61.194 -7.062  1.00 15.63  ? 138 TYR F O   1 
ATOM   8236 C  CB  . TYR F  1 140 ? 18.580  -63.670 -5.407  1.00 16.89  ? 138 TYR F CB  1 
ATOM   8237 C  CG  . TYR F  1 140 ? 18.699  -64.942 -4.605  1.00 18.99  ? 138 TYR F CG  1 
ATOM   8238 C  CD1 . TYR F  1 140 ? 19.278  -66.076 -5.119  1.00 20.02  ? 138 TYR F CD1 1 
ATOM   8239 C  CD2 . TYR F  1 140 ? 18.153  -65.018 -3.334  1.00 24.44  ? 138 TYR F CD2 1 
ATOM   8240 C  CE1 . TYR F  1 140 ? 19.327  -67.254 -4.386  1.00 20.95  ? 138 TYR F CE1 1 
ATOM   8241 C  CE2 . TYR F  1 140 ? 18.214  -66.182 -2.589  1.00 23.44  ? 138 TYR F CE2 1 
ATOM   8242 C  CZ  . TYR F  1 140 ? 18.806  -67.303 -3.118  1.00 21.62  ? 138 TYR F CZ  1 
ATOM   8243 O  OH  . TYR F  1 140 ? 18.844  -68.470 -2.369  1.00 19.21  ? 138 TYR F OH  1 
ATOM   8244 N  N   . GLY F  1 141 ? 18.511  -62.719 -8.586  1.00 16.91  ? 139 GLY F N   1 
ATOM   8245 C  CA  . GLY F  1 141 ? 17.681  -61.799 -9.349  1.00 16.90  ? 139 GLY F CA  1 
ATOM   8246 C  C   . GLY F  1 141 ? 16.271  -62.309 -9.541  1.00 16.77  ? 139 GLY F C   1 
ATOM   8247 O  O   . GLY F  1 141 ? 16.054  -63.519 -9.631  1.00 17.86  ? 139 GLY F O   1 
ATOM   8248 N  N   . ARG F  1 142 ? 15.306  -61.395 -9.637  1.00 16.59  ? 140 ARG F N   1 
ATOM   8249 C  CA  . ARG F  1 142 ? 13.946  -61.795 -10.006 1.00 17.58  ? 140 ARG F CA  1 
ATOM   8250 C  C   . ARG F  1 142 ? 13.884  -62.174 -11.467 1.00 19.35  ? 140 ARG F C   1 
ATOM   8251 O  O   . ARG F  1 142 ? 13.002  -62.935 -11.881 1.00 19.81  ? 140 ARG F O   1 
ATOM   8252 C  CB  . ARG F  1 142 ? 12.934  -60.678 -9.729  1.00 17.74  ? 140 ARG F CB  1 
ATOM   8253 C  CG  . ARG F  1 142 ? 12.627  -60.480 -8.258  1.00 17.48  ? 140 ARG F CG  1 
ATOM   8254 C  CD  . ARG F  1 142 ? 12.087  -61.738 -7.602  1.00 16.98  ? 140 ARG F CD  1 
ATOM   8255 N  NE  . ARG F  1 142 ? 11.586  -61.428 -6.273  1.00 18.36  ? 140 ARG F NE  1 
ATOM   8256 C  CZ  . ARG F  1 142 ? 11.049  -62.310 -5.442  1.00 19.34  ? 140 ARG F CZ  1 
ATOM   8257 N  NH1 . ARG F  1 142 ? 10.603  -61.899 -4.262  1.00 20.21  ? 140 ARG F NH1 1 
ATOM   8258 N  NH2 . ARG F  1 142 ? 10.956  -63.593 -5.781  1.00 19.48  ? 140 ARG F NH2 1 
ATOM   8259 N  N   . THR F  1 143 ? 14.805  -61.616 -12.249 1.00 19.36  ? 141 THR F N   1 
ATOM   8260 C  CA  . THR F  1 143 ? 15.044  -62.084 -13.614 1.00 20.72  ? 141 THR F CA  1 
ATOM   8261 C  C   . THR F  1 143 ? 16.455  -62.660 -13.719 1.00 22.09  ? 141 THR F C   1 
ATOM   8262 O  O   . THR F  1 143 ? 17.224  -62.612 -12.768 1.00 21.29  ? 141 THR F O   1 
ATOM   8263 C  CB  . THR F  1 143 ? 14.905  -60.941 -14.648 1.00 19.95  ? 141 THR F CB  1 
ATOM   8264 O  OG1 . THR F  1 143 ? 16.013  -60.053 -14.526 1.00 17.75  ? 141 THR F OG1 1 
ATOM   8265 C  CG2 . THR F  1 143 ? 13.620  -60.142 -14.425 1.00 20.75  ? 141 THR F CG2 1 
ATOM   8266 N  N   . LYS F  1 144 ? 16.795  -63.156 -14.902 1.00 23.92  ? 142 LYS F N   1 
ATOM   8267 C  CA  . LYS F  1 144 ? 18.070  -63.822 -15.126 1.00 23.42  ? 142 LYS F CA  1 
ATOM   8268 C  C   . LYS F  1 144 ? 19.230  -62.842 -15.309 1.00 25.34  ? 142 LYS F C   1 
ATOM   8269 O  O   . LYS F  1 144 ? 20.373  -63.257 -15.419 1.00 24.43  ? 142 LYS F O   1 
ATOM   8270 C  CB  . LYS F  1 144 ? 17.970  -64.718 -16.353 1.00 24.23  ? 142 LYS F CB  1 
ATOM   8271 C  CG  . LYS F  1 144 ? 16.934  -65.814 -16.252 1.00 24.27  ? 142 LYS F CG  1 
ATOM   8272 C  CD  . LYS F  1 144 ? 16.892  -66.625 -17.539 1.00 25.29  ? 142 LYS F CD  1 
ATOM   8273 C  CE  . LYS F  1 144 ? 15.661  -67.508 -17.601 1.00 26.34  ? 142 LYS F CE  1 
ATOM   8274 N  NZ  . LYS F  1 144 ? 15.598  -68.235 -18.899 1.00 30.50  ? 142 LYS F NZ  1 
ATOM   8275 N  N   . GLU F  1 145 ? 18.940  -61.546 -15.355 1.00 27.46  ? 143 GLU F N   1 
ATOM   8276 C  CA  . GLU F  1 145 ? 19.973  -60.536 -15.569 1.00 31.18  ? 143 GLU F CA  1 
ATOM   8277 C  C   . GLU F  1 145 ? 20.014  -59.559 -14.397 1.00 29.93  ? 143 GLU F C   1 
ATOM   8278 O  O   . GLU F  1 145 ? 18.983  -59.264 -13.797 1.00 28.30  ? 143 GLU F O   1 
ATOM   8279 C  CB  . GLU F  1 145 ? 19.687  -59.759 -16.859 1.00 38.98  ? 143 GLU F CB  1 
ATOM   8280 C  CG  . GLU F  1 145 ? 19.516  -60.622 -18.107 1.00 48.03  ? 143 GLU F CG  1 
ATOM   8281 C  CD  . GLU F  1 145 ? 20.827  -60.919 -18.812 1.00 57.03  ? 143 GLU F CD  1 
ATOM   8282 O  OE1 . GLU F  1 145 ? 21.889  -60.493 -18.311 1.00 63.87  ? 143 GLU F OE1 1 
ATOM   8283 O  OE2 . GLU F  1 145 ? 20.794  -61.586 -19.869 1.00 72.81  ? 143 GLU F OE2 1 
ATOM   8284 N  N   . LEU F  1 146 ? 21.191  -59.007 -14.111 1.00 25.54  ? 144 LEU F N   1 
ATOM   8285 C  CA  . LEU F  1 146 ? 21.283  -57.820 -13.261 1.00 23.99  ? 144 LEU F CA  1 
ATOM   8286 C  C   . LEU F  1 146 ? 22.325  -56.848 -13.790 1.00 21.15  ? 144 LEU F C   1 
ATOM   8287 O  O   . LEU F  1 146 ? 23.161  -57.212 -14.604 1.00 20.47  ? 144 LEU F O   1 
ATOM   8288 C  CB  . LEU F  1 146 ? 21.652  -58.211 -11.822 1.00 24.17  ? 144 LEU F CB  1 
ATOM   8289 C  CG  . LEU F  1 146 ? 20.627  -59.003 -11.016 1.00 26.49  ? 144 LEU F CG  1 
ATOM   8290 C  CD1 . LEU F  1 146 ? 21.267  -59.443 -9.714  1.00 26.75  ? 144 LEU F CD1 1 
ATOM   8291 C  CD2 . LEU F  1 146 ? 19.349  -58.210 -10.756 1.00 26.26  ? 144 LEU F CD2 1 
ATOM   8292 N  N   . THR F  1 147 ? 22.299  -55.633 -13.261 1.00 19.93  ? 145 THR F N   1 
ATOM   8293 C  CA  . THR F  1 147 ? 23.178  -54.579 -13.704 1.00 21.69  ? 145 THR F CA  1 
ATOM   8294 C  C   . THR F  1 147 ? 24.620  -54.844 -13.295 1.00 21.80  ? 145 THR F C   1 
ATOM   8295 O  O   . THR F  1 147 ? 24.889  -55.545 -12.325 1.00 20.51  ? 145 THR F O   1 
ATOM   8296 C  CB  . THR F  1 147 ? 22.747  -53.220 -13.119 1.00 22.90  ? 145 THR F CB  1 
ATOM   8297 O  OG1 . THR F  1 147 ? 22.794  -53.262 -11.687 1.00 21.24  ? 145 THR F OG1 1 
ATOM   8298 C  CG2 . THR F  1 147 ? 21.327  -52.858 -13.588 1.00 22.26  ? 145 THR F CG2 1 
ATOM   8299 N  N   . SER F  1 148 ? 25.541  -54.301 -14.076 1.00 22.76  ? 146 SER F N   1 
ATOM   8300 C  CA  . SER F  1 148 ? 26.944  -54.290 -13.733 1.00 24.34  ? 146 SER F CA  1 
ATOM   8301 C  C   . SER F  1 148 ? 27.140  -53.804 -12.311 1.00 26.51  ? 146 SER F C   1 
ATOM   8302 O  O   . SER F  1 148 ? 27.976  -54.320 -11.576 1.00 26.05  ? 146 SER F O   1 
ATOM   8303 C  CB  . SER F  1 148 ? 27.691  -53.376 -14.701 1.00 25.26  ? 146 SER F CB  1 
ATOM   8304 O  OG  . SER F  1 148 ? 29.048  -53.267 -14.345 1.00 27.72  ? 146 SER F OG  1 
ATOM   8305 N  N   . GLU F  1 149 ? 26.394  -52.771 -11.947 1.00 31.20  ? 147 GLU F N   1 
ATOM   8306 C  CA  . GLU F  1 149 ? 26.564  -52.115 -10.663 1.00 32.18  ? 147 GLU F CA  1 
ATOM   8307 C  C   . GLU F  1 149 ? 26.287  -53.089 -9.530  1.00 29.51  ? 147 GLU F C   1 
ATOM   8308 O  O   . GLU F  1 149 ? 27.064  -53.191 -8.585  1.00 31.01  ? 147 GLU F O   1 
ATOM   8309 C  CB  . GLU F  1 149 ? 25.609  -50.934 -10.578 1.00 37.28  ? 147 GLU F CB  1 
ATOM   8310 C  CG  . GLU F  1 149 ? 25.733  -50.109 -9.316  1.00 47.17  ? 147 GLU F CG  1 
ATOM   8311 C  CD  . GLU F  1 149 ? 24.930  -48.822 -9.391  1.00 54.25  ? 147 GLU F CD  1 
ATOM   8312 O  OE1 . GLU F  1 149 ? 24.754  -48.282 -10.512 1.00 54.04  ? 147 GLU F OE1 1 
ATOM   8313 O  OE2 . GLU F  1 149 ? 24.481  -48.351 -8.324  1.00 53.71  ? 147 GLU F OE2 1 
ATOM   8314 N  N   . LEU F  1 150 ? 25.195  -53.833 -9.644  1.00 28.57  ? 148 LEU F N   1 
ATOM   8315 C  CA  . LEU F  1 150 ? 24.851  -54.830 -8.633  1.00 30.27  ? 148 LEU F CA  1 
ATOM   8316 C  C   . LEU F  1 150 ? 25.863  -55.978 -8.579  1.00 27.83  ? 148 LEU F C   1 
ATOM   8317 O  O   . LEU F  1 150 ? 26.202  -56.463 -7.502  1.00 25.22  ? 148 LEU F O   1 
ATOM   8318 C  CB  . LEU F  1 150 ? 23.439  -55.374 -8.878  1.00 30.32  ? 148 LEU F CB  1 
ATOM   8319 C  CG  . LEU F  1 150 ? 22.308  -54.384 -8.563  1.00 35.14  ? 148 LEU F CG  1 
ATOM   8320 C  CD1 . LEU F  1 150 ? 20.991  -54.858 -9.168  1.00 36.92  ? 148 LEU F CD1 1 
ATOM   8321 C  CD2 . LEU F  1 150 ? 22.179  -54.157 -7.061  1.00 33.46  ? 148 LEU F CD2 1 
ATOM   8322 N  N   . LYS F  1 151 ? 26.343  -56.405 -9.741  1.00 26.74  ? 149 LYS F N   1 
ATOM   8323 C  CA  . LYS F  1 151 ? 27.283  -57.497 -9.796  1.00 26.58  ? 149 LYS F CA  1 
ATOM   8324 C  C   . LYS F  1 151 ? 28.623  -57.081 -9.226  1.00 26.28  ? 149 LYS F C   1 
ATOM   8325 O  O   . LYS F  1 151 ? 29.292  -57.880 -8.577  1.00 26.64  ? 149 LYS F O   1 
ATOM   8326 C  CB  . LYS F  1 151 ? 27.408  -58.028 -11.228 1.00 28.61  ? 149 LYS F CB  1 
ATOM   8327 C  CG  . LYS F  1 151 ? 26.125  -58.708 -11.690 1.00 28.65  ? 149 LYS F CG  1 
ATOM   8328 C  CD  . LYS F  1 151 ? 26.295  -59.486 -12.981 1.00 29.12  ? 149 LYS F CD  1 
ATOM   8329 C  CE  . LYS F  1 151 ? 26.322  -58.564 -14.183 1.00 30.77  ? 149 LYS F CE  1 
ATOM   8330 N  NZ  . LYS F  1 151 ? 25.955  -59.277 -15.439 1.00 30.92  ? 149 LYS F NZ  1 
ATOM   8331 N  N   . GLU F  1 152 ? 29.021  -55.836 -9.472  1.00 26.37  ? 150 GLU F N   1 
ATOM   8332 C  CA  . GLU F  1 152 ? 30.253  -55.307 -8.891  1.00 28.02  ? 150 GLU F CA  1 
ATOM   8333 C  C   . GLU F  1 152 ? 30.142  -55.199 -7.377  1.00 25.49  ? 150 GLU F C   1 
ATOM   8334 O  O   . GLU F  1 152 ? 31.110  -55.448 -6.664  1.00 25.35  ? 150 GLU F O   1 
ATOM   8335 C  CB  . GLU F  1 152 ? 30.595  -53.930 -9.468  1.00 29.31  ? 150 GLU F CB  1 
ATOM   8336 C  CG  . GLU F  1 152 ? 31.174  -53.986 -10.873 1.00 34.57  ? 150 GLU F CG  1 
ATOM   8337 C  CD  . GLU F  1 152 ? 32.414  -54.856 -10.965 1.00 37.52  ? 150 GLU F CD  1 
ATOM   8338 O  OE1 . GLU F  1 152 ? 32.618  -55.480 -12.025 1.00 35.95  ? 150 GLU F OE1 1 
ATOM   8339 O  OE2 . GLU F  1 152 ? 33.180  -54.921 -9.977  1.00 45.21  ? 150 GLU F OE2 1 
ATOM   8340 N  N   . ASN F  1 153 ? 28.976  -54.801 -6.891  1.00 23.50  ? 151 ASN F N   1 
ATOM   8341 C  CA  A ASN F  1 153 ? 28.769  -54.718 -5.462  0.50 22.32  ? 151 ASN F CA  1 
ATOM   8342 C  CA  B ASN F  1 153 ? 28.734  -54.713 -5.458  0.50 24.86  ? 151 ASN F CA  1 
ATOM   8343 C  C   . ASN F  1 153 ? 28.892  -56.096 -4.814  1.00 23.11  ? 151 ASN F C   1 
ATOM   8344 O  O   . ASN F  1 153 ? 29.430  -56.228 -3.718  1.00 21.60  ? 151 ASN F O   1 
ATOM   8345 C  CB  A ASN F  1 153 ? 27.406  -54.121 -5.161  0.50 21.60  ? 151 ASN F CB  1 
ATOM   8346 C  CB  B ASN F  1 153 ? 27.321  -54.181 -5.191  0.50 28.19  ? 151 ASN F CB  1 
ATOM   8347 C  CG  A ASN F  1 153 ? 27.240  -53.780 -3.695  0.50 19.52  ? 151 ASN F CG  1 
ATOM   8348 C  CG  B ASN F  1 153 ? 27.180  -52.692 -5.476  0.50 31.77  ? 151 ASN F CG  1 
ATOM   8349 O  OD1 A ASN F  1 153 ? 27.947  -52.925 -3.166  0.50 20.03  ? 151 ASN F OD1 1 
ATOM   8350 O  OD1 B ASN F  1 153 ? 28.077  -51.899 -5.180  0.50 36.41  ? 151 ASN F OD1 1 
ATOM   8351 N  ND2 A ASN F  1 153 ? 26.326  -54.462 -3.033  0.50 17.38  ? 151 ASN F ND2 1 
ATOM   8352 N  ND2 B ASN F  1 153 ? 26.029  -52.301 -6.022  0.50 31.69  ? 151 ASN F ND2 1 
ATOM   8353 N  N   . PHE F  1 154 ? 28.414  -57.118 -5.519  1.00 20.91  ? 152 PHE F N   1 
ATOM   8354 C  CA  . PHE F  1 154 ? 28.501  -58.497 -5.077  1.00 19.67  ? 152 PHE F CA  1 
ATOM   8355 C  C   . PHE F  1 154 ? 29.950  -58.999 -5.063  1.00 20.02  ? 152 PHE F C   1 
ATOM   8356 O  O   . PHE F  1 154 ? 30.377  -59.674 -4.126  1.00 19.32  ? 152 PHE F O   1 
ATOM   8357 C  CB  . PHE F  1 154 ? 27.642  -59.372 -5.995  1.00 20.48  ? 152 PHE F CB  1 
ATOM   8358 C  CG  . PHE F  1 154 ? 27.824  -60.848 -5.792  1.00 20.38  ? 152 PHE F CG  1 
ATOM   8359 C  CD1 . PHE F  1 154 ? 28.420  -61.623 -6.765  1.00 21.96  ? 152 PHE F CD1 1 
ATOM   8360 C  CD2 . PHE F  1 154 ? 27.339  -61.462 -4.652  1.00 20.89  ? 152 PHE F CD2 1 
ATOM   8361 C  CE1 . PHE F  1 154 ? 28.557  -62.989 -6.596  1.00 23.85  ? 152 PHE F CE1 1 
ATOM   8362 C  CE2 . PHE F  1 154 ? 27.479  -62.822 -4.463  1.00 22.02  ? 152 PHE F CE2 1 
ATOM   8363 C  CZ  . PHE F  1 154 ? 28.091  -63.590 -5.436  1.00 24.71  ? 152 PHE F CZ  1 
ATOM   8364 N  N   . ILE F  1 155 ? 30.712  -58.649 -6.087  1.00 20.20  ? 153 ILE F N   1 
ATOM   8365 C  CA  . ILE F  1 155 ? 32.130  -58.967 -6.122  1.00 21.64  ? 153 ILE F CA  1 
ATOM   8366 C  C   . ILE F  1 155 ? 32.871  -58.269 -4.977  1.00 23.59  ? 153 ILE F C   1 
ATOM   8367 O  O   . ILE F  1 155 ? 33.717  -58.870 -4.306  1.00 23.45  ? 153 ILE F O   1 
ATOM   8368 C  CB  . ILE F  1 155 ? 32.744  -58.546 -7.472  1.00 22.62  ? 153 ILE F CB  1 
ATOM   8369 C  CG1 . ILE F  1 155 ? 32.199  -59.441 -8.587  1.00 22.92  ? 153 ILE F CG1 1 
ATOM   8370 C  CG2 . ILE F  1 155 ? 34.263  -58.643 -7.430  1.00 23.62  ? 153 ILE F CG2 1 
ATOM   8371 C  CD1 . ILE F  1 155 ? 32.450  -58.897 -9.980  1.00 24.19  ? 153 ILE F CD1 1 
ATOM   8372 N  N   . ARG F  1 156 ? 32.552  -56.999 -4.761  1.00 24.69  ? 154 ARG F N   1 
ATOM   8373 C  CA  . ARG F  1 156 ? 33.180  -56.222 -3.694  1.00 29.05  ? 154 ARG F CA  1 
ATOM   8374 C  C   . ARG F  1 156 ? 32.938  -56.890 -2.343  1.00 24.83  ? 154 ARG F C   1 
ATOM   8375 O  O   . ARG F  1 156 ? 33.862  -57.076 -1.556  1.00 23.37  ? 154 ARG F O   1 
ATOM   8376 C  CB  . ARG F  1 156 ? 32.620  -54.796 -3.695  1.00 33.71  ? 154 ARG F CB  1 
ATOM   8377 C  CG  . ARG F  1 156 ? 33.297  -53.826 -2.733  1.00 42.07  ? 154 ARG F CG  1 
ATOM   8378 C  CD  . ARG F  1 156 ? 32.933  -52.366 -3.059  1.00 46.39  ? 154 ARG F CD  1 
ATOM   8379 N  NE  . ARG F  1 156 ? 32.759  -52.136 -4.500  1.00 48.31  ? 154 ARG F NE  1 
ATOM   8380 C  CZ  . ARG F  1 156 ? 31.600  -51.827 -5.095  1.00 48.17  ? 154 ARG F CZ  1 
ATOM   8381 N  NH1 . ARG F  1 156 ? 30.484  -51.675 -4.386  1.00 50.89  ? 154 ARG F NH1 1 
ATOM   8382 N  NH2 . ARG F  1 156 ? 31.550  -51.674 -6.410  1.00 41.19  ? 154 ARG F NH2 1 
ATOM   8383 N  N   . PHE F  1 157 ? 31.689  -57.265 -2.093  1.00 22.03  ? 155 PHE F N   1 
ATOM   8384 C  CA  . PHE F  1 157 ? 31.307  -57.877 -0.831  1.00 20.11  ? 155 PHE F CA  1 
ATOM   8385 C  C   . PHE F  1 157 ? 31.980  -59.232 -0.661  1.00 20.61  ? 155 PHE F C   1 
ATOM   8386 O  O   . PHE F  1 157 ? 32.494  -59.545 0.405   1.00 21.63  ? 155 PHE F O   1 
ATOM   8387 C  CB  . PHE F  1 157 ? 29.787  -58.033 -0.763  1.00 19.46  ? 155 PHE F CB  1 
ATOM   8388 C  CG  . PHE F  1 157 ? 29.298  -58.696 0.489   1.00 17.59  ? 155 PHE F CG  1 
ATOM   8389 C  CD1 . PHE F  1 157 ? 29.508  -58.108 1.730   1.00 18.77  ? 155 PHE F CD1 1 
ATOM   8390 C  CD2 . PHE F  1 157 ? 28.609  -59.899 0.426   1.00 16.22  ? 155 PHE F CD2 1 
ATOM   8391 C  CE1 . PHE F  1 157 ? 29.039  -58.715 2.887   1.00 17.96  ? 155 PHE F CE1 1 
ATOM   8392 C  CE2 . PHE F  1 157 ? 28.150  -60.515 1.572   1.00 16.12  ? 155 PHE F CE2 1 
ATOM   8393 C  CZ  . PHE F  1 157 ? 28.352  -59.920 2.806   1.00 16.70  ? 155 PHE F CZ  1 
ATOM   8394 N  N   . SER F  1 158 ? 32.004  -60.019 -1.727  1.00 20.63  ? 156 SER F N   1 
ATOM   8395 C  CA  . SER F  1 158 ? 32.632  -61.337 -1.693  1.00 20.88  ? 156 SER F CA  1 
ATOM   8396 C  C   . SER F  1 158 ? 34.108  -61.237 -1.330  1.00 22.65  ? 156 SER F C   1 
ATOM   8397 O  O   . SER F  1 158 ? 34.604  -61.997 -0.504  1.00 23.40  ? 156 SER F O   1 
ATOM   8398 C  CB  . SER F  1 158 ? 32.460  -62.045 -3.039  1.00 19.83  ? 156 SER F CB  1 
ATOM   8399 O  OG  . SER F  1 158 ? 31.095  -62.397 -3.248  1.00 18.33  ? 156 SER F OG  1 
ATOM   8400 N  N   . LYS F  1 159 ? 34.799  -60.263 -1.910  1.00 24.10  ? 157 LYS F N   1 
ATOM   8401 C  CA  . LYS F  1 159 ? 36.204  -60.021 -1.575  1.00 24.87  ? 157 LYS F CA  1 
ATOM   8402 C  C   . LYS F  1 159 ? 36.401  -59.594 -0.128  1.00 22.36  ? 157 LYS F C   1 
ATOM   8403 O  O   . LYS F  1 159 ? 37.378  -59.978 0.506   1.00 21.69  ? 157 LYS F O   1 
ATOM   8404 C  CB  . LYS F  1 159 ? 36.798  -58.961 -2.493  1.00 27.62  ? 157 LYS F CB  1 
ATOM   8405 C  CG  . LYS F  1 159 ? 37.204  -59.533 -3.836  1.00 31.64  ? 157 LYS F CG  1 
ATOM   8406 C  CD  . LYS F  1 159 ? 37.583  -58.453 -4.827  1.00 35.71  ? 157 LYS F CD  1 
ATOM   8407 C  CE  . LYS F  1 159 ? 37.836  -59.052 -6.200  1.00 37.81  ? 157 LYS F CE  1 
ATOM   8408 N  NZ  . LYS F  1 159 ? 38.567  -58.103 -7.084  1.00 43.39  ? 157 LYS F NZ  1 
ATOM   8409 N  N   . SER F  1 160 ? 35.464  -58.811 0.399   1.00 20.21  ? 158 SER F N   1 
ATOM   8410 C  CA  . SER F  1 160 ? 35.565  -58.353 1.776   1.00 20.17  ? 158 SER F CA  1 
ATOM   8411 C  C   . SER F  1 160 ? 35.501  -59.534 2.746   1.00 20.62  ? 158 SER F C   1 
ATOM   8412 O  O   . SER F  1 160 ? 35.852  -59.403 3.913   1.00 24.69  ? 158 SER F O   1 
ATOM   8413 C  CB  . SER F  1 160 ? 34.445  -57.347 2.094   1.00 18.52  ? 158 SER F CB  1 
ATOM   8414 O  OG  . SER F  1 160 ? 33.245  -58.005 2.464   1.00 16.32  ? 158 SER F OG  1 
ATOM   8415 N  N   . LEU F  1 161 ? 34.991  -60.667 2.271   1.00 20.34  ? 159 LEU F N   1 
ATOM   8416 C  CA  . LEU F  1 161 ? 34.867  -61.861 3.099   1.00 19.84  ? 159 LEU F CA  1 
ATOM   8417 C  C   . LEU F  1 161 ? 36.030  -62.834 2.828   1.00 21.47  ? 159 LEU F C   1 
ATOM   8418 O  O   . LEU F  1 161 ? 36.015  -63.960 3.301   1.00 22.83  ? 159 LEU F O   1 
ATOM   8419 C  CB  . LEU F  1 161 ? 33.520  -62.553 2.841   1.00 17.99  ? 159 LEU F CB  1 
ATOM   8420 C  CG  . LEU F  1 161 ? 32.249  -61.753 3.127   1.00 15.92  ? 159 LEU F CG  1 
ATOM   8421 C  CD1 . LEU F  1 161 ? 31.030  -62.622 2.896   1.00 16.05  ? 159 LEU F CD1 1 
ATOM   8422 C  CD2 . LEU F  1 161 ? 32.225  -61.204 4.543   1.00 15.49  ? 159 LEU F CD2 1 
ATOM   8423 N  N   . GLY F  1 162 ? 37.011  -62.404 2.037   1.00 21.77  ? 160 GLY F N   1 
ATOM   8424 C  CA  . GLY F  1 162 ? 38.233  -63.173 1.839   1.00 23.04  ? 160 GLY F CA  1 
ATOM   8425 C  C   . GLY F  1 162 ? 38.287  -63.967 0.532   1.00 24.73  ? 160 GLY F C   1 
ATOM   8426 O  O   . GLY F  1 162 ? 39.248  -64.697 0.294   1.00 25.04  ? 160 GLY F O   1 
ATOM   8427 N  N   . LEU F  1 163 ? 37.272  -63.826 -0.320  1.00 24.03  ? 161 LEU F N   1 
ATOM   8428 C  CA  . LEU F  1 163 ? 37.208  -64.598 -1.562  1.00 26.27  ? 161 LEU F CA  1 
ATOM   8429 C  C   . LEU F  1 163 ? 37.843  -63.858 -2.737  1.00 27.62  ? 161 LEU F C   1 
ATOM   8430 O  O   . LEU F  1 163 ? 37.503  -62.717 -3.005  1.00 28.02  ? 161 LEU F O   1 
ATOM   8431 C  CB  . LEU F  1 163 ? 35.761  -64.920 -1.911  1.00 24.38  ? 161 LEU F CB  1 
ATOM   8432 C  CG  . LEU F  1 163 ? 35.013  -65.771 -0.889  1.00 23.95  ? 161 LEU F CG  1 
ATOM   8433 C  CD1 . LEU F  1 163 ? 33.539  -65.822 -1.240  1.00 22.72  ? 161 LEU F CD1 1 
ATOM   8434 C  CD2 . LEU F  1 163 ? 35.606  -67.173 -0.821  1.00 25.33  ? 161 LEU F CD2 1 
ATOM   8435 N  N   . PRO F  1 164 ? 38.778  -64.511 -3.436  1.00 30.40  ? 162 PRO F N   1 
ATOM   8436 C  CA  . PRO F  1 164 ? 39.321  -63.948 -4.669  1.00 33.07  ? 162 PRO F CA  1 
ATOM   8437 C  C   . PRO F  1 164 ? 38.426  -64.230 -5.880  1.00 33.52  ? 162 PRO F C   1 
ATOM   8438 O  O   . PRO F  1 164 ? 37.448  -64.972 -5.773  1.00 31.80  ? 162 PRO F O   1 
ATOM   8439 C  CB  . PRO F  1 164 ? 40.669  -64.657 -4.808  1.00 33.65  ? 162 PRO F CB  1 
ATOM   8440 C  CG  . PRO F  1 164 ? 40.457  -65.985 -4.160  1.00 33.73  ? 162 PRO F CG  1 
ATOM   8441 C  CD  . PRO F  1 164 ? 39.399  -65.803 -3.098  1.00 31.80  ? 162 PRO F CD  1 
ATOM   8442 N  N   . GLU F  1 165 ? 38.783  -63.658 -7.024  1.00 36.81  ? 163 GLU F N   1 
ATOM   8443 C  CA  . GLU F  1 165 ? 37.883  -63.570 -8.165  1.00 38.37  ? 163 GLU F CA  1 
ATOM   8444 C  C   . GLU F  1 165 ? 37.547  -64.953 -8.729  1.00 35.68  ? 163 GLU F C   1 
ATOM   8445 O  O   . GLU F  1 165 ? 36.447  -65.173 -9.217  1.00 33.26  ? 163 GLU F O   1 
ATOM   8446 C  CB  . GLU F  1 165 ? 38.520  -62.722 -9.274  1.00 46.16  ? 163 GLU F CB  1 
ATOM   8447 C  CG  . GLU F  1 165 ? 37.514  -62.027 -10.195 1.00 55.69  ? 163 GLU F CG  1 
ATOM   8448 C  CD  . GLU F  1 165 ? 37.322  -60.547 -9.882  1.00 58.35  ? 163 GLU F CD  1 
ATOM   8449 O  OE1 . GLU F  1 165 ? 37.813  -60.087 -8.830  1.00 59.94  ? 163 GLU F OE1 1 
ATOM   8450 O  OE2 . GLU F  1 165 ? 36.663  -59.844 -10.683 1.00 62.41  ? 163 GLU F OE2 1 
ATOM   8451 N  N   . ASN F  1 166 ? 38.495  -65.880 -8.660  1.00 34.63  ? 164 ASN F N   1 
ATOM   8452 C  CA  . ASN F  1 166 ? 38.279  -67.218 -9.196  1.00 34.99  ? 164 ASN F CA  1 
ATOM   8453 C  C   . ASN F  1 166 ? 37.420  -68.110 -8.286  1.00 32.27  ? 164 ASN F C   1 
ATOM   8454 O  O   . ASN F  1 166 ? 37.133  -69.261 -8.624  1.00 30.84  ? 164 ASN F O   1 
ATOM   8455 C  CB  . ASN F  1 166 ? 39.611  -67.898 -9.503  1.00 37.02  ? 164 ASN F CB  1 
ATOM   8456 C  CG  . ASN F  1 166 ? 40.417  -68.184 -8.260  1.00 38.57  ? 164 ASN F CG  1 
ATOM   8457 O  OD1 . ASN F  1 166 ? 40.234  -67.552 -7.230  1.00 40.13  ? 164 ASN F OD1 1 
ATOM   8458 N  ND2 . ASN F  1 166 ? 41.312  -69.152 -8.350  1.00 41.97  ? 164 ASN F ND2 1 
ATOM   8459 N  N   . HIS F  1 167 ? 36.988  -67.562 -7.154  1.00 30.07  ? 165 HIS F N   1 
ATOM   8460 C  CA  . HIS F  1 167 ? 35.947  -68.192 -6.335  1.00 29.05  ? 165 HIS F CA  1 
ATOM   8461 C  C   . HIS F  1 167 ? 34.599  -67.477 -6.483  1.00 27.03  ? 165 HIS F C   1 
ATOM   8462 O  O   . HIS F  1 167 ? 33.703  -67.631 -5.648  1.00 24.19  ? 165 HIS F O   1 
ATOM   8463 C  CB  . HIS F  1 167 ? 36.372  -68.214 -4.871  1.00 29.17  ? 165 HIS F CB  1 
ATOM   8464 C  CG  . HIS F  1 167 ? 37.361  -69.290 -4.551  1.00 32.46  ? 165 HIS F CG  1 
ATOM   8465 N  ND1 . HIS F  1 167 ? 37.000  -70.475 -3.949  1.00 34.69  ? 165 HIS F ND1 1 
ATOM   8466 C  CD2 . HIS F  1 167 ? 38.696  -69.367 -4.765  1.00 35.52  ? 165 HIS F CD2 1 
ATOM   8467 C  CE1 . HIS F  1 167 ? 38.072  -71.236 -3.803  1.00 37.61  ? 165 HIS F CE1 1 
ATOM   8468 N  NE2 . HIS F  1 167 ? 39.114  -70.585 -4.285  1.00 36.83  ? 165 HIS F NE2 1 
ATOM   8469 N  N   . ILE F  1 168 ? 34.473  -66.697 -7.555  1.00 26.51  ? 166 ILE F N   1 
ATOM   8470 C  CA  . ILE F  1 168 ? 33.244  -65.988 -7.862  1.00 24.38  ? 166 ILE F CA  1 
ATOM   8471 C  C   . ILE F  1 168 ? 32.828  -66.334 -9.281  1.00 24.45  ? 166 ILE F C   1 
ATOM   8472 O  O   . ILE F  1 168 ? 33.607  -66.182 -10.210 1.00 26.06  ? 166 ILE F O   1 
ATOM   8473 C  CB  . ILE F  1 168 ? 33.432  -64.468 -7.759  1.00 25.00  ? 166 ILE F CB  1 
ATOM   8474 C  CG1 . ILE F  1 168 ? 33.929  -64.089 -6.361  1.00 24.70  ? 166 ILE F CG1 1 
ATOM   8475 C  CG2 . ILE F  1 168 ? 32.122  -63.761 -8.054  1.00 25.38  ? 166 ILE F CG2 1 
ATOM   8476 C  CD1 . ILE F  1 168 ? 34.304  -62.631 -6.207  1.00 24.45  ? 166 ILE F CD1 1 
ATOM   8477 N  N   . VAL F  1 169 ? 31.605  -66.830 -9.443  1.00 22.89  ? 167 VAL F N   1 
ATOM   8478 C  CA  . VAL F  1 169 ? 31.112  -67.163 -10.759 1.00 23.43  ? 167 VAL F CA  1 
ATOM   8479 C  C   . VAL F  1 169 ? 29.751  -66.551 -11.029 1.00 21.63  ? 167 VAL F C   1 
ATOM   8480 O  O   . VAL F  1 169 ? 28.967  -66.266 -10.114 1.00 20.34  ? 167 VAL F O   1 
ATOM   8481 C  CB  . VAL F  1 169 ? 31.047  -68.685 -11.013 1.00 25.40  ? 167 VAL F CB  1 
ATOM   8482 C  CG1 . VAL F  1 169 ? 32.373  -69.335 -10.694 1.00 27.69  ? 167 VAL F CG1 1 
ATOM   8483 C  CG2 . VAL F  1 169 ? 29.942  -69.331 -10.215 1.00 25.09  ? 167 VAL F CG2 1 
ATOM   8484 N  N   . PHE F  1 170 ? 29.479  -66.367 -12.309 1.00 21.74  ? 168 PHE F N   1 
ATOM   8485 C  CA  . PHE F  1 170 ? 28.201  -65.869 -12.753 1.00 21.17  ? 168 PHE F CA  1 
ATOM   8486 C  C   . PHE F  1 170 ? 27.597  -66.892 -13.699 1.00 22.47  ? 168 PHE F C   1 
ATOM   8487 O  O   . PHE F  1 170 ? 27.975  -66.964 -14.863 1.00 22.57  ? 168 PHE F O   1 
ATOM   8488 C  CB  . PHE F  1 170 ? 28.377  -64.514 -13.431 1.00 20.79  ? 168 PHE F CB  1 
ATOM   8489 C  CG  . PHE F  1 170 ? 28.858  -63.457 -12.497 1.00 20.67  ? 168 PHE F CG  1 
ATOM   8490 C  CD1 . PHE F  1 170 ? 30.213  -63.165 -12.403 1.00 21.91  ? 168 PHE F CD1 1 
ATOM   8491 C  CD2 . PHE F  1 170 ? 27.970  -62.802 -11.650 1.00 18.84  ? 168 PHE F CD2 1 
ATOM   8492 C  CE1 . PHE F  1 170 ? 30.663  -62.219 -11.496 1.00 21.34  ? 168 PHE F CE1 1 
ATOM   8493 C  CE2 . PHE F  1 170 ? 28.417  -61.854 -10.743 1.00 18.55  ? 168 PHE F CE2 1 
ATOM   8494 C  CZ  . PHE F  1 170 ? 29.761  -61.557 -10.672 1.00 19.57  ? 168 PHE F CZ  1 
ATOM   8495 N  N   . PRO F  1 171 ? 26.679  -67.719 -13.175 1.00 23.16  ? 169 PRO F N   1 
ATOM   8496 C  CA  . PRO F  1 171 ? 26.115  -68.832 -13.934 1.00 24.51  ? 169 PRO F CA  1 
ATOM   8497 C  C   . PRO F  1 171 ? 25.437  -68.353 -15.201 1.00 24.45  ? 169 PRO F C   1 
ATOM   8498 O  O   . PRO F  1 171 ? 24.816  -67.297 -15.218 1.00 21.79  ? 169 PRO F O   1 
ATOM   8499 C  CB  . PRO F  1 171 ? 25.094  -69.435 -12.974 1.00 23.25  ? 169 PRO F CB  1 
ATOM   8500 C  CG  . PRO F  1 171 ? 25.593  -69.072 -11.623 1.00 22.55  ? 169 PRO F CG  1 
ATOM   8501 C  CD  . PRO F  1 171 ? 26.240  -67.730 -11.770 1.00 21.79  ? 169 PRO F CD  1 
ATOM   8502 N  N   . VAL F  1 172 ? 25.602  -69.131 -16.260 1.00 27.63  ? 170 VAL F N   1 
ATOM   8503 C  CA  . VAL F  1 172 ? 25.126  -68.764 -17.581 1.00 27.64  ? 170 VAL F CA  1 
ATOM   8504 C  C   . VAL F  1 172 ? 23.620  -68.994 -17.638 1.00 25.71  ? 170 VAL F C   1 
ATOM   8505 O  O   . VAL F  1 172 ? 23.142  -70.053 -17.262 1.00 24.93  ? 170 VAL F O   1 
ATOM   8506 C  CB  . VAL F  1 172 ? 25.834  -69.618 -18.658 1.00 30.58  ? 170 VAL F CB  1 
ATOM   8507 C  CG1 . VAL F  1 172 ? 25.255  -69.344 -20.039 1.00 31.62  ? 170 VAL F CG1 1 
ATOM   8508 C  CG2 . VAL F  1 172 ? 27.334  -69.353 -18.636 1.00 30.98  ? 170 VAL F CG2 1 
ATOM   8509 N  N   . PRO F  1 173 ? 22.864  -67.983 -18.084 1.00 25.11  ? 171 PRO F N   1 
ATOM   8510 C  CA  . PRO F  1 173 ? 21.415  -68.136 -18.251 1.00 23.64  ? 171 PRO F CA  1 
ATOM   8511 C  C   . PRO F  1 173 ? 21.060  -69.303 -19.160 1.00 23.36  ? 171 PRO F C   1 
ATOM   8512 O  O   . PRO F  1 173 ? 21.744  -69.533 -20.150 1.00 23.16  ? 171 PRO F O   1 
ATOM   8513 C  CB  . PRO F  1 173 ? 20.987  -66.815 -18.894 1.00 23.21  ? 171 PRO F CB  1 
ATOM   8514 C  CG  . PRO F  1 173 ? 22.046  -65.834 -18.492 1.00 22.91  ? 171 PRO F CG  1 
ATOM   8515 C  CD  . PRO F  1 173 ? 23.323  -66.612 -18.380 1.00 24.11  ? 171 PRO F CD  1 
ATOM   8516 N  N   . ILE F  1 174 ? 20.011  -70.040 -18.793 1.00 22.56  ? 172 ILE F N   1 
ATOM   8517 C  CA  . ILE F  1 174 ? 19.478  -71.116 -19.619 1.00 23.08  ? 172 ILE F CA  1 
ATOM   8518 C  C   . ILE F  1 174 ? 17.962  -71.083 -19.561 1.00 22.97  ? 172 ILE F C   1 
ATOM   8519 O  O   . ILE F  1 174 ? 17.388  -70.376 -18.743 1.00 21.59  ? 172 ILE F O   1 
ATOM   8520 C  CB  . ILE F  1 174 ? 19.934  -72.495 -19.116 1.00 23.47  ? 172 ILE F CB  1 
ATOM   8521 C  CG1 . ILE F  1 174 ? 19.441  -72.725 -17.685 1.00 22.56  ? 172 ILE F CG1 1 
ATOM   8522 C  CG2 . ILE F  1 174 ? 21.448  -72.630 -19.196 1.00 24.22  ? 172 ILE F CG2 1 
ATOM   8523 C  CD1 . ILE F  1 174 ? 19.589  -74.159 -17.221 1.00 23.62  ? 172 ILE F CD1 1 
ATOM   8524 N  N   . ASP F  1 175 ? 17.319  -71.861 -20.425 1.00 25.92  ? 173 ASP F N   1 
ATOM   8525 C  CA  . ASP F  1 175 ? 15.853  -71.873 -20.529 1.00 28.38  ? 173 ASP F CA  1 
ATOM   8526 C  C   . ASP F  1 175 ? 15.229  -73.143 -19.959 1.00 27.63  ? 173 ASP F C   1 
ATOM   8527 O  O   . ASP F  1 175 ? 14.070  -73.145 -19.577 1.00 30.03  ? 173 ASP F O   1 
ATOM   8528 C  CB  . ASP F  1 175 ? 15.427  -71.718 -21.997 1.00 30.36  ? 173 ASP F CB  1 
ATOM   8529 C  CG  . ASP F  1 175 ? 15.595  -70.305 -22.506 1.00 29.77  ? 173 ASP F CG  1 
ATOM   8530 O  OD1 . ASP F  1 175 ? 15.712  -70.127 -23.731 1.00 34.58  ? 173 ASP F OD1 1 
ATOM   8531 O  OD2 . ASP F  1 175 ? 15.629  -69.372 -21.682 1.00 30.88  ? 173 ASP F OD2 1 
ATOM   8532 N  N   . GLN F  1 176 ? 15.990  -74.228 -19.934 1.00 28.11  ? 174 GLN F N   1 
ATOM   8533 C  CA  . GLN F  1 176 ? 15.474  -75.519 -19.482 1.00 29.42  ? 174 GLN F CA  1 
ATOM   8534 C  C   . GLN F  1 176 ? 15.198  -75.509 -17.978 1.00 29.05  ? 174 GLN F C   1 
ATOM   8535 O  O   . GLN F  1 176 ? 15.991  -74.973 -17.198 1.00 29.65  ? 174 GLN F O   1 
ATOM   8536 C  CB  . GLN F  1 176 ? 16.472  -76.625 -19.835 1.00 31.36  ? 174 GLN F CB  1 
ATOM   8537 C  CG  . GLN F  1 176 ? 16.723  -76.772 -21.338 1.00 31.45  ? 174 GLN F CG  1 
ATOM   8538 C  CD  . GLN F  1 176 ? 17.987  -76.064 -21.821 1.00 32.06  ? 174 GLN F CD  1 
ATOM   8539 O  OE1 . GLN F  1 176 ? 18.515  -75.163 -21.163 1.00 30.83  ? 174 GLN F OE1 1 
ATOM   8540 N  NE2 . GLN F  1 176 ? 18.468  -76.466 -22.986 1.00 32.61  ? 174 GLN F NE2 1 
ATOM   8541 N  N   . CYS F  1 177 ? 14.034  -76.028 -17.595 1.00 28.21  ? 175 CYS F N   1 
ATOM   8542 C  CA  . CYS F  1 177 ? 13.703  -76.328 -16.193 1.00 27.47  ? 175 CYS F CA  1 
ATOM   8543 C  C   . CYS F  1 177 ? 13.362  -75.110 -15.323 1.00 25.48  ? 175 CYS F C   1 
ATOM   8544 O  O   . CYS F  1 177 ? 12.438  -75.165 -14.517 1.00 25.00  ? 175 CYS F O   1 
ATOM   8545 C  CB  . CYS F  1 177 ? 14.811  -77.141 -15.520 1.00 27.32  ? 175 CYS F CB  1 
ATOM   8546 S  SG  . CYS F  1 177 ? 15.062  -78.781 -16.226 1.00 29.48  ? 175 CYS F SG  1 
ATOM   8547 N  N   . ILE F  1 178 ? 14.092  -74.017 -15.468 1.00 25.04  ? 176 ILE F N   1 
ATOM   8548 C  CA  . ILE F  1 178 ? 14.046  -72.958 -14.462 1.00 24.74  ? 176 ILE F CA  1 
ATOM   8549 C  C   . ILE F  1 178 ? 12.998  -71.872 -14.705 1.00 25.94  ? 176 ILE F C   1 
ATOM   8550 O  O   . ILE F  1 178 ? 12.921  -70.924 -13.940 1.00 25.63  ? 176 ILE F O   1 
ATOM   8551 C  CB  . ILE F  1 178 ? 15.432  -72.315 -14.272 1.00 25.46  ? 176 ILE F CB  1 
ATOM   8552 C  CG1 . ILE F  1 178 ? 15.831  -71.479 -15.498 1.00 25.71  ? 176 ILE F CG1 1 
ATOM   8553 C  CG2 . ILE F  1 178 ? 16.471  -73.396 -14.016 1.00 26.25  ? 176 ILE F CG2 1 
ATOM   8554 C  CD1 . ILE F  1 178 ? 17.193  -70.829 -15.363 1.00 26.25  ? 176 ILE F CD1 1 
ATOM   8555 N  N   . ASP F  1 179 ? 12.165  -72.017 -15.735 1.00 30.28  ? 177 ASP F N   1 
ATOM   8556 C  CA  . ASP F  1 179 ? 11.145  -71.007 -16.043 1.00 33.23  ? 177 ASP F CA  1 
ATOM   8557 C  C   . ASP F  1 179 ? 9.733   -71.543 -15.860 1.00 33.51  ? 177 ASP F C   1 
ATOM   8558 O  O   . ASP F  1 179 ? 9.537   -72.553 -15.190 1.00 40.57  ? 177 ASP F O   1 
ATOM   8559 C  CB  . ASP F  1 179 ? 11.323  -70.478 -17.467 1.00 34.17  ? 177 ASP F CB  1 
ATOM   8560 C  CG  . ASP F  1 179 ? 12.582  -69.660 -17.620 1.00 33.99  ? 177 ASP F CG  1 
ATOM   8561 O  OD1 . ASP F  1 179 ? 13.040  -69.095 -16.610 1.00 34.71  ? 177 ASP F OD1 1 
ATOM   8562 O  OD2 . ASP F  1 179 ? 13.134  -69.596 -18.734 1.00 37.95  ? 177 ASP F OD2 1 
HETATM 8563 CM CM  . ZCM G  2 .   ? -9.044  -8.973  30.667  1.00 41.75  ? 201 ZCM A CM  1 
HETATM 8564 C  C1  . 4OL H  3 .   ? -12.229 -5.374  29.597  1.00 36.20  ? 202 4OL A C1  1 
HETATM 8565 C  C2  . 4OL H  3 .   ? -12.345 -6.199  30.853  1.00 33.52  ? 202 4OL A C2  1 
HETATM 8566 C  C6  . 4OL H  3 .   ? -13.263 -6.622  33.044  1.00 32.11  ? 202 4OL A C6  1 
HETATM 8567 C  C5  . 4OL H  3 .   ? -12.526 -7.809  33.137  1.00 30.86  ? 202 4OL A C5  1 
HETATM 8568 C  C4  . 4OL H  3 .   ? -11.702 -8.216  32.086  1.00 30.43  ? 202 4OL A C4  1 
HETATM 8569 C  C7  . 4OL H  3 .   ? -13.171 -5.812  31.910  1.00 32.34  ? 202 4OL A C7  1 
HETATM 8570 C  C12 . 4OL H  3 .   ? -11.806 -5.361  27.166  1.00 35.60  ? 202 4OL A C12 1 
HETATM 8571 C  C13 . 4OL H  3 .   ? -10.357 -5.002  26.824  1.00 36.59  ? 202 4OL A C13 1 
HETATM 8572 C  C14 . 4OL H  3 .   ? -9.448  -6.219  26.896  1.00 35.64  ? 202 4OL A C14 1 
HETATM 8573 C  C16 . 4OL H  3 .   ? -7.304  -5.189  27.443  1.00 41.14  ? 202 4OL A C16 1 
HETATM 8574 C  C17 . 4OL H  3 .   ? -7.681  -6.012  25.185  1.00 41.15  ? 202 4OL A C17 1 
HETATM 8575 C  C18 . 4OL H  3 .   ? -7.566  -7.528  25.012  1.00 40.41  ? 202 4OL A C18 1 
HETATM 8576 C  C20 . 4OL H  3 .   ? -6.046  -9.524  24.991  1.00 42.72  ? 202 4OL A C20 1 
HETATM 8577 C  C23 . 4OL H  3 .   ? -8.063  -3.438  29.061  1.00 41.64  ? 202 4OL A C23 1 
HETATM 8578 C  C24 . 4OL H  3 .   ? -8.580  -3.061  30.294  1.00 40.57  ? 202 4OL A C24 1 
HETATM 8579 C  C25 . 4OL H  3 .   ? -8.895  -4.027  31.244  1.00 40.17  ? 202 4OL A C25 1 
HETATM 8580 C  C26 . 4OL H  3 .   ? -8.692  -5.382  30.976  1.00 37.61  ? 202 4OL A C26 1 
HETATM 8581 O  O55 . 4OL H  3 .   ? -8.595  -10.635 24.618  1.00 31.81  ? 202 4OL A O55 1 
HETATM 8582 C  C28 . 4OL H  3 .   ? -8.032  -10.825 25.684  1.00 36.35  ? 202 4OL A C28 1 
HETATM 8583 C  C34 . 4OL H  3 .   ? -8.769  -11.579 26.764  1.00 35.71  ? 202 4OL A C34 1 
HETATM 8584 C  C39 . 4OL H  3 .   ? -9.119  -12.909 26.636  1.00 35.87  ? 202 4OL A C39 1 
HETATM 8585 C  C38 . 4OL H  3 .   ? -9.825  -13.549 27.651  1.00 36.73  ? 202 4OL A C38 1 
HETATM 8586 C  C37 . 4OL H  3 .   ? -10.185 -12.863 28.804  1.00 38.00  ? 202 4OL A C37 1 
HETATM 8587 C  C36 . 4OL H  3 .   ? -9.830  -11.529 28.966  1.00 35.56  ? 202 4OL A C36 1 
HETATM 8588 O  O47 . 4OL H  3 .   ? -10.168 -10.928 30.021  1.00 34.37  ? 202 4OL A O47 1 
HETATM 8589 N  N35 . 4OL H  3 .   ? -9.120  -10.888 27.928  1.00 34.44  ? 202 4OL A N35 1 
HETATM 8590 O  O46 . 4OL H  3 .   ? -8.724  -9.511  27.984  1.00 39.66  ? 202 4OL A O46 1 
HETATM 8591 N  N21 . 4OL H  3 .   ? -6.819  -10.326 25.947  1.00 40.23  ? 202 4OL A N21 1 
HETATM 8592 C  C29 . 4OL H  3 .   ? -6.173  -10.520 27.245  1.00 42.40  ? 202 4OL A C29 1 
HETATM 8593 C  C30 . 4OL H  3 .   ? -5.536  -11.908 27.273  1.00 41.69  ? 202 4OL A C30 1 
HETATM 8594 C  C31 . 4OL H  3 .   ? -4.529  -12.000 28.416  1.00 43.71  ? 202 4OL A C31 1 
HETATM 8595 N  N32 . 4OL H  3 .   ? -5.058  -11.472 29.665  1.00 44.55  ? 202 4OL A N32 1 
HETATM 8596 C  C33 . 4OL H  3 .   ? -4.292  -11.325 30.750  1.00 49.02  ? 202 4OL A C33 1 
HETATM 8597 O  O53 . 4OL H  3 .   ? -3.098  -11.581 30.742  1.00 52.10  ? 202 4OL A O53 1 
HETATM 8598 C  C40 . 4OL H  3 .   ? -4.941  -10.898 32.037  1.00 49.12  ? 202 4OL A C40 1 
HETATM 8599 N  N45 . 4OL H  3 .   ? -6.230  -10.345 31.999  1.00 48.16  ? 202 4OL A N45 1 
HETATM 8600 O  O50 . 4OL H  3 .   ? -6.849  -10.180 30.724  1.00 49.13  ? 202 4OL A O50 1 
HETATM 8601 C  C44 . 4OL H  3 .   ? -6.871  -9.955  33.198  1.00 47.26  ? 202 4OL A C44 1 
HETATM 8602 O  O51 . 4OL H  3 .   ? -8.010  -9.454  33.178  1.00 47.03  ? 202 4OL A O51 1 
HETATM 8603 C  C43 . 4OL H  3 .   ? -6.226  -10.125 34.415  1.00 46.11  ? 202 4OL A C43 1 
HETATM 8604 C  C42 . 4OL H  3 .   ? -4.952  -10.687 34.444  1.00 48.85  ? 202 4OL A C42 1 
HETATM 8605 C  C41 . 4OL H  3 .   ? -4.311  -11.073 33.266  1.00 49.80  ? 202 4OL A C41 1 
HETATM 8606 C  C19 . 4OL H  3 .   ? -6.188  -8.054  25.400  1.00 41.32  ? 202 4OL A C19 1 
HETATM 8607 N  N15 . 4OL H  3 .   ? -8.108  -5.768  26.557  1.00 39.14  ? 202 4OL A N15 1 
HETATM 8608 O  O54 . 4OL H  3 .   ? -6.129  -4.975  27.214  1.00 42.31  ? 202 4OL A O54 1 
HETATM 8609 C  C22 . 4OL H  3 .   ? -7.857  -4.783  28.772  1.00 41.42  ? 202 4OL A C22 1 
HETATM 8610 N  N27 . 4OL H  3 .   ? -8.169  -5.773  29.722  1.00 38.94  ? 202 4OL A N27 1 
HETATM 8611 O  O48 . 4OL H  3 .   ? -7.928  -7.149  29.396  1.00 39.47  ? 202 4OL A O48 1 
HETATM 8612 O  O49 . 4OL H  3 .   ? -8.964  -6.228  31.859  1.00 32.38  ? 202 4OL A O49 1 
HETATM 8613 N  N9  . 4OL H  3 .   ? -11.940 -6.019  28.454  1.00 36.91  ? 202 4OL A N9  1 
HETATM 8614 O  O8  . 4OL H  3 .   ? -12.408 -4.167  29.651  1.00 35.71  ? 202 4OL A O8  1 
HETATM 8615 N  N3  . 4OL H  3 .   ? -11.624 -7.406  30.935  1.00 30.50  ? 202 4OL A N3  1 
HETATM 8616 O  O9  . 4OL H  3 .   ? -11.055 -9.299  32.148  1.00 30.01  ? 202 4OL A O9  1 
HETATM 8617 O  O10 . 4OL H  3 .   ? -10.804 -7.799  29.826  1.00 32.20  ? 202 4OL A O10 1 
HETATM 8618 S  S   . SO4 I  4 .   ? -13.795 -14.191 28.458  1.00 37.67  ? 203 SO4 A S   1 
HETATM 8619 O  O1  . SO4 I  4 .   ? -12.847 -15.290 28.172  1.00 37.59  ? 203 SO4 A O1  1 
HETATM 8620 O  O2  . SO4 I  4 .   ? -13.618 -13.050 27.518  1.00 32.23  ? 203 SO4 A O2  1 
HETATM 8621 O  O3  . SO4 I  4 .   ? -15.162 -14.753 28.301  1.00 31.75  ? 203 SO4 A O3  1 
HETATM 8622 O  O4  . SO4 I  4 .   ? -13.556 -13.681 29.840  1.00 42.52  ? 203 SO4 A O4  1 
HETATM 8623 CM CM  . ZCM J  2 .   ? 3.592   -38.136 21.778  1.00 38.07  ? 201 ZCM B CM  1 
HETATM 8624 C  C1  . 4OL K  3 .   ? 4.286   -34.058 19.077  1.00 32.49  ? 202 4OL B C1  1 
HETATM 8625 C  C2  . 4OL K  3 .   ? 3.019   -34.836 19.034  1.00 29.70  ? 202 4OL B C2  1 
HETATM 8626 C  C6  . 4OL K  3 .   ? 0.715   -35.071 18.414  1.00 27.61  ? 202 4OL B C6  1 
HETATM 8627 C  C5  . 4OL K  3 .   ? 0.707   -36.364 18.954  1.00 30.02  ? 202 4OL B C5  1 
HETATM 8628 C  C4  . 4OL K  3 .   ? 1.854   -36.917 19.542  1.00 29.70  ? 202 4OL B C4  1 
HETATM 8629 C  C7  . 4OL K  3 .   ? 1.878   -34.302 18.448  1.00 28.59  ? 202 4OL B C7  1 
HETATM 8630 C  C12 . 4OL K  3 .   ? 6.725   -34.089 19.386  1.00 34.61  ? 202 4OL B C12 1 
HETATM 8631 C  C13 . 4OL K  3 .   ? 7.424   -34.020 20.743  1.00 35.84  ? 202 4OL B C13 1 
HETATM 8632 C  C14 . 4OL K  3 .   ? 7.509   -35.401 21.379  1.00 37.80  ? 202 4OL B C14 1 
HETATM 8633 C  C16 . 4OL K  3 .   ? 7.138   -34.833 23.747  1.00 36.73  ? 202 4OL B C16 1 
HETATM 8634 C  C17 . 4OL K  3 .   ? 9.359   -35.529 23.018  1.00 41.14  ? 202 4OL B C17 1 
HETATM 8635 C  C18 . 4OL K  3 .   ? 9.533   -37.051 22.946  1.00 39.64  ? 202 4OL B C18 1 
HETATM 8636 C  C20 . 4OL K  3 .   ? 9.391   -39.284 24.144  1.00 38.33  ? 202 4OL B C20 1 
HETATM 8637 C  C23 . 4OL K  3 .   ? 5.357   -33.073 23.707  1.00 38.18  ? 202 4OL B C23 1 
HETATM 8638 C  C24 . 4OL K  3 .   ? 4.048   -32.636 23.514  1.00 35.75  ? 202 4OL B C24 1 
HETATM 8639 C  C25 . 4OL K  3 .   ? 3.069   -33.535 23.121  1.00 35.34  ? 202 4OL B C25 1 
HETATM 8640 C  C26 . 4OL K  3 .   ? 3.387   -34.880 22.920  1.00 33.37  ? 202 4OL B C26 1 
HETATM 8641 O  O55 . 4OL K  3 .   ? 9.575   -39.914 21.447  1.00 29.73  ? 202 4OL B O55 1 
HETATM 8642 C  C28 . 4OL K  3 .   ? 8.526   -40.175 22.017  1.00 31.76  ? 202 4OL B C28 1 
HETATM 8643 C  C34 . 4OL K  3 .   ? 7.396   -40.726 21.187  1.00 31.32  ? 202 4OL B C34 1 
HETATM 8644 C  C39 . 4OL K  3 .   ? 7.560   -41.888 20.443  1.00 31.69  ? 202 4OL B C39 1 
HETATM 8645 C  C38 . 4OL K  3 .   ? 6.509   -42.374 19.660  1.00 29.97  ? 202 4OL B C38 1 
HETATM 8646 C  C37 . 4OL K  3 .   ? 5.283   -41.720 19.608  1.00 28.57  ? 202 4OL B C37 1 
HETATM 8647 C  C36 . 4OL K  3 .   ? 5.082   -40.560 20.348  1.00 28.67  ? 202 4OL B C36 1 
HETATM 8648 O  O47 . 4OL K  3 .   ? 3.954   -40.006 20.263  1.00 28.35  ? 202 4OL B O47 1 
HETATM 8649 N  N35 . 4OL K  3 .   ? 6.157   -40.054 21.143  1.00 29.14  ? 202 4OL B N35 1 
HETATM 8650 O  O46 . 4OL K  3 .   ? 6.058   -38.865 21.939  1.00 33.77  ? 202 4OL B O46 1 
HETATM 8651 N  N21 . 4OL K  3 .   ? 8.358   -39.931 23.324  1.00 35.09  ? 202 4OL B N21 1 
HETATM 8652 C  C29 . 4OL K  3 .   ? 7.125   -40.250 24.038  1.00 33.86  ? 202 4OL B C29 1 
HETATM 8653 C  C30 . 4OL K  3 .   ? 7.133   -41.753 24.298  1.00 34.59  ? 202 4OL B C30 1 
HETATM 8654 C  C31 . 4OL K  3 .   ? 6.133   -42.146 25.383  1.00 34.90  ? 202 4OL B C31 1 
HETATM 8655 N  N32 . 4OL K  3 .   ? 4.810   -41.662 25.054  1.00 34.72  ? 202 4OL B N32 1 
HETATM 8656 C  C33 . 4OL K  3 .   ? 3.772   -41.769 25.874  1.00 32.85  ? 202 4OL B C33 1 
HETATM 8657 O  O53 . 4OL K  3 .   ? 3.814   -42.408 26.906  1.00 32.89  ? 202 4OL B O53 1 
HETATM 8658 C  C40 . 4OL K  3 .   ? 2.504   -41.118 25.423  1.00 32.21  ? 202 4OL B C40 1 
HETATM 8659 N  N45 . 4OL K  3 .   ? 2.543   -40.221 24.340  1.00 31.54  ? 202 4OL B N45 1 
HETATM 8660 O  O50 . 4OL K  3 .   ? 3.783   -39.896 23.719  1.00 30.74  ? 202 4OL B O50 1 
HETATM 8661 C  C44 . 4OL K  3 .   ? 1.358   -39.629 23.872  1.00 32.23  ? 202 4OL B C44 1 
HETATM 8662 O  O51 . 4OL K  3 .   ? 1.405   -38.841 22.907  1.00 35.45  ? 202 4OL B O51 1 
HETATM 8663 C  C43 . 4OL K  3 .   ? 0.147   -39.930 24.484  1.00 32.54  ? 202 4OL B C43 1 
HETATM 8664 C  C42 . 4OL K  3 .   ? 0.117   -40.821 25.555  1.00 33.74  ? 202 4OL B C42 1 
HETATM 8665 C  C41 . 4OL K  3 .   ? 1.288   -41.416 26.022  1.00 33.24  ? 202 4OL B C41 1 
HETATM 8666 C  C19 . 4OL K  3 .   ? 9.094   -37.777 24.224  1.00 38.71  ? 202 4OL B C19 1 
HETATM 8667 N  N15 . 4OL K  3 .   ? 7.948   -35.223 22.760  1.00 40.19  ? 202 4OL B N15 1 
HETATM 8668 O  O54 . 4OL K  3 .   ? 7.558   -34.804 24.889  1.00 35.72  ? 202 4OL B O54 1 
HETATM 8669 C  C22 . 4OL K  3 .   ? 5.710   -34.409 23.503  1.00 37.13  ? 202 4OL B C22 1 
HETATM 8670 N  N27 . 4OL K  3 .   ? 4.710   -35.330 23.109  1.00 34.23  ? 202 4OL B N27 1 
HETATM 8671 O  O48 . 4OL K  3 .   ? 5.023   -36.715 22.906  1.00 35.55  ? 202 4OL B O48 1 
HETATM 8672 O  O49 . 4OL K  3 .   ? 2.491   -35.685 22.575  1.00 30.11  ? 202 4OL B O49 1 
HETATM 8673 N  N9  . 4OL K  3 .   ? 5.405   -34.703 19.428  1.00 33.31  ? 202 4OL B N9  1 
HETATM 8674 O  O8  . 4OL K  3 .   ? 4.245   -32.882 18.758  1.00 35.29  ? 202 4OL B O8  1 
HETATM 8675 N  N3  . 4OL K  3 .   ? 3.017   -36.127 19.578  1.00 26.99  ? 202 4OL B N3  1 
HETATM 8676 O  O9  . 4OL K  3 .   ? 1.845   -38.093 20.019  1.00 31.48  ? 202 4OL B O9  1 
HETATM 8677 O  O10 . 4OL K  3 .   ? 4.228   -36.626 20.132  1.00 30.56  ? 202 4OL B O10 1 
HETATM 8678 S  S   . SO4 L  4 .   ? 5.534   -45.375 -5.428  1.00 54.25  ? 203 SO4 B S   1 
HETATM 8679 O  O1  . SO4 L  4 .   ? 5.322   -46.840 -5.428  1.00 34.90  ? 203 SO4 B O1  1 
HETATM 8680 O  O2  . SO4 L  4 .   ? 4.984   -44.754 -6.654  1.00 48.86  ? 203 SO4 B O2  1 
HETATM 8681 O  O3  . SO4 L  4 .   ? 6.993   -45.128 -5.405  1.00 48.39  ? 203 SO4 B O3  1 
HETATM 8682 O  O4  . SO4 L  4 .   ? 4.874   -44.744 -4.254  1.00 45.38  ? 203 SO4 B O4  1 
HETATM 8683 S  S   . SO4 M  4 .   ? 5.023   -42.502 16.063  1.00 36.25  ? 204 SO4 B S   1 
HETATM 8684 O  O1  . SO4 M  4 .   ? 6.008   -41.389 16.257  1.00 36.55  ? 204 SO4 B O1  1 
HETATM 8685 O  O2  . SO4 M  4 .   ? 4.819   -42.705 14.614  1.00 36.79  ? 204 SO4 B O2  1 
HETATM 8686 O  O3  . SO4 M  4 .   ? 5.515   -43.787 16.597  1.00 30.93  ? 204 SO4 B O3  1 
HETATM 8687 O  O4  . SO4 M  4 .   ? 3.772   -42.100 16.783  1.00 40.75  ? 204 SO4 B O4  1 
HETATM 8688 C  C1  . GOL N  5 .   ? -8.358  -59.072 19.657  1.00 67.21  ? 205 GOL B C1  1 
HETATM 8689 O  O1  . GOL N  5 .   ? -8.924  -58.061 18.811  1.00 53.60  ? 205 GOL B O1  1 
HETATM 8690 C  C2  . GOL N  5 .   ? -6.926  -59.398 19.226  1.00 62.75  ? 205 GOL B C2  1 
HETATM 8691 O  O2  . GOL N  5 .   ? -6.081  -59.433 20.381  1.00 66.32  ? 205 GOL B O2  1 
HETATM 8692 C  C3  . GOL N  5 .   ? -6.857  -60.750 18.514  1.00 60.40  ? 205 GOL B C3  1 
HETATM 8693 O  O3  . GOL N  5 .   ? -6.030  -60.669 17.342  1.00 47.97  ? 205 GOL B O3  1 
HETATM 8694 CM CM  . ZCM O  2 .   ? -30.196 -50.822 10.557  1.00 36.35  ? 201 ZCM C CM  1 
HETATM 8695 C  C1  . 4OL P  3 .   ? -31.219 -48.152 6.567   1.00 30.44  ? 202 4OL C C1  1 
HETATM 8696 C  C2  . 4OL P  3 .   ? -29.911 -47.983 7.255   1.00 27.93  ? 202 4OL C C2  1 
HETATM 8697 C  C6  . 4OL P  3 .   ? -27.633 -47.197 7.294   1.00 24.43  ? 202 4OL C C6  1 
HETATM 8698 C  C5  . 4OL P  3 .   ? -27.482 -47.714 8.589   1.00 25.76  ? 202 4OL C C5  1 
HETATM 8699 C  C4  . 4OL P  3 .   ? -28.541 -48.367 9.235   1.00 26.35  ? 202 4OL C C4  1 
HETATM 8700 C  C7  . 4OL P  3 .   ? -28.850 -47.332 6.623   1.00 25.96  ? 202 4OL C C7  1 
HETATM 8701 C  C12 . 4OL P  3 .   ? -33.648 -48.445 6.789   1.00 34.44  ? 202 4OL C C12 1 
HETATM 8702 C  C13 . 4OL P  3 .   ? -34.167 -49.884 6.726   1.00 36.49  ? 202 4OL C C13 1 
HETATM 8703 C  C14 . 4OL P  3 .   ? -34.271 -50.526 8.109   1.00 36.51  ? 202 4OL C C14 1 
HETATM 8704 C  C16 . 4OL P  3 .   ? -33.776 -52.852 7.432   1.00 38.20  ? 202 4OL C C16 1 
HETATM 8705 C  C17 . 4OL P  3 .   ? -36.040 -52.235 8.158   1.00 38.61  ? 202 4OL C C17 1 
HETATM 8706 C  C18 . 4OL P  3 .   ? -36.265 -52.152 9.668   1.00 39.36  ? 202 4OL C C18 1 
HETATM 8707 C  C20 . 4OL P  3 .   ? -35.991 -53.244 11.928  1.00 38.94  ? 202 4OL C C20 1 
HETATM 8708 C  C23 . 4OL P  3 .   ? -32.180 -52.568 5.574   1.00 36.36  ? 202 4OL C C23 1 
HETATM 8709 C  C24 . 4OL P  3 .   ? -30.947 -52.257 5.024   1.00 34.61  ? 202 4OL C C24 1 
HETATM 8710 C  C25 . 4OL P  3 .   ? -29.900 -51.869 5.844   1.00 34.75  ? 202 4OL C C25 1 
HETATM 8711 C  C26 . 4OL P  3 .   ? -30.081 -51.789 7.221   1.00 35.19  ? 202 4OL C C26 1 
HETATM 8712 O  O55 . 4OL P  3 .   ? -36.072 -50.621 12.617  1.00 33.07  ? 202 4OL C O55 1 
HETATM 8713 C  C28 . 4OL P  3 .   ? -35.024 -51.200 12.851  1.00 34.28  ? 202 4OL C C28 1 
HETATM 8714 C  C34 . 4OL P  3 .   ? -33.883 -50.383 13.398  1.00 32.26  ? 202 4OL C C34 1 
HETATM 8715 C  C39 . 4OL P  3 .   ? -33.972 -49.756 14.632  1.00 30.86  ? 202 4OL C C39 1 
HETATM 8716 C  C38 . 4OL P  3 .   ? -32.912 -48.974 15.102  1.00 30.75  ? 202 4OL C C38 1 
HETATM 8717 C  C37 . 4OL P  3 .   ? -31.749 -48.805 14.351  1.00 30.71  ? 202 4OL C C37 1 
HETATM 8718 C  C36 . 4OL P  3 .   ? -31.626 -49.433 13.110  1.00 33.26  ? 202 4OL C C36 1 
HETATM 8719 O  O47 . 4OL P  3 .   ? -30.565 -49.272 12.453  1.00 30.39  ? 202 4OL C O47 1 
HETATM 8720 N  N35 . 4OL P  3 .   ? -32.712 -50.230 12.633  1.00 32.73  ? 202 4OL C N35 1 
HETATM 8721 O  O46 . 4OL P  3 .   ? -32.678 -50.907 11.371  1.00 39.76  ? 202 4OL C O46 1 
HETATM 8722 N  N21 . 4OL P  3 .   ? -34.895 -52.501 12.560  1.00 37.31  ? 202 4OL C N21 1 
HETATM 8723 C  C29 . 4OL P  3 .   ? -33.672 -53.276 12.785  1.00 36.87  ? 202 4OL C C29 1 
HETATM 8724 C  C30 . 4OL P  3 .   ? -33.553 -53.579 14.277  1.00 36.60  ? 202 4OL C C30 1 
HETATM 8725 C  C31 . 4OL P  3 .   ? -32.451 -54.605 14.532  1.00 38.54  ? 202 4OL C C31 1 
HETATM 8726 N  N32 . 4OL P  3 .   ? -31.179 -54.208 13.956  1.00 39.33  ? 202 4OL C N32 1 
HETATM 8727 C  C33 . 4OL P  3 .   ? -30.064 -54.924 14.095  1.00 42.19  ? 202 4OL C C33 1 
HETATM 8728 O  O53 . 4OL P  3 .   ? -30.014 -55.948 14.762  1.00 47.21  ? 202 4OL C O53 1 
HETATM 8729 C  C40 . 4OL P  3 .   ? -28.833 -54.429 13.391  1.00 43.39  ? 202 4OL C C40 1 
HETATM 8730 N  N45 . 4OL P  3 .   ? -28.926 -53.276 12.598  1.00 40.26  ? 202 4OL C N45 1 
HETATM 8731 O  O50 . 4OL P  3 .   ? -30.189 -52.616 12.506  1.00 50.97  ? 202 4OL C O50 1 
HETATM 8732 C  C44 . 4OL P  3 .   ? -27.789 -52.779 11.928  1.00 37.88  ? 202 4OL C C44 1 
HETATM 8733 O  O51 . 4OL P  3 .   ? -27.860 -51.746 11.230  1.00 34.36  ? 202 4OL C O51 1 
HETATM 8734 C  C43 . 4OL P  3 .   ? -26.577 -53.443 12.054  1.00 38.62  ? 202 4OL C C43 1 
HETATM 8735 C  C42 . 4OL P  3 .   ? -26.491 -54.593 12.831  1.00 40.70  ? 202 4OL C C42 1 
HETATM 8736 C  C41 . 4OL P  3 .   ? -27.610 -55.085 13.499  1.00 42.40  ? 202 4OL C C41 1 
HETATM 8737 C  C19 . 4OL P  3 .   ? -35.689 -53.350 10.426  1.00 39.41  ? 202 4OL C C19 1 
HETATM 8738 N  N15 . 4OL P  3 .   ? -34.635 -51.924 7.892   1.00 38.72  ? 202 4OL C N15 1 
HETATM 8739 O  O54 . 4OL P  3 .   ? -34.108 -54.021 7.302   1.00 39.55  ? 202 4OL C O54 1 
HETATM 8740 C  C22 . 4OL P  3 .   ? -32.397 -52.491 6.947   1.00 36.00  ? 202 4OL C C22 1 
HETATM 8741 N  N27 . 4OL P  3 .   ? -31.332 -52.102 7.800   1.00 34.50  ? 202 4OL C N27 1 
HETATM 8742 O  O48 . 4OL P  3 .   ? -31.493 -51.997 9.220   1.00 31.24  ? 202 4OL C O48 1 
HETATM 8743 O  O49 . 4OL P  3 .   ? -29.116 -51.444 7.932   1.00 35.36  ? 202 4OL C O49 1 
HETATM 8744 N  N9  . 4OL P  3 .   ? -32.300 -48.337 7.328   1.00 33.11  ? 202 4OL C N9  1 
HETATM 8745 O  O8  . 4OL P  3 .   ? -31.242 -48.127 5.347   1.00 31.72  ? 202 4OL C O8  1 
HETATM 8746 N  N3  . 4OL P  3 .   ? -29.773 -48.490 8.562   1.00 26.95  ? 202 4OL C N3  1 
HETATM 8747 O  O9  . 4OL P  3 .   ? -28.407 -48.819 10.400  1.00 26.37  ? 202 4OL C O9  1 
HETATM 8748 O  O10 . 4OL P  3 .   ? -30.888 -49.126 9.190   1.00 29.65  ? 202 4OL C O10 1 
HETATM 8749 S  S   . SO4 Q  4 .   ? -43.725 -66.977 24.733  1.00 80.69  ? 203 SO4 C S   1 
HETATM 8750 O  O1  . SO4 Q  4 .   ? -44.014 -66.292 23.452  1.00 68.63  ? 203 SO4 C O1  1 
HETATM 8751 O  O2  . SO4 Q  4 .   ? -44.540 -68.219 24.826  1.00 66.47  ? 203 SO4 C O2  1 
HETATM 8752 O  O3  . SO4 Q  4 .   ? -42.282 -67.311 24.828  1.00 66.02  ? 203 SO4 C O3  1 
HETATM 8753 O  O4  . SO4 Q  4 .   ? -44.071 -66.050 25.834  1.00 81.23  ? 203 SO4 C O4  1 
HETATM 8754 S  S   . SO4 R  4 .   ? -31.821 -45.182 14.885  1.00 35.20  ? 204 SO4 C S   1 
HETATM 8755 O  O1  . SO4 R  4 .   ? -30.550 -45.796 14.384  1.00 36.55  ? 204 SO4 C O1  1 
HETATM 8756 O  O2  . SO4 R  4 .   ? -32.878 -45.362 13.850  1.00 31.91  ? 204 SO4 C O2  1 
HETATM 8757 O  O3  . SO4 R  4 .   ? -32.201 -45.780 16.174  1.00 27.89  ? 204 SO4 C O3  1 
HETATM 8758 O  O4  . SO4 R  4 .   ? -31.658 -43.729 15.122  1.00 39.04  ? 204 SO4 C O4  1 
HETATM 8759 C  C1  . GOL S  5 .   ? -32.448 -23.287 17.885  1.00 34.79  ? 205 GOL C C1  1 
HETATM 8760 O  O1  . GOL S  5 .   ? -32.731 -23.794 19.183  1.00 28.48  ? 205 GOL C O1  1 
HETATM 8761 C  C2  . GOL S  5 .   ? -33.232 -24.140 16.910  1.00 42.69  ? 205 GOL C C2  1 
HETATM 8762 O  O2  . GOL S  5 .   ? -34.512 -24.412 17.491  1.00 48.06  ? 205 GOL C O2  1 
HETATM 8763 C  C3  . GOL S  5 .   ? -32.503 -25.454 16.658  1.00 42.67  ? 205 GOL C C3  1 
HETATM 8764 O  O3  . GOL S  5 .   ? -31.082 -25.269 16.703  1.00 46.83  ? 205 GOL C O3  1 
HETATM 8765 CM CM  . ZCM T  2 .   ? -18.454 -58.436 -19.592 1.00 45.75  ? 201 ZCM D CM  1 
HETATM 8766 C  C1  . 4OL U  3 .   ? -15.471 -57.199 -23.033 1.00 34.35  ? 202 4OL D C1  1 
HETATM 8767 C  C2  . 4OL U  3 .   ? -15.288 -58.467 -22.245 1.00 33.73  ? 202 4OL D C2  1 
HETATM 8768 C  C6  . 4OL U  3 .   ? -14.271 -60.630 -21.924 1.00 30.25  ? 202 4OL D C6  1 
HETATM 8769 C  C5  . 4OL U  3 .   ? -14.985 -60.796 -20.737 1.00 29.72  ? 202 4OL D C5  1 
HETATM 8770 C  C4  . 4OL U  3 .   ? -15.845 -59.803 -20.286 1.00 30.33  ? 202 4OL D C4  1 
HETATM 8771 C  C7  . 4OL U  3 .   ? -14.419 -59.468 -22.678 1.00 31.86  ? 202 4OL D C7  1 
HETATM 8772 C  C12 . 4OL U  3 .   ? -15.988 -54.816 -23.103 1.00 35.51  ? 202 4OL D C12 1 
HETATM 8773 C  C13 . 4OL U  3 .   ? -17.404 -54.368 -23.445 1.00 37.65  ? 202 4OL D C13 1 
HETATM 8774 C  C14 . 4OL U  3 .   ? -18.284 -54.425 -22.204 1.00 39.65  ? 202 4OL D C14 1 
HETATM 8775 C  C16 . 4OL U  3 .   ? -20.449 -55.059 -23.173 1.00 45.69  ? 202 4OL D C16 1 
HETATM 8776 C  C17 . 4OL U  3 .   ? -20.059 -52.751 -22.434 1.00 45.58  ? 202 4OL D C17 1 
HETATM 8777 C  C18 . 4OL U  3 .   ? -20.227 -52.532 -20.930 1.00 47.77  ? 202 4OL D C18 1 
HETATM 8778 C  C20 . 4OL U  3 .   ? -21.720 -52.848 -18.901 1.00 50.54  ? 202 4OL D C20 1 
HETATM 8779 C  C23 . 4OL U  3 .   ? -19.623 -56.650 -24.897 1.00 46.42  ? 202 4OL D C23 1 
HETATM 8780 C  C24 . 4OL U  3 .   ? -19.073 -57.857 -25.299 1.00 45.29  ? 202 4OL D C24 1 
HETATM 8781 C  C25 . 4OL U  3 .   ? -18.734 -58.819 -24.362 1.00 45.46  ? 202 4OL D C25 1 
HETATM 8782 C  C26 . 4OL U  3 .   ? -18.946 -58.593 -23.007 1.00 46.39  ? 202 4OL D C26 1 
HETATM 8783 O  O55 . 4OL U  3 .   ? -19.283 -52.327 -17.710 1.00 39.75  ? 202 4OL D O55 1 
HETATM 8784 C  C28 . 4OL U  3 .   ? -19.754 -53.438 -17.561 1.00 41.63  ? 202 4OL D C28 1 
HETATM 8785 C  C34 . 4OL U  3 .   ? -18.935 -54.463 -16.837 1.00 37.61  ? 202 4OL D C34 1 
HETATM 8786 C  C39 . 4OL U  3 .   ? -18.590 -54.326 -15.504 1.00 35.60  ? 202 4OL D C39 1 
HETATM 8787 C  C38 . 4OL U  3 .   ? -17.830 -55.299 -14.871 1.00 34.46  ? 202 4OL D C38 1 
HETATM 8788 C  C37 . 4OL U  3 .   ? -17.402 -56.421 -15.565 1.00 37.17  ? 202 4OL D C37 1 
HETATM 8789 C  C36 . 4OL U  3 .   ? -17.737 -56.574 -16.904 1.00 37.37  ? 202 4OL D C36 1 
HETATM 8790 O  O47 . 4OL U  3 .   ? -17.340 -57.584 -17.517 1.00 39.07  ? 202 4OL D O47 1 
HETATM 8791 N  N35 . 4OL U  3 .   ? -18.509 -55.584 -17.550 1.00 37.88  ? 202 4OL D N35 1 
HETATM 8792 O  O46 . 4OL U  3 .   ? -18.885 -55.666 -18.930 1.00 42.26  ? 202 4OL D O46 1 
HETATM 8793 N  N21 . 4OL U  3 .   ? -20.952 -53.770 -18.066 1.00 47.23  ? 202 4OL D N21 1 
HETATM 8794 C  C29 . 4OL U  3 .   ? -21.582 -55.078 -17.894 1.00 48.83  ? 202 4OL D C29 1 
HETATM 8795 C  C30 . 4OL U  3 .   ? -21.926 -55.299 -16.423 1.00 47.87  ? 202 4OL D C30 1 
HETATM 8796 C  C31 . 4OL U  3 .   ? -22.883 -56.484 -16.262 1.00 50.51  ? 202 4OL D C31 1 
HETATM 8797 N  N32 . 4OL U  3 .   ? -22.344 -57.730 -16.794 1.00 52.24  ? 202 4OL D N32 1 
HETATM 8798 C  C33 . 4OL U  3 .   ? -23.092 -58.826 -16.963 1.00 53.07  ? 202 4OL D C33 1 
HETATM 8799 O  O53 . 4OL U  3 .   ? -24.281 -58.863 -16.689 1.00 58.53  ? 202 4OL D O53 1 
HETATM 8800 C  C40 . 4OL U  3 .   ? -22.459 -60.068 -17.511 1.00 52.14  ? 202 4OL D C40 1 
HETATM 8801 N  N45 . 4OL U  3 .   ? -21.201 -60.016 -18.146 1.00 55.63  ? 202 4OL D N45 1 
HETATM 8802 O  O50 . 4OL U  3 .   ? -20.521 -58.761 -18.263 1.00 51.54  ? 202 4OL D O50 1 
HETATM 8803 C  C44 . 4OL U  3 .   ? -20.623 -61.198 -18.661 1.00 53.18  ? 202 4OL D C44 1 
HETATM 8804 O  O51 . 4OL U  3 .   ? -19.512 -61.177 -19.224 1.00 53.18  ? 202 4OL D O51 1 
HETATM 8805 C  C43 . 4OL U  3 .   ? -21.297 -62.403 -18.542 1.00 54.02  ? 202 4OL D C43 1 
HETATM 8806 C  C42 . 4OL U  3 .   ? -22.539 -62.440 -17.916 1.00 56.44  ? 202 4OL D C42 1 
HETATM 8807 C  C41 . 4OL U  3 .   ? -23.119 -61.283 -17.400 1.00 53.45  ? 202 4OL D C41 1 
HETATM 8808 C  C19 . 4OL U  3 .   ? -21.460 -53.240 -20.361 1.00 50.16  ? 202 4OL D C19 1 
HETATM 8809 N  N15 . 4OL U  3 .   ? -19.648 -54.134 -22.629 1.00 42.93  ? 202 4OL D N15 1 
HETATM 8810 O  O54 . 4OL U  3 .   ? -21.634 -54.846 -23.410 1.00 44.63  ? 202 4OL D O54 1 
HETATM 8811 C  C22 . 4OL U  3 .   ? -19.855 -56.389 -23.554 1.00 44.94  ? 202 4OL D C22 1 
HETATM 8812 N  N27 . 4OL U  3 .   ? -19.517 -57.360 -22.587 1.00 45.63  ? 202 4OL D N27 1 
HETATM 8813 O  O48 . 4OL U  3 .   ? -19.754 -57.083 -21.202 1.00 45.72  ? 202 4OL D O48 1 
HETATM 8814 O  O49 . 4OL U  3 .   ? -18.625 -59.501 -22.198 1.00 41.48  ? 202 4OL D O49 1 
HETATM 8815 N  N9  . 4OL U  3 .   ? -15.924 -56.100 -22.422 1.00 33.75  ? 202 4OL D N9  1 
HETATM 8816 O  O8  . 4OL U  3 .   ? -15.180 -57.205 -24.214 1.00 35.73  ? 202 4OL D O8  1 
HETATM 8817 N  N3  . 4OL U  3 .   ? -16.001 -58.624 -21.046 1.00 32.46  ? 202 4OL D N3  1 
HETATM 8818 O  O9  . 4OL U  3 .   ? -16.465 -59.964 -19.209 1.00 31.82  ? 202 4OL D O9  1 
HETATM 8819 O  O10 . 4OL U  3 .   ? -16.878 -57.558 -20.646 1.00 34.72  ? 202 4OL D O10 1 
HETATM 8820 S  S   . SO4 V  4 .   ? -13.710 -56.352 -14.482 1.00 29.15  ? 203 SO4 D S   1 
HETATM 8821 O  O1  . SO4 V  4 .   ? -13.780 -55.405 -15.628 1.00 26.48  ? 203 SO4 D O1  1 
HETATM 8822 O  O2  . SO4 V  4 .   ? -14.207 -57.697 -14.894 1.00 32.75  ? 203 SO4 D O2  1 
HETATM 8823 O  O3  . SO4 V  4 .   ? -14.528 -55.885 -13.336 1.00 25.46  ? 203 SO4 D O3  1 
HETATM 8824 O  O4  . SO4 V  4 .   ? -12.296 -56.430 -14.082 1.00 25.44  ? 203 SO4 D O4  1 
HETATM 8825 C  C1  . GOL W  5 .   ? 6.710   -53.278 -8.121  1.00 39.47  ? 204 GOL D C1  1 
HETATM 8826 O  O1  . GOL W  5 .   ? 6.258   -51.946 -8.399  1.00 37.49  ? 204 GOL D O1  1 
HETATM 8827 C  C2  . GOL W  5 .   ? 6.832   -53.481 -6.611  1.00 38.99  ? 204 GOL D C2  1 
HETATM 8828 O  O2  . GOL W  5 .   ? 5.857   -52.687 -5.934  1.00 31.39  ? 204 GOL D O2  1 
HETATM 8829 C  C3  . GOL W  5 .   ? 6.613   -54.957 -6.250  1.00 52.16  ? 204 GOL D C3  1 
HETATM 8830 O  O3  . GOL W  5 .   ? 6.290   -55.123 -4.854  1.00 42.36  ? 204 GOL D O3  1 
HETATM 8831 S  S   . SO4 X  4 .   ? -36.738 -45.136 -6.658  1.00 86.79  ? 205 SO4 D S   1 
HETATM 8832 O  O1  . SO4 X  4 .   ? -36.592 -43.661 -6.568  1.00 53.78  ? 205 SO4 D O1  1 
HETATM 8833 O  O2  . SO4 X  4 .   ? -36.679 -45.536 -8.086  1.00 75.49  ? 205 SO4 D O2  1 
HETATM 8834 O  O3  . SO4 X  4 .   ? -38.043 -45.567 -6.087  1.00 66.74  ? 205 SO4 D O3  1 
HETATM 8835 O  O4  . SO4 X  4 .   ? -35.630 -45.780 -5.905  1.00 75.80  ? 205 SO4 D O4  1 
HETATM 8836 CM CM  . ZCM Y  2 .   ? 1.990   -30.020 -49.509 1.00 44.80  ? 201 ZCM E CM  1 
HETATM 8837 C  C1  . 4OL Z  3 .   ? -2.217  -30.075 -46.515 1.00 36.99  ? 202 4OL E C1  1 
HETATM 8838 C  C2  . 4OL Z  3 .   ? -1.283  -28.890 -46.483 1.00 32.90  ? 202 4OL E C2  1 
HETATM 8839 C  C6  . 4OL Z  3 .   ? -0.801  -26.632 -45.759 1.00 29.61  ? 202 4OL E C6  1 
HETATM 8840 C  C5  . 4OL Z  3 .   ? 0.474   -26.704 -46.318 1.00 32.10  ? 202 4OL E C5  1 
HETATM 8841 C  C4  . 4OL Z  3 .   ? 0.894   -27.866 -46.964 1.00 32.84  ? 202 4OL E C4  1 
HETATM 8842 C  C7  . 4OL Z  3 .   ? -1.666  -27.721 -45.837 1.00 30.29  ? 202 4OL E C7  1 
HETATM 8843 C  C12 . 4OL Z  3 .   ? -2.565  -32.442 -46.971 1.00 38.33  ? 202 4OL E C12 1 
HETATM 8844 C  C13 . 4OL Z  3 .   ? -2.773  -33.027 -48.365 1.00 41.69  ? 202 4OL E C13 1 
HETATM 8845 C  C14 . 4OL Z  3 .   ? -1.439  -33.413 -48.982 1.00 43.32  ? 202 4OL E C14 1 
HETATM 8846 C  C16 . 4OL Z  3 .   ? -1.835  -32.738 -51.308 1.00 45.37  ? 202 4OL E C16 1 
HETATM 8847 C  C17 . 4OL Z  3 .   ? -1.628  -35.100 -50.786 1.00 51.05  ? 202 4OL E C17 1 
HETATM 8848 C  C18 . 4OL Z  3 .   ? -0.173  -35.592 -50.740 1.00 49.61  ? 202 4OL E C18 1 
HETATM 8849 C  C20 . 4OL Z  3 .   ? 1.998   -35.947 -52.040 1.00 44.93  ? 202 4OL E C20 1 
HETATM 8850 C  C23 . 4OL Z  3 .   ? -3.315  -30.775 -51.199 1.00 40.69  ? 202 4OL E C23 1 
HETATM 8851 C  C24 . 4OL Z  3 .   ? -3.593  -29.436 -50.985 1.00 40.66  ? 202 4OL E C24 1 
HETATM 8852 C  C25 . 4OL Z  3 .   ? -2.600  -28.563 -50.566 1.00 41.64  ? 202 4OL E C25 1 
HETATM 8853 C  C26 . 4OL Z  3 .   ? -1.304  -29.018 -50.366 1.00 42.70  ? 202 4OL E C26 1 
HETATM 8854 O  O55 . 4OL Z  3 .   ? 2.656   -36.310 -49.394 1.00 38.91  ? 202 4OL E O55 1 
HETATM 8855 C  C28 . 4OL Z  3 .   ? 3.160   -35.359 -49.968 1.00 39.34  ? 202 4OL E C28 1 
HETATM 8856 C  C34 . 4OL Z  3 .   ? 4.014   -34.436 -49.146 1.00 38.01  ? 202 4OL E C34 1 
HETATM 8857 C  C39 . 4OL Z  3 .   ? 5.210   -34.856 -48.579 1.00 37.57  ? 202 4OL E C39 1 
HETATM 8858 C  C38 . 4OL Z  3 .   ? 5.965   -33.976 -47.802 1.00 37.58  ? 202 4OL E C38 1 
HETATM 8859 C  C37 . 4OL Z  3 .   ? 5.536   -32.669 -47.585 1.00 35.24  ? 202 4OL E C37 1 
HETATM 8860 C  C36 . 4OL Z  3 .   ? 4.341   -32.233 -48.145 1.00 34.43  ? 202 4OL E C36 1 
HETATM 8861 O  O47 . 4OL Z  3 .   ? 3.966   -31.059 -47.942 1.00 33.56  ? 202 4OL E O47 1 
HETATM 8862 N  N35 . 4OL Z  3 .   ? 3.566   -33.125 -48.921 1.00 35.71  ? 202 4OL E N35 1 
HETATM 8863 O  O46 . 4OL Z  3 .   ? 2.323   -32.746 -49.519 1.00 38.93  ? 202 4OL E O46 1 
HETATM 8864 N  N21 . 4OL Z  3 .   ? 2.902   -35.106 -51.260 1.00 41.35  ? 202 4OL E N21 1 
HETATM 8865 C  C29 . 4OL Z  3 .   ? 3.403   -33.937 -51.980 1.00 42.63  ? 202 4OL E C29 1 
HETATM 8866 C  C30 . 4OL Z  3 .   ? 4.837   -34.182 -52.428 1.00 41.79  ? 202 4OL E C30 1 
HETATM 8867 C  C31 . 4OL Z  3 .   ? 5.238   -33.158 -53.488 1.00 44.19  ? 202 4OL E C31 1 
HETATM 8868 N  N32 . 4OL Z  3 .   ? 5.076   -31.795 -53.013 1.00 44.01  ? 202 4OL E N32 1 
HETATM 8869 C  C33 . 4OL Z  3 .   ? 4.912   -30.742 -53.821 1.00 47.32  ? 202 4OL E C33 1 
HETATM 8870 O  O53 . 4OL Z  3 .   ? 4.976   -30.848 -55.034 1.00 48.94  ? 202 4OL E O53 1 
HETATM 8871 C  C40 . 4OL Z  3 .   ? 4.575   -29.412 -53.188 1.00 48.66  ? 202 4OL E C40 1 
HETATM 8872 N  N45 . 4OL Z  3 .   ? 4.078   -29.402 -51.873 1.00 46.72  ? 202 4OL E N45 1 
HETATM 8873 O  O50 . 4OL Z  3 .   ? 3.926   -30.628 -51.160 1.00 58.05  ? 202 4OL E O50 1 
HETATM 8874 C  C44 . 4OL Z  3 .   ? 3.749   -28.202 -51.231 1.00 48.62  ? 202 4OL E C44 1 
HETATM 8875 O  O51 . 4OL Z  3 .   ? 3.342   -28.258 -50.051 1.00 48.41  ? 202 4OL E O51 1 
HETATM 8876 C  C43 . 4OL Z  3 .   ? 3.891   -26.995 -51.907 1.00 46.26  ? 202 4OL E C43 1 
HETATM 8877 C  C42 . 4OL Z  3 .   ? 4.371   -26.998 -53.216 1.00 49.25  ? 202 4OL E C42 1 
HETATM 8878 C  C41 . 4OL Z  3 .   ? 4.715   -28.195 -53.855 1.00 49.83  ? 202 4OL E C41 1 
HETATM 8879 C  C19 . 4OL Z  3 .   ? 0.620   -35.266 -52.013 1.00 48.88  ? 202 4OL E C19 1 
HETATM 8880 N  N15 . 4OL Z  3 .   ? -1.656  -33.686 -50.395 1.00 46.86  ? 202 4OL E N15 1 
HETATM 8881 O  O54 . 4OL Z  3 .   ? -1.851  -33.055 -52.488 1.00 47.60  ? 202 4OL E O54 1 
HETATM 8882 C  C22 . 4OL Z  3 .   ? -2.041  -31.277 -50.994 1.00 41.30  ? 202 4OL E C22 1 
HETATM 8883 N  N27 . 4OL Z  3 .   ? -1.003  -30.392 -50.586 1.00 40.31  ? 202 4OL E N27 1 
HETATM 8884 O  O48 . 4OL Z  3 .   ? 0.327   -30.871 -50.345 1.00 33.18  ? 202 4OL E O48 1 
HETATM 8885 O  O49 . 4OL Z  3 .   ? -0.435  -28.183 -49.993 1.00 39.16  ? 202 4OL E O49 1 
HETATM 8886 N  N9  . 4OL Z  3 .   ? -1.767  -31.232 -47.001 1.00 36.30  ? 202 4OL E N9  1 
HETATM 8887 O  O8  . 4OL Z  3 .   ? -3.338  -29.991 -46.024 1.00 41.77  ? 202 4OL E O8  1 
HETATM 8888 N  N3  . 4OL Z  3 .   ? 0.014   -28.983 -47.038 1.00 32.19  ? 202 4OL E N3  1 
HETATM 8889 O  O9  . 4OL Z  3 .   ? 2.052   -27.885 -47.458 1.00 30.87  ? 202 4OL E O9  1 
HETATM 8890 O  O10 . 4OL Z  3 .   ? 0.401   -30.218 -47.682 1.00 40.63  ? 202 4OL E O10 1 
HETATM 8891 S  S   . SO4 AA 4 .   ? 6.468   -32.598 -43.860 1.00 40.67  ? 203 SO4 E S   1 
HETATM 8892 O  O1  . SO4 AA 4 .   ? 7.580   -33.317 -44.512 1.00 47.57  ? 203 SO4 E O1  1 
HETATM 8893 O  O2  . SO4 AA 4 .   ? 6.484   -31.176 -44.293 1.00 59.69  ? 203 SO4 E O2  1 
HETATM 8894 O  O3  . SO4 AA 4 .   ? 5.136   -33.187 -44.160 1.00 37.50  ? 203 SO4 E O3  1 
HETATM 8895 O  O4  . SO4 AA 4 .   ? 6.700   -32.689 -42.404 1.00 51.56  ? 203 SO4 E O4  1 
HETATM 8896 C  C1  . GOL BA 5 .   ? 10.065  -48.964 -63.886 1.00 56.51  ? 204 GOL E C1  1 
HETATM 8897 O  O1  . GOL BA 5 .   ? 10.883  -49.617 -62.903 1.00 54.75  ? 204 GOL E O1  1 
HETATM 8898 C  C2  . GOL BA 5 .   ? 10.935  -48.417 -65.014 1.00 53.39  ? 204 GOL E C2  1 
HETATM 8899 O  O2  . GOL BA 5 .   ? 10.978  -49.384 -66.072 1.00 62.73  ? 204 GOL E O2  1 
HETATM 8900 C  C3  . GOL BA 5 .   ? 10.383  -47.097 -65.545 1.00 52.79  ? 204 GOL E C3  1 
HETATM 8901 O  O3  . GOL BA 5 .   ? 11.337  -46.046 -65.354 1.00 53.24  ? 204 GOL E O3  1 
HETATM 8902 S  S   . SO4 CA 4 .   ? 20.315  -37.963 -25.683 1.00 78.96  ? 205 SO4 E S   1 
HETATM 8903 O  O1  . SO4 CA 4 .   ? 21.368  -38.758 -26.358 1.00 79.93  ? 205 SO4 E O1  1 
HETATM 8904 O  O2  . SO4 CA 4 .   ? 19.015  -38.249 -26.332 1.00 68.34  ? 205 SO4 E O2  1 
HETATM 8905 O  O3  . SO4 CA 4 .   ? 20.288  -38.355 -24.254 1.00 56.71  ? 205 SO4 E O3  1 
HETATM 8906 O  O4  . SO4 CA 4 .   ? 20.597  -36.510 -25.797 1.00 58.24  ? 205 SO4 E O4  1 
HETATM 8907 CM CM  . ZCM DA 2 .   ? 24.810  -76.895 -0.518  1.00 42.34  ? 201 ZCM F CM  1 
HETATM 8908 C  C1  . 4OL EA 3 .   ? 29.010  -74.022 -0.809  1.00 36.30  ? 202 4OL F C1  1 
HETATM 8909 C  C2  . 4OL EA 3 .   ? 27.975  -73.967 0.283   1.00 32.92  ? 202 4OL F C2  1 
HETATM 8910 C  C6  . 4OL EA 3 .   ? 27.259  -73.145 2.442   1.00 31.19  ? 202 4OL F C6  1 
HETATM 8911 C  C5  . 4OL EA 3 .   ? 26.035  -73.790 2.296   1.00 31.22  ? 202 4OL F C5  1 
HETATM 8912 C  C4  . 4OL EA 3 .   ? 25.754  -74.529 1.150   1.00 29.06  ? 202 4OL F C4  1 
HETATM 8913 C  C7  . 4OL EA 3 .   ? 28.225  -73.232 1.439   1.00 32.18  ? 202 4OL F C7  1 
HETATM 8914 C  C12 . 4OL EA 3 .   ? 29.503  -74.486 -3.157  1.00 39.76  ? 202 4OL F C12 1 
HETATM 8915 C  C13 . 4OL EA 3 .   ? 29.666  -75.907 -3.697  1.00 41.25  ? 202 4OL F C13 1 
HETATM 8916 C  C14 . 4OL EA 3 .   ? 28.320  -76.528 -4.064  1.00 39.49  ? 202 4OL F C14 1 
HETATM 8917 C  C16 . 4OL EA 3 .   ? 28.683  -78.865 -3.388  1.00 41.79  ? 202 4OL F C16 1 
HETATM 8918 C  C17 . 4OL EA 3 .   ? 28.539  -78.322 -5.762  1.00 42.57  ? 202 4OL F C17 1 
HETATM 8919 C  C18 . 4OL EA 3 .   ? 27.106  -78.197 -6.305  1.00 41.09  ? 202 4OL F C18 1 
HETATM 8920 C  C20 . 4OL EA 3 .   ? 24.837  -79.284 -6.619  1.00 39.40  ? 202 4OL F C20 1 
HETATM 8921 C  C23 . 4OL EA 3 .   ? 30.147  -78.659 -1.423  1.00 41.20  ? 202 4OL F C23 1 
HETATM 8922 C  C24 . 4OL EA 3 .   ? 30.396  -78.384 -0.092  1.00 38.92  ? 202 4OL F C24 1 
HETATM 8923 C  C25 . 4OL EA 3 .   ? 29.364  -77.945 0.719   1.00 40.55  ? 202 4OL F C25 1 
HETATM 8924 C  C26 . 4OL EA 3 .   ? 28.075  -77.799 0.220   1.00 38.10  ? 202 4OL F C26 1 
HETATM 8925 O  O55 . 4OL EA 3 .   ? 24.087  -76.663 -6.788  1.00 34.64  ? 202 4OL F O55 1 
HETATM 8926 C  C28 . 4OL EA 3 .   ? 23.670  -77.288 -5.840  1.00 33.75  ? 202 4OL F C28 1 
HETATM 8927 C  C34 . 4OL EA 3 .   ? 22.873  -76.493 -4.859  1.00 33.08  ? 202 4OL F C34 1 
HETATM 8928 C  C39 . 4OL EA 3 .   ? 21.677  -75.919 -5.258  1.00 31.25  ? 202 4OL F C39 1 
HETATM 8929 C  C38 . 4OL EA 3 .   ? 20.958  -75.135 -4.359  1.00 31.98  ? 202 4OL F C38 1 
HETATM 8930 C  C37 . 4OL EA 3 .   ? 21.439  -74.913 -3.073  1.00 30.75  ? 202 4OL F C37 1 
HETATM 8931 C  C36 . 4OL EA 3 .   ? 22.651  -75.463 -2.660  1.00 30.70  ? 202 4OL F C36 1 
HETATM 8932 O  O47 . 4OL EA 3 .   ? 23.070  -75.248 -1.489  1.00 31.89  ? 202 4OL F O47 1 
HETATM 8933 N  N35 . 4OL EA 3 .   ? 23.387  -76.252 -3.567  1.00 31.34  ? 202 4OL F N35 1 
HETATM 8934 O  O46 . 4OL EA 3 .   ? 24.647  -76.838 -3.194  1.00 36.02  ? 202 4OL F O46 1 
HETATM 8935 N  N21 . 4OL EA 3 .   ? 23.988  -78.570 -5.663  1.00 38.06  ? 202 4OL F N21 1 
HETATM 8936 C  C29 . 4OL EA 3 .   ? 23.584  -79.343 -4.498  1.00 39.86  ? 202 4OL F C29 1 
HETATM 8937 C  C30 . 4OL EA 3 .   ? 22.138  -79.764 -4.727  1.00 39.36  ? 202 4OL F C30 1 
HETATM 8938 C  C31 . 4OL EA 3 .   ? 21.745  -80.842 -3.721  1.00 41.08  ? 202 4OL F C31 1 
HETATM 8939 N  N32 . 4OL EA 3 .   ? 22.177  -80.531 -2.368  1.00 40.66  ? 202 4OL F N32 1 
HETATM 8940 C  C33 . 4OL EA 3 .   ? 21.539  -81.018 -1.308  1.00 40.55  ? 202 4OL F C33 1 
HETATM 8941 O  O53 . 4OL EA 3 .   ? 20.584  -81.751 -1.434  1.00 42.53  ? 202 4OL F O53 1 
HETATM 8942 C  C40 . 4OL EA 3 .   ? 21.985  -80.651 0.076   1.00 43.28  ? 202 4OL F C40 1 
HETATM 8943 N  N45 . 4OL EA 3 .   ? 22.730  -79.473 0.281   1.00 38.99  ? 202 4OL F N45 1 
HETATM 8944 O  O50 . 4OL EA 3 .   ? 23.061  -78.653 -0.832  1.00 36.58  ? 202 4OL F O50 1 
HETATM 8945 C  C44 . 4OL EA 3 .   ? 23.161  -79.127 1.571   1.00 40.03  ? 202 4OL F C44 1 
HETATM 8946 O  O51 . 4OL EA 3 .   ? 23.820  -78.092 1.740   1.00 43.32  ? 202 4OL F O51 1 
HETATM 8947 C  C43 . 4OL EA 3 .   ? 22.842  -79.939 2.648   1.00 43.09  ? 202 4OL F C43 1 
HETATM 8948 C  C42 . 4OL EA 3 .   ? 22.096  -81.099 2.442   1.00 45.38  ? 202 4OL F C42 1 
HETATM 8949 C  C41 . 4OL EA 3 .   ? 21.667  -81.459 1.166   1.00 44.05  ? 202 4OL F C41 1 
HETATM 8950 C  C19 . 4OL EA 3 .   ? 26.228  -79.414 -5.991  1.00 40.89  ? 202 4OL F C19 1 
HETATM 8951 N  N15 . 4OL EA 3 .   ? 28.530  -77.947 -4.343  1.00 41.74  ? 202 4OL F N15 1 
HETATM 8952 O  O54 . 4OL EA 3 .   ? 28.698  -80.062 -3.644  1.00 47.04  ? 202 4OL F O54 1 
HETATM 8953 C  C22 . 4OL EA 3 .   ? 28.872  -78.501 -1.950  1.00 39.66  ? 202 4OL F C22 1 
HETATM 8954 N  N27 . 4OL EA 3 .   ? 27.802  -78.089 -1.122  1.00 36.79  ? 202 4OL F N27 1 
HETATM 8955 O  O48 . 4OL EA 3 .   ? 26.467  -77.903 -1.619  1.00 33.50  ? 202 4OL F O48 1 
HETATM 8956 O  O49 . 4OL EA 3 .   ? 27.156  -77.425 0.979   1.00 37.17  ? 202 4OL F O49 1 
HETATM 8957 N  N9  . 4OL EA 3 .   ? 28.616  -74.442 -2.007  1.00 38.20  ? 202 4OL F N9  1 
HETATM 8958 O  O8  . 4OL EA 3 .   ? 30.156  -73.630 -0.606  1.00 41.78  ? 202 4OL F O8  1 
HETATM 8959 N  N3  . 4OL EA 3 .   ? 26.730  -74.614 0.119   1.00 30.62  ? 202 4OL F N3  1 
HETATM 8960 O  O9  . 4OL EA 3 .   ? 24.631  -75.094 1.061   1.00 27.01  ? 202 4OL F O9  1 
HETATM 8961 O  O10 . 4OL EA 3 .   ? 26.482  -75.368 -1.096  1.00 33.51  ? 202 4OL F O10 1 
HETATM 8962 S  S   . SO4 FA 4 .   ? 20.731  -71.178 -3.209  1.00 39.15  ? 203 SO4 F S   1 
HETATM 8963 O  O1  . SO4 FA 4 .   ? 21.929  -71.388 -4.062  1.00 41.54  ? 203 SO4 F O1  1 
HETATM 8964 O  O2  . SO4 FA 4 .   ? 19.462  -71.407 -3.923  1.00 34.30  ? 203 SO4 F O2  1 
HETATM 8965 O  O3  . SO4 FA 4 .   ? 20.787  -72.132 -2.081  1.00 44.01  ? 203 SO4 F O3  1 
HETATM 8966 O  O4  . SO4 FA 4 .   ? 20.743  -69.772 -2.737  1.00 47.04  ? 203 SO4 F O4  1 
HETATM 8967 O  O   . HOH GA 6 .   ? -31.022 -4.865  19.837  1.00 27.60  ? 301 HOH A O   1 
HETATM 8968 O  O   . HOH GA 6 .   ? -23.692 -21.371 18.989  1.00 35.98  ? 302 HOH A O   1 
HETATM 8969 O  O   . HOH GA 6 .   ? -15.706 3.815   28.179  1.00 14.83  ? 303 HOH A O   1 
HETATM 8970 O  O   . HOH GA 6 .   ? -9.523  -24.490 31.464  1.00 14.90  ? 304 HOH A O   1 
HETATM 8971 O  O   . HOH GA 6 .   ? -5.751  -25.040 19.798  1.00 32.83  ? 305 HOH A O   1 
HETATM 8972 O  O   . HOH GA 6 .   ? -9.069  -24.654 20.776  1.00 32.98  ? 306 HOH A O   1 
HETATM 8973 O  O   . HOH GA 6 .   ? -29.025 -7.917  14.028  1.00 14.96  ? 307 HOH A O   1 
HETATM 8974 O  O   . HOH GA 6 .   ? -19.083 -12.935 16.192  1.00 13.23  ? 308 HOH A O   1 
HETATM 8975 O  O   . HOH GA 6 .   ? -28.454 -12.748 23.729  1.00 26.57  ? 309 HOH A O   1 
HETATM 8976 O  O   . HOH GA 6 .   ? -27.687 -16.483 27.290  1.00 22.73  ? 310 HOH A O   1 
HETATM 8977 O  O   . HOH GA 6 .   ? -23.635 -28.800 29.371  1.00 13.92  ? 311 HOH A O   1 
HETATM 8978 O  O   . HOH GA 6 .   ? -14.609 -3.275  28.594  1.00 24.88  ? 312 HOH A O   1 
HETATM 8979 O  O   . HOH GA 6 .   ? -28.035 -18.733 40.470  1.00 16.60  ? 313 HOH A O   1 
HETATM 8980 O  O   . HOH GA 6 .   ? -21.171 -19.335 44.997  1.00 19.41  ? 314 HOH A O   1 
HETATM 8981 O  O   . HOH GA 6 .   ? -11.617 -8.877  27.363  1.00 24.98  ? 315 HOH A O   1 
HETATM 8982 O  O   . HOH GA 6 .   ? -20.485 -14.994 14.837  1.00 18.39  ? 316 HOH A O   1 
HETATM 8983 O  O   . HOH GA 6 .   ? -8.338  -15.311 18.485  1.00 26.12  ? 317 HOH A O   1 
HETATM 8984 O  O   . HOH GA 6 .   ? -31.088 -26.055 23.542  1.00 18.23  ? 318 HOH A O   1 
HETATM 8985 O  O   . HOH GA 6 .   ? -30.051 -22.929 35.395  1.00 16.91  ? 319 HOH A O   1 
HETATM 8986 O  O   . HOH GA 6 .   ? -24.158 -25.107 40.505  1.00 17.05  ? 320 HOH A O   1 
HETATM 8987 O  O   . HOH GA 6 .   ? -1.950  -18.029 31.415  1.00 23.86  ? 321 HOH A O   1 
HETATM 8988 O  O   . HOH GA 6 .   ? -5.433  -25.019 30.387  1.00 15.83  ? 322 HOH A O   1 
HETATM 8989 O  O   . HOH GA 6 .   ? -19.222 -23.981 41.210  1.00 20.55  ? 323 HOH A O   1 
HETATM 8990 O  O   . HOH GA 6 .   ? -29.484 -2.901  16.886  1.00 24.74  ? 324 HOH A O   1 
HETATM 8991 O  O   . HOH GA 6 .   ? -11.189 -9.830  25.067  1.00 30.73  ? 325 HOH A O   1 
HETATM 8992 O  O   . HOH GA 6 .   ? -30.862 -26.271 28.523  1.00 19.10  ? 326 HOH A O   1 
HETATM 8993 O  O   . HOH GA 6 .   ? -17.092 3.069   37.140  1.00 27.97  ? 327 HOH A O   1 
HETATM 8994 O  O   . HOH GA 6 .   ? -7.272  -17.110 45.698  1.00 27.20  ? 328 HOH A O   1 
HETATM 8995 O  O   . HOH GA 6 .   ? -31.694 -1.384  26.494  1.00 28.12  ? 329 HOH A O   1 
HETATM 8996 O  O   . HOH GA 6 .   ? -11.933 -13.818 32.528  1.00 31.19  ? 330 HOH A O   1 
HETATM 8997 O  O   . HOH GA 6 .   ? -6.467  -16.880 38.583  1.00 18.32  ? 331 HOH A O   1 
HETATM 8998 O  O   . HOH GA 6 .   ? -27.582 -23.542 41.858  1.00 21.53  ? 332 HOH A O   1 
HETATM 8999 O  O   . HOH GA 6 .   ? -0.241  -19.145 11.804  1.00 18.95  ? 333 HOH A O   1 
HETATM 9000 O  O   . HOH GA 6 .   ? -12.482 -9.497  43.629  1.00 29.11  ? 334 HOH A O   1 
HETATM 9001 O  O   . HOH GA 6 .   ? -20.710 -19.556 42.300  1.00 23.99  ? 335 HOH A O   1 
HETATM 9002 O  O   . HOH GA 6 .   ? -18.563 -5.752  15.286  1.00 22.62  ? 336 HOH A O   1 
HETATM 9003 O  O   . HOH GA 6 .   ? -21.672 -9.230  45.059  1.00 16.09  ? 337 HOH A O   1 
HETATM 9004 O  O   . HOH GA 6 .   ? -14.955 -5.736  40.665  1.00 26.09  ? 338 HOH A O   1 
HETATM 9005 O  O   . HOH GA 6 .   ? -25.323 -25.963 19.993  1.00 19.22  ? 339 HOH A O   1 
HETATM 9006 O  O   . HOH GA 6 .   ? -16.891 -28.425 24.985  1.00 28.01  ? 340 HOH A O   1 
HETATM 9007 O  O   . HOH GA 6 .   ? -31.416 -25.201 36.260  1.00 27.63  ? 341 HOH A O   1 
HETATM 9008 O  O   . HOH GA 6 .   ? -26.451 -2.241  42.971  1.00 24.40  ? 342 HOH A O   1 
HETATM 9009 O  O   . HOH GA 6 .   ? -33.087 -14.318 14.243  1.00 33.73  ? 343 HOH A O   1 
HETATM 9010 O  O   . HOH GA 6 .   ? -2.039  -10.127 16.136  1.00 25.06  ? 344 HOH A O   1 
HETATM 9011 O  O   . HOH GA 6 .   ? -25.960 -22.798 19.268  1.00 33.09  ? 345 HOH A O   1 
HETATM 9012 O  O   . HOH HA 6 .   ? 5.597   -31.505 17.584  1.00 25.92  ? 301 HOH B O   1 
HETATM 9013 O  O   . HOH HA 6 .   ? -4.799  -54.881 0.550   1.00 15.04  ? 302 HOH B O   1 
HETATM 9014 O  O   . HOH HA 6 .   ? 2.479   -53.378 18.438  1.00 26.54  ? 303 HOH B O   1 
HETATM 9015 O  O   . HOH HA 6 .   ? -0.243  -24.402 10.631  1.00 20.74  ? 304 HOH B O   1 
HETATM 9016 O  O   . HOH HA 6 .   ? 12.078  -39.661 21.213  1.00 27.10  ? 305 HOH B O   1 
HETATM 9017 O  O   . HOH HA 6 .   ? -6.923  -33.963 18.515  1.00 32.02  ? 306 HOH B O   1 
HETATM 9018 O  O   . HOH HA 6 .   ? -5.401  -24.533 14.506  1.00 12.98  ? 307 HOH B O   1 
HETATM 9019 O  O   . HOH HA 6 .   ? -7.537  -31.167 26.843  1.00 20.16  ? 308 HOH B O   1 
HETATM 9020 O  O   . HOH HA 6 .   ? 4.987   -24.294 18.055  1.00 13.54  ? 309 HOH B O   1 
HETATM 9021 O  O   . HOH HA 6 .   ? 9.086   -38.798 18.797  1.00 36.46  ? 310 HOH B O   1 
HETATM 9022 O  O   . HOH HA 6 .   ? -3.969  -25.387 17.112  1.00 19.90  ? 311 HOH B O   1 
HETATM 9023 O  O   . HOH HA 6 .   ? -2.272  -35.875 28.363  1.00 24.38  ? 312 HOH B O   1 
HETATM 9024 O  O   . HOH HA 6 .   ? -8.034  -51.206 5.146   1.00 19.13  ? 313 HOH B O   1 
HETATM 9025 O  O   . HOH HA 6 .   ? -8.461  -44.424 2.935   1.00 15.08  ? 314 HOH B O   1 
HETATM 9026 O  O   . HOH HA 6 .   ? 12.549  -21.914 7.120   1.00 34.69  ? 315 HOH B O   1 
HETATM 9027 O  O   . HOH HA 6 .   ? 8.058   -55.265 9.724   1.00 15.55  ? 316 HOH B O   1 
HETATM 9028 O  O   . HOH HA 6 .   ? 17.691  -41.791 7.809   1.00 15.79  ? 317 HOH B O   1 
HETATM 9029 O  O   . HOH HA 6 .   ? 16.623  -40.129 9.660   1.00 19.16  ? 318 HOH B O   1 
HETATM 9030 O  O   . HOH HA 6 .   ? 17.843  -41.286 5.141   1.00 18.42  ? 319 HOH B O   1 
HETATM 9031 O  O   . HOH HA 6 .   ? -4.041  -47.544 -0.847  1.00 17.07  ? 320 HOH B O   1 
HETATM 9032 O  O   . HOH HA 6 .   ? -4.188  -46.732 23.987  1.00 24.00  ? 321 HOH B O   1 
HETATM 9033 O  O   . HOH HA 6 .   ? 3.407   -20.982 10.933  1.00 21.99  ? 322 HOH B O   1 
HETATM 9034 O  O   . HOH HA 6 .   ? -9.602  -27.899 24.893  1.00 31.90  ? 323 HOH B O   1 
HETATM 9035 O  O   . HOH HA 6 .   ? -9.852  -49.125 2.273   1.00 16.51  ? 324 HOH B O   1 
HETATM 9036 O  O   . HOH HA 6 .   ? 15.596  -44.226 20.037  1.00 23.96  ? 325 HOH B O   1 
HETATM 9037 O  O   . HOH HA 6 .   ? -8.438  -51.296 10.346  1.00 21.33  ? 326 HOH B O   1 
HETATM 9038 O  O   . HOH HA 6 .   ? 0.310   -46.358 -2.731  1.00 17.62  ? 327 HOH B O   1 
HETATM 9039 O  O   . HOH HA 6 .   ? 0.119   -30.144 27.194  1.00 29.36  ? 328 HOH B O   1 
HETATM 9040 O  O   . HOH HA 6 .   ? 4.825   -41.449 1.947   1.00 21.00  ? 329 HOH B O   1 
HETATM 9041 O  O   . HOH HA 6 .   ? -2.133  -25.187 18.848  1.00 21.28  ? 330 HOH B O   1 
HETATM 9042 O  O   . HOH HA 6 .   ? -9.171  -40.139 20.203  1.00 39.51  ? 331 HOH B O   1 
HETATM 9043 O  O   . HOH HA 6 .   ? 6.771   -37.740 19.002  1.00 20.53  ? 332 HOH B O   1 
HETATM 9044 O  O   . HOH HA 6 .   ? 14.936  -55.437 25.012  1.00 31.87  ? 333 HOH B O   1 
HETATM 9045 O  O   . HOH HA 6 .   ? -9.004  -46.786 9.829   1.00 18.43  ? 334 HOH B O   1 
HETATM 9046 O  O   . HOH HA 6 .   ? -4.059  -41.047 -1.928  1.00 21.53  ? 335 HOH B O   1 
HETATM 9047 O  O   . HOH HA 6 .   ? 6.408   -24.295 27.531  1.00 38.14  ? 336 HOH B O   1 
HETATM 9048 O  O   . HOH HA 6 .   ? -7.972  -26.409 22.557  1.00 27.24  ? 337 HOH B O   1 
HETATM 9049 O  O   . HOH HA 6 .   ? -10.427 -43.409 -0.374  1.00 21.62  ? 338 HOH B O   1 
HETATM 9050 O  O   . HOH HA 6 .   ? 22.485  -44.771 20.347  1.00 31.57  ? 339 HOH B O   1 
HETATM 9051 O  O   . HOH HA 6 .   ? -10.192 -37.934 19.692  1.00 19.18  ? 340 HOH B O   1 
HETATM 9052 O  O   . HOH HA 6 .   ? -1.446  -23.524 27.981  1.00 21.75  ? 341 HOH B O   1 
HETATM 9053 O  O   . HOH HA 6 .   ? 14.349  -22.754 4.887   1.00 26.37  ? 342 HOH B O   1 
HETATM 9054 O  O   . HOH HA 6 .   ? -4.521  -54.769 3.201   1.00 22.12  ? 343 HOH B O   1 
HETATM 9055 O  O   . HOH HA 6 .   ? -7.744  -36.211 0.879   1.00 20.17  ? 344 HOH B O   1 
HETATM 9056 O  O   . HOH HA 6 .   ? -11.903 -46.964 9.483   1.00 20.46  ? 345 HOH B O   1 
HETATM 9057 O  O   . HOH HA 6 .   ? 9.212   -21.011 16.044  1.00 30.48  ? 346 HOH B O   1 
HETATM 9058 O  O   . HOH HA 6 .   ? 3.509   -30.814 0.226   1.00 28.74  ? 347 HOH B O   1 
HETATM 9059 O  O   . HOH HA 6 .   ? -9.136  -49.404 6.888   1.00 21.07  ? 348 HOH B O   1 
HETATM 9060 O  O   . HOH HA 6 .   ? -7.952  -49.053 8.984   1.00 25.05  ? 349 HOH B O   1 
HETATM 9061 O  O   . HOH IA 6 .   ? -38.887 -50.427 12.602  1.00 26.94  ? 301 HOH C O   1 
HETATM 9062 O  O   . HOH IA 6 .   ? -39.378 -29.334 3.024   1.00 28.07  ? 302 HOH C O   1 
HETATM 9063 O  O   . HOH IA 6 .   ? -32.346 -46.318 3.974   1.00 19.58  ? 303 HOH C O   1 
HETATM 9064 O  O   . HOH IA 6 .   ? -22.178 -29.324 27.100  1.00 22.54  ? 304 HOH C O   1 
HETATM 9065 O  O   . HOH IA 6 .   ? -27.555 -39.160 -3.281  1.00 27.43  ? 305 HOH C O   1 
HETATM 9066 O  O   . HOH IA 6 .   ? -27.279 -31.217 1.934   1.00 24.43  ? 306 HOH C O   1 
HETATM 9067 O  O   . HOH IA 6 .   ? -32.429 -46.902 -3.194  1.00 17.43  ? 307 HOH C O   1 
HETATM 9068 O  O   . HOH IA 6 .   ? -33.045 -48.293 10.448  1.00 27.70  ? 308 HOH C O   1 
HETATM 9069 O  O   . HOH IA 6 .   ? -45.044 -37.691 15.205  1.00 15.95  ? 309 HOH C O   1 
HETATM 9070 O  O   . HOH IA 6 .   ? -19.043 -33.959 23.355  1.00 20.01  ? 310 HOH C O   1 
HETATM 9071 O  O   . HOH IA 6 .   ? -23.450 -45.422 -2.505  1.00 12.12  ? 311 HOH C O   1 
HETATM 9072 O  O   . HOH IA 6 .   ? -17.156 -48.304 9.929   1.00 33.77  ? 312 HOH C O   1 
HETATM 9073 O  O   . HOH IA 6 .   ? -18.188 -39.092 23.466  1.00 25.29  ? 313 HOH C O   1 
HETATM 9074 O  O   . HOH IA 6 .   ? -18.750 -31.602 16.433  1.00 18.84  ? 314 HOH C O   1 
HETATM 9075 O  O   . HOH IA 6 .   ? -28.533 -47.453 25.854  1.00 18.77  ? 315 HOH C O   1 
HETATM 9076 O  O   . HOH IA 6 .   ? -43.778 -39.392 13.301  1.00 17.61  ? 316 HOH C O   1 
HETATM 9077 O  O   . HOH IA 6 .   ? -19.383 -55.085 2.800   1.00 16.94  ? 317 HOH C O   1 
HETATM 9078 O  O   . HOH IA 6 .   ? -22.199 -42.995 -3.303  1.00 18.43  ? 318 HOH C O   1 
HETATM 9079 O  O   . HOH IA 6 .   ? -27.626 -26.416 18.843  1.00 23.03  ? 319 HOH C O   1 
HETATM 9080 O  O   . HOH IA 6 .   ? -33.875 -30.115 -0.888  1.00 32.01  ? 320 HOH C O   1 
HETATM 9081 O  O   . HOH IA 6 .   ? -35.566 -48.088 11.329  1.00 27.35  ? 321 HOH C O   1 
HETATM 9082 O  O   . HOH IA 6 .   ? -20.389 -47.052 5.714   1.00 25.03  ? 322 HOH C O   1 
HETATM 9083 O  O   . HOH IA 6 .   ? -21.384 -58.377 -3.096  1.00 16.97  ? 323 HOH C O   1 
HETATM 9084 O  O   . HOH IA 6 .   ? -28.306 -47.324 14.599  1.00 25.15  ? 324 HOH C O   1 
HETATM 9085 O  O   . HOH IA 6 .   ? -41.839 -49.848 17.464  1.00 10.28  ? 325 HOH C O   1 
HETATM 9086 O  O   . HOH IA 6 .   ? -47.668 -56.310 17.678  1.00 30.69  ? 326 HOH C O   1 
HETATM 9087 O  O   . HOH IA 6 .   ? -21.860 -52.822 18.806  1.00 17.63  ? 327 HOH C O   1 
HETATM 9088 O  O   . HOH IA 6 .   ? -23.139 -27.960 19.918  1.00 8.95   ? 328 HOH C O   1 
HETATM 9089 O  O   . HOH IA 6 .   ? -34.587 -39.085 28.009  1.00 13.11  ? 329 HOH C O   1 
HETATM 9090 O  O   . HOH IA 6 .   ? -25.318 -47.292 -2.677  1.00 18.00  ? 330 HOH C O   1 
HETATM 9091 O  O   . HOH IA 6 .   ? -26.949 -56.069 1.995   1.00 33.79  ? 331 HOH C O   1 
HETATM 9092 O  O   . HOH IA 6 .   ? -17.580 -38.535 18.759  1.00 16.68  ? 332 HOH C O   1 
HETATM 9093 O  O   . HOH IA 6 .   ? -50.613 -47.486 20.541  1.00 23.39  ? 333 HOH C O   1 
HETATM 9094 O  O   . HOH IA 6 .   ? -16.800 -28.358 15.666  1.00 26.28  ? 334 HOH C O   1 
HETATM 9095 O  O   . HOH IA 6 .   ? -44.067 -25.222 12.331  1.00 40.12  ? 335 HOH C O   1 
HETATM 9096 O  O   . HOH IA 6 .   ? -45.105 -41.059 6.199   1.00 31.90  ? 336 HOH C O   1 
HETATM 9097 O  O   . HOH IA 6 .   ? -44.260 -47.907 27.135  1.00 25.78  ? 337 HOH C O   1 
HETATM 9098 O  O   . HOH IA 6 .   ? -25.814 -56.390 -4.716  1.00 26.63  ? 338 HOH C O   1 
HETATM 9099 O  O   . HOH IA 6 .   ? -22.470 -32.090 27.021  1.00 12.17  ? 339 HOH C O   1 
HETATM 9100 O  O   . HOH IA 6 .   ? -17.160 -52.946 -0.231  1.00 22.22  ? 340 HOH C O   1 
HETATM 9101 O  O   . HOH IA 6 .   ? -44.545 -56.526 13.999  1.00 26.56  ? 341 HOH C O   1 
HETATM 9102 O  O   . HOH IA 6 .   ? -23.603 -26.768 13.376  1.00 21.83  ? 342 HOH C O   1 
HETATM 9103 O  O   . HOH IA 6 .   ? -19.235 -46.903 32.053  1.00 31.24  ? 343 HOH C O   1 
HETATM 9104 O  O   . HOH IA 6 .   ? -15.280 -38.078 18.620  1.00 26.79  ? 344 HOH C O   1 
HETATM 9105 O  O   . HOH IA 6 .   ? -32.022 -52.963 -0.437  1.00 30.35  ? 345 HOH C O   1 
HETATM 9106 O  O   . HOH IA 6 .   ? -45.520 -51.424 27.517  1.00 31.23  ? 346 HOH C O   1 
HETATM 9107 O  O   . HOH IA 6 .   ? -33.859 -50.721 -1.053  1.00 33.93  ? 347 HOH C O   1 
HETATM 9108 O  O   . HOH IA 6 .   ? -46.854 -27.541 14.048  1.00 23.90  ? 348 HOH C O   1 
HETATM 9109 O  O   . HOH IA 6 .   ? -39.197 -31.518 22.510  1.00 33.17  ? 349 HOH C O   1 
HETATM 9110 O  O   . HOH IA 6 .   ? -17.800 -35.758 21.817  1.00 18.12  ? 350 HOH C O   1 
HETATM 9111 O  O   . HOH IA 6 .   ? -18.887 -38.012 21.154  1.00 20.87  ? 351 HOH C O   1 
HETATM 9112 O  O   . HOH JA 6 .   ? 0.237   -45.930 -28.890 1.00 28.07  ? 301 HOH D O   1 
HETATM 9113 O  O   . HOH JA 6 .   ? -13.561 -56.134 -25.579 1.00 19.24  ? 302 HOH D O   1 
HETATM 9114 O  O   . HOH JA 6 .   ? -23.453 -63.032 -12.323 1.00 29.69  ? 303 HOH D O   1 
HETATM 9115 O  O   . HOH JA 6 .   ? 3.507   -50.759 -3.271  1.00 16.48  ? 304 HOH D O   1 
HETATM 9116 O  O   . HOH JA 6 .   ? -17.475 -59.510 -3.996  1.00 16.64  ? 305 HOH D O   1 
HETATM 9117 O  O   . HOH JA 6 .   ? -7.642  -42.654 -13.527 1.00 15.20  ? 306 HOH D O   1 
HETATM 9118 O  O   . HOH JA 6 .   ? -3.990  -46.788 -7.484  1.00 26.77  ? 307 HOH D O   1 
HETATM 9119 O  O   . HOH JA 6 .   ? -16.391 -52.780 -18.403 1.00 23.28  ? 308 HOH D O   1 
HETATM 9120 O  O   . HOH JA 6 .   ? -18.299 -59.908 -38.215 1.00 26.94  ? 309 HOH D O   1 
HETATM 9121 O  O   . HOH JA 6 .   ? -12.266 -55.726 -32.590 1.00 19.42  ? 310 HOH D O   1 
HETATM 9122 O  O   . HOH JA 6 .   ? 0.943   -67.790 -10.268 1.00 18.70  ? 311 HOH D O   1 
HETATM 9123 O  O   . HOH JA 6 .   ? -14.543 -71.240 -19.764 1.00 29.38  ? 312 HOH D O   1 
HETATM 9124 O  O   . HOH JA 6 .   ? -2.616  -68.139 -4.061  1.00 15.10  ? 313 HOH D O   1 
HETATM 9125 O  O   . HOH JA 6 .   ? -21.421 -69.236 -27.480 1.00 51.00  ? 314 HOH D O   1 
HETATM 9126 O  O   . HOH JA 6 .   ? 0.103   -54.721 -12.619 1.00 25.77  ? 315 HOH D O   1 
HETATM 9127 O  O   . HOH JA 6 .   ? -15.473 -60.060 -15.052 1.00 32.24  ? 316 HOH D O   1 
HETATM 9128 O  O   . HOH JA 6 .   ? 8.146   -56.292 -3.304  1.00 31.41  ? 317 HOH D O   1 
HETATM 9129 O  O   . HOH JA 6 .   ? -10.628 -64.878 -31.908 1.00 22.42  ? 318 HOH D O   1 
HETATM 9130 O  O   . HOH JA 6 .   ? -3.557  -57.071 0.047   1.00 20.60  ? 319 HOH D O   1 
HETATM 9131 O  O   . HOH JA 6 .   ? -20.620 -66.528 -12.010 1.00 19.08  ? 320 HOH D O   1 
HETATM 9132 O  O   . HOH JA 6 .   ? -19.807 -49.664 -17.543 1.00 38.95  ? 321 HOH D O   1 
HETATM 9133 O  O   . HOH JA 6 .   ? -19.618 -46.629 -12.772 1.00 24.89  ? 322 HOH D O   1 
HETATM 9134 O  O   . HOH JA 6 .   ? 4.997   -62.461 -12.703 1.00 22.58  ? 323 HOH D O   1 
HETATM 9135 O  O   . HOH JA 6 .   ? 3.146   -62.975 -6.538  1.00 17.30  ? 324 HOH D O   1 
HETATM 9136 O  O   . HOH JA 6 .   ? 4.112   -69.124 -10.322 1.00 22.09  ? 325 HOH D O   1 
HETATM 9137 O  O   . HOH JA 6 .   ? -8.838  -43.877 -15.427 1.00 20.16  ? 326 HOH D O   1 
HETATM 9138 O  O   . HOH JA 6 .   ? -12.828 -68.294 -23.416 1.00 40.66  ? 327 HOH D O   1 
HETATM 9139 O  O   . HOH JA 6 .   ? 4.815   -66.782 -13.869 1.00 25.39  ? 328 HOH D O   1 
HETATM 9140 O  O   . HOH JA 6 .   ? -7.745  -69.010 -5.009  1.00 23.55  ? 329 HOH D O   1 
HETATM 9141 O  O   . HOH JA 6 .   ? -16.236 -54.904 -19.605 1.00 30.59  ? 330 HOH D O   1 
HETATM 9142 O  O   . HOH JA 6 .   ? -5.881  -72.580 -9.642  1.00 17.93  ? 331 HOH D O   1 
HETATM 9143 O  O   . HOH JA 6 .   ? -6.352  -69.946 -9.469  1.00 26.48  ? 332 HOH D O   1 
HETATM 9144 O  O   . HOH JA 6 .   ? -2.166  -47.729 -3.104  1.00 16.89  ? 333 HOH D O   1 
HETATM 9145 O  O   . HOH JA 6 .   ? -25.492 -59.693 -10.150 1.00 20.52  ? 334 HOH D O   1 
HETATM 9146 O  O   . HOH JA 6 .   ? -5.272  -72.119 -20.027 1.00 24.91  ? 335 HOH D O   1 
HETATM 9147 O  O   . HOH JA 6 .   ? -10.164 -52.794 -0.381  1.00 19.12  ? 336 HOH D O   1 
HETATM 9148 O  O   . HOH JA 6 .   ? -20.527 -39.258 -12.350 1.00 29.80  ? 337 HOH D O   1 
HETATM 9149 O  O   . HOH JA 6 .   ? 1.050   -69.277 -6.002  1.00 16.31  ? 338 HOH D O   1 
HETATM 9150 O  O   . HOH JA 6 .   ? -16.851 -71.667 -0.187  1.00 41.66  ? 339 HOH D O   1 
HETATM 9151 O  O   . HOH JA 6 .   ? -25.864 -43.980 -17.461 1.00 27.28  ? 340 HOH D O   1 
HETATM 9152 O  O   . HOH KA 6 .   ? 20.074  -34.330 -25.683 1.00 21.24  ? 301 HOH E O   1 
HETATM 9153 O  O   . HOH KA 6 .   ? 3.938   -10.518 -54.491 1.00 22.79  ? 302 HOH E O   1 
HETATM 9154 O  O   . HOH KA 6 .   ? 13.984  -24.612 -27.933 1.00 25.19  ? 303 HOH E O   1 
HETATM 9155 O  O   . HOH KA 6 .   ? 10.733  -49.943 -58.342 1.00 24.69  ? 304 HOH E O   1 
HETATM 9156 O  O   . HOH KA 6 .   ? 20.814  -25.556 -27.409 1.00 28.78  ? 305 HOH E O   1 
HETATM 9157 O  O   . HOH KA 6 .   ? -11.568 -29.565 -45.059 1.00 20.38  ? 306 HOH E O   1 
HETATM 9158 O  O   . HOH KA 6 .   ? 11.410  -19.654 -30.997 1.00 10.95  ? 307 HOH E O   1 
HETATM 9159 O  O   . HOH KA 6 .   ? -8.845  -30.335 -28.252 1.00 27.76  ? 308 HOH E O   1 
HETATM 9160 O  O   . HOH KA 6 .   ? 7.342   -18.717 -28.509 1.00 25.04  ? 309 HOH E O   1 
HETATM 9161 O  O   . HOH KA 6 .   ? 3.975   -44.874 -35.467 1.00 20.14  ? 310 HOH E O   1 
HETATM 9162 O  O   . HOH KA 6 .   ? 1.149   -33.129 -46.591 1.00 20.48  ? 311 HOH E O   1 
HETATM 9163 O  O   . HOH KA 6 .   ? 3.552   -44.879 -32.660 1.00 19.04  ? 312 HOH E O   1 
HETATM 9164 O  O   . HOH KA 6 .   ? 2.139   -43.463 -37.124 1.00 20.47  ? 313 HOH E O   1 
HETATM 9165 O  O   . HOH KA 6 .   ? 11.785  -24.093 -52.190 1.00 25.31  ? 314 HOH E O   1 
HETATM 9166 O  O   . HOH KA 6 .   ? 6.111   -43.216 -47.867 1.00 21.15  ? 315 HOH E O   1 
HETATM 9167 O  O   . HOH KA 6 .   ? 8.134   -23.841 -26.308 1.00 22.14  ? 316 HOH E O   1 
HETATM 9168 O  O   . HOH KA 6 .   ? 4.992   -24.857 -27.497 1.00 26.16  ? 317 HOH E O   1 
HETATM 9169 O  O   . HOH KA 6 .   ? 13.362  -19.534 -37.924 1.00 22.98  ? 318 HOH E O   1 
HETATM 9170 O  O   . HOH KA 6 .   ? 4.254   -15.070 -37.824 1.00 28.77  ? 319 HOH E O   1 
HETATM 9171 O  O   . HOH KA 6 .   ? 5.682   -32.508 -30.176 1.00 24.40  ? 320 HOH E O   1 
HETATM 9172 O  O   . HOH KA 6 .   ? -1.449  -44.364 -32.733 1.00 20.29  ? 321 HOH E O   1 
HETATM 9173 O  O   . HOH KA 6 .   ? 1.750   -35.550 -46.800 1.00 29.35  ? 322 HOH E O   1 
HETATM 9174 O  O   . HOH KA 6 .   ? 15.189  -47.312 -46.472 1.00 29.98  ? 323 HOH E O   1 
HETATM 9175 O  O   . HOH KA 6 .   ? 11.502  -27.927 -25.497 1.00 22.71  ? 324 HOH E O   1 
HETATM 9176 O  O   . HOH KA 6 .   ? 7.337   -28.096 -47.036 1.00 26.32  ? 325 HOH E O   1 
HETATM 9177 O  O   . HOH KA 6 .   ? -14.467 -30.196 -52.071 1.00 38.70  ? 326 HOH E O   1 
HETATM 9178 O  O   . HOH KA 6 .   ? 3.410   -19.042 -28.604 1.00 25.02  ? 327 HOH E O   1 
HETATM 9179 O  O   . HOH KA 6 .   ? 11.813  -33.877 -23.059 1.00 25.39  ? 328 HOH E O   1 
HETATM 9180 O  O   . HOH KA 6 .   ? 6.229   -9.676  -53.610 1.00 19.41  ? 329 HOH E O   1 
HETATM 9181 O  O   . HOH LA 6 .   ? 21.999  -72.610 -0.540  1.00 22.32  ? 301 HOH F O   1 
HETATM 9182 O  O   . HOH LA 6 .   ? 22.938  -81.778 19.026  1.00 30.83  ? 302 HOH F O   1 
HETATM 9183 O  O   . HOH LA 6 .   ? 29.920  -51.426 -12.979 1.00 30.28  ? 303 HOH F O   1 
HETATM 9184 O  O   . HOH LA 6 .   ? 16.417  -59.384 -12.189 1.00 33.98  ? 304 HOH F O   1 
HETATM 9185 O  O   . HOH LA 6 .   ? 18.963  -73.091 -22.427 1.00 31.28  ? 305 HOH F O   1 
HETATM 9186 O  O   . HOH LA 6 .   ? 13.509  -54.906 4.572   1.00 27.58  ? 306 HOH F O   1 
HETATM 9187 O  O   . HOH LA 6 .   ? 11.440  -64.223 -10.312 1.00 19.37  ? 307 HOH F O   1 
HETATM 9188 O  O   . HOH LA 6 .   ? 21.889  -51.123 -10.518 1.00 23.71  ? 308 HOH F O   1 
HETATM 9189 O  O   . HOH LA 6 .   ? 15.831  -58.169 9.617   1.00 13.34  ? 309 HOH F O   1 
HETATM 9190 O  O   . HOH LA 6 .   ? 25.458  -74.373 -3.563  1.00 22.77  ? 310 HOH F O   1 
HETATM 9191 O  O   . HOH LA 6 .   ? 9.268   -60.632 8.101   1.00 18.38  ? 311 HOH F O   1 
HETATM 9192 O  O   . HOH LA 6 .   ? 22.992  -63.065 -15.660 1.00 14.05  ? 312 HOH F O   1 
HETATM 9193 O  O   . HOH LA 6 .   ? 20.719  -75.626 -13.767 1.00 26.65  ? 313 HOH F O   1 
HETATM 9194 O  O   . HOH LA 6 .   ? 24.462  -64.777 -14.284 1.00 19.50  ? 314 HOH F O   1 
HETATM 9195 O  O   . HOH LA 6 .   ? 38.747  -72.218 -0.411  1.00 12.01  ? 315 HOH F O   1 
HETATM 9196 O  O   . HOH LA 6 .   ? 22.130  -54.793 4.451   1.00 21.08  ? 316 HOH F O   1 
HETATM 9197 O  O   . HOH LA 6 .   ? 25.078  -74.094 -5.951  1.00 27.68  ? 317 HOH F O   1 
HETATM 9198 O  O   . HOH LA 6 .   ? 23.439  -60.337 -15.569 1.00 21.22  ? 318 HOH F O   1 
HETATM 9199 O  O   . HOH LA 6 .   ? 14.863  -79.219 5.516   1.00 29.61  ? 319 HOH F O   1 
HETATM 9200 O  O   . HOH LA 6 .   ? 11.760  -70.187 14.958  1.00 32.97  ? 320 HOH F O   1 
HETATM 9201 O  O   . HOH LA 6 .   ? 21.924  -75.855 -20.772 1.00 25.00  ? 321 HOH F O   1 
HETATM 9202 O  O   . HOH LA 6 .   ? 32.094  -57.084 4.778   1.00 18.28  ? 322 HOH F O   1 
HETATM 9203 O  O   . HOH LA 6 .   ? 9.339   -73.931 -2.657  1.00 21.50  ? 323 HOH F O   1 
HETATM 9204 O  O   . HOH LA 6 .   ? 36.088  -55.470 -1.105  1.00 22.05  ? 324 HOH F O   1 
HETATM 9205 O  O   . HOH LA 6 .   ? 36.849  -71.577 8.892   1.00 24.91  ? 325 HOH F O   1 
HETATM 9206 O  O   . HOH LA 6 .   ? 19.823  -74.215 1.153   1.00 32.11  ? 326 HOH F O   1 
HETATM 9207 O  O   . HOH LA 6 .   ? 31.523  -66.864 -14.154 1.00 22.32  ? 327 HOH F O   1 
HETATM 9208 O  O   . HOH LA 6 .   ? 19.344  -67.666 14.707  1.00 32.52  ? 328 HOH F O   1 
HETATM 9209 O  O   . HOH LA 6 .   ? 11.565  -74.072 -17.582 1.00 35.77  ? 329 HOH F O   1 
HETATM 9210 O  O   . HOH LA 6 .   ? 13.651  -65.063 9.831   1.00 18.77  ? 330 HOH F O   1 
HETATM 9211 O  O   . HOH LA 6 .   ? 20.844  -80.915 19.770  1.00 17.85  ? 331 HOH F O   1 
HETATM 9212 O  O   . HOH LA 6 .   ? 12.505  -77.052 -19.958 1.00 26.99  ? 332 HOH F O   1 
HETATM 9213 O  O   . HOH LA 6 .   ? 19.495  -53.281 5.297   1.00 28.36  ? 333 HOH F O   1 
HETATM 9214 O  O   . HOH LA 6 .   ? 23.642  -55.731 10.130  1.00 22.45  ? 334 HOH F O   1 
HETATM 9215 O  O   . HOH LA 6 .   ? 15.067  -62.985 -17.607 1.00 21.11  ? 335 HOH F O   1 
HETATM 9216 O  O   . HOH LA 6 .   ? 16.205  -81.777 13.432  1.00 26.08  ? 336 HOH F O   1 
HETATM 9217 O  O   . HOH LA 6 .   ? 25.408  -81.835 -16.635 1.00 26.76  ? 337 HOH F O   1 
HETATM 9218 O  O   . HOH LA 6 .   ? 11.755  -64.862 8.051   1.00 22.17  ? 338 HOH F O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . ASP A  4   ? 0.8461 0.8527 1.4218 -0.3309 0.0626  -0.2054 2   ASP A N   
2    C  CA  . ASP A  4   ? 0.8913 0.8511 1.4541 -0.3539 0.0902  -0.2044 2   ASP A CA  
3    C  C   . ASP A  4   ? 0.9395 0.8485 1.4397 -0.3506 0.1213  -0.1762 2   ASP A C   
4    O  O   . ASP A  4   ? 0.9412 0.8499 1.4525 -0.3583 0.1510  -0.1700 2   ASP A O   
5    C  CB  . ASP A  4   ? 0.8842 0.8665 1.5217 -0.3835 0.1115  -0.2282 2   ASP A CB  
6    C  CG  . ASP A  4   ? 0.8804 0.8678 1.5523 -0.3986 0.0945  -0.2535 2   ASP A CG  
7    O  OD1 . ASP A  4   ? 0.8449 0.8373 1.4978 -0.3822 0.0579  -0.2575 2   ASP A OD1 
8    O  OD2 . ASP A  4   ? 0.8369 0.8222 1.5546 -0.4271 0.1184  -0.2699 2   ASP A OD2 
9    N  N   . SER A  5   ? 0.9518 0.8174 1.3856 -0.3382 0.1140  -0.1601 3   SER A N   
10   C  CA  . SER A  5   ? 0.9721 0.7897 1.3401 -0.3295 0.1368  -0.1337 3   SER A CA  
11   C  C   . SER A  5   ? 1.0309 0.7965 1.3374 -0.3234 0.1324  -0.1231 3   SER A C   
12   O  O   . SER A  5   ? 0.9908 0.7555 1.3033 -0.3262 0.1122  -0.1352 3   SER A O   
13   C  CB  . SER A  5   ? 0.8940 0.7313 1.2388 -0.3048 0.1257  -0.1182 3   SER A CB  
14   O  OG  . SER A  5   ? 0.8336 0.6895 1.1645 -0.2847 0.0888  -0.1188 3   SER A OG  
15   N  N   . THR A  6   ? 1.0687 0.7899 1.3152 -0.3142 0.1516  -0.1010 4   THR A N   
16   C  CA  . THR A  6   ? 1.0386 0.7214 1.2187 -0.2960 0.1395  -0.0861 4   THR A CA  
17   C  C   . THR A  6   ? 1.0011 0.6841 1.1405 -0.2722 0.1370  -0.0663 4   THR A C   
18   O  O   . THR A  6   ? 1.0721 0.7680 1.2238 -0.2730 0.1531  -0.0615 4   THR A O   
19   C  CB  . THR A  6   ? 1.0660 0.6854 1.2062 -0.3074 0.1656  -0.0801 4   THR A CB  
20   O  OG1 . THR A  6   ? 1.0222 0.6421 1.2060 -0.3331 0.1718  -0.1002 4   THR A OG1 
21   C  CG2 . THR A  6   ? 1.0413 0.6242 1.1170 -0.2878 0.1502  -0.0675 4   THR A CG2 
22   N  N   . SER A  7   ? 0.9204 0.5913 1.0144 -0.2511 0.1164  -0.0561 5   SER A N   
23   C  CA  . SER A  7   ? 0.8425 0.5065 0.8937 -0.2295 0.1159  -0.0379 5   SER A CA  
24   C  C   . SER A  7   ? 0.7889 0.4319 0.7902 -0.2097 0.0967  -0.0290 5   SER A C   
25   O  O   . SER A  7   ? 0.7702 0.4144 0.7750 -0.2100 0.0784  -0.0374 5   SER A O   
26   C  CB  . SER A  7   ? 0.8127 0.5282 0.8971 -0.2216 0.1033  -0.0401 5   SER A CB  
27   O  OG  . SER A  7   ? 0.8067 0.5560 0.9132 -0.2150 0.0726  -0.0505 5   SER A OG  
28   N  N   . ASP A  8   ? 0.7217 0.3450 0.6770 -0.1922 0.1013  -0.0130 6   ASP A N   
29   C  CA  . ASP A  8   ? 0.6930 0.2949 0.6002 -0.1726 0.0868  -0.0043 6   ASP A CA  
30   C  C   . ASP A  8   ? 0.6269 0.2514 0.5213 -0.1525 0.0754  0.0045  6   ASP A C   
31   O  O   . ASP A  8   ? 0.6181 0.2431 0.5073 -0.1498 0.0889  0.0115  6   ASP A O   
32   C  CB  . ASP A  8   ? 0.7535 0.2972 0.6090 -0.1705 0.1063  0.0055  6   ASP A CB  
33   C  CG  . ASP A  8   ? 0.8132 0.3270 0.6683 -0.1857 0.1120  -0.0023 6   ASP A CG  
34   O  OD1 . ASP A  8   ? 0.8689 0.3357 0.6755 -0.1784 0.1180  0.0048  6   ASP A OD1 
35   O  OD2 . ASP A  8   ? 0.8112 0.3482 0.7149 -0.2046 0.1101  -0.0167 6   ASP A OD2 
36   N  N   . LEU A  9   ? 0.5834 0.2246 0.4717 -0.1385 0.0516  0.0037  7   LEU A N   
37   C  CA  . LEU A  9   ? 0.5375 0.2051 0.4219 -0.1219 0.0399  0.0093  7   LEU A CA  
38   C  C   . LEU A  9   ? 0.5346 0.1872 0.3790 -0.1026 0.0276  0.0159  7   LEU A C   
39   O  O   . LEU A  9   ? 0.5564 0.1967 0.3906 -0.1010 0.0177  0.0124  7   LEU A O   
40   C  CB  . LEU A  9   ? 0.4960 0.2091 0.4233 -0.1244 0.0231  -0.0003 7   LEU A CB  
41   C  CG  . LEU A  9   ? 0.4876 0.2263 0.4603 -0.1397 0.0323  -0.0078 7   LEU A CG  
42   C  CD1 . LEU A  9   ? 0.4541 0.2341 0.4629 -0.1380 0.0119  -0.0182 7   LEU A CD1 
43   C  CD2 . LEU A  9   ? 0.4918 0.2320 0.4586 -0.1368 0.0486  0.0010  7   LEU A CD2 
44   N  N   . ILE A  10  ? 0.5172 0.1730 0.3413 -0.0877 0.0276  0.0241  8   ILE A N   
45   C  CA  . ILE A  10  ? 0.4998 0.1550 0.2982 -0.0690 0.0133  0.0276  8   ILE A CA  
46   C  C   . ILE A  10  ? 0.4614 0.1494 0.2847 -0.0671 -0.0052 0.0208  8   ILE A C   
47   O  O   . ILE A  10  ? 0.4347 0.1535 0.2889 -0.0719 -0.0084 0.0171  8   ILE A O   
48   C  CB  . ILE A  10  ? 0.4916 0.1499 0.2708 -0.0544 0.0157  0.0350  8   ILE A CB  
49   C  CG1 . ILE A  10  ? 0.5363 0.1535 0.2788 -0.0513 0.0323  0.0422  8   ILE A CG1 
50   C  CG2 . ILE A  10  ? 0.4699 0.1384 0.2351 -0.0367 0.0000  0.0355  8   ILE A CG2 
51   C  CD1 . ILE A  10  ? 0.5430 0.1634 0.2737 -0.0422 0.0387  0.0479  8   ILE A CD1 
52   N  N   . PRO A  11  ? 0.4661 0.1446 0.2737 -0.0592 -0.0167 0.0191  9   PRO A N   
53   C  CA  . PRO A  11  ? 0.4441 0.1459 0.2686 -0.0565 -0.0329 0.0129  9   PRO A CA  
54   C  C   . PRO A  11  ? 0.4154 0.1465 0.2483 -0.0463 -0.0387 0.0148  9   PRO A C   
55   O  O   . PRO A  11  ? 0.4215 0.1512 0.2380 -0.0361 -0.0351 0.0207  9   PRO A O   
56   C  CB  . PRO A  11  ? 0.4601 0.1385 0.2562 -0.0471 -0.0400 0.0131  9   PRO A CB  
57   C  CG  . PRO A  11  ? 0.4950 0.1364 0.2665 -0.0506 -0.0278 0.0169  9   PRO A CG  
58   C  CD  . PRO A  11  ? 0.4998 0.1413 0.2701 -0.0520 -0.0140 0.0229  9   PRO A CD  
59   N  N   . ALA A  12  ? 0.3931 0.1490 0.2500 -0.0484 -0.0480 0.0092  10  ALA A N   
60   C  CA  . ALA A  12  ? 0.3823 0.1614 0.2438 -0.0387 -0.0531 0.0106  10  ALA A CA  
61   C  C   . ALA A  12  ? 0.3943 0.1652 0.2320 -0.0248 -0.0583 0.0129  10  ALA A C   
62   O  O   . ALA A  12  ? 0.4309 0.1853 0.2553 -0.0224 -0.0637 0.0107  10  ALA A O   
63   C  CB  . ALA A  12  ? 0.3640 0.1642 0.2493 -0.0416 -0.0626 0.0037  10  ALA A CB  
64   N  N   . PRO A  13  ? 0.3892 0.1719 0.2228 -0.0157 -0.0562 0.0163  11  PRO A N   
65   C  CA  . PRO A  13  ? 0.3959 0.1761 0.2139 -0.0030 -0.0605 0.0164  11  PRO A CA  
66   C  C   . PRO A  13  ? 0.4180 0.2056 0.2412 -0.0005 -0.0682 0.0122  11  PRO A C   
67   O  O   . PRO A  13  ? 0.4118 0.2126 0.2516 -0.0056 -0.0708 0.0097  11  PRO A O   
68   C  CB  . PRO A  13  ? 0.3807 0.1773 0.2019 0.0031  -0.0564 0.0185  11  PRO A CB  
69   C  CG  . PRO A  13  ? 0.3675 0.1816 0.2100 -0.0054 -0.0536 0.0184  11  PRO A CG  
70   C  CD  . PRO A  13  ? 0.3694 0.1729 0.2184 -0.0171 -0.0515 0.0179  11  PRO A CD  
71   N  N   . PRO A  14  ? 0.4415 0.2191 0.2487 0.0087  -0.0713 0.0113  12  PRO A N   
72   C  CA  . PRO A  14  ? 0.4228 0.2057 0.2304 0.0137  -0.0755 0.0083  12  PRO A CA  
73   C  C   . PRO A  14  ? 0.4148 0.2193 0.2351 0.0160  -0.0711 0.0087  12  PRO A C   
74   O  O   . PRO A  14  ? 0.3964 0.2108 0.2203 0.0184  -0.0657 0.0104  12  PRO A O   
75   C  CB  . PRO A  14  ? 0.4365 0.2046 0.2241 0.0240  -0.0760 0.0081  12  PRO A CB  
76   C  CG  . PRO A  14  ? 0.4499 0.2145 0.2306 0.0275  -0.0718 0.0109  12  PRO A CG  
77   C  CD  . PRO A  14  ? 0.4497 0.2118 0.2367 0.0172  -0.0697 0.0132  12  PRO A CD  
78   N  N   . LEU A  15  ? 0.4190 0.2282 0.2436 0.0164  -0.0737 0.0065  13  LEU A N   
79   C  CA  . LEU A  15  ? 0.4088 0.2344 0.2434 0.0178  -0.0685 0.0067  13  LEU A CA  
80   C  C   . LEU A  15  ? 0.4111 0.2408 0.2418 0.0250  -0.0611 0.0064  13  LEU A C   
81   O  O   . LEU A  15  ? 0.4123 0.2568 0.2538 0.0245  -0.0549 0.0062  13  LEU A O   
82   C  CB  . LEU A  15  ? 0.4108 0.2339 0.2438 0.0193  -0.0731 0.0043  13  LEU A CB  
83   C  CG  . LEU A  15  ? 0.4301 0.2578 0.2760 0.0120  -0.0807 0.0022  13  LEU A CG  
84   C  CD1 . LEU A  15  ? 0.4680 0.2937 0.3106 0.0169  -0.0875 -0.0014 13  LEU A CD1 
85   C  CD2 . LEU A  15  ? 0.4248 0.2701 0.2896 0.0047  -0.0751 0.0046  13  LEU A CD2 
86   N  N   . SER A  16  ? 0.4131 0.2305 0.2304 0.0313  -0.0614 0.0055  14  SER A N   
87   C  CA  . SER A  16  ? 0.4052 0.2288 0.2230 0.0381  -0.0541 0.0034  14  SER A CA  
88   C  C   . SER A  16  ? 0.4170 0.2563 0.2463 0.0381  -0.0522 0.0030  14  SER A C   
89   O  O   . SER A  16  ? 0.4574 0.3097 0.2955 0.0422  -0.0466 -0.0007 14  SER A O   
90   C  CB  . SER A  16  ? 0.4194 0.2261 0.2202 0.0459  -0.0554 0.0023  14  SER A CB  
91   O  OG  . SER A  16  ? 0.4250 0.2239 0.2187 0.0469  -0.0605 0.0036  14  SER A OG  
92   N  N   . LYS A  17  ? 0.4039 0.2412 0.2329 0.0337  -0.0563 0.0060  15  LYS A N   
93   C  CA  . LYS A  17  ? 0.4132 0.2608 0.2471 0.0358  -0.0552 0.0057  15  LYS A CA  
94   C  C   . LYS A  17  ? 0.3874 0.2513 0.2364 0.0297  -0.0520 0.0062  15  LYS A C   
95   O  O   . LYS A  17  ? 0.3886 0.2598 0.2402 0.0313  -0.0517 0.0059  15  LYS A O   
96   C  CB  . LYS A  17  ? 0.4807 0.3115 0.3000 0.0362  -0.0588 0.0091  15  LYS A CB  
97   C  CG  . LYS A  17  ? 0.5172 0.3328 0.3193 0.0457  -0.0616 0.0079  15  LYS A CG  
98   C  CD  . LYS A  17  ? 0.6057 0.4048 0.3910 0.0489  -0.0632 0.0110  15  LYS A CD  
99   C  CE  . LYS A  17  ? 0.6596 0.4322 0.4239 0.0514  -0.0658 0.0125  15  LYS A CE  
100  N  NZ  . LYS A  17  ? 0.6898 0.4453 0.4324 0.0615  -0.0668 0.0139  15  LYS A NZ  
101  N  N   . VAL A  18  ? 0.3603 0.2278 0.2166 0.0241  -0.0503 0.0068  16  VAL A N   
102  C  CA  . VAL A  18  ? 0.3224 0.2034 0.1916 0.0188  -0.0470 0.0074  16  VAL A CA  
103  C  C   . VAL A  18  ? 0.3023 0.1930 0.1793 0.0200  -0.0409 0.0040  16  VAL A C   
104  O  O   . VAL A  18  ? 0.2886 0.1729 0.1619 0.0196  -0.0398 0.0043  16  VAL A O   
105  C  CB  . VAL A  18  ? 0.3092 0.1864 0.1813 0.0117  -0.0498 0.0104  16  VAL A CB  
106  C  CG1 . VAL A  18  ? 0.2981 0.1890 0.1829 0.0074  -0.0460 0.0112  16  VAL A CG1 
107  C  CG2 . VAL A  18  ? 0.3290 0.1939 0.1948 0.0084  -0.0533 0.0128  16  VAL A CG2 
108  N  N   . PRO A  19  ? 0.3099 0.2144 0.1963 0.0218  -0.0368 0.0000  17  PRO A N   
109  C  CA  . PRO A  19  ? 0.3191 0.2315 0.2144 0.0212  -0.0285 -0.0043 17  PRO A CA  
110  C  C   . PRO A  19  ? 0.3209 0.2327 0.2181 0.0162  -0.0251 -0.0016 17  PRO A C   
111  O  O   . PRO A  19  ? 0.2931 0.2060 0.1911 0.0128  -0.0291 0.0021  17  PRO A O   
112  C  CB  . PRO A  19  ? 0.3167 0.2464 0.2254 0.0227  -0.0272 -0.0104 17  PRO A CB  
113  C  CG  . PRO A  19  ? 0.3297 0.2570 0.2311 0.0285  -0.0354 -0.0100 17  PRO A CG  
114  C  CD  . PRO A  19  ? 0.3402 0.2514 0.2278 0.0256  -0.0399 -0.0019 17  PRO A CD  
115  N  N   . LEU A  20  ? 0.3339 0.2422 0.2305 0.0165  -0.0165 -0.0040 18  LEU A N   
116  C  CA  . LEU A  20  ? 0.3153 0.2207 0.2107 0.0139  -0.0117 -0.0024 18  LEU A CA  
117  C  C   . LEU A  20  ? 0.2962 0.2123 0.2042 0.0107  -0.0013 -0.0077 18  LEU A C   
118  O  O   . LEU A  20  ? 0.2726 0.1905 0.1860 0.0111  0.0066  -0.0133 18  LEU A O   
119  C  CB  . LEU A  20  ? 0.3393 0.2249 0.2175 0.0180  -0.0091 -0.0008 18  LEU A CB  
120  C  CG  . LEU A  20  ? 0.4115 0.2889 0.2826 0.0183  -0.0037 0.0005  18  LEU A CG  
121  C  CD1 . LEU A  20  ? 0.4088 0.2899 0.2811 0.0178  -0.0145 0.0041  18  LEU A CD1 
122  C  CD2 . LEU A  20  ? 0.4423 0.2957 0.2916 0.0246  0.0026  0.0008  18  LEU A CD2 
123  N  N   . GLN A  21  ? 0.2998 0.2237 0.2142 0.0071  -0.0010 -0.0070 19  GLN A N   
124  C  CA  . GLN A  21  ? 0.2993 0.2309 0.2245 0.0032  0.0088  -0.0126 19  GLN A CA  
125  C  C   . GLN A  21  ? 0.3138 0.2314 0.2325 0.0030  0.0224  -0.0150 19  GLN A C   
126  O  O   . GLN A  21  ? 0.3467 0.2459 0.2478 0.0059  0.0245  -0.0101 19  GLN A O   
127  C  CB  . GLN A  21  ? 0.2871 0.2215 0.2130 0.0006  0.0080  -0.0097 19  GLN A CB  
128  C  CG  . GLN A  21  ? 0.2922 0.2300 0.2259 -0.0037 0.0188  -0.0152 19  GLN A CG  
129  C  CD  . GLN A  21  ? 0.2970 0.2525 0.2490 -0.0062 0.0189  -0.0245 19  GLN A CD  
130  O  OE1 . GLN A  21  ? 0.2675 0.2345 0.2242 -0.0042 0.0090  -0.0251 19  GLN A OE1 
131  N  NE2 . GLN A  21  ? 0.3006 0.2573 0.2625 -0.0100 0.0305  -0.0327 19  GLN A NE2 
132  N  N   . GLN A  22  ? 0.3307 0.2556 0.2628 0.0004  0.0318  -0.0233 20  GLN A N   
133  C  CA  . GLN A  22  ? 0.3541 0.2633 0.2805 -0.0009 0.0490  -0.0262 20  GLN A CA  
134  C  C   . GLN A  22  ? 0.3343 0.2320 0.2537 -0.0047 0.0592  -0.0251 20  GLN A C   
135  O  O   . GLN A  22  ? 0.3047 0.2150 0.2353 -0.0088 0.0568  -0.0272 20  GLN A O   
136  C  CB  . GLN A  22  ? 0.3821 0.3052 0.3306 -0.0041 0.0583  -0.0372 20  GLN A CB  
137  C  CG  . GLN A  22  ? 0.4550 0.3995 0.4299 -0.0114 0.0619  -0.0477 20  GLN A CG  
138  C  CD  . GLN A  22  ? 0.5272 0.4624 0.5080 -0.0194 0.0835  -0.0542 20  GLN A CD  
139  O  OE1 . GLN A  22  ? 0.5535 0.4694 0.5241 -0.0195 0.0991  -0.0537 20  GLN A OE1 
140  N  NE2 . GLN A  22  ? 0.4957 0.4418 0.4911 -0.0261 0.0856  -0.0604 20  GLN A NE2 
141  N  N   . ASN A  23  ? 0.3560 0.2263 0.2523 -0.0015 0.0700  -0.0212 21  ASN A N   
142  C  CA  . ASN A  23  ? 0.3828 0.2352 0.2664 -0.0032 0.0823  -0.0200 21  ASN A CA  
143  C  C   . ASN A  23  ? 0.3753 0.2344 0.2577 -0.0024 0.0713  -0.0157 21  ASN A C   
144  O  O   . ASN A  23  ? 0.3665 0.2297 0.2570 -0.0079 0.0779  -0.0190 21  ASN A O   
145  C  CB  . ASN A  23  ? 0.4372 0.2936 0.3390 -0.0130 0.1012  -0.0299 21  ASN A CB  
146  C  CG  . ASN A  23  ? 0.5349 0.3624 0.4166 -0.0145 0.1194  -0.0286 21  ASN A CG  
147  O  OD1 . ASN A  23  ? 0.6869 0.4842 0.5358 -0.0059 0.1226  -0.0210 21  ASN A OD1 
148  N  ND2 . ASN A  23  ? 0.5818 0.4165 0.4815 -0.0245 0.1312  -0.0368 21  ASN A ND2 
149  N  N   . PHE A  24  ? 0.3408 0.2009 0.2142 0.0041  0.0553  -0.0090 22  PHE A N   
150  C  CA  . PHE A  24  ? 0.3236 0.1934 0.2000 0.0048  0.0451  -0.0054 22  PHE A CA  
151  C  C   . PHE A  24  ? 0.3401 0.1926 0.2015 0.0067  0.0545  -0.0039 22  PHE A C   
152  O  O   . PHE A  24  ? 0.3740 0.1999 0.2105 0.0134  0.0612  -0.0014 22  PHE A O   
153  C  CB  . PHE A  24  ? 0.3267 0.1978 0.1966 0.0113  0.0289  0.0000  22  PHE A CB  
154  C  CG  . PHE A  24  ? 0.3181 0.1998 0.1936 0.0120  0.0200  0.0031  22  PHE A CG  
155  C  CD1 . PHE A  24  ? 0.3443 0.2140 0.2050 0.0195  0.0164  0.0062  22  PHE A CD1 
156  C  CD2 . PHE A  24  ? 0.2994 0.2024 0.1938 0.0064  0.0151  0.0023  22  PHE A CD2 
157  C  CE1 . PHE A  24  ? 0.3313 0.2135 0.2008 0.0204  0.0087  0.0081  22  PHE A CE1 
158  C  CE2 . PHE A  24  ? 0.3004 0.2123 0.2000 0.0069  0.0091  0.0052  22  PHE A CE2 
159  C  CZ  . PHE A  24  ? 0.3120 0.2152 0.2015 0.0134  0.0063  0.0079  22  PHE A CZ  
160  N  N   . GLN A  25  ? 0.3173 0.1821 0.1901 0.0025  0.0543  -0.0052 23  GLN A N   
161  C  CA  . GLN A  25  ? 0.3509 0.1999 0.2097 0.0045  0.0627  -0.0039 23  GLN A CA  
162  C  C   . GLN A  25  ? 0.3431 0.1991 0.1998 0.0108  0.0498  0.0013  23  GLN A C   
163  O  O   . GLN A  25  ? 0.3197 0.1948 0.1924 0.0068  0.0449  0.0007  23  GLN A O   
164  C  CB  . GLN A  25  ? 0.3662 0.2224 0.2397 -0.0053 0.0738  -0.0106 23  GLN A CB  
165  C  CG  . GLN A  25  ? 0.3844 0.2373 0.2668 -0.0131 0.0884  -0.0185 23  GLN A CG  
166  C  CD  . GLN A  25  ? 0.4399 0.2585 0.2965 -0.0099 0.1052  -0.0169 23  GLN A CD  
167  O  OE1 . GLN A  25  ? 0.5204 0.3167 0.3594 -0.0090 0.1168  -0.0159 23  GLN A OE1 
168  N  NE2 . GLN A  25  ? 0.4807 0.2919 0.3320 -0.0075 0.1078  -0.0166 23  GLN A NE2 
169  N  N   . ASP A  26  ? 0.3539 0.1936 0.1902 0.0215  0.0448  0.0054  24  ASP A N   
170  C  CA  . ASP A  26  ? 0.3425 0.1928 0.1819 0.0280  0.0311  0.0086  24  ASP A CA  
171  C  C   . ASP A  26  ? 0.3466 0.2002 0.1882 0.0280  0.0349  0.0089  24  ASP A C   
172  O  O   . ASP A  26  ? 0.3358 0.2093 0.1931 0.0276  0.0264  0.0101  24  ASP A O   
173  C  CB  . ASP A  26  ? 0.3601 0.1928 0.1777 0.0414  0.0230  0.0106  24  ASP A CB  
174  C  CG  . ASP A  26  ? 0.3731 0.1708 0.1573 0.0503  0.0349  0.0113  24  ASP A CG  
175  O  OD1 . ASP A  26  ? 0.3878 0.1752 0.1676 0.0448  0.0506  0.0104  24  ASP A OD1 
176  O  OD2 . ASP A  26  ? 0.3851 0.1639 0.1458 0.0636  0.0281  0.0124  24  ASP A OD2 
177  N  N   . ASN A  27  ? 0.3728 0.2060 0.1988 0.0278  0.0493  0.0078  25  ASN A N   
178  C  CA  . ASN A  27  ? 0.4000 0.2329 0.2250 0.0284  0.0538  0.0080  25  ASN A CA  
179  C  C   . ASN A  27  ? 0.3468 0.2040 0.1968 0.0173  0.0536  0.0051  25  ASN A C   
180  O  O   . ASN A  27  ? 0.3167 0.1854 0.1738 0.0186  0.0495  0.0065  25  ASN A O   
181  C  CB  . ASN A  27  ? 0.4573 0.2576 0.2562 0.0307  0.0706  0.0071  25  ASN A CB  
182  C  CG  . ASN A  27  ? 0.5381 0.3303 0.3404 0.0193  0.0855  0.0023  25  ASN A CG  
183  O  OD1 . ASN A  27  ? 0.5467 0.3428 0.3546 0.0168  0.0839  0.0012  25  ASN A OD1 
184  N  ND2 . ASN A  27  ? 0.6100 0.3912 0.4102 0.0122  0.1006  -0.0016 25  ASN A ND2 
185  N  N   . GLN A  28  ? 0.3553 0.2195 0.2176 0.0076  0.0578  0.0006  26  GLN A N   
186  C  CA  . GLN A  28  ? 0.3351 0.2194 0.2177 -0.0010 0.0569  -0.0036 26  GLN A CA  
187  C  C   . GLN A  28  ? 0.3189 0.2253 0.2155 0.0000  0.0429  -0.0005 26  GLN A C   
188  O  O   . GLN A  28  ? 0.2949 0.2148 0.2022 -0.0036 0.0404  -0.0022 26  GLN A O   
189  C  CB  . GLN A  28  ? 0.3557 0.2436 0.2497 -0.0098 0.0633  -0.0112 26  GLN A CB  
190  C  CG  . GLN A  28  ? 0.4342 0.3036 0.3215 -0.0152 0.0806  -0.0171 26  GLN A CG  
191  C  CD  . GLN A  28  ? 0.5140 0.3957 0.4225 -0.0252 0.0857  -0.0276 26  GLN A CD  
192  O  OE1 . GLN A  28  ? 0.5509 0.4543 0.4783 -0.0293 0.0783  -0.0334 26  GLN A OE1 
193  N  NE2 . GLN A  28  ? 0.5347 0.4025 0.4399 -0.0283 0.0984  -0.0308 26  GLN A NE2 
194  N  N   . PHE A  29  ? 0.2861 0.1939 0.1812 0.0047  0.0344  0.0035  27  PHE A N   
195  C  CA  . PHE A  29  ? 0.2743 0.1999 0.1826 0.0042  0.0236  0.0060  27  PHE A CA  
196  C  C   . PHE A  29  ? 0.2681 0.2003 0.1794 0.0083  0.0199  0.0097  27  PHE A C   
197  O  O   . PHE A  29  ? 0.2536 0.1992 0.1764 0.0065  0.0146  0.0115  27  PHE A O   
198  C  CB  . PHE A  29  ? 0.2693 0.1938 0.1769 0.0062  0.0163  0.0074  27  PHE A CB  
199  C  CG  . PHE A  29  ? 0.2542 0.1934 0.1745 0.0034  0.0077  0.0090  27  PHE A CG  
200  C  CD1 . PHE A  29  ? 0.2565 0.2011 0.1820 0.0059  0.0000  0.0119  27  PHE A CD1 
201  C  CD2 . PHE A  29  ? 0.2488 0.1953 0.1756 -0.0012 0.0075  0.0066  27  PHE A CD2 
202  C  CE1 . PHE A  29  ? 0.2416 0.1958 0.1773 0.0022  -0.0051 0.0132  27  PHE A CE1 
203  C  CE2 . PHE A  29  ? 0.2447 0.1990 0.1777 -0.0025 0.0010  0.0086  27  PHE A CE2 
204  C  CZ  . PHE A  29  ? 0.2402 0.1968 0.1770 -0.0016 -0.0041 0.0124  27  PHE A CZ  
205  N  N   . GLN A  30  ? 0.2872 0.2083 0.1872 0.0142  0.0242  0.0104  28  GLN A N   
206  C  CA  . GLN A  30  ? 0.2929 0.2204 0.1963 0.0199  0.0216  0.0128  28  GLN A CA  
207  C  C   . GLN A  30  ? 0.2753 0.2145 0.1885 0.0155  0.0248  0.0131  28  GLN A C   
208  O  O   . GLN A  30  ? 0.2584 0.1968 0.1712 0.0095  0.0294  0.0107  28  GLN A O   
209  C  CB  . GLN A  30  ? 0.3224 0.2317 0.2072 0.0282  0.0274  0.0128  28  GLN A CB  
210  C  CG  . GLN A  30  ? 0.3527 0.2463 0.2214 0.0376  0.0234  0.0130  28  GLN A CG  
211  C  CD  . GLN A  30  ? 0.3624 0.2354 0.2089 0.0484  0.0287  0.0135  28  GLN A CD  
212  O  OE1 . GLN A  30  ? 0.4036 0.2815 0.2507 0.0587  0.0216  0.0139  28  GLN A OE1 
213  N  NE2 . GLN A  30  ? 0.3728 0.2231 0.2009 0.0459  0.0419  0.0127  28  GLN A NE2 
214  N  N   . GLY A  31  ? 0.2726 0.2219 0.1944 0.0194  0.0225  0.0153  29  GLY A N   
215  C  CA  . GLY A  31  ? 0.2546 0.2115 0.1820 0.0171  0.0272  0.0163  29  GLY A CA  
216  C  C   . GLY A  31  ? 0.2576 0.2281 0.1996 0.0123  0.0244  0.0182  29  GLY A C   
217  O  O   . GLY A  31  ? 0.2501 0.2268 0.2015 0.0110  0.0181  0.0186  29  GLY A O   
218  N  N   . LYS A  32  ? 0.2610 0.2331 0.2023 0.0099  0.0297  0.0192  30  LYS A N   
219  C  CA  . LYS A  32  ? 0.2688 0.2484 0.2192 0.0064  0.0305  0.0218  30  LYS A CA  
220  C  C   . LYS A  32  ? 0.2495 0.2249 0.1939 0.0019  0.0276  0.0212  30  LYS A C   
221  O  O   . LYS A  32  ? 0.2390 0.2082 0.1730 0.0016  0.0274  0.0181  30  LYS A O   
222  C  CB  . LYS A  32  ? 0.2973 0.2768 0.2453 0.0082  0.0390  0.0237  30  LYS A CB  
223  C  CG  . LYS A  32  ? 0.3446 0.3268 0.2981 0.0049  0.0434  0.0270  30  LYS A CG  
224  C  CD  . LYS A  32  ? 0.3918 0.3707 0.3398 0.0076  0.0536  0.0291  30  LYS A CD  
225  C  CE  . LYS A  32  ? 0.4872 0.4785 0.4535 0.0102  0.0584  0.0295  30  LYS A CE  
226  N  NZ  . LYS A  32  ? 0.5600 0.5474 0.5207 0.0132  0.0702  0.0319  30  LYS A NZ  
227  N  N   . TRP A  33  ? 0.2386 0.2173 0.1903 -0.0011 0.0250  0.0232  31  TRP A N   
228  C  CA  . TRP A  33  ? 0.2372 0.2101 0.1809 -0.0034 0.0226  0.0233  31  TRP A CA  
229  C  C   . TRP A  33  ? 0.2449 0.2153 0.1894 -0.0054 0.0285  0.0274  31  TRP A C   
230  O  O   . TRP A  33  ? 0.2307 0.2078 0.1901 -0.0080 0.0316  0.0291  31  TRP A O   
231  C  CB  . TRP A  33  ? 0.2201 0.1935 0.1673 -0.0053 0.0150  0.0219  31  TRP A CB  
232  C  CG  . TRP A  33  ? 0.2247 0.1963 0.1683 -0.0038 0.0116  0.0180  31  TRP A CG  
233  C  CD1 . TRP A  33  ? 0.2161 0.1878 0.1626 -0.0020 0.0097  0.0172  31  TRP A CD1 
234  C  CD2 . TRP A  33  ? 0.2187 0.1869 0.1550 -0.0039 0.0103  0.0135  31  TRP A CD2 
235  N  NE1 . TRP A  33  ? 0.2141 0.1796 0.1534 -0.0016 0.0100  0.0136  31  TRP A NE1 
236  C  CE2 . TRP A  33  ? 0.2160 0.1816 0.1523 -0.0037 0.0104  0.0107  31  TRP A CE2 
237  C  CE3 . TRP A  33  ? 0.2268 0.1936 0.1565 -0.0032 0.0088  0.0107  31  TRP A CE3 
238  C  CZ2 . TRP A  33  ? 0.2099 0.1735 0.1441 -0.0050 0.0113  0.0049  31  TRP A CZ2 
239  C  CZ3 . TRP A  33  ? 0.2265 0.1943 0.1559 -0.0033 0.0068  0.0038  31  TRP A CZ3 
240  C  CH2 . TRP A  33  ? 0.2188 0.1860 0.1525 -0.0053 0.0090  0.0008  31  TRP A CH2 
241  N  N   . TYR A  34  ? 0.2535 0.2131 0.1816 -0.0037 0.0302  0.0282  32  TYR A N   
242  C  CA  . TYR A  34  ? 0.2716 0.2216 0.1933 -0.0048 0.0377  0.0327  32  TYR A CA  
243  C  C   . TYR A  34  ? 0.2765 0.2197 0.1943 -0.0068 0.0330  0.0334  32  TYR A C   
244  O  O   . TYR A  34  ? 0.2663 0.2078 0.1765 -0.0041 0.0241  0.0302  32  TYR A O   
245  C  CB  . TYR A  34  ? 0.3010 0.2373 0.1998 0.0010  0.0419  0.0333  32  TYR A CB  
246  C  CG  . TYR A  34  ? 0.3013 0.2403 0.2005 0.0033  0.0486  0.0334  32  TYR A CG  
247  C  CD1 . TYR A  34  ? 0.3150 0.2541 0.2210 0.0016  0.0609  0.0376  32  TYR A CD1 
248  C  CD2 . TYR A  34  ? 0.3119 0.2532 0.2058 0.0067  0.0436  0.0285  32  TYR A CD2 
249  C  CE1 . TYR A  34  ? 0.3299 0.2710 0.2354 0.0049  0.0674  0.0376  32  TYR A CE1 
250  C  CE2 . TYR A  34  ? 0.3132 0.2546 0.2052 0.0092  0.0499  0.0285  32  TYR A CE2 
251  C  CZ  . TYR A  34  ? 0.3273 0.2683 0.2239 0.0091  0.0615  0.0334  32  TYR A CZ  
252  O  OH  . TYR A  34  ? 0.3352 0.2755 0.2287 0.0127  0.0682  0.0335  32  TYR A OH  
253  N  N   . VAL A  35  ? 0.2809 0.2200 0.2051 -0.0119 0.0398  0.0368  33  VAL A N   
254  C  CA  . VAL A  35  ? 0.2862 0.2148 0.2036 -0.0138 0.0367  0.0378  33  VAL A CA  
255  C  C   . VAL A  35  ? 0.3052 0.2108 0.1932 -0.0082 0.0412  0.0409  33  VAL A C   
256  O  O   . VAL A  35  ? 0.3262 0.2176 0.2057 -0.0097 0.0539  0.0453  33  VAL A O   
257  C  CB  . VAL A  35  ? 0.2885 0.2210 0.2261 -0.0227 0.0418  0.0387  33  VAL A CB  
258  C  CG1 . VAL A  35  ? 0.3049 0.2217 0.2313 -0.0247 0.0401  0.0400  33  VAL A CG1 
259  C  CG2 . VAL A  35  ? 0.2558 0.2094 0.2186 -0.0251 0.0337  0.0344  33  VAL A CG2 
260  N  N   . VAL A  36  ? 0.3036 0.2050 0.1755 -0.0007 0.0308  0.0377  34  VAL A N   
261  C  CA  . VAL A  36  ? 0.3276 0.2083 0.1685 0.0087  0.0309  0.0384  34  VAL A CA  
262  C  C   . VAL A  36  ? 0.3398 0.2022 0.1649 0.0104  0.0298  0.0408  34  VAL A C   
263  O  O   . VAL A  36  ? 0.3484 0.1859 0.1439 0.0179  0.0340  0.0437  34  VAL A O   
264  C  CB  . VAL A  36  ? 0.3471 0.2362 0.1825 0.0167  0.0185  0.0310  34  VAL A CB  
265  C  CG1 . VAL A  36  ? 0.4038 0.2734 0.2077 0.0290  0.0130  0.0292  34  VAL A CG1 
266  C  CG2 . VAL A  36  ? 0.3541 0.2533 0.1967 0.0162  0.0217  0.0291  34  VAL A CG2 
267  N  N   . GLY A  37  ? 0.3250 0.1971 0.1669 0.0047  0.0240  0.0394  35  GLY A N   
268  C  CA  . GLY A  37  ? 0.3342 0.1886 0.1629 0.0052  0.0235  0.0417  35  GLY A CA  
269  C  C   . GLY A  37  ? 0.3303 0.1932 0.1831 -0.0063 0.0251  0.0422  35  GLY A C   
270  O  O   . GLY A  37  ? 0.2968 0.1818 0.1741 -0.0109 0.0198  0.0390  35  GLY A O   
271  N  N   . LEU A  38  ? 0.3627 0.2054 0.2059 -0.0101 0.0321  0.0458  36  LEU A N   
272  C  CA  . LEU A  38  ? 0.3602 0.2082 0.2251 -0.0215 0.0333  0.0450  36  LEU A CA  
273  C  C   . LEU A  38  ? 0.3752 0.1989 0.2196 -0.0199 0.0325  0.0466  36  LEU A C   
274  O  O   . LEU A  38  ? 0.4152 0.2104 0.2314 -0.0159 0.0417  0.0511  36  LEU A O   
275  C  CB  . LEU A  38  ? 0.4009 0.2477 0.2812 -0.0322 0.0491  0.0471  36  LEU A CB  
276  C  CG  . LEU A  38  ? 0.4136 0.2894 0.3316 -0.0405 0.0484  0.0430  36  LEU A CG  
277  C  CD1 . LEU A  38  ? 0.4455 0.3171 0.3792 -0.0516 0.0657  0.0438  36  LEU A CD1 
278  C  CD2 . LEU A  38  ? 0.4156 0.3063 0.3518 -0.0433 0.0345  0.0378  36  LEU A CD2 
279  N  N   . ALA A  39  ? 0.3475 0.1788 0.2026 -0.0221 0.0223  0.0433  37  ALA A N   
280  C  CA  . ALA A  39  ? 0.3622 0.1701 0.1989 -0.0212 0.0217  0.0446  37  ALA A CA  
281  C  C   . ALA A  39  ? 0.3474 0.1643 0.2079 -0.0319 0.0179  0.0410  37  ALA A C   
282  O  O   . ALA A  39  ? 0.3215 0.1632 0.2049 -0.0337 0.0090  0.0367  37  ALA A O   
283  C  CB  . ALA A  39  ? 0.3616 0.1653 0.1768 -0.0070 0.0096  0.0431  37  ALA A CB  
284  N  N   . GLY A  40  ? 0.3569 0.1514 0.2097 -0.0384 0.0245  0.0421  38  GLY A N   
285  C  CA  . GLY A  40  ? 0.3432 0.1443 0.2170 -0.0481 0.0192  0.0372  38  GLY A CA  
286  C  C   . GLY A  40  ? 0.3667 0.1413 0.2346 -0.0582 0.0301  0.0377  38  GLY A C   
287  O  O   . GLY A  40  ? 0.3876 0.1358 0.2338 -0.0584 0.0447  0.0429  38  GLY A O   
288  N  N   . ASN A  41  ? 0.3609 0.1394 0.2452 -0.0659 0.0232  0.0320  39  ASN A N   
289  C  CA  . ASN A  41  ? 0.3970 0.1471 0.2724 -0.0750 0.0318  0.0315  39  ASN A CA  
290  C  C   . ASN A  41  ? 0.4205 0.1692 0.3196 -0.0918 0.0492  0.0289  39  ASN A C   
291  O  O   . ASN A  41  ? 0.4490 0.1701 0.3404 -0.1015 0.0616  0.0287  39  ASN A O   
292  C  CB  . ASN A  41  ? 0.3916 0.1416 0.2709 -0.0761 0.0177  0.0257  39  ASN A CB  
293  C  CG  . ASN A  41  ? 0.3602 0.1421 0.2786 -0.0834 0.0065  0.0164  39  ASN A CG  
294  O  OD1 . ASN A  41  ? 0.3369 0.1447 0.2800 -0.0856 0.0071  0.0144  39  ASN A OD1 
295  N  ND2 . ASN A  41  ? 0.3588 0.1372 0.2796 -0.0852 -0.0047 0.0105  39  ASN A ND2 
296  N  N   . ALA A  42  ? 0.4121 0.1887 0.3390 -0.0951 0.0518  0.0269  40  ALA A N   
297  C  CA  . ALA A  42  ? 0.4506 0.2277 0.4001 -0.1093 0.0712  0.0251  40  ALA A CA  
298  C  C   . ALA A  42  ? 0.4814 0.2533 0.4162 -0.1036 0.0854  0.0328  40  ALA A C   
299  O  O   . ALA A  42  ? 0.5019 0.2754 0.4549 -0.1139 0.1031  0.0319  40  ALA A O   
300  C  CB  . ALA A  42  ? 0.4317 0.2470 0.4318 -0.1191 0.0636  0.0139  40  ALA A CB  
301  N  N   . ILE A  43  ? 0.5209 0.2880 0.4249 -0.0871 0.0772  0.0392  41  ILE A N   
302  C  CA  . ILE A  43  ? 0.5797 0.3361 0.4617 -0.0791 0.0886  0.0463  41  ILE A CA  
303  C  C   . ILE A  43  ? 0.6494 0.3585 0.4878 -0.0757 0.1043  0.0536  41  ILE A C   
304  O  O   . ILE A  43  ? 0.6768 0.3639 0.4854 -0.0673 0.0967  0.0557  41  ILE A O   
305  C  CB  . ILE A  43  ? 0.5784 0.3491 0.4459 -0.0624 0.0720  0.0481  41  ILE A CB  
306  C  CG1 . ILE A  43  ? 0.5585 0.3704 0.4630 -0.0644 0.0597  0.0422  41  ILE A CG1 
307  C  CG2 . ILE A  43  ? 0.6052 0.3593 0.4438 -0.0526 0.0821  0.0546  41  ILE A CG2 
308  C  CD1 . ILE A  43  ? 0.5761 0.4050 0.5084 -0.0727 0.0719  0.0407  41  ILE A CD1 
309  N  N   . LEU A  44  ? 0.7234 0.4148 0.5560 -0.0813 0.1270  0.0574  42  LEU A N   
310  C  CA  . LEU A  44  ? 0.8103 0.4505 0.5974 -0.0780 0.1456  0.0649  42  LEU A CA  
311  C  C   . LEU A  44  ? 0.8638 0.4883 0.6243 -0.0685 0.1591  0.0717  42  LEU A C   
312  O  O   . LEU A  44  ? 0.8574 0.4963 0.6428 -0.0773 0.1730  0.0708  42  LEU A O   
313  C  CB  . LEU A  44  ? 0.8461 0.4680 0.6494 -0.0982 0.1667  0.0622  42  LEU A CB  
314  C  CG  . LEU A  44  ? 0.9302 0.4965 0.6874 -0.0967 0.1803  0.0677  42  LEU A CG  
315  C  CD1 . LEU A  44  ? 0.9458 0.4967 0.6610 -0.0760 0.1600  0.0714  42  LEU A CD1 
316  C  CD2 . LEU A  44  ? 0.9471 0.5094 0.7331 -0.1180 0.1891  0.0607  42  LEU A CD2 
317  N  N   . ARG A  45  ? 0.9285 0.5238 0.6379 -0.0491 0.1540  0.0776  43  ARG A N   
318  C  CA  . ARG A  45  ? 0.9641 0.5373 0.6395 -0.0373 0.1655  0.0838  43  ARG A CA  
319  C  C   . ARG A  45  ? 1.0086 0.5466 0.6738 -0.0489 0.1988  0.0886  43  ARG A C   
320  O  O   . ARG A  45  ? 1.0158 0.5135 0.6563 -0.0531 0.2132  0.0916  43  ARG A O   
321  C  CB  . ARG A  45  ? 1.0252 0.5674 0.6441 -0.0135 0.1537  0.0877  43  ARG A CB  
322  C  CG  . ARG A  45  ? 1.0717 0.6083 0.6642 0.0022  0.1534  0.0905  43  ARG A CG  
323  C  CD  . ARG A  45  ? 1.1376 0.6452 0.6754 0.0276  0.1394  0.0920  43  ARG A CD  
324  N  NE  . ARG A  45  ? 1.1471 0.6053 0.6314 0.0397  0.1576  0.0992  43  ARG A NE  
325  C  CZ  . ARG A  45  ? 1.1214 0.5717 0.5735 0.0599  0.1487  0.0991  43  ARG A CZ  
326  N  NH1 . ARG A  45  ? 1.1476 0.5482 0.5473 0.0712  0.1667  0.1059  43  ARG A NH1 
327  N  NH2 . ARG A  45  ? 1.1063 0.5961 0.5770 0.0689  0.1223  0.0915  43  ARG A NH2 
328  N  N   . GLU A  46  ? 1.0108 0.5633 0.6957 -0.0546 0.2124  0.0889  44  GLU A N   
329  C  CA  . GLU A  46  ? 1.0599 0.5838 0.7421 -0.0671 0.2468  0.0925  44  GLU A CA  
330  C  C   . GLU A  46  ? 1.0946 0.5887 0.7321 -0.0519 0.2602  0.1002  44  GLU A C   
331  O  O   . GLU A  46  ? 0.9640 0.4864 0.6209 -0.0498 0.2579  0.0989  44  GLU A O   
332  C  CB  . GLU A  46  ? 1.0196 0.5883 0.7709 -0.0891 0.2544  0.0844  44  GLU A CB  
333  N  N   . ASP A  47  ? 1.1696 0.6034 0.7442 -0.0402 0.2742  0.1082  45  ASP A N   
334  C  CA  . ASP A  47  ? 1.2394 0.6349 0.7596 -0.0222 0.2861  0.1157  45  ASP A CA  
335  C  C   . ASP A  47  ? 1.2600 0.6569 0.8006 -0.0347 0.3158  0.1174  45  ASP A C   
336  O  O   . ASP A  47  ? 1.2092 0.6094 0.7361 -0.0231 0.3153  0.1195  45  ASP A O   
337  C  CB  . ASP A  47  ? 1.2772 0.6012 0.7244 -0.0085 0.2995  0.1238  45  ASP A CB  
338  N  N   . LYS A  48  ? 1.3230 0.7188 0.8984 -0.0586 0.3414  0.1154  46  LYS A N   
339  C  CA  . LYS A  48  ? 1.3620 0.7547 0.9572 -0.0717 0.3747  0.1165  46  LYS A CA  
340  C  C   . LYS A  48  ? 1.3171 0.7722 0.9684 -0.0759 0.3626  0.1099  46  LYS A C   
341  O  O   . LYS A  48  ? 1.3859 0.8353 1.0269 -0.0703 0.3771  0.1134  46  LYS A O   
342  C  CB  . LYS A  48  ? 1.3689 0.7513 0.9968 -0.0982 0.4037  0.1130  46  LYS A CB  
343  N  N   . ASP A  49  ? 1.1668 0.6780 0.8735 -0.0842 0.3364  0.1007  47  ASP A N   
344  C  CA  . ASP A  49  ? 1.0650 0.6344 0.8274 -0.0893 0.3261  0.0937  47  ASP A CA  
345  C  C   . ASP A  49  ? 0.9946 0.6031 0.7681 -0.0783 0.2866  0.0894  47  ASP A C   
346  O  O   . ASP A  49  ? 0.8817 0.5273 0.6989 -0.0880 0.2694  0.0815  47  ASP A O   
347  C  CB  . ASP A  49  ? 1.0631 0.6666 0.8947 -0.1144 0.3392  0.0840  47  ASP A CB  
348  N  N   . PRO A  50  ? 0.9713 0.5700 0.7041 -0.0576 0.2725  0.0940  48  PRO A N   
349  C  CA  . PRO A  50  ? 0.9154 0.5405 0.6489 -0.0463 0.2376  0.0904  48  PRO A CA  
350  C  C   . PRO A  50  ? 0.8051 0.4883 0.5967 -0.0538 0.2219  0.0823  48  PRO A C   
351  O  O   . PRO A  50  ? 0.7618 0.4634 0.5799 -0.0594 0.2342  0.0809  48  PRO A O   
352  C  CB  . PRO A  50  ? 0.9778 0.5781 0.6580 -0.0241 0.2314  0.0954  48  PRO A CB  
353  C  CG  . PRO A  50  ? 1.0194 0.6019 0.6906 -0.0255 0.2592  0.1000  48  PRO A CG  
354  C  CD  . PRO A  50  ? 1.0407 0.6094 0.7326 -0.0450 0.2886  0.1009  48  PRO A CD  
355  N  N   . GLN A  51  ? 0.7244 0.4341 0.5330 -0.0526 0.1957  0.0772  49  GLN A N   
356  C  CA  . GLN A  51  ? 0.6676 0.4268 0.5248 -0.0578 0.1802  0.0699  49  GLN A CA  
357  C  C   . GLN A  51  ? 0.5981 0.3723 0.4479 -0.0453 0.1704  0.0702  49  GLN A C   
358  O  O   . GLN A  51  ? 0.5924 0.3498 0.4038 -0.0307 0.1604  0.0730  49  GLN A O   
359  C  CB  . GLN A  51  ? 0.6654 0.4420 0.5365 -0.0592 0.1571  0.0649  49  GLN A CB  
360  C  CG  . GLN A  51  ? 0.6959 0.5140 0.5965 -0.0564 0.1359  0.0590  49  GLN A CG  
361  C  CD  . GLN A  51  ? 0.7073 0.5535 0.6510 -0.0680 0.1270  0.0515  49  GLN A CD  
362  O  OE1 . GLN A  51  ? 0.7368 0.5720 0.6797 -0.0739 0.1250  0.0502  49  GLN A OE1 
363  N  NE2 . GLN A  51  ? 0.7169 0.5977 0.6962 -0.0701 0.1210  0.0460  49  GLN A NE2 
364  N  N   . LYS A  52  ? 0.5512 0.3568 0.4384 -0.0508 0.1733  0.0663  50  LYS A N   
365  C  CA  . LYS A  52  ? 0.5203 0.3395 0.4028 -0.0404 0.1660  0.0662  50  LYS A CA  
366  C  C   . LYS A  52  ? 0.4418 0.2918 0.3420 -0.0368 0.1401  0.0607  50  LYS A C   
367  O  O   . LYS A  52  ? 0.4002 0.2722 0.3315 -0.0446 0.1307  0.0556  50  LYS A O   
368  C  CB  . LYS A  52  ? 0.5150 0.3497 0.4256 -0.0463 0.1835  0.0651  50  LYS A CB  
369  C  CG  . LYS A  52  ? 0.5798 0.3805 0.4682 -0.0483 0.2124  0.0712  50  LYS A CG  
370  C  CD  . LYS A  52  ? 0.6117 0.4307 0.5319 -0.0542 0.2308  0.0692  50  LYS A CD  
371  C  CE  . LYS A  52  ? 0.6921 0.4804 0.6028 -0.0619 0.2638  0.0736  50  LYS A CE  
372  N  NZ  . LYS A  52  ? 0.7480 0.5490 0.6798 -0.0634 0.2830  0.0728  50  LYS A NZ  
373  N  N   . MET A  53  ? 0.4190 0.2679 0.2970 -0.0248 0.1291  0.0611  51  MET A N   
374  C  CA  . MET A  53  ? 0.3707 0.2462 0.2641 -0.0216 0.1088  0.0558  51  MET A CA  
375  C  C   . MET A  53  ? 0.3294 0.2362 0.2637 -0.0279 0.1093  0.0517  51  MET A C   
376  O  O   . MET A  53  ? 0.3262 0.2368 0.2717 -0.0300 0.1240  0.0526  51  MET A O   
377  C  CB  . MET A  53  ? 0.3794 0.2477 0.2453 -0.0093 0.1016  0.0558  51  MET A CB  
378  C  CG  . MET A  53  ? 0.3542 0.2438 0.2308 -0.0063 0.0824  0.0502  51  MET A CG  
379  S  SD  . MET A  53  ? 0.3731 0.2519 0.2177 0.0066  0.0732  0.0476  51  MET A SD  
380  C  CE  . MET A  53  ? 0.4027 0.2570 0.2161 0.0132  0.0668  0.0483  51  MET A CE  
381  N  N   . TYR A  54  ? 0.2920 0.2200 0.2469 -0.0297 0.0934  0.0468  52  TYR A N   
382  C  CA  . TYR A  54  ? 0.2686 0.2244 0.2548 -0.0309 0.0890  0.0421  52  TYR A CA  
383  C  C   . TYR A  54  ? 0.2476 0.2118 0.2279 -0.0241 0.0718  0.0394  52  TYR A C   
384  O  O   . TYR A  54  ? 0.2647 0.2171 0.2232 -0.0205 0.0638  0.0401  52  TYR A O   
385  C  CB  . TYR A  54  ? 0.2608 0.2331 0.2817 -0.0404 0.0885  0.0373  52  TYR A CB  
386  C  CG  . TYR A  54  ? 0.2613 0.2301 0.2804 -0.0434 0.0759  0.0354  52  TYR A CG  
387  C  CD1 . TYR A  54  ? 0.2796 0.2277 0.2859 -0.0489 0.0825  0.0382  52  TYR A CD1 
388  C  CD2 . TYR A  54  ? 0.2514 0.2350 0.2795 -0.0402 0.0585  0.0309  52  TYR A CD2 
389  C  CE1 . TYR A  54  ? 0.2810 0.2248 0.2848 -0.0512 0.0713  0.0364  52  TYR A CE1 
390  C  CE2 . TYR A  54  ? 0.2512 0.2305 0.2767 -0.0424 0.0478  0.0292  52  TYR A CE2 
391  C  CZ  . TYR A  54  ? 0.2710 0.2313 0.2849 -0.0478 0.0538  0.0319  52  TYR A CZ  
392  O  OH  . TYR A  54  ? 0.2623 0.2167 0.2713 -0.0492 0.0433  0.0302  52  TYR A OH  
393  N  N   . ALA A  55  ? 0.2240 0.2076 0.2232 -0.0218 0.0672  0.0358  53  ALA A N   
394  C  CA  . ALA A  55  ? 0.2098 0.1982 0.2024 -0.0157 0.0544  0.0333  53  ALA A CA  
395  C  C   . ALA A  55  ? 0.2005 0.2050 0.2146 -0.0163 0.0437  0.0285  53  ALA A C   
396  O  O   . ALA A  55  ? 0.1920 0.2105 0.2312 -0.0193 0.0456  0.0255  53  ALA A O   
397  C  CB  . ALA A  55  ? 0.2078 0.1969 0.1929 -0.0094 0.0586  0.0337  53  ALA A CB  
398  N  N   . THR A  56  ? 0.2002 0.2022 0.2042 -0.0126 0.0327  0.0268  54  THR A N   
399  C  CA  . THR A  56  ? 0.2004 0.2120 0.2167 -0.0106 0.0221  0.0225  54  THR A CA  
400  C  C   . THR A  56  ? 0.2101 0.2182 0.2132 -0.0029 0.0175  0.0215  54  THR A C   
401  O  O   . THR A  56  ? 0.2144 0.2114 0.1991 -0.0023 0.0177  0.0227  54  THR A O   
402  C  CB  . THR A  56  ? 0.2106 0.2170 0.2253 -0.0146 0.0143  0.0216  54  THR A CB  
403  O  OG1 . THR A  56  ? 0.2246 0.2319 0.2517 -0.0224 0.0199  0.0221  54  THR A OG1 
404  C  CG2 . THR A  56  ? 0.2247 0.2372 0.2466 -0.0106 0.0024  0.0169  54  THR A CG2 
405  N  N   . ILE A  57  ? 0.2106 0.2276 0.2234 0.0031  0.0136  0.0184  55  ILE A N   
406  C  CA  . ILE A  57  ? 0.2140 0.2241 0.2120 0.0112  0.0125  0.0179  55  ILE A CA  
407  C  C   . ILE A  57  ? 0.2245 0.2306 0.2176 0.0173  0.0018  0.0147  55  ILE A C   
408  O  O   . ILE A  57  ? 0.2119 0.2286 0.2199 0.0207  -0.0060 0.0107  55  ILE A O   
409  C  CB  . ILE A  57  ? 0.2248 0.2431 0.2307 0.0172  0.0179  0.0173  55  ILE A CB  
410  C  CG1 . ILE A  57  ? 0.2342 0.2528 0.2409 0.0122  0.0298  0.0208  55  ILE A CG1 
411  C  CG2 . ILE A  57  ? 0.2165 0.2231 0.2032 0.0261  0.0178  0.0170  55  ILE A CG2 
412  C  CD1 . ILE A  57  ? 0.2460 0.2769 0.2682 0.0162  0.0365  0.0199  55  ILE A CD1 
413  N  N   . TYR A  58  ? 0.2369 0.2271 0.2089 0.0188  0.0019  0.0155  56  TYR A N   
414  C  CA  . TYR A  58  ? 0.2638 0.2437 0.2242 0.0251  -0.0057 0.0133  56  TYR A CA  
415  C  C   . TYR A  58  ? 0.2876 0.2545 0.2304 0.0354  -0.0032 0.0129  56  TYR A C   
416  O  O   . TYR A  58  ? 0.2978 0.2539 0.2274 0.0339  0.0059  0.0144  56  TYR A O   
417  C  CB  . TYR A  58  ? 0.2453 0.2134 0.1935 0.0198  -0.0048 0.0142  56  TYR A CB  
418  C  CG  . TYR A  58  ? 0.2295 0.2046 0.1889 0.0127  -0.0094 0.0143  56  TYR A CG  
419  C  CD1 . TYR A  58  ? 0.2545 0.2246 0.2108 0.0143  -0.0177 0.0125  56  TYR A CD1 
420  C  CD2 . TYR A  58  ? 0.2187 0.2016 0.1878 0.0054  -0.0049 0.0163  56  TYR A CD2 
421  C  CE1 . TYR A  58  ? 0.2413 0.2151 0.2057 0.0079  -0.0214 0.0126  56  TYR A CE1 
422  C  CE2 . TYR A  58  ? 0.2207 0.2053 0.1959 -0.0004 -0.0079 0.0168  56  TYR A CE2 
423  C  CZ  . TYR A  58  ? 0.2231 0.2039 0.1969 0.0004  -0.0162 0.0148  56  TYR A CZ  
424  O  OH  . TYR A  58  ? 0.2202 0.2002 0.1982 -0.0052 -0.0188 0.0152  56  TYR A OH  
425  N  N   . GLU A  59  ? 0.3231 0.2898 0.2644 0.0463  -0.0117 0.0099  57  GLU A N   
426  C  CA  . GLU A  59  ? 0.3413 0.2908 0.2604 0.0588  -0.0100 0.0096  57  GLU A CA  
427  C  C   . GLU A  59  ? 0.3336 0.2638 0.2311 0.0678  -0.0172 0.0080  57  GLU A C   
428  O  O   . GLU A  59  ? 0.3014 0.2392 0.2066 0.0737  -0.0304 0.0040  57  GLU A O   
429  C  CB  . GLU A  59  ? 0.3919 0.3555 0.3236 0.0687  -0.0145 0.0068  57  GLU A CB  
430  C  CG  . GLU A  59  ? 0.4652 0.4378 0.4061 0.0647  -0.0040 0.0091  57  GLU A CG  
431  C  CD  . GLU A  59  ? 0.5783 0.5731 0.5425 0.0724  -0.0089 0.0051  57  GLU A CD  
432  O  OE1 . GLU A  59  ? 0.7006 0.6981 0.6655 0.0855  -0.0205 0.0000  57  GLU A OE1 
433  O  OE2 . GLU A  59  ? 0.7583 0.7679 0.7405 0.0661  -0.0012 0.0064  57  GLU A OE2 
434  N  N   . LEU A  60  ? 0.3466 0.2501 0.2162 0.0692  -0.0079 0.0103  58  LEU A N   
435  C  CA  . LEU A  60  ? 0.3763 0.2546 0.2188 0.0782  -0.0108 0.0096  58  LEU A CA  
436  C  C   . LEU A  60  ? 0.4134 0.2768 0.2348 0.0975  -0.0168 0.0078  58  LEU A C   
437  O  O   . LEU A  60  ? 0.4338 0.2856 0.2417 0.1029  -0.0086 0.0093  58  LEU A O   
438  C  CB  . LEU A  60  ? 0.3806 0.2348 0.2025 0.0716  0.0048  0.0122  58  LEU A CB  
439  C  CG  . LEU A  60  ? 0.4032 0.2297 0.1978 0.0770  0.0067  0.0123  58  LEU A CG  
440  C  CD1 . LEU A  60  ? 0.4012 0.2409 0.2096 0.0734  -0.0048 0.0108  58  LEU A CD1 
441  C  CD2 . LEU A  60  ? 0.4162 0.2230 0.1979 0.0679  0.0257  0.0134  58  LEU A CD2 
442  N  N   . LYS A  61  ? 0.4627 0.3252 0.2797 0.1091  -0.0321 0.0039  59  LYS A N   
443  C  CA  . LYS A  61  ? 0.5101 0.3576 0.3046 0.1310  -0.0412 0.0007  59  LYS A CA  
444  C  C   . LYS A  61  ? 0.5448 0.3467 0.2901 0.1425  -0.0342 0.0033  59  LYS A C   
445  O  O   . LYS A  61  ? 0.5691 0.3547 0.3025 0.1332  -0.0241 0.0065  59  LYS A O   
446  C  CB  . LYS A  61  ? 0.5107 0.3803 0.3252 0.1397  -0.0633 -0.0071 59  LYS A CB  
447  C  CG  . LYS A  61  ? 0.5293 0.4418 0.3936 0.1261  -0.0678 -0.0102 59  LYS A CG  
448  C  CD  . LYS A  61  ? 0.6026 0.5392 0.4898 0.1385  -0.0870 -0.0202 59  LYS A CD  
449  C  CE  . LYS A  61  ? 0.6778 0.6028 0.5496 0.1512  -0.1050 -0.0268 59  LYS A CE  
450  N  NZ  . LYS A  61  ? 0.7231 0.6822 0.6370 0.1442  -0.1199 -0.0360 59  LYS A NZ  
451  N  N   . GLU A  62  ? 0.5704 0.3508 0.2864 0.1638  -0.0391 0.0017  60  GLU A N   
452  C  CA  . GLU A  62  ? 0.6451 0.3761 0.3078 0.1782  -0.0320 0.0042  60  GLU A CA  
453  C  C   . GLU A  62  ? 0.6477 0.3659 0.2978 0.1784  -0.0375 0.0034  60  GLU A C   
454  O  O   . GLU A  62  ? 0.6528 0.3359 0.2713 0.1762  -0.0216 0.0078  60  GLU A O   
455  C  CB  . GLU A  62  ? 0.7215 0.4349 0.3557 0.2058  -0.0437 0.0006  60  GLU A CB  
456  C  CG  . GLU A  62  ? 0.8589 0.5175 0.4324 0.2254  -0.0404 0.0024  60  GLU A CG  
457  C  CD  . GLU A  62  ? 1.0247 0.6498 0.5572 0.2477  -0.0367 0.0034  60  GLU A CD  
458  O  OE1 . GLU A  62  ? 1.0661 0.7034 0.6133 0.2426  -0.0284 0.0050  60  GLU A OE1 
459  O  OE2 . GLU A  62  ? 1.0736 0.6574 0.5560 0.2717  -0.0421 0.0025  60  GLU A OE2 
460  N  N   . ASP A  63  ? 0.6019 0.3478 0.2774 0.1805  -0.0588 -0.0028 61  ASP A N   
461  C  CA  . ASP A  63  ? 0.6025 0.3358 0.2646 0.1830  -0.0668 -0.0046 61  ASP A CA  
462  C  C   . ASP A  63  ? 0.5751 0.3235 0.2619 0.1591  -0.0571 -0.0012 61  ASP A C   
463  O  O   . ASP A  63  ? 0.5906 0.3339 0.2727 0.1587  -0.0639 -0.0028 61  ASP A O   
464  C  CB  . ASP A  63  ? 0.5963 0.3503 0.2731 0.1967  -0.0950 -0.0146 61  ASP A CB  
465  C  CG  . ASP A  63  ? 0.5682 0.3746 0.3050 0.1795  -0.1045 -0.0193 61  ASP A CG  
466  O  OD1 . ASP A  63  ? 0.5147 0.3399 0.2784 0.1584  -0.0902 -0.0141 61  ASP A OD1 
467  O  OD2 . ASP A  63  ? 0.5838 0.4118 0.3406 0.1878  -0.1264 -0.0292 61  ASP A OD2 
468  N  N   . LYS A  64  ? 0.5661 0.3326 0.2781 0.1408  -0.0425 0.0026  62  LYS A N   
469  C  CA  . LYS A  64  ? 0.5616 0.3397 0.2935 0.1199  -0.0320 0.0056  62  LYS A CA  
470  C  C   . LYS A  64  ? 0.4755 0.2913 0.2483 0.1087  -0.0452 0.0024  62  LYS A C   
471  O  O   . LYS A  64  ? 0.4323 0.2574 0.2200 0.0938  -0.0392 0.0043  62  LYS A O   
472  C  CB  . LYS A  64  ? 0.6417 0.3862 0.3416 0.1217  -0.0228 0.0078  62  LYS A CB  
473  C  CG  . LYS A  64  ? 0.7262 0.4287 0.3849 0.1291  -0.0036 0.0115  62  LYS A CG  
474  C  CD  . LYS A  64  ? 0.7046 0.4142 0.3778 0.1146  0.0148  0.0139  62  LYS A CD  
475  C  CE  . LYS A  64  ? 0.7270 0.3920 0.3591 0.1207  0.0356  0.0168  62  LYS A CE  
476  N  NZ  . LYS A  64  ? 0.6910 0.3625 0.3356 0.1103  0.0495  0.0175  62  LYS A NZ  
477  N  N   . SER A  65  ? 0.4424 0.2790 0.2333 0.1162  -0.0628 -0.0032 63  SER A N   
478  C  CA  . SER A  65  ? 0.4024 0.2758 0.2361 0.1033  -0.0713 -0.0063 63  SER A CA  
479  C  C   . SER A  65  ? 0.3466 0.2419 0.2057 0.0920  -0.0608 -0.0034 63  SER A C   
480  O  O   . SER A  65  ? 0.3352 0.2214 0.1819 0.0975  -0.0524 -0.0011 63  SER A O   
481  C  CB  . SER A  65  ? 0.4183 0.3072 0.2659 0.1146  -0.0929 -0.0155 63  SER A CB  
482  O  OG  . SER A  65  ? 0.4611 0.3315 0.2876 0.1230  -0.1040 -0.0189 63  SER A OG  
483  N  N   . TYR A  66  ? 0.3062 0.2266 0.1973 0.0768  -0.0605 -0.0034 64  TYR A N   
484  C  CA  . TYR A  66  ? 0.2908 0.2320 0.2058 0.0673  -0.0520 -0.0012 64  TYR A CA  
485  C  C   . TYR A  66  ? 0.2806 0.2491 0.2267 0.0692  -0.0622 -0.0074 64  TYR A C   
486  O  O   . TYR A  66  ? 0.2697 0.2508 0.2338 0.0666  -0.0733 -0.0127 64  TYR A O   
487  C  CB  . TYR A  66  ? 0.2626 0.2118 0.1909 0.0504  -0.0435 0.0025  64  TYR A CB  
488  C  CG  . TYR A  66  ? 0.2640 0.1955 0.1728 0.0456  -0.0309 0.0071  64  TYR A CG  
489  C  CD1 . TYR A  66  ? 0.2664 0.1899 0.1690 0.0402  -0.0304 0.0079  64  TYR A CD1 
490  C  CD2 . TYR A  66  ? 0.2673 0.1924 0.1675 0.0455  -0.0192 0.0096  64  TYR A CD2 
491  C  CE1 . TYR A  66  ? 0.2724 0.1839 0.1630 0.0354  -0.0187 0.0101  64  TYR A CE1 
492  C  CE2 . TYR A  66  ? 0.2699 0.1823 0.1583 0.0393  -0.0078 0.0115  64  TYR A CE2 
493  C  CZ  . TYR A  66  ? 0.2715 0.1785 0.1567 0.0344  -0.0076 0.0113  64  TYR A CZ  
494  O  OH  . TYR A  66  ? 0.2861 0.1842 0.1646 0.0282  0.0034  0.0112  64  TYR A OH  
495  N  N   . ASN A  67  ? 0.2768 0.2549 0.2310 0.0729  -0.0575 -0.0073 65  ASN A N   
496  C  CA  A ASN A  67  ? 0.2610 0.2690 0.2520 0.0675  -0.0587 -0.0111 65  ASN A CA  
497  C  CA  B ASN A  67  ? 0.2570 0.2651 0.2482 0.0672  -0.0583 -0.0109 65  ASN A CA  
498  C  C   . ASN A  67  ? 0.2315 0.2468 0.2355 0.0502  -0.0448 -0.0052 65  ASN A C   
499  O  O   . ASN A  67  ? 0.2246 0.2289 0.2135 0.0472  -0.0328 0.0008  65  ASN A O   
500  C  CB  A ASN A  67  ? 0.2806 0.2951 0.2738 0.0805  -0.0594 -0.0138 65  ASN A CB  
501  C  CB  B ASN A  67  ? 0.2699 0.2844 0.2634 0.0783  -0.0566 -0.0125 65  ASN A CB  
502  C  CG  A ASN A  67  ? 0.3209 0.3456 0.3230 0.0959  -0.0779 -0.0241 65  ASN A CG  
503  C  CG  B ASN A  67  ? 0.2870 0.3272 0.3104 0.0861  -0.0700 -0.0229 65  ASN A CG  
504  O  OD1 A ASN A  67  ? 0.3675 0.3877 0.3579 0.1125  -0.0821 -0.0268 65  ASN A OD1 
505  O  OD1 B ASN A  67  ? 0.3300 0.3679 0.3483 0.0984  -0.0862 -0.0301 65  ASN A OD1 
506  N  ND2 A ASN A  67  ? 0.3232 0.3598 0.3440 0.0917  -0.0899 -0.0308 65  ASN A ND2 
507  N  ND2 B ASN A  67  ? 0.2771 0.3426 0.3332 0.0792  -0.0632 -0.0246 65  ASN A ND2 
508  N  N   . VAL A  68  ? 0.2001 0.2320 0.2306 0.0395  -0.0466 -0.0078 66  VAL A N   
509  C  CA  . VAL A  68  ? 0.1786 0.2125 0.2161 0.0251  -0.0344 -0.0024 66  VAL A CA  
510  C  C   . VAL A  68  ? 0.1689 0.2249 0.2384 0.0189  -0.0285 -0.0049 66  VAL A C   
511  O  O   . VAL A  68  ? 0.1691 0.2419 0.2654 0.0171  -0.0356 -0.0124 66  VAL A O   
512  C  CB  . VAL A  68  ? 0.1766 0.2032 0.2111 0.0168  -0.0381 -0.0018 66  VAL A CB  
513  C  CG1 . VAL A  68  ? 0.1686 0.1919 0.2024 0.0050  -0.0260 0.0042  66  VAL A CG1 
514  C  CG2 . VAL A  68  ? 0.1830 0.1889 0.1885 0.0238  -0.0437 -0.0005 66  VAL A CG2 
515  N  N   . THR A  69  ? 0.1619 0.2173 0.2290 0.0154  -0.0148 0.0004  67  THR A N   
516  C  CA  . THR A  69  ? 0.1635 0.2364 0.2573 0.0105  -0.0055 -0.0011 67  THR A CA  
517  C  C   . THR A  69  ? 0.1679 0.2323 0.2566 -0.0009 0.0086  0.0055  67  THR A C   
518  O  O   . THR A  69  ? 0.1710 0.2197 0.2348 -0.0004 0.0143  0.0116  67  THR A O   
519  C  CB  . THR A  69  ? 0.1652 0.2438 0.2587 0.0206  -0.0014 -0.0013 67  THR A CB  
520  O  OG1 . THR A  69  ? 0.1678 0.2481 0.2572 0.0344  -0.0151 -0.0069 67  THR A OG1 
521  C  CG2 . THR A  69  ? 0.1596 0.2593 0.2855 0.0164  0.0082  -0.0046 67  THR A CG2 
522  N  N   . SER A  70  ? 0.1774 0.2500 0.2881 -0.0110 0.0139  0.0034  68  SER A N   
523  C  CA  . SER A  70  ? 0.1872 0.2473 0.2891 -0.0202 0.0284  0.0099  68  SER A CA  
524  C  C   . SER A  70  ? 0.1904 0.2608 0.3112 -0.0230 0.0436  0.0096  68  SER A C   
525  O  O   . SER A  70  ? 0.1856 0.2773 0.3397 -0.0244 0.0433  0.0022  68  SER A O   
526  C  CB  . SER A  70  ? 0.1981 0.2519 0.3044 -0.0302 0.0270  0.0090  68  SER A CB  
527  O  OG  . SER A  70  ? 0.2013 0.2392 0.2817 -0.0279 0.0179  0.0120  68  SER A OG  
528  N  N   . VAL A  71  ? 0.2014 0.2571 0.3013 -0.0229 0.0564  0.0168  69  VAL A N   
529  C  CA  . VAL A  71  ? 0.2150 0.2754 0.3263 -0.0244 0.0733  0.0179  69  VAL A CA  
530  C  C   . VAL A  71  ? 0.2317 0.2729 0.3315 -0.0335 0.0890  0.0235  69  VAL A C   
531  O  O   . VAL A  71  ? 0.2318 0.2503 0.2982 -0.0318 0.0891  0.0296  69  VAL A O   
532  C  CB  . VAL A  71  ? 0.2232 0.2773 0.3136 -0.0145 0.0764  0.0218  69  VAL A CB  
533  C  CG1 . VAL A  71  ? 0.2345 0.2954 0.3384 -0.0143 0.0934  0.0221  69  VAL A CG1 
534  C  CG2 . VAL A  71  ? 0.2214 0.2845 0.3112 -0.0046 0.0611  0.0179  69  VAL A CG2 
535  N  N   . LEU A  72  ? 0.2415 0.2909 0.3685 -0.0424 0.1026  0.0204  70  LEU A N   
536  C  CA  . LEU A  72  ? 0.2724 0.2995 0.3874 -0.0513 0.1203  0.0256  70  LEU A CA  
537  C  C   . LEU A  72  ? 0.2913 0.3189 0.4173 -0.0537 0.1435  0.0268  70  LEU A C   
538  O  O   . LEU A  72  ? 0.2676 0.3217 0.4279 -0.0530 0.1457  0.0202  70  LEU A O   
539  C  CB  . LEU A  72  ? 0.2852 0.3160 0.4229 -0.0634 0.1195  0.0204  70  LEU A CB  
540  C  CG  . LEU A  72  ? 0.2845 0.3082 0.4081 -0.0628 0.1005  0.0200  70  LEU A CG  
541  C  CD1 . LEU A  72  ? 0.2697 0.3175 0.4095 -0.0556 0.0791  0.0131  70  LEU A CD1 
542  C  CD2 . LEU A  72  ? 0.2952 0.3119 0.4314 -0.0756 0.1053  0.0169  70  LEU A CD2 
543  N  N   . PHE A  73  ? 0.3129 0.3101 0.4086 -0.0553 0.1610  0.0348  71  PHE A N   
544  C  CA  . PHE A  73  ? 0.3373 0.3284 0.4398 -0.0590 0.1873  0.0367  71  PHE A CA  
545  C  C   . PHE A  73  ? 0.3647 0.3482 0.4857 -0.0741 0.2046  0.0346  71  PHE A C   
546  O  O   . PHE A  73  ? 0.3795 0.3317 0.4698 -0.0771 0.2096  0.0404  71  PHE A O   
547  C  CB  . PHE A  73  ? 0.3542 0.3110 0.4062 -0.0498 0.1973  0.0467  71  PHE A CB  
548  C  CG  . PHE A  73  ? 0.3682 0.3140 0.4199 -0.0511 0.2254  0.0497  71  PHE A CG  
549  C  CD1 . PHE A  73  ? 0.3564 0.3305 0.4450 -0.0512 0.2329  0.0442  71  PHE A CD1 
550  C  CD2 . PHE A  73  ? 0.4089 0.3137 0.4202 -0.0506 0.2446  0.0580  71  PHE A CD2 
551  C  CE1 . PHE A  73  ? 0.3896 0.3533 0.4780 -0.0521 0.2605  0.0469  71  PHE A CE1 
552  C  CE2 . PHE A  73  ? 0.4389 0.3292 0.4456 -0.0511 0.2727  0.0614  71  PHE A CE2 
553  C  CZ  . PHE A  73  ? 0.4289 0.3497 0.4759 -0.0526 0.2815  0.0558  71  PHE A CZ  
554  N  N   . ARG A  74  ? 0.3907 0.4029 0.5626 -0.0832 0.2135  0.0254  72  ARG A N   
555  C  CA  . ARG A  74  ? 0.4315 0.4389 0.6275 -0.0998 0.2317  0.0212  72  ARG A CA  
556  C  C   . ARG A  74  ? 0.4297 0.4604 0.6732 -0.1080 0.2538  0.0134  72  ARG A C   
557  O  O   . ARG A  74  ? 0.3940 0.4621 0.6739 -0.1030 0.2446  0.0050  72  ARG A O   
558  C  CB  . ARG A  74  ? 0.4617 0.4840 0.6805 -0.1073 0.2118  0.0131  72  ARG A CB  
559  C  CG  . ARG A  74  ? 0.4781 0.5469 0.7462 -0.1056 0.1915  -0.0002 72  ARG A CG  
560  C  CD  . ARG A  74  ? 0.5359 0.6115 0.8158 -0.1111 0.1710  -0.0072 72  ARG A CD  
561  N  NE  . ARG A  74  ? 0.5864 0.6522 0.8857 -0.1293 0.1878  -0.0117 72  ARG A NE  
562  C  CZ  . ARG A  74  ? 0.5674 0.6600 0.9223 -0.1421 0.1979  -0.0251 72  ARG A CZ  
563  N  NH1 . ARG A  74  ? 0.6036 0.6825 0.9725 -0.1598 0.2146  -0.0290 72  ARG A NH1 
564  N  NH2 . ARG A  74  ? 0.5304 0.6635 0.9279 -0.1372 0.1915  -0.0357 72  ARG A NH2 
565  N  N   . LYS A  75  ? 0.4764 0.4831 0.7183 -0.1201 0.2842  0.0160  73  LYS A N   
566  C  CA  . LYS A  75  ? 0.4968 0.5208 0.7821 -0.1293 0.3112  0.0090  73  LYS A CA  
567  C  C   . LYS A  75  ? 0.4554 0.4897 0.7354 -0.1154 0.3152  0.0121  73  LYS A C   
568  O  O   . LYS A  75  ? 0.4438 0.5135 0.7729 -0.1173 0.3227  0.0023  73  LYS A O   
569  C  CB  . LYS A  75  ? 0.5223 0.5934 0.8785 -0.1411 0.3018  -0.0089 73  LYS A CB  
570  C  CG  . LYS A  75  ? 0.5968 0.6558 0.9621 -0.1576 0.3030  -0.0134 73  LYS A CG  
571  C  CD  . LYS A  75  ? 0.6259 0.7333 1.0594 -0.1669 0.2866  -0.0330 73  LYS A CD  
572  C  CE  . LYS A  75  ? 0.6721 0.7800 1.1483 -0.1904 0.3133  -0.0434 73  LYS A CE  
573  N  NZ  . LYS A  75  ? 0.7094 0.7781 1.1540 -0.2009 0.3158  -0.0380 73  LYS A NZ  
574  N  N   . LYS A  76  ? 0.4389 0.4428 0.6599 -0.1009 0.3094  0.0249  74  LYS A N   
575  C  CA  . LYS A  76  ? 0.4380 0.4406 0.6417 -0.0873 0.3154  0.0297  74  LYS A CA  
576  C  C   . LYS A  76  ? 0.3819 0.4257 0.6124 -0.0763 0.2903  0.0224  74  LYS A C   
577  O  O   . LYS A  76  ? 0.3803 0.4314 0.6105 -0.0666 0.2968  0.0233  74  LYS A O   
578  C  CB  . LYS A  76  ? 0.4796 0.4760 0.7000 -0.0942 0.3530  0.0295  74  LYS A CB  
579  C  CG  . LYS A  76  ? 0.5420 0.4843 0.7165 -0.0997 0.3806  0.0403  74  LYS A CG  
580  C  CD  . LYS A  76  ? 0.5976 0.5317 0.7901 -0.1080 0.4214  0.0396  74  LYS A CD  
581  C  CE  . LYS A  76  ? 0.6572 0.5339 0.8047 -0.1151 0.4507  0.0495  74  LYS A CE  
582  N  NZ  . LYS A  76  ? 0.7020 0.5625 0.8564 -0.1209 0.4938  0.0509  74  LYS A NZ  
583  N  N   . LYS A  77  ? 0.3396 0.4064 0.5887 -0.0767 0.2622  0.0155  75  LYS A N   
584  C  CA  . LYS A  77  ? 0.3011 0.4016 0.5697 -0.0649 0.2373  0.0087  75  LYS A CA  
585  C  C   . LYS A  77  ? 0.2789 0.3722 0.5189 -0.0583 0.2080  0.0115  75  LYS A C   
586  O  O   . LYS A  77  ? 0.2793 0.3511 0.4982 -0.0648 0.2048  0.0156  75  LYS A O   
587  C  CB  . LYS A  77  ? 0.2814 0.4275 0.6171 -0.0711 0.2334  -0.0072 75  LYS A CB  
588  C  CG  . LYS A  77  ? 0.2934 0.4542 0.6660 -0.0768 0.2621  -0.0124 75  LYS A CG  
589  C  CD  . LYS A  77  ? 0.2726 0.4856 0.7123 -0.0766 0.2525  -0.0303 75  LYS A CD  
590  C  CE  . LYS A  77  ? 0.2872 0.5163 0.7691 -0.0846 0.2838  -0.0369 75  LYS A CE  
591  N  NZ  . LYS A  77  ? 0.2712 0.5551 0.8228 -0.0831 0.2733  -0.0566 75  LYS A NZ  
592  N  N   . CYS A  78  ? 0.2638 0.3729 0.5015 -0.0449 0.1882  0.0094  76  CYS A N   
593  C  CA  . CYS A  78  ? 0.2487 0.3549 0.4662 -0.0389 0.1614  0.0101  76  CYS A CA  
594  C  C   . CYS A  78  ? 0.2395 0.3746 0.4967 -0.0427 0.1443  -0.0015 76  CYS A C   
595  O  O   . CYS A  78  ? 0.2219 0.3888 0.5191 -0.0394 0.1408  -0.0119 76  CYS A O   
596  C  CB  . CYS A  78  ? 0.2434 0.3488 0.4378 -0.0233 0.1500  0.0129  76  CYS A CB  
597  S  SG  . CYS A  78  ? 0.2717 0.3443 0.4199 -0.0175 0.1681  0.0246  76  CYS A SG  
598  N  N   . ASP A  79  ? 0.2587 0.3821 0.5043 -0.0487 0.1332  -0.0006 77  ASP A N   
599  C  CA  . ASP A  79  ? 0.2911 0.4363 0.5691 -0.0531 0.1168  -0.0116 77  ASP A CA  
600  C  C   . ASP A  79  ? 0.2703 0.4097 0.5218 -0.0426 0.0915  -0.0100 77  ASP A C   
601  O  O   . ASP A  79  ? 0.2765 0.3894 0.4865 -0.0400 0.0898  -0.0002 77  ASP A O   
602  C  CB  . ASP A  79  ? 0.3710 0.5038 0.6563 -0.0698 0.1271  -0.0121 77  ASP A CB  
603  C  CG  . ASP A  79  ? 0.4433 0.5939 0.7563 -0.0746 0.1082  -0.0234 77  ASP A CG  
604  O  OD1 . ASP A  79  ? 0.5342 0.6653 0.8312 -0.0824 0.1055  -0.0206 77  ASP A OD1 
605  O  OD2 . ASP A  79  ? 0.4716 0.6545 0.8206 -0.0692 0.0950  -0.0355 77  ASP A OD2 
606  N  N   . TYR A  80  ? 0.2509 0.4142 0.5260 -0.0359 0.0722  -0.0204 78  TYR A N   
607  C  CA  . TYR A  80  ? 0.2441 0.3999 0.4925 -0.0241 0.0507  -0.0190 78  TYR A CA  
608  C  C   . TYR A  80  ? 0.2456 0.4099 0.5094 -0.0269 0.0327  -0.0279 78  TYR A C   
609  O  O   . TYR A  80  ? 0.2709 0.4617 0.5750 -0.0282 0.0268  -0.0405 78  TYR A O   
610  C  CB  . TYR A  80  ? 0.2321 0.4016 0.4825 -0.0078 0.0431  -0.0223 78  TYR A CB  
611  C  CG  . TYR A  80  ? 0.2303 0.3894 0.4619 -0.0035 0.0592  -0.0139 78  TYR A CG  
612  C  CD1 . TYR A  80  ? 0.2312 0.3649 0.4192 0.0024  0.0582  -0.0042 78  TYR A CD1 
613  C  CD2 . TYR A  80  ? 0.2363 0.4108 0.4948 -0.0058 0.0761  -0.0166 78  TYR A CD2 
614  C  CE1 . TYR A  80  ? 0.2369 0.3598 0.4067 0.0064  0.0718  0.0023  78  TYR A CE1 
615  C  CE2 . TYR A  80  ? 0.2403 0.4027 0.4786 -0.0011 0.0910  -0.0088 78  TYR A CE2 
616  C  CZ  . TYR A  80  ? 0.2453 0.3814 0.4382 0.0051  0.0879  0.0004  78  TYR A CZ  
617  O  OH  . TYR A  80  ? 0.2563 0.3788 0.4274 0.0100  0.1014  0.0071  78  TYR A OH  
618  N  N   . TRP A  81  ? 0.2405 0.3828 0.4735 -0.0278 0.0240  -0.0223 79  TRP A N   
619  C  CA  . TRP A  81  ? 0.2361 0.3823 0.4751 -0.0269 0.0047  -0.0300 79  TRP A CA  
620  C  C   . TRP A  81  ? 0.2173 0.3519 0.4242 -0.0118 -0.0117 -0.0275 79  TRP A C   
621  O  O   . TRP A  81  ? 0.2160 0.3273 0.3868 -0.0102 -0.0090 -0.0176 79  TRP A O   
622  C  CB  . TRP A  81  ? 0.2640 0.3928 0.4947 -0.0404 0.0083  -0.0269 79  TRP A CB  
623  C  CG  . TRP A  81  ? 0.2855 0.4166 0.5208 -0.0391 -0.0116 -0.0351 79  TRP A CG  
624  C  CD1 . TRP A  81  ? 0.2888 0.4436 0.5547 -0.0343 -0.0274 -0.0492 79  TRP A CD1 
625  C  CD2 . TRP A  81  ? 0.2972 0.4055 0.5038 -0.0406 -0.0189 -0.0305 79  TRP A CD2 
626  N  NE1 . TRP A  81  ? 0.2968 0.4428 0.5526 -0.0330 -0.0440 -0.0533 79  TRP A NE1 
627  C  CE2 . TRP A  81  ? 0.3023 0.4198 0.5221 -0.0370 -0.0383 -0.0415 79  TRP A CE2 
628  C  CE3 . TRP A  81  ? 0.3062 0.3880 0.4780 -0.0436 -0.0117 -0.0190 79  TRP A CE3 
629  C  CZ2 . TRP A  81  ? 0.3235 0.4226 0.5209 -0.0369 -0.0489 -0.0404 79  TRP A CZ2 
630  C  CZ3 . TRP A  81  ? 0.3414 0.4075 0.4939 -0.0433 -0.0224 -0.0184 79  TRP A CZ3 
631  C  CH2 . TRP A  81  ? 0.3356 0.4096 0.5002 -0.0402 -0.0400 -0.0285 79  TRP A CH2 
632  N  N   . ILE A  82  ? 0.2098 0.3602 0.4302 -0.0002 -0.0284 -0.0375 80  ILE A N   
633  C  CA  . ILE A  82  ? 0.2192 0.3555 0.4077 0.0154  -0.0427 -0.0359 80  ILE A CA  
634  C  C   . ILE A  82  ? 0.2344 0.3659 0.4193 0.0168  -0.0602 -0.0422 80  ILE A C   
635  O  O   . ILE A  82  ? 0.2205 0.3716 0.4375 0.0146  -0.0700 -0.0541 80  ILE A O   
636  C  CB  . ILE A  82  ? 0.2241 0.3755 0.4212 0.0319  -0.0502 -0.0424 80  ILE A CB  
637  C  CG1 . ILE A  82  ? 0.2288 0.3844 0.4292 0.0310  -0.0323 -0.0365 80  ILE A CG1 
638  C  CG2 . ILE A  82  ? 0.2269 0.3572 0.3852 0.0489  -0.0631 -0.0403 80  ILE A CG2 
639  C  CD1 . ILE A  82  ? 0.2295 0.4068 0.4503 0.0450  -0.0371 -0.0449 80  ILE A CD1 
640  N  N   . ARG A  83  ? 0.2672 0.3727 0.4140 0.0208  -0.0641 -0.0351 81  ARG A N   
641  C  CA  . ARG A  83  ? 0.3016 0.3984 0.4376 0.0264  -0.0814 -0.0406 81  ARG A CA  
642  C  C   . ARG A  83  ? 0.2926 0.3614 0.3836 0.0385  -0.0849 -0.0338 81  ARG A C   
643  O  O   . ARG A  83  ? 0.2686 0.3262 0.3396 0.0412  -0.0739 -0.0255 81  ARG A O   
644  C  CB  . ARG A  83  ? 0.3179 0.4106 0.4619 0.0109  -0.0794 -0.0405 81  ARG A CB  
645  C  CG  . ARG A  83  ? 0.3271 0.3969 0.4429 0.0031  -0.0665 -0.0279 81  ARG A CG  
646  C  CD  . ARG A  83  ? 0.3894 0.4631 0.5113 -0.0047 -0.0477 -0.0207 81  ARG A CD  
647  N  NE  . ARG A  83  ? 0.4131 0.4683 0.5149 -0.0135 -0.0372 -0.0115 81  ARG A NE  
648  C  CZ  . ARG A  83  ? 0.4403 0.4909 0.5358 -0.0182 -0.0221 -0.0042 81  ARG A CZ  
649  N  NH1 . ARG A  83  ? 0.4072 0.4698 0.5152 -0.0163 -0.0140 -0.0042 81  ARG A NH1 
650  N  NH2 . ARG A  83  ? 0.4502 0.4836 0.5255 -0.0234 -0.0158 0.0025  81  ARG A NH2 
651  N  N   . THR A  84  ? 0.2834 0.3399 0.3588 0.0456  -0.0993 -0.0380 82  THR A N   
652  C  CA  . THR A  84  ? 0.2782 0.3067 0.3112 0.0587  -0.1024 -0.0333 82  THR A CA  
653  C  C   . THR A  84  ? 0.2577 0.2661 0.2706 0.0513  -0.1001 -0.0281 82  THR A C   
654  O  O   . THR A  84  ? 0.2601 0.2717 0.2836 0.0465  -0.1090 -0.0334 82  THR A O   
655  C  CB  . THR A  84  ? 0.3003 0.3271 0.3255 0.0783  -0.1219 -0.0433 82  THR A CB  
656  O  OG1 . THR A  84  ? 0.2933 0.3396 0.3372 0.0866  -0.1235 -0.0482 82  THR A OG1 
657  C  CG2 . THR A  84  ? 0.3377 0.3293 0.3138 0.0929  -0.1230 -0.0382 82  THR A CG2 
658  N  N   . PHE A  85  ? 0.2499 0.2376 0.2346 0.0508  -0.0881 -0.0187 83  PHE A N   
659  C  CA  . PHE A  85  ? 0.2472 0.2138 0.2088 0.0480  -0.0865 -0.0147 83  PHE A CA  
660  C  C   . PHE A  85  ? 0.2724 0.2119 0.1971 0.0634  -0.0909 -0.0146 83  PHE A C   
661  O  O   . PHE A  85  ? 0.2790 0.2054 0.1839 0.0703  -0.0824 -0.0106 83  PHE A O   
662  C  CB  . PHE A  85  ? 0.2304 0.1927 0.1873 0.0371  -0.0701 -0.0062 83  PHE A CB  
663  C  CG  . PHE A  85  ? 0.2125 0.1914 0.1948 0.0228  -0.0649 -0.0051 83  PHE A CG  
664  C  CD1 . PHE A  85  ? 0.2069 0.1824 0.1846 0.0146  -0.0525 0.0013  83  PHE A CD1 
665  C  CD2 . PHE A  85  ? 0.2124 0.2090 0.2226 0.0180  -0.0718 -0.0112 83  PHE A CD2 
666  C  CE1 . PHE A  85  ? 0.1971 0.1823 0.1916 0.0036  -0.0469 0.0029  83  PHE A CE1 
667  C  CE2 . PHE A  85  ? 0.2042 0.2108 0.2340 0.0047  -0.0638 -0.0095 83  PHE A CE2 
668  C  CZ  . PHE A  85  ? 0.1981 0.1970 0.2172 -0.0015 -0.0512 -0.0017 83  PHE A CZ  
669  N  N   . VAL A  86  ? 0.2885 0.2173 0.2024 0.0691  -0.1033 -0.0193 84  VAL A N   
670  C  CA  . VAL A  86  ? 0.3201 0.2187 0.1948 0.0851  -0.1076 -0.0195 84  VAL A CA  
671  C  C   . VAL A  86  ? 0.3218 0.1980 0.1734 0.0802  -0.0964 -0.0130 84  VAL A C   
672  O  O   . VAL A  86  ? 0.3131 0.1946 0.1757 0.0701  -0.0975 -0.0130 84  VAL A O   
673  C  CB  . VAL A  86  ? 0.3546 0.2523 0.2276 0.0970  -0.1296 -0.0298 84  VAL A CB  
674  C  CG1 . VAL A  86  ? 0.3898 0.2504 0.2152 0.1157  -0.1335 -0.0295 84  VAL A CG1 
675  C  CG2 . VAL A  86  ? 0.3562 0.2800 0.2569 0.1030  -0.1419 -0.0386 84  VAL A CG2 
676  N  N   . PRO A  87  ? 0.3442 0.1941 0.1638 0.0874  -0.0846 -0.0081 85  PRO A N   
677  C  CA  . PRO A  87  ? 0.3498 0.1806 0.1513 0.0824  -0.0719 -0.0032 85  PRO A CA  
678  C  C   . PRO A  87  ? 0.3605 0.1802 0.1514 0.0855  -0.0822 -0.0062 85  PRO A C   
679  O  O   . PRO A  87  ? 0.3772 0.1841 0.1509 0.0993  -0.0962 -0.0112 85  PRO A O   
680  C  CB  . PRO A  87  ? 0.3779 0.1776 0.1433 0.0935  -0.0597 0.0000  85  PRO A CB  
681  C  CG  . PRO A  87  ? 0.3827 0.1906 0.1530 0.0997  -0.0620 -0.0010 85  PRO A CG  
682  C  CD  . PRO A  87  ? 0.3705 0.2049 0.1677 0.1015  -0.0821 -0.0077 85  PRO A CD  
683  N  N   . GLY A  88  ? 0.3622 0.1859 0.1619 0.0739  -0.0758 -0.0037 86  GLY A N   
684  C  CA  . GLY A  88  ? 0.3813 0.1935 0.1706 0.0757  -0.0837 -0.0059 86  GLY A CA  
685  C  C   . GLY A  88  ? 0.4079 0.1919 0.1673 0.0795  -0.0703 -0.0021 86  GLY A C   
686  O  O   . GLY A  88  ? 0.4183 0.1806 0.1526 0.0874  -0.0591 0.0002  86  GLY A O   
687  N  N   . SER A  89  ? 0.3956 0.1789 0.1576 0.0738  -0.0701 -0.0018 87  SER A N   
688  C  CA  . SER A  89  ? 0.4285 0.1837 0.1612 0.0800  -0.0622 -0.0004 87  SER A CA  
689  C  C   . SER A  89  ? 0.4454 0.1951 0.1750 0.0752  -0.0395 0.0036  87  SER A C   
690  O  O   . SER A  89  ? 0.4602 0.1842 0.1643 0.0810  -0.0282 0.0047  87  SER A O   
691  C  CB  . SER A  89  ? 0.4167 0.1750 0.1558 0.0754  -0.0694 -0.0019 87  SER A CB  
692  O  OG  . SER A  89  ? 0.3815 0.1607 0.1460 0.0622  -0.0608 0.0004  87  SER A OG  
693  N  N   . GLN A  90  ? 0.4443 0.2180 0.2006 0.0644  -0.0325 0.0049  88  GLN A N   
694  C  CA  . GLN A  90  ? 0.4503 0.2228 0.2093 0.0587  -0.0121 0.0065  88  GLN A CA  
695  C  C   . GLN A  90  ? 0.4179 0.2130 0.2002 0.0508  -0.0092 0.0069  88  GLN A C   
696  O  O   . GLN A  90  ? 0.3774 0.1932 0.1789 0.0473  -0.0214 0.0067  88  GLN A O   
697  C  CB  . GLN A  90  ? 0.4492 0.2301 0.2205 0.0516  -0.0057 0.0056  88  GLN A CB  
698  C  CG  . GLN A  90  ? 0.4373 0.2444 0.2347 0.0439  -0.0181 0.0051  88  GLN A CG  
699  C  CD  . GLN A  90  ? 0.4391 0.2480 0.2402 0.0419  -0.0172 0.0041  88  GLN A CD  
700  O  OE1 . GLN A  90  ? 0.4309 0.2289 0.2234 0.0439  -0.0049 0.0030  88  GLN A OE1 
701  N  NE2 . GLN A  90  ? 0.4463 0.2684 0.2604 0.0379  -0.0291 0.0042  88  GLN A NE2 
702  N  N   . PRO A  91  ? 0.4169 0.2069 0.1977 0.0475  0.0080  0.0071  89  PRO A N   
703  C  CA  . PRO A  91  ? 0.3915 0.1983 0.1894 0.0417  0.0106  0.0072  89  PRO A CA  
704  C  C   . PRO A  91  ? 0.3472 0.1853 0.1765 0.0315  0.0039  0.0064  89  PRO A C   
705  O  O   . PRO A  91  ? 0.3100 0.1566 0.1502 0.0263  0.0067  0.0047  89  PRO A O   
706  C  CB  . PRO A  91  ? 0.4036 0.1972 0.1950 0.0382  0.0319  0.0060  89  PRO A CB  
707  C  CG  . PRO A  91  ? 0.4346 0.1963 0.1961 0.0462  0.0406  0.0065  89  PRO A CG  
708  C  CD  . PRO A  91  ? 0.4480 0.2149 0.2112 0.0488  0.0271  0.0065  89  PRO A CD  
709  N  N   . GLY A  92  ? 0.3280 0.1814 0.1698 0.0302  -0.0047 0.0075  90  GLY A N   
710  C  CA  . GLY A  92  ? 0.2894 0.1673 0.1556 0.0222  -0.0106 0.0075  90  GLY A CA  
711  C  C   . GLY A  92  ? 0.2764 0.1602 0.1481 0.0227  -0.0249 0.0080  90  GLY A C   
712  O  O   . GLY A  92  ? 0.2406 0.1401 0.1289 0.0165  -0.0288 0.0085  90  GLY A O   
713  N  N   . GLU A  93  ? 0.2925 0.1614 0.1487 0.0303  -0.0322 0.0072  91  GLU A N   
714  C  CA  . GLU A  93  ? 0.2982 0.1716 0.1605 0.0305  -0.0464 0.0057  91  GLU A CA  
715  C  C   . GLU A  93  ? 0.2933 0.1671 0.1549 0.0375  -0.0567 0.0032  91  GLU A C   
716  O  O   . GLU A  93  ? 0.3344 0.1937 0.1774 0.0469  -0.0549 0.0029  91  GLU A O   
717  C  CB  . GLU A  93  ? 0.3366 0.1934 0.1828 0.0342  -0.0493 0.0048  91  GLU A CB  
718  C  CG  . GLU A  93  ? 0.3561 0.2171 0.2104 0.0315  -0.0623 0.0027  91  GLU A CG  
719  C  CD  . GLU A  93  ? 0.3912 0.2377 0.2317 0.0332  -0.0627 0.0025  91  GLU A CD  
720  O  OE1 . GLU A  93  ? 0.4488 0.2978 0.2917 0.0295  -0.0538 0.0044  91  GLU A OE1 
721  O  OE2 . GLU A  93  ? 0.4048 0.2377 0.2321 0.0392  -0.0727 -0.0002 91  GLU A OE2 
722  N  N   . PHE A  94  ? 0.2805 0.1712 0.1632 0.0330  -0.0665 0.0007  92  PHE A N   
723  C  CA  . PHE A  94  ? 0.2796 0.1780 0.1700 0.0390  -0.0769 -0.0036 92  PHE A CA  
724  C  C   . PHE A  94  ? 0.2840 0.1923 0.1917 0.0355  -0.0906 -0.0094 92  PHE A C   
725  O  O   . PHE A  94  ? 0.2709 0.1840 0.1898 0.0254  -0.0890 -0.0085 92  PHE A O   
726  C  CB  . PHE A  94  ? 0.2649 0.1812 0.1735 0.0349  -0.0702 -0.0019 92  PHE A CB  
727  C  CG  . PHE A  94  ? 0.2656 0.1735 0.1608 0.0356  -0.0561 0.0028  92  PHE A CG  
728  C  CD1 . PHE A  94  ? 0.2612 0.1727 0.1610 0.0264  -0.0456 0.0062  92  PHE A CD1 
729  C  CD2 . PHE A  94  ? 0.2769 0.1719 0.1540 0.0460  -0.0537 0.0027  92  PHE A CD2 
730  C  CE1 . PHE A  94  ? 0.2668 0.1723 0.1578 0.0261  -0.0332 0.0084  92  PHE A CE1 
731  C  CE2 . PHE A  94  ? 0.2879 0.1732 0.1533 0.0451  -0.0393 0.0061  92  PHE A CE2 
732  C  CZ  . PHE A  94  ? 0.2724 0.1645 0.1470 0.0344  -0.0292 0.0083  92  PHE A CZ  
733  N  N   . THR A  95  ? 0.3064 0.2172 0.2164 0.0443  -0.1042 -0.0165 93  THR A N   
734  C  CA  . THR A  95  ? 0.3060 0.2340 0.2431 0.0394  -0.1168 -0.0247 93  THR A CA  
735  C  C   . THR A  95  ? 0.2915 0.2431 0.2551 0.0398  -0.1191 -0.0290 93  THR A C   
736  O  O   . THR A  95  ? 0.2864 0.2370 0.2411 0.0477  -0.1143 -0.0262 93  THR A O   
737  C  CB  . THR A  95  ? 0.3384 0.2529 0.2610 0.0499  -0.1345 -0.0329 93  THR A CB  
738  O  OG1 . THR A  95  ? 0.3758 0.2778 0.2750 0.0677  -0.1412 -0.0350 93  THR A OG1 
739  C  CG2 . THR A  95  ? 0.3662 0.2575 0.2640 0.0489  -0.1313 -0.0287 93  THR A CG2 
740  N  N   . LEU A  96  ? 0.2927 0.2652 0.2898 0.0308  -0.1249 -0.0363 94  LEU A N   
741  C  CA  . LEU A  96  ? 0.2770 0.2751 0.3049 0.0307  -0.1269 -0.0423 94  LEU A CA  
742  C  C   . LEU A  96  ? 0.2947 0.2937 0.3176 0.0481  -0.1458 -0.0525 94  LEU A C   
743  O  O   . LEU A  96  ? 0.3106 0.3013 0.3262 0.0535  -0.1609 -0.0601 94  LEU A O   
744  C  CB  . LEU A  96  ? 0.2610 0.2797 0.3279 0.0145  -0.1253 -0.0481 94  LEU A CB  
745  C  CG  . LEU A  96  ? 0.2435 0.2900 0.3472 0.0090  -0.1192 -0.0521 94  LEU A CG  
746  C  CD1 . LEU A  96  ? 0.2333 0.2772 0.3275 0.0062  -0.1007 -0.0401 94  LEU A CD1 
747  C  CD2 . LEU A  96  ? 0.2359 0.2969 0.3753 -0.0080 -0.1160 -0.0588 94  LEU A CD2 
748  N  N   . GLY A  97  ? 0.2978 0.3052 0.3223 0.0585  -0.1458 -0.0533 95  GLY A N   
749  C  CA  . GLY A  97  ? 0.3216 0.3328 0.3442 0.0771  -0.1653 -0.0647 95  GLY A CA  
750  C  C   . GLY A  97  ? 0.3243 0.3688 0.3945 0.0725  -0.1782 -0.0799 95  GLY A C   
751  O  O   . GLY A  97  ? 0.3072 0.3743 0.4142 0.0555  -0.1673 -0.0802 95  GLY A O   
752  N  N   . ASN A  98  ? 0.3499 0.3965 0.4193 0.0882  -0.2013 -0.0936 96  ASN A N   
753  C  CA  . ASN A  98  ? 0.3507 0.4326 0.4694 0.0860  -0.2159 -0.1114 96  ASN A CA  
754  C  C   . ASN A  98  ? 0.3313 0.4278 0.4865 0.0616  -0.2104 -0.1156 96  ASN A C   
755  O  O   . ASN A  98  ? 0.3223 0.4508 0.5271 0.0492  -0.2069 -0.1245 96  ASN A O   
756  C  CB  . ASN A  98  ? 0.3403 0.4497 0.4877 0.0885  -0.2095 -0.1133 96  ASN A CB  
757  C  CG  . ASN A  98  ? 0.3597 0.4990 0.5416 0.1011  -0.2319 -0.1339 96  ASN A CG  
758  O  OD1 . ASN A  98  ? 0.3875 0.5314 0.5792 0.1047  -0.2524 -0.1484 96  ASN A OD1 
759  N  ND2 . ASN A  98  ? 0.3742 0.5353 0.5762 0.1081  -0.2287 -0.1365 96  ASN A ND2 
760  N  N   . ILE A  99  ? 0.3349 0.4061 0.4648 0.0555  -0.2092 -0.1099 97  ILE A N   
761  C  CA  . ILE A  99  ? 0.3290 0.4060 0.4843 0.0333  -0.2021 -0.1119 97  ILE A CA  
762  C  C   . ILE A  99  ? 0.3425 0.4485 0.5467 0.0271  -0.2172 -0.1327 97  ILE A C   
763  O  O   . ILE A  99  ? 0.3405 0.4607 0.5805 0.0060  -0.2056 -0.1357 97  ILE A O   
764  C  CB  . ILE A  99  ? 0.3468 0.3905 0.4641 0.0318  -0.2024 -0.1047 97  ILE A CB  
765  C  CG1 . ILE A  99  ? 0.3470 0.3744 0.4442 0.0212  -0.1782 -0.0859 97  ILE A CG1 
766  C  CG2 . ILE A  99  ? 0.3561 0.4050 0.4983 0.0185  -0.2107 -0.1166 97  ILE A CG2 
767  C  CD1 . ILE A  99  ? 0.3648 0.3622 0.4283 0.0193  -0.1764 -0.0788 97  ILE A CD1 
768  N  N   . LYS A  100 ? 0.3609 0.4743 0.5663 0.0456  -0.2427 -0.1480 98  LYS A N   
769  C  CA  . LYS A  100 ? 0.3663 0.5092 0.6202 0.0411  -0.2607 -0.1711 98  LYS A CA  
770  C  C   . LYS A  100 ? 0.3449 0.5288 0.6583 0.0285  -0.2501 -0.1791 98  LYS A C   
771  O  O   . LYS A  100 ? 0.3466 0.5579 0.7112 0.0156  -0.2556 -0.1970 98  LYS A O   
772  C  CB  . LYS A  100 ? 0.4012 0.5436 0.6406 0.0682  -0.2926 -0.1868 98  LYS A CB  
773  N  N   . SER A  101 ? 0.3238 0.5121 0.6317 0.0327  -0.2347 -0.1672 99  SER A N   
774  C  CA  . SER A  101 ? 0.3080 0.5342 0.6686 0.0246  -0.2247 -0.1746 99  SER A CA  
775  C  C   . SER A  101 ? 0.2959 0.5247 0.6804 -0.0036 -0.1956 -0.1659 99  SER A C   
776  O  O   . SER A  101 ? 0.2803 0.5375 0.7093 -0.0141 -0.1824 -0.1712 99  SER A O   
777  C  CB  . SER A  101 ? 0.2950 0.5225 0.6370 0.0424  -0.2206 -0.1658 99  SER A CB  
778  O  OG  . SER A  101 ? 0.2833 0.4877 0.5943 0.0344  -0.1953 -0.1432 99  SER A OG  
779  N  N   . TYR A  102 ? 0.3041 0.5010 0.6560 -0.0145 -0.1846 -0.1523 100 TYR A N   
780  C  CA  . TYR A  102 ? 0.3043 0.4971 0.6719 -0.0395 -0.1586 -0.1447 100 TYR A CA  
781  C  C   . TYR A  102 ? 0.3136 0.5041 0.7014 -0.0550 -0.1640 -0.1567 100 TYR A C   
782  O  O   . TYR A  102 ? 0.3269 0.4901 0.6802 -0.0524 -0.1729 -0.1529 100 TYR A O   
783  C  CB  . TYR A  102 ? 0.2926 0.4509 0.6100 -0.0408 -0.1410 -0.1213 100 TYR A CB  
784  C  CG  . TYR A  102 ? 0.2912 0.4466 0.5838 -0.0264 -0.1357 -0.1093 100 TYR A CG  
785  C  CD1 . TYR A  102 ? 0.3026 0.4393 0.5524 -0.0066 -0.1490 -0.1039 100 TYR A CD1 
786  C  CD2 . TYR A  102 ? 0.2897 0.4578 0.5991 -0.0327 -0.1155 -0.1031 100 TYR A CD2 
787  C  CE1 . TYR A  102 ? 0.2994 0.4306 0.5256 0.0052  -0.1424 -0.0932 100 TYR A CE1 
788  C  CE2 . TYR A  102 ? 0.2839 0.4475 0.5693 -0.0199 -0.1105 -0.0925 100 TYR A CE2 
789  C  CZ  . TYR A  102 ? 0.2902 0.4354 0.5347 -0.0014 -0.1240 -0.0878 100 TYR A CZ  
790  O  OH  . TYR A  102 ? 0.2649 0.4028 0.4847 0.0100  -0.1176 -0.0778 100 TYR A OH  
791  N  N   . PRO A  103 ? 0.3149 0.5338 0.7598 -0.0714 -0.1580 -0.1721 101 PRO A N   
792  C  CA  . PRO A  103 ? 0.3314 0.5504 0.8001 -0.0858 -0.1657 -0.1873 101 PRO A CA  
793  C  C   . PRO A  103 ? 0.3369 0.5173 0.7719 -0.1007 -0.1479 -0.1720 101 PRO A C   
794  O  O   . PRO A  103 ? 0.3185 0.4851 0.7403 -0.1099 -0.1218 -0.1555 101 PRO A O   
795  C  CB  . PRO A  103 ? 0.3224 0.5798 0.8616 -0.1030 -0.1552 -0.2049 101 PRO A CB  
796  C  CG  . PRO A  103 ? 0.3080 0.5912 0.8610 -0.0901 -0.1523 -0.2032 101 PRO A CG  
797  C  CD  . PRO A  103 ? 0.3043 0.5559 0.7955 -0.0780 -0.1431 -0.1773 101 PRO A CD  
798  N  N   . GLY A  104 ? 0.3595 0.5211 0.7777 -0.1010 -0.1631 -0.1777 102 GLY A N   
799  C  CA  . GLY A  104 ? 0.3724 0.4964 0.7579 -0.1132 -0.1488 -0.1650 102 GLY A CA  
800  C  C   . GLY A  104 ? 0.3737 0.4644 0.6952 -0.0980 -0.1497 -0.1445 102 GLY A C   
801  O  O   . GLY A  104 ? 0.3907 0.4501 0.6808 -0.1029 -0.1445 -0.1361 102 GLY A O   
802  N  N   . LEU A  105 ? 0.3434 0.4403 0.6463 -0.0796 -0.1552 -0.1371 103 LEU A N   
803  C  CA  . LEU A  105 ? 0.3235 0.3922 0.5717 -0.0673 -0.1512 -0.1179 103 LEU A CA  
804  C  C   . LEU A  105 ? 0.3374 0.3889 0.5515 -0.0500 -0.1745 -0.1210 103 LEU A C   
805  O  O   . LEU A  105 ? 0.3613 0.4268 0.5821 -0.0353 -0.1950 -0.1327 103 LEU A O   
806  C  CB  . LEU A  105 ? 0.3013 0.3818 0.5450 -0.0573 -0.1432 -0.1085 103 LEU A CB  
807  C  CG  . LEU A  105 ? 0.2943 0.3490 0.4877 -0.0469 -0.1359 -0.0896 103 LEU A CG  
808  C  CD1 . LEU A  105 ? 0.2891 0.3211 0.4650 -0.0601 -0.1163 -0.0768 103 LEU A CD1 
809  C  CD2 . LEU A  105 ? 0.2775 0.3452 0.4704 -0.0377 -0.1293 -0.0832 103 LEU A CD2 
810  N  N   . THR A  106 ? 0.3362 0.3559 0.5121 -0.0503 -0.1712 -0.1111 104 THR A N   
811  C  CA  . THR A  106 ? 0.3500 0.3493 0.4910 -0.0346 -0.1906 -0.1136 104 THR A CA  
812  C  C   . THR A  106 ? 0.3455 0.3208 0.4372 -0.0206 -0.1847 -0.0966 104 THR A C   
813  O  O   . THR A  106 ? 0.3605 0.3230 0.4235 -0.0031 -0.1990 -0.0981 104 THR A O   
814  C  CB  . THR A  106 ? 0.3648 0.3459 0.5022 -0.0441 -0.1966 -0.1206 104 THR A CB  
815  O  OG1 . THR A  106 ? 0.3509 0.3134 0.4767 -0.0581 -0.1753 -0.1077 104 THR A OG1 
816  C  CG2 . THR A  106 ? 0.3743 0.3795 0.5614 -0.0557 -0.2074 -0.1419 104 THR A CG2 
817  N  N   . SER A  107 ? 0.3280 0.2966 0.4097 -0.0278 -0.1635 -0.0815 105 SER A N   
818  C  CA  . SER A  107 ? 0.3138 0.2656 0.3572 -0.0159 -0.1569 -0.0675 105 SER A CA  
819  C  C   . SER A  107 ? 0.2963 0.2549 0.3435 -0.0224 -0.1363 -0.0554 105 SER A C   
820  O  O   . SER A  107 ? 0.2814 0.2479 0.3508 -0.0370 -0.1241 -0.0544 105 SER A O   
821  C  CB  . SER A  107 ? 0.3278 0.2499 0.3359 -0.0131 -0.1574 -0.0620 105 SER A CB  
822  O  OG  . SER A  107 ? 0.3387 0.2528 0.3504 -0.0277 -0.1444 -0.0570 105 SER A OG  
823  N  N   . TYR A  108 ? 0.2888 0.2417 0.3125 -0.0112 -0.1320 -0.0466 106 TYR A N   
824  C  CA  . TYR A  108 ? 0.2753 0.2352 0.3016 -0.0151 -0.1152 -0.0368 106 TYR A CA  
825  C  C   . TYR A  108 ? 0.2814 0.2268 0.2752 -0.0042 -0.1104 -0.0276 106 TYR A C   
826  O  O   . TYR A  108 ? 0.2890 0.2327 0.2709 0.0081  -0.1167 -0.0291 106 TYR A O   
827  C  CB  . TYR A  108 ? 0.2690 0.2543 0.3243 -0.0150 -0.1153 -0.0419 106 TYR A CB  
828  C  CG  . TYR A  108 ? 0.2568 0.2499 0.3201 -0.0223 -0.0971 -0.0333 106 TYR A CG  
829  C  CD1 . TYR A  108 ? 0.2412 0.2285 0.2835 -0.0151 -0.0893 -0.0242 106 TYR A CD1 
830  C  CD2 . TYR A  108 ? 0.2575 0.2611 0.3476 -0.0365 -0.0867 -0.0348 106 TYR A CD2 
831  C  CE1 . TYR A  108 ? 0.2268 0.2197 0.2741 -0.0206 -0.0743 -0.0173 106 TYR A CE1 
832  C  CE2 . TYR A  108 ? 0.2488 0.2555 0.3412 -0.0416 -0.0699 -0.0267 106 TYR A CE2 
833  C  CZ  . TYR A  108 ? 0.2423 0.2440 0.3128 -0.0330 -0.0650 -0.0182 106 TYR A CZ  
834  O  OH  . TYR A  108 ? 0.2379 0.2413 0.3088 -0.0373 -0.0496 -0.0111 106 TYR A OH  
835  N  N   . LEU A  109 ? 0.2816 0.2155 0.2608 -0.0086 -0.0987 -0.0188 107 LEU A N   
836  C  CA  . LEU A  109 ? 0.2766 0.1973 0.2286 -0.0002 -0.0933 -0.0120 107 LEU A CA  
837  C  C   . LEU A  109 ? 0.2452 0.1726 0.1998 -0.0044 -0.0790 -0.0047 107 LEU A C   
838  O  O   . LEU A  109 ? 0.2329 0.1632 0.1965 -0.0134 -0.0719 -0.0020 107 LEU A O   
839  C  CB  . LEU A  109 ? 0.2934 0.1942 0.2242 0.0010  -0.0946 -0.0103 107 LEU A CB  
840  C  CG  . LEU A  109 ? 0.3076 0.1966 0.2149 0.0081  -0.0867 -0.0045 107 LEU A CG  
841  C  CD1 . LEU A  109 ? 0.3184 0.1977 0.2084 0.0202  -0.0914 -0.0066 107 LEU A CD1 
842  C  CD2 . LEU A  109 ? 0.3474 0.2212 0.2399 0.0076  -0.0853 -0.0026 107 LEU A CD2 
843  N  N   . VAL A  110 ? 0.2397 0.1665 0.1836 0.0026  -0.0746 -0.0019 108 VAL A N   
844  C  CA  . VAL A  110 ? 0.2337 0.1652 0.1772 0.0000  -0.0623 0.0035  108 VAL A CA  
845  C  C   . VAL A  110 ? 0.2501 0.1689 0.1729 0.0052  -0.0572 0.0062  108 VAL A C   
846  O  O   . VAL A  110 ? 0.2596 0.1676 0.1676 0.0130  -0.0594 0.0048  108 VAL A O   
847  C  CB  . VAL A  110 ? 0.2226 0.1657 0.1749 0.0028  -0.0596 0.0033  108 VAL A CB  
848  C  CG1 . VAL A  110 ? 0.2038 0.1507 0.1551 0.0000  -0.0477 0.0081  108 VAL A CG1 
849  C  CG2 . VAL A  110 ? 0.2203 0.1789 0.1971 -0.0013 -0.0643 -0.0009 108 VAL A CG2 
850  N  N   . ARG A  111 ? 0.2537 0.1729 0.1750 0.0014  -0.0500 0.0092  109 ARG A N   
851  C  CA  . ARG A  111 ? 0.2610 0.1734 0.1697 0.0052  -0.0439 0.0097  109 ARG A CA  
852  C  C   . ARG A  111 ? 0.2420 0.1638 0.1565 0.0023  -0.0358 0.0110  109 ARG A C   
853  O  O   . ARG A  111 ? 0.2512 0.1769 0.1700 -0.0011 -0.0354 0.0124  109 ARG A O   
854  C  CB  . ARG A  111 ? 0.2941 0.1957 0.1927 0.0066  -0.0466 0.0092  109 ARG A CB  
855  C  CG  . ARG A  111 ? 0.3472 0.2453 0.2381 0.0099  -0.0391 0.0084  109 ARG A CG  
856  C  CD  . ARG A  111 ? 0.3930 0.2808 0.2742 0.0127  -0.0417 0.0076  109 ARG A CD  
857  N  NE  . ARG A  111 ? 0.3755 0.2479 0.2430 0.0175  -0.0467 0.0067  109 ARG A NE  
858  C  CZ  . ARG A  111 ? 0.3598 0.2194 0.2154 0.0209  -0.0497 0.0059  109 ARG A CZ  
859  N  NH1 . ARG A  111 ? 0.3540 0.1978 0.1947 0.0263  -0.0550 0.0047  109 ARG A NH1 
860  N  NH2 . ARG A  111 ? 0.3308 0.1919 0.1874 0.0206  -0.0481 0.0060  109 ARG A NH2 
861  N  N   . VAL A  112 ? 0.2333 0.1561 0.1456 0.0044  -0.0292 0.0101  110 VAL A N   
862  C  CA  . VAL A  112 ? 0.2265 0.1579 0.1444 0.0020  -0.0224 0.0093  110 VAL A CA  
863  C  C   . VAL A  112 ? 0.2296 0.1602 0.1452 0.0031  -0.0207 0.0063  110 VAL A C   
864  O  O   . VAL A  112 ? 0.2387 0.1628 0.1491 0.0054  -0.0167 0.0038  110 VAL A O   
865  C  CB  . VAL A  112 ? 0.2180 0.1493 0.1348 0.0029  -0.0151 0.0081  110 VAL A CB  
866  C  CG1 . VAL A  112 ? 0.2216 0.1621 0.1453 0.0000  -0.0093 0.0055  110 VAL A CG1 
867  C  CG2 . VAL A  112 ? 0.2167 0.1497 0.1358 0.0041  -0.0176 0.0103  110 VAL A CG2 
868  N  N   . VAL A  113 ? 0.2271 0.1632 0.1457 0.0023  -0.0232 0.0063  111 VAL A N   
869  C  CA  . VAL A  113 ? 0.2332 0.1699 0.1501 0.0054  -0.0243 0.0028  111 VAL A CA  
870  C  C   . VAL A  113 ? 0.2412 0.1885 0.1666 0.0057  -0.0190 -0.0036 111 VAL A C   
871  O  O   . VAL A  113 ? 0.2700 0.2191 0.1987 0.0076  -0.0160 -0.0089 111 VAL A O   
872  C  CB  . VAL A  113 ? 0.2427 0.1773 0.1550 0.0066  -0.0297 0.0051  111 VAL A CB  
873  C  CG1 . VAL A  113 ? 0.2709 0.2069 0.1805 0.0125  -0.0322 0.0004  111 VAL A CG1 
874  C  CG2 . VAL A  113 ? 0.2435 0.1672 0.1501 0.0044  -0.0337 0.0099  111 VAL A CG2 
875  N  N   . SER A  114 ? 0.2368 0.1916 0.1671 0.0038  -0.0175 -0.0042 112 SER A N   
876  C  CA  . SER A  114 ? 0.2318 0.1968 0.1719 0.0030  -0.0129 -0.0119 112 SER A CA  
877  C  C   . SER A  114 ? 0.2302 0.1984 0.1718 0.0002  -0.0103 -0.0108 112 SER A C   
878  O  O   . SER A  114 ? 0.2312 0.1969 0.1672 0.0005  -0.0134 -0.0051 112 SER A O   
879  C  CB  . SER A  114 ? 0.2435 0.2175 0.1878 0.0078  -0.0186 -0.0187 112 SER A CB  
880  O  OG  . SER A  114 ? 0.2896 0.2633 0.2266 0.0108  -0.0244 -0.0163 112 SER A OG  
881  N  N   . THR A  115 ? 0.2154 0.1881 0.1647 -0.0027 -0.0034 -0.0168 113 THR A N   
882  C  CA  . THR A  115 ? 0.2287 0.2037 0.1789 -0.0048 -0.0007 -0.0171 113 THR A CA  
883  C  C   . THR A  115 ? 0.2218 0.2029 0.1830 -0.0085 0.0060  -0.0273 113 THR A C   
884  O  O   . THR A  115 ? 0.2241 0.2049 0.1922 -0.0109 0.0123  -0.0325 113 THR A O   
885  C  CB  . THR A  115 ? 0.2529 0.2186 0.1959 -0.0062 0.0032  -0.0093 113 THR A CB  
886  O  OG1 . THR A  115 ? 0.2231 0.1906 0.1657 -0.0073 0.0059  -0.0092 113 THR A OG1 
887  C  CG2 . THR A  115 ? 0.2598 0.2158 0.1999 -0.0074 0.0111  -0.0101 113 THR A CG2 
888  N  N   . ASN A  116 ? 0.2172 0.2030 0.1803 -0.0093 0.0055  -0.0308 114 ASN A N   
889  C  CA  . ASN A  116 ? 0.2296 0.2187 0.2029 -0.0145 0.0133  -0.0404 114 ASN A CA  
890  C  C   . ASN A  116 ? 0.2431 0.2221 0.2077 -0.0170 0.0202  -0.0356 114 ASN A C   
891  O  O   . ASN A  116 ? 0.2776 0.2563 0.2474 -0.0215 0.0268  -0.0428 114 ASN A O   
892  C  CB  . ASN A  116 ? 0.2298 0.2338 0.2144 -0.0128 0.0057  -0.0523 114 ASN A CB  
893  C  CG  . ASN A  116 ? 0.2416 0.2443 0.2147 -0.0083 -0.0012 -0.0495 114 ASN A CG  
894  O  OD1 . ASN A  116 ? 0.2150 0.2078 0.1742 -0.0069 -0.0002 -0.0381 114 ASN A OD1 
895  N  ND2 . ASN A  116 ? 0.2384 0.2513 0.2179 -0.0056 -0.0084 -0.0611 114 ASN A ND2 
896  N  N   . TYR A  117 ? 0.2433 0.2142 0.1957 -0.0139 0.0187  -0.0243 115 TYR A N   
897  C  CA  . TYR A  117 ? 0.2485 0.2085 0.1918 -0.0141 0.0255  -0.0189 115 TYR A CA  
898  C  C   . TYR A  117 ? 0.2652 0.2271 0.2058 -0.0136 0.0251  -0.0193 115 TYR A C   
899  O  O   . TYR A  117 ? 0.2913 0.2486 0.2245 -0.0108 0.0260  -0.0121 115 TYR A O   
900  C  CB  . TYR A  117 ? 0.2646 0.2122 0.2055 -0.0177 0.0376  -0.0222 115 TYR A CB  
901  C  CG  . TYR A  117 ? 0.2481 0.1886 0.1861 -0.0166 0.0397  -0.0204 115 TYR A CG  
902  C  CD1 . TYR A  117 ? 0.2562 0.1873 0.1818 -0.0111 0.0363  -0.0117 115 TYR A CD1 
903  C  CD2 . TYR A  117 ? 0.2545 0.1985 0.2028 -0.0205 0.0444  -0.0283 115 TYR A CD2 
904  C  CE1 . TYR A  117 ? 0.2600 0.1825 0.1798 -0.0090 0.0371  -0.0103 115 TYR A CE1 
905  C  CE2 . TYR A  117 ? 0.2476 0.1830 0.1909 -0.0188 0.0473  -0.0263 115 TYR A CE2 
906  C  CZ  . TYR A  117 ? 0.2613 0.1844 0.1882 -0.0127 0.0434  -0.0170 115 TYR A CZ  
907  O  OH  . TYR A  117 ? 0.2682 0.1808 0.1871 -0.0099 0.0452  -0.0153 115 TYR A OH  
908  N  N   . ASN A  118 ? 0.2620 0.2312 0.2091 -0.0154 0.0233  -0.0285 116 ASN A N   
909  C  CA  . ASN A  118 ? 0.2449 0.2131 0.1866 -0.0143 0.0232  -0.0301 116 ASN A CA  
910  C  C   . ASN A  118 ? 0.2430 0.2173 0.1802 -0.0088 0.0132  -0.0302 116 ASN A C   
911  O  O   . ASN A  118 ? 0.2380 0.2095 0.1676 -0.0065 0.0126  -0.0315 116 ASN A O   
912  C  CB  . ASN A  118 ? 0.2471 0.2145 0.1959 -0.0201 0.0294  -0.0417 116 ASN A CB  
913  C  CG  . ASN A  118 ? 0.2589 0.2395 0.2245 -0.0228 0.0249  -0.0545 116 ASN A CG  
914  O  OD1 . ASN A  118 ? 0.2502 0.2406 0.2179 -0.0177 0.0140  -0.0558 116 ASN A OD1 
915  N  ND2 . ASN A  118 ? 0.2786 0.2587 0.2564 -0.0306 0.0341  -0.0646 116 ASN A ND2 
916  N  N   . GLN A  119 ? 0.2271 0.2057 0.1650 -0.0056 0.0061  -0.0280 117 GLN A N   
917  C  CA  . GLN A  119 ? 0.2450 0.2232 0.1724 0.0012  -0.0021 -0.0268 117 GLN A CA  
918  C  C   . GLN A  119 ? 0.2456 0.2199 0.1673 0.0036  -0.0043 -0.0171 117 GLN A C   
919  O  O   . GLN A  119 ? 0.2387 0.2055 0.1492 0.0063  -0.0028 -0.0095 117 GLN A O   
920  C  CB  . GLN A  119 ? 0.2540 0.2410 0.1864 0.0048  -0.0113 -0.0395 117 GLN A CB  
921  C  CG  . GLN A  119 ? 0.2703 0.2608 0.2069 0.0034  -0.0116 -0.0510 117 GLN A CG  
922  C  CD  . GLN A  119 ? 0.2644 0.2680 0.2122 0.0068  -0.0222 -0.0666 117 GLN A CD  
923  O  OE1 . GLN A  119 ? 0.2994 0.3123 0.2596 0.0067  -0.0252 -0.0706 117 GLN A OE1 
924  N  NE2 . GLN A  119 ? 0.2770 0.2816 0.2205 0.0109  -0.0287 -0.0764 117 GLN A NE2 
925  N  N   . HIS A  120 ? 0.2271 0.2053 0.1563 0.0025  -0.0069 -0.0181 118 HIS A N   
926  C  CA  A HIS A  120 ? 0.2194 0.1926 0.1421 0.0051  -0.0104 -0.0111 118 HIS A CA  
927  C  CA  B HIS A  120 ? 0.2434 0.2168 0.1663 0.0052  -0.0106 -0.0114 118 HIS A CA  
928  C  C   . HIS A  120 ? 0.2251 0.1984 0.1553 0.0011  -0.0083 -0.0076 118 HIS A C   
929  O  O   . HIS A  120 ? 0.2219 0.1985 0.1608 -0.0021 -0.0048 -0.0118 118 HIS A O   
930  C  CB  A HIS A  120 ? 0.2158 0.1896 0.1321 0.0123  -0.0196 -0.0164 118 HIS A CB  
931  C  CB  B HIS A  120 ? 0.2673 0.2429 0.1861 0.0119  -0.0198 -0.0179 118 HIS A CB  
932  C  CG  A HIS A  120 ? 0.1989 0.1849 0.1294 0.0125  -0.0236 -0.0279 118 HIS A CG  
933  C  CG  B HIS A  120 ? 0.3095 0.2906 0.2277 0.0164  -0.0248 -0.0284 118 HIS A CG  
934  N  ND1 A HIS A  120 ? 0.1865 0.1755 0.1254 0.0107  -0.0233 -0.0281 118 HIS A ND1 
935  N  ND1 B HIS A  120 ? 0.3413 0.3143 0.2443 0.0208  -0.0252 -0.0268 118 HIS A ND1 
936  C  CD2 A HIS A  120 ? 0.1962 0.1929 0.1359 0.0140  -0.0274 -0.0405 118 HIS A CD2 
937  C  CD2 B HIS A  120 ? 0.3224 0.3165 0.2541 0.0173  -0.0298 -0.0418 118 HIS A CD2 
938  C  CE1 A HIS A  120 ? 0.1861 0.1875 0.1398 0.0108  -0.0251 -0.0400 118 HIS A CE1 
939  C  CE1 B HIS A  120 ? 0.3552 0.3351 0.2604 0.0249  -0.0320 -0.0390 118 HIS A CE1 
940  N  NE2 A HIS A  120 ? 0.1860 0.1936 0.1423 0.0123  -0.0279 -0.0484 118 HIS A NE2 
941  N  NE2 B HIS A  120 ? 0.3432 0.3377 0.2682 0.0224  -0.0351 -0.0489 118 HIS A NE2 
942  N  N   . ALA A  121 ? 0.2321 0.1994 0.1573 0.0015  -0.0098 -0.0002 119 ALA A N   
943  C  CA  . ALA A  121 ? 0.2379 0.2034 0.1671 -0.0004 -0.0106 0.0023  119 ALA A CA  
944  C  C   . ALA A  121 ? 0.2581 0.2163 0.1802 0.0009  -0.0145 0.0072  119 ALA A C   
945  O  O   . ALA A  121 ? 0.2342 0.1866 0.1489 0.0016  -0.0132 0.0112  119 ALA A O   
946  C  CB  . ALA A  121 ? 0.2335 0.1982 0.1672 -0.0037 -0.0061 0.0060  119 ALA A CB  
947  N  N   . MET A  122 ? 0.2626 0.2183 0.1852 0.0012  -0.0180 0.0068  120 MET A N   
948  C  CA  . MET A  122 ? 0.2712 0.2176 0.1878 0.0008  -0.0207 0.0116  120 MET A CA  
949  C  C   . MET A  122 ? 0.2529 0.1981 0.1753 -0.0024 -0.0216 0.0132  120 MET A C   
950  O  O   . MET A  122 ? 0.2389 0.1857 0.1633 -0.0013 -0.0218 0.0101  120 MET A O   
951  C  CB  . MET A  122 ? 0.3037 0.2450 0.2113 0.0064  -0.0260 0.0090  120 MET A CB  
952  C  CG  . MET A  122 ? 0.3469 0.2856 0.2436 0.0128  -0.0281 0.0069  120 MET A CG  
953  S  SD  . MET A  122 ? 0.4233 0.3495 0.3039 0.0212  -0.0348 0.0064  120 MET A SD  
954  C  CE  . MET A  122 ? 0.4456 0.3856 0.3399 0.0234  -0.0386 -0.0019 120 MET A CE  
955  N  N   . VAL A  123 ? 0.2444 0.1857 0.1691 -0.0061 -0.0216 0.0172  121 VAL A N   
956  C  CA  . VAL A  123 ? 0.2350 0.1760 0.1658 -0.0081 -0.0247 0.0173  121 VAL A CA  
957  C  C   . VAL A  123 ? 0.2329 0.1655 0.1625 -0.0112 -0.0279 0.0188  121 VAL A C   
958  O  O   . VAL A  123 ? 0.2450 0.1736 0.1745 -0.0147 -0.0241 0.0215  121 VAL A O   
959  C  CB  . VAL A  123 ? 0.2263 0.1756 0.1682 -0.0101 -0.0223 0.0178  121 VAL A CB  
960  C  CG1 . VAL A  123 ? 0.2254 0.1742 0.1717 -0.0093 -0.0283 0.0160  121 VAL A CG1 
961  C  CG2 . VAL A  123 ? 0.2044 0.1588 0.1452 -0.0076 -0.0176 0.0165  121 VAL A CG2 
962  N  N   . PHE A  124 ? 0.2335 0.1608 0.1605 -0.0100 -0.0337 0.0170  122 PHE A N   
963  C  CA  . PHE A  124 ? 0.2341 0.1515 0.1591 -0.0130 -0.0376 0.0173  122 PHE A CA  
964  C  C   . PHE A  124 ? 0.2299 0.1520 0.1682 -0.0167 -0.0421 0.0147  122 PHE A C   
965  O  O   . PHE A  124 ? 0.2372 0.1639 0.1772 -0.0126 -0.0460 0.0124  122 PHE A O   
966  C  CB  . PHE A  124 ? 0.2422 0.1494 0.1539 -0.0080 -0.0421 0.0159  122 PHE A CB  
967  C  CG  . PHE A  124 ? 0.2563 0.1508 0.1637 -0.0106 -0.0469 0.0155  122 PHE A CG  
968  C  CD1 . PHE A  124 ? 0.2576 0.1498 0.1675 -0.0106 -0.0540 0.0123  122 PHE A CD1 
969  C  CD2 . PHE A  124 ? 0.2609 0.1432 0.1591 -0.0121 -0.0447 0.0178  122 PHE A CD2 
970  C  CE1 . PHE A  124 ? 0.2690 0.1491 0.1755 -0.0135 -0.0591 0.0106  122 PHE A CE1 
971  C  CE2 . PHE A  124 ? 0.2722 0.1404 0.1657 -0.0154 -0.0481 0.0170  122 PHE A CE2 
972  C  CZ  . PHE A  124 ? 0.2785 0.1467 0.1776 -0.0168 -0.0555 0.0130  122 PHE A CZ  
973  N  N   . PHE A  125 ? 0.2315 0.1517 0.1791 -0.0239 -0.0412 0.0144  123 PHE A N   
974  C  CA  . PHE A  125 ? 0.2267 0.1545 0.1923 -0.0280 -0.0468 0.0094  123 PHE A CA  
975  C  C   . PHE A  125 ? 0.2402 0.1561 0.2051 -0.0332 -0.0509 0.0068  123 PHE A C   
976  O  O   . PHE A  125 ? 0.2566 0.1601 0.2139 -0.0377 -0.0444 0.0100  123 PHE A O   
977  C  CB  . PHE A  125 ? 0.2190 0.1599 0.2052 -0.0344 -0.0396 0.0092  123 PHE A CB  
978  C  CG  . PHE A  125 ? 0.2100 0.1613 0.1967 -0.0298 -0.0348 0.0116  123 PHE A CG  
979  C  CD1 . PHE A  125 ? 0.2043 0.1694 0.2038 -0.0262 -0.0390 0.0080  123 PHE A CD1 
980  C  CD2 . PHE A  125 ? 0.2147 0.1608 0.1880 -0.0281 -0.0267 0.0169  123 PHE A CD2 
981  C  CE1 . PHE A  125 ? 0.1990 0.1710 0.1968 -0.0218 -0.0339 0.0103  123 PHE A CE1 
982  C  CE2 . PHE A  125 ? 0.2121 0.1667 0.1857 -0.0244 -0.0224 0.0183  123 PHE A CE2 
983  C  CZ  . PHE A  125 ? 0.2018 0.1686 0.1874 -0.0218 -0.0252 0.0154  123 PHE A CZ  
984  N  N   . LYS A  126 ? 0.2498 0.1671 0.2206 -0.0320 -0.0620 0.0005  124 LYS A N   
985  C  CA  . LYS A  126 ? 0.2660 0.1728 0.2393 -0.0380 -0.0670 -0.0039 124 LYS A CA  
986  C  C   . LYS A  126 ? 0.2619 0.1826 0.2595 -0.0409 -0.0768 -0.0136 124 LYS A C   
987  O  O   . LYS A  126 ? 0.2516 0.1806 0.2498 -0.0321 -0.0861 -0.0172 124 LYS A O   
988  C  CB  . LYS A  126 ? 0.2858 0.1749 0.2344 -0.0308 -0.0738 -0.0032 124 LYS A CB  
989  C  CG  . LYS A  126 ? 0.3245 0.2007 0.2733 -0.0361 -0.0805 -0.0087 124 LYS A CG  
990  C  CD  . LYS A  126 ? 0.3534 0.2087 0.2744 -0.0290 -0.0838 -0.0063 124 LYS A CD  
991  C  CE  . LYS A  126 ? 0.3615 0.2138 0.2724 -0.0191 -0.0959 -0.0108 124 LYS A CE  
992  N  NZ  . LYS A  126 ? 0.3847 0.2380 0.3084 -0.0226 -0.1085 -0.0208 124 LYS A NZ  
993  N  N   . LYS A  127 ? 0.2738 0.1962 0.2915 -0.0527 -0.0744 -0.0187 125 LYS A N   
994  C  CA  . LYS A  127 ? 0.2830 0.2228 0.3304 -0.0563 -0.0841 -0.0305 125 LYS A CA  
995  C  C   . LYS A  127 ? 0.3010 0.2312 0.3585 -0.0675 -0.0865 -0.0379 125 LYS A C   
996  O  O   . LYS A  127 ? 0.3057 0.2182 0.3537 -0.0759 -0.0745 -0.0327 125 LYS A O   
997  C  CB  . LYS A  127 ? 0.2840 0.2464 0.3595 -0.0612 -0.0752 -0.0316 125 LYS A CB  
998  C  CG  . LYS A  127 ? 0.3128 0.2810 0.4177 -0.0774 -0.0639 -0.0363 125 LYS A CG  
999  C  CD  . LYS A  127 ? 0.3298 0.3236 0.4642 -0.0793 -0.0572 -0.0390 125 LYS A CD  
1000 C  CE  . LYS A  127 ? 0.3835 0.3893 0.5567 -0.0955 -0.0478 -0.0481 125 LYS A CE  
1001 N  NZ  . LYS A  127 ? 0.4317 0.4671 0.6384 -0.0952 -0.0445 -0.0536 125 LYS A NZ  
1002 N  N   . VAL A  128 ? 0.3109 0.2498 0.3840 -0.0662 -0.1029 -0.0505 126 VAL A N   
1003 C  CA  . VAL A  128 ? 0.3380 0.2713 0.4274 -0.0782 -0.1066 -0.0608 126 VAL A CA  
1004 C  C   . VAL A  128 ? 0.3506 0.3126 0.4868 -0.0867 -0.1101 -0.0749 126 VAL A C   
1005 O  O   . VAL A  128 ? 0.3510 0.3330 0.5002 -0.0765 -0.1256 -0.0834 126 VAL A O   
1006 C  CB  . VAL A  128 ? 0.3492 0.2668 0.4178 -0.0696 -0.1252 -0.0667 126 VAL A CB  
1007 C  CG1 . VAL A  128 ? 0.3624 0.2744 0.4499 -0.0832 -0.1295 -0.0790 126 VAL A CG1 
1008 C  CG2 . VAL A  128 ? 0.3473 0.2383 0.3724 -0.0609 -0.1206 -0.0537 126 VAL A CG2 
1009 N  N   . SER A  129 ? 0.3881 0.3513 0.5491 -0.1045 -0.0950 -0.0778 127 SER A N   
1010 C  CA  . SER A  129 ? 0.4301 0.4230 0.6419 -0.1152 -0.0937 -0.0918 127 SER A CA  
1011 C  C   . SER A  129 ? 0.4693 0.4539 0.7039 -0.1352 -0.0857 -0.1014 127 SER A C   
1012 O  O   . SER A  129 ? 0.5146 0.4720 0.7299 -0.1448 -0.0671 -0.0917 127 SER A O   
1013 C  CB  . SER A  129 ? 0.4272 0.4333 0.6509 -0.1180 -0.0744 -0.0836 127 SER A CB  
1014 O  OG  . SER A  129 ? 0.4462 0.4802 0.7213 -0.1301 -0.0692 -0.0970 127 SER A OG  
1015 N  N   . GLN A  130 ? 0.5165 0.5233 0.7912 -0.1408 -0.1000 -0.1213 128 GLN A N   
1016 C  CA  . GLN A  130 ? 0.5574 0.5555 0.8541 -0.1596 -0.0962 -0.1336 128 GLN A CA  
1017 C  C   . GLN A  130 ? 0.5833 0.5407 0.8333 -0.1578 -0.0975 -0.1249 128 GLN A C   
1018 O  O   . GLN A  130 ? 0.6919 0.6257 0.9394 -0.1737 -0.0816 -0.1240 128 GLN A O   
1019 C  CB  . GLN A  130 ? 0.5908 0.5902 0.9159 -0.1806 -0.0664 -0.1326 128 GLN A CB  
1020 C  CG  . GLN A  130 ? 0.6271 0.6687 1.0164 -0.1901 -0.0663 -0.1510 128 GLN A CG  
1021 C  CD  . GLN A  130 ? 0.6299 0.6954 1.0276 -0.1807 -0.0592 -0.1435 128 GLN A CD  
1022 O  OE1 . GLN A  130 ? 0.6524 0.7006 1.0091 -0.1704 -0.0504 -0.1240 128 GLN A OE1 
1023 N  NE2 . GLN A  130 ? 0.6268 0.7327 1.0793 -0.1843 -0.0630 -0.1601 128 GLN A NE2 
1024 N  N   . ASN A  131 ? 0.5766 0.5240 0.7883 -0.1381 -0.1147 -0.1182 129 ASN A N   
1025 C  CA  . ASN A  131 ? 0.5661 0.4774 0.7344 -0.1339 -0.1182 -0.1113 129 ASN A CA  
1026 C  C   . ASN A  131 ? 0.5493 0.4308 0.6817 -0.1360 -0.0956 -0.0920 129 ASN A C   
1027 O  O   . ASN A  131 ? 0.5513 0.4022 0.6473 -0.1321 -0.0964 -0.0855 129 ASN A O   
1028 C  CB  . ASN A  131 ? 0.6084 0.5114 0.7949 -0.1473 -0.1257 -0.1278 129 ASN A CB  
1029 C  CG  . ASN A  131 ? 0.6327 0.5645 0.8524 -0.1426 -0.1520 -0.1490 129 ASN A CG  
1030 O  OD1 . ASN A  131 ? 0.6488 0.6010 0.9166 -0.1578 -0.1531 -0.1670 129 ASN A OD1 
1031 N  ND2 . ASN A  131 ? 0.6168 0.5488 0.8100 -0.1209 -0.1733 -0.1481 129 ASN A ND2 
1032 N  N   . ARG A  132 ? 0.5024 0.3926 0.6434 -0.1401 -0.0766 -0.0832 130 ARG A N   
1033 C  CA  . ARG A  132 ? 0.4931 0.3569 0.5984 -0.1386 -0.0571 -0.0653 130 ARG A CA  
1034 C  C   . ARG A  132 ? 0.4516 0.3212 0.5308 -0.1202 -0.0611 -0.0529 130 ARG A C   
1035 O  O   . ARG A  132 ? 0.4122 0.3092 0.5093 -0.1140 -0.0671 -0.0551 130 ARG A O   
1036 C  CB  . ARG A  132 ? 0.5140 0.3776 0.6393 -0.1542 -0.0318 -0.0630 130 ARG A CB  
1037 C  CG  . ARG A  132 ? 0.5577 0.4107 0.7079 -0.1752 -0.0219 -0.0746 130 ARG A CG  
1038 C  CD  . ARG A  132 ? 0.5938 0.4474 0.7665 -0.1909 0.0056  -0.0732 130 ARG A CD  
1039 N  NE  . ARG A  132 ? 0.6064 0.5018 0.8224 -0.1917 0.0040  -0.0806 130 ARG A NE  
1040 C  CZ  . ARG A  132 ? 0.6165 0.5269 0.8752 -0.2086 0.0215  -0.0892 130 ARG A CZ  
1041 N  NH1 . ARG A  132 ? 0.6730 0.5578 0.9362 -0.2275 0.0436  -0.0915 130 ARG A NH1 
1042 N  NH2 . ARG A  132 ? 0.6124 0.5624 0.9093 -0.2064 0.0180  -0.0961 130 ARG A NH2 
1043 N  N   . GLU A  133 ? 0.4334 0.2771 0.4712 -0.1114 -0.0577 -0.0408 131 GLU A N   
1044 C  CA  . GLU A  133 ? 0.3942 0.2420 0.4080 -0.0946 -0.0626 -0.0313 131 GLU A CA  
1045 C  C   . GLU A  133 ? 0.3715 0.2157 0.3740 -0.0937 -0.0449 -0.0194 131 GLU A C   
1046 O  O   . GLU A  133 ? 0.3824 0.2008 0.3596 -0.0943 -0.0340 -0.0118 131 GLU A O   
1047 C  CB  . GLU A  133 ? 0.4142 0.2397 0.3927 -0.0837 -0.0720 -0.0279 131 GLU A CB  
1048 C  CG  . GLU A  133 ? 0.4297 0.2623 0.3894 -0.0671 -0.0789 -0.0217 131 GLU A CG  
1049 C  CD  . GLU A  133 ? 0.4742 0.2895 0.4065 -0.0565 -0.0900 -0.0219 131 GLU A CD  
1050 O  OE1 . GLU A  133 ? 0.5479 0.3699 0.4697 -0.0441 -0.0968 -0.0201 131 GLU A OE1 
1051 O  OE2 . GLU A  133 ? 0.4610 0.2539 0.3806 -0.0602 -0.0905 -0.0235 131 GLU A OE2 
1052 N  N   . TYR A  134 ? 0.3298 0.1980 0.3483 -0.0907 -0.0432 -0.0183 132 TYR A N   
1053 C  CA  . TYR A  134 ? 0.3121 0.1782 0.3198 -0.0886 -0.0283 -0.0081 132 TYR A CA  
1054 C  C   . TYR A  134 ? 0.2868 0.1573 0.2732 -0.0732 -0.0349 -0.0016 132 TYR A C   
1055 O  O   . TYR A  134 ? 0.2704 0.1548 0.2611 -0.0657 -0.0480 -0.0054 132 TYR A O   
1056 C  CB  . TYR A  134 ? 0.2984 0.1876 0.3393 -0.0962 -0.0198 -0.0116 132 TYR A CB  
1057 C  CG  . TYR A  134 ? 0.3091 0.1979 0.3783 -0.1132 -0.0105 -0.0198 132 TYR A CG  
1058 C  CD1 . TYR A  134 ? 0.3035 0.2137 0.4081 -0.1192 -0.0222 -0.0338 132 TYR A CD1 
1059 C  CD2 . TYR A  134 ? 0.3291 0.1948 0.3894 -0.1231 0.0106  -0.0145 132 TYR A CD2 
1060 C  CE1 . TYR A  134 ? 0.3149 0.2277 0.4515 -0.1365 -0.0130 -0.0436 132 TYR A CE1 
1061 C  CE2 . TYR A  134 ? 0.3442 0.2079 0.4324 -0.1407 0.0223  -0.0227 132 TYR A CE2 
1062 C  CZ  . TYR A  134 ? 0.3345 0.2239 0.4637 -0.1482 0.0105  -0.0378 132 TYR A CZ  
1063 O  OH  . TYR A  134 ? 0.3484 0.2392 0.5111 -0.1670 0.0225  -0.0482 132 TYR A OH  
1064 N  N   . PHE A  135 ? 0.2870 0.1444 0.2495 -0.0681 -0.0255 0.0074  133 PHE A N   
1065 C  CA  . PHE A  135 ? 0.2748 0.1406 0.2241 -0.0557 -0.0294 0.0119  133 PHE A CA  
1066 C  C   . PHE A  135 ? 0.2812 0.1448 0.2220 -0.0540 -0.0170 0.0186  133 PHE A C   
1067 O  O   . PHE A  135 ? 0.2980 0.1436 0.2293 -0.0589 -0.0052 0.0221  133 PHE A O   
1068 C  CB  . PHE A  135 ? 0.2773 0.1298 0.2014 -0.0457 -0.0376 0.0136  133 PHE A CB  
1069 C  CG  . PHE A  135 ? 0.2975 0.1254 0.1952 -0.0428 -0.0309 0.0190  133 PHE A CG  
1070 C  CD1 . PHE A  135 ? 0.3257 0.1313 0.2157 -0.0495 -0.0276 0.0183  133 PHE A CD1 
1071 C  CD2 . PHE A  135 ? 0.2927 0.1189 0.1724 -0.0325 -0.0289 0.0237  133 PHE A CD2 
1072 C  CE1 . PHE A  135 ? 0.3526 0.1316 0.2134 -0.0445 -0.0217 0.0235  133 PHE A CE1 
1073 C  CE2 . PHE A  135 ? 0.3191 0.1222 0.1724 -0.0269 -0.0248 0.0277  133 PHE A CE2 
1074 C  CZ  . PHE A  135 ? 0.3495 0.1275 0.1912 -0.0321 -0.0211 0.0282  133 PHE A CZ  
1075 N  N   . LYS A  136 ? 0.2774 0.1569 0.2197 -0.0468 -0.0191 0.0200  134 LYS A N   
1076 C  CA  . LYS A  136 ? 0.2914 0.1687 0.2228 -0.0432 -0.0098 0.0254  134 LYS A CA  
1077 C  C   . LYS A  136 ? 0.2729 0.1605 0.1964 -0.0327 -0.0161 0.0259  134 LYS A C   
1078 O  O   . LYS A  136 ? 0.2606 0.1599 0.1918 -0.0299 -0.0247 0.0224  134 LYS A O   
1079 C  CB  . LYS A  136 ? 0.2965 0.1856 0.2488 -0.0506 0.0000  0.0251  134 LYS A CB  
1080 C  CG  . LYS A  136 ? 0.2870 0.2018 0.2610 -0.0489 -0.0064 0.0211  134 LYS A CG  
1081 C  CD  . LYS A  136 ? 0.3062 0.2326 0.2977 -0.0536 0.0042  0.0215  134 LYS A CD  
1082 C  CE  . LYS A  136 ? 0.3028 0.2525 0.3117 -0.0493 -0.0028 0.0177  134 LYS A CE  
1083 N  NZ  . LYS A  136 ? 0.3069 0.2720 0.3410 -0.0545 0.0054  0.0153  134 LYS A NZ  
1084 N  N   . ILE A  137 ? 0.2765 0.1574 0.1831 -0.0266 -0.0115 0.0294  135 ILE A N   
1085 C  CA  . ILE A  137 ? 0.2783 0.1706 0.1815 -0.0185 -0.0153 0.0284  135 ILE A CA  
1086 C  C   . ILE A  137 ? 0.2911 0.1884 0.1961 -0.0187 -0.0074 0.0305  135 ILE A C   
1087 O  O   . ILE A  137 ? 0.2941 0.1773 0.1872 -0.0193 0.0008  0.0341  135 ILE A O   
1088 C  CB  . ILE A  137 ? 0.2903 0.1723 0.1724 -0.0090 -0.0196 0.0281  135 ILE A CB  
1089 C  CG1 . ILE A  137 ? 0.3187 0.1903 0.1948 -0.0085 -0.0253 0.0270  135 ILE A CG1 
1090 C  CG2 . ILE A  137 ? 0.2746 0.1719 0.1602 -0.0026 -0.0241 0.0242  135 ILE A CG2 
1091 C  CD1 . ILE A  137 ? 0.3429 0.1901 0.2016 -0.0097 -0.0209 0.0305  135 ILE A CD1 
1092 N  N   . THR A  138 ? 0.2935 0.2080 0.2105 -0.0176 -0.0091 0.0283  136 THR A N   
1093 C  CA  . THR A  138 ? 0.3283 0.2479 0.2467 -0.0171 -0.0021 0.0298  136 THR A CA  
1094 C  C   . THR A  138 ? 0.2991 0.2219 0.2069 -0.0091 -0.0057 0.0274  136 THR A C   
1095 O  O   . THR A  138 ? 0.3118 0.2428 0.2238 -0.0067 -0.0118 0.0236  136 THR A O   
1096 C  CB  . THR A  138 ? 0.3654 0.3014 0.3057 -0.0215 -0.0008 0.0284  136 THR A CB  
1097 O  OG1 . THR A  138 ? 0.3945 0.3307 0.3493 -0.0292 0.0025  0.0285  136 THR A OG1 
1098 C  CG2 . THR A  138 ? 0.4219 0.3629 0.3622 -0.0197 0.0060  0.0297  136 THR A CG2 
1099 N  N   . LEU A  139 ? 0.2875 0.2026 0.1813 -0.0050 -0.0013 0.0290  137 LEU A N   
1100 C  CA  . LEU A  139 ? 0.2844 0.2053 0.1721 0.0017  -0.0049 0.0247  137 LEU A CA  
1101 C  C   . LEU A  139 ? 0.2649 0.1943 0.1605 -0.0003 0.0009  0.0251  137 LEU A C   
1102 O  O   . LEU A  139 ? 0.2625 0.1843 0.1520 -0.0009 0.0089  0.0291  137 LEU A O   
1103 C  CB  . LEU A  139 ? 0.3134 0.2187 0.1766 0.0107  -0.0068 0.0245  137 LEU A CB  
1104 C  CG  . LEU A  139 ? 0.3243 0.2360 0.1817 0.0188  -0.0127 0.0177  137 LEU A CG  
1105 C  CD1 . LEU A  139 ? 0.3064 0.2340 0.1779 0.0197  -0.0209 0.0099  137 LEU A CD1 
1106 C  CD2 . LEU A  139 ? 0.3505 0.2436 0.1795 0.0302  -0.0154 0.0174  137 LEU A CD2 
1107 N  N   . TYR A  140 ? 0.2530 0.1958 0.1603 -0.0009 -0.0017 0.0208  138 TYR A N   
1108 C  CA  . TYR A  140 ? 0.2417 0.1915 0.1557 -0.0022 0.0033  0.0207  138 TYR A CA  
1109 C  C   . TYR A  140 ? 0.2626 0.2125 0.1674 0.0026  0.0020  0.0158  138 TYR A C   
1110 O  O   . TYR A  140 ? 0.2453 0.1988 0.1498 0.0053  -0.0041 0.0095  138 TYR A O   
1111 C  CB  . TYR A  140 ? 0.2193 0.1789 0.1474 -0.0050 0.0019  0.0187  138 TYR A CB  
1112 C  CG  . TYR A  140 ? 0.2145 0.1770 0.1541 -0.0086 0.0018  0.0217  138 TYR A CG  
1113 C  CD1 . TYR A  140 ? 0.2226 0.1833 0.1667 -0.0119 0.0061  0.0255  138 TYR A CD1 
1114 C  CD2 . TYR A  140 ? 0.2104 0.1765 0.1562 -0.0085 -0.0020 0.0197  138 TYR A CD2 
1115 C  CE1 . TYR A  140 ? 0.2304 0.1970 0.1898 -0.0157 0.0048  0.0255  138 TYR A CE1 
1116 C  CE2 . TYR A  140 ? 0.2075 0.1769 0.1636 -0.0100 -0.0046 0.0204  138 TYR A CE2 
1117 C  CZ  . TYR A  140 ? 0.2153 0.1870 0.1805 -0.0140 -0.0021 0.0226  138 TYR A CZ  
1118 O  OH  . TYR A  140 ? 0.2151 0.1931 0.1949 -0.0159 -0.0060 0.0209  138 TYR A OH  
1119 N  N   . GLY A  141 ? 0.2653 0.2122 0.1647 0.0038  0.0080  0.0176  139 GLY A N   
1120 C  CA  . GLY A  141 ? 0.2589 0.2070 0.1522 0.0076  0.0067  0.0118  139 GLY A CA  
1121 C  C   . GLY A  141 ? 0.2490 0.2021 0.1500 0.0048  0.0132  0.0125  139 GLY A C   
1122 O  O   . GLY A  141 ? 0.2292 0.1828 0.1357 0.0026  0.0197  0.0183  139 GLY A O   
1123 N  N   . ARG A  142 ? 0.2543 0.2110 0.1568 0.0050  0.0118  0.0056  140 ARG A N   
1124 C  CA  . ARG A  142 ? 0.2543 0.2113 0.1587 0.0040  0.0184  0.0060  140 ARG A CA  
1125 C  C   . ARG A  142 ? 0.2820 0.2308 0.1723 0.0084  0.0226  0.0082  140 ARG A C   
1126 O  O   . ARG A  142 ? 0.2678 0.2155 0.1585 0.0086  0.0299  0.0115  140 ARG A O   
1127 C  CB  . ARG A  142 ? 0.2597 0.2192 0.1680 0.0020  0.0176  -0.0025 140 ARG A CB  
1128 C  CG  . ARG A  142 ? 0.2449 0.2081 0.1641 -0.0021 0.0179  -0.0038 140 ARG A CG  
1129 C  CD  . ARG A  142 ? 0.2418 0.2035 0.1639 -0.0021 0.0224  0.0032  140 ARG A CD  
1130 N  NE  . ARG A  142 ? 0.2456 0.2050 0.1712 -0.0041 0.0236  0.0012  140 ARG A NE  
1131 C  CZ  . ARG A  142 ? 0.2503 0.2063 0.1757 -0.0021 0.0254  0.0053  140 ARG A CZ  
1132 N  NH1 . ARG A  142 ? 0.2453 0.1942 0.1681 -0.0025 0.0274  0.0033  140 ARG A NH1 
1133 N  NH2 . ARG A  142 ? 0.2784 0.2376 0.2059 0.0009  0.0253  0.0106  140 ARG A NH2 
1134 N  N   . THR A  143 ? 0.2937 0.2351 0.1694 0.0134  0.0180  0.0062  141 THR A N   
1135 C  CA  . THR A  143 ? 0.3266 0.2546 0.1832 0.0190  0.0232  0.0103  141 THR A CA  
1136 C  C   . THR A  143 ? 0.3477 0.2656 0.1944 0.0209  0.0251  0.0168  141 THR A C   
1137 O  O   . THR A  143 ? 0.3553 0.2774 0.2102 0.0181  0.0208  0.0175  141 THR A O   
1138 C  CB  . THR A  143 ? 0.3558 0.2767 0.1951 0.0262  0.0165  0.0019  141 THR A CB  
1139 O  OG1 . THR A  143 ? 0.3580 0.2774 0.1902 0.0312  0.0056  -0.0031 141 THR A OG1 
1140 C  CG2 . THR A  143 ? 0.3571 0.2872 0.2076 0.0226  0.0142  -0.0068 141 THR A CG2 
1141 N  N   . LYS A  144 ? 0.3803 0.2817 0.2070 0.0260  0.0327  0.0216  142 LYS A N   
1142 C  CA  . LYS A  144 ? 0.4058 0.2919 0.2201 0.0270  0.0394  0.0288  142 LYS A CA  
1143 C  C   . LYS A  144 ? 0.4295 0.3010 0.2199 0.0358  0.0299  0.0259  142 LYS A C   
1144 O  O   . LYS A  144 ? 0.4420 0.2974 0.2189 0.0372  0.0347  0.0314  142 LYS A O   
1145 C  CB  . LYS A  144 ? 0.4256 0.2956 0.2246 0.0295  0.0545  0.0352  142 LYS A CB  
1146 C  CG  . LYS A  144 ? 0.4333 0.3173 0.2557 0.0225  0.0649  0.0382  142 LYS A CG  
1147 C  CD  . LYS A  144 ? 0.4647 0.3320 0.2712 0.0259  0.0812  0.0438  142 LYS A CD  
1148 C  CE  . LYS A  144 ? 0.4657 0.3480 0.2931 0.0224  0.0893  0.0445  142 LYS A CE  
1149 N  NZ  . LYS A  144 ? 0.5121 0.3777 0.3235 0.0263  0.1065  0.0495  142 LYS A NZ  
1150 N  N   . GLU A  145 ? 0.4761 0.3526 0.2616 0.0421  0.0168  0.0163  143 GLU A N   
1151 C  CA  . GLU A  145 ? 0.5568 0.4218 0.3203 0.0532  0.0053  0.0112  143 GLU A CA  
1152 C  C   . GLU A  145 ? 0.5111 0.3968 0.2965 0.0507  -0.0076 0.0027  143 GLU A C   
1153 O  O   . GLU A  145 ? 0.4508 0.3565 0.2609 0.0434  -0.0095 -0.0027 143 GLU A O   
1154 C  CB  . GLU A  145 ? 0.7008 0.5544 0.4394 0.0653  -0.0009 0.0042  143 GLU A CB  
1155 C  CG  . GLU A  145 ? 0.8241 0.6551 0.5384 0.0689  0.0130  0.0122  143 GLU A CG  
1156 C  CD  . GLU A  145 ? 0.9628 0.7610 0.6393 0.0792  0.0187  0.0193  143 GLU A CD  
1157 O  OE1 . GLU A  145 ? 0.9796 0.7721 0.6473 0.0846  0.0102  0.0178  143 GLU A OE1 
1158 O  OE2 . GLU A  145 ? 0.9351 0.7108 0.5887 0.0825  0.0330  0.0264  143 GLU A OE2 
1159 N  N   . LEU A  146 ? 0.5443 0.4230 0.3188 0.0572  -0.0151 0.0016  144 LEU A N   
1160 C  CA  . LEU A  146 ? 0.5479 0.4447 0.3387 0.0587  -0.0286 -0.0089 144 LEU A CA  
1161 C  C   . LEU A  146 ? 0.5127 0.3965 0.2776 0.0750  -0.0411 -0.0149 144 LEU A C   
1162 O  O   . LEU A  146 ? 0.5212 0.3779 0.2528 0.0842  -0.0376 -0.0083 144 LEU A O   
1163 C  CB  . LEU A  146 ? 0.5589 0.4662 0.3713 0.0489  -0.0259 -0.0046 144 LEU A CB  
1164 C  CG  . LEU A  146 ? 0.5566 0.4787 0.3958 0.0350  -0.0171 -0.0008 144 LEU A CG  
1165 C  CD1 . LEU A  146 ? 0.5412 0.4672 0.3929 0.0290  -0.0164 0.0033  144 LEU A CD1 
1166 C  CD2 . LEU A  146 ? 0.5134 0.4537 0.3720 0.0311  -0.0202 -0.0105 144 LEU A CD2 
1167 N  N   . THR A  147 ? 0.5010 0.4035 0.2809 0.0790  -0.0551 -0.0281 145 THR A N   
1168 C  CA  . THR A  147 ? 0.5272 0.4225 0.2862 0.0969  -0.0706 -0.0375 145 THR A CA  
1169 C  C   . THR A  147 ? 0.5505 0.4272 0.2896 0.1035  -0.0703 -0.0296 145 THR A C   
1170 O  O   . THR A  147 ? 0.5875 0.4673 0.3410 0.0924  -0.0618 -0.0214 145 THR A O   
1171 C  CB  . THR A  147 ? 0.5057 0.4312 0.2947 0.0978  -0.0847 -0.0554 145 THR A CB  
1172 O  OG1 . THR A  147 ? 0.4349 0.3778 0.2533 0.0863  -0.0804 -0.0539 145 THR A OG1 
1173 C  CG2 . THR A  147 ? 0.4831 0.4238 0.2897 0.0914  -0.0850 -0.0651 145 THR A CG2 
1174 N  N   . SER A  148 ? 0.5951 0.4506 0.2989 0.1226  -0.0802 -0.0327 146 SER A N   
1175 C  CA  . SER A  148 ? 0.6305 0.4670 0.3121 0.1327  -0.0831 -0.0283 146 SER A CA  
1176 C  C   . SER A  148 ? 0.6158 0.4786 0.3304 0.1271  -0.0892 -0.0342 146 SER A C   
1177 O  O   . SER A  148 ? 0.5912 0.4438 0.3023 0.1235  -0.0833 -0.0255 146 SER A O   
1178 C  CB  . SER A  148 ? 0.6566 0.4719 0.2979 0.1579  -0.0980 -0.0360 146 SER A CB  
1179 O  OG  . SER A  148 ? 0.7559 0.5483 0.3703 0.1697  -0.1005 -0.0315 146 SER A OG  
1180 N  N   . GLU A  149 ? 0.6174 0.5128 0.3643 0.1257  -0.0999 -0.0493 147 GLU A N   
1181 C  CA  . GLU A  149 ? 0.6237 0.5443 0.4026 0.1212  -0.1045 -0.0564 147 GLU A CA  
1182 C  C   . GLU A  149 ? 0.5280 0.4520 0.3263 0.1020  -0.0889 -0.0443 147 GLU A C   
1183 O  O   . GLU A  149 ? 0.5411 0.4639 0.3426 0.1012  -0.0883 -0.0410 147 GLU A O   
1184 C  CB  . GLU A  149 ? 0.6779 0.6326 0.4916 0.1197  -0.1142 -0.0752 147 GLU A CB  
1185 C  CG  . GLU A  149 ? 0.7890 0.7706 0.6368 0.1167  -0.1183 -0.0852 147 GLU A CG  
1186 C  CD  . GLU A  149 ? 0.9069 0.9207 0.7879 0.1176  -0.1287 -0.1068 147 GLU A CD  
1187 O  OE1 . GLU A  149 ? 0.8838 0.8971 0.7540 0.1281  -0.1400 -0.1169 147 GLU A OE1 
1188 O  OE2 . GLU A  149 ? 0.8996 0.9381 0.8173 0.1076  -0.1249 -0.1145 147 GLU A OE2 
1189 N  N   . LEU A  150 ? 0.4691 0.3973 0.2798 0.0878  -0.0776 -0.0388 148 LEU A N   
1190 C  CA  . LEU A  150 ? 0.4620 0.3944 0.2909 0.0715  -0.0651 -0.0292 148 LEU A CA  
1191 C  C   . LEU A  150 ? 0.4630 0.3699 0.2695 0.0707  -0.0573 -0.0151 148 LEU A C   
1192 O  O   . LEU A  150 ? 0.4404 0.3482 0.2569 0.0631  -0.0530 -0.0099 148 LEU A O   
1193 C  CB  . LEU A  150 ? 0.4855 0.4266 0.3297 0.0593  -0.0559 -0.0274 148 LEU A CB  
1194 C  CG  . LEU A  150 ? 0.4903 0.4567 0.3631 0.0544  -0.0590 -0.0405 148 LEU A CG  
1195 C  CD1 . LEU A  150 ? 0.5121 0.4798 0.3895 0.0465  -0.0511 -0.0389 148 LEU A CD1 
1196 C  CD2 . LEU A  150 ? 0.4695 0.4503 0.3673 0.0457  -0.0555 -0.0421 148 LEU A CD2 
1197 N  N   . LYS A  151 ? 0.4830 0.3651 0.2582 0.0785  -0.0548 -0.0095 149 LYS A N   
1198 C  CA  . LYS A  151 ? 0.5112 0.3665 0.2653 0.0765  -0.0447 0.0030  149 LYS A CA  
1199 C  C   . LYS A  151 ? 0.4820 0.3241 0.2200 0.0860  -0.0512 0.0028  149 LYS A C   
1200 O  O   . LYS A  151 ? 0.4619 0.2939 0.2001 0.0786  -0.0441 0.0104  149 LYS A O   
1201 C  CB  . LYS A  151 ? 0.6042 0.4334 0.3274 0.0820  -0.0368 0.0092  149 LYS A CB  
1202 C  CG  . LYS A  151 ? 0.7210 0.5614 0.4611 0.0708  -0.0272 0.0116  149 LYS A CG  
1203 C  CD  . LYS A  151 ? 0.8121 0.6245 0.5229 0.0739  -0.0148 0.0198  149 LYS A CD  
1204 C  CE  . LYS A  151 ? 0.8911 0.6897 0.5710 0.0915  -0.0237 0.0135  149 LYS A CE  
1205 N  NZ  . LYS A  151 ? 0.9417 0.7204 0.6009 0.0923  -0.0105 0.0200  149 LYS A NZ  
1206 N  N   . GLU A  152 ? 0.4564 0.3009 0.1836 0.1024  -0.0657 -0.0073 150 GLU A N   
1207 C  CA  . GLU A  152 ? 0.4722 0.3094 0.1886 0.1130  -0.0740 -0.0097 150 GLU A CA  
1208 C  C   . GLU A  152 ? 0.4359 0.2965 0.1860 0.1021  -0.0741 -0.0119 150 GLU A C   
1209 O  O   . GLU A  152 ? 0.4311 0.2792 0.1732 0.1026  -0.0727 -0.0072 150 GLU A O   
1210 C  CB  . GLU A  152 ? 0.4891 0.3296 0.1917 0.1346  -0.0917 -0.0230 150 GLU A CB  
1211 C  CG  . GLU A  152 ? 0.5464 0.3523 0.2013 0.1516  -0.0936 -0.0201 150 GLU A CG  
1212 C  CD  . GLU A  152 ? 0.5979 0.3609 0.2136 0.1546  -0.0823 -0.0061 150 GLU A CD  
1213 O  OE1 . GLU A  152 ? 0.6011 0.3586 0.2163 0.1546  -0.0825 -0.0036 150 GLU A OE1 
1214 O  OE2 . GLU A  152 ? 0.6396 0.3723 0.2239 0.1566  -0.0718 0.0023  150 GLU A OE2 
1215 N  N   . ASN A  153 ? 0.4031 0.2944 0.1881 0.0927  -0.0748 -0.0190 151 ASN A N   
1216 C  CA  . ASN A  153 ? 0.3990 0.3085 0.2124 0.0825  -0.0726 -0.0204 151 ASN A CA  
1217 C  C   . ASN A  153 ? 0.3551 0.2520 0.1683 0.0691  -0.0610 -0.0078 151 ASN A C   
1218 O  O   . ASN A  153 ? 0.3593 0.2554 0.1779 0.0661  -0.0605 -0.0060 151 ASN A O   
1219 C  CB  . ASN A  153 ? 0.4020 0.3410 0.2485 0.0743  -0.0722 -0.0295 151 ASN A CB  
1220 C  CG  . ASN A  153 ? 0.4544 0.4094 0.3260 0.0671  -0.0697 -0.0327 151 ASN A CG  
1221 O  OD1 . ASN A  153 ? 0.5706 0.5322 0.4463 0.0753  -0.0765 -0.0398 151 ASN A OD1 
1222 N  ND2 . ASN A  153 ? 0.4729 0.4325 0.3595 0.0530  -0.0598 -0.0275 151 ASN A ND2 
1223 N  N   . PHE A  154 ? 0.3361 0.2235 0.1437 0.0616  -0.0521 -0.0001 152 PHE A N   
1224 C  CA  . PHE A  154 ? 0.3238 0.2019 0.1348 0.0489  -0.0417 0.0097  152 PHE A CA  
1225 C  C   . PHE A  154 ? 0.3419 0.1918 0.1277 0.0525  -0.0394 0.0163  152 PHE A C   
1226 O  O   . PHE A  154 ? 0.3289 0.1744 0.1208 0.0447  -0.0362 0.0202  152 PHE A O   
1227 C  CB  . PHE A  154 ? 0.3148 0.1921 0.1281 0.0417  -0.0326 0.0144  152 PHE A CB  
1228 C  CG  . PHE A  154 ? 0.3069 0.1738 0.1232 0.0301  -0.0218 0.0233  152 PHE A CG  
1229 C  CD1 . PHE A  154 ? 0.3315 0.1744 0.1268 0.0304  -0.0124 0.0301  152 PHE A CD1 
1230 C  CD2 . PHE A  154 ? 0.2783 0.1587 0.1183 0.0195  -0.0205 0.0238  152 PHE A CD2 
1231 C  CE1 . PHE A  154 ? 0.3252 0.1615 0.1290 0.0183  -0.0014 0.0363  152 PHE A CE1 
1232 C  CE2 . PHE A  154 ? 0.2789 0.1531 0.1256 0.0093  -0.0124 0.0295  152 PHE A CE2 
1233 C  CZ  . PHE A  154 ? 0.3044 0.1585 0.1360 0.0077  -0.0026 0.0351  152 PHE A CZ  
1234 N  N   . ILE A  155 ? 0.3760 0.2044 0.1311 0.0653  -0.0412 0.0170  153 ILE A N   
1235 C  CA  . ILE A  155 ? 0.4150 0.2113 0.1400 0.0712  -0.0385 0.0227  153 ILE A CA  
1236 C  C   . ILE A  155 ? 0.4368 0.2368 0.1640 0.0772  -0.0478 0.0184  153 ILE A C   
1237 O  O   . ILE A  155 ? 0.4501 0.2337 0.1705 0.0726  -0.0435 0.0234  153 ILE A O   
1238 C  CB  . ILE A  155 ? 0.4516 0.2212 0.1373 0.0878  -0.0399 0.0234  153 ILE A CB  
1239 C  CG1 . ILE A  155 ? 0.4596 0.2176 0.1374 0.0815  -0.0269 0.0298  153 ILE A CG1 
1240 C  CG2 . ILE A  155 ? 0.4838 0.2175 0.1339 0.0973  -0.0384 0.0281  153 ILE A CG2 
1241 C  CD1 . ILE A  155 ? 0.4971 0.2319 0.1367 0.0991  -0.0292 0.0289  153 ILE A CD1 
1242 N  N   . ARG A  156 ? 0.4443 0.2666 0.1830 0.0870  -0.0598 0.0081  154 ARG A N   
1243 C  CA  . ARG A  156 ? 0.4576 0.2875 0.2025 0.0932  -0.0679 0.0026  154 ARG A CA  
1244 C  C   . ARG A  156 ? 0.4114 0.2497 0.1788 0.0777  -0.0620 0.0061  154 ARG A C   
1245 O  O   . ARG A  156 ? 0.4291 0.2535 0.1873 0.0787  -0.0621 0.0087  154 ARG A O   
1246 C  CB  . ARG A  156 ? 0.4915 0.3509 0.2556 0.1026  -0.0793 -0.0109 154 ARG A CB  
1247 C  CG  . ARG A  156 ? 0.5373 0.4067 0.3086 0.1120  -0.0877 -0.0186 154 ARG A CG  
1248 C  CD  . ARG A  156 ? 0.5776 0.4742 0.3655 0.1242  -0.0996 -0.0343 154 ARG A CD  
1249 N  NE  . ARG A  156 ? 0.6173 0.5075 0.3873 0.1342  -0.1057 -0.0374 154 ARG A NE  
1250 C  CZ  . ARG A  156 ? 0.5982 0.5087 0.3869 0.1298  -0.1069 -0.0442 154 ARG A CZ  
1251 N  NH1 . ARG A  156 ? 0.6109 0.5487 0.4368 0.1150  -0.1014 -0.0485 154 ARG A NH1 
1252 N  NH2 . ARG A  156 ? 0.5717 0.4717 0.3386 0.1409  -0.1131 -0.0468 154 ARG A NH2 
1253 N  N   . PHE A  157 ? 0.3597 0.2186 0.1537 0.0648  -0.0574 0.0058  155 PHE A N   
1254 C  CA  . PHE A  157 ? 0.3328 0.1993 0.1458 0.0526  -0.0534 0.0080  155 PHE A CA  
1255 C  C   . PHE A  157 ? 0.3448 0.1890 0.1470 0.0439  -0.0467 0.0169  155 PHE A C   
1256 O  O   . PHE A  157 ? 0.3295 0.1669 0.1321 0.0406  -0.0474 0.0181  155 PHE A O   
1257 C  CB  . PHE A  157 ? 0.3059 0.1951 0.1445 0.0430  -0.0498 0.0058  155 PHE A CB  
1258 C  CG  . PHE A  157 ? 0.2843 0.1784 0.1380 0.0327  -0.0465 0.0079  155 PHE A CG  
1259 C  CD1 . PHE A  157 ? 0.2820 0.1799 0.1406 0.0353  -0.0493 0.0042  155 PHE A CD1 
1260 C  CD2 . PHE A  157 ? 0.2649 0.1589 0.1264 0.0221  -0.0409 0.0129  155 PHE A CD2 
1261 C  CE1 . PHE A  157 ? 0.2712 0.1693 0.1381 0.0280  -0.0470 0.0060  155 PHE A CE1 
1262 C  CE2 . PHE A  157 ? 0.2587 0.1557 0.1310 0.0153  -0.0402 0.0137  155 PHE A CE2 
1263 C  CZ  . PHE A  157 ? 0.2669 0.1642 0.1398 0.0186  -0.0434 0.0105  155 PHE A CZ  
1264 N  N   . SER A  158 ? 0.3597 0.1908 0.1514 0.0405  -0.0398 0.0223  156 SER A N   
1265 C  CA  . SER A  158 ? 0.3881 0.1981 0.1723 0.0310  -0.0314 0.0292  156 SER A CA  
1266 C  C   . SER A  158 ? 0.4225 0.2057 0.1820 0.0373  -0.0328 0.0311  156 SER A C   
1267 O  O   . SER A  158 ? 0.4423 0.2157 0.2046 0.0286  -0.0302 0.0331  156 SER A O   
1268 C  CB  . SER A  158 ? 0.3970 0.1953 0.1720 0.0277  -0.0213 0.0341  156 SER A CB  
1269 O  OG  . SER A  158 ? 0.3743 0.1957 0.1736 0.0199  -0.0186 0.0331  156 SER A OG  
1270 N  N   . LYS A  159 ? 0.4482 0.2189 0.1825 0.0531  -0.0378 0.0295  157 LYS A N   
1271 C  CA  . LYS A  159 ? 0.4850 0.2284 0.1919 0.0623  -0.0400 0.0309  157 LYS A CA  
1272 C  C   . LYS A  159 ? 0.4571 0.2119 0.1771 0.0625  -0.0472 0.0268  157 LYS A C   
1273 O  O   . LYS A  159 ? 0.4993 0.2327 0.2058 0.0614  -0.0459 0.0294  157 LYS A O   
1274 C  CB  . LYS A  159 ? 0.5342 0.2648 0.2117 0.0827  -0.0465 0.0284  157 LYS A CB  
1275 C  CG  . LYS A  159 ? 0.6181 0.3173 0.2645 0.0855  -0.0368 0.0350  157 LYS A CG  
1276 C  CD  . LYS A  159 ? 0.7016 0.3900 0.3178 0.1082  -0.0456 0.0311  157 LYS A CD  
1277 C  CE  . LYS A  159 ? 0.8225 0.4767 0.4042 0.1115  -0.0343 0.0382  157 LYS A CE  
1278 N  NZ  . LYS A  159 ? 0.9084 0.5384 0.4473 0.1373  -0.0432 0.0355  157 LYS A NZ  
1279 N  N   . SER A  160 ? 0.4270 0.2133 0.1722 0.0635  -0.0536 0.0203  158 SER A N   
1280 C  CA  . SER A  160 ? 0.4105 0.2065 0.1668 0.0645  -0.0586 0.0163  158 SER A CA  
1281 C  C   . SER A  160 ? 0.4040 0.1945 0.1697 0.0498  -0.0541 0.0201  158 SER A C   
1282 O  O   . SER A  160 ? 0.4058 0.1934 0.1718 0.0505  -0.0572 0.0185  158 SER A O   
1283 C  CB  . SER A  160 ? 0.3802 0.2094 0.1628 0.0665  -0.0626 0.0084  158 SER A CB  
1284 O  OG  . SER A  160 ? 0.3742 0.2185 0.1795 0.0526  -0.0577 0.0096  158 SER A OG  
1285 N  N   . LEU A  161 ? 0.3867 0.1759 0.1603 0.0372  -0.0474 0.0242  159 LEU A N   
1286 C  CA  . LEU A  161 ? 0.3908 0.1763 0.1755 0.0238  -0.0448 0.0259  159 LEU A CA  
1287 C  C   . LEU A  161 ? 0.4209 0.1762 0.1884 0.0179  -0.0386 0.0303  159 LEU A C   
1288 O  O   . LEU A  161 ? 0.4254 0.1778 0.2047 0.0053  -0.0361 0.0303  159 LEU A O   
1289 C  CB  . LEU A  161 ? 0.3647 0.1714 0.1746 0.0133  -0.0417 0.0257  159 LEU A CB  
1290 C  CG  . LEU A  161 ? 0.3468 0.1800 0.1738 0.0165  -0.0454 0.0215  159 LEU A CG  
1291 C  CD1 . LEU A  161 ? 0.3378 0.1864 0.1852 0.0068  -0.0420 0.0220  159 LEU A CD1 
1292 C  CD2 . LEU A  161 ? 0.3412 0.1778 0.1703 0.0204  -0.0507 0.0178  159 LEU A CD2 
1293 N  N   . GLY A  162 ? 0.4501 0.1818 0.1892 0.0273  -0.0359 0.0332  160 GLY A N   
1294 C  CA  . GLY A  162 ? 0.4798 0.1760 0.1964 0.0233  -0.0282 0.0374  160 GLY A CA  
1295 C  C   . GLY A  162 ? 0.5123 0.1926 0.2207 0.0168  -0.0151 0.0423  160 GLY A C   
1296 O  O   . GLY A  162 ? 0.5276 0.1761 0.2184 0.0110  -0.0050 0.0458  160 GLY A O   
1297 N  N   . LEU A  163 ? 0.5113 0.2115 0.2315 0.0174  -0.0136 0.0425  161 LEU A N   
1298 C  CA  . LEU A  163 ? 0.5403 0.2271 0.2546 0.0110  0.0004  0.0471  161 LEU A CA  
1299 C  C   . LEU A  163 ? 0.5807 0.2408 0.2554 0.0273  0.0032  0.0508  161 LEU A C   
1300 O  O   . LEU A  163 ? 0.5938 0.2668 0.2623 0.0421  -0.0074 0.0477  161 LEU A O   
1301 C  CB  . LEU A  163 ? 0.4964 0.2160 0.2419 0.0037  0.0011  0.0454  161 LEU A CB  
1302 C  CG  . LEU A  163 ? 0.4765 0.2210 0.2592 -0.0106 -0.0015 0.0415  161 LEU A CG  
1303 C  CD1 . LEU A  163 ? 0.4541 0.2296 0.2619 -0.0131 -0.0026 0.0398  161 LEU A CD1 
1304 C  CD2 . LEU A  163 ? 0.4896 0.2181 0.2799 -0.0262 0.0096  0.0423  161 LEU A CD2 
1305 N  N   . PRO A  164 ? 0.6505 0.2720 0.2978 0.0248  0.0180  0.0566  162 PRO A N   
1306 C  CA  . PRO A  164 ? 0.6974 0.2880 0.3013 0.0414  0.0224  0.0607  162 PRO A CA  
1307 C  C   . PRO A  164 ? 0.6870 0.2848 0.2948 0.0395  0.0308  0.0628  162 PRO A C   
1308 O  O   . PRO A  164 ? 0.6870 0.3126 0.3320 0.0242  0.0349  0.0616  162 PRO A O   
1309 C  CB  . PRO A  164 ? 0.7332 0.2743 0.3043 0.0378  0.0377  0.0664  162 PRO A CB  
1310 C  CG  . PRO A  164 ? 0.7289 0.2806 0.3365 0.0129  0.0477  0.0654  162 PRO A CG  
1311 C  CD  . PRO A  164 ? 0.6715 0.2727 0.3240 0.0072  0.0316  0.0586  162 PRO A CD  
1312 N  N   . GLU A  165 ? 0.7434 0.3147 0.3109 0.0566  0.0327  0.0657  163 GLU A N   
1313 C  CA  . GLU A  165 ? 0.7791 0.3596 0.3461 0.0604  0.0356  0.0662  163 GLU A CA  
1314 C  C   . GLU A  165 ? 0.7243 0.2977 0.3044 0.0417  0.0576  0.0714  163 GLU A C   
1315 O  O   . GLU A  165 ? 0.6922 0.2898 0.2943 0.0367  0.0596  0.0704  163 GLU A O   
1316 C  CB  . GLU A  165 ? 0.9014 0.4472 0.4147 0.0848  0.0329  0.0678  163 GLU A CB  
1317 C  CG  . GLU A  165 ? 1.0265 0.5922 0.5406 0.0959  0.0239  0.0637  163 GLU A CG  
1318 C  CD  . GLU A  165 ? 1.0559 0.6464 0.5726 0.1143  -0.0009 0.0537  163 GLU A CD  
1319 O  OE1 . GLU A  165 ? 1.0024 0.6019 0.5284 0.1160  -0.0107 0.0501  163 GLU A OE1 
1320 O  OE2 . GLU A  165 ? 0.8925 0.4934 0.4027 0.1268  -0.0101 0.0485  163 GLU A OE2 
1321 N  N   . ASN A  166 ? 0.7233 0.2628 0.2903 0.0315  0.0751  0.0764  164 ASN A N   
1322 C  CA  . ASN A  166 ? 0.7239 0.2555 0.3054 0.0131  0.0985  0.0801  164 ASN A CA  
1323 C  C   . ASN A  166 ? 0.6687 0.2446 0.3109 -0.0084 0.0969  0.0747  164 ASN A C   
1324 O  O   . ASN A  166 ? 0.6862 0.2646 0.3506 -0.0245 0.1144  0.0755  164 ASN A O   
1325 C  CB  . ASN A  166 ? 0.7753 0.2526 0.3218 0.0087  0.1204  0.0862  164 ASN A CB  
1326 C  CG  . ASN A  166 ? 0.7859 0.2588 0.3434 -0.0009 0.1170  0.0835  164 ASN A CG  
1327 O  OD1 . ASN A  166 ? 0.7653 0.2669 0.3413 0.0027  0.0958  0.0782  164 ASN A OD1 
1328 N  ND2 . ASN A  166 ? 0.8211 0.2572 0.3677 -0.0142 0.1393  0.0867  164 ASN A ND2 
1329 N  N   . HIS A  167 ? 0.6062 0.2163 0.2740 -0.0073 0.0761  0.0688  165 HIS A N   
1330 C  CA  . HIS A  167 ? 0.5639 0.2172 0.2838 -0.0221 0.0705  0.0631  165 HIS A CA  
1331 C  C   . HIS A  167 ? 0.5231 0.2128 0.2600 -0.0146 0.0573  0.0601  165 HIS A C   
1332 O  O   . HIS A  167 ? 0.4631 0.1880 0.2362 -0.0214 0.0477  0.0551  165 HIS A O   
1333 C  CB  . HIS A  167 ? 0.5445 0.2065 0.2799 -0.0273 0.0587  0.0585  165 HIS A CB  
1334 C  CG  . HIS A  167 ? 0.5768 0.2141 0.3136 -0.0420 0.0723  0.0586  165 HIS A CG  
1335 N  ND1 . HIS A  167 ? 0.5790 0.2373 0.3581 -0.0608 0.0756  0.0530  165 HIS A ND1 
1336 C  CD2 . HIS A  167 ? 0.6153 0.2080 0.3167 -0.0406 0.0833  0.0627  165 HIS A CD2 
1337 C  CE1 . HIS A  167 ? 0.5957 0.2251 0.3686 -0.0720 0.0885  0.0528  165 HIS A CE1 
1338 N  NE2 . HIS A  167 ? 0.6254 0.2129 0.3500 -0.0604 0.0944  0.0593  165 HIS A NE2 
1339 N  N   . ILE A  168 ? 0.5512 0.2294 0.2596 -0.0002 0.0574  0.0628  166 ILE A N   
1340 C  CA  . ILE A  168 ? 0.5188 0.2269 0.2400 0.0065  0.0469  0.0594  166 ILE A CA  
1341 C  C   . ILE A  168 ? 0.5182 0.2150 0.2264 0.0083  0.0607  0.0635  166 ILE A C   
1342 O  O   . ILE A  168 ? 0.5596 0.2195 0.2274 0.0176  0.0698  0.0683  166 ILE A O   
1343 C  CB  . ILE A  168 ? 0.5310 0.2401 0.2311 0.0252  0.0294  0.0558  166 ILE A CB  
1344 C  CG1 . ILE A  168 ? 0.5349 0.2522 0.2450 0.0246  0.0177  0.0522  166 ILE A CG1 
1345 C  CG2 . ILE A  168 ? 0.5226 0.2627 0.2392 0.0300  0.0197  0.0509  166 ILE A CG2 
1346 C  CD1 . ILE A  168 ? 0.5530 0.2705 0.2442 0.0429  0.0019  0.0477  166 ILE A CD1 
1347 N  N   . VAL A  169 ? 0.4742 0.1997 0.2135 0.0003  0.0628  0.0617  167 VAL A N   
1348 C  CA  . VAL A  169 ? 0.4814 0.1979 0.2100 0.0020  0.0762  0.0652  167 VAL A CA  
1349 C  C   . VAL A  169 ? 0.4444 0.1907 0.1877 0.0072  0.0656  0.0611  167 VAL A C   
1350 O  O   . VAL A  169 ? 0.3990 0.1773 0.1716 0.0039  0.0525  0.0558  167 VAL A O   
1351 C  CB  . VAL A  169 ? 0.4851 0.1997 0.2355 -0.0148 0.0974  0.0680  167 VAL A CB  
1352 C  CG1 . VAL A  169 ? 0.5176 0.2026 0.2571 -0.0227 0.1095  0.0708  167 VAL A CG1 
1353 C  CG2 . VAL A  169 ? 0.4417 0.1991 0.2431 -0.0272 0.0918  0.0625  167 VAL A CG2 
1354 N  N   . PHE A  170 ? 0.4629 0.1947 0.1828 0.0155  0.0727  0.0636  168 PHE A N   
1355 C  CA  . PHE A  170 ? 0.4473 0.2020 0.1775 0.0200  0.0655  0.0598  168 PHE A CA  
1356 C  C   . PHE A  170 ? 0.4515 0.2035 0.1880 0.0133  0.0840  0.0639  168 PHE A C   
1357 O  O   . PHE A  170 ? 0.4802 0.2019 0.1834 0.0204  0.0963  0.0686  168 PHE A O   
1358 C  CB  . PHE A  170 ? 0.4680 0.2093 0.1628 0.0390  0.0530  0.0566  168 PHE A CB  
1359 C  CG  . PHE A  170 ? 0.4630 0.2122 0.1570 0.0462  0.0345  0.0509  168 PHE A CG  
1360 C  CD1 . PHE A  170 ? 0.5000 0.2199 0.1626 0.0551  0.0333  0.0531  168 PHE A CD1 
1361 C  CD2 . PHE A  170 ? 0.4195 0.2039 0.1449 0.0432  0.0204  0.0436  168 PHE A CD2 
1362 C  CE1 . PHE A  170 ? 0.4995 0.2283 0.1638 0.0619  0.0169  0.0475  168 PHE A CE1 
1363 C  CE2 . PHE A  170 ? 0.4180 0.2107 0.1460 0.0487  0.0058  0.0380  168 PHE A CE2 
1364 C  CZ  . PHE A  170 ? 0.4573 0.2238 0.1559 0.0584  0.0034  0.0397  168 PHE A CZ  
1365 N  N   . PRO A  171 ? 0.4257 0.2075 0.2037 0.0004  0.0867  0.0620  169 PRO A N   
1366 C  CA  . PRO A  171 ? 0.4356 0.2198 0.2273 -0.0069 0.1048  0.0648  169 PRO A CA  
1367 C  C   . PRO A  171 ? 0.4569 0.2312 0.2239 0.0042  0.1077  0.0661  169 PRO A C   
1368 O  O   . PRO A  171 ? 0.4372 0.2221 0.1976 0.0136  0.0917  0.0617  169 PRO A O   
1369 C  CB  . PRO A  171 ? 0.3972 0.2212 0.2362 -0.0170 0.0980  0.0597  169 PRO A CB  
1370 C  CG  . PRO A  171 ? 0.3864 0.2194 0.2356 -0.0195 0.0832  0.0563  169 PRO A CG  
1371 C  CD  . PRO A  171 ? 0.3947 0.2081 0.2078 -0.0066 0.0729  0.0567  169 PRO A CD  
1372 N  N   . VAL A  172 ? 0.5043 0.2573 0.2582 0.0028  0.1291  0.0714  170 VAL A N   
1373 C  CA  . VAL A  172 ? 0.5526 0.2880 0.2756 0.0145  0.1346  0.0736  170 VAL A CA  
1374 C  C   . VAL A  172 ? 0.5142 0.2818 0.2666 0.0120  0.1311  0.0698  170 VAL A C   
1375 O  O   . VAL A  172 ? 0.5138 0.3044 0.3045 0.0000  0.1392  0.0692  170 VAL A O   
1376 C  CB  . VAL A  172 ? 0.6097 0.3086 0.3085 0.0130  0.1623  0.0812  170 VAL A CB  
1377 C  CG1 . VAL A  172 ? 0.6523 0.3296 0.3158 0.0261  0.1696  0.0838  170 VAL A CG1 
1378 C  CG2 . VAL A  172 ? 0.6584 0.3204 0.3236 0.0163  0.1665  0.0851  170 VAL A CG2 
1379 N  N   . PRO A  173 ? 0.4998 0.2694 0.2349 0.0237  0.1181  0.0663  171 PRO A N   
1380 C  CA  . PRO A  173 ? 0.4695 0.2638 0.2263 0.0224  0.1161  0.0630  171 PRO A CA  
1381 C  C   . PRO A  173 ? 0.4679 0.2554 0.2282 0.0188  0.1389  0.0679  171 PRO A C   
1382 O  O   . PRO A  173 ? 0.4950 0.2496 0.2236 0.0235  0.1549  0.0735  171 PRO A O   
1383 C  CB  . PRO A  173 ? 0.4744 0.2599 0.2012 0.0367  0.1018  0.0584  171 PRO A CB  
1384 C  CG  . PRO A  173 ? 0.4848 0.2580 0.1914 0.0436  0.0882  0.0561  171 PRO A CG  
1385 C  CD  . PRO A  173 ? 0.5094 0.2611 0.2076 0.0387  0.1025  0.0633  171 PRO A CD  
1386 N  N   . ILE A  174 ? 0.4424 0.2597 0.2405 0.0112  0.1411  0.0657  172 ILE A N   
1387 C  CA  . ILE A  174 ? 0.4552 0.2723 0.2623 0.0088  0.1614  0.0686  172 ILE A CA  
1388 C  C   . ILE A  174 ? 0.4415 0.2835 0.2664 0.0115  0.1535  0.0643  172 ILE A C   
1389 O  O   . ILE A  174 ? 0.3888 0.2489 0.2240 0.0123  0.1345  0.0593  172 ILE A O   
1390 C  CB  . ILE A  174 ? 0.4490 0.2798 0.2937 -0.0052 0.1762  0.0692  172 ILE A CB  
1391 C  CG1 . ILE A  174 ? 0.4018 0.2703 0.2893 -0.0125 0.1597  0.0629  172 ILE A CG1 
1392 C  CG2 . ILE A  174 ? 0.4795 0.2819 0.3061 -0.0093 0.1874  0.0736  172 ILE A CG2 
1393 C  CD1 . ILE A  174 ? 0.3936 0.2830 0.3248 -0.0250 0.1712  0.0604  172 ILE A CD1 
1394 N  N   . ASP A  175 ? 0.4719 0.3129 0.2998 0.0127  0.1699  0.0664  173 ASP A N   
1395 C  CA  . ASP A  175 ? 0.4836 0.3425 0.3227 0.0169  0.1651  0.0631  173 ASP A CA  
1396 C  C   . ASP A  175 ? 0.4467 0.3366 0.3317 0.0094  0.1712  0.0608  173 ASP A C   
1397 O  O   . ASP A  175 ? 0.4352 0.3451 0.3356 0.0120  0.1618  0.0569  173 ASP A O   
1398 C  CB  . ASP A  175 ? 0.5529 0.3866 0.3574 0.0271  0.1769  0.0662  173 ASP A CB  
1399 C  CG  . ASP A  175 ? 0.6237 0.4324 0.3841 0.0379  0.1638  0.0649  173 ASP A CG  
1400 O  OD1 . ASP A  175 ? 0.6991 0.4771 0.4215 0.0472  0.1740  0.0683  173 ASP A OD1 
1401 O  OD2 . ASP A  175 ? 0.6346 0.4541 0.3986 0.0378  0.1433  0.0598  173 ASP A OD2 
1402 N  N   . GLN A  176 ? 0.4280 0.3210 0.3345 0.0006  0.1872  0.0623  174 GLN A N   
1403 C  CA  . GLN A  176 ? 0.3923 0.3172 0.3463 -0.0058 0.1929  0.0580  174 GLN A CA  
1404 C  C   . GLN A  176 ? 0.3474 0.3005 0.3302 -0.0093 0.1713  0.0519  174 GLN A C   
1405 O  O   . GLN A  176 ? 0.3300 0.2789 0.3084 -0.0135 0.1603  0.0516  174 GLN A O   
1406 C  CB  . GLN A  176 ? 0.4117 0.3326 0.3839 -0.0161 0.2159  0.0593  174 GLN A CB  
1407 C  CG  . GLN A  176 ? 0.4505 0.3402 0.3927 -0.0121 0.2412  0.0658  174 GLN A CG  
1408 C  CD  . GLN A  176 ? 0.4905 0.3387 0.3875 -0.0109 0.2474  0.0724  174 GLN A CD  
1409 O  OE1 . GLN A  176 ? 0.4985 0.3401 0.3799 -0.0098 0.2293  0.0723  174 GLN A OE1 
1410 N  NE2 . GLN A  176 ? 0.5263 0.3445 0.4002 -0.0097 0.2737  0.0781  174 GLN A NE2 
1411 N  N   . CYS A  177 ? 0.3216 0.3002 0.3294 -0.0058 0.1651  0.0471  175 CYS A N   
1412 C  CA  . CYS A  177 ? 0.2849 0.2912 0.3241 -0.0079 0.1481  0.0405  175 CYS A CA  
1413 C  C   . CYS A  177 ? 0.2841 0.2867 0.3046 -0.0035 0.1270  0.0398  175 CYS A C   
1414 O  O   . CYS A  177 ? 0.2552 0.2741 0.2887 0.0006  0.1144  0.0354  175 CYS A O   
1415 C  CB  . CYS A  177 ? 0.2729 0.2901 0.3417 -0.0195 0.1507  0.0372  175 CYS A CB  
1416 S  SG  . CYS A  177 ? 0.2854 0.3158 0.3911 -0.0273 0.1757  0.0343  175 CYS A SG  
1417 N  N   . ILE A  178 ? 0.3119 0.2924 0.3024 -0.0041 0.1236  0.0435  176 ILE A N   
1418 C  CA  . ILE A  178 ? 0.3146 0.2945 0.2956 -0.0032 0.1053  0.0415  176 ILE A CA  
1419 C  C   . ILE A  178 ? 0.3570 0.3274 0.3129 0.0045  0.0984  0.0412  176 ILE A C   
1420 O  O   . ILE A  178 ? 0.3969 0.3679 0.3472 0.0052  0.0850  0.0386  176 ILE A O   
1421 C  CB  . ILE A  178 ? 0.3207 0.2853 0.2873 -0.0079 0.1028  0.0437  176 ILE A CB  
1422 C  CG1 . ILE A  178 ? 0.3385 0.2762 0.2684 -0.0029 0.1095  0.0480  176 ILE A CG1 
1423 C  CG2 . ILE A  178 ? 0.3351 0.3053 0.3252 -0.0173 0.1114  0.0436  176 ILE A CG2 
1424 C  CD1 . ILE A  178 ? 0.3551 0.2747 0.2661 -0.0047 0.1065  0.0501  176 ILE A CD1 
1425 N  N   . ASP A  179 ? 0.4068 0.3673 0.3478 0.0099  0.1086  0.0432  177 ASP A N   
1426 C  CA  . ASP A  179 ? 0.4550 0.4067 0.3743 0.0167  0.1030  0.0415  177 ASP A CA  
1427 C  C   . ASP A  179 ? 0.5072 0.4723 0.4401 0.0210  0.1019  0.0389  177 ASP A C   
1428 O  O   . ASP A  179 ? 0.5157 0.4723 0.4319 0.0264  0.1007  0.0374  177 ASP A O   
1429 C  CB  . ASP A  179 ? 0.4794 0.4092 0.3697 0.0220  0.1133  0.0444  177 ASP A CB  
1430 C  CG  . ASP A  179 ? 0.5289 0.4392 0.3944 0.0221  0.1107  0.0458  177 ASP A CG  
1431 O  OD1 . ASP A  179 ? 0.5655 0.4797 0.4345 0.0187  0.0987  0.0436  177 ASP A OD1 
1432 O  OD2 . ASP A  179 ? 0.5511 0.4404 0.3915 0.0270  0.1207  0.0491  177 ASP A OD2 
1433 N  N   . GLY A  180 ? 0.5939 0.5789 0.5563 0.0194  0.1019  0.0375  178 GLY A N   
1434 C  CA  . GLY A  180 ? 0.6228 0.6199 0.5969 0.0261  0.0997  0.0346  178 GLY A CA  
1435 C  C   . GLY A  180 ? 0.6130 0.6086 0.5801 0.0284  0.0857  0.0315  178 GLY A C   
1436 O  O   . GLY A  180 ? 0.5329 0.5171 0.4814 0.0333  0.0848  0.0306  178 GLY A O   
1437 N  N   . SER B  5   ? 0.9266 0.6604 0.6085 0.1334  -0.1556 -0.2015 3   SER B N   
1438 C  CA  . SER B  5   ? 0.8975 0.6334 0.6299 0.1089  -0.1565 -0.2016 3   SER B CA  
1439 C  C   . SER B  5   ? 0.8717 0.5955 0.6039 0.1063  -0.1443 -0.1972 3   SER B C   
1440 O  O   . SER B  5   ? 0.8392 0.5675 0.5549 0.1092  -0.1232 -0.1807 3   SER B O   
1441 C  CB  . SER B  5   ? 0.8473 0.6046 0.6098 0.0905  -0.1431 -0.1836 3   SER B CB  
1442 N  N   . THR B  6   ? 0.8489 0.5574 0.6014 0.1009  -0.1581 -0.2123 4   THR B N   
1443 C  CA  . THR B  6   ? 0.8392 0.5296 0.5795 0.1066  -0.1535 -0.2153 4   THR B CA  
1444 C  C   . THR B  6   ? 0.7572 0.4449 0.5386 0.0855  -0.1456 -0.2083 4   THR B C   
1445 O  O   . THR B  6   ? 0.7409 0.4150 0.5157 0.0881  -0.1386 -0.2072 4   THR B O   
1446 C  CB  . THR B  6   ? 0.9225 0.5909 0.6476 0.1216  -0.1783 -0.2415 4   THR B CB  
1447 O  OG1 . THR B  6   ? 0.9317 0.6027 0.6800 0.1168  -0.2016 -0.2574 4   THR B OG1 
1448 C  CG2 . THR B  6   ? 0.9646 0.6257 0.6323 0.1501  -0.1775 -0.2456 4   THR B CG2 
1449 N  N   . SER B  7   ? 0.6893 0.3890 0.5120 0.0662  -0.1469 -0.2037 5   SER B N   
1450 C  CA  . SER B  7   ? 0.6542 0.3480 0.5205 0.0470  -0.1452 -0.2016 5   SER B CA  
1451 C  C   . SER B  7   ? 0.6033 0.3024 0.4739 0.0386  -0.1200 -0.1796 5   SER B C   
1452 O  O   . SER B  7   ? 0.5587 0.2710 0.4077 0.0436  -0.1044 -0.1652 5   SER B O   
1453 C  CB  . SER B  7   ? 0.6433 0.3502 0.5526 0.0308  -0.1542 -0.2035 5   SER B CB  
1454 O  OG  . SER B  7   ? 0.6392 0.3692 0.5498 0.0254  -0.1397 -0.1860 5   SER B OG  
1455 N  N   . ASP B  8   ? 0.5836 0.2718 0.4834 0.0262  -0.1166 -0.1772 6   ASP B N   
1456 C  CA  . ASP B  8   ? 0.5558 0.2483 0.4619 0.0185  -0.0945 -0.1571 6   ASP B CA  
1457 C  C   . ASP B  8   ? 0.5089 0.2251 0.4319 0.0073  -0.0820 -0.1403 6   ASP B C   
1458 O  O   . ASP B  8   ? 0.5000 0.2269 0.4466 -0.0010 -0.0900 -0.1433 6   ASP B O   
1459 C  CB  . ASP B  8   ? 0.5747 0.2491 0.5097 0.0080  -0.0940 -0.1577 6   ASP B CB  
1460 C  CG  . ASP B  8   ? 0.6315 0.2806 0.5537 0.0183  -0.1083 -0.1760 6   ASP B CG  
1461 O  OD1 . ASP B  8   ? 0.6677 0.2994 0.6186 0.0093  -0.1142 -0.1815 6   ASP B OD1 
1462 O  OD2 . ASP B  8   ? 0.6595 0.3055 0.5431 0.0361  -0.1136 -0.1847 6   ASP B OD2 
1463 N  N   . LEU B  9   ? 0.4735 0.1979 0.3852 0.0079  -0.0631 -0.1234 7   LEU B N   
1464 C  CA  . LEU B  9   ? 0.4415 0.1874 0.3633 0.0003  -0.0510 -0.1078 7   LEU B CA  
1465 C  C   . LEU B  9   ? 0.4258 0.1707 0.3642 -0.0083 -0.0354 -0.0928 7   LEU B C   
1466 O  O   . LEU B  9   ? 0.4324 0.1639 0.3608 -0.0038 -0.0296 -0.0910 7   LEU B O   
1467 C  CB  . LEU B  9   ? 0.4304 0.1890 0.3204 0.0117  -0.0438 -0.1018 7   LEU B CB  
1468 C  CG  . LEU B  9   ? 0.4396 0.2033 0.3120 0.0207  -0.0561 -0.1120 7   LEU B CG  
1469 C  CD1 . LEU B  9   ? 0.4360 0.2088 0.2773 0.0325  -0.0456 -0.1036 7   LEU B CD1 
1470 C  CD2 . LEU B  9   ? 0.4281 0.2057 0.3248 0.0107  -0.0631 -0.1125 7   LEU B CD2 
1471 N  N   . ILE B  10  ? 0.4110 0.1700 0.3728 -0.0192 -0.0282 -0.0819 8   ILE B N   
1472 C  CA  . ILE B  10  ? 0.3984 0.1591 0.3681 -0.0238 -0.0118 -0.0658 8   ILE B CA  
1473 C  C   . ILE B  10  ? 0.3902 0.1585 0.3316 -0.0138 -0.0018 -0.0580 8   ILE B C   
1474 O  O   . ILE B  10  ? 0.3896 0.1716 0.3172 -0.0092 -0.0027 -0.0580 8   ILE B O   
1475 C  CB  . ILE B  10  ? 0.3747 0.1507 0.3716 -0.0348 -0.0057 -0.0556 8   ILE B CB  
1476 C  CG1 . ILE B  10  ? 0.3864 0.1546 0.4188 -0.0461 -0.0130 -0.0612 8   ILE B CG1 
1477 C  CG2 . ILE B  10  ? 0.3595 0.1388 0.3553 -0.0351 0.0113  -0.0388 8   ILE B CG2 
1478 C  CD1 . ILE B  10  ? 0.3734 0.1601 0.4330 -0.0555 -0.0117 -0.0561 8   ILE B CD1 
1479 N  N   . PRO B  11  ? 0.4030 0.1619 0.3370 -0.0100 0.0075  -0.0515 9   PRO B N   
1480 C  CA  . PRO B  11  ? 0.3999 0.1651 0.3101 0.0000  0.0155  -0.0461 9   PRO B CA  
1481 C  C   . PRO B  11  ? 0.3849 0.1706 0.2977 -0.0020 0.0236  -0.0349 9   PRO B C   
1482 O  O   . PRO B  11  ? 0.3817 0.1726 0.3124 -0.0097 0.0280  -0.0272 9   PRO B O   
1483 C  CB  . PRO B  11  ? 0.4118 0.1624 0.3207 0.0028  0.0229  -0.0413 9   PRO B CB  
1484 C  CG  . PRO B  11  ? 0.4276 0.1591 0.3529 -0.0032 0.0161  -0.0480 9   PRO B CG  
1485 C  CD  . PRO B  11  ? 0.4189 0.1589 0.3668 -0.0141 0.0099  -0.0501 9   PRO B CD  
1486 N  N   . ALA B  12  ? 0.3831 0.1799 0.2789 0.0053  0.0260  -0.0337 10  ALA B N   
1487 C  CA  . ALA B  12  ? 0.3676 0.1818 0.2658 0.0044  0.0332  -0.0237 10  ALA B CA  
1488 C  C   . ALA B  12  ? 0.3740 0.1862 0.2760 0.0054  0.0422  -0.0148 10  ALA B C   
1489 O  O   . ALA B  12  ? 0.3880 0.1888 0.2823 0.0110  0.0446  -0.0157 10  ALA B O   
1490 C  CB  . ALA B  12  ? 0.3669 0.1911 0.2490 0.0123  0.0350  -0.0237 10  ALA B CB  
1491 N  N   . PRO B  13  ? 0.3868 0.2093 0.2994 0.0013  0.0468  -0.0065 11  PRO B N   
1492 C  CA  . PRO B  13  ? 0.3934 0.2140 0.3062 0.0046  0.0546  0.0017  11  PRO B CA  
1493 C  C   . PRO B  13  ? 0.3974 0.2253 0.2984 0.0136  0.0574  0.0028  11  PRO B C   
1494 O  O   . PRO B  13  ? 0.3820 0.2207 0.2789 0.0151  0.0553  0.0003  11  PRO B O   
1495 C  CB  . PRO B  13  ? 0.3868 0.2189 0.3111 0.0000  0.0576  0.0090  11  PRO B CB  
1496 C  CG  . PRO B  13  ? 0.3804 0.2261 0.3055 -0.0027 0.0521  0.0050  11  PRO B CG  
1497 C  CD  . PRO B  13  ? 0.3851 0.2228 0.3057 -0.0036 0.0448  -0.0047 11  PRO B CD  
1498 N  N   . PRO B  14  ? 0.4103 0.2323 0.3071 0.0199  0.0621  0.0068  12  PRO B N   
1499 C  CA  . PRO B  14  ? 0.4013 0.2336 0.2926 0.0280  0.0642  0.0081  12  PRO B CA  
1500 C  C   . PRO B  14  ? 0.4022 0.2514 0.2999 0.0268  0.0641  0.0120  12  PRO B C   
1501 O  O   . PRO B  14  ? 0.4097 0.2602 0.3128 0.0232  0.0650  0.0165  12  PRO B O   
1502 C  CB  . PRO B  14  ? 0.4052 0.2268 0.2920 0.0351  0.0680  0.0118  12  PRO B CB  
1503 C  CG  . PRO B  14  ? 0.4182 0.2279 0.3102 0.0297  0.0704  0.0165  12  PRO B CG  
1504 C  CD  . PRO B  14  ? 0.4135 0.2202 0.3126 0.0200  0.0660  0.0112  12  PRO B CD  
1505 N  N   . LEU B  15  ? 0.4201 0.2817 0.3183 0.0303  0.0634  0.0106  13  LEU B N   
1506 C  CA  . LEU B  15  ? 0.4597 0.3363 0.3654 0.0291  0.0619  0.0128  13  LEU B CA  
1507 C  C   . LEU B  15  ? 0.4586 0.3374 0.3655 0.0340  0.0624  0.0169  13  LEU B C   
1508 O  O   . LEU B  15  ? 0.4186 0.3064 0.3302 0.0329  0.0606  0.0186  13  LEU B O   
1509 C  CB  . LEU B  15  ? 0.5123 0.4000 0.4216 0.0318  0.0619  0.0110  13  LEU B CB  
1510 C  CG  . LEU B  15  ? 0.5905 0.4774 0.4955 0.0286  0.0622  0.0084  13  LEU B CG  
1511 C  CD1 . LEU B  15  ? 0.6754 0.5735 0.5856 0.0319  0.0650  0.0092  13  LEU B CD1 
1512 C  CD2 . LEU B  15  ? 0.5420 0.4303 0.4483 0.0212  0.0587  0.0084  13  LEU B CD2 
1513 N  N   . SER B  16  ? 0.4620 0.3312 0.3627 0.0407  0.0646  0.0182  14  SER B N   
1514 C  CA  . SER B  16  ? 0.4590 0.3276 0.3562 0.0482  0.0653  0.0224  14  SER B CA  
1515 C  C   . SER B  16  ? 0.4733 0.3372 0.3697 0.0445  0.0686  0.0283  14  SER B C   
1516 O  O   . SER B  16  ? 0.4285 0.2937 0.3203 0.0514  0.0697  0.0325  14  SER B O   
1517 C  CB  . SER B  16  ? 0.4975 0.3547 0.3862 0.0572  0.0674  0.0229  14  SER B CB  
1518 O  OG  . SER B  16  ? 0.5272 0.3673 0.4112 0.0538  0.0719  0.0259  14  SER B OG  
1519 N  N   . LYS B  17  ? 0.4813 0.3401 0.3825 0.0345  0.0700  0.0284  15  LYS B N   
1520 C  CA  . LYS B  17  ? 0.4401 0.2973 0.3461 0.0298  0.0739  0.0342  15  LYS B CA  
1521 C  C   . LYS B  17  ? 0.3858 0.2575 0.2997 0.0241  0.0705  0.0329  15  LYS B C   
1522 O  O   . LYS B  17  ? 0.3647 0.2377 0.2851 0.0198  0.0736  0.0372  15  LYS B O   
1523 C  CB  . LYS B  17  ? 0.4961 0.3391 0.4076 0.0221  0.0766  0.0348  15  LYS B CB  
1524 C  CG  . LYS B  17  ? 0.5830 0.4087 0.4882 0.0276  0.0822  0.0395  15  LYS B CG  
1525 C  CD  . LYS B  17  ? 0.6326 0.4447 0.5491 0.0189  0.0859  0.0422  15  LYS B CD  
1526 C  CE  . LYS B  17  ? 0.6550 0.4480 0.5670 0.0208  0.0863  0.0399  15  LYS B CE  
1527 N  NZ  . LYS B  17  ? 0.6200 0.3965 0.5430 0.0158  0.0930  0.0468  15  LYS B NZ  
1528 N  N   . VAL B  18  ? 0.3465 0.2288 0.2614 0.0242  0.0650  0.0275  16  VAL B N   
1529 C  CA  . VAL B  18  ? 0.2809 0.1754 0.2025 0.0194  0.0614  0.0260  16  VAL B CA  
1530 C  C   . VAL B  18  ? 0.2618 0.1671 0.1831 0.0263  0.0582  0.0254  16  VAL B C   
1531 O  O   . VAL B  18  ? 0.2412 0.1515 0.1645 0.0284  0.0548  0.0216  16  VAL B O   
1532 C  CB  . VAL B  18  ? 0.2819 0.1784 0.2057 0.0137  0.0577  0.0205  16  VAL B CB  
1533 C  CG1 . VAL B  18  ? 0.2686 0.1759 0.1984 0.0092  0.0542  0.0198  16  VAL B CG1 
1534 C  CG2 . VAL B  18  ? 0.2878 0.1724 0.2107 0.0087  0.0582  0.0184  16  VAL B CG2 
1535 N  N   . PRO B  19  ? 0.2616 0.1704 0.1815 0.0304  0.0591  0.0290  17  PRO B N   
1536 C  CA  . PRO B  19  ? 0.2513 0.1688 0.1704 0.0383  0.0541  0.0267  17  PRO B CA  
1537 C  C   . PRO B  19  ? 0.2525 0.1799 0.1812 0.0334  0.0483  0.0220  17  PRO B C   
1538 O  O   . PRO B  19  ? 0.2460 0.1749 0.1793 0.0249  0.0486  0.0219  17  PRO B O   
1539 C  CB  . PRO B  19  ? 0.2628 0.1819 0.1774 0.0429  0.0570  0.0316  17  PRO B CB  
1540 C  CG  . PRO B  19  ? 0.2767 0.1853 0.1888 0.0401  0.0659  0.0384  17  PRO B CG  
1541 C  CD  . PRO B  19  ? 0.2751 0.1793 0.1946 0.0291  0.0654  0.0354  17  PRO B CD  
1542 N  N   . LEU B  20  ? 0.2554 0.1890 0.1880 0.0395  0.0425  0.0180  18  LEU B N   
1543 C  CA  . LEU B  20  ? 0.2435 0.1859 0.1875 0.0360  0.0373  0.0145  18  LEU B CA  
1544 C  C   . LEU B  20  ? 0.2421 0.1899 0.1861 0.0424  0.0317  0.0126  18  LEU B C   
1545 O  O   . LEU B  20  ? 0.2498 0.1972 0.1887 0.0527  0.0282  0.0104  18  LEU B O   
1546 C  CB  . LEU B  20  ? 0.2336 0.1791 0.1874 0.0376  0.0348  0.0109  18  LEU B CB  
1547 C  CG  . LEU B  20  ? 0.2420 0.1957 0.2115 0.0346  0.0303  0.0083  18  LEU B CG  
1548 C  CD1 . LEU B  20  ? 0.2433 0.1964 0.2139 0.0255  0.0347  0.0115  18  LEU B CD1 
1549 C  CD2 . LEU B  20  ? 0.2419 0.2001 0.2256 0.0381  0.0277  0.0047  18  LEU B CD2 
1550 N  N   . GLN B  21  ? 0.2363 0.1885 0.1843 0.0378  0.0302  0.0129  19  GLN B N   
1551 C  CA  . GLN B  21  ? 0.2540 0.2111 0.2024 0.0443  0.0240  0.0100  19  GLN B CA  
1552 C  C   . GLN B  21  ? 0.2545 0.2144 0.2114 0.0512  0.0152  0.0031  19  GLN B C   
1553 O  O   . GLN B  21  ? 0.2267 0.1894 0.1985 0.0460  0.0130  0.0008  19  GLN B O   
1554 C  CB  . GLN B  21  ? 0.2335 0.1949 0.1886 0.0375  0.0226  0.0103  19  GLN B CB  
1555 C  CG  . GLN B  21  ? 0.2194 0.1852 0.1763 0.0442  0.0151  0.0062  19  GLN B CG  
1556 C  CD  . GLN B  21  ? 0.2164 0.1820 0.1593 0.0544  0.0168  0.0077  19  GLN B CD  
1557 O  OE1 . GLN B  21  ? 0.2249 0.1901 0.1618 0.0520  0.0246  0.0137  19  GLN B OE1 
1558 N  NE2 . GLN B  21  ? 0.2149 0.1808 0.1534 0.0665  0.0093  0.0022  19  GLN B NE2 
1559 N  N   . GLN B  22  ? 0.2712 0.2306 0.2195 0.0636  0.0104  0.0000  20  GLN B N   
1560 C  CA  . GLN B  22  ? 0.3203 0.2828 0.2777 0.0718  -0.0007 -0.0087 20  GLN B CA  
1561 C  C   . GLN B  22  ? 0.2865 0.2541 0.2604 0.0686  -0.0091 -0.0142 20  GLN B C   
1562 O  O   . GLN B  22  ? 0.2246 0.1928 0.1937 0.0679  -0.0090 -0.0128 20  GLN B O   
1563 C  CB  . GLN B  22  ? 0.4015 0.3611 0.3409 0.0885  -0.0049 -0.0114 20  GLN B CB  
1564 C  CG  . GLN B  22  ? 0.5908 0.5533 0.5385 0.0995  -0.0192 -0.0226 20  GLN B CG  
1565 C  CD  . GLN B  22  ? 0.6579 0.6157 0.5840 0.1180  -0.0228 -0.0248 20  GLN B CD  
1566 O  OE1 . GLN B  22  ? 0.6377 0.5902 0.5405 0.1255  -0.0154 -0.0182 20  GLN B OE1 
1567 N  NE2 . GLN B  22  ? 0.6362 0.5965 0.5713 0.1262  -0.0342 -0.0341 20  GLN B NE2 
1568 N  N   . ASN B  23  ? 0.2944 0.2658 0.2898 0.0666  -0.0158 -0.0198 21  ASN B N   
1569 C  CA  . ASN B  23  ? 0.3260 0.3007 0.3411 0.0646  -0.0251 -0.0258 21  ASN B CA  
1570 C  C   . ASN B  23  ? 0.2919 0.2658 0.3079 0.0547  -0.0195 -0.0199 21  ASN B C   
1571 O  O   . ASN B  23  ? 0.2837 0.2573 0.2985 0.0577  -0.0253 -0.0229 21  ASN B O   
1572 C  CB  . ASN B  23  ? 0.3838 0.3583 0.3938 0.0788  -0.0387 -0.0357 21  ASN B CB  
1573 C  CG  . ASN B  23  ? 0.5730 0.5498 0.6090 0.0775  -0.0511 -0.0446 21  ASN B CG  
1574 O  OD1 . ASN B  23  ? 0.6100 0.5898 0.6728 0.0681  -0.0508 -0.0444 21  ASN B OD1 
1575 N  ND2 . ASN B  23  ? 0.5957 0.5707 0.6248 0.0877  -0.0618 -0.0522 21  ASN B ND2 
1576 N  N   . PHE B  24  ? 0.2403 0.2135 0.2575 0.0442  -0.0088 -0.0120 22  PHE B N   
1577 C  CA  . PHE B  24  ? 0.2354 0.2073 0.2499 0.0362  -0.0034 -0.0062 22  PHE B CA  
1578 C  C   . PHE B  24  ? 0.2314 0.2041 0.2640 0.0335  -0.0095 -0.0086 22  PHE B C   
1579 O  O   . PHE B  24  ? 0.2389 0.2130 0.2933 0.0317  -0.0128 -0.0112 22  PHE B O   
1580 C  CB  . PHE B  24  ? 0.2361 0.2064 0.2488 0.0278  0.0071  0.0008  22  PHE B CB  
1581 C  CG  . PHE B  24  ? 0.2265 0.1953 0.2355 0.0210  0.0115  0.0061  22  PHE B CG  
1582 C  CD1 . PHE B  24  ? 0.2203 0.1886 0.2421 0.0158  0.0138  0.0092  22  PHE B CD1 
1583 C  CD2 . PHE B  24  ? 0.2602 0.2282 0.2540 0.0207  0.0135  0.0081  22  PHE B CD2 
1584 C  CE1 . PHE B  24  ? 0.2244 0.1903 0.2399 0.0116  0.0173  0.0140  22  PHE B CE1 
1585 C  CE2 . PHE B  24  ? 0.2261 0.1934 0.2170 0.0156  0.0158  0.0117  22  PHE B CE2 
1586 C  CZ  . PHE B  24  ? 0.2313 0.1970 0.2311 0.0118  0.0173  0.0145  22  PHE B CZ  
1587 N  N   . GLN B  25  ? 0.2219 0.1934 0.2473 0.0335  -0.0109 -0.0077 23  GLN B N   
1588 C  CA  . GLN B  25  ? 0.2230 0.1932 0.2634 0.0322  -0.0172 -0.0101 23  GLN B CA  
1589 C  C   . GLN B  25  ? 0.2162 0.1842 0.2559 0.0240  -0.0099 -0.0021 23  GLN B C   
1590 O  O   . GLN B  25  ? 0.2045 0.1724 0.2301 0.0243  -0.0084 0.0001  23  GLN B O   
1591 C  CB  . GLN B  25  ? 0.2384 0.2086 0.2701 0.0415  -0.0262 -0.0166 23  GLN B CB  
1592 C  CG  . GLN B  25  ? 0.2689 0.2401 0.3000 0.0524  -0.0356 -0.0258 23  GLN B CG  
1593 C  CD  . G