data_4ZIN
# 
_entry.id   4ZIN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ZIN         
WWPDB D_1000209044 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          4ZIO 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4ZIN 
_pdbx_database_status.recvd_initial_deposition_date   2015-04-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Reddington, S.C.' 1 ? 
'Driezis, S.'      2 ? 
'Hartley, A.M.'    3 ? 
'Watson, P.D.'     4 ? 
'Rizkallah, P.J.'  5 ? 
'Jones, D.D.'      6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Rsc Adv' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2046-2069 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            5 
_citation.language                  ? 
_citation.page_first                77734 
_citation.page_last                 77738 
_citation.title                     
'Genetically encoded phenyl azide photochemistry drives positive and negative functional modulation of a red fluorescent protein' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1039/c5ra13552d 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Reddington, S.C.' 1 ? 
primary 'Driezis, S.'      2 ? 
primary 'Hartley, A.M.'    3 ? 
primary 'Watson, P.D.'     4 ? 
primary 'Rizkallah, P.J.'  5 ? 
primary 'Jones, D.D.'      6 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4ZIN 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     43.280 
_cell.length_a_esd                 ? 
_cell.length_b                     103.430 
_cell.length_b_esd                 ? 
_cell.length_c                     150.720 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4ZIN 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'MCherry fluorescent protein' 24782.949 3   ? ? ? ? 
2 non-polymer syn 'SULFATE ION'                 96.063    6   ? ? ? ? 
3 non-polymer syn 1,2-ETHANEDIOL                62.068    1   ? ? ? ? 
4 water       nat water                         18.015    400 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;AIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQF(CH6)SKAYVKHPADIPDYL
KLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMG(4OO)EASSERMYPEDGALKG
EIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKL
SFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGXEASSERMYPEDGALKGEIKQRL
KLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTG
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ILE n 
1 3   ILE n 
1 4   LYS n 
1 5   GLU n 
1 6   PHE n 
1 7   MET n 
1 8   ARG n 
1 9   PHE n 
1 10  LYS n 
1 11  VAL n 
1 12  HIS n 
1 13  MET n 
1 14  GLU n 
1 15  GLY n 
1 16  SER n 
1 17  VAL n 
1 18  ASN n 
1 19  GLY n 
1 20  HIS n 
1 21  GLU n 
1 22  PHE n 
1 23  GLU n 
1 24  ILE n 
1 25  GLU n 
1 26  GLY n 
1 27  GLU n 
1 28  GLY n 
1 29  GLU n 
1 30  GLY n 
1 31  ARG n 
1 32  PRO n 
1 33  TYR n 
1 34  GLU n 
1 35  GLY n 
1 36  THR n 
1 37  GLN n 
1 38  THR n 
1 39  ALA n 
1 40  LYS n 
1 41  LEU n 
1 42  LYS n 
1 43  VAL n 
1 44  THR n 
1 45  LYS n 
1 46  GLY n 
1 47  GLY n 
1 48  PRO n 
1 49  LEU n 
1 50  PRO n 
1 51  PHE n 
1 52  ALA n 
1 53  TRP n 
1 54  ASP n 
1 55  ILE n 
1 56  LEU n 
1 57  SER n 
1 58  PRO n 
1 59  GLN n 
1 60  PHE n 
1 61  CH6 n 
1 62  SER n 
1 63  LYS n 
1 64  ALA n 
1 65  TYR n 
1 66  VAL n 
1 67  LYS n 
1 68  HIS n 
1 69  PRO n 
1 70  ALA n 
1 71  ASP n 
1 72  ILE n 
1 73  PRO n 
1 74  ASP n 
1 75  TYR n 
1 76  LEU n 
1 77  LYS n 
1 78  LEU n 
1 79  SER n 
1 80  PHE n 
1 81  PRO n 
1 82  GLU n 
1 83  GLY n 
1 84  PHE n 
1 85  LYS n 
1 86  TRP n 
1 87  GLU n 
1 88  ARG n 
1 89  VAL n 
1 90  MET n 
1 91  ASN n 
1 92  PHE n 
1 93  GLU n 
1 94  ASP n 
1 95  GLY n 
1 96  GLY n 
1 97  VAL n 
1 98  VAL n 
1 99  THR n 
1 100 VAL n 
1 101 THR n 
1 102 GLN n 
1 103 ASP n 
1 104 SER n 
1 105 SER n 
1 106 LEU n 
1 107 GLN n 
1 108 ASP n 
1 109 GLY n 
1 110 GLU n 
1 111 PHE n 
1 112 ILE n 
1 113 TYR n 
1 114 LYS n 
1 115 VAL n 
1 116 LYS n 
1 117 LEU n 
1 118 ARG n 
1 119 GLY n 
1 120 THR n 
1 121 ASN n 
1 122 PHE n 
1 123 PRO n 
1 124 SER n 
1 125 ASP n 
1 126 GLY n 
1 127 PRO n 
1 128 VAL n 
1 129 MET n 
1 130 GLN n 
1 131 LYS n 
1 132 LYS n 
1 133 THR n 
1 134 MET n 
1 135 GLY n 
1 136 4OO n 
1 137 GLU n 
1 138 ALA n 
1 139 SER n 
1 140 SER n 
1 141 GLU n 
1 142 ARG n 
1 143 MET n 
1 144 TYR n 
1 145 PRO n 
1 146 GLU n 
1 147 ASP n 
1 148 GLY n 
1 149 ALA n 
1 150 LEU n 
1 151 LYS n 
1 152 GLY n 
1 153 GLU n 
1 154 ILE n 
1 155 LYS n 
1 156 GLN n 
1 157 ARG n 
1 158 LEU n 
1 159 LYS n 
1 160 LEU n 
1 161 LYS n 
1 162 ASP n 
1 163 GLY n 
1 164 GLY n 
1 165 HIS n 
1 166 TYR n 
1 167 ASP n 
1 168 ALA n 
1 169 GLU n 
1 170 VAL n 
1 171 LYS n 
1 172 THR n 
1 173 THR n 
1 174 TYR n 
1 175 LYS n 
1 176 ALA n 
1 177 LYS n 
1 178 LYS n 
1 179 PRO n 
1 180 VAL n 
1 181 GLN n 
1 182 LEU n 
1 183 PRO n 
1 184 GLY n 
1 185 ALA n 
1 186 TYR n 
1 187 ASN n 
1 188 VAL n 
1 189 ASN n 
1 190 ILE n 
1 191 LYS n 
1 192 LEU n 
1 193 ASP n 
1 194 ILE n 
1 195 THR n 
1 196 SER n 
1 197 HIS n 
1 198 ASN n 
1 199 GLU n 
1 200 ASP n 
1 201 TYR n 
1 202 THR n 
1 203 ILE n 
1 204 VAL n 
1 205 GLU n 
1 206 GLN n 
1 207 TYR n 
1 208 GLU n 
1 209 ARG n 
1 210 ALA n 
1 211 GLU n 
1 212 GLY n 
1 213 ARG n 
1 214 HIS n 
1 215 SER n 
1 216 THR n 
1 217 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   217 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 mCherry 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Anaplasma marginale' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     770 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    X5DSL3_ANAMA 
_struct_ref.pdbx_db_accession          X5DSL3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKL
SFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRL
KLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTG
;
_struct_ref.pdbx_align_begin           11 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ZIN A 1 ? 217 ? X5DSL3 11 ? 229 ? 6 224 
2 1 4ZIN B 1 ? 217 ? X5DSL3 11 ? 229 ? 6 224 
3 1 4ZIN C 1 ? 217 ? X5DSL3 11 ? 229 ? 6 224 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ZIN CH6 A 61  ? UNP X5DSL3 MET 71  chromophore 66  1  
1 4ZIN CH6 A 61  ? UNP X5DSL3 TYR 72  chromophore 66  2  
1 4ZIN CH6 A 61  ? UNP X5DSL3 GLY 73  chromophore 66  3  
1 4ZIN 4OO A 136 ? UNP X5DSL3 TRP 148 conflict    143 4  
2 4ZIN CH6 B 61  ? UNP X5DSL3 MET 71  chromophore 66  5  
2 4ZIN CH6 B 61  ? UNP X5DSL3 TYR 72  chromophore 66  6  
2 4ZIN CH6 B 61  ? UNP X5DSL3 GLY 73  chromophore 66  7  
2 4ZIN 4OO B 136 ? UNP X5DSL3 TRP 148 conflict    143 8  
3 4ZIN CH6 C 61  ? UNP X5DSL3 MET 71  chromophore 66  9  
3 4ZIN CH6 C 61  ? UNP X5DSL3 TYR 72  chromophore 66  10 
3 4ZIN CH6 C 61  ? UNP X5DSL3 GLY 73  chromophore 66  11 
3 4ZIN 4OO C 136 ? UNP X5DSL3 TRP 148 conflict    143 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4OO non-polymer         . 4-triaza-1,2-dien-2-ium-1-yl-L-phenylalanine ?                           'C9 H11 N4 O2 1'  207.209 
ALA 'L-peptide linking' y ALANINE ?                           'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?                           'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                           'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                           'C4 H7 N O4'      133.103 
CH6 'L-peptide linking' n 
'{(4Z)-2-[(1S)-1-amino-3-(methylsulfanyl)propyl]-4-[(4-hydroxyphenyl)methylidene]-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 
'CHROMOPHORE (MET-TYR-GLY)' 'C16 H19 N3 O4 S' 349.405 
EDO non-polymer         . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL'           'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE ?                           'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                           'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?                           'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ?                           'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?                           'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                           'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?                           'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?                           'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?                           'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                           'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?                           'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ?                           'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION' ?                           'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE ?                           'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                           'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?                           'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?                           'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4ZIN 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.24 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.06 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Sitting drop' 
_exptl_crystal_grow.pdbx_pH_range   7.9-8.9 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-10-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9795  1.0 
2 0.97623 1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97623 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4ZIN 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.670 
_reflns.d_resolution_low                 51.710 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       79561 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.100 
_reflns.pdbx_Rmerge_I_obs                0.074 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.600 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.030 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         567722 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.670 1.710  ? 2.400  41458 ? ? 5770 ? 100.000 ? ? ? ? 0.814 ? ? ? ? ? ? ? ? 7.200 ? ? ? ? ? 0.324 0 1 1 0.772 ? 
7.470 51.710 ? 30.600 6596  ? ? 1024 ? 99.300  ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 6.400 ? ? ? ? ? 0.016 0 2 1 0.997 ? 
# 
_refine.aniso_B[1][1]                            -2.3800 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            0.0100 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            2.3700 
_refine.B_iso_max                                74.200 
_refine.B_iso_mean                               29.4300 
_refine.B_iso_min                                13.720 
_refine.correlation_coeff_Fo_to_Fc               0.9540 
_refine.correlation_coeff_Fo_to_Fc_free          0.9380 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4ZIN 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.6700 
_refine.ls_d_res_low                             51.71 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     75603 
_refine.ls_number_reflns_R_free                  3874 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9300 
_refine.ls_percent_reflns_R_free                 4.9000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2080 
_refine.ls_R_factor_R_free                       0.2476 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2059 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      0.2562 
_refine.ls_wR_factor_R_work                      0.2102 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2H5O 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.1140 
_refine.pdbx_overall_ESU_R_Free                  0.1150 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             5.9090 
_refine.overall_SU_ML                            0.0960 
_refine.overall_SU_R_Cruickshank_DPI             0.1144 
_refine.overall_SU_R_free                        0.1152 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.7972 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.6700 
_refine_hist.d_res_low                        51.71 
_refine_hist.pdbx_number_atoms_ligand         34 
_refine_hist.number_atoms_solvent             400 
_refine_hist.number_atoms_total               5669 
_refine_hist.pdbx_number_residues_total       651 
_refine_hist.pdbx_B_iso_mean_ligand           58.63 
_refine_hist.pdbx_B_iso_mean_solvent          37.11 
_refine_hist.pdbx_number_atoms_protein        5235 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.019  0.019  5394  ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  5027  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 2.120  1.985  7241  ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 0.925  3.000  11660 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 7.097  5.000  642   ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 29.869 24.699 249   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 14.841 15.000 945   ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 19.358 15.000 24    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.140  0.200  735   ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.010  0.021  5994  ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.003  0.020  1203  ? r_gen_planes_other     ? ? 
'X-RAY DIFFRACTION' ? 1.839  1.930  2586  ? r_mcbond_it            ? ? 
'X-RAY DIFFRACTION' ? 1.829  1.929  2585  ? r_mcbond_other         ? ? 
'X-RAY DIFFRACTION' ? 2.471  2.887  3222  ? r_mcangle_it           ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       1.6700 
_refine_ls_shell.d_res_low                        1.7130 
_refine_ls_shell.number_reflns_all                5765 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             257 
_refine_ls_shell.number_reflns_R_work             5508 
_refine_ls_shell.percent_reflns_obs               100.0000 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3150 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2850 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     4ZIN 
_struct.title                        
'Genetically encoded Phenyl Azide Photochemistry Drive Positive and Negative Functional Modulation of a Red Fluorescent Protein' 
_struct.pdbx_descriptor              mCherry 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4ZIN 
_struct_keywords.text            
;mCherry, Photoactivation, Photodeactivation, Coloration, Fluorescence, Microscopy, Phenyl Azide, Non-canonical amino acids, Optogenetics, Synchrotron, fluorescent protein
;
_struct_keywords.pdbx_keywords   'FLUORESCENT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ALA A 52 ? PHE A 60 ? ALA A 57 PHE A 65 5 ? 9 
HELX_P HELX_P2 AA2 ASP A 74 ? SER A 79 ? ASP A 81 SER A 86 1 ? 6 
HELX_P HELX_P3 AA3 ALA B 52 ? PHE B 60 ? ALA B 57 PHE B 65 5 ? 9 
HELX_P HELX_P4 AA4 SER B 62 ? VAL B 66 ? SER B 69 VAL B 73 5 ? 5 
HELX_P HELX_P5 AA5 ASP B 74 ? SER B 79 ? ASP B 81 SER B 86 1 ? 6 
HELX_P HELX_P6 AA6 ALA C 52 ? PHE C 60 ? ALA C 57 PHE C 65 5 ? 9 
HELX_P HELX_P7 AA7 SER C 62 ? VAL C 66 ? SER C 69 VAL C 73 5 ? 5 
HELX_P HELX_P8 AA8 ASP C 74 ? SER C 79 ? ASP C 81 SER C 86 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale both ? A PHE 60  C  ? ? ? 1_555 A CH6 61  N1 ? ? A PHE 65  A CH6 66  1_555 ? ? ? ? ? ? ? 1.295 ? 
covale2  covale both ? A CH6 61  C3 ? ? ? 1_555 A SER 62  N  ? ? A CH6 66  A SER 69  1_555 ? ? ? ? ? ? ? 1.234 ? 
covale3  covale one  ? A GLY 135 C  ? ? ? 1_555 A 4OO 136 N  ? ? A GLY 142 A 4OO 143 1_555 ? ? ? ? ? ? ? 1.313 ? 
covale4  covale both ? A 4OO 136 C  ? ? ? 1_555 A GLU 137 N  ? ? A 4OO 143 A GLU 144 1_555 ? ? ? ? ? ? ? 1.307 ? 
covale5  covale both ? B PHE 60  C  ? ? ? 1_555 B CH6 61  N1 ? ? B PHE 65  B CH6 66  1_555 ? ? ? ? ? ? ? 1.281 ? 
covale6  covale both ? B CH6 61  C3 ? ? ? 1_555 B SER 62  N  ? ? B CH6 66  B SER 69  1_555 ? ? ? ? ? ? ? 1.250 ? 
covale7  covale one  ? B GLY 135 C  ? ? ? 1_555 B 4OO 136 N  ? ? B GLY 142 B 4OO 143 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale8  covale both ? B 4OO 136 C  ? ? ? 1_555 B GLU 137 N  ? ? B 4OO 143 B GLU 144 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale9  covale both ? C PHE 60  C  ? ? ? 1_555 C CH6 61  N1 ? ? C PHE 65  C CH6 66  1_555 ? ? ? ? ? ? ? 1.280 ? 
covale10 covale both ? C CH6 61  C3 ? ? ? 1_555 C SER 62  N  ? ? C CH6 66  C SER 69  1_555 ? ? ? ? ? ? ? 1.264 ? 
covale11 covale one  ? C GLY 135 C  ? ? ? 1_555 C 4OO 136 N  ? ? C GLY 142 C 4OO 143 1_555 ? ? ? ? ? ? ? 1.317 ? 
covale12 covale both ? C 4OO 136 C  ? ? ? 1_555 C GLU 137 N  ? ? C 4OO 143 C GLU 144 1_555 ? ? ? ? ? ? ? 1.312 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 47 A . ? GLY 52 A PRO 48 A ? PRO 53 A 1 -7.82 
2 PHE 80 A . ? PHE 87 A PRO 81 A ? PRO 88 A 1 17.81 
3 GLY 47 B . ? GLY 52 B PRO 48 B ? PRO 53 B 1 1.08  
4 PHE 80 B . ? PHE 87 B PRO 81 B ? PRO 88 B 1 16.02 
5 GLY 47 C . ? GLY 52 C PRO 48 C ? PRO 53 C 1 -5.39 
6 PHE 80 C . ? PHE 87 C PRO 81 C ? PRO 88 C 1 19.18 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 13 ? 
AA2 ? 13 ? 
AA3 ? 13 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? anti-parallel 
AA1 4  5  ? anti-parallel 
AA1 5  6  ? anti-parallel 
AA1 6  7  ? parallel      
AA1 7  8  ? anti-parallel 
AA1 8  9  ? anti-parallel 
AA1 9  10 ? anti-parallel 
AA1 10 11 ? anti-parallel 
AA1 11 12 ? anti-parallel 
AA1 12 13 ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? anti-parallel 
AA2 5  6  ? anti-parallel 
AA2 6  7  ? parallel      
AA2 7  8  ? anti-parallel 
AA2 8  9  ? anti-parallel 
AA2 9  10 ? anti-parallel 
AA2 10 11 ? anti-parallel 
AA2 11 12 ? anti-parallel 
AA2 12 13 ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? anti-parallel 
AA3 3  4  ? anti-parallel 
AA3 4  5  ? anti-parallel 
AA3 5  6  ? anti-parallel 
AA3 6  7  ? parallel      
AA3 7  8  ? anti-parallel 
AA3 8  9  ? anti-parallel 
AA3 9  10 ? anti-parallel 
AA3 10 11 ? anti-parallel 
AA3 11 12 ? anti-parallel 
AA3 12 13 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  THR A 133 ? 4OO A 136 ? THR A 140 4OO A 143 
AA1 2  ALA A 149 ? LEU A 160 ? ALA A 156 LEU A 167 
AA1 3  HIS A 165 ? ALA A 176 ? HIS A 172 ALA A 183 
AA1 4  PHE A 84  ? PHE A 92  ? PHE A 91  PHE A 99  
AA1 5  VAL A 97  ? GLN A 107 ? VAL A 104 GLN A 114 
AA1 6  GLU A 110 ? THR A 120 ? GLU A 117 THR A 127 
AA1 7  MET A 7   ? VAL A 17  ? MET A 12  VAL A 22  
AA1 8  HIS A 20  ? ARG A 31  ? HIS A 25  ARG A 36  
AA1 9  THR A 36  ? LYS A 45  ? THR A 41  LYS A 50  
AA1 10 ILE A 203 ? HIS A 214 ? ILE A 210 HIS A 221 
AA1 11 TYR A 186 ? HIS A 197 ? TYR A 193 HIS A 204 
AA1 12 SER A 139 ? GLU A 146 ? SER A 146 GLU A 153 
AA1 13 ALA A 149 ? LEU A 160 ? ALA A 156 LEU A 167 
AA2 1  THR B 133 ? 4OO B 136 ? THR B 140 4OO B 143 
AA2 2  ALA B 149 ? LEU B 160 ? ALA B 156 LEU B 167 
AA2 3  HIS B 165 ? ALA B 176 ? HIS B 172 ALA B 183 
AA2 4  PHE B 84  ? PHE B 92  ? PHE B 91  PHE B 99  
AA2 5  VAL B 97  ? GLN B 107 ? VAL B 104 GLN B 114 
AA2 6  GLU B 110 ? THR B 120 ? GLU B 117 THR B 127 
AA2 7  MET B 7   ? VAL B 17  ? MET B 12  VAL B 22  
AA2 8  HIS B 20  ? ARG B 31  ? HIS B 25  ARG B 36  
AA2 9  THR B 36  ? LYS B 45  ? THR B 41  LYS B 50  
AA2 10 ILE B 203 ? HIS B 214 ? ILE B 210 HIS B 221 
AA2 11 TYR B 186 ? HIS B 197 ? TYR B 193 HIS B 204 
AA2 12 SER B 139 ? GLU B 146 ? SER B 146 GLU B 153 
AA2 13 ALA B 149 ? LEU B 160 ? ALA B 156 LEU B 167 
AA3 1  THR C 133 ? 4OO C 136 ? THR C 140 4OO C 143 
AA3 2  ALA C 149 ? LEU C 160 ? ALA C 156 LEU C 167 
AA3 3  HIS C 165 ? ALA C 176 ? HIS C 172 ALA C 183 
AA3 4  PHE C 84  ? PHE C 92  ? PHE C 91  PHE C 99  
AA3 5  VAL C 97  ? GLN C 107 ? VAL C 104 GLN C 114 
AA3 6  GLU C 110 ? THR C 120 ? GLU C 117 THR C 127 
AA3 7  MET C 7   ? VAL C 17  ? MET C 12  VAL C 22  
AA3 8  HIS C 20  ? ARG C 31  ? HIS C 25  ARG C 36  
AA3 9  THR C 36  ? LYS C 45  ? THR C 41  LYS C 50  
AA3 10 ILE C 203 ? HIS C 214 ? ILE C 210 HIS C 221 
AA3 11 TYR C 186 ? HIS C 197 ? TYR C 193 HIS C 204 
AA3 12 SER C 139 ? GLU C 146 ? SER C 146 GLU C 153 
AA3 13 ALA C 149 ? LEU C 160 ? ALA C 156 LEU C 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N MET A 134 ? N MET A 141 O LYS A 159 ? O LYS A 166 
AA1 2  3  N LEU A 150 ? N LEU A 157 O TYR A 174 ? O TYR A 181 
AA1 3  4  O GLU A 169 ? O GLU A 176 N ASN A 91  ? N ASN A 98  
AA1 4  5  N ARG A 88  ? N ARG A 95  O VAL A 100 ? O VAL A 107 
AA1 5  6  N VAL A 97  ? N VAL A 104 O THR A 120 ? O THR A 127 
AA1 6  7  O GLY A 119 ? O GLY A 126 N SER A 16  ? N SER A 21  
AA1 7  8  N PHE A 9   ? N PHE A 14  O GLY A 28  ? O GLY A 33  
AA1 8  9  N GLU A 25  ? N GLU A 30  O LYS A 42  ? O LYS A 47  
AA1 9  10 N LEU A 41  ? N LEU A 46  O VAL A 204 ? O VAL A 211 
AA1 10 11 O ARG A 213 ? O ARG A 220 N ASN A 187 ? N ASN A 194 
AA1 11 12 O TYR A 186 ? O TYR A 193 N MET A 143 ? N MET A 150 
AA1 12 13 N TYR A 144 ? N TYR A 151 O LYS A 151 ? O LYS A 158 
AA2 1  2  N GLY B 135 ? N GLY B 142 O LYS B 159 ? O LYS B 166 
AA2 2  3  N LEU B 150 ? N LEU B 157 O TYR B 174 ? O TYR B 181 
AA2 3  4  O LYS B 175 ? O LYS B 182 N LYS B 85  ? N LYS B 92  
AA2 4  5  N PHE B 84  ? N PHE B 91  O SER B 104 ? O SER B 111 
AA2 5  6  N THR B 99  ? N THR B 106 O ARG B 118 ? O ARG B 125 
AA2 6  7  O VAL B 115 ? O VAL B 122 N HIS B 12  ? N HIS B 17  
AA2 7  8  N MET B 13  ? N MET B 18  O ILE B 24  ? O ILE B 29  
AA2 8  9  N GLU B 27  ? N GLU B 32  O LYS B 40  ? O LYS B 45  
AA2 9  10 N LEU B 41  ? N LEU B 46  O VAL B 204 ? O VAL B 211 
AA2 10 11 O ARG B 213 ? O ARG B 220 N ASN B 187 ? N ASN B 194 
AA2 11 12 O TYR B 186 ? O TYR B 193 N MET B 143 ? N MET B 150 
AA2 12 13 N TYR B 144 ? N TYR B 151 O LYS B 151 ? O LYS B 158 
AA3 1  2  N GLY C 135 ? N GLY C 142 O LYS C 159 ? O LYS C 166 
AA3 2  3  N ILE C 154 ? N ILE C 161 O VAL C 170 ? O VAL C 177 
AA3 3  4  O THR C 173 ? O THR C 180 N GLU C 87  ? N GLU C 94  
AA3 4  5  N MET C 90  ? N MET C 97  O VAL C 98  ? O VAL C 105 
AA3 5  6  N SER C 105 ? N SER C 112 O ILE C 112 ? O ILE C 119 
AA3 6  7  O TYR C 113 ? O TYR C 120 N LYS C 10  ? N LYS C 15  
AA3 7  8  N VAL C 11  ? N VAL C 16  O GLY C 26  ? O GLY C 31  
AA3 8  9  N GLU C 29  ? N GLU C 34  O THR C 38  ? O THR C 43  
AA3 9  10 N LEU C 41  ? N LEU C 46  O VAL C 204 ? O VAL C 211 
AA3 10 11 O GLU C 205 ? O GLU C 212 N SER C 196 ? N SER C 203 
AA3 11 12 O TYR C 186 ? O TYR C 193 N MET C 143 ? N MET C 150 
AA3 12 13 N TYR C 144 ? N TYR C 151 O LYS C 151 ? O LYS C 158 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 301 ? 5  'binding site for residue SO4 A 301'                  
AC2 Software A SO4 302 ? 9  'binding site for residue SO4 A 302'                  
AC3 Software B SO4 301 ? 5  'binding site for residue SO4 B 301'                  
AC4 Software B SO4 302 ? 5  'binding site for residue SO4 B 302'                  
AC5 Software C SO4 301 ? 6  'binding site for residue SO4 C 301'                  
AC6 Software C SO4 302 ? 3  'binding site for residue SO4 C 302'                  
AC7 Software C EDO 303 ? 7  'binding site for residue EDO C 303'                  
AC8 Software B PHE 65  ? 20 'binding site for Di-peptide PHE B 65 and CH6 B 66'   
AC9 Software B CH6 66  ? 21 'binding site for Di-peptide CH6 B 66 and SER B 69'   
AD1 Software B GLY 142 ? 14 'binding site for Di-peptide GLY B 142 and 4OO B 143' 
AD2 Software B 4OO 143 ? 17 'binding site for Di-peptide 4OO B 143 and GLU B 144' 
AD3 Software C PHE 65  ? 19 'binding site for Di-peptide PHE C 65 and CH6 C 66'   
AD4 Software C CH6 66  ? 21 'binding site for Di-peptide CH6 C 66 and SER C 69'   
AD5 Software C GLY 142 ? 11 'binding site for Di-peptide GLY C 142 and 4OO C 143' 
AD6 Software C 4OO 143 ? 15 'binding site for Di-peptide 4OO C 143 and GLU C 144' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  THR A 99  ? THR A 106 . ? 1_555 ? 
2   AC1 5  THR A 101 ? THR A 108 . ? 1_555 ? 
3   AC1 5  LYS A 116 ? LYS A 123 . ? 1_555 ? 
4   AC1 5  LEU A 117 ? LEU A 124 . ? 1_555 ? 
5   AC1 5  ARG A 118 ? ARG A 125 . ? 1_555 ? 
6   AC2 9  ASP A 71  ? ASP A 78  . ? 1_555 ? 
7   AC2 9  ILE A 72  ? ILE A 79  . ? 1_555 ? 
8   AC2 9  PRO A 73  ? PRO A 80  . ? 1_555 ? 
9   AC2 9  PRO A 183 ? PRO A 190 . ? 1_555 ? 
10  AC2 9  GLY A 184 ? GLY A 191 . ? 1_555 ? 
11  AC2 9  ALA A 185 ? ALA A 192 . ? 1_555 ? 
12  AC2 9  TYR A 186 ? TYR A 193 . ? 1_555 ? 
13  AC2 9  HOH K .   ? HOH A 430 . ? 1_555 ? 
14  AC2 9  HOH K .   ? HOH A 540 . ? 1_555 ? 
15  AC3 5  THR B 99  ? THR B 106 . ? 1_555 ? 
16  AC3 5  THR B 101 ? THR B 108 . ? 1_555 ? 
17  AC3 5  LYS B 116 ? LYS B 123 . ? 1_555 ? 
18  AC3 5  LEU B 117 ? LEU B 124 . ? 1_555 ? 
19  AC3 5  ARG B 118 ? ARG B 125 . ? 1_555 ? 
20  AC4 5  ASN B 189 ? ASN B 196 . ? 1_555 ? 
21  AC4 5  LYS B 191 ? LYS B 198 . ? 1_555 ? 
22  AC4 5  ARG B 209 ? ARG B 216 . ? 1_555 ? 
23  AC4 5  ALA B 210 ? ALA B 217 . ? 1_555 ? 
24  AC4 5  GLU B 211 ? GLU B 218 . ? 1_555 ? 
25  AC5 6  ILE C 72  ? ILE C 79  . ? 1_555 ? 
26  AC5 6  PRO C 183 ? PRO C 190 . ? 1_555 ? 
27  AC5 6  GLY C 184 ? GLY C 191 . ? 1_555 ? 
28  AC5 6  ALA C 185 ? ALA C 192 . ? 1_555 ? 
29  AC5 6  HOH M .   ? HOH C 438 . ? 1_555 ? 
30  AC5 6  HOH M .   ? HOH C 459 . ? 1_555 ? 
31  AC6 3  THR C 99  ? THR C 106 . ? 1_555 ? 
32  AC6 3  THR C 101 ? THR C 108 . ? 1_555 ? 
33  AC6 3  LYS C 116 ? LYS C 123 . ? 1_555 ? 
34  AC7 7  GLU B 146 ? GLU B 153 . ? 3_544 ? 
35  AC7 7  ASP B 147 ? ASP B 154 . ? 3_544 ? 
36  AC7 7  ASN C 18  ? ASN C 23  . ? 1_555 ? 
37  AC7 7  GLY C 19  ? GLY C 24  . ? 1_555 ? 
38  AC7 7  THR C 120 ? THR C 127 . ? 1_555 ? 
39  AC7 7  ASN C 121 ? ASN C 128 . ? 1_555 ? 
40  AC7 7  HOH M .   ? HOH C 409 . ? 1_555 ? 
41  AC8 20 MET B 13  ? MET B 18  . ? 1_555 ? 
42  AC8 20 LEU B 56  ? LEU B 61  . ? 1_555 ? 
43  AC8 20 SER B 57  ? SER B 62  . ? 1_555 ? 
44  AC8 20 PRO B 58  ? PRO B 63  . ? 1_555 ? 
45  AC8 20 GLN B 59  ? GLN B 64  . ? 1_555 ? 
46  AC8 20 SER B 62  ? SER B 69  . ? 1_555 ? 
47  AC8 20 LYS B 63  ? LYS B 70  . ? 1_555 ? 
48  AC8 20 ARG B 88  ? ARG B 95  . ? 1_555 ? 
49  AC8 20 GLN B 102 ? GLN B 109 . ? 1_555 ? 
50  AC8 20 4OO B 136 ? 4OO B 143 . ? 1_555 ? 
51  AC8 20 GLU B 137 ? GLU B 144 . ? 1_555 ? 
52  AC8 20 ILE B 154 ? ILE B 161 . ? 1_555 ? 
53  AC8 20 GLN B 156 ? GLN B 163 . ? 1_555 ? 
54  AC8 20 ILE B 190 ? ILE B 197 . ? 1_555 ? 
55  AC8 20 LEU B 192 ? LEU B 199 . ? 1_555 ? 
56  AC8 20 GLN B 206 ? GLN B 213 . ? 1_555 ? 
57  AC8 20 GLU B 208 ? GLU B 215 . ? 1_555 ? 
58  AC8 20 HOH L .   ? HOH B 405 . ? 1_555 ? 
59  AC8 20 HOH L .   ? HOH B 425 . ? 1_555 ? 
60  AC8 20 HOH L .   ? HOH B 461 . ? 1_555 ? 
61  AC9 21 GLN B 37  ? GLN B 42  . ? 1_555 ? 
62  AC9 21 SER B 57  ? SER B 62  . ? 1_555 ? 
63  AC9 21 PRO B 58  ? PRO B 63  . ? 1_555 ? 
64  AC9 21 GLN B 59  ? GLN B 64  . ? 1_555 ? 
65  AC9 21 PHE B 60  ? PHE B 65  . ? 1_555 ? 
66  AC9 21 LYS B 63  ? LYS B 70  . ? 1_555 ? 
67  AC9 21 ALA B 64  ? ALA B 71  . ? 1_555 ? 
68  AC9 21 TYR B 65  ? TYR B 72  . ? 1_555 ? 
69  AC9 21 ARG B 88  ? ARG B 95  . ? 1_555 ? 
70  AC9 21 GLN B 102 ? GLN B 109 . ? 1_555 ? 
71  AC9 21 4OO B 136 ? 4OO B 143 . ? 1_555 ? 
72  AC9 21 GLU B 137 ? GLU B 144 . ? 1_555 ? 
73  AC9 21 ILE B 154 ? ILE B 161 . ? 1_555 ? 
74  AC9 21 GLN B 156 ? GLN B 163 . ? 1_555 ? 
75  AC9 21 ILE B 190 ? ILE B 197 . ? 1_555 ? 
76  AC9 21 LEU B 192 ? LEU B 199 . ? 1_555 ? 
77  AC9 21 GLN B 206 ? GLN B 213 . ? 1_555 ? 
78  AC9 21 GLU B 208 ? GLU B 215 . ? 1_555 ? 
79  AC9 21 HOH L .   ? HOH B 405 . ? 1_555 ? 
80  AC9 21 HOH L .   ? HOH B 425 . ? 1_555 ? 
81  AC9 21 HOH L .   ? HOH B 461 . ? 1_555 ? 
82  AD1 14 ASP B 54  ? ASP B 59  . ? 1_555 ? 
83  AD1 14 SER B 57  ? SER B 62  . ? 1_555 ? 
84  AD1 14 PRO B 58  ? PRO B 63  . ? 1_555 ? 
85  AD1 14 CH6 B 61  ? CH6 B 66  . ? 1_555 ? 
86  AD1 14 MET B 90  ? MET B 97  . ? 1_555 ? 
87  AD1 14 MET B 134 ? MET B 141 . ? 1_555 ? 
88  AD1 14 GLU B 137 ? GLU B 144 . ? 1_555 ? 
89  AD1 14 GLN B 156 ? GLN B 163 . ? 1_555 ? 
90  AD1 14 ARG B 157 ? ARG B 164 . ? 1_555 ? 
91  AD1 14 LEU B 158 ? LEU B 165 . ? 1_555 ? 
92  AD1 14 LYS B 159 ? LYS B 166 . ? 1_555 ? 
93  AD1 14 LEU B 192 ? LEU B 199 . ? 1_555 ? 
94  AD1 14 HOH L .   ? HOH B 430 . ? 1_555 ? 
95  AD1 14 HOH L .   ? HOH B 443 . ? 1_555 ? 
96  AD2 17 ASP B 54  ? ASP B 59  . ? 1_555 ? 
97  AD2 17 SER B 57  ? SER B 62  . ? 1_555 ? 
98  AD2 17 PRO B 58  ? PRO B 63  . ? 1_555 ? 
99  AD2 17 CH6 B 61  ? CH6 B 66  . ? 1_555 ? 
100 AD2 17 MET B 90  ? MET B 97  . ? 1_555 ? 
101 AD2 17 GLY B 135 ? GLY B 142 . ? 1_555 ? 
102 AD2 17 ALA B 138 ? ALA B 145 . ? 1_555 ? 
103 AD2 17 SER B 139 ? SER B 146 . ? 1_555 ? 
104 AD2 17 GLN B 156 ? GLN B 163 . ? 1_555 ? 
105 AD2 17 ARG B 157 ? ARG B 164 . ? 1_555 ? 
106 AD2 17 LEU B 158 ? LEU B 165 . ? 1_555 ? 
107 AD2 17 LYS B 159 ? LYS B 166 . ? 1_555 ? 
108 AD2 17 HIS B 165 ? HIS B 172 . ? 1_555 ? 
109 AD2 17 LEU B 192 ? LEU B 199 . ? 1_555 ? 
110 AD2 17 HOH L .   ? HOH B 421 . ? 1_555 ? 
111 AD2 17 HOH L .   ? HOH B 430 . ? 1_555 ? 
112 AD2 17 HOH L .   ? HOH B 443 . ? 1_555 ? 
113 AD3 19 MET C 13  ? MET C 18  . ? 1_555 ? 
114 AD3 19 ALA C 39  ? ALA C 44  . ? 1_555 ? 
115 AD3 19 LEU C 56  ? LEU C 61  . ? 1_555 ? 
116 AD3 19 SER C 57  ? SER C 62  . ? 1_555 ? 
117 AD3 19 PRO C 58  ? PRO C 63  . ? 1_555 ? 
118 AD3 19 GLN C 59  ? GLN C 64  . ? 1_555 ? 
119 AD3 19 SER C 62  ? SER C 69  . ? 1_555 ? 
120 AD3 19 LYS C 63  ? LYS C 70  . ? 1_555 ? 
121 AD3 19 TRP C 86  ? TRP C 93  . ? 1_555 ? 
122 AD3 19 ARG C 88  ? ARG C 95  . ? 1_555 ? 
123 AD3 19 SER C 139 ? SER C 146 . ? 1_555 ? 
124 AD3 19 GLN C 156 ? GLN C 163 . ? 1_555 ? 
125 AD3 19 ILE C 190 ? ILE C 197 . ? 1_555 ? 
126 AD3 19 LEU C 192 ? LEU C 199 . ? 1_555 ? 
127 AD3 19 GLN C 206 ? GLN C 213 . ? 1_555 ? 
128 AD3 19 GLU C 208 ? GLU C 215 . ? 1_555 ? 
129 AD3 19 HOH M .   ? HOH C 401 . ? 1_555 ? 
130 AD3 19 HOH M .   ? HOH C 421 . ? 1_555 ? 
131 AD3 19 HOH M .   ? HOH C 433 . ? 1_555 ? 
132 AD4 21 GLN C 37  ? GLN C 42  . ? 1_555 ? 
133 AD4 21 ALA C 39  ? ALA C 44  . ? 1_555 ? 
134 AD4 21 SER C 57  ? SER C 62  . ? 1_555 ? 
135 AD4 21 PRO C 58  ? PRO C 63  . ? 1_555 ? 
136 AD4 21 GLN C 59  ? GLN C 64  . ? 1_555 ? 
137 AD4 21 PHE C 60  ? PHE C 65  . ? 1_555 ? 
138 AD4 21 LYS C 63  ? LYS C 70  . ? 1_555 ? 
139 AD4 21 ALA C 64  ? ALA C 71  . ? 1_555 ? 
140 AD4 21 TYR C 65  ? TYR C 72  . ? 1_555 ? 
141 AD4 21 TRP C 86  ? TRP C 93  . ? 1_555 ? 
142 AD4 21 ARG C 88  ? ARG C 95  . ? 1_555 ? 
143 AD4 21 TYR C 113 ? TYR C 120 . ? 1_555 ? 
144 AD4 21 SER C 139 ? SER C 146 . ? 1_555 ? 
145 AD4 21 GLN C 156 ? GLN C 163 . ? 1_555 ? 
146 AD4 21 ILE C 190 ? ILE C 197 . ? 1_555 ? 
147 AD4 21 LEU C 192 ? LEU C 199 . ? 1_555 ? 
148 AD4 21 GLN C 206 ? GLN C 213 . ? 1_555 ? 
149 AD4 21 GLU C 208 ? GLU C 215 . ? 1_555 ? 
150 AD4 21 HOH M .   ? HOH C 401 . ? 1_555 ? 
151 AD4 21 HOH M .   ? HOH C 421 . ? 1_555 ? 
152 AD4 21 HOH M .   ? HOH C 433 . ? 1_555 ? 
153 AD5 11 ASP C 54  ? ASP C 59  . ? 1_555 ? 
154 AD5 11 SER C 57  ? SER C 62  . ? 1_555 ? 
155 AD5 11 PRO C 58  ? PRO C 63  . ? 1_555 ? 
156 AD5 11 MET C 90  ? MET C 97  . ? 1_555 ? 
157 AD5 11 PHE C 92  ? PHE C 99  . ? 1_555 ? 
158 AD5 11 MET C 134 ? MET C 141 . ? 1_555 ? 
159 AD5 11 GLU C 137 ? GLU C 144 . ? 1_555 ? 
160 AD5 11 ARG C 157 ? ARG C 164 . ? 1_555 ? 
161 AD5 11 LEU C 158 ? LEU C 165 . ? 1_555 ? 
162 AD5 11 LYS C 159 ? LYS C 166 . ? 1_555 ? 
163 AD5 11 HOH M .   ? HOH C 437 . ? 1_555 ? 
164 AD6 15 ASP C 54  ? ASP C 59  . ? 1_555 ? 
165 AD6 15 SER C 57  ? SER C 62  . ? 1_555 ? 
166 AD6 15 PRO C 58  ? PRO C 63  . ? 1_555 ? 
167 AD6 15 MET C 90  ? MET C 97  . ? 1_555 ? 
168 AD6 15 PHE C 92  ? PHE C 99  . ? 1_555 ? 
169 AD6 15 GLY C 135 ? GLY C 142 . ? 1_555 ? 
170 AD6 15 ALA C 138 ? ALA C 145 . ? 1_555 ? 
171 AD6 15 SER C 139 ? SER C 146 . ? 1_555 ? 
172 AD6 15 ARG C 157 ? ARG C 164 . ? 1_555 ? 
173 AD6 15 LEU C 158 ? LEU C 165 . ? 1_555 ? 
174 AD6 15 LYS C 159 ? LYS C 166 . ? 1_555 ? 
175 AD6 15 HOH M .   ? HOH C 401 . ? 1_555 ? 
176 AD6 15 HOH M .   ? HOH C 423 . ? 1_555 ? 
177 AD6 15 HOH M .   ? HOH C 437 . ? 1_555 ? 
178 AD6 15 HOH M .   ? HOH C 483 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4ZIN 
_atom_sites.fract_transf_matrix[1][1]   0.023105 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009668 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006635 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? -3.906  4.414   -2.848  1.00 58.14 ? 6   ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? -3.377  5.165   -4.012  1.00 55.71 ? 6   ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? -2.100  4.553   -4.565  1.00 51.26 ? 6   ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? -1.858  4.662   -5.746  1.00 58.35 ? 6   ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? -3.132  6.626   -3.634  1.00 55.45 ? 6   ALA A CB  1 
ATOM   6    N N   . ILE A 1 2   ? -1.286  3.914   -3.729  1.00 46.89 ? 7   ILE A N   1 
ATOM   7    C CA  . ILE A 1 2   ? 0.080   3.585   -4.146  1.00 44.93 ? 7   ILE A CA  1 
ATOM   8    C C   . ILE A 1 2   ? 0.168   2.491   -5.221  1.00 38.39 ? 7   ILE A C   1 
ATOM   9    O O   . ILE A 1 2   ? 1.042   2.552   -6.064  1.00 40.33 ? 7   ILE A O   1 
ATOM   10   C CB  . ILE A 1 2   ? 1.058   3.335   -2.971  1.00 48.19 ? 7   ILE A CB  1 
ATOM   11   C CG1 . ILE A 1 2   ? 1.111   1.891   -2.536  1.00 43.86 ? 7   ILE A CG1 1 
ATOM   12   C CG2 . ILE A 1 2   ? 0.764   4.246   -1.772  1.00 48.29 ? 7   ILE A CG2 1 
ATOM   13   C CD1 . ILE A 1 2   ? 2.536   1.527   -2.226  1.00 46.60 ? 7   ILE A CD1 1 
ATOM   14   N N   . ILE A 1 3   ? -0.751  1.533   -5.246  1.00 34.73 ? 8   ILE A N   1 
ATOM   15   C CA  . ILE A 1 3   ? -0.828  0.632   -6.387  1.00 35.75 ? 8   ILE A CA  1 
ATOM   16   C C   . ILE A 1 3   ? -1.939  1.094   -7.296  1.00 34.95 ? 8   ILE A C   1 
ATOM   17   O O   . ILE A 1 3   ? -3.114  1.071   -6.913  1.00 34.56 ? 8   ILE A O   1 
ATOM   18   C CB  . ILE A 1 3   ? -1.052  -0.838  -5.938  1.00 33.09 ? 8   ILE A CB  1 
ATOM   19   C CG1 . ILE A 1 3   ? 0.143   -1.299  -5.128  1.00 35.77 ? 8   ILE A CG1 1 
ATOM   20   C CG2 . ILE A 1 3   ? -1.311  -1.752  -7.124  1.00 32.40 ? 8   ILE A CG2 1 
ATOM   21   C CD1 . ILE A 1 3   ? 1.488   -1.045  -5.764  1.00 40.58 ? 8   ILE A CD1 1 
ATOM   22   N N   . LYS A 1 4   ? -1.565  1.533   -8.499  1.00 35.79 ? 9   LYS A N   1 
ATOM   23   C CA  . LYS A 1 4   ? -2.502  2.176   -9.385  1.00 33.57 ? 9   LYS A CA  1 
ATOM   24   C C   . LYS A 1 4   ? -3.173  1.120   -10.223 1.00 31.55 ? 9   LYS A C   1 
ATOM   25   O O   . LYS A 1 4   ? -2.804  -0.079  -10.200 1.00 30.62 ? 9   LYS A O   1 
ATOM   26   C CB  . LYS A 1 4   ? -1.784  3.227   -10.249 1.00 36.83 ? 9   LYS A CB  1 
ATOM   27   C CG  . LYS A 1 4   ? -0.987  4.256   -9.438  1.00 36.82 ? 9   LYS A CG  1 
ATOM   28   C CD  . LYS A 1 4   ? -1.878  5.364   -8.889  1.00 41.67 ? 9   LYS A CD  1 
ATOM   29   C CE  . LYS A 1 4   ? -1.155  6.343   -7.956  1.00 40.28 ? 9   LYS A CE  1 
ATOM   30   N NZ  . LYS A 1 4   ? 0.135   6.829   -8.483  1.00 46.30 ? 9   LYS A NZ  1 
ATOM   31   N N   . GLU A 1 5   ? -4.197  1.541   -10.946 1.00 31.36 ? 10  GLU A N   1 
ATOM   32   C CA  . GLU A 1 5   ? -5.012  0.635   -11.751 1.00 31.04 ? 10  GLU A CA  1 
ATOM   33   C C   . GLU A 1 5   ? -4.182  0.049   -12.909 1.00 29.93 ? 10  GLU A C   1 
ATOM   34   O O   . GLU A 1 5   ? -4.557  -0.984  -13.505 1.00 30.16 ? 10  GLU A O   1 
ATOM   35   C CB  . GLU A 1 5   ? -6.256  1.382   -12.264 1.00 37.87 ? 10  GLU A CB  1 
ATOM   36   C CG  . GLU A 1 5   ? -6.935  2.214   -11.145 1.00 43.89 ? 10  GLU A CG  1 
ATOM   37   C CD  . GLU A 1 5   ? -8.450  2.322   -11.247 1.00 47.72 ? 10  GLU A CD  1 
ATOM   38   O OE1 . GLU A 1 5   ? -9.101  1.307   -11.595 1.00 53.15 ? 10  GLU A OE1 1 
ATOM   39   O OE2 . GLU A 1 5   ? -8.993  3.411   -10.939 1.00 54.77 ? 10  GLU A OE2 1 
ATOM   40   N N   . PHE A 1 6   ? -3.091  0.741   -13.225 1.00 29.98 ? 11  PHE A N   1 
ATOM   41   C CA  . PHE A 1 6   ? -2.148  0.315   -14.273 1.00 29.21 ? 11  PHE A CA  1 
ATOM   42   C C   . PHE A 1 6   ? -0.805  0.505   -13.676 1.00 26.90 ? 11  PHE A C   1 
ATOM   43   O O   . PHE A 1 6   ? -0.542  1.563   -13.133 1.00 30.85 ? 11  PHE A O   1 
ATOM   44   C CB  . PHE A 1 6   ? -2.266  1.210   -15.500 1.00 31.11 ? 11  PHE A CB  1 
ATOM   45   C CG  . PHE A 1 6   ? -1.216  0.958   -16.500 1.00 33.35 ? 11  PHE A CG  1 
ATOM   46   C CD1 . PHE A 1 6   ? -1.303  -0.146  -17.319 1.00 34.57 ? 11  PHE A CD1 1 
ATOM   47   C CD2 . PHE A 1 6   ? -0.133  1.797   -16.602 1.00 32.56 ? 11  PHE A CD2 1 
ATOM   48   C CE1 . PHE A 1 6   ? -0.321  -0.425  -18.250 1.00 35.28 ? 11  PHE A CE1 1 
ATOM   49   C CE2 . PHE A 1 6   ? 0.847   1.538   -17.545 1.00 35.89 ? 11  PHE A CE2 1 
ATOM   50   C CZ  . PHE A 1 6   ? 0.754   0.423   -18.351 1.00 33.25 ? 11  PHE A CZ  1 
ATOM   51   N N   . MET A 1 7   ? 0.054   -0.536  -13.740 1.00 25.57 ? 12  MET A N   1 
ATOM   52   C CA  . MET A 1 7   ? 1.349   -0.474  -13.166 1.00 24.49 ? 12  MET A CA  1 
ATOM   53   C C   . MET A 1 7   ? 2.323   -1.186  -14.130 1.00 23.67 ? 12  MET A C   1 
ATOM   54   O O   . MET A 1 7   ? 1.995   -2.236  -14.712 1.00 22.02 ? 12  MET A O   1 
ATOM   55   C CB  . MET A 1 7   ? 1.375   -1.249  -11.804 1.00 27.54 ? 12  MET A CB  1 
ATOM   56   C CG  . MET A 1 7   ? 0.552   -0.613  -10.688 1.00 30.06 ? 12  MET A CG  1 
ATOM   57   S SD  . MET A 1 7   ? 1.256   0.958   -10.220 1.00 33.37 ? 12  MET A SD  1 
ATOM   58   C CE  . MET A 1 7   ? 2.699   0.535   -9.263  1.00 32.04 ? 12  MET A CE  1 
ATOM   59   N N   . ARG A 1 8   ? 3.500   -0.609  -14.221 1.00 24.03 ? 13  ARG A N   1 
ATOM   60   C CA  . ARG A 1 8   ? 4.619   -1.198  -14.927 1.00 22.70 ? 13  ARG A CA  1 
ATOM   61   C C   . ARG A 1 8   ? 5.540   -1.928  -13.960 1.00 22.95 ? 13  ARG A C   1 
ATOM   62   O O   . ARG A 1 8   ? 5.585   -1.627  -12.771 1.00 25.65 ? 13  ARG A O   1 
ATOM   63   C CB  . ARG A 1 8   ? 5.403   -0.094  -15.702 1.00 26.46 ? 13  ARG A CB  1 
ATOM   64   C CG  . ARG A 1 8   ? 4.523   0.506   -16.786 1.00 28.77 ? 13  ARG A CG  1 
ATOM   65   C CD  . ARG A 1 8   ? 5.297   1.316   -17.813 1.00 33.37 ? 13  ARG A CD  1 
ATOM   66   N NE  . ARG A 1 8   ? 4.417   1.913   -18.818 1.00 34.96 ? 13  ARG A NE  1 
ATOM   67   C CZ  . ARG A 1 8   ? 3.911   1.305   -19.903 1.00 41.31 ? 13  ARG A CZ  1 
ATOM   68   N NH1 . ARG A 1 8   ? 4.145   0.011   -20.161 1.00 43.22 ? 13  ARG A NH1 1 
ATOM   69   N NH2 . ARG A 1 8   ? 3.129   1.994   -20.741 1.00 40.27 ? 13  ARG A NH2 1 
ATOM   70   N N   . PHE A 1 9   ? 6.380   -2.800  -14.505 1.00 21.97 ? 14  PHE A N   1 
ATOM   71   C CA  . PHE A 1 9   ? 7.447   -3.417  -13.731 1.00 20.64 ? 14  PHE A CA  1 
ATOM   72   C C   . PHE A 1 9   ? 8.692   -3.659  -14.531 1.00 21.66 ? 14  PHE A C   1 
ATOM   73   O O   . PHE A 1 9   ? 8.607   -3.690  -15.789 1.00 23.39 ? 14  PHE A O   1 
ATOM   74   C CB  . PHE A 1 9   ? 6.942   -4.747  -13.075 1.00 21.40 ? 14  PHE A CB  1 
ATOM   75   C CG  . PHE A 1 9   ? 6.694   -5.902  -14.003 1.00 20.97 ? 14  PHE A CG  1 
ATOM   76   C CD1 . PHE A 1 9   ? 7.714   -6.739  -14.343 1.00 23.27 ? 14  PHE A CD1 1 
ATOM   77   C CD2 . PHE A 1 9   ? 5.409   -6.182  -14.438 1.00 22.56 ? 14  PHE A CD2 1 
ATOM   78   C CE1 . PHE A 1 9   ? 7.470   -7.870  -15.117 1.00 24.38 ? 14  PHE A CE1 1 
ATOM   79   C CE2 . PHE A 1 9   ? 5.139   -7.329  -15.180 1.00 25.22 ? 14  PHE A CE2 1 
ATOM   80   C CZ  . PHE A 1 9   ? 6.190   -8.161  -15.548 1.00 25.26 ? 14  PHE A CZ  1 
ATOM   81   N N   . LYS A 1 10  ? 9.813   -3.793  -13.845 1.00 21.26 ? 15  LYS A N   1 
ATOM   82   C CA  . LYS A 1 10  ? 11.090  -4.251  -14.408 1.00 22.47 ? 15  LYS A CA  1 
ATOM   83   C C   . LYS A 1 10  ? 11.574  -5.466  -13.657 1.00 23.41 ? 15  LYS A C   1 
ATOM   84   O O   . LYS A 1 10  ? 11.349  -5.562  -12.444 1.00 22.84 ? 15  LYS A O   1 
ATOM   85   C CB  . LYS A 1 10  ? 12.168  -3.173  -14.259 1.00 25.18 ? 15  LYS A CB  1 
ATOM   86   C CG  . LYS A 1 10  ? 11.780  -1.884  -14.943 1.00 28.23 ? 15  LYS A CG  1 
ATOM   87   C CD  . LYS A 1 10  ? 12.610  -0.702  -14.473 1.00 30.08 ? 15  LYS A CD  1 
ATOM   88   C CE  . LYS A 1 10  ? 12.720  0.314   -15.616 1.00 33.00 ? 15  LYS A CE  1 
ATOM   89   N NZ  . LYS A 1 10  ? 11.663  1.296   -15.513 1.00 33.36 ? 15  LYS A NZ  1 
ATOM   90   N N   . VAL A 1 11  ? 12.201  -6.392  -14.374 1.00 20.19 ? 16  VAL A N   1 
ATOM   91   C CA  . VAL A 1 11  ? 12.634  -7.654  -13.767 1.00 20.74 ? 16  VAL A CA  1 
ATOM   92   C C   . VAL A 1 11  ? 14.029  -7.991  -14.250 1.00 22.68 ? 16  VAL A C   1 
ATOM   93   O O   . VAL A 1 11  ? 14.371  -7.752  -15.441 1.00 21.89 ? 16  VAL A O   1 
ATOM   94   C CB  . VAL A 1 11  ? 11.617  -8.793  -14.001 1.00 21.25 ? 16  VAL A CB  1 
ATOM   95   C CG1 . VAL A 1 11  ? 11.313  -9.062  -15.485 1.00 21.41 ? 16  VAL A CG1 1 
ATOM   96   C CG2 . VAL A 1 11  ? 12.114  -10.067 -13.276 1.00 21.50 ? 16  VAL A CG2 1 
ATOM   97   N N   . HIS A 1 12  ? 14.835  -8.493  -13.326 1.00 20.66 ? 17  HIS A N   1 
ATOM   98   C CA  . HIS A 1 12  ? 16.135  -9.068  -13.585 1.00 20.95 ? 17  HIS A CA  1 
ATOM   99   C C   . HIS A 1 12  ? 16.211  -10.495 -13.010 1.00 22.09 ? 17  HIS A C   1 
ATOM   100  O O   . HIS A 1 12  ? 15.886  -10.648 -11.838 1.00 22.18 ? 17  HIS A O   1 
ATOM   101  C CB  . HIS A 1 12  ? 17.222  -8.297  -12.958 1.00 24.28 ? 17  HIS A CB  1 
ATOM   102  C CG  . HIS A 1 12  ? 18.587  -8.864  -13.213 1.00 30.92 ? 17  HIS A CG  1 
ATOM   103  N ND1 . HIS A 1 12  ? 19.258  -9.645  -12.287 1.00 35.33 ? 17  HIS A ND1 1 
ATOM   104  C CD2 . HIS A 1 12  ? 19.388  -8.802  -14.306 1.00 32.74 ? 17  HIS A CD2 1 
ATOM   105  C CE1 . HIS A 1 12  ? 20.420  -10.016 -12.791 1.00 35.76 ? 17  HIS A CE1 1 
ATOM   106  N NE2 . HIS A 1 12  ? 20.522  -9.512  -14.012 1.00 34.82 ? 17  HIS A NE2 1 
ATOM   107  N N   . MET A 1 13  ? 16.587  -11.474 -13.830 1.00 20.05 ? 18  MET A N   1 
ATOM   108  C CA  . MET A 1 13  ? 16.860  -12.834 -13.306 1.00 21.10 ? 18  MET A CA  1 
ATOM   109  C C   . MET A 1 13  ? 18.329  -13.206 -13.503 1.00 22.83 ? 18  MET A C   1 
ATOM   110  O O   . MET A 1 13  ? 18.868  -13.032 -14.608 1.00 21.12 ? 18  MET A O   1 
ATOM   111  C CB  . MET A 1 13  ? 15.952  -13.868 -13.965 1.00 20.63 ? 18  MET A CB  1 
ATOM   112  C CG  . MET A 1 13  ? 16.212  -15.313 -13.504 1.00 21.42 ? 18  MET A CG  1 
ATOM   113  S SD  . MET A 1 13  ? 15.344  -16.516 -14.510 1.00 22.47 ? 18  MET A SD  1 
ATOM   114  C CE  . MET A 1 13  ? 13.730  -16.330 -13.803 1.00 22.72 ? 18  MET A CE  1 
ATOM   115  N N   . GLU A 1 14  ? 18.969  -13.747 -12.461 1.00 21.43 ? 19  GLU A N   1 
ATOM   116  C CA  . GLU A 1 14  ? 20.273  -14.424 -12.566 1.00 21.59 ? 19  GLU A CA  1 
ATOM   117  C C   . GLU A 1 14  ? 20.003  -15.891 -12.286 1.00 21.85 ? 19  GLU A C   1 
ATOM   118  O O   . GLU A 1 14  ? 19.398  -16.239 -11.287 1.00 20.95 ? 19  GLU A O   1 
ATOM   119  C CB  . GLU A 1 14  ? 21.186  -13.866 -11.493 1.00 28.90 ? 19  GLU A CB  1 
ATOM   120  C CG  . GLU A 1 14  ? 22.569  -14.474 -11.409 1.00 37.09 ? 19  GLU A CG  1 
ATOM   121  C CD  . GLU A 1 14  ? 23.260  -14.172 -10.069 1.00 46.15 ? 19  GLU A CD  1 
ATOM   122  O OE1 . GLU A 1 14  ? 22.802  -13.275 -9.308  1.00 52.03 ? 19  GLU A OE1 1 
ATOM   123  O OE2 . GLU A 1 14  ? 24.263  -14.861 -9.764  1.00 54.11 ? 19  GLU A OE2 1 
ATOM   124  N N   . GLY A 1 15  ? 20.431  -16.772 -13.164 1.00 18.87 ? 20  GLY A N   1 
ATOM   125  C CA  . GLY A 1 15  ? 20.123  -18.141 -13.044 1.00 20.82 ? 20  GLY A CA  1 
ATOM   126  C C   . GLY A 1 15  ? 21.177  -19.094 -13.545 1.00 20.28 ? 20  GLY A C   1 
ATOM   127  O O   . GLY A 1 15  ? 22.113  -18.703 -14.235 1.00 20.24 ? 20  GLY A O   1 
ATOM   128  N N   . SER A 1 16  ? 21.032  -20.335 -13.120 1.00 18.91 ? 21  SER A N   1 
ATOM   129  C CA  . SER A 1 16  ? 21.734  -21.455 -13.734 1.00 20.06 ? 21  SER A CA  1 
ATOM   130  C C   . SER A 1 16  ? 20.851  -22.675 -13.745 1.00 20.35 ? 21  SER A C   1 
ATOM   131  O O   . SER A 1 16  ? 20.127  -22.908 -12.780 1.00 18.67 ? 21  SER A O   1 
ATOM   132  C CB  . SER A 1 16  ? 23.060  -21.780 -13.064 1.00 25.03 ? 21  SER A CB  1 
ATOM   133  O OG  . SER A 1 16  ? 22.922  -22.416 -11.825 1.00 30.93 ? 21  SER A OG  1 
ATOM   134  N N   . VAL A 1 17  ? 20.857  -23.428 -14.825 1.00 16.46 ? 22  VAL A N   1 
ATOM   135  C CA  . VAL A 1 17  ? 20.135  -24.687 -14.933 1.00 17.43 ? 22  VAL A CA  1 
ATOM   136  C C   . VAL A 1 17  ? 21.111  -25.719 -15.424 1.00 17.95 ? 22  VAL A C   1 
ATOM   137  O O   . VAL A 1 17  ? 21.753  -25.523 -16.480 1.00 18.56 ? 22  VAL A O   1 
ATOM   138  C CB  . VAL A 1 17  ? 18.955  -24.556 -15.912 1.00 17.23 ? 22  VAL A CB  1 
ATOM   139  C CG1 . VAL A 1 17  ? 18.319  -25.866 -16.265 1.00 17.36 ? 22  VAL A CG1 1 
ATOM   140  C CG2 . VAL A 1 17  ? 17.941  -23.541 -15.403 1.00 17.66 ? 22  VAL A CG2 1 
ATOM   141  N N   . ASN A 1 18  ? 21.251  -26.810 -14.674 1.00 17.65 ? 23  ASN A N   1 
ATOM   142  C CA  . ASN A 1 18  ? 22.239  -27.846 -14.897 1.00 18.62 ? 23  ASN A CA  1 
ATOM   143  C C   . ASN A 1 18  ? 23.638  -27.292 -15.184 1.00 19.86 ? 23  ASN A C   1 
ATOM   144  O O   . ASN A 1 18  ? 24.357  -27.833 -16.035 1.00 21.94 ? 23  ASN A O   1 
ATOM   145  C CB  . ASN A 1 18  ? 21.806  -28.804 -16.012 1.00 18.73 ? 23  ASN A CB  1 
ATOM   146  C CG  . ASN A 1 18  ? 20.850  -29.868 -15.549 1.00 19.11 ? 23  ASN A CG  1 
ATOM   147  O OD1 . ASN A 1 18  ? 20.125  -29.689 -14.569 1.00 19.10 ? 23  ASN A OD1 1 
ATOM   148  N ND2 . ASN A 1 18  ? 20.805  -30.970 -16.290 1.00 20.78 ? 23  ASN A ND2 1 
ATOM   149  N N   . GLY A 1 19  ? 24.046  -26.286 -14.441 1.00 19.31 ? 24  GLY A N   1 
ATOM   150  C CA  . GLY A 1 19  ? 25.376  -25.698 -14.636 1.00 21.43 ? 24  GLY A CA  1 
ATOM   151  C C   . GLY A 1 19  ? 25.410  -24.565 -15.635 1.00 21.36 ? 24  GLY A C   1 
ATOM   152  O O   . GLY A 1 19  ? 26.371  -23.831 -15.626 1.00 24.24 ? 24  GLY A O   1 
ATOM   153  N N   . HIS A 1 20  ? 24.356  -24.352 -16.428 1.00 20.42 ? 25  HIS A N   1 
ATOM   154  C CA  . HIS A 1 20  ? 24.441  -23.309 -17.488 1.00 20.40 ? 25  HIS A CA  1 
ATOM   155  C C   . HIS A 1 20  ? 23.939  -21.991 -16.930 1.00 20.41 ? 25  HIS A C   1 
ATOM   156  O O   . HIS A 1 20  ? 22.738  -21.873 -16.634 1.00 21.09 ? 25  HIS A O   1 
ATOM   157  C CB  . HIS A 1 20  ? 23.577  -23.650 -18.679 1.00 20.27 ? 25  HIS A CB  1 
ATOM   158  C CG  . HIS A 1 20  ? 23.774  -22.711 -19.805 1.00 25.17 ? 25  HIS A CG  1 
ATOM   159  N ND1 . HIS A 1 20  ? 23.044  -21.545 -19.942 1.00 29.04 ? 25  HIS A ND1 1 
ATOM   160  C CD2 . HIS A 1 20  ? 24.659  -22.737 -20.824 1.00 26.02 ? 25  HIS A CD2 1 
ATOM   161  C CE1 . HIS A 1 20  ? 23.497  -20.880 -20.983 1.00 26.35 ? 25  HIS A CE1 1 
ATOM   162  N NE2 . HIS A 1 20  ? 24.426  -21.620 -21.578 1.00 27.81 ? 25  HIS A NE2 1 
ATOM   163  N N   . GLU A 1 21  ? 24.835  -21.023 -16.846 1.00 21.76 ? 26  GLU A N   1 
ATOM   164  C CA  . GLU A 1 21  ? 24.598  -19.753 -16.265 1.00 21.40 ? 26  GLU A CA  1 
ATOM   165  C C   . GLU A 1 21  ? 24.013  -18.755 -17.269 1.00 23.14 ? 26  GLU A C   1 
ATOM   166  O O   . GLU A 1 21  ? 24.435  -18.714 -18.442 1.00 24.34 ? 26  GLU A O   1 
ATOM   167  C CB  . GLU A 1 21  ? 25.887  -19.183 -15.655 1.00 23.92 ? 26  GLU A CB  1 
ATOM   168  C CG  . GLU A 1 21  ? 26.299  -20.037 -14.463 1.00 26.70 ? 26  GLU A CG  1 
ATOM   169  C CD  . GLU A 1 21  ? 27.498  -19.595 -13.644 1.00 34.26 ? 26  GLU A CD  1 
ATOM   170  O OE1 . GLU A 1 21  ? 28.293  -18.779 -14.089 1.00 39.30 ? 26  GLU A OE1 1 
ATOM   171  O OE2 . GLU A 1 21  ? 27.685  -20.164 -12.536 1.00 37.39 ? 26  GLU A OE2 1 
ATOM   172  N N   . PHE A 1 22  ? 23.063  -17.957 -16.823 1.00 19.74 ? 27  PHE A N   1 
ATOM   173  C CA  . PHE A 1 22  ? 22.384  -17.002 -17.728 1.00 19.16 ? 27  PHE A CA  1 
ATOM   174  C C   . PHE A 1 22  ? 21.828  -15.824 -16.929 1.00 21.42 ? 27  PHE A C   1 
ATOM   175  O O   . PHE A 1 22  ? 21.764  -15.825 -15.708 1.00 19.82 ? 27  PHE A O   1 
ATOM   176  C CB  . PHE A 1 22  ? 21.275  -17.684 -18.519 1.00 20.01 ? 27  PHE A CB  1 
ATOM   177  C CG  . PHE A 1 22  ? 20.179  -18.203 -17.652 1.00 19.60 ? 27  PHE A CG  1 
ATOM   178  C CD1 . PHE A 1 22  ? 20.314  -19.478 -17.112 1.00 19.89 ? 27  PHE A CD1 1 
ATOM   179  C CD2 . PHE A 1 22  ? 19.077  -17.449 -17.375 1.00 20.75 ? 27  PHE A CD2 1 
ATOM   180  C CE1 . PHE A 1 22  ? 19.335  -19.929 -16.279 1.00 22.95 ? 27  PHE A CE1 1 
ATOM   181  C CE2 . PHE A 1 22  ? 18.073  -17.903 -16.523 1.00 23.40 ? 27  PHE A CE2 1 
ATOM   182  C CZ  . PHE A 1 22  ? 18.197  -19.196 -16.024 1.00 22.75 ? 27  PHE A CZ  1 
ATOM   183  N N   . GLU A 1 23  ? 21.528  -14.749 -17.629 1.00 20.39 ? 28  GLU A N   1 
ATOM   184  C CA  . GLU A 1 23  ? 20.799  -13.601 -17.047 1.00 22.23 ? 28  GLU A CA  1 
ATOM   185  C C   . GLU A 1 23  ? 19.703  -13.197 -18.022 1.00 22.74 ? 28  GLU A C   1 
ATOM   186  O O   . GLU A 1 23  ? 19.865  -13.350 -19.247 1.00 24.20 ? 28  GLU A O   1 
ATOM   187  C CB  . GLU A 1 23  ? 21.705  -12.398 -16.801 1.00 23.76 ? 28  GLU A CB  1 
ATOM   188  C CG  . GLU A 1 23  ? 22.716  -12.638 -15.711 1.00 28.01 ? 28  GLU A CG  1 
ATOM   189  C CD  . GLU A 1 23  ? 23.513  -11.419 -15.262 1.00 34.22 ? 28  GLU A CD  1 
ATOM   190  O OE1 . GLU A 1 23  ? 24.527  -11.678 -14.587 1.00 40.11 ? 28  GLU A OE1 1 
ATOM   191  O OE2 . GLU A 1 23  ? 23.098  -10.263 -15.505 1.00 34.92 ? 28  GLU A OE2 1 
ATOM   192  N N   . ILE A 1 24  ? 18.606  -12.675 -17.473 1.00 20.86 ? 29  ILE A N   1 
ATOM   193  C CA  . ILE A 1 24  ? 17.441  -12.258 -18.243 1.00 21.87 ? 29  ILE A CA  1 
ATOM   194  C C   . ILE A 1 24  ? 17.025  -10.939 -17.714 1.00 21.85 ? 29  ILE A C   1 
ATOM   195  O O   . ILE A 1 24  ? 17.138  -10.696 -16.515 1.00 19.91 ? 29  ILE A O   1 
ATOM   196  C CB  . ILE A 1 24  ? 16.307  -13.311 -18.206 1.00 23.10 ? 29  ILE A CB  1 
ATOM   197  C CG1 . ILE A 1 24  ? 16.786  -14.503 -19.073 1.00 23.42 ? 29  ILE A CG1 1 
ATOM   198  C CG2 . ILE A 1 24  ? 14.976  -12.764 -18.686 1.00 22.83 ? 29  ILE A CG2 1 
ATOM   199  C CD1 . ILE A 1 24  ? 15.900  -15.692 -19.009 1.00 25.70 ? 29  ILE A CD1 1 
ATOM   200  N N   . GLU A 1 25  ? 16.674  -10.011 -18.624 1.00 19.55 ? 30  GLU A N   1 
ATOM   201  C CA  . GLU A 1 25  ? 16.100  -8.721  -18.250 1.00 21.71 ? 30  GLU A CA  1 
ATOM   202  C C   . GLU A 1 25  ? 14.800  -8.570  -18.915 1.00 20.92 ? 30  GLU A C   1 
ATOM   203  O O   . GLU A 1 25  ? 14.563  -9.052  -20.082 1.00 24.61 ? 30  GLU A O   1 
ATOM   204  C CB  . GLU A 1 25  ? 17.094  -7.574  -18.614 1.00 27.91 ? 30  GLU A CB  1 
ATOM   205  C CG  . GLU A 1 25  ? 18.454  -7.611  -17.903 1.00 30.91 ? 30  GLU A CG  1 
ATOM   206  C CD  . GLU A 1 25  ? 19.333  -6.382  -18.210 1.00 38.97 ? 30  GLU A CD  1 
ATOM   207  O OE1 . GLU A 1 25  ? 20.408  -6.232  -17.560 1.00 41.68 ? 30  GLU A OE1 1 
ATOM   208  O OE2 . GLU A 1 25  ? 18.969  -5.581  -19.119 1.00 43.80 ? 30  GLU A OE2 1 
ATOM   209  N N   . GLY A 1 26  ? 13.895  -7.835  -18.294 1.00 20.99 ? 31  GLY A N   1 
ATOM   210  C CA  . GLY A 1 26  ? 12.611  -7.630  -18.841 1.00 21.06 ? 31  GLY A CA  1 
ATOM   211  C C   . GLY A 1 26  ? 11.816  -6.484  -18.251 1.00 19.93 ? 31  GLY A C   1 
ATOM   212  O O   . GLY A 1 26  ? 12.204  -5.848  -17.286 1.00 20.11 ? 31  GLY A O   1 
ATOM   213  N N   . GLU A 1 27  ? 10.736  -6.223  -18.911 1.00 22.54 ? 32  GLU A N   1 
ATOM   214  C CA  . GLU A 1 27  ? 9.795   -5.177  -18.517 1.00 25.27 ? 32  GLU A CA  1 
ATOM   215  C C   . GLU A 1 27  ? 8.428   -5.636  -18.734 1.00 22.78 ? 32  GLU A C   1 
ATOM   216  O O   . GLU A 1 27  ? 8.121   -6.356  -19.697 1.00 23.81 ? 32  GLU A O   1 
ATOM   217  C CB  . GLU A 1 27  ? 9.942   -4.004  -19.512 1.00 33.10 ? 32  GLU A CB  1 
ATOM   218  C CG  . GLU A 1 27  ? 10.943  -2.967  -19.157 1.00 37.16 ? 32  GLU A CG  1 
ATOM   219  C CD  . GLU A 1 27  ? 10.750  -1.770  -20.077 1.00 44.16 ? 32  GLU A CD  1 
ATOM   220  O OE1 . GLU A 1 27  ? 10.769  -2.010  -21.293 1.00 43.91 ? 32  GLU A OE1 1 
ATOM   221  O OE2 . GLU A 1 27  ? 10.511  -0.637  -19.597 1.00 48.23 ? 32  GLU A OE2 1 
ATOM   222  N N   . GLY A 1 28  ? 7.491   -5.144  -17.954 1.00 21.32 ? 33  GLY A N   1 
ATOM   223  C CA  . GLY A 1 28  ? 6.146   -5.602  -18.096 1.00 21.44 ? 33  GLY A CA  1 
ATOM   224  C C   . GLY A 1 28  ? 5.135   -4.566  -17.624 1.00 21.34 ? 33  GLY A C   1 
ATOM   225  O O   . GLY A 1 28  ? 5.522   -3.482  -17.170 1.00 21.15 ? 33  GLY A O   1 
ATOM   226  N N   . GLU A 1 29  ? 3.886   -4.885  -17.803 1.00 22.10 ? 34  GLU A N   1 
ATOM   227  C CA  . GLU A 1 29  ? 2.806   -4.004  -17.405 1.00 25.41 ? 34  GLU A CA  1 
ATOM   228  C C   . GLU A 1 29  ? 1.515   -4.789  -17.220 1.00 23.30 ? 34  GLU A C   1 
ATOM   229  O O   . GLU A 1 29  ? 1.314   -5.829  -17.800 1.00 25.77 ? 34  GLU A O   1 
ATOM   230  C CB  . GLU A 1 29  ? 2.600   -2.896  -18.448 1.00 27.25 ? 34  GLU A CB  1 
ATOM   231  C CG  . GLU A 1 29  ? 2.154   -3.461  -19.795 1.00 30.27 ? 34  GLU A CG  1 
ATOM   232  C CD  . GLU A 1 29  ? 2.152   -2.465  -20.923 1.00 36.28 ? 34  GLU A CD  1 
ATOM   233  O OE1 . GLU A 1 29  ? 3.140   -1.728  -21.087 1.00 42.29 ? 34  GLU A OE1 1 
ATOM   234  O OE2 . GLU A 1 29  ? 1.141   -2.438  -21.633 1.00 40.53 ? 34  GLU A OE2 1 
ATOM   235  N N   . GLY A 1 30  ? 0.603   -4.221  -16.452 1.00 23.69 ? 35  GLY A N   1 
ATOM   236  C CA  . GLY A 1 30  ? -0.698  -4.769  -16.366 1.00 24.69 ? 35  GLY A CA  1 
ATOM   237  C C   . GLY A 1 30  ? -1.608  -3.989  -15.431 1.00 21.79 ? 35  GLY A C   1 
ATOM   238  O O   . GLY A 1 30  ? -1.304  -2.851  -15.074 1.00 22.91 ? 35  GLY A O   1 
ATOM   239  N N   . ARG A 1 31  ? -2.716  -4.647  -15.093 1.00 23.05 ? 36  ARG A N   1 
ATOM   240  C CA  . ARG A 1 31  ? -3.857  -4.083  -14.371 1.00 24.74 ? 36  ARG A CA  1 
ATOM   241  C C   . ARG A 1 31  ? -3.967  -4.891  -13.044 1.00 22.95 ? 36  ARG A C   1 
ATOM   242  O O   . ARG A 1 31  ? -4.549  -5.937  -13.045 1.00 22.52 ? 36  ARG A O   1 
ATOM   243  C CB  . ARG A 1 31  ? -5.110  -4.315  -15.177 1.00 28.41 ? 36  ARG A CB  1 
ATOM   244  C CG  . ARG A 1 31  ? -5.019  -3.819  -16.620 1.00 33.24 ? 36  ARG A CG  1 
ATOM   245  C CD  . ARG A 1 31  ? -5.090  -2.345  -16.697 1.00 36.92 ? 36  ARG A CD  1 
ATOM   246  N NE  . ARG A 1 31  ? -6.427  -1.894  -16.312 1.00 38.55 ? 36  ARG A NE  1 
ATOM   247  C CZ  . ARG A 1 31  ? -6.762  -0.607  -16.194 1.00 41.54 ? 36  ARG A CZ  1 
ATOM   248  N NH1 . ARG A 1 31  ? -5.893  0.351   -16.473 1.00 43.57 ? 36  ARG A NH1 1 
ATOM   249  N NH2 . ARG A 1 31  ? -7.980  -0.280  -15.792 1.00 45.62 ? 36  ARG A NH2 1 
ATOM   250  N N   . PRO A 1 32  ? -3.357  -4.383  -11.985 1.00 23.51 ? 37  PRO A N   1 
ATOM   251  C CA  . PRO A 1 32  ? -3.268  -5.235  -10.770 1.00 23.88 ? 37  PRO A CA  1 
ATOM   252  C C   . PRO A 1 32  ? -4.582  -5.664  -10.153 1.00 26.76 ? 37  PRO A C   1 
ATOM   253  O O   . PRO A 1 32  ? -4.641  -6.748  -9.525  1.00 26.02 ? 37  PRO A O   1 
ATOM   254  C CB  . PRO A 1 32  ? -2.437  -4.421  -9.830  1.00 24.15 ? 37  PRO A CB  1 
ATOM   255  C CG  . PRO A 1 32  ? -1.712  -3.395  -10.684 1.00 25.88 ? 37  PRO A CG  1 
ATOM   256  C CD  . PRO A 1 32  ? -2.537  -3.195  -11.894 1.00 24.30 ? 37  PRO A CD  1 
ATOM   257  N N   . TYR A 1 33  ? -5.627  -4.872  -10.314 1.00 24.74 ? 38  TYR A N   1 
ATOM   258  C CA  . TYR A 1 33  ? -6.883  -5.154  -9.667  1.00 26.62 ? 38  TYR A CA  1 
ATOM   259  C C   . TYR A 1 33  ? -7.681  -6.000  -10.596 1.00 28.22 ? 38  TYR A C   1 
ATOM   260  O O   . TYR A 1 33  ? -8.652  -6.666  -10.186 1.00 33.56 ? 38  TYR A O   1 
ATOM   261  C CB  . TYR A 1 33  ? -7.589  -3.839  -9.266  1.00 26.09 ? 38  TYR A CB  1 
ATOM   262  C CG  . TYR A 1 33  ? -6.802  -3.038  -8.284  1.00 27.61 ? 38  TYR A CG  1 
ATOM   263  C CD1 . TYR A 1 33  ? -6.864  -3.298  -6.929  1.00 26.97 ? 38  TYR A CD1 1 
ATOM   264  C CD2 . TYR A 1 33  ? -5.946  -2.063  -8.689  1.00 27.40 ? 38  TYR A CD2 1 
ATOM   265  C CE1 . TYR A 1 33  ? -6.118  -2.551  -6.034  1.00 28.48 ? 38  TYR A CE1 1 
ATOM   266  C CE2 . TYR A 1 33  ? -5.184  -1.338  -7.809  1.00 27.25 ? 38  TYR A CE2 1 
ATOM   267  C CZ  . TYR A 1 33  ? -5.296  -1.559  -6.486  1.00 27.93 ? 38  TYR A CZ  1 
ATOM   268  O OH  . TYR A 1 33  ? -4.530  -0.852  -5.624  1.00 30.89 ? 38  TYR A OH  1 
ATOM   269  N N   . GLU A 1 34  ? -7.258  -6.082  -11.850 1.00 28.20 ? 39  GLU A N   1 
ATOM   270  C CA  . GLU A 1 34  ? -7.973  -6.947  -12.756 1.00 27.95 ? 39  GLU A CA  1 
ATOM   271  C C   . GLU A 1 34  ? -7.323  -8.302  -12.933 1.00 24.93 ? 39  GLU A C   1 
ATOM   272  O O   . GLU A 1 34  ? -7.912  -9.222  -13.480 1.00 25.40 ? 39  GLU A O   1 
ATOM   273  C CB  . GLU A 1 34  ? -8.170  -6.245  -14.122 1.00 32.38 ? 39  GLU A CB  1 
ATOM   274  C CG  . GLU A 1 34  ? -9.131  -5.091  -14.064 1.00 35.55 ? 39  GLU A CG  1 
ATOM   275  C CD  . GLU A 1 34  ? -8.962  -4.068  -15.189 1.00 39.36 ? 39  GLU A CD  1 
ATOM   276  O OE1 . GLU A 1 34  ? -8.542  -4.426  -16.303 1.00 50.72 ? 39  GLU A OE1 1 
ATOM   277  O OE2 . GLU A 1 34  ? -9.265  -2.877  -14.971 1.00 46.20 ? 39  GLU A OE2 1 
ATOM   278  N N   . GLY A 1 35  ? -6.082  -8.420  -12.494 1.00 24.66 ? 40  GLY A N   1 
ATOM   279  C CA  . GLY A 1 35  ? -5.368  -9.677  -12.478 1.00 24.41 ? 40  GLY A CA  1 
ATOM   280  C C   . GLY A 1 35  ? -4.646  -10.025 -13.768 1.00 25.71 ? 40  GLY A C   1 
ATOM   281  O O   . GLY A 1 35  ? -4.309  -11.166 -13.969 1.00 23.86 ? 40  GLY A O   1 
ATOM   282  N N   . THR A 1 36  ? -4.402  -9.023  -14.593 1.00 22.66 ? 41  THR A N   1 
ATOM   283  C CA  . THR A 1 36  ? -3.743  -9.246  -15.885 1.00 24.63 ? 41  THR A CA  1 
ATOM   284  C C   . THR A 1 36  ? -2.430  -8.557  -16.046 1.00 22.64 ? 41  THR A C   1 
ATOM   285  O O   . THR A 1 36  ? -2.232  -7.444  -15.559 1.00 21.79 ? 41  THR A O   1 
ATOM   286  C CB  . THR A 1 36  ? -4.657  -8.844  -17.043 1.00 26.92 ? 41  THR A CB  1 
ATOM   287  O OG1 . THR A 1 36  ? -5.006  -7.485  -16.871 1.00 26.86 ? 41  THR A OG1 1 
ATOM   288  C CG2 . THR A 1 36  ? -5.913  -9.768  -17.115 1.00 29.99 ? 41  THR A CG2 1 
ATOM   289  N N   . GLN A 1 37  ? -1.507  -9.204  -16.764 1.00 21.90 ? 42  GLN A N   1 
ATOM   290  C CA  . GLN A 1 37  ? -0.233  -8.597  -17.007 1.00 23.18 ? 42  GLN A CA  1 
ATOM   291  C C   . GLN A 1 37  ? 0.453   -9.230  -18.230 1.00 21.56 ? 42  GLN A C   1 
ATOM   292  O O   . GLN A 1 37  ? 0.094   -10.334 -18.663 1.00 21.65 ? 42  GLN A O   1 
ATOM   293  C CB  . GLN A 1 37  ? 0.695   -8.671  -15.778 1.00 23.63 ? 42  GLN A CB  1 
ATOM   294  C CG  . GLN A 1 37  ? 0.923   -10.059 -15.278 1.00 25.71 ? 42  GLN A CG  1 
ATOM   295  C CD  . GLN A 1 37  ? 1.843   -10.131 -14.084 1.00 32.11 ? 42  GLN A CD  1 
ATOM   296  O OE1 . GLN A 1 37  ? 2.887   -9.473  -14.034 1.00 31.79 ? 42  GLN A OE1 1 
ATOM   297  N NE2 . GLN A 1 37  ? 1.441   -10.935 -13.076 1.00 29.67 ? 42  GLN A NE2 1 
ATOM   298  N N   . THR A 1 38  ? 1.345   -8.457  -18.822 1.00 23.59 ? 43  THR A N   1 
ATOM   299  C CA  . THR A 1 38  ? 2.213   -8.921  -19.910 1.00 23.85 ? 43  THR A CA  1 
ATOM   300  C C   . THR A 1 38  ? 3.651   -8.562  -19.587 1.00 23.32 ? 43  THR A C   1 
ATOM   301  O O   . THR A 1 38  ? 3.955   -7.690  -18.742 1.00 25.38 ? 43  THR A O   1 
ATOM   302  C CB  . THR A 1 38  ? 1.824   -8.281  -21.268 1.00 24.27 ? 43  THR A CB  1 
ATOM   303  O OG1 . THR A 1 38  ? 1.890   -6.886  -21.091 1.00 26.99 ? 43  THR A OG1 1 
ATOM   304  C CG2 . THR A 1 38  ? 0.482   -8.663  -21.713 1.00 26.01 ? 43  THR A CG2 1 
ATOM   305  N N   . ALA A 1 39  ? 4.577   -9.282  -20.208 1.00 22.91 ? 44  ALA A N   1 
ATOM   306  C CA  . ALA A 1 39  ? 5.988   -9.067  -19.990 1.00 22.09 ? 44  ALA A CA  1 
ATOM   307  C C   . ALA A 1 39  ? 6.726   -9.387  -21.290 1.00 22.11 ? 44  ALA A C   1 
ATOM   308  O O   . ALA A 1 39  ? 6.324   -10.260 -22.010 1.00 24.52 ? 44  ALA A O   1 
ATOM   309  C CB  . ALA A 1 39  ? 6.544   -9.992  -18.888 1.00 24.19 ? 44  ALA A CB  1 
ATOM   310  N N   . LYS A 1 40  ? 7.777   -8.631  -21.504 1.00 21.06 ? 45  LYS A N   1 
ATOM   311  C CA  . LYS A 1 40  ? 8.722   -8.806  -22.579 1.00 23.47 ? 45  LYS A CA  1 
ATOM   312  C C   . LYS A 1 40  ? 10.093  -9.020  -21.972 1.00 20.30 ? 45  LYS A C   1 
ATOM   313  O O   . LYS A 1 40  ? 10.654  -8.181  -21.286 1.00 22.90 ? 45  LYS A O   1 
ATOM   314  C CB  . LYS A 1 40  ? 8.744   -7.541  -23.458 1.00 27.16 ? 45  LYS A CB  1 
ATOM   315  C CG  . LYS A 1 40  ? 7.483   -7.263  -24.260 1.00 33.57 ? 45  LYS A CG  1 
ATOM   316  C CD  . LYS A 1 40  ? 7.363   -5.806  -24.730 1.00 40.74 ? 45  LYS A CD  1 
ATOM   317  C CE  . LYS A 1 40  ? 5.907   -5.509  -25.095 1.00 42.76 ? 45  LYS A CE  1 
ATOM   318  N NZ  . LYS A 1 40  ? 5.705   -4.308  -25.981 1.00 43.72 ? 45  LYS A NZ  1 
ATOM   319  N N   . LEU A 1 41  ? 10.671  -10.177 -22.218 1.00 22.24 ? 46  LEU A N   1 
ATOM   320  C CA  . LEU A 1 41  ? 11.888  -10.602 -21.579 1.00 21.54 ? 46  LEU A CA  1 
ATOM   321  C C   . LEU A 1 41  ? 12.919  -10.819 -22.654 1.00 20.10 ? 46  LEU A C   1 
ATOM   322  O O   . LEU A 1 41  ? 12.587  -11.251 -23.753 1.00 22.62 ? 46  LEU A O   1 
ATOM   323  C CB  . LEU A 1 41  ? 11.647  -11.980 -20.967 1.00 23.04 ? 46  LEU A CB  1 
ATOM   324  C CG  . LEU A 1 41  ? 10.775  -12.204 -19.741 1.00 25.09 ? 46  LEU A CG  1 
ATOM   325  C CD1 . LEU A 1 41  ? 10.899  -11.131 -18.696 1.00 23.66 ? 46  LEU A CD1 1 
ATOM   326  C CD2 . LEU A 1 41  ? 9.343   -12.574 -20.059 1.00 26.49 ? 46  LEU A CD2 1 
ATOM   327  N N   . LYS A 1 42  ? 14.142  -10.581 -22.303 1.00 20.07 ? 47  LYS A N   1 
ATOM   328  C CA  . LYS A 1 42  ? 15.265  -10.990 -23.141 1.00 22.45 ? 47  LYS A CA  1 
ATOM   329  C C   . LYS A 1 42  ? 16.431  -11.596 -22.387 1.00 19.99 ? 47  LYS A C   1 
ATOM   330  O O   . LYS A 1 42  ? 16.796  -11.137 -21.323 1.00 21.43 ? 47  LYS A O   1 
ATOM   331  C CB  . LYS A 1 42  ? 15.746  -9.747  -23.916 1.00 23.20 ? 47  LYS A CB  1 
ATOM   332  C CG  . LYS A 1 42  ? 16.397  -8.740  -23.051 1.00 28.07 ? 47  LYS A CG  1 
ATOM   333  C CD  . LYS A 1 42  ? 16.853  -7.545  -23.902 1.00 30.00 ? 47  LYS A CD  1 
ATOM   334  C CE  . LYS A 1 42  ? 17.334  -6.382  -23.047 1.00 31.30 ? 47  LYS A CE  1 
ATOM   335  N NZ  . LYS A 1 42  ? 17.947  -5.349  -23.925 1.00 31.87 ? 47  LYS A NZ  1 
ATOM   336  N N   . VAL A 1 43  ? 17.098  -12.543 -23.036 1.00 20.45 ? 48  VAL A N   1 
ATOM   337  C CA  . VAL A 1 43  ? 18.302  -13.118 -22.506 1.00 20.19 ? 48  VAL A CA  1 
ATOM   338  C C   . VAL A 1 43  ? 19.446  -12.185 -22.791 1.00 24.10 ? 48  VAL A C   1 
ATOM   339  O O   . VAL A 1 43  ? 19.751  -11.940 -23.980 1.00 24.07 ? 48  VAL A O   1 
ATOM   340  C CB  . VAL A 1 43  ? 18.615  -14.503 -23.064 1.00 21.06 ? 48  VAL A CB  1 
ATOM   341  C CG1 . VAL A 1 43  ? 19.835  -15.065 -22.343 1.00 23.27 ? 48  VAL A CG1 1 
ATOM   342  C CG2 . VAL A 1 43  ? 17.431  -15.459 -22.897 1.00 21.25 ? 48  VAL A CG2 1 
ATOM   343  N N   . THR A 1 44  ? 20.116  -11.752 -21.744 1.00 22.46 ? 49  THR A N   1 
ATOM   344  C CA  . THR A 1 44  ? 21.243  -10.824 -21.840 1.00 25.17 ? 49  THR A CA  1 
ATOM   345  C C   . THR A 1 44  ? 22.580  -11.470 -21.697 1.00 27.91 ? 49  THR A C   1 
ATOM   346  O O   . THR A 1 44  ? 23.604  -10.908 -22.124 1.00 28.65 ? 49  THR A O   1 
ATOM   347  C CB  . THR A 1 44  ? 21.092  -9.709  -20.787 1.00 27.33 ? 49  THR A CB  1 
ATOM   348  O OG1 . THR A 1 44  ? 20.931  -10.294 -19.486 1.00 29.42 ? 49  THR A OG1 1 
ATOM   349  C CG2 . THR A 1 44  ? 19.865  -8.939  -21.045 1.00 28.51 ? 49  THR A CG2 1 
ATOM   350  N N   . LYS A 1 45  ? 22.629  -12.614 -21.036 1.00 23.31 ? 50  LYS A N   1 
ATOM   351  C CA  . LYS A 1 45  ? 23.868  -13.341 -20.847 1.00 26.24 ? 50  LYS A CA  1 
ATOM   352  C C   . LYS A 1 45  ? 23.570  -14.831 -20.930 1.00 26.72 ? 50  LYS A C   1 
ATOM   353  O O   . LYS A 1 45  ? 22.532  -15.277 -20.438 1.00 24.49 ? 50  LYS A O   1 
ATOM   354  C CB  . LYS A 1 45  ? 24.548  -12.974 -19.543 1.00 31.07 ? 50  LYS A CB  1 
ATOM   355  C CG  . LYS A 1 45  ? 25.353  -11.681 -19.624 1.00 41.54 ? 50  LYS A CG  1 
ATOM   356  C CD  . LYS A 1 45  ? 26.225  -11.533 -18.374 1.00 49.52 ? 50  LYS A CD  1 
ATOM   357  C CE  . LYS A 1 45  ? 27.290  -10.458 -18.572 1.00 54.28 ? 50  LYS A CE  1 
ATOM   358  N NZ  . LYS A 1 45  ? 27.966  -10.120 -17.288 1.00 56.77 ? 50  LYS A NZ  1 
ATOM   359  N N   . GLY A 1 46  ? 24.441  -15.600 -21.602 1.00 26.18 ? 51  GLY A N   1 
ATOM   360  C CA  . GLY A 1 46  ? 24.310  -17.084 -21.666 1.00 24.45 ? 51  GLY A CA  1 
ATOM   361  C C   . GLY A 1 46  ? 23.301  -17.646 -22.617 1.00 24.97 ? 51  GLY A C   1 
ATOM   362  O O   . GLY A 1 46  ? 22.817  -18.772 -22.516 1.00 26.14 ? 51  GLY A O   1 
ATOM   363  N N   . GLY A 1 47  ? 22.935  -16.830 -23.603 1.00 24.84 ? 52  GLY A N   1 
ATOM   364  C CA  . GLY A 1 47  ? 21.969  -17.262 -24.578 1.00 25.16 ? 52  GLY A CA  1 
ATOM   365  C C   . GLY A 1 47  ? 22.637  -17.805 -25.845 1.00 25.52 ? 52  GLY A C   1 
ATOM   366  O O   . GLY A 1 47  ? 23.811  -17.573 -26.036 1.00 30.79 ? 52  GLY A O   1 
ATOM   367  N N   . PRO A 1 48  ? 21.934  -18.551 -26.667 1.00 26.69 ? 53  PRO A N   1 
ATOM   368  C CA  . PRO A 1 48  ? 20.600  -19.052 -26.409 1.00 25.36 ? 53  PRO A CA  1 
ATOM   369  C C   . PRO A 1 48  ? 20.633  -20.117 -25.320 1.00 23.36 ? 53  PRO A C   1 
ATOM   370  O O   . PRO A 1 48  ? 21.622  -20.813 -25.172 1.00 23.87 ? 53  PRO A O   1 
ATOM   371  C CB  . PRO A 1 48  ? 20.168  -19.655 -27.740 1.00 27.49 ? 53  PRO A CB  1 
ATOM   372  C CG  . PRO A 1 48  ? 21.414  -19.913 -28.482 1.00 29.11 ? 53  PRO A CG  1 
ATOM   373  C CD  . PRO A 1 48  ? 22.523  -19.093 -27.906 1.00 29.66 ? 53  PRO A CD  1 
ATOM   374  N N   . LEU A 1 49  ? 19.511  -20.225 -24.612 1.00 21.98 ? 54  LEU A N   1 
ATOM   375  C CA  . LEU A 1 49  ? 19.466  -21.114 -23.442 1.00 21.20 ? 54  LEU A CA  1 
ATOM   376  C C   . LEU A 1 49  ? 19.377  -22.469 -23.964 1.00 20.73 ? 54  LEU A C   1 
ATOM   377  O O   . LEU A 1 49  ? 18.595  -22.739 -24.903 1.00 22.28 ? 54  LEU A O   1 
ATOM   378  C CB  . LEU A 1 49  ? 18.284  -20.824 -22.573 1.00 19.71 ? 54  LEU A CB  1 
ATOM   379  C CG  . LEU A 1 49  ? 18.145  -19.418 -22.012 1.00 20.30 ? 54  LEU A CG  1 
ATOM   380  C CD1 . LEU A 1 49  ? 16.827  -19.294 -21.281 1.00 21.60 ? 54  LEU A CD1 1 
ATOM   381  C CD2 . LEU A 1 49  ? 19.349  -19.017 -21.223 1.00 20.20 ? 54  LEU A CD2 1 
ATOM   382  N N   . PRO A 1 50  ? 20.105  -23.387 -23.316 1.00 21.06 ? 55  PRO A N   1 
ATOM   383  C CA  . PRO A 1 50  ? 20.031  -24.751 -23.752 1.00 22.24 ? 55  PRO A CA  1 
ATOM   384  C C   . PRO A 1 50  ? 19.014  -25.577 -23.005 1.00 22.31 ? 55  PRO A C   1 
ATOM   385  O O   . PRO A 1 50  ? 19.266  -26.770 -22.792 1.00 30.32 ? 55  PRO A O   1 
ATOM   386  C CB  . PRO A 1 50  ? 21.411  -25.289 -23.404 1.00 23.93 ? 55  PRO A CB  1 
ATOM   387  C CG  . PRO A 1 50  ? 21.813  -24.562 -22.204 1.00 23.61 ? 55  PRO A CG  1 
ATOM   388  C CD  . PRO A 1 50  ? 21.205  -23.163 -22.381 1.00 21.09 ? 55  PRO A CD  1 
ATOM   389  N N   . PHE A 1 51  ? 17.923  -24.989 -22.569 1.00 18.67 ? 56  PHE A N   1 
ATOM   390  C CA  . PHE A 1 51  ? 16.830  -25.699 -21.953 1.00 18.06 ? 56  PHE A CA  1 
ATOM   391  C C   . PHE A 1 51  ? 15.507  -24.974 -22.198 1.00 18.73 ? 56  PHE A C   1 
ATOM   392  O O   . PHE A 1 51  ? 15.475  -23.831 -22.739 1.00 20.57 ? 56  PHE A O   1 
ATOM   393  C CB  . PHE A 1 51  ? 17.147  -25.782 -20.436 1.00 18.10 ? 56  PHE A CB  1 
ATOM   394  C CG  . PHE A 1 51  ? 17.360  -24.481 -19.819 1.00 16.50 ? 56  PHE A CG  1 
ATOM   395  C CD1 . PHE A 1 51  ? 16.257  -23.715 -19.377 1.00 16.95 ? 56  PHE A CD1 1 
ATOM   396  C CD2 . PHE A 1 51  ? 18.653  -23.978 -19.613 1.00 16.79 ? 56  PHE A CD2 1 
ATOM   397  C CE1 . PHE A 1 51  ? 16.478  -22.420 -18.833 1.00 18.83 ? 56  PHE A CE1 1 
ATOM   398  C CE2 . PHE A 1 51  ? 18.867  -22.707 -19.061 1.00 16.78 ? 56  PHE A CE2 1 
ATOM   399  C CZ  . PHE A 1 51  ? 17.821  -21.959 -18.672 1.00 17.11 ? 56  PHE A CZ  1 
ATOM   400  N N   . ALA A 1 52  ? 14.420  -25.621 -21.807 1.00 18.22 ? 57  ALA A N   1 
ATOM   401  C CA  . ALA A 1 52  ? 13.096  -25.151 -22.037 1.00 18.87 ? 57  ALA A CA  1 
ATOM   402  C C   . ALA A 1 52  ? 12.831  -23.876 -21.289 1.00 19.40 ? 57  ALA A C   1 
ATOM   403  O O   . ALA A 1 52  ? 12.919  -23.740 -20.068 1.00 19.11 ? 57  ALA A O   1 
ATOM   404  C CB  . ALA A 1 52  ? 12.044  -26.160 -21.683 1.00 21.05 ? 57  ALA A CB  1 
ATOM   405  N N   . TRP A 1 53  ? 12.422  -22.868 -22.043 1.00 17.75 ? 58  TRP A N   1 
ATOM   406  C CA  . TRP A 1 53  ? 11.960  -21.665 -21.425 1.00 18.75 ? 58  TRP A CA  1 
ATOM   407  C C   . TRP A 1 53  ? 10.854  -21.770 -20.379 1.00 18.12 ? 58  TRP A C   1 
ATOM   408  O O   . TRP A 1 53  ? 10.807  -20.983 -19.437 1.00 18.80 ? 58  TRP A O   1 
ATOM   409  C CB  . TRP A 1 53  ? 11.452  -20.655 -22.533 1.00 20.36 ? 58  TRP A CB  1 
ATOM   410  C CG  . TRP A 1 53  ? 11.046  -19.389 -21.980 1.00 19.38 ? 58  TRP A CG  1 
ATOM   411  C CD1 . TRP A 1 53  ? 9.798   -19.043 -21.569 1.00 20.15 ? 58  TRP A CD1 1 
ATOM   412  C CD2 . TRP A 1 53  ? 11.842  -18.276 -21.770 1.00 19.51 ? 58  TRP A CD2 1 
ATOM   413  N NE1 . TRP A 1 53  ? 9.794   -17.822 -21.079 1.00 19.81 ? 58  TRP A NE1 1 
ATOM   414  C CE2 . TRP A 1 53  ? 11.032  -17.303 -21.187 1.00 20.71 ? 58  TRP A CE2 1 
ATOM   415  C CE3 . TRP A 1 53  ? 13.177  -17.969 -22.035 1.00 21.83 ? 58  TRP A CE3 1 
ATOM   416  C CZ2 . TRP A 1 53  ? 11.505  -16.058 -20.815 1.00 22.73 ? 58  TRP A CZ2 1 
ATOM   417  C CZ3 . TRP A 1 53  ? 13.647  -16.710 -21.673 1.00 23.42 ? 58  TRP A CZ3 1 
ATOM   418  C CH2 . TRP A 1 53  ? 12.811  -15.788 -21.052 1.00 23.21 ? 58  TRP A CH2 1 
ATOM   419  N N   . ASP A 1 54  ? 9.976   -22.712 -20.551 1.00 18.49 ? 59  ASP A N   1 
ATOM   420  C CA  . ASP A 1 54  ? 8.823   -22.943 -19.707 1.00 19.59 ? 59  ASP A CA  1 
ATOM   421  C C   . ASP A 1 54  ? 9.201   -23.006 -18.233 1.00 19.33 ? 59  ASP A C   1 
ATOM   422  O O   . ASP A 1 54  ? 8.414   -22.511 -17.430 1.00 21.37 ? 59  ASP A O   1 
ATOM   423  C CB  . ASP A 1 54  ? 8.056   -24.183 -20.092 1.00 21.73 ? 59  ASP A CB  1 
ATOM   424  C CG  . ASP A 1 54  ? 7.239   -24.028 -21.415 1.00 22.64 ? 59  ASP A CG  1 
ATOM   425  O OD1 . ASP A 1 54  ? 6.698   -22.894 -21.693 1.00 25.58 ? 59  ASP A OD1 1 
ATOM   426  O OD2 . ASP A 1 54  ? 7.150   -25.048 -22.076 1.00 28.07 ? 59  ASP A OD2 1 
ATOM   427  N N   . ILE A 1 55  ? 10.371  -23.506 -17.885 1.00 20.46 ? 60  ILE A N   1 
ATOM   428  C CA  . ILE A 1 55  ? 10.691  -23.554 -16.439 1.00 20.62 ? 60  ILE A CA  1 
ATOM   429  C C   . ILE A 1 55  ? 11.017  -22.202 -15.798 1.00 20.46 ? 60  ILE A C   1 
ATOM   430  O O   . ILE A 1 55  ? 10.965  -22.013 -14.539 1.00 20.06 ? 60  ILE A O   1 
ATOM   431  C CB  . ILE A 1 55  ? 11.825  -24.567 -16.127 1.00 21.15 ? 60  ILE A CB  1 
ATOM   432  C CG1 . ILE A 1 55  ? 13.210  -24.082 -16.609 1.00 21.83 ? 60  ILE A CG1 1 
ATOM   433  C CG2 . ILE A 1 55  ? 11.443  -25.940 -16.589 1.00 22.12 ? 60  ILE A CG2 1 
ATOM   434  C CD1 . ILE A 1 55  ? 14.419  -24.861 -16.118 1.00 20.79 ? 60  ILE A CD1 1 
ATOM   435  N N   . LEU A 1 56  ? 11.369  -21.225 -16.634 1.00 17.02 ? 61  LEU A N   1 
ATOM   436  C CA  . LEU A 1 56  ? 11.538  -19.858 -16.219 1.00 17.42 ? 61  LEU A CA  1 
ATOM   437  C C   . LEU A 1 56  ? 10.263  -19.006 -16.156 1.00 16.28 ? 61  LEU A C   1 
ATOM   438  O O   . LEU A 1 56  ? 10.179  -18.086 -15.369 1.00 17.53 ? 61  LEU A O   1 
ATOM   439  C CB  . LEU A 1 56  ? 12.550  -19.153 -17.155 1.00 17.40 ? 61  LEU A CB  1 
ATOM   440  C CG  . LEU A 1 56  ? 13.911  -19.813 -17.336 1.00 18.34 ? 61  LEU A CG  1 
ATOM   441  C CD1 . LEU A 1 56  ? 14.774  -18.903 -18.169 1.00 21.12 ? 61  LEU A CD1 1 
ATOM   442  C CD2 . LEU A 1 56  ? 14.662  -20.239 -16.079 1.00 20.29 ? 61  LEU A CD2 1 
ATOM   443  N N   . SER A 1 57  ? 9.295   -19.344 -17.026 1.00 18.14 ? 62  SER A N   1 
ATOM   444  C CA  . SER A 1 57  ? 8.149   -18.467 -17.269 1.00 20.70 ? 62  SER A CA  1 
ATOM   445  C C   . SER A 1 57  ? 7.364   -18.079 -16.004 1.00 19.87 ? 62  SER A C   1 
ATOM   446  O O   . SER A 1 57  ? 7.072   -16.914 -15.826 1.00 19.71 ? 62  SER A O   1 
ATOM   447  C CB  . SER A 1 57  ? 7.286   -19.061 -18.406 1.00 22.87 ? 62  SER A CB  1 
ATOM   448  O OG  . SER A 1 57  ? 6.610   -20.213 -17.961 1.00 24.85 ? 62  SER A OG  1 
ATOM   449  N N   . PRO A 1 58  ? 7.170   -19.025 -15.046 1.00 19.17 ? 63  PRO A N   1 
ATOM   450  C CA  . PRO A 1 58  ? 6.403   -18.607 -13.817 1.00 21.41 ? 63  PRO A CA  1 
ATOM   451  C C   . PRO A 1 58  ? 7.191   -17.819 -12.776 1.00 22.44 ? 63  PRO A C   1 
ATOM   452  O O   . PRO A 1 58  ? 6.647   -17.448 -11.717 1.00 22.32 ? 63  PRO A O   1 
ATOM   453  C CB  . PRO A 1 58  ? 5.938   -19.949 -13.212 1.00 22.90 ? 63  PRO A CB  1 
ATOM   454  C CG  . PRO A 1 58  ? 6.534   -21.028 -14.046 1.00 24.15 ? 63  PRO A CG  1 
ATOM   455  C CD  . PRO A 1 58  ? 7.552   -20.432 -15.002 1.00 21.57 ? 63  PRO A CD  1 
ATOM   456  N N   . GLN A 1 59  ? 8.453   -17.532 -13.050 1.00 19.76 ? 64  GLN A N   1 
ATOM   457  C CA  . GLN A 1 59  ? 9.238   -16.743 -12.157 1.00 20.44 ? 64  GLN A CA  1 
ATOM   458  C C   . GLN A 1 59  ? 9.143   -15.275 -12.413 1.00 22.95 ? 64  GLN A C   1 
ATOM   459  O O   . GLN A 1 59  ? 9.539   -14.490 -11.590 1.00 21.78 ? 64  GLN A O   1 
ATOM   460  C CB  . GLN A 1 59  ? 10.684  -17.177 -12.085 1.00 22.49 ? 64  GLN A CB  1 
ATOM   461  C CG  . GLN A 1 59  ? 10.944  -18.632 -12.363 1.00 21.85 ? 64  GLN A CG  1 
ATOM   462  C CD  . GLN A 1 59  ? 10.219  -19.625 -11.483 1.00 21.84 ? 64  GLN A CD  1 
ATOM   463  O OE1 . GLN A 1 59  ? 9.718   -19.298 -10.415 1.00 21.95 ? 64  GLN A OE1 1 
ATOM   464  N NE2 . GLN A 1 59  ? 10.126  -20.812 -11.944 1.00 21.66 ? 64  GLN A NE2 1 
ATOM   465  N N   . PHE A 1 60  ? 8.564   -14.875 -13.537 1.00 22.72 ? 65  PHE A N   1 
ATOM   466  C CA  . PHE A 1 60  ? 8.572   -13.455 -13.838 1.00 26.36 ? 65  PHE A CA  1 
ATOM   467  C C   . PHE A 1 60  ? 7.318   -12.710 -13.389 1.00 36.29 ? 65  PHE A C   1 
ATOM   468  O O   . PHE A 1 60  ? 7.439   -11.491 -13.097 1.00 43.56 ? 65  PHE A O   1 
ATOM   469  C CB  . PHE A 1 60  ? 8.771   -13.260 -15.351 1.00 24.72 ? 65  PHE A CB  1 
ATOM   470  C CG  . PHE A 1 60  ? 10.028  -13.841 -15.861 1.00 23.77 ? 65  PHE A CG  1 
ATOM   471  C CD1 . PHE A 1 60  ? 11.222  -13.280 -15.534 1.00 24.73 ? 65  PHE A CD1 1 
ATOM   472  C CD2 . PHE A 1 60  ? 10.021  -14.900 -16.715 1.00 23.96 ? 65  PHE A CD2 1 
ATOM   473  C CE1 . PHE A 1 60  ? 12.388  -13.812 -16.024 1.00 25.50 ? 65  PHE A CE1 1 
ATOM   474  C CE2 . PHE A 1 60  ? 11.186  -15.443 -17.213 1.00 24.15 ? 65  PHE A CE2 1 
ATOM   475  C CZ  . PHE A 1 60  ? 12.370  -14.902 -16.856 1.00 24.21 ? 65  PHE A CZ  1 
HETATM 476  N N1  . CH6 A 1 61  ? 6.300   -13.404 -12.990 1.00 38.53 ? 66  CH6 A N1  1 
HETATM 477  C CE  . CH6 A 1 61  ? 4.892   -12.064 -16.557 1.00 41.10 ? 66  CH6 A CE  1 
HETATM 478  S SD  . CH6 A 1 61  ? 3.768   -13.396 -16.854 1.00 38.76 ? 66  CH6 A SD  1 
HETATM 479  C CG1 . CH6 A 1 61  ? 3.588   -14.087 -15.195 1.00 40.92 ? 66  CH6 A CG1 1 
HETATM 480  C CB1 . CH6 A 1 61  ? 4.922   -14.533 -14.603 1.00 40.69 ? 66  CH6 A CB1 1 
HETATM 481  C CA1 . CH6 A 1 61  ? 5.003   -14.033 -13.144 1.00 41.94 ? 66  CH6 A CA1 1 
HETATM 482  C C1  . CH6 A 1 61  ? 4.625   -15.123 -12.172 1.00 39.58 ? 66  CH6 A C1  1 
HETATM 483  N N2  . CH6 A 1 61  ? 3.789   -16.198 -12.500 1.00 36.41 ? 66  CH6 A N2  1 
HETATM 484  O OH  . CH6 A 1 61  ? 0.334   -21.975 -14.299 1.00 45.05 ? 66  CH6 A OH  1 
HETATM 485  C CD2 . CH6 A 1 61  ? 1.839   -20.311 -11.292 1.00 42.56 ? 66  CH6 A CD2 1 
HETATM 486  C CE2 . CH6 A 1 61  ? 1.141   -21.251 -12.067 1.00 45.05 ? 66  CH6 A CE2 1 
HETATM 487  C CZ  . CH6 A 1 61  ? 0.994   -21.076 -13.453 1.00 45.80 ? 66  CH6 A CZ  1 
HETATM 488  C CE1 . CH6 A 1 61  ? 1.543   -19.924 -13.976 1.00 42.00 ? 66  CH6 A CE1 1 
HETATM 489  C CD1 . CH6 A 1 61  ? 2.201   -18.964 -13.222 1.00 40.23 ? 66  CH6 A CD1 1 
HETATM 490  C CG2 . CH6 A 1 61  ? 2.356   -19.158 -11.860 1.00 44.02 ? 66  CH6 A CG2 1 
HETATM 491  C CB2 . CH6 A 1 61  ? 3.036   -18.184 -10.986 1.00 41.26 ? 66  CH6 A CB2 1 
HETATM 492  C CA2 . CH6 A 1 61  ? 3.698   -16.913 -11.347 1.00 41.49 ? 66  CH6 A CA2 1 
HETATM 493  C C2  . CH6 A 1 61  ? 4.459   -16.188 -10.336 1.00 38.53 ? 66  CH6 A C2  1 
HETATM 494  O O2  . CH6 A 1 61  ? 4.622   -16.585 -9.135  1.00 35.43 ? 66  CH6 A O2  1 
HETATM 495  N N3  . CH6 A 1 61  ? 5.013   -15.119 -10.837 1.00 35.98 ? 66  CH6 A N3  1 
HETATM 496  C CA3 . CH6 A 1 61  ? 5.930   -14.317 -9.989  1.00 34.86 ? 66  CH6 A CA3 1 
HETATM 497  C C3  . CH6 A 1 61  ? 5.887   -12.804 -9.914  1.00 33.31 ? 66  CH6 A C3  1 
HETATM 498  O O3  . CH6 A 1 61  ? 6.863   -12.208 -9.389  1.00 36.07 ? 66  CH6 A O3  1 
ATOM   499  N N   . SER A 1 62  ? 4.712   -12.541 -10.184 1.00 29.22 ? 69  SER A N   1 
ATOM   500  C CA  . SER A 1 62  ? 4.365   -11.128 -10.195 1.00 29.01 ? 69  SER A CA  1 
ATOM   501  C C   . SER A 1 62  ? 3.013   -11.045 -9.535  1.00 31.60 ? 69  SER A C   1 
ATOM   502  O O   . SER A 1 62  ? 1.944   -10.858 -10.145 1.00 26.22 ? 69  SER A O   1 
ATOM   503  C CB  . SER A 1 62  ? 4.356   -10.657 -11.655 1.00 29.16 ? 69  SER A CB  1 
ATOM   504  O OG  . SER A 1 62  ? 4.063   -9.293  -11.674 1.00 28.73 ? 69  SER A OG  1 
ATOM   505  N N   . LYS A 1 63  ? 3.092   -11.252 -8.232  1.00 29.18 ? 70  LYS A N   1 
ATOM   506  C CA  . LYS A 1 63  ? 1.914   -11.574 -7.417  1.00 31.67 ? 70  LYS A CA  1 
ATOM   507  C C   . LYS A 1 63  ? 1.132   -10.376 -6.957  1.00 27.35 ? 70  LYS A C   1 
ATOM   508  O O   . LYS A 1 63  ? 0.011   -10.517 -6.427  1.00 29.27 ? 70  LYS A O   1 
ATOM   509  C CB  . LYS A 1 63  ? 2.318   -12.455 -6.222  1.00 33.24 ? 70  LYS A CB  1 
ATOM   510  C CG  . LYS A 1 63  ? 2.724   -13.847 -6.650  1.00 36.41 ? 70  LYS A CG  1 
ATOM   511  C CD  . LYS A 1 63  ? 1.511   -14.649 -7.067  1.00 40.89 ? 70  LYS A CD  1 
ATOM   512  C CE  . LYS A 1 63  ? 1.883   -16.096 -7.301  1.00 41.51 ? 70  LYS A CE  1 
ATOM   513  N NZ  . LYS A 1 63  ? 0.787   -16.798 -7.988  1.00 46.84 ? 70  LYS A NZ  1 
ATOM   514  N N   . ALA A 1 64  ? 1.652   -9.186  -7.200  1.00 25.24 ? 71  ALA A N   1 
ATOM   515  C CA  . ALA A 1 64  ? 0.835   -8.008  -7.060  1.00 24.92 ? 71  ALA A CA  1 
ATOM   516  C C   . ALA A 1 64  ? -0.302  -7.884  -8.056  1.00 24.33 ? 71  ALA A C   1 
ATOM   517  O O   . ALA A 1 64  ? -1.203  -7.065  -7.819  1.00 25.36 ? 71  ALA A O   1 
ATOM   518  C CB  . ALA A 1 64  ? 1.686   -6.761  -7.169  1.00 27.58 ? 71  ALA A CB  1 
ATOM   519  N N   . TYR A 1 65  ? -0.268  -8.658  -9.135  1.00 22.68 ? 72  TYR A N   1 
ATOM   520  C CA  . TYR A 1 65  ? -1.310  -8.578  -10.222 1.00 24.34 ? 72  TYR A CA  1 
ATOM   521  C C   . TYR A 1 65  ? -2.290  -9.708  -10.186 1.00 24.28 ? 72  TYR A C   1 
ATOM   522  O O   . TYR A 1 65  ? -2.496  -10.460 -11.174 1.00 29.64 ? 72  TYR A O   1 
ATOM   523  C CB  . TYR A 1 65  ? -0.656  -8.556  -11.626 1.00 23.23 ? 72  TYR A CB  1 
ATOM   524  C CG  . TYR A 1 65  ? 0.255   -7.402  -11.931 1.00 23.08 ? 72  TYR A CG  1 
ATOM   525  C CD1 . TYR A 1 65  ? 1.562   -7.348  -11.470 1.00 22.53 ? 72  TYR A CD1 1 
ATOM   526  C CD2 . TYR A 1 65  ? -0.169  -6.376  -12.776 1.00 24.26 ? 72  TYR A CD2 1 
ATOM   527  C CE1 . TYR A 1 65  ? 2.390   -6.260  -11.744 1.00 23.78 ? 72  TYR A CE1 1 
ATOM   528  C CE2 . TYR A 1 65  ? 0.655   -5.335  -13.086 1.00 22.60 ? 72  TYR A CE2 1 
ATOM   529  C CZ  . TYR A 1 65  ? 1.908   -5.252  -12.566 1.00 23.00 ? 72  TYR A CZ  1 
ATOM   530  O OH  . TYR A 1 65  ? 2.697   -4.230  -12.886 1.00 22.94 ? 72  TYR A OH  1 
ATOM   531  N N   . VAL A 1 66  ? -2.737  -10.057 -8.986  1.00 22.55 ? 73  VAL A N   1 
ATOM   532  C CA  . VAL A 1 66  ? -3.741  -11.074 -8.858  1.00 22.19 ? 73  VAL A CA  1 
ATOM   533  C C   . VAL A 1 66  ? -5.040  -10.376 -8.420  1.00 22.69 ? 73  VAL A C   1 
ATOM   534  O O   . VAL A 1 66  ? -5.058  -9.603  -7.433  1.00 23.74 ? 73  VAL A O   1 
ATOM   535  C CB  . VAL A 1 66  ? -3.363  -12.064 -7.745  1.00 22.71 ? 73  VAL A CB  1 
ATOM   536  C CG1 . VAL A 1 66  ? -4.547  -12.992 -7.490  1.00 23.57 ? 73  VAL A CG1 1 
ATOM   537  C CG2 . VAL A 1 66  ? -2.071  -12.803 -8.099  1.00 22.52 ? 73  VAL A CG2 1 
ATOM   538  N N   . LYS A 1 67  ? -6.128  -10.653 -9.122  1.00 23.48 ? 74  LYS A N   1 
ATOM   539  C CA  . LYS A 1 67  ? -7.389  -10.011 -8.752  1.00 26.30 ? 74  LYS A CA  1 
ATOM   540  C C   . LYS A 1 67  ? -7.932  -10.683 -7.484  1.00 23.69 ? 74  LYS A C   1 
ATOM   541  O O   . LYS A 1 67  ? -8.080  -11.865 -7.497  1.00 24.80 ? 74  LYS A O   1 
ATOM   542  C CB  . LYS A 1 67  ? -8.375  -10.275 -9.854  1.00 27.14 ? 74  LYS A CB  1 
ATOM   543  C CG  . LYS A 1 67  ? -9.723  -9.668  -9.610  1.00 30.93 ? 74  LYS A CG  1 
ATOM   544  C CD  . LYS A 1 67  ? -10.676 -9.920  -10.763 1.00 31.05 ? 74  LYS A CD  1 
ATOM   545  C CE  . LYS A 1 67  ? -11.950 -9.135  -10.506 1.00 34.99 ? 74  LYS A CE  1 
ATOM   546  N NZ  . LYS A 1 67  ? -12.858 -9.205  -11.677 1.00 40.46 ? 74  LYS A NZ  1 
ATOM   547  N N   . HIS A 1 68  ? -8.251  -9.909  -6.451  1.00 25.28 ? 75  HIS A N   1 
ATOM   548  C CA  . HIS A 1 68  ? -8.853  -10.476 -5.248  1.00 26.70 ? 75  HIS A CA  1 
ATOM   549  C C   . HIS A 1 68  ? -10.247 -9.961  -4.956  1.00 27.17 ? 75  HIS A C   1 
ATOM   550  O O   . HIS A 1 68  ? -10.462 -8.750  -5.037  1.00 29.63 ? 75  HIS A O   1 
ATOM   551  C CB  . HIS A 1 68  ? -7.961  -10.122 -4.073  1.00 26.45 ? 75  HIS A CB  1 
ATOM   552  C CG  . HIS A 1 68  ? -6.747  -11.002 -3.937  1.00 25.61 ? 75  HIS A CG  1 
ATOM   553  N ND1 . HIS A 1 68  ? -5.625  -10.867 -4.723  1.00 24.71 ? 75  HIS A ND1 1 
ATOM   554  C CD2 . HIS A 1 68  ? -6.457  -11.992 -3.060  1.00 27.98 ? 75  HIS A CD2 1 
ATOM   555  C CE1 . HIS A 1 68  ? -4.707  -11.739 -4.354  1.00 23.44 ? 75  HIS A CE1 1 
ATOM   556  N NE2 . HIS A 1 68  ? -5.191  -12.435 -3.341  1.00 25.20 ? 75  HIS A NE2 1 
ATOM   557  N N   . PRO A 1 69  ? -11.174 -10.865 -4.559  1.00 28.97 ? 76  PRO A N   1 
ATOM   558  C CA  . PRO A 1 69  ? -12.415 -10.400 -3.960  1.00 31.25 ? 76  PRO A CA  1 
ATOM   559  C C   . PRO A 1 69  ? -12.139 -9.462  -2.782  1.00 31.38 ? 76  PRO A C   1 
ATOM   560  O O   . PRO A 1 69  ? -11.102 -9.555  -2.082  1.00 32.46 ? 76  PRO A O   1 
ATOM   561  C CB  . PRO A 1 69  ? -13.107 -11.713 -3.505  1.00 33.20 ? 76  PRO A CB  1 
ATOM   562  C CG  . PRO A 1 69  ? -12.433 -12.803 -4.263  1.00 30.30 ? 76  PRO A CG  1 
ATOM   563  C CD  . PRO A 1 69  ? -11.042 -12.325 -4.455  1.00 27.98 ? 76  PRO A CD  1 
ATOM   564  N N   . ALA A 1 70  ? -13.041 -8.527  -2.572  1.00 33.00 ? 77  ALA A N   1 
ATOM   565  C CA  . ALA A 1 70  ? -12.880 -7.528  -1.525  1.00 34.70 ? 77  ALA A CA  1 
ATOM   566  C C   . ALA A 1 70  ? -12.679 -8.144  -0.133  1.00 32.84 ? 77  ALA A C   1 
ATOM   567  O O   . ALA A 1 70  ? -12.032 -7.542  0.711   1.00 34.75 ? 77  ALA A O   1 
ATOM   568  C CB  . ALA A 1 70  ? -14.093 -6.617  -1.496  1.00 38.41 ? 77  ALA A CB  1 
ATOM   569  N N   . ASP A 1 71  ? -13.252 -9.307  0.100   1.00 31.96 ? 78  ASP A N   1 
ATOM   570  C CA  . ASP A 1 71  ? -13.186 -9.933  1.422   1.00 32.48 ? 78  ASP A CA  1 
ATOM   571  C C   . ASP A 1 71  ? -12.053 -10.949 1.584   1.00 31.45 ? 78  ASP A C   1 
ATOM   572  O O   . ASP A 1 71  ? -12.065 -11.740 2.511   1.00 30.21 ? 78  ASP A O   1 
ATOM   573  C CB  . ASP A 1 71  ? -14.524 -10.552 1.822   1.00 34.54 ? 78  ASP A CB  1 
ATOM   574  C CG  . ASP A 1 71  ? -15.152 -11.421 0.756   1.00 39.26 ? 78  ASP A CG  1 
ATOM   575  O OD1 . ASP A 1 71  ? -14.809 -11.347 -0.449  1.00 37.22 ? 78  ASP A OD1 1 
ATOM   576  O OD2 . ASP A 1 71  ? -16.093 -12.163 1.125   1.00 46.24 ? 78  ASP A OD2 1 
ATOM   577  N N   . ILE A 1 72  ? -11.095 -10.975 0.670   1.00 28.21 ? 79  ILE A N   1 
ATOM   578  C CA  . ILE A 1 72  ? -9.878  -11.825 0.827   1.00 25.23 ? 79  ILE A CA  1 
ATOM   579  C C   . ILE A 1 72  ? -8.749  -10.798 0.896   1.00 26.74 ? 79  ILE A C   1 
ATOM   580  O O   . ILE A 1 72  ? -8.492  -10.052 -0.110  1.00 25.19 ? 79  ILE A O   1 
ATOM   581  C CB  . ILE A 1 72  ? -9.596  -12.787 -0.339  1.00 24.96 ? 79  ILE A CB  1 
ATOM   582  C CG1 . ILE A 1 72  ? -10.739 -13.793 -0.580  1.00 26.64 ? 79  ILE A CG1 1 
ATOM   583  C CG2 . ILE A 1 72  ? -8.259  -13.548 -0.098  1.00 24.04 ? 79  ILE A CG2 1 
ATOM   584  C CD1 . ILE A 1 72  ? -10.469 -14.921 -1.537  1.00 26.88 ? 79  ILE A CD1 1 
ATOM   585  N N   . PRO A 1 73  ? -8.097  -10.653 2.064   1.00 24.96 ? 80  PRO A N   1 
ATOM   586  C CA  . PRO A 1 73  ? -7.048  -9.688  2.180   1.00 23.36 ? 80  PRO A CA  1 
ATOM   587  C C   . PRO A 1 73  ? -5.936  -9.993  1.122   1.00 22.67 ? 80  PRO A C   1 
ATOM   588  O O   . PRO A 1 73  ? -5.548  -11.127 0.944   1.00 23.45 ? 80  PRO A O   1 
ATOM   589  C CB  . PRO A 1 73  ? -6.530  -9.854  3.584   1.00 26.74 ? 80  PRO A CB  1 
ATOM   590  C CG  . PRO A 1 73  ? -7.671  -10.525 4.330   1.00 25.53 ? 80  PRO A CG  1 
ATOM   591  C CD  . PRO A 1 73  ? -8.332  -11.378 3.336   1.00 26.90 ? 80  PRO A CD  1 
ATOM   592  N N   . ASP A 1 74  ? -5.601  -8.945  0.381   1.00 24.21 ? 81  ASP A N   1 
ATOM   593  C CA  . ASP A 1 74  ? -4.609  -8.971  -0.651  1.00 23.95 ? 81  ASP A CA  1 
ATOM   594  C C   . ASP A 1 74  ? -3.278  -8.637  -0.058  1.00 22.07 ? 81  ASP A C   1 
ATOM   595  O O   . ASP A 1 74  ? -2.762  -7.546  -0.246  1.00 25.74 ? 81  ASP A O   1 
ATOM   596  C CB  . ASP A 1 74  ? -4.922  -7.942  -1.755  1.00 24.57 ? 81  ASP A CB  1 
ATOM   597  C CG  . ASP A 1 74  ? -4.253  -8.257  -3.039  1.00 26.78 ? 81  ASP A CG  1 
ATOM   598  O OD1 . ASP A 1 74  ? -3.182  -8.957  -3.072  1.00 26.05 ? 81  ASP A OD1 1 
ATOM   599  O OD2 . ASP A 1 74  ? -4.877  -7.827  -4.063  1.00 25.44 ? 81  ASP A OD2 1 
ATOM   600  N N   . TYR A 1 75  ? -2.734  -9.627  0.642   1.00 21.05 ? 82  TYR A N   1 
ATOM   601  C CA  . TYR A 1 75  ? -1.535  -9.485  1.422   1.00 21.96 ? 82  TYR A CA  1 
ATOM   602  C C   . TYR A 1 75  ? -0.354  -8.923  0.598   1.00 21.68 ? 82  TYR A C   1 
ATOM   603  O O   . TYR A 1 75  ? 0.324   -8.050  1.045   1.00 22.29 ? 82  TYR A O   1 
ATOM   604  C CB  . TYR A 1 75  ? -1.262  -10.850 2.144   1.00 21.59 ? 82  TYR A CB  1 
ATOM   605  C CG  . TYR A 1 75  ? 0.064   -11.064 2.821   1.00 20.18 ? 82  TYR A CG  1 
ATOM   606  C CD1 . TYR A 1 75  ? 0.274   -10.608 4.093   1.00 21.00 ? 82  TYR A CD1 1 
ATOM   607  C CD2 . TYR A 1 75  ? 1.090   -11.784 2.207   1.00 20.57 ? 82  TYR A CD2 1 
ATOM   608  C CE1 . TYR A 1 75  ? 1.473   -10.815 4.713   1.00 21.37 ? 82  TYR A CE1 1 
ATOM   609  C CE2 . TYR A 1 75  ? 2.278   -12.051 2.856   1.00 21.18 ? 82  TYR A CE2 1 
ATOM   610  C CZ  . TYR A 1 75  ? 2.431   -11.546 4.158   1.00 21.36 ? 82  TYR A CZ  1 
ATOM   611  O OH  . TYR A 1 75  ? 3.590   -11.741 4.851   1.00 20.85 ? 82  TYR A OH  1 
ATOM   612  N N   . LEU A 1 76  ? -0.204  -9.372  -0.629  1.00 21.43 ? 83  LEU A N   1 
ATOM   613  C CA  . LEU A 1 76  ? 0.930   -8.990  -1.458  1.00 22.57 ? 83  LEU A CA  1 
ATOM   614  C C   . LEU A 1 76  ? 0.794   -7.513  -1.935  1.00 21.58 ? 83  LEU A C   1 
ATOM   615  O O   . LEU A 1 76  ? 1.773   -6.772  -1.914  1.00 23.71 ? 83  LEU A O   1 
ATOM   616  C CB  . LEU A 1 76  ? 1.204   -10.032 -2.541  1.00 23.63 ? 83  LEU A CB  1 
ATOM   617  C CG  . LEU A 1 76  ? 1.628   -11.374 -1.866  1.00 25.22 ? 83  LEU A CG  1 
ATOM   618  C CD1 . LEU A 1 76  ? 2.073   -12.329 -2.899  1.00 27.54 ? 83  LEU A CD1 1 
ATOM   619  C CD2 . LEU A 1 76  ? 2.751   -11.168 -0.855  1.00 25.96 ? 83  LEU A CD2 1 
ATOM   620  N N   . LYS A 1 77  ? -0.411  -7.082  -2.267  1.00 22.79 ? 84  LYS A N   1 
ATOM   621  C CA  . LYS A 1 77  ? -0.651  -5.618  -2.546  1.00 23.26 ? 84  LYS A CA  1 
ATOM   622  C C   . LYS A 1 77  ? -0.439  -4.778  -1.301  1.00 22.40 ? 84  LYS A C   1 
ATOM   623  O O   . LYS A 1 77  ? 0.240   -3.780  -1.358  1.00 24.03 ? 84  LYS A O   1 
ATOM   624  C CB  . LYS A 1 77  ? -2.035  -5.365  -3.094  1.00 24.12 ? 84  LYS A CB  1 
ATOM   625  C CG  . LYS A 1 77  ? -2.196  -5.804  -4.525  1.00 23.27 ? 84  LYS A CG  1 
ATOM   626  C CD  . LYS A 1 77  ? -3.468  -5.205  -5.077  1.00 23.45 ? 84  LYS A CD  1 
ATOM   627  C CE  . LYS A 1 77  ? -3.652  -5.606  -6.515  1.00 24.08 ? 84  LYS A CE  1 
ATOM   628  N NZ  . LYS A 1 77  ? -3.910  -7.054  -6.730  1.00 23.44 ? 84  LYS A NZ  1 
ATOM   629  N N   . LEU A 1 78  ? -0.942  -5.213  -0.132  1.00 21.99 ? 85  LEU A N   1 
ATOM   630  C CA  . LEU A 1 78  ? -0.758  -4.509  1.124   1.00 25.47 ? 85  LEU A CA  1 
ATOM   631  C C   . LEU A 1 78  ? 0.670   -4.304  1.568   1.00 24.38 ? 85  LEU A C   1 
ATOM   632  O O   . LEU A 1 78  ? 0.923   -3.405  2.327   1.00 26.14 ? 85  LEU A O   1 
ATOM   633  C CB  . LEU A 1 78  ? -1.503  -5.237  2.284   1.00 26.17 ? 85  LEU A CB  1 
ATOM   634  C CG  . LEU A 1 78  ? -3.039  -5.276  2.155   1.00 28.67 ? 85  LEU A CG  1 
ATOM   635  C CD1 . LEU A 1 78  ? -3.639  -6.279  3.134   1.00 28.75 ? 85  LEU A CD1 1 
ATOM   636  C CD2 . LEU A 1 78  ? -3.686  -3.920  2.374   1.00 31.07 ? 85  LEU A CD2 1 
ATOM   637  N N   . SER A 1 79  ? 1.587   -5.119  1.119   1.00 23.52 ? 86  SER A N   1 
ATOM   638  C CA  . SER A 1 79  ? 2.958   -5.119  1.551   1.00 22.90 ? 86  SER A CA  1 
ATOM   639  C C   . SER A 1 79  ? 3.713   -3.866  1.008   1.00 23.61 ? 86  SER A C   1 
ATOM   640  O O   . SER A 1 79  ? 4.865   -3.620  1.370   1.00 24.26 ? 86  SER A O   1 
ATOM   641  C CB  . SER A 1 79  ? 3.638   -6.401  1.016   1.00 22.50 ? 86  SER A CB  1 
ATOM   642  O OG  . SER A 1 79  ? 3.987   -6.305  -0.358  1.00 24.86 ? 86  SER A OG  1 
ATOM   643  N N   . PHE A 1 80  ? 3.096   -3.186  0.069   1.00 25.37 ? 87  PHE A N   1 
ATOM   644  C CA  . PHE A 1 80  ? 3.802   -2.053  -0.622  1.00 27.17 ? 87  PHE A CA  1 
ATOM   645  C C   . PHE A 1 80  ? 3.493   -0.786  0.140   1.00 30.19 ? 87  PHE A C   1 
ATOM   646  O O   . PHE A 1 80  ? 2.397   -0.664  0.655   1.00 32.70 ? 87  PHE A O   1 
ATOM   647  C CB  . PHE A 1 80  ? 3.367   -1.992  -2.077  1.00 27.51 ? 87  PHE A CB  1 
ATOM   648  C CG  . PHE A 1 80  ? 3.976   -3.057  -2.914  1.00 25.43 ? 87  PHE A CG  1 
ATOM   649  C CD1 . PHE A 1 80  ? 5.315   -2.996  -3.324  1.00 25.95 ? 87  PHE A CD1 1 
ATOM   650  C CD2 . PHE A 1 80  ? 3.255   -4.225  -3.220  1.00 25.50 ? 87  PHE A CD2 1 
ATOM   651  C CE1 . PHE A 1 80  ? 5.881   -4.028  -4.065  1.00 26.02 ? 87  PHE A CE1 1 
ATOM   652  C CE2 . PHE A 1 80  ? 3.813   -5.241  -3.922  1.00 23.94 ? 87  PHE A CE2 1 
ATOM   653  C CZ  . PHE A 1 80  ? 5.128   -5.144  -4.414  1.00 24.53 ? 87  PHE A CZ  1 
ATOM   654  N N   . PRO A 1 81  ? 4.418   0.173   0.146   1.00 34.38 ? 88  PRO A N   1 
ATOM   655  C CA  . PRO A 1 81  ? 5.538   0.235   -0.840  1.00 33.49 ? 88  PRO A CA  1 
ATOM   656  C C   . PRO A 1 81  ? 6.788   -0.619  -0.656  1.00 30.70 ? 88  PRO A C   1 
ATOM   657  O O   . PRO A 1 81  ? 7.520   -0.851  -1.638  1.00 35.11 ? 88  PRO A O   1 
ATOM   658  C CB  . PRO A 1 81  ? 5.978   1.712   -0.731  1.00 33.77 ? 88  PRO A CB  1 
ATOM   659  C CG  . PRO A 1 81  ? 5.667   2.075   0.684   1.00 34.37 ? 88  PRO A CG  1 
ATOM   660  C CD  . PRO A 1 81  ? 4.295   1.455   0.880   1.00 37.54 ? 88  PRO A CD  1 
ATOM   661  N N   . GLU A 1 82  ? 7.066   -1.025  0.566   1.00 29.98 ? 89  GLU A N   1 
ATOM   662  C CA  . GLU A 1 82  ? 8.292   -1.738  0.897   1.00 30.15 ? 89  GLU A CA  1 
ATOM   663  C C   . GLU A 1 82  ? 8.425   -3.022  0.073   1.00 28.53 ? 89  GLU A C   1 
ATOM   664  O O   . GLU A 1 82  ? 9.458   -3.303  -0.543  1.00 27.18 ? 89  GLU A O   1 
ATOM   665  C CB  . GLU A 1 82  ? 8.300   -2.112  2.357   1.00 32.11 ? 89  GLU A CB  1 
ATOM   666  C CG  . GLU A 1 82  ? 8.241   -0.959  3.313   1.00 39.07 ? 89  GLU A CG  1 
ATOM   667  C CD  . GLU A 1 82  ? 6.890   -0.188  3.351   1.00 45.13 ? 89  GLU A CD  1 
ATOM   668  O OE1 . GLU A 1 82  ? 5.784   -0.730  3.029   1.00 41.07 ? 89  GLU A OE1 1 
ATOM   669  O OE2 . GLU A 1 82  ? 6.938   1.001   3.746   1.00 49.08 ? 89  GLU A OE2 1 
ATOM   670  N N   . GLY A 1 83  ? 7.350   -3.789  0.054   1.00 26.08 ? 90  GLY A N   1 
ATOM   671  C CA  . GLY A 1 83  ? 7.306   -4.976  -0.777  1.00 22.90 ? 90  GLY A CA  1 
ATOM   672  C C   . GLY A 1 83  ? 7.318   -6.287  -0.036  1.00 23.24 ? 90  GLY A C   1 
ATOM   673  O O   . GLY A 1 83  ? 6.980   -6.373  1.147   1.00 21.22 ? 90  GLY A O   1 
ATOM   674  N N   . PHE A 1 84  ? 7.815   -7.291  -0.737  1.00 21.49 ? 91  PHE A N   1 
ATOM   675  C CA  . PHE A 1 84  ? 7.822   -8.652  -0.207  1.00 21.21 ? 91  PHE A CA  1 
ATOM   676  C C   . PHE A 1 84  ? 8.904   -9.468  -0.872  1.00 20.72 ? 91  PHE A C   1 
ATOM   677  O O   . PHE A 1 84  ? 9.522   -9.037  -1.847  1.00 21.85 ? 91  PHE A O   1 
ATOM   678  C CB  . PHE A 1 84  ? 6.428   -9.278  -0.375  1.00 21.41 ? 91  PHE A CB  1 
ATOM   679  C CG  . PHE A 1 84  ? 6.033   -9.544  -1.798  1.00 20.91 ? 91  PHE A CG  1 
ATOM   680  C CD1 . PHE A 1 84  ? 5.440   -8.549  -2.570  1.00 23.03 ? 91  PHE A CD1 1 
ATOM   681  C CD2 . PHE A 1 84  ? 6.149   -10.781 -2.337  1.00 23.30 ? 91  PHE A CD2 1 
ATOM   682  C CE1 . PHE A 1 84  ? 5.006   -8.791  -3.859  1.00 21.12 ? 91  PHE A CE1 1 
ATOM   683  C CE2 . PHE A 1 84  ? 5.767   -10.985 -3.675  1.00 23.15 ? 91  PHE A CE2 1 
ATOM   684  C CZ  . PHE A 1 84  ? 5.195   -9.991  -4.403  1.00 21.42 ? 91  PHE A CZ  1 
ATOM   685  N N   . LYS A 1 85  ? 9.129   -10.657 -0.334  1.00 19.47 ? 92  LYS A N   1 
ATOM   686  C CA  . LYS A 1 85  ? 10.055  -11.588 -0.889  1.00 19.74 ? 92  LYS A CA  1 
ATOM   687  C C   . LYS A 1 85  ? 9.328   -12.913 -1.056  1.00 20.26 ? 92  LYS A C   1 
ATOM   688  O O   . LYS A 1 85  ? 8.371   -13.215 -0.324  1.00 19.48 ? 92  LYS A O   1 
ATOM   689  C CB  . LYS A 1 85  ? 11.221  -11.830 0.030   1.00 22.41 ? 92  LYS A CB  1 
ATOM   690  C CG  . LYS A 1 85  ? 12.192  -10.640 0.123   1.00 28.67 ? 92  LYS A CG  1 
ATOM   691  C CD  . LYS A 1 85  ? 13.268  -11.053 1.119   1.00 32.01 ? 92  LYS A CD  1 
ATOM   692  C CE  . LYS A 1 85  ? 13.719  -9.969  2.019   1.00 38.68 ? 92  LYS A CE  1 
ATOM   693  N NZ  . LYS A 1 85  ? 14.266  -8.853  1.210   1.00 42.42 ? 92  LYS A NZ  1 
ATOM   694  N N   . TRP A 1 86  ? 9.866   -13.730 -1.918  1.00 19.12 ? 93  TRP A N   1 
ATOM   695  C CA  . TRP A 1 86  ? 9.392   -15.111 -1.977  1.00 18.45 ? 93  TRP A CA  1 
ATOM   696  C C   . TRP A 1 86  ? 10.476  -16.105 -2.249  1.00 19.65 ? 93  TRP A C   1 
ATOM   697  O O   . TRP A 1 86  ? 11.570  -15.788 -2.746  1.00 18.33 ? 93  TRP A O   1 
ATOM   698  C CB  . TRP A 1 86  ? 8.188   -15.286 -2.925  1.00 19.64 ? 93  TRP A CB  1 
ATOM   699  C CG  . TRP A 1 86  ? 8.280   -14.881 -4.386  1.00 20.88 ? 93  TRP A CG  1 
ATOM   700  C CD1 . TRP A 1 86  ? 7.845   -13.717 -4.944  1.00 22.37 ? 93  TRP A CD1 1 
ATOM   701  C CD2 . TRP A 1 86  ? 8.717   -15.685 -5.485  1.00 19.18 ? 93  TRP A CD2 1 
ATOM   702  N NE1 . TRP A 1 86  ? 8.040   -13.721 -6.276  1.00 22.91 ? 93  TRP A NE1 1 
ATOM   703  C CE2 . TRP A 1 86  ? 8.598   -14.897 -6.645  1.00 21.46 ? 93  TRP A CE2 1 
ATOM   704  C CE3 . TRP A 1 86  ? 9.324   -16.933 -5.588  1.00 19.54 ? 93  TRP A CE3 1 
ATOM   705  C CZ2 . TRP A 1 86  ? 8.930   -15.368 -7.930  1.00 19.55 ? 93  TRP A CZ2 1 
ATOM   706  C CZ3 . TRP A 1 86  ? 9.666   -17.399 -6.834  1.00 19.77 ? 93  TRP A CZ3 1 
ATOM   707  C CH2 . TRP A 1 86  ? 9.472   -16.576 -8.025  1.00 19.48 ? 93  TRP A CH2 1 
ATOM   708  N N   . GLU A 1 87  ? 10.200  -17.356 -1.861  1.00 18.12 ? 94  GLU A N   1 
ATOM   709  C CA  . GLU A 1 87  ? 11.105  -18.417 -1.991  1.00 19.11 ? 94  GLU A CA  1 
ATOM   710  C C   . GLU A 1 87  ? 10.323  -19.621 -2.463  1.00 17.87 ? 94  GLU A C   1 
ATOM   711  O O   . GLU A 1 87  ? 9.296   -19.990 -1.840  1.00 17.89 ? 94  GLU A O   1 
ATOM   712  C CB  . GLU A 1 87  ? 11.698  -18.721 -0.634  1.00 24.31 ? 94  GLU A CB  1 
ATOM   713  C CG  . GLU A 1 87  ? 12.892  -19.599 -0.587  1.00 32.38 ? 94  GLU A CG  1 
ATOM   714  C CD  . GLU A 1 87  ? 13.684  -19.342 0.745   1.00 39.86 ? 94  GLU A CD  1 
ATOM   715  O OE1 . GLU A 1 87  ? 13.057  -18.950 1.760   1.00 43.28 ? 94  GLU A OE1 1 
ATOM   716  O OE2 . GLU A 1 87  ? 14.935  -19.453 0.750   1.00 48.87 ? 94  GLU A OE2 1 
ATOM   717  N N   . ARG A 1 88  ? 10.822  -20.285 -3.496  1.00 16.18 ? 95  ARG A N   1 
ATOM   718  C CA  . ARG A 1 88  ? 10.070  -21.384 -4.164  1.00 14.97 ? 95  ARG A CA  1 
ATOM   719  C C   . ARG A 1 88  ? 10.920  -22.625 -4.394  1.00 15.33 ? 95  ARG A C   1 
ATOM   720  O O   . ARG A 1 88  ? 12.138  -22.475 -4.677  1.00 15.88 ? 95  ARG A O   1 
ATOM   721  C CB  . ARG A 1 88  ? 9.588   -20.849 -5.543  1.00 15.30 ? 95  ARG A CB  1 
ATOM   722  C CG  . ARG A 1 88  ? 8.857   -21.826 -6.420  1.00 15.32 ? 95  ARG A CG  1 
ATOM   723  C CD  . ARG A 1 88  ? 8.233   -21.124 -7.671  1.00 16.45 ? 95  ARG A CD  1 
ATOM   724  N NE  . ARG A 1 88  ? 7.138   -20.255 -7.306  1.00 19.30 ? 95  ARG A NE  1 
ATOM   725  C CZ  . ARG A 1 88  ? 6.587   -19.278 -8.042  1.00 20.60 ? 95  ARG A CZ  1 
ATOM   726  N NH1 . ARG A 1 88  ? 7.081   -18.981 -9.261  1.00 19.74 ? 95  ARG A NH1 1 
ATOM   727  N NH2 . ARG A 1 88  ? 5.566   -18.588 -7.575  1.00 22.21 ? 95  ARG A NH2 1 
ATOM   728  N N   . VAL A 1 89  ? 10.317  -23.804 -4.237  1.00 14.21 ? 96  VAL A N   1 
ATOM   729  C CA  . VAL A 1 89  ? 10.888  -25.060 -4.623  1.00 15.03 ? 96  VAL A CA  1 
ATOM   730  C C   . VAL A 1 89  ? 9.972   -25.757 -5.600  1.00 15.15 ? 96  VAL A C   1 
ATOM   731  O O   . VAL A 1 89  ? 8.794   -25.830 -5.346  1.00 15.31 ? 96  VAL A O   1 
ATOM   732  C CB  . VAL A 1 89  ? 11.110  -25.961 -3.378  1.00 16.76 ? 96  VAL A CB  1 
ATOM   733  C CG1 . VAL A 1 89  ? 11.674  -27.316 -3.770  1.00 18.70 ? 96  VAL A CG1 1 
ATOM   734  C CG2 . VAL A 1 89  ? 12.042  -25.241 -2.454  1.00 18.97 ? 96  VAL A CG2 1 
ATOM   735  N N   . MET A 1 90  ? 10.508  -26.209 -6.718  1.00 16.18 ? 97  MET A N   1 
ATOM   736  C CA  . MET A 1 90  ? 9.774   -27.014 -7.725  1.00 15.88 ? 97  MET A CA  1 
ATOM   737  C C   . MET A 1 90  ? 10.427  -28.378 -7.852  1.00 16.39 ? 97  MET A C   1 
ATOM   738  O O   . MET A 1 90  ? 11.638  -28.492 -8.145  1.00 17.12 ? 97  MET A O   1 
ATOM   739  C CB  . MET A 1 90  ? 9.812   -26.284 -9.110  1.00 17.38 ? 97  MET A CB  1 
ATOM   740  C CG  . MET A 1 90  ? 9.449   -24.818 -9.011  1.00 19.27 ? 97  MET A CG  1 
ATOM   741  S SD  . MET A 1 90  ? 9.691   -24.058 -10.648 1.00 26.31 ? 97  MET A SD  1 
ATOM   742  C CE  . MET A 1 90  ? 8.339   -24.854 -11.457 1.00 28.81 ? 97  MET A CE  1 
ATOM   743  N N   . ASN A 1 91  ? 9.642   -29.428 -7.561  1.00 15.53 ? 98  ASN A N   1 
ATOM   744  C CA  . ASN A 1 91  ? 10.130  -30.753 -7.736  1.00 15.52 ? 98  ASN A CA  1 
ATOM   745  C C   . ASN A 1 91  ? 9.459   -31.371 -8.941  1.00 16.00 ? 98  ASN A C   1 
ATOM   746  O O   . ASN A 1 91  ? 8.275   -31.682 -8.926  1.00 17.52 ? 98  ASN A O   1 
ATOM   747  C CB  . ASN A 1 91  ? 9.845   -31.653 -6.530  1.00 16.22 ? 98  ASN A CB  1 
ATOM   748  C CG  . ASN A 1 91  ? 10.931  -31.533 -5.479  1.00 17.52 ? 98  ASN A CG  1 
ATOM   749  O OD1 . ASN A 1 91  ? 12.084  -31.680 -5.796  1.00 17.12 ? 98  ASN A OD1 1 
ATOM   750  N ND2 . ASN A 1 91  ? 10.529  -31.391 -4.211  1.00 18.50 ? 98  ASN A ND2 1 
ATOM   751  N N   . PHE A 1 92  ? 10.246  -31.526 -9.979  1.00 17.38 ? 99  PHE A N   1 
ATOM   752  C CA  . PHE A 1 92  ? 9.711   -32.122 -11.185 1.00 17.59 ? 99  PHE A CA  1 
ATOM   753  C C   . PHE A 1 92  ? 9.650   -33.661 -11.117 1.00 19.91 ? 99  PHE A C   1 
ATOM   754  O O   . PHE A 1 92  ? 10.478  -34.318 -10.441 1.00 19.91 ? 99  PHE A O   1 
ATOM   755  C CB  . PHE A 1 92  ? 10.580  -31.670 -12.352 1.00 18.39 ? 99  PHE A CB  1 
ATOM   756  C CG  . PHE A 1 92  ? 10.413  -30.211 -12.655 1.00 18.06 ? 99  PHE A CG  1 
ATOM   757  C CD1 . PHE A 1 92  ? 11.156  -29.245 -11.991 1.00 17.73 ? 99  PHE A CD1 1 
ATOM   758  C CD2 . PHE A 1 92  ? 9.530   -29.802 -13.683 1.00 18.68 ? 99  PHE A CD2 1 
ATOM   759  C CE1 . PHE A 1 92  ? 10.984  -27.865 -12.270 1.00 18.65 ? 99  PHE A CE1 1 
ATOM   760  C CE2 . PHE A 1 92  ? 9.360   -28.447 -13.932 1.00 19.95 ? 99  PHE A CE2 1 
ATOM   761  C CZ  . PHE A 1 92  ? 10.084  -27.493 -13.243 1.00 20.19 ? 99  PHE A CZ  1 
ATOM   762  N N   . GLU A 1 93  ? 8.720   -34.258 -11.886 1.00 20.20 ? 100 GLU A N   1 
ATOM   763  C CA  . GLU A 1 93  ? 8.483   -35.706 -11.795 1.00 22.37 ? 100 GLU A CA  1 
ATOM   764  C C   . GLU A 1 93  ? 9.655   -36.614 -12.139 1.00 21.02 ? 100 GLU A C   1 
ATOM   765  O O   . GLU A 1 93  ? 9.709   -37.748 -11.629 1.00 22.53 ? 100 GLU A O   1 
ATOM   766  C CB  . GLU A 1 93  ? 7.301   -36.126 -12.648 1.00 24.30 ? 100 GLU A CB  1 
ATOM   767  C CG  . GLU A 1 93  ? 7.570   -35.981 -14.115 1.00 25.64 ? 100 GLU A CG  1 
ATOM   768  C CD  . GLU A 1 93  ? 6.465   -36.533 -15.014 1.00 29.93 ? 100 GLU A CD  1 
ATOM   769  O OE1 . GLU A 1 93  ? 5.342   -36.042 -14.978 1.00 27.99 ? 100 GLU A OE1 1 
ATOM   770  O OE2 . GLU A 1 93  ? 6.769   -37.499 -15.771 1.00 36.55 ? 100 GLU A OE2 1 
ATOM   771  N N   . ASP A 1 94  ? 10.609  -36.136 -12.923 1.00 20.68 ? 101 ASP A N   1 
ATOM   772  C CA  . ASP A 1 94  ? 11.796  -36.918 -13.301 1.00 22.28 ? 101 ASP A CA  1 
ATOM   773  C C   . ASP A 1 94  ? 13.077  -36.576 -12.523 1.00 21.90 ? 101 ASP A C   1 
ATOM   774  O O   . ASP A 1 94  ? 14.204  -37.006 -12.869 1.00 21.63 ? 101 ASP A O   1 
ATOM   775  C CB  . ASP A 1 94  ? 12.092  -36.789 -14.794 1.00 22.69 ? 101 ASP A CB  1 
ATOM   776  C CG  . ASP A 1 94  ? 12.434  -35.355 -15.214 1.00 23.86 ? 101 ASP A CG  1 
ATOM   777  O OD1 . ASP A 1 94  ? 12.305  -34.392 -14.404 1.00 22.36 ? 101 ASP A OD1 1 
ATOM   778  O OD2 . ASP A 1 94  ? 12.849  -35.244 -16.382 1.00 22.83 ? 101 ASP A OD2 1 
ATOM   779  N N   . GLY A 1 95  ? 12.894  -35.862 -11.436 1.00 21.80 ? 102 GLY A N   1 
ATOM   780  C CA  . GLY A 1 95  ? 13.989  -35.575 -10.510 1.00 22.36 ? 102 GLY A CA  1 
ATOM   781  C C   . GLY A 1 95  ? 14.658  -34.234 -10.692 1.00 20.47 ? 102 GLY A C   1 
ATOM   782  O O   . GLY A 1 95  ? 15.441  -33.775 -9.839  1.00 19.70 ? 102 GLY A O   1 
ATOM   783  N N   . GLY A 1 96  ? 14.249  -33.468 -11.729 1.00 17.28 ? 103 GLY A N   1 
ATOM   784  C CA  . GLY A 1 96  ? 14.769  -32.131 -11.789 1.00 16.89 ? 103 GLY A CA  1 
ATOM   785  C C   . GLY A 1 96  ? 14.225  -31.276 -10.662 1.00 15.01 ? 103 GLY A C   1 
ATOM   786  O O   . GLY A 1 96  ? 13.149  -31.506 -10.152 1.00 16.20 ? 103 GLY A O   1 
ATOM   787  N N   . VAL A 1 97  ? 15.003  -30.336 -10.231 1.00 15.96 ? 104 VAL A N   1 
ATOM   788  C CA  . VAL A 1 97  ? 14.667  -29.409 -9.106  1.00 15.09 ? 104 VAL A CA  1 
ATOM   789  C C   . VAL A 1 97  ? 14.990  -27.967 -9.503  1.00 16.56 ? 104 VAL A C   1 
ATOM   790  O O   . VAL A 1 97  ? 16.076  -27.711 -10.050 1.00 16.73 ? 104 VAL A O   1 
ATOM   791  C CB  . VAL A 1 97  ? 15.513  -29.803 -7.867  1.00 16.42 ? 104 VAL A CB  1 
ATOM   792  C CG1 . VAL A 1 97  ? 15.301  -28.784 -6.716  1.00 16.80 ? 104 VAL A CG1 1 
ATOM   793  C CG2 . VAL A 1 97  ? 15.212  -31.232 -7.475  1.00 17.56 ? 104 VAL A CG2 1 
ATOM   794  N N   . VAL A 1 98  ? 14.081  -27.046 -9.254  1.00 15.26 ? 105 VAL A N   1 
ATOM   795  C CA  . VAL A 1 98  ? 14.352  -25.645 -9.336  1.00 15.95 ? 105 VAL A CA  1 
ATOM   796  C C   . VAL A 1 98  ? 14.098  -24.973 -7.980  1.00 16.21 ? 105 VAL A C   1 
ATOM   797  O O   . VAL A 1 98  ? 13.040  -25.155 -7.394  1.00 16.97 ? 105 VAL A O   1 
ATOM   798  C CB  . VAL A 1 98  ? 13.494  -24.993 -10.363 1.00 16.18 ? 105 VAL A CB  1 
ATOM   799  C CG1 . VAL A 1 98  ? 13.675  -23.460 -10.358 1.00 18.49 ? 105 VAL A CG1 1 
ATOM   800  C CG2 . VAL A 1 98  ? 13.878  -25.590 -11.714 1.00 16.78 ? 105 VAL A CG2 1 
ATOM   801  N N   . THR A 1 99  ? 15.042  -24.188 -7.515  1.00 16.21 ? 106 THR A N   1 
ATOM   802  C CA  . THR A 1 99  ? 14.790  -23.350 -6.364  1.00 17.30 ? 106 THR A CA  1 
ATOM   803  C C   . THR A 1 99  ? 14.941  -21.887 -6.790  1.00 17.39 ? 106 THR A C   1 
ATOM   804  O O   . THR A 1 99  ? 15.763  -21.573 -7.689  1.00 16.47 ? 106 THR A O   1 
ATOM   805  C CB  . THR A 1 99  ? 15.710  -23.694 -5.214  1.00 20.14 ? 106 THR A CB  1 
ATOM   806  O OG1 . THR A 1 99  ? 17.060  -23.471 -5.590  1.00 22.18 ? 106 THR A OG1 1 
ATOM   807  C CG2 . THR A 1 99  ? 15.562  -25.121 -4.907  1.00 19.21 ? 106 THR A CG2 1 
ATOM   808  N N   . VAL A 1 100 ? 14.127  -21.041 -6.220  1.00 15.57 ? 107 VAL A N   1 
ATOM   809  C CA  . VAL A 1 100 ? 14.022  -19.646 -6.647  1.00 16.88 ? 107 VAL A CA  1 
ATOM   810  C C   . VAL A 1 100 ? 13.904  -18.747 -5.462  1.00 18.77 ? 107 VAL A C   1 
ATOM   811  O O   . VAL A 1 100 ? 13.141  -19.030 -4.537  1.00 18.03 ? 107 VAL A O   1 
ATOM   812  C CB  . VAL A 1 100 ? 12.806  -19.414 -7.560  1.00 18.82 ? 107 VAL A CB  1 
ATOM   813  C CG1 . VAL A 1 100 ? 12.912  -18.044 -8.262  1.00 21.16 ? 107 VAL A CG1 1 
ATOM   814  C CG2 . VAL A 1 100 ? 12.686  -20.504 -8.602  1.00 19.11 ? 107 VAL A CG2 1 
ATOM   815  N N   . THR A 1 101 ? 14.549  -17.603 -5.506  1.00 18.21 ? 108 THR A N   1 
ATOM   816  C CA  . THR A 1 101 ? 14.290  -16.568 -4.519  1.00 19.66 ? 108 THR A CA  1 
ATOM   817  C C   . THR A 1 101 ? 14.020  -15.277 -5.229  1.00 20.13 ? 108 THR A C   1 
ATOM   818  O O   . THR A 1 101 ? 14.557  -15.049 -6.307  1.00 20.42 ? 108 THR A O   1 
ATOM   819  C CB  . THR A 1 101 ? 15.424  -16.382 -3.535  1.00 21.88 ? 108 THR A CB  1 
ATOM   820  O OG1 . THR A 1 101 ? 16.629  -15.936 -4.236  1.00 23.24 ? 108 THR A OG1 1 
ATOM   821  C CG2 . THR A 1 101 ? 15.676  -17.624 -2.731  1.00 22.49 ? 108 THR A CG2 1 
ATOM   822  N N   . GLN A 1 102 ? 13.188  -14.436 -4.669  1.00 18.09 ? 109 GLN A N   1 
ATOM   823  C CA  . GLN A 1 102 ? 12.778  -13.236 -5.358  1.00 18.28 ? 109 GLN A CA  1 
ATOM   824  C C   . GLN A 1 102 ? 12.552  -12.120 -4.382  1.00 20.00 ? 109 GLN A C   1 
ATOM   825  O O   . GLN A 1 102 ? 12.053  -12.355 -3.277  1.00 18.55 ? 109 GLN A O   1 
ATOM   826  C CB  . GLN A 1 102 ? 11.539  -13.512 -6.141  1.00 18.67 ? 109 GLN A CB  1 
ATOM   827  C CG  . GLN A 1 102 ? 11.222  -12.487 -7.218  1.00 19.89 ? 109 GLN A CG  1 
ATOM   828  C CD  . GLN A 1 102 ? 10.246  -11.409 -6.822  1.00 21.39 ? 109 GLN A CD  1 
ATOM   829  O OE1 . GLN A 1 102 ? 9.994   -11.148 -5.658  1.00 20.62 ? 109 GLN A OE1 1 
ATOM   830  N NE2 . GLN A 1 102 ? 9.638   -10.774 -7.851  1.00 23.53 ? 109 GLN A NE2 1 
ATOM   831  N N   . ASP A 1 103 ? 12.943  -10.909 -4.795  1.00 17.37 ? 110 ASP A N   1 
ATOM   832  C CA  . ASP A 1 103 ? 12.622  -9.702  -4.061  1.00 21.08 ? 110 ASP A CA  1 
ATOM   833  C C   . ASP A 1 103 ? 11.772  -8.735  -4.932  1.00 20.48 ? 110 ASP A C   1 
ATOM   834  O O   . ASP A 1 103 ? 12.035  -8.572  -6.137  1.00 22.35 ? 110 ASP A O   1 
ATOM   835  C CB  . ASP A 1 103 ? 13.912  -9.081  -3.534  1.00 22.72 ? 110 ASP A CB  1 
ATOM   836  C CG  . ASP A 1 103 ? 13.655  -7.831  -2.709  1.00 26.39 ? 110 ASP A CG  1 
ATOM   837  O OD1 . ASP A 1 103 ? 13.165  -6.822  -3.250  1.00 30.31 ? 110 ASP A OD1 1 
ATOM   838  O OD2 . ASP A 1 103 ? 13.913  -7.909  -1.504  1.00 29.21 ? 110 ASP A OD2 1 
ATOM   839  N N   . SER A 1 104 ? 10.708  -8.181  -4.344  1.00 20.86 ? 111 SER A N   1 
ATOM   840  C CA  . SER A 1 104 ? 9.778   -7.278  -4.982  1.00 21.52 ? 111 SER A CA  1 
ATOM   841  C C   . SER A 1 104 ? 9.698   -5.974  -4.195  1.00 22.96 ? 111 SER A C   1 
ATOM   842  O O   . SER A 1 104 ? 9.450   -5.994  -2.997  1.00 23.48 ? 111 SER A O   1 
ATOM   843  C CB  . SER A 1 104 ? 8.374   -7.889  -5.149  1.00 22.15 ? 111 SER A CB  1 
ATOM   844  O OG  . SER A 1 104 ? 8.284   -9.118  -5.874  1.00 21.22 ? 111 SER A OG  1 
ATOM   845  N N   . SER A 1 105 ? 9.893   -4.844  -4.875  1.00 23.43 ? 112 SER A N   1 
ATOM   846  C CA  . SER A 1 105 ? 9.914   -3.533  -4.260  1.00 25.37 ? 112 SER A CA  1 
ATOM   847  C C   . SER A 1 105 ? 9.232   -2.550  -5.221  1.00 26.89 ? 112 SER A C   1 
ATOM   848  O O   . SER A 1 105 ? 8.843   -2.907  -6.344  1.00 21.78 ? 112 SER A O   1 
ATOM   849  C CB  . SER A 1 105 ? 11.366  -3.156  -3.926  1.00 27.28 ? 112 SER A CB  1 
ATOM   850  O OG  . SER A 1 105 ? 12.167  -3.041  -5.111  1.00 28.40 ? 112 SER A OG  1 
ATOM   851  N N   . LEU A 1 106 ? 9.034   -1.313  -4.765  1.00 28.90 ? 113 LEU A N   1 
ATOM   852  C CA  . LEU A 1 106 ? 8.368   -0.320  -5.568  1.00 30.23 ? 113 LEU A CA  1 
ATOM   853  C C   . LEU A 1 106 ? 9.339   0.876   -5.612  1.00 31.06 ? 113 LEU A C   1 
ATOM   854  O O   . LEU A 1 106 ? 9.920   1.245   -4.586  1.00 34.62 ? 113 LEU A O   1 
ATOM   855  C CB  . LEU A 1 106 ? 7.039   0.073   -4.960  1.00 29.53 ? 113 LEU A CB  1 
ATOM   856  C CG  . LEU A 1 106 ? 6.316   1.137   -5.744  1.00 31.32 ? 113 LEU A CG  1 
ATOM   857  C CD1 . LEU A 1 106 ? 5.625   0.569   -6.977  1.00 32.42 ? 113 LEU A CD1 1 
ATOM   858  C CD2 . LEU A 1 106 ? 5.338   1.841   -4.807  1.00 35.52 ? 113 LEU A CD2 1 
ATOM   859  N N   . GLN A 1 107 ? 9.579   1.368   -6.815  1.00 29.36 ? 114 GLN A N   1 
ATOM   860  C CA  . GLN A 1 107 ? 10.506  2.475   -7.065  1.00 32.45 ? 114 GLN A CA  1 
ATOM   861  C C   . GLN A 1 107 ? 9.881   3.318   -8.113  1.00 30.72 ? 114 GLN A C   1 
ATOM   862  O O   . GLN A 1 107 ? 9.594   2.848   -9.231  1.00 27.79 ? 114 GLN A O   1 
ATOM   863  C CB  . GLN A 1 107 ? 11.885  2.023   -7.571  1.00 35.46 ? 114 GLN A CB  1 
ATOM   864  C CG  . GLN A 1 107 ? 12.728  1.279   -6.553  1.00 40.76 ? 114 GLN A CG  1 
ATOM   865  C CD  . GLN A 1 107 ? 12.947  2.034   -5.272  1.00 43.15 ? 114 GLN A CD  1 
ATOM   866  O OE1 . GLN A 1 107 ? 13.239  3.238   -5.280  1.00 49.20 ? 114 GLN A OE1 1 
ATOM   867  N NE2 . GLN A 1 107 ? 12.830  1.322   -4.142  1.00 44.49 ? 114 GLN A NE2 1 
ATOM   868  N N   . ASP A 1 108 ? 9.677   4.588   -7.761  1.00 32.13 ? 115 ASP A N   1 
ATOM   869  C CA  . ASP A 1 108 ? 9.197   5.594   -8.714  1.00 33.50 ? 115 ASP A CA  1 
ATOM   870  C C   . ASP A 1 108 ? 7.960   5.122   -9.447  1.00 30.99 ? 115 ASP A C   1 
ATOM   871  O O   . ASP A 1 108 ? 7.843   5.233   -10.647 1.00 29.68 ? 115 ASP A O   1 
ATOM   872  C CB  . ASP A 1 108 ? 10.310  5.943   -9.703  1.00 38.88 ? 115 ASP A CB  1 
ATOM   873  C CG  . ASP A 1 108 ? 11.632  6.222   -9.010  1.00 45.11 ? 115 ASP A CG  1 
ATOM   874  O OD1 . ASP A 1 108 ? 12.213  5.286   -8.396  1.00 57.83 ? 115 ASP A OD1 1 
ATOM   875  O OD2 . ASP A 1 108 ? 12.118  7.371   -9.087  1.00 56.66 ? 115 ASP A OD2 1 
ATOM   876  N N   . GLY A 1 109 ? 7.034   4.506   -8.716  1.00 30.04 ? 116 GLY A N   1 
ATOM   877  C CA  . GLY A 1 109 ? 5.766   4.106   -9.295  1.00 27.95 ? 116 GLY A CA  1 
ATOM   878  C C   . GLY A 1 109 ? 5.808   2.824   -10.061 1.00 25.35 ? 116 GLY A C   1 
ATOM   879  O O   . GLY A 1 109 ? 4.829   2.476   -10.689 1.00 31.84 ? 116 GLY A O   1 
ATOM   880  N N   . GLU A 1 110 ? 6.954   2.152   -10.037 1.00 27.40 ? 117 GLU A N   1 
ATOM   881  C CA  . GLU A 1 110 ? 7.138   0.892   -10.724 1.00 26.73 ? 117 GLU A CA  1 
ATOM   882  C C   . GLU A 1 110 ? 7.572   -0.249  -9.811  1.00 23.80 ? 117 GLU A C   1 
ATOM   883  O O   . GLU A 1 110 ? 8.430   -0.103  -8.958  1.00 22.99 ? 117 GLU A O   1 
ATOM   884  C CB  . GLU A 1 110 ? 8.156   1.013   -11.886 1.00 30.59 ? 117 GLU A CB  1 
ATOM   885  C CG  . GLU A 1 110 ? 7.671   1.921   -13.014 1.00 33.53 ? 117 GLU A CG  1 
ATOM   886  C CD  . GLU A 1 110 ? 8.634   1.961   -14.179 1.00 42.55 ? 117 GLU A CD  1 
ATOM   887  O OE1 . GLU A 1 110 ? 8.896   0.865   -14.740 1.00 44.84 ? 117 GLU A OE1 1 
ATOM   888  O OE2 . GLU A 1 110 ? 9.130   3.085   -14.533 1.00 47.91 ? 117 GLU A OE2 1 
ATOM   889  N N   . PHE A 1 111 ? 7.088   -1.435  -10.141 1.00 23.02 ? 118 PHE A N   1 
ATOM   890  C CA  . PHE A 1 111 ? 7.530   -2.619  -9.401  1.00 23.21 ? 118 PHE A CA  1 
ATOM   891  C C   . PHE A 1 111 ? 8.905   -3.021  -9.906  1.00 23.24 ? 118 PHE A C   1 
ATOM   892  O O   . PHE A 1 111 ? 9.149   -3.020  -11.148 1.00 24.91 ? 118 PHE A O   1 
ATOM   893  C CB  . PHE A 1 111 ? 6.576   -3.788  -9.613  1.00 22.91 ? 118 PHE A CB  1 
ATOM   894  C CG  . PHE A 1 111 ? 5.215   -3.580  -9.014  1.00 23.17 ? 118 PHE A CG  1 
ATOM   895  C CD1 . PHE A 1 111 ? 5.114   -3.378  -7.659  1.00 23.36 ? 118 PHE A CD1 1 
ATOM   896  C CD2 . PHE A 1 111 ? 4.086   -3.639  -9.758  1.00 21.18 ? 118 PHE A CD2 1 
ATOM   897  C CE1 . PHE A 1 111 ? 3.866   -3.201  -7.070  1.00 23.75 ? 118 PHE A CE1 1 
ATOM   898  C CE2 . PHE A 1 111 ? 2.836   -3.527  -9.187  1.00 23.37 ? 118 PHE A CE2 1 
ATOM   899  C CZ  . PHE A 1 111 ? 2.731   -3.287  -7.835  1.00 22.78 ? 118 PHE A CZ  1 
ATOM   900  N N   . ILE A 1 112 ? 9.761   -3.407  -8.982  1.00 22.72 ? 119 ILE A N   1 
ATOM   901  C CA  . ILE A 1 112 ? 11.114  -3.851  -9.301  1.00 25.17 ? 119 ILE A CA  1 
ATOM   902  C C   . ILE A 1 112 ? 11.273  -5.271  -8.748  1.00 21.93 ? 119 ILE A C   1 
ATOM   903  O O   . ILE A 1 112 ? 11.187  -5.469  -7.579  1.00 23.03 ? 119 ILE A O   1 
ATOM   904  C CB  . ILE A 1 112 ? 12.175  -2.906  -8.686  1.00 24.22 ? 119 ILE A CB  1 
ATOM   905  C CG1 . ILE A 1 112 ? 11.951  -1.413  -9.093  1.00 26.79 ? 119 ILE A CG1 1 
ATOM   906  C CG2 . ILE A 1 112 ? 13.595  -3.382  -8.919  1.00 25.51 ? 119 ILE A CG2 1 
ATOM   907  C CD1 . ILE A 1 112 ? 11.961  -0.989  -10.560 1.00 27.72 ? 119 ILE A CD1 1 
ATOM   908  N N   . TYR A 1 113 ? 11.600  -6.216  -9.635  1.00 20.78 ? 120 TYR A N   1 
ATOM   909  C CA  . TYR A 1 113 ? 11.695  -7.626  -9.295  1.00 21.67 ? 120 TYR A CA  1 
ATOM   910  C C   . TYR A 1 113 ? 13.110  -8.081  -9.543  1.00 22.70 ? 120 TYR A C   1 
ATOM   911  O O   . TYR A 1 113 ? 13.646  -7.871  -10.638 1.00 23.34 ? 120 TYR A O   1 
ATOM   912  C CB  . TYR A 1 113 ? 10.760  -8.420  -10.188 1.00 20.64 ? 120 TYR A CB  1 
ATOM   913  C CG  . TYR A 1 113 ? 9.292   -8.130  -10.138 1.00 20.67 ? 120 TYR A CG  1 
ATOM   914  C CD1 . TYR A 1 113 ? 8.678   -7.612  -9.036  1.00 22.41 ? 120 TYR A CD1 1 
ATOM   915  C CD2 . TYR A 1 113 ? 8.502   -8.435  -11.204 1.00 23.50 ? 120 TYR A CD2 1 
ATOM   916  C CE1 . TYR A 1 113 ? 7.335   -7.376  -9.038  1.00 23.56 ? 120 TYR A CE1 1 
ATOM   917  C CE2 . TYR A 1 113 ? 7.159   -8.189  -11.205 1.00 24.06 ? 120 TYR A CE2 1 
ATOM   918  C CZ  . TYR A 1 113 ? 6.590   -7.670  -10.112 1.00 23.84 ? 120 TYR A CZ  1 
ATOM   919  O OH  . TYR A 1 113 ? 5.238   -7.491  -10.120 1.00 26.13 ? 120 TYR A OH  1 
ATOM   920  N N   . LYS A 1 114 ? 13.735  -8.689  -8.563  1.00 20.03 ? 121 LYS A N   1 
ATOM   921  C CA  . LYS A 1 114 ? 15.037  -9.325  -8.692  1.00 20.18 ? 121 LYS A CA  1 
ATOM   922  C C   . LYS A 1 114 ? 14.878  -10.822 -8.362  1.00 20.48 ? 121 LYS A C   1 
ATOM   923  O O   . LYS A 1 114 ? 14.390  -11.140 -7.300  1.00 17.90 ? 121 LYS A O   1 
ATOM   924  C CB  . LYS A 1 114 ? 16.011  -8.710  -7.744  1.00 24.10 ? 121 LYS A CB  1 
ATOM   925  C CG  . LYS A 1 114 ? 16.268  -7.216  -8.069  1.00 25.86 ? 121 LYS A CG  1 
ATOM   926  C CD  . LYS A 1 114 ? 16.826  -7.031  -9.466  1.00 31.99 ? 121 LYS A CD  1 
ATOM   927  C CE  . LYS A 1 114 ? 17.652  -5.745  -9.619  1.00 36.06 ? 121 LYS A CE  1 
ATOM   928  N NZ  . LYS A 1 114 ? 16.843  -4.510  -9.643  1.00 38.73 ? 121 LYS A NZ  1 
ATOM   929  N N   . VAL A 1 115 ? 15.287  -11.695 -9.269  1.00 18.73 ? 122 VAL A N   1 
ATOM   930  C CA  . VAL A 1 115 ? 15.047  -13.135 -9.125  1.00 18.08 ? 122 VAL A CA  1 
ATOM   931  C C   . VAL A 1 115 ? 16.400  -13.862 -9.213  1.00 21.31 ? 122 VAL A C   1 
ATOM   932  O O   . VAL A 1 115 ? 17.238  -13.545 -10.108 1.00 19.28 ? 122 VAL A O   1 
ATOM   933  C CB  . VAL A 1 115 ? 14.113  -13.684 -10.263 1.00 20.01 ? 122 VAL A CB  1 
ATOM   934  C CG1 . VAL A 1 115 ? 13.653  -15.102 -10.013 1.00 19.85 ? 122 VAL A CG1 1 
ATOM   935  C CG2 . VAL A 1 115 ? 12.909  -12.809 -10.577 1.00 21.12 ? 122 VAL A CG2 1 
ATOM   936  N N   . LYS A 1 116 ? 16.618  -14.879 -8.354  1.00 18.91 ? 123 LYS A N   1 
ATOM   937  C CA  . LYS A 1 116 ? 17.727  -15.786 -8.515  1.00 20.19 ? 123 LYS A CA  1 
ATOM   938  C C   . LYS A 1 116 ? 17.187  -17.215 -8.623  1.00 18.35 ? 123 LYS A C   1 
ATOM   939  O O   . LYS A 1 116 ? 16.270  -17.575 -7.868  1.00 16.61 ? 123 LYS A O   1 
ATOM   940  C CB  . LYS A 1 116 ? 18.626  -15.730 -7.280  1.00 22.67 ? 123 LYS A CB  1 
ATOM   941  C CG  . LYS A 1 116 ? 19.374  -14.428 -7.109  1.00 27.83 ? 123 LYS A CG  1 
ATOM   942  C CD  . LYS A 1 116 ? 20.138  -14.448 -5.786  1.00 33.81 ? 123 LYS A CD  1 
ATOM   943  C CE  . LYS A 1 116 ? 21.207  -13.352 -5.740  1.00 39.66 ? 123 LYS A CE  1 
ATOM   944  N NZ  . LYS A 1 116 ? 22.032  -13.436 -4.499  1.00 41.38 ? 123 LYS A NZ  1 
ATOM   945  N N   . LEU A 1 117 ? 17.731  -18.014 -9.544  1.00 17.31 ? 124 LEU A N   1 
ATOM   946  C CA  . LEU A 1 117 ? 17.164  -19.275 -9.867  1.00 17.51 ? 124 LEU A CA  1 
ATOM   947  C C   . LEU A 1 117 ? 18.266  -20.314 -10.009 1.00 17.59 ? 124 LEU A C   1 
ATOM   948  O O   . LEU A 1 117 ? 19.275  -20.052 -10.643 1.00 17.47 ? 124 LEU A O   1 
ATOM   949  C CB  . LEU A 1 117 ? 16.354  -19.185 -11.135 1.00 17.74 ? 124 LEU A CB  1 
ATOM   950  C CG  . LEU A 1 117 ? 15.674  -20.438 -11.647 1.00 17.54 ? 124 LEU A CG  1 
ATOM   951  C CD1 . LEU A 1 117 ? 14.312  -20.104 -12.245 1.00 20.56 ? 124 LEU A CD1 1 
ATOM   952  C CD2 . LEU A 1 117 ? 16.553  -21.304 -12.529 1.00 18.05 ? 124 LEU A CD2 1 
ATOM   953  N N   . ARG A 1 118 ? 18.084  -21.466 -9.384  1.00 16.28 ? 125 ARG A N   1 
ATOM   954  C CA  . ARG A 1 118 ? 18.979  -22.610 -9.527  1.00 17.39 ? 125 ARG A CA  1 
ATOM   955  C C   . ARG A 1 118 ? 18.236  -23.839 -9.905  1.00 16.37 ? 125 ARG A C   1 
ATOM   956  O O   . ARG A 1 118 ? 17.437  -24.377 -9.091  1.00 17.41 ? 125 ARG A O   1 
ATOM   957  C CB  . ARG A 1 118 ? 19.759  -22.868 -8.246  1.00 20.02 ? 125 ARG A CB  1 
ATOM   958  C CG  . ARG A 1 118 ? 20.814  -23.957 -8.403  1.00 22.20 ? 125 ARG A CG  1 
ATOM   959  C CD  . ARG A 1 118 ? 21.502  -24.222 -7.066  1.00 27.34 ? 125 ARG A CD  1 
ATOM   960  N NE  . ARG A 1 118 ? 20.446  -24.921 -6.370  1.00 32.57 ? 125 ARG A NE  1 
ATOM   961  C CZ  . ARG A 1 118 ? 20.108  -24.827 -5.103  1.00 33.29 ? 125 ARG A CZ  1 
ATOM   962  N NH1 . ARG A 1 118 ? 19.022  -25.551 -4.740  1.00 33.73 ? 125 ARG A NH1 1 
ATOM   963  N NH2 . ARG A 1 118 ? 20.822  -24.090 -4.239  1.00 33.43 ? 125 ARG A NH2 1 
ATOM   964  N N   . GLY A 1 119 ? 18.483  -24.323 -11.122 1.00 16.08 ? 126 GLY A N   1 
ATOM   965  C CA  . GLY A 1 119 ? 17.856  -25.561 -11.639 1.00 16.04 ? 126 GLY A CA  1 
ATOM   966  C C   . GLY A 1 119 ? 18.915  -26.657 -11.655 1.00 16.24 ? 126 GLY A C   1 
ATOM   967  O O   . GLY A 1 119 ? 20.022  -26.450 -12.133 1.00 15.30 ? 126 GLY A O   1 
ATOM   968  N N   . THR A 1 120 ? 18.636  -27.837 -11.094 1.00 14.60 ? 127 THR A N   1 
ATOM   969  C CA  . THR A 1 120 ? 19.614  -28.911 -11.017 1.00 16.70 ? 127 THR A CA  1 
ATOM   970  C C   . THR A 1 120 ? 18.987  -30.306 -11.236 1.00 15.47 ? 127 THR A C   1 
ATOM   971  O O   . THR A 1 120 ? 17.788  -30.480 -11.141 1.00 15.51 ? 127 THR A O   1 
ATOM   972  C CB  . THR A 1 120 ? 20.355  -28.919 -9.635  1.00 18.69 ? 127 THR A CB  1 
ATOM   973  O OG1 . THR A 1 120 ? 19.349  -29.085 -8.645  1.00 18.27 ? 127 THR A OG1 1 
ATOM   974  C CG2 . THR A 1 120 ? 21.077  -27.650 -9.372  1.00 19.18 ? 127 THR A CG2 1 
ATOM   975  N N   . ASN A 1 121 ? 19.795  -31.275 -11.649 1.00 16.47 ? 128 ASN A N   1 
ATOM   976  C CA  . ASN A 1 121 ? 19.384  -32.663 -11.755 1.00 17.44 ? 128 ASN A CA  1 
ATOM   977  C C   . ASN A 1 121 ? 18.355  -32.960 -12.789 1.00 18.03 ? 128 ASN A C   1 
ATOM   978  O O   . ASN A 1 121 ? 17.667  -33.981 -12.780 1.00 18.43 ? 128 ASN A O   1 
ATOM   979  C CB  . ASN A 1 121 ? 18.941  -33.248 -10.363 1.00 19.42 ? 128 ASN A CB  1 
ATOM   980  C CG  . ASN A 1 121 ? 19.000  -34.748 -10.304 1.00 20.39 ? 128 ASN A CG  1 
ATOM   981  O OD1 . ASN A 1 121 ? 20.018  -35.291 -10.588 1.00 21.53 ? 128 ASN A OD1 1 
ATOM   982  N ND2 . ASN A 1 121 ? 17.925  -35.403 -9.842  1.00 21.08 ? 128 ASN A ND2 1 
ATOM   983  N N   . PHE A 1 122 ? 18.302  -32.106 -13.848 1.00 16.34 ? 129 PHE A N   1 
ATOM   984  C CA  . PHE A 1 122 ? 17.426  -32.518 -14.903 1.00 16.81 ? 129 PHE A CA  1 
ATOM   985  C C   . PHE A 1 122 ? 18.151  -33.544 -15.740 1.00 18.11 ? 129 PHE A C   1 
ATOM   986  O O   . PHE A 1 122 ? 19.297  -33.305 -16.108 1.00 17.89 ? 129 PHE A O   1 
ATOM   987  C CB  . PHE A 1 122 ? 17.042  -31.345 -15.804 1.00 17.52 ? 129 PHE A CB  1 
ATOM   988  C CG  . PHE A 1 122 ? 16.066  -30.386 -15.144 1.00 15.84 ? 129 PHE A CG  1 
ATOM   989  C CD1 . PHE A 1 122 ? 14.697  -30.642 -15.094 1.00 15.71 ? 129 PHE A CD1 1 
ATOM   990  C CD2 . PHE A 1 122 ? 16.549  -29.254 -14.521 1.00 16.24 ? 129 PHE A CD2 1 
ATOM   991  C CE1 . PHE A 1 122 ? 13.832  -29.753 -14.516 1.00 15.49 ? 129 PHE A CE1 1 
ATOM   992  C CE2 . PHE A 1 122 ? 15.684  -28.372 -13.921 1.00 16.96 ? 129 PHE A CE2 1 
ATOM   993  C CZ  . PHE A 1 122 ? 14.326  -28.632 -13.919 1.00 15.51 ? 129 PHE A CZ  1 
ATOM   994  N N   . PRO A 1 123 ? 17.469  -34.655 -16.059 1.00 19.00 ? 130 PRO A N   1 
ATOM   995  C CA  . PRO A 1 123 ? 18.055  -35.665 -16.909 1.00 20.81 ? 130 PRO A CA  1 
ATOM   996  C C   . PRO A 1 123 ? 18.401  -35.066 -18.261 1.00 20.61 ? 130 PRO A C   1 
ATOM   997  O O   . PRO A 1 123 ? 17.639  -34.277 -18.809 1.00 18.88 ? 130 PRO A O   1 
ATOM   998  C CB  . PRO A 1 123 ? 16.950  -36.701 -17.084 1.00 22.54 ? 130 PRO A CB  1 
ATOM   999  C CG  . PRO A 1 123 ? 16.016  -36.469 -15.933 1.00 22.35 ? 130 PRO A CG  1 
ATOM   1000 C CD  . PRO A 1 123 ? 16.082  -34.987 -15.669 1.00 21.08 ? 130 PRO A CD  1 
ATOM   1001 N N   . SER A 1 124 ? 19.546  -35.460 -18.780 1.00 20.66 ? 131 SER A N   1 
ATOM   1002 C CA  . SER A 1 124 ? 20.026  -34.786 -19.985 1.00 20.61 ? 131 SER A CA  1 
ATOM   1003 C C   . SER A 1 124 ? 19.093  -35.123 -21.161 1.00 22.31 ? 131 SER A C   1 
ATOM   1004 O O   . SER A 1 124 ? 19.019  -34.319 -22.113 1.00 22.49 ? 131 SER A O   1 
ATOM   1005 C CB  . SER A 1 124 ? 21.428  -35.174 -20.299 1.00 23.53 ? 131 SER A CB  1 
ATOM   1006 O OG  . SER A 1 124 ? 21.458  -36.547 -20.661 1.00 30.88 ? 131 SER A OG  1 
ATOM   1007 N N   . ASP A 1 125 ? 18.408  -36.272 -21.096 1.00 21.74 ? 132 ASP A N   1 
ATOM   1008 C CA  . ASP A 1 125 ? 17.473  -36.724 -22.130 1.00 25.03 ? 132 ASP A CA  1 
ATOM   1009 C C   . ASP A 1 125 ? 16.007  -36.377 -21.819 1.00 24.77 ? 132 ASP A C   1 
ATOM   1010 O O   . ASP A 1 125 ? 15.097  -36.774 -22.550 1.00 25.26 ? 132 ASP A O   1 
ATOM   1011 C CB  . ASP A 1 125 ? 17.602  -38.251 -22.360 1.00 28.64 ? 132 ASP A CB  1 
ATOM   1012 C CG  . ASP A 1 125 ? 17.195  -39.067 -21.142 1.00 33.36 ? 132 ASP A CG  1 
ATOM   1013 O OD1 . ASP A 1 125 ? 17.392  -38.595 -20.027 1.00 30.98 ? 132 ASP A OD1 1 
ATOM   1014 O OD2 . ASP A 1 125 ? 16.715  -40.215 -21.267 1.00 41.45 ? 132 ASP A OD2 1 
ATOM   1015 N N   . GLY A 1 126 ? 15.743  -35.615 -20.764 1.00 21.80 ? 133 GLY A N   1 
ATOM   1016 C CA  . GLY A 1 126 ? 14.422  -35.288 -20.408 1.00 21.45 ? 133 GLY A CA  1 
ATOM   1017 C C   . GLY A 1 126 ? 13.856  -34.067 -21.118 1.00 20.79 ? 133 GLY A C   1 
ATOM   1018 O O   . GLY A 1 126 ? 14.570  -33.392 -21.915 1.00 19.73 ? 133 GLY A O   1 
ATOM   1019 N N   . PRO A 1 127 ? 12.574  -33.767 -20.882 1.00 20.73 ? 134 PRO A N   1 
ATOM   1020 C CA  . PRO A 1 127 ? 11.924  -32.728 -21.676 1.00 20.14 ? 134 PRO A CA  1 
ATOM   1021 C C   . PRO A 1 127 ? 12.436  -31.312 -21.475 1.00 20.90 ? 134 PRO A C   1 
ATOM   1022 O O   . PRO A 1 127 ? 12.290  -30.464 -22.355 1.00 21.98 ? 134 PRO A O   1 
ATOM   1023 C CB  . PRO A 1 127 ? 10.465  -32.777 -21.247 1.00 22.96 ? 134 PRO A CB  1 
ATOM   1024 C CG  . PRO A 1 127 ? 10.476  -33.509 -19.994 1.00 24.46 ? 134 PRO A CG  1 
ATOM   1025 C CD  . PRO A 1 127 ? 11.611  -34.498 -20.050 1.00 22.09 ? 134 PRO A CD  1 
ATOM   1026 N N   . VAL A 1 128 ? 13.039  -31.032 -20.316 1.00 19.02 ? 135 VAL A N   1 
ATOM   1027 C CA  . VAL A 1 128 ? 13.581  -29.727 -20.086 1.00 18.04 ? 135 VAL A CA  1 
ATOM   1028 C C   . VAL A 1 128 ? 14.888  -29.470 -20.864 1.00 19.67 ? 135 VAL A C   1 
ATOM   1029 O O   . VAL A 1 128 ? 14.986  -28.490 -21.617 1.00 18.94 ? 135 VAL A O   1 
ATOM   1030 C CB  . VAL A 1 128 ? 13.739  -29.478 -18.539 1.00 17.52 ? 135 VAL A CB  1 
ATOM   1031 C CG1 . VAL A 1 128 ? 14.512  -28.201 -18.291 1.00 17.26 ? 135 VAL A CG1 1 
ATOM   1032 C CG2 . VAL A 1 128 ? 12.378  -29.449 -17.929 1.00 16.66 ? 135 VAL A CG2 1 
ATOM   1033 N N   . MET A 1 129 ? 15.829  -30.389 -20.784 1.00 18.36 ? 136 MET A N   1 
ATOM   1034 C CA  . MET A 1 129 ? 17.078  -30.172 -21.425 1.00 19.47 ? 136 MET A CA  1 
ATOM   1035 C C   . MET A 1 129 ? 16.928  -30.436 -22.922 1.00 19.50 ? 136 MET A C   1 
ATOM   1036 O O   . MET A 1 129 ? 17.771  -30.017 -23.634 1.00 25.04 ? 136 MET A O   1 
ATOM   1037 C CB  . MET A 1 129 ? 18.178  -31.034 -20.866 1.00 19.71 ? 136 MET A CB  1 
ATOM   1038 C CG  . MET A 1 129 ? 18.466  -30.723 -19.412 1.00 20.14 ? 136 MET A CG  1 
ATOM   1039 S SD  . MET A 1 129 ? 18.752  -28.996 -18.960 1.00 22.64 ? 136 MET A SD  1 
ATOM   1040 C CE  . MET A 1 129 ? 20.171  -28.535 -19.892 1.00 23.15 ? 136 MET A CE  1 
ATOM   1041 N N   . GLN A 1 130 ? 15.905  -31.182 -23.339 1.00 19.85 ? 137 GLN A N   1 
ATOM   1042 C CA  . GLN A 1 130 ? 15.715  -31.481 -24.781 1.00 20.44 ? 137 GLN A CA  1 
ATOM   1043 C C   . GLN A 1 130 ? 14.693  -30.545 -25.431 1.00 22.42 ? 137 GLN A C   1 
ATOM   1044 O O   . GLN A 1 130 ? 14.320  -30.704 -26.619 1.00 23.32 ? 137 GLN A O   1 
ATOM   1045 C CB  . GLN A 1 130 ? 15.278  -32.923 -24.961 1.00 21.32 ? 137 GLN A CB  1 
ATOM   1046 C CG  . GLN A 1 130 ? 16.310  -33.941 -24.551 1.00 20.56 ? 137 GLN A CG  1 
ATOM   1047 C CD  . GLN A 1 130 ? 17.519  -33.896 -25.449 1.00 23.45 ? 137 GLN A CD  1 
ATOM   1048 O OE1 . GLN A 1 130 ? 17.391  -33.726 -26.670 1.00 21.92 ? 137 GLN A OE1 1 
ATOM   1049 N NE2 . GLN A 1 130 ? 18.693  -34.088 -24.874 1.00 22.20 ? 137 GLN A NE2 1 
ATOM   1050 N N   . LYS A 1 131 ? 14.184  -29.596 -24.685 1.00 20.19 ? 138 LYS A N   1 
ATOM   1051 C CA  . LYS A 1 131 ? 13.185  -28.632 -25.176 1.00 21.28 ? 138 LYS A CA  1 
ATOM   1052 C C   . LYS A 1 131 ? 11.952  -29.258 -25.793 1.00 23.57 ? 138 LYS A C   1 
ATOM   1053 O O   . LYS A 1 131 ? 11.577  -28.908 -26.959 1.00 25.55 ? 138 LYS A O   1 
ATOM   1054 C CB  . LYS A 1 131 ? 13.778  -27.592 -26.130 1.00 22.81 ? 138 LYS A CB  1 
ATOM   1055 C CG  . LYS A 1 131 ? 14.874  -26.769 -25.536 1.00 25.84 ? 138 LYS A CG  1 
ATOM   1056 C CD  . LYS A 1 131 ? 15.356  -25.628 -26.422 1.00 28.57 ? 138 LYS A CD  1 
ATOM   1057 C CE  . LYS A 1 131 ? 16.757  -25.286 -26.047 1.00 29.47 ? 138 LYS A CE  1 
ATOM   1058 N NZ  . LYS A 1 131 ? 17.489  -24.468 -27.047 1.00 33.24 ? 138 LYS A NZ  1 
ATOM   1059 N N   . LYS A 1 132 ? 11.302  -30.111 -25.035 1.00 22.43 ? 139 LYS A N   1 
ATOM   1060 C CA  . LYS A 1 132 ? 10.151  -30.893 -25.455 1.00 23.83 ? 139 LYS A CA  1 
ATOM   1061 C C   . LYS A 1 132 ? 8.872   -30.378 -24.842 1.00 22.57 ? 139 LYS A C   1 
ATOM   1062 O O   . LYS A 1 132 ? 7.807   -30.960 -25.075 1.00 23.39 ? 139 LYS A O   1 
ATOM   1063 C CB  . LYS A 1 132 ? 10.321  -32.409 -25.236 1.00 26.73 ? 139 LYS A CB  1 
ATOM   1064 C CG  . LYS A 1 132 ? 11.345  -33.060 -26.144 1.00 31.30 ? 139 LYS A CG  1 
ATOM   1065 C CD  . LYS A 1 132 ? 11.338  -34.574 -26.023 1.00 42.01 ? 139 LYS A CD  1 
ATOM   1066 C CE  . LYS A 1 132 ? 12.119  -35.067 -24.807 1.00 45.78 ? 139 LYS A CE  1 
ATOM   1067 N NZ  . LYS A 1 132 ? 12.394  -36.534 -24.919 1.00 49.33 ? 139 LYS A NZ  1 
ATOM   1068 N N   . THR A 1 133 ? 8.956   -29.321 -24.036 1.00 23.29 ? 140 THR A N   1 
ATOM   1069 C CA  . THR A 1 133 ? 7.750   -28.713 -23.467 1.00 24.98 ? 140 THR A CA  1 
ATOM   1070 C C   . THR A 1 133 ? 7.009   -27.705 -24.387 1.00 26.16 ? 140 THR A C   1 
ATOM   1071 O O   . THR A 1 133 ? 7.612   -27.049 -25.240 1.00 27.80 ? 140 THR A O   1 
ATOM   1072 C CB  . THR A 1 133 ? 8.007   -28.085 -22.046 1.00 26.79 ? 140 THR A CB  1 
ATOM   1073 O OG1 . THR A 1 133 ? 8.807   -26.925 -22.145 1.00 27.85 ? 140 THR A OG1 1 
ATOM   1074 C CG2 . THR A 1 133 ? 8.727   -29.108 -21.198 1.00 28.09 ? 140 THR A CG2 1 
ATOM   1075 N N   . MET A 1 134 ? 5.704   -27.604 -24.183 1.00 25.86 ? 141 MET A N   1 
ATOM   1076 C CA  . MET A 1 134 ? 4.819   -26.777 -25.024 1.00 30.51 ? 141 MET A CA  1 
ATOM   1077 C C   . MET A 1 134 ? 3.877   -25.919 -24.160 1.00 29.54 ? 141 MET A C   1 
ATOM   1078 O O   . MET A 1 134 ? 2.732   -25.713 -24.557 1.00 30.19 ? 141 MET A O   1 
ATOM   1079 C CB  . MET A 1 134 ? 3.873   -27.624 -25.906 1.00 34.83 ? 141 MET A CB  1 
ATOM   1080 C CG  . MET A 1 134 ? 4.453   -28.480 -26.978 1.00 38.33 ? 141 MET A CG  1 
ATOM   1081 S SD  . MET A 1 134 ? 3.105   -28.906 -28.167 1.00 46.87 ? 141 MET A SD  1 
ATOM   1082 C CE  . MET A 1 134 ? 2.025   -29.972 -27.211 1.00 42.01 ? 141 MET A CE  1 
ATOM   1083 N N   . GLY A 1 135 ? 4.325   -25.435 -23.007 1.00 22.42 ? 142 GLY A N   1 
ATOM   1084 C CA  . GLY A 1 135 ? 3.576   -24.483 -22.233 1.00 23.95 ? 142 GLY A CA  1 
ATOM   1085 C C   . GLY A 1 135 ? 2.796   -25.119 -21.090 1.00 24.34 ? 142 GLY A C   1 
ATOM   1086 O O   . GLY A 1 135 ? 2.619   -26.276 -21.086 1.00 26.39 ? 142 GLY A O   1 
HETATM 1087 N N1  . 4OO A 1 136 ? 6.731   -23.995 -15.551 1.00 33.69 ? 143 4OO A N1  1 
HETATM 1088 N N2  . 4OO A 1 136 ? 7.049   -24.978 -14.883 1.00 49.57 ? 143 4OO A N2  1 
HETATM 1089 N N3  . 4OO A 1 136 ? 7.381   -26.019 -14.170 1.00 48.92 ? 143 4OO A N3  1 
HETATM 1090 C C   . 4OO A 1 136 ? 0.028   -24.961 -19.244 1.00 29.82 ? 143 4OO A C   1 
HETATM 1091 O O   . 4OO A 1 136 ? -0.607  -24.155 -19.953 1.00 31.13 ? 143 4OO A O   1 
HETATM 1092 C CA  . 4OO A 1 136 ? 1.481   -24.810 -19.020 1.00 27.16 ? 143 4OO A CA  1 
HETATM 1093 N N   . 4OO A 1 136 ? 2.288   -24.317 -20.183 1.00 24.12 ? 143 4OO A N   1 
HETATM 1094 C CB  . 4OO A 1 136 ? 1.612   -23.792 -17.936 1.00 26.64 ? 143 4OO A CB  1 
HETATM 1095 C CG  . 4OO A 1 136 ? 2.952   -23.888 -17.296 1.00 27.99 ? 143 4OO A CG  1 
HETATM 1096 C CD2 . 4OO A 1 136 ? 3.946   -23.006 -17.682 1.00 24.80 ? 143 4OO A CD2 1 
HETATM 1097 C CE2 . 4OO A 1 136 ? 5.174   -23.078 -17.084 1.00 27.02 ? 143 4OO A CE2 1 
HETATM 1098 C CZ  . 4OO A 1 136 ? 5.436   -23.988 -16.104 1.00 28.68 ? 143 4OO A CZ  1 
HETATM 1099 C CE1 . 4OO A 1 136 ? 4.448   -24.886 -15.695 1.00 29.28 ? 143 4OO A CE1 1 
HETATM 1100 C CD1 . 4OO A 1 136 ? 3.197   -24.848 -16.277 1.00 27.81 ? 143 4OO A CD1 1 
ATOM   1101 N N   . GLU A 1 137 ? -0.549  -25.974 -18.654 1.00 27.67 ? 144 GLU A N   1 
ATOM   1102 C CA  . GLU A 1 137 ? -1.981  -25.996 -18.502 1.00 29.35 ? 144 GLU A CA  1 
ATOM   1103 C C   . GLU A 1 137 ? -2.312  -24.941 -17.478 1.00 27.20 ? 144 GLU A C   1 
ATOM   1104 O O   . GLU A 1 137 ? -1.428  -24.539 -16.645 1.00 27.84 ? 144 GLU A O   1 
ATOM   1105 C CB  . GLU A 1 137 ? -2.448  -27.373 -18.058 1.00 30.01 ? 144 GLU A CB  1 
ATOM   1106 C CG  . GLU A 1 137 ? -2.167  -28.536 -19.023 1.00 33.31 ? 144 GLU A CG  1 
ATOM   1107 C CD  . GLU A 1 137 ? -3.040  -28.510 -20.276 1.00 37.00 ? 144 GLU A CD  1 
ATOM   1108 O OE1 . GLU A 1 137 ? -3.810  -27.534 -20.471 1.00 39.21 ? 144 GLU A OE1 1 
ATOM   1109 O OE2 . GLU A 1 137 ? -2.963  -29.482 -21.057 1.00 40.15 ? 144 GLU A OE2 1 
ATOM   1110 N N   . ALA A 1 138 ? -3.559  -24.468 -17.519 1.00 26.48 ? 145 ALA A N   1 
ATOM   1111 C CA  . ALA A 1 138 ? -4.074  -23.591 -16.478 1.00 26.53 ? 145 ALA A CA  1 
ATOM   1112 C C   . ALA A 1 138 ? -3.932  -24.322 -15.148 1.00 23.13 ? 145 ALA A C   1 
ATOM   1113 O O   . ALA A 1 138 ? -4.102  -25.518 -15.078 1.00 25.83 ? 145 ALA A O   1 
ATOM   1114 C CB  . ALA A 1 138 ? -5.518  -23.199 -16.727 1.00 25.93 ? 145 ALA A CB  1 
ATOM   1115 N N   . SER A 1 139 ? -3.689  -23.552 -14.105 1.00 24.09 ? 146 SER A N   1 
ATOM   1116 C CA  . SER A 1 139 ? -3.259  -24.122 -12.797 1.00 26.48 ? 146 SER A CA  1 
ATOM   1117 C C   . SER A 1 139 ? -4.086  -23.501 -11.718 1.00 22.01 ? 146 SER A C   1 
ATOM   1118 O O   . SER A 1 139 ? -4.620  -22.454 -11.904 1.00 24.23 ? 146 SER A O   1 
ATOM   1119 C CB  . SER A 1 139 ? -1.844  -23.534 -12.491 1.00 28.64 ? 146 SER A CB  1 
ATOM   1120 O OG  . SER A 1 139 ? -0.894  -24.450 -12.838 1.00 39.49 ? 146 SER A OG  1 
ATOM   1121 N N   . SER A 1 140 ? -4.056  -24.104 -10.523 1.00 21.92 ? 147 SER A N   1 
ATOM   1122 C CA  . SER A 1 140 ? -4.655  -23.434 -9.386  1.00 20.50 ? 147 SER A CA  1 
ATOM   1123 C C   . SER A 1 140 ? -3.662  -23.529 -8.203  1.00 19.86 ? 147 SER A C   1 
ATOM   1124 O O   . SER A 1 140 ? -3.119  -24.638 -7.934  1.00 23.42 ? 147 SER A O   1 
ATOM   1125 C CB  . SER A 1 140 ? -5.977  -24.092 -9.076  1.00 26.22 ? 147 SER A CB  1 
ATOM   1126 O OG  . SER A 1 140 ? -6.387  -23.792 -7.747  1.00 34.20 ? 147 SER A OG  1 
ATOM   1127 N N   . GLU A 1 141 ? -3.367  -22.389 -7.610  1.00 19.27 ? 148 GLU A N   1 
ATOM   1128 C CA  . GLU A 1 141 ? -2.445  -22.320 -6.467  1.00 19.98 ? 148 GLU A CA  1 
ATOM   1129 C C   . GLU A 1 141 ? -3.344  -22.319 -5.241  1.00 19.20 ? 148 GLU A C   1 
ATOM   1130 O O   . GLU A 1 141 ? -4.159  -21.398 -5.039  1.00 21.12 ? 148 GLU A O   1 
ATOM   1131 C CB  . GLU A 1 141 ? -1.585  -21.085 -6.518  1.00 19.62 ? 148 GLU A CB  1 
ATOM   1132 C CG  . GLU A 1 141 ? -0.416  -21.111 -5.587  1.00 20.94 ? 148 GLU A CG  1 
ATOM   1133 C CD  . GLU A 1 141 ? 0.606   -20.049 -5.769  1.00 25.05 ? 148 GLU A CD  1 
ATOM   1134 O OE1 . GLU A 1 141 ? 0.379   -19.026 -6.521  1.00 30.80 ? 148 GLU A OE1 1 
ATOM   1135 O OE2 . GLU A 1 141 ? 1.678   -20.161 -5.169  1.00 25.16 ? 148 GLU A OE2 1 
ATOM   1136 N N   . ARG A 1 142 ? -3.127  -23.289 -4.342  1.00 19.14 ? 149 ARG A N   1 
ATOM   1137 C CA  . ARG A 1 142 ? -3.846  -23.313 -3.041  1.00 20.79 ? 149 ARG A CA  1 
ATOM   1138 C C   . ARG A 1 142 ? -3.037  -22.521 -2.018  1.00 20.02 ? 149 ARG A C   1 
ATOM   1139 O O   . ARG A 1 142 ? -1.871  -22.872 -1.778  1.00 18.89 ? 149 ARG A O   1 
ATOM   1140 C CB  . ARG A 1 142 ? -3.996  -24.763 -2.603  1.00 23.93 ? 149 ARG A CB  1 
ATOM   1141 C CG  . ARG A 1 142 ? -4.866  -25.557 -3.575  1.00 32.18 ? 149 ARG A CG  1 
ATOM   1142 C CD  . ARG A 1 142 ? -5.105  -26.988 -3.122  1.00 36.61 ? 149 ARG A CD  1 
ATOM   1143 N NE  . ARG A 1 142 ? -5.980  -27.024 -1.951  1.00 45.73 ? 149 ARG A NE  1 
ATOM   1144 C CZ  . ARG A 1 142 ? -6.428  -28.130 -1.352  1.00 48.91 ? 149 ARG A CZ  1 
ATOM   1145 N NH1 . ARG A 1 142 ? -6.113  -29.328 -1.827  1.00 50.46 ? 149 ARG A NH1 1 
ATOM   1146 N NH2 . ARG A 1 142 ? -7.212  -28.031 -0.273  1.00 53.52 ? 149 ARG A NH2 1 
ATOM   1147 N N   . MET A 1 143 ? -3.628  -21.485 -1.460  1.00 17.70 ? 150 MET A N   1 
ATOM   1148 C CA  . MET A 1 143 ? -2.921  -20.564 -0.624  1.00 19.32 ? 150 MET A CA  1 
ATOM   1149 C C   . MET A 1 143 ? -3.371  -20.792 0.822   1.00 19.48 ? 150 MET A C   1 
ATOM   1150 O O   . MET A 1 143 ? -4.551  -21.015 1.058   1.00 19.04 ? 150 MET A O   1 
ATOM   1151 C CB  . MET A 1 143 ? -3.271  -19.148 -0.944  1.00 20.70 ? 150 MET A CB  1 
ATOM   1152 C CG  . MET A 1 143 ? -3.224  -18.782 -2.433  1.00 22.03 ? 150 MET A CG  1 
ATOM   1153 S SD  . MET A 1 143 ? -1.633  -19.007 -3.191  1.00 24.24 ? 150 MET A SD  1 
ATOM   1154 C CE  . MET A 1 143 ? -0.645  -18.022 -2.185  1.00 21.81 ? 150 MET A CE  1 
ATOM   1155 N N   . TYR A 1 144 ? -2.429  -20.638 1.750   1.00 18.68 ? 151 TYR A N   1 
ATOM   1156 C CA  . TYR A 1 144 ? -2.765  -20.612 3.169   1.00 20.13 ? 151 TYR A CA  1 
ATOM   1157 C C   . TYR A 1 144 ? -1.714  -19.895 3.972   1.00 18.82 ? 151 TYR A C   1 
ATOM   1158 O O   . TYR A 1 144 ? -0.550  -19.937 3.636   1.00 18.11 ? 151 TYR A O   1 
ATOM   1159 C CB  . TYR A 1 144 ? -2.960  -22.028 3.697   1.00 19.78 ? 151 TYR A CB  1 
ATOM   1160 C CG  . TYR A 1 144 ? -1.748  -22.933 3.615   1.00 19.88 ? 151 TYR A CG  1 
ATOM   1161 C CD1 . TYR A 1 144 ? -1.429  -23.589 2.445   1.00 20.70 ? 151 TYR A CD1 1 
ATOM   1162 C CD2 . TYR A 1 144 ? -0.885  -23.098 4.685   1.00 21.47 ? 151 TYR A CD2 1 
ATOM   1163 C CE1 . TYR A 1 144 ? -0.357  -24.408 2.334   1.00 23.13 ? 151 TYR A CE1 1 
ATOM   1164 C CE2 . TYR A 1 144 ? 0.265   -23.907 4.548   1.00 21.67 ? 151 TYR A CE2 1 
ATOM   1165 C CZ  . TYR A 1 144 ? 0.500   -24.565 3.354   1.00 23.91 ? 151 TYR A CZ  1 
ATOM   1166 O OH  . TYR A 1 144 ? 1.569   -25.363 3.039   1.00 28.98 ? 151 TYR A OH  1 
ATOM   1167 N N   . PRO A 1 145 ? -2.131  -19.322 5.091   1.00 19.49 ? 152 PRO A N   1 
ATOM   1168 C CA  . PRO A 1 145 ? -1.162  -18.660 5.946   1.00 18.88 ? 152 PRO A CA  1 
ATOM   1169 C C   . PRO A 1 145 ? -0.477  -19.618 6.867   1.00 20.64 ? 152 PRO A C   1 
ATOM   1170 O O   . PRO A 1 145 ? -1.094  -20.609 7.292   1.00 19.92 ? 152 PRO A O   1 
ATOM   1171 C CB  . PRO A 1 145 ? -2.025  -17.702 6.704   1.00 19.84 ? 152 PRO A CB  1 
ATOM   1172 C CG  . PRO A 1 145 ? -3.363  -18.440 6.868   1.00 19.13 ? 152 PRO A CG  1 
ATOM   1173 C CD  . PRO A 1 145 ? -3.525  -19.140 5.570   1.00 18.76 ? 152 PRO A CD  1 
ATOM   1174 N N   . GLU A 1 146 ? 0.813   -19.378 7.136   1.00 20.37 ? 153 GLU A N   1 
ATOM   1175 C CA  . GLU A 1 146 ? 1.589   -20.277 8.011   1.00 22.54 ? 153 GLU A CA  1 
ATOM   1176 C C   . GLU A 1 146 ? 2.826   -19.563 8.506   1.00 25.43 ? 153 GLU A C   1 
ATOM   1177 O O   . GLU A 1 146 ? 3.614   -19.036 7.708   1.00 25.03 ? 153 GLU A O   1 
ATOM   1178 C CB  . GLU A 1 146 ? 1.953   -21.606 7.364   1.00 24.14 ? 153 GLU A CB  1 
ATOM   1179 C CG  . GLU A 1 146 ? 2.705   -22.570 8.290   1.00 26.74 ? 153 GLU A CG  1 
ATOM   1180 C CD  . GLU A 1 146 ? 3.007   -23.906 7.663   1.00 29.52 ? 153 GLU A CD  1 
ATOM   1181 O OE1 . GLU A 1 146 ? 3.308   -23.946 6.442   1.00 31.27 ? 153 GLU A OE1 1 
ATOM   1182 O OE2 . GLU A 1 146 ? 2.940   -24.968 8.344   1.00 30.55 ? 153 GLU A OE2 1 
ATOM   1183 N N   . ASP A 1 147 ? 2.960   -19.570 9.839   1.00 28.04 ? 154 ASP A N   1 
ATOM   1184 C CA  . ASP A 1 147 ? 4.107   -18.906 10.489  1.00 31.58 ? 154 ASP A CA  1 
ATOM   1185 C C   . ASP A 1 147 ? 4.413   -17.516 9.993   1.00 28.13 ? 154 ASP A C   1 
ATOM   1186 O O   . ASP A 1 147 ? 5.567   -17.181 9.732   1.00 30.60 ? 154 ASP A O   1 
ATOM   1187 C CB  . ASP A 1 147 ? 5.316   -19.784 10.255  1.00 35.87 ? 154 ASP A CB  1 
ATOM   1188 C CG  . ASP A 1 147 ? 5.857   -20.282 11.522  1.00 43.27 ? 154 ASP A CG  1 
ATOM   1189 O OD1 . ASP A 1 147 ? 6.581   -19.484 12.171  1.00 46.72 ? 154 ASP A OD1 1 
ATOM   1190 O OD2 . ASP A 1 147 ? 5.475   -21.410 11.891  1.00 43.91 ? 154 ASP A OD2 1 
ATOM   1191 N N   . GLY A 1 148 ? 3.394   -16.685 9.878   1.00 24.93 ? 155 GLY A N   1 
ATOM   1192 C CA  . GLY A 1 148 ? 3.554   -15.322 9.658   1.00 24.85 ? 155 GLY A CA  1 
ATOM   1193 C C   . GLY A 1 148 ? 3.811   -15.019 8.187   1.00 23.52 ? 155 GLY A C   1 
ATOM   1194 O O   . GLY A 1 148 ? 4.232   -13.972 7.874   1.00 25.66 ? 155 GLY A O   1 
ATOM   1195 N N   . ALA A 1 149 ? 3.600   -15.987 7.335   1.00 21.21 ? 156 ALA A N   1 
ATOM   1196 C CA  . ALA A 1 149 ? 3.825   -15.785 5.899   1.00 20.85 ? 156 ALA A CA  1 
ATOM   1197 C C   . ALA A 1 149 ? 2.702   -16.487 5.144   1.00 20.31 ? 156 ALA A C   1 
ATOM   1198 O O   . ALA A 1 149 ? 1.868   -17.159 5.704   1.00 20.00 ? 156 ALA A O   1 
ATOM   1199 C CB  . ALA A 1 149 ? 5.157   -16.370 5.487   1.00 21.03 ? 156 ALA A CB  1 
ATOM   1200 N N   . LEU A 1 150 ? 2.712   -16.281 3.832   1.00 19.14 ? 157 LEU A N   1 
ATOM   1201 C CA  . LEU A 1 150 ? 1.673   -16.789 2.956   1.00 19.06 ? 157 LEU A CA  1 
ATOM   1202 C C   . LEU A 1 150 ? 2.257   -17.897 2.174   1.00 19.16 ? 157 LEU A C   1 
ATOM   1203 O O   . LEU A 1 150 ? 3.275   -17.715 1.550   1.00 20.98 ? 157 LEU A O   1 
ATOM   1204 C CB  . LEU A 1 150 ? 1.101   -15.703 2.036   1.00 20.42 ? 157 LEU A CB  1 
ATOM   1205 C CG  . LEU A 1 150 ? 0.014   -16.133 1.071   1.00 21.21 ? 157 LEU A CG  1 
ATOM   1206 C CD1 . LEU A 1 150 ? -1.175  -16.711 1.864   1.00 24.04 ? 157 LEU A CD1 1 
ATOM   1207 C CD2 . LEU A 1 150 ? -0.453  -14.963 0.247   1.00 23.10 ? 157 LEU A CD2 1 
ATOM   1208 N N   . LYS A 1 151 ? 1.660   -19.071 2.224   1.00 17.95 ? 158 LYS A N   1 
ATOM   1209 C CA  . LYS A 1 151 ? 2.164   -20.203 1.430   1.00 17.71 ? 158 LYS A CA  1 
ATOM   1210 C C   . LYS A 1 151 ? 1.255   -20.522 0.275   1.00 17.53 ? 158 LYS A C   1 
ATOM   1211 O O   . LYS A 1 151 ? 0.044   -20.383 0.369   1.00 17.73 ? 158 LYS A O   1 
ATOM   1212 C CB  . LYS A 1 151 ? 2.268   -21.499 2.204   1.00 20.44 ? 158 LYS A CB  1 
ATOM   1213 C CG  . LYS A 1 151 ? 2.890   -21.307 3.553   1.00 23.73 ? 158 LYS A CG  1 
ATOM   1214 C CD  . LYS A 1 151 ? 4.313   -20.887 3.363   1.00 23.88 ? 158 LYS A CD  1 
ATOM   1215 C CE  . LYS A 1 151 ? 5.045   -20.778 4.733   1.00 26.19 ? 158 LYS A CE  1 
ATOM   1216 N NZ  . LYS A 1 151 ? 5.493   -22.105 5.122   1.00 27.82 ? 158 LYS A NZ  1 
ATOM   1217 N N   . GLY A 1 152 ? 1.854   -21.073 -0.743  1.00 17.96 ? 159 GLY A N   1 
ATOM   1218 C CA  . GLY A 1 152 ? 1.118   -21.478 -1.931  1.00 16.74 ? 159 GLY A CA  1 
ATOM   1219 C C   . GLY A 1 152 ? 1.618   -22.793 -2.430  1.00 17.66 ? 159 GLY A C   1 
ATOM   1220 O O   . GLY A 1 152 ? 2.851   -23.019 -2.468  1.00 18.28 ? 159 GLY A O   1 
ATOM   1221 N N   . GLU A 1 153 ? 0.694   -23.690 -2.826  1.00 16.47 ? 160 GLU A N   1 
ATOM   1222 C CA  . GLU A 1 153 ? 1.025   -25.003 -3.323  1.00 18.00 ? 160 GLU A CA  1 
ATOM   1223 C C   . GLU A 1 153 ? 0.337   -25.203 -4.695  1.00 18.05 ? 160 GLU A C   1 
ATOM   1224 O O   . GLU A 1 153 ? -0.827  -24.907 -4.840  1.00 19.17 ? 160 GLU A O   1 
ATOM   1225 C CB  . GLU A 1 153 ? 0.629   -26.125 -2.368  1.00 21.96 ? 160 GLU A CB  1 
ATOM   1226 C CG  . GLU A 1 153 ? 1.461   -26.167 -1.111  1.00 24.53 ? 160 GLU A CG  1 
ATOM   1227 C CD  . GLU A 1 153 ? 0.948   -27.144 -0.041  1.00 31.06 ? 160 GLU A CD  1 
ATOM   1228 O OE1 . GLU A 1 153 ? 1.556   -27.195 1.059   1.00 34.96 ? 160 GLU A OE1 1 
ATOM   1229 O OE2 . GLU A 1 153 ? -0.138  -27.741 -0.226  1.00 36.12 ? 160 GLU A OE2 1 
ATOM   1230 N N   . ILE A 1 154 ? 1.092   -25.672 -5.649  1.00 19.06 ? 161 ILE A N   1 
ATOM   1231 C CA  . ILE A 1 154 ? 0.542   -25.976 -6.991  1.00 19.83 ? 161 ILE A CA  1 
ATOM   1232 C C   . ILE A 1 154 ? 1.077   -27.294 -7.512  1.00 21.82 ? 161 ILE A C   1 
ATOM   1233 O O   . ILE A 1 154 ? 2.278   -27.599 -7.350  1.00 21.30 ? 161 ILE A O   1 
ATOM   1234 C CB  . ILE A 1 154 ? 0.984   -24.966 -8.057  1.00 24.94 ? 161 ILE A CB  1 
ATOM   1235 C CG1 . ILE A 1 154 ? 1.002   -23.581 -7.553  1.00 29.30 ? 161 ILE A CG1 1 
ATOM   1236 C CG2 . ILE A 1 154 ? 0.101   -25.172 -9.315  1.00 22.72 ? 161 ILE A CG2 1 
ATOM   1237 C CD1 . ILE A 1 154 ? 1.766   -22.667 -8.451  1.00 29.63 ? 161 ILE A CD1 1 
ATOM   1238 N N   . LYS A 1 155 ? 0.222   -28.064 -8.173  1.00 22.15 ? 162 LYS A N   1 
ATOM   1239 C CA  . LYS A 1 155 ? 0.632   -29.164 -9.056  1.00 26.59 ? 162 LYS A CA  1 
ATOM   1240 C C   . LYS A 1 155 ? 0.604   -28.617 -10.470 1.00 26.72 ? 162 LYS A C   1 
ATOM   1241 O O   . LYS A 1 155 ? -0.473  -28.264 -10.941 1.00 30.21 ? 162 LYS A O   1 
ATOM   1242 C CB  . LYS A 1 155 ? -0.339  -30.315 -8.958  1.00 30.53 ? 162 LYS A CB  1 
ATOM   1243 C CG  . LYS A 1 155 ? -1.070  -30.453 -7.644  1.00 37.36 ? 162 LYS A CG  1 
ATOM   1244 C CD  . LYS A 1 155 ? -0.682  -31.681 -6.873  1.00 41.45 ? 162 LYS A CD  1 
ATOM   1245 C CE  . LYS A 1 155 ? -1.838  -32.036 -5.979  1.00 46.59 ? 162 LYS A CE  1 
ATOM   1246 N NZ  . LYS A 1 155 ? -1.439  -33.151 -5.073  1.00 51.91 ? 162 LYS A NZ  1 
ATOM   1247 N N   . GLN A 1 156 ? 1.745   -28.387 -11.074 1.00 26.53 ? 163 GLN A N   1 
ATOM   1248 C CA  . GLN A 1 156 ? 1.840   -27.740 -12.382 1.00 26.27 ? 163 GLN A CA  1 
ATOM   1249 C C   . GLN A 1 156 ? 1.944   -28.853 -13.390 1.00 25.29 ? 163 GLN A C   1 
ATOM   1250 O O   . GLN A 1 156 ? 2.607   -29.864 -13.150 1.00 21.85 ? 163 GLN A O   1 
ATOM   1251 C CB  . GLN A 1 156 ? 3.107   -26.897 -12.612 1.00 25.80 ? 163 GLN A CB  1 
ATOM   1252 C CG  . GLN A 1 156 ? 3.321   -25.658 -11.821 1.00 28.16 ? 163 GLN A CG  1 
ATOM   1253 C CD  . GLN A 1 156 ? 2.439   -24.533 -12.246 1.00 35.40 ? 163 GLN A CD  1 
ATOM   1254 O OE1 . GLN A 1 156 ? 1.364   -24.743 -12.825 1.00 34.61 ? 163 GLN A OE1 1 
ATOM   1255 N NE2 . GLN A 1 156 ? 2.891   -23.306 -11.966 1.00 40.30 ? 163 GLN A NE2 1 
ATOM   1256 N N   . ARG A 1 157 ? 1.349   -28.631 -14.566 1.00 24.65 ? 164 ARG A N   1 
ATOM   1257 C CA  . ARG A 1 157 ? 1.527   -29.568 -15.675 1.00 24.32 ? 164 ARG A CA  1 
ATOM   1258 C C   . ARG A 1 157 ? 2.015   -28.826 -16.887 1.00 22.85 ? 164 ARG A C   1 
ATOM   1259 O O   . ARG A 1 157 ? 1.394   -27.820 -17.278 1.00 24.74 ? 164 ARG A O   1 
ATOM   1260 C CB  . ARG A 1 157 ? 0.203   -30.259 -16.043 1.00 24.85 ? 164 ARG A CB  1 
ATOM   1261 C CG  . ARG A 1 157 ? -0.588  -30.812 -14.872 1.00 32.22 ? 164 ARG A CG  1 
ATOM   1262 C CD  . ARG A 1 157 ? -1.576  -31.879 -15.362 1.00 36.75 ? 164 ARG A CD  1 
ATOM   1263 N NE  . ARG A 1 157 ? -0.871  -33.133 -15.639 1.00 38.41 ? 164 ARG A NE  1 
ATOM   1264 C CZ  . ARG A 1 157 ? -1.428  -34.234 -16.142 1.00 43.36 ? 164 ARG A CZ  1 
ATOM   1265 N NH1 . ARG A 1 157 ? -2.712  -34.245 -16.495 1.00 40.59 ? 164 ARG A NH1 1 
ATOM   1266 N NH2 . ARG A 1 157 ? -0.679  -35.321 -16.315 1.00 46.87 ? 164 ARG A NH2 1 
ATOM   1267 N N   . LEU A 1 158 ? 3.114   -29.306 -17.440 1.00 20.92 ? 165 LEU A N   1 
ATOM   1268 C CA  . LEU A 1 158 ? 3.646   -28.796 -18.695 1.00 21.88 ? 165 LEU A CA  1 
ATOM   1269 C C   . LEU A 1 158 ? 3.184   -29.718 -19.797 1.00 21.77 ? 165 LEU A C   1 
ATOM   1270 O O   . LEU A 1 158 ? 3.258   -30.932 -19.699 1.00 22.16 ? 165 LEU A O   1 
ATOM   1271 C CB  . LEU A 1 158 ? 5.138   -28.777 -18.671 1.00 22.20 ? 165 LEU A CB  1 
ATOM   1272 C CG  . LEU A 1 158 ? 5.947   -27.480 -18.689 1.00 29.52 ? 165 LEU A CG  1 
ATOM   1273 C CD1 . LEU A 1 158 ? 5.193   -26.157 -18.737 1.00 30.27 ? 165 LEU A CD1 1 
ATOM   1274 C CD2 . LEU A 1 158 ? 7.234   -27.476 -17.861 1.00 27.16 ? 165 LEU A CD2 1 
ATOM   1275 N N   . LYS A 1 159 ? 2.701   -29.114 -20.881 1.00 23.45 ? 166 LYS A N   1 
ATOM   1276 C CA  . LYS A 1 159 ? 2.393   -29.900 -22.089 1.00 24.62 ? 166 LYS A CA  1 
ATOM   1277 C C   . LYS A 1 159 ? 3.666   -30.350 -22.802 1.00 22.19 ? 166 LYS A C   1 
ATOM   1278 O O   . LYS A 1 159 ? 4.632   -29.570 -22.869 1.00 23.35 ? 166 LYS A O   1 
ATOM   1279 C CB  . LYS A 1 159 ? 1.528   -29.063 -23.019 1.00 25.01 ? 166 LYS A CB  1 
ATOM   1280 C CG  . LYS A 1 159 ? 0.259   -28.554 -22.378 1.00 29.69 ? 166 LYS A CG  1 
ATOM   1281 C CD  . LYS A 1 159 ? -0.633  -27.707 -23.328 1.00 33.91 ? 166 LYS A CD  1 
ATOM   1282 C CE  . LYS A 1 159 ? -0.455  -26.210 -23.167 1.00 37.98 ? 166 LYS A CE  1 
ATOM   1283 N NZ  . LYS A 1 159 ? -1.718  -25.439 -23.308 1.00 42.99 ? 166 LYS A NZ  1 
ATOM   1284 N N   . LEU A 1 160 ? 3.665   -31.582 -23.330 1.00 22.14 ? 167 LEU A N   1 
ATOM   1285 C CA  . LEU A 1 160 ? 4.805   -32.125 -24.060 1.00 21.36 ? 167 LEU A CA  1 
ATOM   1286 C C   . LEU A 1 160 ? 4.536   -32.064 -25.571 1.00 24.62 ? 167 LEU A C   1 
ATOM   1287 O O   . LEU A 1 160 ? 3.395   -32.323 -26.002 1.00 25.34 ? 167 LEU A O   1 
ATOM   1288 C CB  . LEU A 1 160 ? 5.036   -33.542 -23.681 1.00 23.62 ? 167 LEU A CB  1 
ATOM   1289 C CG  . LEU A 1 160 ? 5.612   -33.605 -22.245 1.00 24.33 ? 167 LEU A CG  1 
ATOM   1290 C CD1 . LEU A 1 160 ? 5.721   -35.009 -21.741 1.00 25.86 ? 167 LEU A CD1 1 
ATOM   1291 C CD2 . LEU A 1 160 ? 6.936   -32.883 -22.149 1.00 27.37 ? 167 LEU A CD2 1 
ATOM   1292 N N   . LYS A 1 161 ? 5.586   -31.815 -26.345 1.00 28.06 ? 168 LYS A N   1 
ATOM   1293 C CA  . LYS A 1 161 ? 5.402   -31.835 -27.827 1.00 31.67 ? 168 LYS A CA  1 
ATOM   1294 C C   . LYS A 1 161 ? 4.831   -33.148 -28.348 1.00 34.57 ? 168 LYS A C   1 
ATOM   1295 O O   . LYS A 1 161 ? 4.044   -33.159 -29.296 1.00 35.52 ? 168 LYS A O   1 
ATOM   1296 C CB  . LYS A 1 161 ? 6.704   -31.477 -28.539 1.00 32.38 ? 168 LYS A CB  1 
ATOM   1297 C CG  . LYS A 1 161 ? 7.106   -30.029 -28.403 1.00 35.64 ? 168 LYS A CG  1 
ATOM   1298 C CD  . LYS A 1 161 ? 8.347   -29.761 -29.236 1.00 39.42 ? 168 LYS A CD  1 
ATOM   1299 C CE  . LYS A 1 161 ? 8.780   -28.302 -29.169 1.00 41.95 ? 168 LYS A CE  1 
ATOM   1300 N NZ  . LYS A 1 161 ? 9.149   -27.870 -27.799 1.00 41.53 ? 168 LYS A NZ  1 
ATOM   1301 N N   . ASP A 1 162 ? 5.231   -34.277 -27.775 1.00 36.42 ? 169 ASP A N   1 
ATOM   1302 C CA  . ASP A 1 162 ? 4.806   -35.544 -28.276 1.00 37.90 ? 169 ASP A CA  1 
ATOM   1303 C C   . ASP A 1 162 ? 3.473   -35.966 -27.675 1.00 35.93 ? 169 ASP A C   1 
ATOM   1304 O O   . ASP A 1 162 ? 3.042   -37.100 -27.883 1.00 39.56 ? 169 ASP A O   1 
ATOM   1305 C CB  . ASP A 1 162 ? 5.939   -36.593 -28.141 1.00 43.41 ? 169 ASP A CB  1 
ATOM   1306 C CG  . ASP A 1 162 ? 7.101   -36.354 -29.166 1.00 48.13 ? 169 ASP A CG  1 
ATOM   1307 O OD1 . ASP A 1 162 ? 6.901   -35.646 -30.202 1.00 44.45 ? 169 ASP A OD1 1 
ATOM   1308 O OD2 . ASP A 1 162 ? 8.214   -36.885 -28.944 1.00 52.98 ? 169 ASP A OD2 1 
ATOM   1309 N N   . GLY A 1 163 ? 2.778   -35.024 -27.040 1.00 32.65 ? 170 GLY A N   1 
ATOM   1310 C CA  . GLY A 1 163 ? 1.538   -35.282 -26.327 1.00 34.59 ? 170 GLY A CA  1 
ATOM   1311 C C   . GLY A 1 163 ? 1.795   -35.696 -24.872 1.00 35.07 ? 170 GLY A C   1 
ATOM   1312 O O   . GLY A 1 163 ? 2.899   -36.119 -24.495 1.00 37.49 ? 170 GLY A O   1 
ATOM   1313 N N   . GLY A 1 164 ? 0.767   -35.609 -24.071 1.00 35.32 ? 171 GLY A N   1 
ATOM   1314 C CA  . GLY A 1 164 ? 0.956   -35.939 -22.649 1.00 32.64 ? 171 GLY A CA  1 
ATOM   1315 C C   . GLY A 1 164 ? 1.586   -34.755 -21.921 1.00 28.35 ? 171 GLY A C   1 
ATOM   1316 O O   . GLY A 1 164 ? 1.732   -33.649 -22.477 1.00 24.17 ? 171 GLY A O   1 
ATOM   1317 N N   . HIS A 1 165 ? 1.989   -35.003 -20.655 1.00 25.14 ? 172 HIS A N   1 
ATOM   1318 C CA  . HIS A 1 165 ? 2.284   -33.927 -19.737 1.00 26.83 ? 172 HIS A CA  1 
ATOM   1319 C C   . HIS A 1 165 ? 3.483   -34.331 -18.857 1.00 23.35 ? 172 HIS A C   1 
ATOM   1320 O O   . HIS A 1 165 ? 3.798   -35.492 -18.689 1.00 27.26 ? 172 HIS A O   1 
ATOM   1321 C CB  . HIS A 1 165 ? 1.099   -33.636 -18.810 1.00 30.08 ? 172 HIS A CB  1 
ATOM   1322 C CG  . HIS A 1 165 ? -0.060  -33.014 -19.512 1.00 35.88 ? 172 HIS A CG  1 
ATOM   1323 N ND1 . HIS A 1 165 ? -1.101  -33.760 -20.038 1.00 39.89 ? 172 HIS A ND1 1 
ATOM   1324 C CD2 . HIS A 1 165 ? -0.314  -31.731 -19.844 1.00 37.20 ? 172 HIS A CD2 1 
ATOM   1325 C CE1 . HIS A 1 165 ? -1.959  -32.953 -20.634 1.00 41.14 ? 172 HIS A CE1 1 
ATOM   1326 N NE2 . HIS A 1 165 ? -1.506  -31.719 -20.534 1.00 40.70 ? 172 HIS A NE2 1 
ATOM   1327 N N   . TYR A 1 166 ? 4.117   -33.314 -18.321 1.00 23.14 ? 173 TYR A N   1 
ATOM   1328 C CA  . TYR A 1 166 ? 5.296   -33.394 -17.494 1.00 20.05 ? 173 TYR A CA  1 
ATOM   1329 C C   . TYR A 1 166 ? 4.935   -32.544 -16.263 1.00 20.15 ? 173 TYR A C   1 
ATOM   1330 O O   . TYR A 1 166 ? 4.649   -31.392 -16.406 1.00 21.23 ? 173 TYR A O   1 
ATOM   1331 C CB  . TYR A 1 166 ? 6.456   -32.733 -18.237 1.00 20.05 ? 173 TYR A CB  1 
ATOM   1332 C CG  . TYR A 1 166 ? 7.766   -32.619 -17.499 1.00 18.90 ? 173 TYR A CG  1 
ATOM   1333 C CD1 . TYR A 1 166 ? 8.385   -33.718 -16.970 1.00 19.24 ? 173 TYR A CD1 1 
ATOM   1334 C CD2 . TYR A 1 166 ? 8.367   -31.363 -17.315 1.00 20.62 ? 173 TYR A CD2 1 
ATOM   1335 C CE1 . TYR A 1 166 ? 9.624   -33.603 -16.308 1.00 19.58 ? 173 TYR A CE1 1 
ATOM   1336 C CE2 . TYR A 1 166 ? 9.585   -31.234 -16.699 1.00 19.15 ? 173 TYR A CE2 1 
ATOM   1337 C CZ  . TYR A 1 166 ? 10.180  -32.340 -16.159 1.00 18.71 ? 173 TYR A CZ  1 
ATOM   1338 O OH  . TYR A 1 166 ? 11.395  -32.171 -15.545 1.00 19.69 ? 173 TYR A OH  1 
ATOM   1339 N N   . ASP A 1 167 ? 4.933   -33.153 -15.067 1.00 21.18 ? 174 ASP A N   1 
ATOM   1340 C CA  . ASP A 1 167 ? 4.389   -32.508 -13.850 1.00 21.81 ? 174 ASP A CA  1 
ATOM   1341 C C   . ASP A 1 167 ? 5.491   -32.111 -12.867 1.00 20.34 ? 174 ASP A C   1 
ATOM   1342 O O   . ASP A 1 167 ? 6.580   -32.619 -12.925 1.00 19.74 ? 174 ASP A O   1 
ATOM   1343 C CB  . ASP A 1 167 ? 3.437   -33.442 -13.118 1.00 24.37 ? 174 ASP A CB  1 
ATOM   1344 C CG  . ASP A 1 167 ? 2.235   -33.860 -14.012 1.00 31.76 ? 174 ASP A CG  1 
ATOM   1345 O OD1 . ASP A 1 167 ? 1.864   -33.095 -14.929 1.00 32.24 ? 174 ASP A OD1 1 
ATOM   1346 O OD2 . ASP A 1 167 ? 1.713   -34.960 -13.822 1.00 33.68 ? 174 ASP A OD2 1 
ATOM   1347 N N   . ALA A 1 168 ? 5.149   -31.093 -12.095 1.00 19.06 ? 175 ALA A N   1 
ATOM   1348 C CA  . ALA A 1 168 ? 5.969   -30.645 -10.971 1.00 18.04 ? 175 ALA A CA  1 
ATOM   1349 C C   . ALA A 1 168 ? 5.076   -30.342 -9.842  1.00 18.46 ? 175 ALA A C   1 
ATOM   1350 O O   . ALA A 1 168 ? 3.982   -29.823 -9.982  1.00 21.53 ? 175 ALA A O   1 
ATOM   1351 C CB  . ALA A 1 168 ? 6.739   -29.431 -11.265 1.00 17.50 ? 175 ALA A CB  1 
ATOM   1352 N N   . GLU A 1 169 ? 5.601   -30.592 -8.634  1.00 17.44 ? 176 GLU A N   1 
ATOM   1353 C CA  . GLU A 1 169 ? 5.003   -30.070 -7.433  1.00 17.93 ? 176 GLU A CA  1 
ATOM   1354 C C   . GLU A 1 169 ? 5.758   -28.824 -7.005  1.00 17.31 ? 176 GLU A C   1 
ATOM   1355 O O   . GLU A 1 169 ? 6.989   -28.860 -6.986  1.00 17.61 ? 176 GLU A O   1 
ATOM   1356 C CB  . GLU A 1 169 ? 5.159   -31.044 -6.270  1.00 21.24 ? 176 GLU A CB  1 
ATOM   1357 C CG  . GLU A 1 169 ? 4.620   -32.419 -6.471  1.00 25.44 ? 176 GLU A CG  1 
ATOM   1358 C CD  . GLU A 1 169 ? 4.995   -33.350 -5.311  1.00 33.79 ? 176 GLU A CD  1 
ATOM   1359 O OE1 . GLU A 1 169 ? 5.722   -32.968 -4.286  1.00 32.12 ? 176 GLU A OE1 1 
ATOM   1360 O OE2 . GLU A 1 169 ? 4.510   -34.494 -5.417  1.00 38.29 ? 176 GLU A OE2 1 
ATOM   1361 N N   . VAL A 1 170 ? 5.037   -27.767 -6.683  1.00 15.61 ? 177 VAL A N   1 
ATOM   1362 C CA  . VAL A 1 170 ? 5.602   -26.478 -6.397  1.00 15.62 ? 177 VAL A CA  1 
ATOM   1363 C C   . VAL A 1 170 ? 5.094   -25.959 -5.082  1.00 17.56 ? 177 VAL A C   1 
ATOM   1364 O O   . VAL A 1 170 ? 3.880   -26.072 -4.747  1.00 18.23 ? 177 VAL A O   1 
ATOM   1365 C CB  . VAL A 1 170 ? 5.296   -25.397 -7.465  1.00 17.62 ? 177 VAL A CB  1 
ATOM   1366 C CG1 . VAL A 1 170 ? 6.019   -24.095 -7.155  1.00 18.42 ? 177 VAL A CG1 1 
ATOM   1367 C CG2 . VAL A 1 170 ? 5.683   -25.911 -8.829  1.00 20.70 ? 177 VAL A CG2 1 
ATOM   1368 N N   . LYS A 1 171 ? 6.015   -25.454 -4.243  1.00 17.26 ? 178 LYS A N   1 
ATOM   1369 C CA  . LYS A 1 171 ? 5.616   -24.796 -3.033  1.00 16.05 ? 178 LYS A CA  1 
ATOM   1370 C C   . LYS A 1 171 ? 6.388   -23.479 -2.837  1.00 14.76 ? 178 LYS A C   1 
ATOM   1371 O O   . LYS A 1 171 ? 7.610   -23.453 -3.062  1.00 13.72 ? 178 LYS A O   1 
ATOM   1372 C CB  . LYS A 1 171 ? 5.842   -25.693 -1.775  1.00 18.37 ? 178 LYS A CB  1 
ATOM   1373 C CG  . LYS A 1 171 ? 5.337   -25.034 -0.513  1.00 21.11 ? 178 LYS A CG  1 
ATOM   1374 C CD  . LYS A 1 171 ? 5.454   -26.055 0.681   1.00 27.20 ? 178 LYS A CD  1 
ATOM   1375 C CE  . LYS A 1 171 ? 4.838   -25.536 1.968   1.00 29.60 ? 178 LYS A CE  1 
ATOM   1376 N NZ  . LYS A 1 171 ? 5.067   -26.647 2.973   1.00 34.13 ? 178 LYS A NZ  1 
ATOM   1377 N N   . THR A 1 172 ? 5.681   -22.411 -2.494  1.00 15.15 ? 179 THR A N   1 
ATOM   1378 C CA  . THR A 1 172 ? 6.278   -21.106 -2.357  1.00 15.21 ? 179 THR A CA  1 
ATOM   1379 C C   . THR A 1 172 ? 5.880   -20.510 -1.060  1.00 16.43 ? 179 THR A C   1 
ATOM   1380 O O   . THR A 1 172 ? 4.747   -20.689 -0.644  1.00 16.81 ? 179 THR A O   1 
ATOM   1381 C CB  . THR A 1 172 ? 5.838   -20.172 -3.534  1.00 16.57 ? 179 THR A CB  1 
ATOM   1382 O OG1 . THR A 1 172 ? 6.007   -20.906 -4.718  1.00 17.50 ? 179 THR A OG1 1 
ATOM   1383 C CG2 . THR A 1 172 ? 6.664   -18.828 -3.612  1.00 17.91 ? 179 THR A CG2 1 
ATOM   1384 N N   . THR A 1 173 ? 6.810   -19.795 -0.431  1.00 16.33 ? 180 THR A N   1 
ATOM   1385 C CA  . THR A 1 173 ? 6.541   -18.942 0.710   1.00 17.59 ? 180 THR A CA  1 
ATOM   1386 C C   . THR A 1 173 ? 6.677   -17.495 0.290   1.00 17.53 ? 180 THR A C   1 
ATOM   1387 O O   . THR A 1 173 ? 7.769   -17.105 -0.226  1.00 18.11 ? 180 THR A O   1 
ATOM   1388 C CB  . THR A 1 173 ? 7.522   -19.241 1.869   1.00 19.35 ? 180 THR A CB  1 
ATOM   1389 O OG1 . THR A 1 173 ? 7.416   -20.594 2.240   1.00 20.17 ? 180 THR A OG1 1 
ATOM   1390 C CG2 . THR A 1 173 ? 7.289   -18.355 3.021   1.00 21.74 ? 180 THR A CG2 1 
ATOM   1391 N N   . TYR A 1 174 ? 5.620   -16.699 0.520   1.00 17.63 ? 181 TYR A N   1 
ATOM   1392 C CA  . TYR A 1 174 ? 5.580   -15.284 0.209   1.00 18.77 ? 181 TYR A CA  1 
ATOM   1393 C C   . TYR A 1 174 ? 5.570   -14.524 1.532   1.00 21.95 ? 181 TYR A C   1 
ATOM   1394 O O   . TYR A 1 174 ? 4.744   -14.827 2.358   1.00 21.74 ? 181 TYR A O   1 
ATOM   1395 C CB  . TYR A 1 174 ? 4.315   -14.927 -0.625  1.00 20.88 ? 181 TYR A CB  1 
ATOM   1396 C CG  . TYR A 1 174 ? 4.102   -15.768 -1.875  1.00 20.14 ? 181 TYR A CG  1 
ATOM   1397 C CD1 . TYR A 1 174 ? 3.354   -16.933 -1.860  1.00 20.07 ? 181 TYR A CD1 1 
ATOM   1398 C CD2 . TYR A 1 174 ? 4.642   -15.375 -3.114  1.00 20.66 ? 181 TYR A CD2 1 
ATOM   1399 C CE1 . TYR A 1 174 ? 3.159   -17.689 -2.990  1.00 20.29 ? 181 TYR A CE1 1 
ATOM   1400 C CE2 . TYR A 1 174 ? 4.448   -16.150 -4.207  1.00 19.95 ? 181 TYR A CE2 1 
ATOM   1401 C CZ  . TYR A 1 174 ? 3.702   -17.261 -4.171  1.00 21.29 ? 181 TYR A CZ  1 
ATOM   1402 O OH  . TYR A 1 174 ? 3.551   -18.067 -5.267  1.00 22.25 ? 181 TYR A OH  1 
ATOM   1403 N N   . LYS A 1 175 ? 6.506   -13.621 1.757   1.00 20.37 ? 182 LYS A N   1 
ATOM   1404 C CA  . LYS A 1 175 ? 6.527   -12.894 3.006   1.00 21.49 ? 182 LYS A CA  1 
ATOM   1405 C C   . LYS A 1 175 ? 6.678   -11.412 2.822   1.00 21.92 ? 182 LYS A C   1 
ATOM   1406 O O   . LYS A 1 175 ? 7.671   -10.946 2.216   1.00 20.16 ? 182 LYS A O   1 
ATOM   1407 C CB  . LYS A 1 175 ? 7.627   -13.457 3.887   1.00 24.92 ? 182 LYS A CB  1 
ATOM   1408 C CG  . LYS A 1 175 ? 7.685   -12.749 5.244   1.00 28.09 ? 182 LYS A CG  1 
ATOM   1409 C CD  . LYS A 1 175 ? 8.204   -13.614 6.357   1.00 31.87 ? 182 LYS A CD  1 
ATOM   1410 C CE  . LYS A 1 175 ? 7.984   -12.915 7.687   1.00 34.03 ? 182 LYS A CE  1 
ATOM   1411 N NZ  . LYS A 1 175 ? 8.768   -13.647 8.714   1.00 38.09 ? 182 LYS A NZ  1 
ATOM   1412 N N   . ALA A 1 176 ? 5.722   -10.660 3.348   1.00 21.39 ? 183 ALA A N   1 
ATOM   1413 C CA  . ALA A 1 176 ? 5.816   -9.190  3.317   1.00 22.03 ? 183 ALA A CA  1 
ATOM   1414 C C   . ALA A 1 176 ? 6.991   -8.703  4.167   1.00 24.06 ? 183 ALA A C   1 
ATOM   1415 O O   . ALA A 1 176 ? 7.338   -9.286  5.204   1.00 22.42 ? 183 ALA A O   1 
ATOM   1416 C CB  . ALA A 1 176 ? 4.530   -8.542  3.816   1.00 22.49 ? 183 ALA A CB  1 
ATOM   1417 N N   . LYS A 1 177 ? 7.613   -7.618  3.730   1.00 23.77 ? 184 LYS A N   1 
ATOM   1418 C CA  . LYS A 1 177 ? 8.707   -7.034  4.487   1.00 26.79 ? 184 LYS A CA  1 
ATOM   1419 C C   . LYS A 1 177 ? 8.241   -6.471  5.873   1.00 29.49 ? 184 LYS A C   1 
ATOM   1420 O O   . LYS A 1 177 ? 8.982   -6.475  6.815   1.00 34.71 ? 184 LYS A O   1 
ATOM   1421 C CB  . LYS A 1 177 ? 9.459   -6.032  3.595   1.00 26.31 ? 184 LYS A CB  1 
ATOM   1422 C CG  . LYS A 1 177 ? 10.164  -6.745  2.413   1.00 25.95 ? 184 LYS A CG  1 
ATOM   1423 C CD  . LYS A 1 177 ? 10.584  -5.805  1.303   1.00 27.76 ? 184 LYS A CD  1 
ATOM   1424 C CE  . LYS A 1 177 ? 11.479  -6.463  0.254   1.00 27.62 ? 184 LYS A CE  1 
ATOM   1425 N NZ  . LYS A 1 177 ? 11.702  -5.551  -0.904  1.00 28.58 ? 184 LYS A NZ  1 
ATOM   1426 N N   . LYS A 1 178 ? 6.994   -6.032  5.943   1.00 30.78 ? 185 LYS A N   1 
ATOM   1427 C CA  . LYS A 1 178 ? 6.379   -5.487  7.152   1.00 36.25 ? 185 LYS A CA  1 
ATOM   1428 C C   . LYS A 1 178 ? 5.120   -6.302  7.427   1.00 35.58 ? 185 LYS A C   1 
ATOM   1429 O O   . LYS A 1 178 ? 4.468   -6.778  6.479   1.00 32.00 ? 185 LYS A O   1 
ATOM   1430 C CB  . LYS A 1 178 ? 6.086   -3.995  6.943   1.00 37.04 ? 185 LYS A CB  1 
ATOM   1431 C CG  . LYS A 1 178 ? 4.777   -3.703  6.223   1.00 40.25 ? 185 LYS A CG  1 
ATOM   1432 C CD  . LYS A 1 178 ? 4.893   -2.626  5.150   1.00 43.73 ? 185 LYS A CD  1 
ATOM   1433 C CE  . LYS A 1 178 ? 3.530   -2.192  4.608   1.00 44.01 ? 185 LYS A CE  1 
ATOM   1434 N NZ  . LYS A 1 178 ? 2.780   -1.515  5.740   1.00 45.93 ? 185 LYS A NZ  1 
ATOM   1435 N N   . PRO A 1 179 ? 4.758   -6.500  8.721   1.00 30.52 ? 186 PRO A N   1 
ATOM   1436 C CA  . PRO A 1 179 ? 3.626   -7.408  8.931   1.00 33.07 ? 186 PRO A CA  1 
ATOM   1437 C C   . PRO A 1 179 ? 2.397   -6.677  8.447   1.00 33.28 ? 186 PRO A C   1 
ATOM   1438 O O   . PRO A 1 179 ? 2.194   -5.531  8.850   1.00 38.51 ? 186 PRO A O   1 
ATOM   1439 C CB  . PRO A 1 179 ? 3.629   -7.628  10.469  1.00 34.28 ? 186 PRO A CB  1 
ATOM   1440 C CG  . PRO A 1 179 ? 4.343   -6.433  11.029  1.00 33.77 ? 186 PRO A CG  1 
ATOM   1441 C CD  . PRO A 1 179 ? 5.416   -6.143  10.004  1.00 35.11 ? 186 PRO A CD  1 
ATOM   1442 N N   . VAL A 1 180 ? 1.698   -7.247  7.471   1.00 28.77 ? 187 VAL A N   1 
ATOM   1443 C CA  . VAL A 1 180 ? 0.384   -6.770  7.008   1.00 27.33 ? 187 VAL A CA  1 
ATOM   1444 C C   . VAL A 1 180 ? -0.566  -7.986  7.069   1.00 27.60 ? 187 VAL A C   1 
ATOM   1445 O O   . VAL A 1 180 ? -0.155  -9.126  7.374   1.00 26.64 ? 187 VAL A O   1 
ATOM   1446 C CB  . VAL A 1 180 ? 0.395   -6.158  5.622   1.00 29.65 ? 187 VAL A CB  1 
ATOM   1447 C CG1 . VAL A 1 180 ? 0.993   -4.756  5.683   1.00 28.30 ? 187 VAL A CG1 1 
ATOM   1448 C CG2 . VAL A 1 180 ? 1.139   -7.060  4.691   1.00 26.85 ? 187 VAL A CG2 1 
ATOM   1449 N N   . GLN A 1 181 ? -1.843  -7.718  6.856   1.00 27.38 ? 188 GLN A N   1 
ATOM   1450 C CA  . GLN A 1 181 ? -2.839  -8.722  7.187   1.00 26.80 ? 188 GLN A CA  1 
ATOM   1451 C C   . GLN A 1 181 ? -2.804  -9.964  6.245   1.00 24.84 ? 188 GLN A C   1 
ATOM   1452 O O   . GLN A 1 181 ? -2.921  -9.810  5.032   1.00 24.73 ? 188 GLN A O   1 
ATOM   1453 C CB  . GLN A 1 181 ? -4.190  -8.083  7.093   1.00 29.74 ? 188 GLN A CB  1 
ATOM   1454 C CG  . GLN A 1 181 ? -5.230  -9.148  7.215   1.00 34.26 ? 188 GLN A CG  1 
ATOM   1455 C CD  . GLN A 1 181 ? -6.487  -8.603  7.659   1.00 39.42 ? 188 GLN A CD  1 
ATOM   1456 O OE1 . GLN A 1 181 ? -6.886  -8.810  8.787   1.00 45.53 ? 188 GLN A OE1 1 
ATOM   1457 N NE2 . GLN A 1 181 ? -7.129  -7.877  6.788   1.00 40.17 ? 188 GLN A NE2 1 
ATOM   1458 N N   . LEU A 1 182 ? -2.707  -11.169 6.833   1.00 22.70 ? 189 LEU A N   1 
ATOM   1459 C CA  . LEU A 1 182 ? -2.709  -12.412 6.076   1.00 22.44 ? 189 LEU A CA  1 
ATOM   1460 C C   . LEU A 1 182 ? -4.186  -12.779 5.800   1.00 23.57 ? 189 LEU A C   1 
ATOM   1461 O O   . LEU A 1 182 ? -5.053  -12.559 6.692   1.00 24.52 ? 189 LEU A O   1 
ATOM   1462 C CB  . LEU A 1 182 ? -2.008  -13.501 6.891   1.00 22.38 ? 189 LEU A CB  1 
ATOM   1463 C CG  . LEU A 1 182 ? -0.489  -13.465 6.822   1.00 21.56 ? 189 LEU A CG  1 
ATOM   1464 C CD1 . LEU A 1 182 ? 0.144   -14.256 7.915   1.00 22.37 ? 189 LEU A CD1 1 
ATOM   1465 C CD2 . LEU A 1 182 ? 0.016   -13.968 5.478   1.00 22.18 ? 189 LEU A CD2 1 
ATOM   1466 N N   . PRO A 1 183 ? -4.463  -13.414 4.666   1.00 21.28 ? 190 PRO A N   1 
ATOM   1467 C CA  . PRO A 1 183 ? -5.731  -13.990 4.403   1.00 21.28 ? 190 PRO A CA  1 
ATOM   1468 C C   . PRO A 1 183 ? -5.867  -15.329 5.061   1.00 20.66 ? 190 PRO A C   1 
ATOM   1469 O O   . PRO A 1 183 ? -4.863  -15.936 5.594   1.00 21.50 ? 190 PRO A O   1 
ATOM   1470 C CB  . PRO A 1 183 ? -5.698  -14.170 2.877   1.00 21.66 ? 190 PRO A CB  1 
ATOM   1471 C CG  . PRO A 1 183 ? -4.318  -14.555 2.618   1.00 22.18 ? 190 PRO A CG  1 
ATOM   1472 C CD  . PRO A 1 183 ? -3.524  -13.705 3.544   1.00 21.84 ? 190 PRO A CD  1 
ATOM   1473 N N   . GLY A 1 184 ? -7.054  -15.906 4.945   1.00 21.01 ? 191 GLY A N   1 
ATOM   1474 C CA  . GLY A 1 184 ? -7.203  -17.366 5.176   1.00 20.08 ? 191 GLY A CA  1 
ATOM   1475 C C   . GLY A 1 184 ? -6.820  -18.233 4.036   1.00 20.02 ? 191 GLY A C   1 
ATOM   1476 O O   . GLY A 1 184 ? -6.036  -17.771 3.146   1.00 20.81 ? 191 GLY A O   1 
ATOM   1477 N N   . ALA A 1 185 ? -7.370  -19.429 3.968   1.00 18.06 ? 192 ALA A N   1 
ATOM   1478 C CA  . ALA A 1 185 ? -7.100  -20.332 2.877   1.00 18.06 ? 192 ALA A CA  1 
ATOM   1479 C C   . ALA A 1 185 ? -7.990  -19.894 1.715   1.00 19.61 ? 192 ALA A C   1 
ATOM   1480 O O   . ALA A 1 185 ? -9.142  -19.543 1.953   1.00 20.22 ? 192 ALA A O   1 
ATOM   1481 C CB  . ALA A 1 185 ? -7.430  -21.754 3.202   1.00 17.72 ? 192 ALA A CB  1 
ATOM   1482 N N   . TYR A 1 186 ? -7.430  -19.900 0.493   1.00 19.90 ? 193 TYR A N   1 
ATOM   1483 C CA  . TYR A 1 186 ? -8.208  -19.619 -0.700  1.00 19.31 ? 193 TYR A CA  1 
ATOM   1484 C C   . TYR A 1 186 ? -7.433  -20.125 -1.892  1.00 19.32 ? 193 TYR A C   1 
ATOM   1485 O O   . TYR A 1 186 ? -6.334  -20.653 -1.753  1.00 17.10 ? 193 TYR A O   1 
ATOM   1486 C CB  . TYR A 1 186 ? -8.486  -18.114 -0.864  1.00 21.75 ? 193 TYR A CB  1 
ATOM   1487 C CG  . TYR A 1 186 ? -7.346  -17.206 -1.160  1.00 20.05 ? 193 TYR A CG  1 
ATOM   1488 C CD1 . TYR A 1 186 ? -6.339  -16.962 -0.238  1.00 20.34 ? 193 TYR A CD1 1 
ATOM   1489 C CD2 . TYR A 1 186 ? -7.232  -16.576 -2.429  1.00 20.25 ? 193 TYR A CD2 1 
ATOM   1490 C CE1 . TYR A 1 186 ? -5.300  -16.088 -0.519  1.00 20.33 ? 193 TYR A CE1 1 
ATOM   1491 C CE2 . TYR A 1 186 ? -6.200  -15.721 -2.690  1.00 20.33 ? 193 TYR A CE2 1 
ATOM   1492 C CZ  . TYR A 1 186 ? -5.177  -15.508 -1.767  1.00 20.18 ? 193 TYR A CZ  1 
ATOM   1493 O OH  . TYR A 1 186 ? -4.123  -14.632 -2.022  1.00 21.86 ? 193 TYR A OH  1 
ATOM   1494 N N   . ASN A 1 187 ? -8.005  -19.959 -3.119  1.00 18.68 ? 194 ASN A N   1 
ATOM   1495 C CA  . ASN A 1 187 ? -7.305  -20.468 -4.288  1.00 20.57 ? 194 ASN A CA  1 
ATOM   1496 C C   . ASN A 1 187 ? -7.105  -19.402 -5.300  1.00 18.97 ? 194 ASN A C   1 
ATOM   1497 O O   . ASN A 1 187 ? -7.864  -18.456 -5.324  1.00 20.00 ? 194 ASN A O   1 
ATOM   1498 C CB  . ASN A 1 187 ? -8.058  -21.586 -5.003  1.00 23.79 ? 194 ASN A CB  1 
ATOM   1499 C CG  . ASN A 1 187 ? -8.354  -22.706 -4.118  1.00 31.64 ? 194 ASN A CG  1 
ATOM   1500 O OD1 . ASN A 1 187 ? -7.459  -23.219 -3.461  1.00 39.39 ? 194 ASN A OD1 1 
ATOM   1501 N ND2 . ASN A 1 187 ? -9.633  -23.096 -4.046  1.00 35.03 ? 194 ASN A ND2 1 
ATOM   1502 N N   . VAL A 1 188 ? -6.016  -19.532 -6.038  1.00 18.32 ? 195 VAL A N   1 
ATOM   1503 C CA  . VAL A 1 188 ? -5.762  -18.632 -7.189  1.00 19.57 ? 195 VAL A CA  1 
ATOM   1504 C C   . VAL A 1 188 ? -5.670  -19.412 -8.485  1.00 20.90 ? 195 VAL A C   1 
ATOM   1505 O O   . VAL A 1 188 ? -4.830  -20.298 -8.668  1.00 22.18 ? 195 VAL A O   1 
ATOM   1506 C CB  . VAL A 1 188 ? -4.478  -17.801 -6.947  1.00 19.89 ? 195 VAL A CB  1 
ATOM   1507 C CG1 . VAL A 1 188 ? -4.181  -16.881 -8.138  1.00 19.81 ? 195 VAL A CG1 1 
ATOM   1508 C CG2 . VAL A 1 188 ? -4.482  -17.003 -5.683  1.00 19.98 ? 195 VAL A CG2 1 
ATOM   1509 N N   . ASN A 1 189 ? -6.543  -19.025 -9.442  1.00 20.74 ? 196 ASN A N   1 
ATOM   1510 C CA  . ASN A 1 189 ? -6.603  -19.643 -10.745 1.00 23.00 ? 196 ASN A CA  1 
ATOM   1511 C C   . ASN A 1 189 ? -5.696  -18.825 -11.654 1.00 19.76 ? 196 ASN A C   1 
ATOM   1512 O O   . ASN A 1 189 ? -5.868  -17.656 -11.731 1.00 21.71 ? 196 ASN A O   1 
ATOM   1513 C CB  . ASN A 1 189 ? -8.045  -19.576 -11.224 1.00 25.03 ? 196 ASN A CB  1 
ATOM   1514 C CG  . ASN A 1 189 ? -8.919  -20.550 -10.490 1.00 29.96 ? 196 ASN A CG  1 
ATOM   1515 O OD1 . ASN A 1 189 ? -8.445  -21.575 -10.005 1.00 34.04 ? 196 ASN A OD1 1 
ATOM   1516 N ND2 . ASN A 1 189 ? -10.168 -20.221 -10.354 1.00 37.28 ? 196 ASN A ND2 1 
ATOM   1517 N N   . ILE A 1 190 ? -4.726  -19.476 -12.282 1.00 20.09 ? 197 ILE A N   1 
ATOM   1518 C CA  . ILE A 1 190 ? -3.696  -18.808 -13.075 1.00 19.71 ? 197 ILE A CA  1 
ATOM   1519 C C   . ILE A 1 190 ? -3.616  -19.441 -14.463 1.00 20.28 ? 197 ILE A C   1 
ATOM   1520 O O   . ILE A 1 190 ? -3.694  -20.657 -14.592 1.00 20.87 ? 197 ILE A O   1 
ATOM   1521 C CB  . ILE A 1 190 ? -2.315  -18.969 -12.429 1.00 23.97 ? 197 ILE A CB  1 
ATOM   1522 C CG1 . ILE A 1 190 ? -2.327  -18.501 -10.982 1.00 25.87 ? 197 ILE A CG1 1 
ATOM   1523 C CG2 . ILE A 1 190 ? -1.273  -18.104 -13.114 1.00 24.36 ? 197 ILE A CG2 1 
ATOM   1524 C CD1 . ILE A 1 190 ? -1.247  -19.215 -10.194 1.00 27.27 ? 197 ILE A CD1 1 
ATOM   1525 N N   . LYS A 1 191 ? -3.474  -18.595 -15.471 1.00 20.85 ? 198 LYS A N   1 
ATOM   1526 C CA  . LYS A 1 191 ? -3.177  -19.138 -16.801 1.00 23.60 ? 198 LYS A CA  1 
ATOM   1527 C C   . LYS A 1 191 ? -2.062  -18.286 -17.345 1.00 21.52 ? 198 LYS A C   1 
ATOM   1528 O O   . LYS A 1 191 ? -2.190  -17.069 -17.413 1.00 22.65 ? 198 LYS A O   1 
ATOM   1529 C CB  . LYS A 1 191 ? -4.382  -19.078 -17.723 1.00 26.27 ? 198 LYS A CB  1 
ATOM   1530 C CG  . LYS A 1 191 ? -4.117  -19.971 -18.938 1.00 29.39 ? 198 LYS A CG  1 
ATOM   1531 C CD  . LYS A 1 191 ? -5.245  -19.762 -19.950 1.00 35.86 ? 198 LYS A CD  1 
ATOM   1532 C CE  . LYS A 1 191 ? -5.394  -20.979 -20.826 1.00 38.49 ? 198 LYS A CE  1 
ATOM   1533 N NZ  . LYS A 1 191 ? -4.078  -21.369 -21.410 1.00 41.01 ? 198 LYS A NZ  1 
ATOM   1534 N N   . LEU A 1 192 ? -0.966  -18.923 -17.673 1.00 22.44 ? 199 LEU A N   1 
ATOM   1535 C CA  . LEU A 1 192 ? 0.202   -18.232 -18.217 1.00 23.53 ? 199 LEU A CA  1 
ATOM   1536 C C   . LEU A 1 192 ? 0.510   -18.713 -19.599 1.00 21.33 ? 199 LEU A C   1 
ATOM   1537 O O   . LEU A 1 192 ? 0.559   -19.893 -19.818 1.00 21.20 ? 199 LEU A O   1 
ATOM   1538 C CB  . LEU A 1 192 ? 1.355   -18.483 -17.257 1.00 25.23 ? 199 LEU A CB  1 
ATOM   1539 C CG  . LEU A 1 192 ? 2.769   -18.155 -17.669 1.00 28.42 ? 199 LEU A CG  1 
ATOM   1540 C CD1 . LEU A 1 192 ? 3.000   -16.710 -17.766 1.00 31.33 ? 199 LEU A CD1 1 
ATOM   1541 C CD2 . LEU A 1 192 ? 3.753   -18.741 -16.644 1.00 31.13 ? 199 LEU A CD2 1 
ATOM   1542 N N   . ASP A 1 193 ? 0.612   -17.769 -20.555 1.00 23.50 ? 200 ASP A N   1 
ATOM   1543 C CA  . ASP A 1 193 ? 0.817   -18.115 -21.965 1.00 25.29 ? 200 ASP A CA  1 
ATOM   1544 C C   . ASP A 1 193 ? 2.038   -17.403 -22.469 1.00 22.14 ? 200 ASP A C   1 
ATOM   1545 O O   . ASP A 1 193 ? 2.300   -16.267 -22.110 1.00 21.68 ? 200 ASP A O   1 
ATOM   1546 C CB  . ASP A 1 193 ? -0.345  -17.553 -22.791 1.00 28.15 ? 200 ASP A CB  1 
ATOM   1547 C CG  . ASP A 1 193 ? -1.691  -17.955 -22.294 1.00 30.81 ? 200 ASP A CG  1 
ATOM   1548 O OD1 . ASP A 1 193 ? -1.881  -19.126 -21.996 1.00 33.09 ? 200 ASP A OD1 1 
ATOM   1549 O OD2 . ASP A 1 193 ? -2.602  -17.069 -22.267 1.00 35.26 ? 200 ASP A OD2 1 
ATOM   1550 N N   . ILE A 1 194 ? 2.784   -18.100 -23.313 1.00 23.61 ? 201 ILE A N   1 
ATOM   1551 C CA  . ILE A 1 194 ? 3.845   -17.506 -24.090 1.00 23.91 ? 201 ILE A CA  1 
ATOM   1552 C C   . ILE A 1 194 ? 3.141   -17.022 -25.360 1.00 22.74 ? 201 ILE A C   1 
ATOM   1553 O O   . ILE A 1 194 ? 2.639   -17.862 -26.143 1.00 23.87 ? 201 ILE A O   1 
ATOM   1554 C CB  . ILE A 1 194 ? 4.942   -18.487 -24.452 1.00 23.43 ? 201 ILE A CB  1 
ATOM   1555 C CG1 . ILE A 1 194 ? 5.624   -19.110 -23.226 1.00 25.95 ? 201 ILE A CG1 1 
ATOM   1556 C CG2 . ILE A 1 194 ? 6.001   -17.830 -25.336 1.00 24.10 ? 201 ILE A CG2 1 
ATOM   1557 C CD1 . ILE A 1 194 ? 6.084   -18.164 -22.149 1.00 24.71 ? 201 ILE A CD1 1 
ATOM   1558 N N   . THR A 1 195 ? 3.184   -15.713 -25.538 1.00 21.92 ? 202 THR A N   1 
ATOM   1559 C CA  . THR A 1 195 ? 2.415   -15.017 -26.608 1.00 23.57 ? 202 THR A CA  1 
ATOM   1560 C C   . THR A 1 195 ? 3.256   -14.861 -27.861 1.00 27.25 ? 202 THR A C   1 
ATOM   1561 O O   . THR A 1 195 ? 2.696   -14.864 -28.974 1.00 26.21 ? 202 THR A O   1 
ATOM   1562 C CB  . THR A 1 195 ? 1.794   -13.678 -26.164 1.00 24.57 ? 202 THR A CB  1 
ATOM   1563 O OG1 . THR A 1 195 ? 2.767   -12.764 -25.650 1.00 26.59 ? 202 THR A OG1 1 
ATOM   1564 C CG2 . THR A 1 195 ? 0.711   -13.882 -25.073 1.00 27.37 ? 202 THR A CG2 1 
ATOM   1565 N N   . SER A 1 196 ? 4.563   -14.700 -27.682 1.00 24.08 ? 203 SER A N   1 
ATOM   1566 C CA  . SER A 1 196 ? 5.482   -14.635 -28.805 1.00 26.42 ? 203 SER A CA  1 
ATOM   1567 C C   . SER A 1 196 ? 6.905   -14.926 -28.409 1.00 25.84 ? 203 SER A C   1 
ATOM   1568 O O   . SER A 1 196 ? 7.300   -14.806 -27.238 1.00 25.67 ? 203 SER A O   1 
ATOM   1569 C CB  . SER A 1 196 ? 5.362   -13.249 -29.458 1.00 33.14 ? 203 SER A CB  1 
ATOM   1570 O OG  . SER A 1 196 ? 6.307   -12.402 -28.953 1.00 40.55 ? 203 SER A OG  1 
ATOM   1571 N N   . HIS A 1 197 ? 7.703   -15.384 -29.367 1.00 22.36 ? 204 HIS A N   1 
ATOM   1572 C CA  . HIS A 1 197 ? 9.067   -15.626 -29.097 1.00 22.93 ? 204 HIS A CA  1 
ATOM   1573 C C   . HIS A 1 197 ? 9.754   -15.769 -30.437 1.00 24.17 ? 204 HIS A C   1 
ATOM   1574 O O   . HIS A 1 197 ? 9.121   -16.172 -31.436 1.00 25.35 ? 204 HIS A O   1 
ATOM   1575 C CB  . HIS A 1 197 ? 9.254   -16.933 -28.292 1.00 23.48 ? 204 HIS A CB  1 
ATOM   1576 C CG  . HIS A 1 197 ? 8.786   -18.152 -28.999 1.00 23.14 ? 204 HIS A CG  1 
ATOM   1577 N ND1 . HIS A 1 197 ? 9.597   -18.841 -29.878 1.00 25.80 ? 204 HIS A ND1 1 
ATOM   1578 C CD2 . HIS A 1 197 ? 7.586   -18.766 -29.033 1.00 25.83 ? 204 HIS A CD2 1 
ATOM   1579 C CE1 . HIS A 1 197 ? 8.925   -19.843 -30.406 1.00 27.95 ? 204 HIS A CE1 1 
ATOM   1580 N NE2 . HIS A 1 197 ? 7.706   -19.829 -29.896 1.00 30.12 ? 204 HIS A NE2 1 
ATOM   1581 N N   . ASN A 1 198 ? 11.012  -15.474 -30.417 1.00 22.33 ? 205 ASN A N   1 
ATOM   1582 C CA  . ASN A 1 198 ? 11.888  -15.703 -31.576 1.00 24.35 ? 205 ASN A CA  1 
ATOM   1583 C C   . ASN A 1 198 ? 12.392  -17.138 -31.573 1.00 24.20 ? 205 ASN A C   1 
ATOM   1584 O O   . ASN A 1 198 ? 12.088  -17.959 -30.653 1.00 25.54 ? 205 ASN A O   1 
ATOM   1585 C CB  . ASN A 1 198 ? 13.000  -14.663 -31.636 1.00 23.06 ? 205 ASN A CB  1 
ATOM   1586 C CG  . ASN A 1 198 ? 13.983  -14.732 -30.527 1.00 26.78 ? 205 ASN A CG  1 
ATOM   1587 O OD1 . ASN A 1 198 ? 13.856  -15.525 -29.565 1.00 25.84 ? 205 ASN A OD1 1 
ATOM   1588 N ND2 . ASN A 1 198 ? 14.924  -13.831 -30.577 1.00 25.61 ? 205 ASN A ND2 1 
ATOM   1589 N N   . GLU A 1 199 ? 13.121  -17.492 -32.631 1.00 26.69 ? 206 GLU A N   1 
ATOM   1590 C CA  . GLU A 1 199 ? 13.393  -18.903 -32.850 1.00 29.96 ? 206 GLU A CA  1 
ATOM   1591 C C   . GLU A 1 199 ? 14.121  -19.573 -31.709 1.00 27.07 ? 206 GLU A C   1 
ATOM   1592 O O   . GLU A 1 199 ? 13.856  -20.748 -31.384 1.00 28.58 ? 206 GLU A O   1 
ATOM   1593 C CB  . GLU A 1 199 ? 14.184  -19.087 -34.159 1.00 35.26 ? 206 GLU A CB  1 
ATOM   1594 C CG  . GLU A 1 199 ? 13.905  -20.441 -34.768 1.00 42.81 ? 206 GLU A CG  1 
ATOM   1595 C CD  . GLU A 1 199 ? 14.836  -20.819 -35.908 1.00 51.71 ? 206 GLU A CD  1 
ATOM   1596 O OE1 . GLU A 1 199 ? 15.766  -20.046 -36.248 1.00 54.91 ? 206 GLU A OE1 1 
ATOM   1597 O OE2 . GLU A 1 199 ? 14.637  -21.931 -36.450 1.00 51.68 ? 206 GLU A OE2 1 
ATOM   1598 N N   . ASP A 1 200 ? 15.046  -18.848 -31.116 1.00 23.59 ? 207 ASP A N   1 
ATOM   1599 C CA  . ASP A 1 200 ? 15.910  -19.412 -30.106 1.00 25.55 ? 207 ASP A CA  1 
ATOM   1600 C C   . ASP A 1 200 ? 15.519  -18.972 -28.679 1.00 23.42 ? 207 ASP A C   1 
ATOM   1601 O O   . ASP A 1 200 ? 16.328  -19.155 -27.755 1.00 22.19 ? 207 ASP A O   1 
ATOM   1602 C CB  . ASP A 1 200 ? 17.396  -19.101 -30.356 1.00 27.59 ? 207 ASP A CB  1 
ATOM   1603 C CG  . ASP A 1 200 ? 17.722  -17.638 -30.334 1.00 27.37 ? 207 ASP A CG  1 
ATOM   1604 O OD1 . ASP A 1 200 ? 16.818  -16.789 -30.134 1.00 30.59 ? 207 ASP A OD1 1 
ATOM   1605 O OD2 . ASP A 1 200 ? 18.912  -17.314 -30.545 1.00 32.29 ? 207 ASP A OD2 1 
ATOM   1606 N N   . TYR A 1 201 ? 14.349  -18.363 -28.554 1.00 22.79 ? 208 TYR A N   1 
ATOM   1607 C CA  . TYR A 1 201 ? 13.825  -17.886 -27.281 1.00 22.49 ? 208 TYR A CA  1 
ATOM   1608 C C   . TYR A 1 201 ? 14.780  -16.966 -26.547 1.00 23.77 ? 208 TYR A C   1 
ATOM   1609 O O   . TYR A 1 201 ? 14.838  -16.936 -25.298 1.00 23.16 ? 208 TYR A O   1 
ATOM   1610 C CB  . TYR A 1 201 ? 13.449  -19.065 -26.401 1.00 24.48 ? 208 TYR A CB  1 
ATOM   1611 C CG  . TYR A 1 201 ? 12.245  -19.838 -26.798 1.00 22.28 ? 208 TYR A CG  1 
ATOM   1612 C CD1 . TYR A 1 201 ? 12.305  -20.791 -27.786 1.00 24.69 ? 208 TYR A CD1 1 
ATOM   1613 C CD2 . TYR A 1 201 ? 11.043  -19.641 -26.154 1.00 24.22 ? 208 TYR A CD2 1 
ATOM   1614 C CE1 . TYR A 1 201 ? 11.201  -21.519 -28.139 1.00 25.83 ? 208 TYR A CE1 1 
ATOM   1615 C CE2 . TYR A 1 201 ? 9.907   -20.387 -26.482 1.00 27.62 ? 208 TYR A CE2 1 
ATOM   1616 C CZ  . TYR A 1 201 ? 9.993   -21.326 -27.482 1.00 26.25 ? 208 TYR A CZ  1 
ATOM   1617 O OH  . TYR A 1 201 ? 8.871   -22.087 -27.813 1.00 29.25 ? 208 TYR A OH  1 
ATOM   1618 N N   . THR A 1 202 ? 15.504  -16.124 -27.292 1.00 20.51 ? 209 THR A N   1 
ATOM   1619 C CA  . THR A 1 202 ? 16.228  -15.031 -26.696 1.00 19.99 ? 209 THR A CA  1 
ATOM   1620 C C   . THR A 1 202 ? 15.391  -13.754 -26.469 1.00 19.67 ? 209 THR A C   1 
ATOM   1621 O O   . THR A 1 202 ? 15.822  -12.871 -25.732 1.00 22.27 ? 209 THR A O   1 
ATOM   1622 C CB  . THR A 1 202 ? 17.517  -14.686 -27.445 1.00 23.27 ? 209 THR A CB  1 
ATOM   1623 O OG1 . THR A 1 202 ? 17.172  -14.458 -28.814 1.00 24.68 ? 209 THR A OG1 1 
ATOM   1624 C CG2 . THR A 1 202 ? 18.591  -15.799 -27.240 1.00 24.95 ? 209 THR A CG2 1 
ATOM   1625 N N   . ILE A 1 203 ? 14.227  -13.688 -27.097 1.00 19.52 ? 210 ILE A N   1 
ATOM   1626 C CA  . ILE A 1 203 ? 13.214  -12.688 -26.902 1.00 20.00 ? 210 ILE A CA  1 
ATOM   1627 C C   . ILE A 1 203 ? 11.873  -13.366 -26.801 1.00 20.70 ? 210 ILE A C   1 
ATOM   1628 O O   . ILE A 1 203 ? 11.435  -14.115 -27.702 1.00 24.16 ? 210 ILE A O   1 
ATOM   1629 C CB  . ILE A 1 203 ? 13.182  -11.645 -28.097 1.00 20.93 ? 210 ILE A CB  1 
ATOM   1630 C CG1 . ILE A 1 203 ? 14.580  -11.045 -28.250 1.00 22.27 ? 210 ILE A CG1 1 
ATOM   1631 C CG2 . ILE A 1 203 ? 12.093  -10.604 -27.793 1.00 21.72 ? 210 ILE A CG2 1 
ATOM   1632 C CD1 . ILE A 1 203 ? 14.670  -10.120 -29.482 1.00 24.32 ? 210 ILE A CD1 1 
ATOM   1633 N N   . VAL A 1 204 ? 11.197  -13.105 -25.673 1.00 19.17 ? 211 VAL A N   1 
ATOM   1634 C CA  . VAL A 1 204 ? 9.983   -13.812 -25.302 1.00 18.92 ? 211 VAL A CA  1 
ATOM   1635 C C   . VAL A 1 204 ? 8.985   -12.884 -24.665 1.00 18.46 ? 211 VAL A C   1 
ATOM   1636 O O   . VAL A 1 204 ? 9.369   -11.965 -23.885 1.00 22.76 ? 211 VAL A O   1 
ATOM   1637 C CB  . VAL A 1 204 ? 10.286  -14.985 -24.281 1.00 19.29 ? 211 VAL A CB  1 
ATOM   1638 C CG1 . VAL A 1 204 ? 8.998   -15.755 -24.044 1.00 20.50 ? 211 VAL A CG1 1 
ATOM   1639 C CG2 . VAL A 1 204 ? 11.363  -15.903 -24.809 1.00 19.97 ? 211 VAL A CG2 1 
ATOM   1640 N N   . GLU A 1 205 ? 7.739   -13.037 -25.082 1.00 19.40 ? 212 GLU A N   1 
ATOM   1641 C CA  . GLU A 1 205 ? 6.644   -12.317 -24.536 1.00 21.19 ? 212 GLU A CA  1 
ATOM   1642 C C   . GLU A 1 205 ? 5.674   -13.256 -23.862 1.00 19.36 ? 212 GLU A C   1 
ATOM   1643 O O   . GLU A 1 205 ? 5.345   -14.311 -24.366 1.00 20.20 ? 212 GLU A O   1 
ATOM   1644 C CB  . GLU A 1 205 ? 5.927   -11.472 -25.584 1.00 24.83 ? 212 GLU A CB  1 
ATOM   1645 C CG  . GLU A 1 205 ? 6.766   -10.262 -25.983 1.00 27.62 ? 212 GLU A CG  1 
ATOM   1646 C CD  . GLU A 1 205 ? 6.121   -9.327  -27.011 1.00 32.00 ? 212 GLU A CD  1 
ATOM   1647 O OE1 . GLU A 1 205 ? 4.885   -9.187  -27.114 1.00 33.33 ? 212 GLU A OE1 1 
ATOM   1648 O OE2 . GLU A 1 205 ? 6.899   -8.682  -27.719 1.00 40.45 ? 212 GLU A OE2 1 
ATOM   1649 N N   . GLN A 1 206 ? 5.208   -12.818 -22.679 1.00 19.99 ? 213 GLN A N   1 
ATOM   1650 C CA  . GLN A 1 206 ? 4.277   -13.594 -21.888 1.00 19.58 ? 213 GLN A CA  1 
ATOM   1651 C C   . GLN A 1 206 ? 3.057   -12.799 -21.494 1.00 19.76 ? 213 GLN A C   1 
ATOM   1652 O O   . GLN A 1 206 ? 3.080   -11.544 -21.434 1.00 23.09 ? 213 GLN A O   1 
ATOM   1653 C CB  . GLN A 1 206 ? 4.957   -14.005 -20.543 1.00 19.86 ? 213 GLN A CB  1 
ATOM   1654 C CG  . GLN A 1 206 ? 6.178   -14.798 -20.778 1.00 21.94 ? 213 GLN A CG  1 
ATOM   1655 C CD  . GLN A 1 206 ? 6.797   -15.477 -19.554 1.00 20.32 ? 213 GLN A CD  1 
ATOM   1656 O OE1 . GLN A 1 206 ? 7.758   -16.157 -19.722 1.00 22.05 ? 213 GLN A OE1 1 
ATOM   1657 N NE2 . GLN A 1 206 ? 6.308   -15.185 -18.328 1.00 20.89 ? 213 GLN A NE2 1 
ATOM   1658 N N   . TYR A 1 207 ? 1.982   -13.535 -21.206 1.00 21.18 ? 214 TYR A N   1 
ATOM   1659 C CA  . TYR A 1 207 ? 0.785   -12.986 -20.682 1.00 20.76 ? 214 TYR A CA  1 
ATOM   1660 C C   . TYR A 1 207 ? 0.322   -13.858 -19.484 1.00 20.94 ? 214 TYR A C   1 
ATOM   1661 O O   . TYR A 1 207 ? 0.359   -15.049 -19.622 1.00 20.40 ? 214 TYR A O   1 
ATOM   1662 C CB  . TYR A 1 207 ? -0.271  -13.012 -21.743 1.00 23.89 ? 214 TYR A CB  1 
ATOM   1663 C CG  . TYR A 1 207 ? -1.629  -12.610 -21.220 1.00 26.17 ? 214 TYR A CG  1 
ATOM   1664 C CD1 . TYR A 1 207 ? -1.963  -11.267 -21.064 1.00 26.51 ? 214 TYR A CD1 1 
ATOM   1665 C CD2 . TYR A 1 207 ? -2.562  -13.564 -20.897 1.00 26.93 ? 214 TYR A CD2 1 
ATOM   1666 C CE1 . TYR A 1 207 ? -3.224  -10.877 -20.655 1.00 29.55 ? 214 TYR A CE1 1 
ATOM   1667 C CE2 . TYR A 1 207 ? -3.828  -13.183 -20.400 1.00 31.58 ? 214 TYR A CE2 1 
ATOM   1668 C CZ  . TYR A 1 207 ? -4.155  -11.840 -20.301 1.00 30.47 ? 214 TYR A CZ  1 
ATOM   1669 O OH  . TYR A 1 207 ? -5.432  -11.446 -19.821 1.00 35.77 ? 214 TYR A OH  1 
ATOM   1670 N N   . GLU A 1 208 ? -0.189  -13.235 -18.449 1.00 20.53 ? 215 GLU A N   1 
ATOM   1671 C CA  . GLU A 1 208 ? -0.763  -14.029 -17.345 1.00 23.50 ? 215 GLU A CA  1 
ATOM   1672 C C   . GLU A 1 208 ? -2.045  -13.399 -16.828 1.00 22.61 ? 215 GLU A C   1 
ATOM   1673 O O   . GLU A 1 208 ? -2.216  -12.190 -16.847 1.00 24.18 ? 215 GLU A O   1 
ATOM   1674 C CB  . GLU A 1 208 ? 0.239   -14.139 -16.207 1.00 24.27 ? 215 GLU A CB  1 
ATOM   1675 C CG  . GLU A 1 208 ? -0.282  -15.123 -15.164 1.00 25.99 ? 215 GLU A CG  1 
ATOM   1676 C CD  . GLU A 1 208 ? 0.631   -15.293 -13.967 1.00 35.24 ? 215 GLU A CD  1 
ATOM   1677 O OE1 . GLU A 1 208 ? 1.517   -16.177 -13.995 1.00 41.09 ? 215 GLU A OE1 1 
ATOM   1678 O OE2 . GLU A 1 208 ? 0.410   -14.560 -12.972 1.00 41.80 ? 215 GLU A OE2 1 
ATOM   1679 N N   . ARG A 1 209 ? -2.991  -14.259 -16.509 1.00 22.19 ? 216 ARG A N   1 
ATOM   1680 C CA  . ARG A 1 209 ? -4.189  -13.827 -15.817 1.00 23.63 ? 216 ARG A CA  1 
ATOM   1681 C C   . ARG A 1 209 ? -4.283  -14.645 -14.515 1.00 20.42 ? 216 ARG A C   1 
ATOM   1682 O O   . ARG A 1 209 ? -4.112  -15.858 -14.575 1.00 23.03 ? 216 ARG A O   1 
ATOM   1683 C CB  . ARG A 1 209 ? -5.416  -14.094 -16.671 1.00 26.90 ? 216 ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 209 ? -6.669  -13.451 -16.027 1.00 31.82 ? 216 ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 209 ? -7.958  -13.872 -16.713 1.00 35.76 ? 216 ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 209 ? -8.588  -12.719 -17.326 1.00 42.94 ? 216 ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 209 ? -8.366  -12.313 -18.576 1.00 46.83 ? 216 ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 209 ? -7.542  -12.995 -19.410 1.00 50.28 ? 216 ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 209 ? -8.994  -11.224 -19.006 1.00 49.50 ? 216 ARG A NH2 1 
ATOM   1690 N N   . ALA A 1 210 ? -4.570  -13.973 -13.418 1.00 21.68 ? 217 ALA A N   1 
ATOM   1691 C CA  . ALA A 1 210 ? -4.647  -14.668 -12.079 1.00 21.31 ? 217 ALA A CA  1 
ATOM   1692 C C   . ALA A 1 210 ? -5.758  -14.060 -11.306 1.00 21.13 ? 217 ALA A C   1 
ATOM   1693 O O   . ALA A 1 210 ? -5.872  -12.826 -11.220 1.00 21.98 ? 217 ALA A O   1 
ATOM   1694 C CB  . ALA A 1 210 ? -3.345  -14.501 -11.349 1.00 20.98 ? 217 ALA A CB  1 
ATOM   1695 N N   . GLU A 1 211 ? -6.585  -14.921 -10.689 1.00 22.18 ? 218 GLU A N   1 
ATOM   1696 C CA  . GLU A 1 211 ? -7.715  -14.451 -9.935  1.00 25.05 ? 218 GLU A CA  1 
ATOM   1697 C C   . GLU A 1 211 ? -7.948  -15.323 -8.686  1.00 22.80 ? 218 GLU A C   1 
ATOM   1698 O O   . GLU A 1 211 ? -8.007  -16.520 -8.792  1.00 21.20 ? 218 GLU A O   1 
ATOM   1699 C CB  . GLU A 1 211 ? -8.971  -14.529 -10.776 1.00 28.17 ? 218 GLU A CB  1 
ATOM   1700 C CG  . GLU A 1 211 ? -10.135 -13.819 -10.106 1.00 33.17 ? 218 GLU A CG  1 
ATOM   1701 C CD  . GLU A 1 211 ? -11.384 -13.862 -10.951 1.00 39.12 ? 218 GLU A CD  1 
ATOM   1702 O OE1 . GLU A 1 211 ? -11.268 -14.222 -12.166 1.00 43.70 ? 218 GLU A OE1 1 
ATOM   1703 O OE2 . GLU A 1 211 ? -12.467 -13.567 -10.389 1.00 38.62 ? 218 GLU A OE2 1 
ATOM   1704 N N   . GLY A 1 212 ? -7.976  -14.650 -7.566  1.00 22.49 ? 219 GLY A N   1 
ATOM   1705 C CA  . GLY A 1 212 ? -8.273  -15.366 -6.287  1.00 22.63 ? 219 GLY A CA  1 
ATOM   1706 C C   . GLY A 1 212 ? -9.746  -15.666 -6.184  1.00 23.78 ? 219 GLY A C   1 
ATOM   1707 O O   . GLY A 1 212 ? -10.606 -14.814 -6.546  1.00 25.70 ? 219 GLY A O   1 
ATOM   1708 N N   . ARG A 1 213 ? -10.061 -16.855 -5.671  1.00 22.80 ? 220 ARG A N   1 
ATOM   1709 C CA  . ARG A 1 213 ? -11.449 -17.266 -5.468  1.00 23.66 ? 220 ARG A CA  1 
ATOM   1710 C C   . ARG A 1 213 ? -11.536 -17.867 -4.037  1.00 24.91 ? 220 ARG A C   1 
ATOM   1711 O O   . ARG A 1 213 ? -10.563 -18.455 -3.569  1.00 20.73 ? 220 ARG A O   1 
ATOM   1712 C CB  . ARG A 1 213 ? -11.830 -18.405 -6.393  1.00 27.81 ? 220 ARG A CB  1 
ATOM   1713 C CG  . ARG A 1 213 ? -11.741 -18.037 -7.905  1.00 32.14 ? 220 ARG A CG  1 
ATOM   1714 C CD  . ARG A 1 213 ? -13.031 -17.378 -8.328  1.00 37.69 ? 220 ARG A CD  1 
ATOM   1715 N NE  . ARG A 1 213 ? -13.112 -16.984 -9.742  1.00 44.70 ? 220 ARG A NE  1 
ATOM   1716 C CZ  . ARG A 1 213 ? -13.542 -17.754 -10.756 1.00 47.89 ? 220 ARG A CZ  1 
ATOM   1717 N NH1 . ARG A 1 213 ? -13.885 -19.020 -10.568 1.00 44.47 ? 220 ARG A NH1 1 
ATOM   1718 N NH2 . ARG A 1 213 ? -13.611 -17.242 -11.993 1.00 49.94 ? 220 ARG A NH2 1 
ATOM   1719 N N   . HIS A 1 214 ? -12.717 -17.804 -3.463  1.00 24.25 ? 221 HIS A N   1 
ATOM   1720 C CA  . HIS A 1 214 ? -12.998 -18.433 -2.175  1.00 24.16 ? 221 HIS A CA  1 
ATOM   1721 C C   . HIS A 1 214 ? -12.902 -19.902 -2.226  1.00 23.88 ? 221 HIS A C   1 
ATOM   1722 O O   . HIS A 1 214 ? -13.241 -20.578 -3.234  1.00 23.91 ? 221 HIS A O   1 
ATOM   1723 C CB  . HIS A 1 214 ? -14.403 -17.996 -1.717  1.00 27.21 ? 221 HIS A CB  1 
ATOM   1724 C CG  . HIS A 1 214 ? -14.493 -16.545 -1.348  1.00 28.01 ? 221 HIS A CG  1 
ATOM   1725 N ND1 . HIS A 1 214 ? -14.083 -16.064 -0.128  1.00 33.46 ? 221 HIS A ND1 1 
ATOM   1726 C CD2 . HIS A 1 214 ? -14.907 -15.458 -2.056  1.00 31.96 ? 221 HIS A CD2 1 
ATOM   1727 C CE1 . HIS A 1 214 ? -14.243 -14.750 -0.091  1.00 34.02 ? 221 HIS A CE1 1 
ATOM   1728 N NE2 . HIS A 1 214 ? -14.758 -14.362 -1.243  1.00 32.48 ? 221 HIS A NE2 1 
ATOM   1729 N N   . SER A 1 215 ? -12.389 -20.523 -1.167  1.00 22.57 ? 222 SER A N   1 
ATOM   1730 C CA  . SER A 1 215 ? -12.443 -21.953 -1.147  1.00 22.86 ? 222 SER A CA  1 
ATOM   1731 C C   . SER A 1 215 ? -13.423 -22.420 -0.071  1.00 22.42 ? 222 SER A C   1 
ATOM   1732 O O   . SER A 1 215 ? -13.666 -23.603 0.023   1.00 24.02 ? 222 SER A O   1 
ATOM   1733 C CB  . SER A 1 215 ? -11.079 -22.575 -0.990  1.00 27.53 ? 222 SER A CB  1 
ATOM   1734 O OG  . SER A 1 215 ? -10.533 -22.257 0.227   1.00 28.85 ? 222 SER A OG  1 
ATOM   1735 N N   . THR A 1 216 ? -13.879 -21.498 0.779   1.00 20.25 ? 223 THR A N   1 
ATOM   1736 C CA  . THR A 1 216 ? -15.019 -21.700 1.695   1.00 21.71 ? 223 THR A CA  1 
ATOM   1737 C C   . THR A 1 216 ? -16.016 -20.579 1.615   1.00 24.80 ? 223 THR A C   1 
ATOM   1738 O O   . THR A 1 216 ? -15.714 -19.492 1.111   1.00 26.30 ? 223 THR A O   1 
ATOM   1739 C CB  . THR A 1 216 ? -14.562 -21.805 3.220   1.00 21.52 ? 223 THR A CB  1 
ATOM   1740 O OG1 . THR A 1 216 ? -13.864 -20.634 3.592   1.00 21.14 ? 223 THR A OG1 1 
ATOM   1741 C CG2 . THR A 1 216 ? -13.650 -22.875 3.425   1.00 21.27 ? 223 THR A CG2 1 
ATOM   1742 N N   . GLY A 1 217 ? -17.157 -20.757 2.246   1.00 28.02 ? 224 GLY A N   1 
ATOM   1743 C CA  . GLY A 1 217 ? -18.151 -19.709 2.363   1.00 31.29 ? 224 GLY A CA  1 
ATOM   1744 C C   . GLY A 1 217 ? -19.437 -19.989 1.615   1.00 35.99 ? 224 GLY A C   1 
ATOM   1745 O O   . GLY A 1 217 ? -20.377 -19.193 1.722   1.00 41.46 ? 224 GLY A O   1 
ATOM   1746 N N   . ALA B 1 1   ? 8.651   14.517  -55.263 1.00 61.33 ? 6   ALA B N   1 
ATOM   1747 C CA  . ALA B 1 1   ? 8.920   13.142  -55.784 1.00 53.02 ? 6   ALA B CA  1 
ATOM   1748 C C   . ALA B 1 1   ? 10.307  12.593  -55.389 1.00 51.17 ? 6   ALA B C   1 
ATOM   1749 O O   . ALA B 1 1   ? 10.615  11.437  -55.667 1.00 43.74 ? 6   ALA B O   1 
ATOM   1750 C CB  . ALA B 1 1   ? 8.765   13.139  -57.299 1.00 55.76 ? 6   ALA B CB  1 
ATOM   1751 N N   . ILE B 1 2   ? 11.142  13.417  -54.758 1.00 48.18 ? 7   ILE B N   1 
ATOM   1752 C CA  . ILE B 1 2   ? 12.542  13.030  -54.491 1.00 49.09 ? 7   ILE B CA  1 
ATOM   1753 C C   . ILE B 1 2   ? 12.619  12.101  -53.269 1.00 40.87 ? 7   ILE B C   1 
ATOM   1754 O O   . ILE B 1 2   ? 13.404  11.162  -53.240 1.00 42.43 ? 7   ILE B O   1 
ATOM   1755 C CB  . ILE B 1 2   ? 13.542  14.227  -54.381 1.00 53.95 ? 7   ILE B CB  1 
ATOM   1756 C CG1 . ILE B 1 2   ? 12.861  15.585  -54.129 1.00 56.09 ? 7   ILE B CG1 1 
ATOM   1757 C CG2 . ILE B 1 2   ? 14.394  14.322  -55.645 1.00 56.26 ? 7   ILE B CG2 1 
ATOM   1758 C CD1 . ILE B 1 2   ? 12.294  16.296  -55.347 1.00 57.00 ? 7   ILE B CD1 1 
ATOM   1759 N N   . ILE B 1 3   ? 11.768  12.346  -52.279 1.00 37.62 ? 8   ILE B N   1 
ATOM   1760 C CA  . ILE B 1 3   ? 11.613  11.447  -51.138 1.00 34.94 ? 8   ILE B CA  1 
ATOM   1761 C C   . ILE B 1 3   ? 10.393  10.539  -51.414 1.00 33.43 ? 8   ILE B C   1 
ATOM   1762 O O   . ILE B 1 3   ? 9.235   10.978  -51.393 1.00 31.09 ? 8   ILE B O   1 
ATOM   1763 C CB  . ILE B 1 3   ? 11.387  12.243  -49.849 1.00 34.07 ? 8   ILE B CB  1 
ATOM   1764 C CG1 . ILE B 1 3   ? 12.543  13.227  -49.619 1.00 36.39 ? 8   ILE B CG1 1 
ATOM   1765 C CG2 . ILE B 1 3   ? 11.260  11.334  -48.654 1.00 32.70 ? 8   ILE B CG2 1 
ATOM   1766 C CD1 . ILE B 1 3   ? 13.902  12.593  -49.680 1.00 36.32 ? 8   ILE B CD1 1 
ATOM   1767 N N   . LYS B 1 4   ? 10.668  9.276   -51.675 1.00 35.82 ? 9   LYS B N   1 
ATOM   1768 C CA  . LYS B 1 4   ? 9.596   8.300   -51.951 1.00 34.61 ? 9   LYS B CA  1 
ATOM   1769 C C   . LYS B 1 4   ? 8.947   7.778   -50.686 1.00 33.49 ? 9   LYS B C   1 
ATOM   1770 O O   . LYS B 1 4   ? 9.465   7.987   -49.598 1.00 30.93 ? 9   LYS B O   1 
ATOM   1771 C CB  . LYS B 1 4   ? 10.189  7.145   -52.715 1.00 36.03 ? 9   LYS B CB  1 
ATOM   1772 C CG  . LYS B 1 4   ? 10.931  7.556   -53.983 1.00 39.22 ? 9   LYS B CG  1 
ATOM   1773 C CD  . LYS B 1 4   ? 11.553  6.333   -54.658 1.00 42.86 ? 9   LYS B CD  1 
ATOM   1774 C CE  . LYS B 1 4   ? 11.873  6.588   -56.134 1.00 47.74 ? 9   LYS B CE  1 
ATOM   1775 N NZ  . LYS B 1 4   ? 12.056  5.310   -56.937 1.00 48.52 ? 9   LYS B NZ  1 
ATOM   1776 N N   . GLU B 1 5   ? 7.811   7.074   -50.797 1.00 29.94 ? 10  GLU B N   1 
ATOM   1777 C CA  . GLU B 1 5   ? 7.146   6.504   -49.616 1.00 29.61 ? 10  GLU B CA  1 
ATOM   1778 C C   . GLU B 1 5   ? 7.918   5.396   -48.916 1.00 25.52 ? 10  GLU B C   1 
ATOM   1779 O O   . GLU B 1 5   ? 7.582   4.988   -47.798 1.00 28.07 ? 10  GLU B O   1 
ATOM   1780 C CB  . GLU B 1 5   ? 5.734   6.019   -49.976 1.00 31.50 ? 10  GLU B CB  1 
ATOM   1781 C CG  . GLU B 1 5   ? 4.676   7.097   -49.731 1.00 36.27 ? 10  GLU B CG  1 
ATOM   1782 C CD  . GLU B 1 5   ? 3.391   6.812   -50.452 1.00 39.73 ? 10  GLU B CD  1 
ATOM   1783 O OE1 . GLU B 1 5   ? 2.547   6.063   -49.920 1.00 39.78 ? 10  GLU B OE1 1 
ATOM   1784 O OE2 . GLU B 1 5   ? 3.250   7.326   -51.582 1.00 44.23 ? 10  GLU B OE2 1 
ATOM   1785 N N   . PHE B 1 6   ? 8.923   4.866   -49.608 1.00 28.02 ? 11  PHE B N   1 
ATOM   1786 C CA  . PHE B 1 6   ? 9.798   3.852   -49.026 1.00 26.81 ? 11  PHE B CA  1 
ATOM   1787 C C   . PHE B 1 6   ? 11.248  4.228   -49.391 1.00 27.22 ? 11  PHE B C   1 
ATOM   1788 O O   . PHE B 1 6   ? 11.569  4.529   -50.537 1.00 27.66 ? 11  PHE B O   1 
ATOM   1789 C CB  . PHE B 1 6   ? 9.431   2.418   -49.488 1.00 30.67 ? 11  PHE B CB  1 
ATOM   1790 C CG  . PHE B 1 6   ? 10.485  1.402   -49.135 1.00 31.86 ? 11  PHE B CG  1 
ATOM   1791 C CD1 . PHE B 1 6   ? 10.514  0.809   -47.878 1.00 34.85 ? 11  PHE B CD1 1 
ATOM   1792 C CD2 . PHE B 1 6   ? 11.473  1.082   -50.051 1.00 35.40 ? 11  PHE B CD2 1 
ATOM   1793 C CE1 . PHE B 1 6   ? 11.489  -0.129  -47.562 1.00 34.31 ? 11  PHE B CE1 1 
ATOM   1794 C CE2 . PHE B 1 6   ? 12.473  0.181   -49.727 1.00 36.21 ? 11  PHE B CE2 1 
ATOM   1795 C CZ  . PHE B 1 6   ? 12.488  -0.412  -48.490 1.00 36.00 ? 11  PHE B CZ  1 
ATOM   1796 N N   . MET B 1 7   ? 12.141  4.309   -48.400 1.00 25.50 ? 12  MET B N   1 
ATOM   1797 C CA  . MET B 1 7   ? 13.437  4.916   -48.676 1.00 25.76 ? 12  MET B CA  1 
ATOM   1798 C C   . MET B 1 7   ? 14.356  4.190   -47.790 1.00 24.01 ? 12  MET B C   1 
ATOM   1799 O O   . MET B 1 7   ? 14.071  3.999   -46.642 1.00 25.04 ? 12  MET B O   1 
ATOM   1800 C CB  . MET B 1 7   ? 13.510  6.390   -48.253 1.00 28.06 ? 12  MET B CB  1 
ATOM   1801 C CG  . MET B 1 7   ? 12.801  7.396   -49.151 1.00 31.23 ? 12  MET B CG  1 
ATOM   1802 S SD  . MET B 1 7   ? 13.536  7.433   -50.750 1.00 35.63 ? 12  MET B SD  1 
ATOM   1803 C CE  . MET B 1 7   ? 14.999  8.446   -50.398 1.00 38.05 ? 12  MET B CE  1 
ATOM   1804 N N   . ARG B 1 8   ? 15.501  3.808   -48.322 1.00 25.39 ? 13  ARG B N   1 
ATOM   1805 C CA  . ARG B 1 8   ? 16.564  3.244   -47.475 1.00 24.61 ? 13  ARG B CA  1 
ATOM   1806 C C   . ARG B 1 8   ? 17.571  4.323   -47.119 1.00 24.18 ? 13  ARG B C   1 
ATOM   1807 O O   . ARG B 1 8   ? 17.582  5.394   -47.696 1.00 24.91 ? 13  ARG B O   1 
ATOM   1808 C CB  . ARG B 1 8   ? 17.329  2.155   -48.281 1.00 28.59 ? 13  ARG B CB  1 
ATOM   1809 C CG  . ARG B 1 8   ? 16.556  0.894   -48.493 1.00 34.51 ? 13  ARG B CG  1 
ATOM   1810 C CD  . ARG B 1 8   ? 17.482  -0.122  -49.167 1.00 39.71 ? 13  ARG B CD  1 
ATOM   1811 N NE  . ARG B 1 8   ? 16.815  -1.403  -49.256 1.00 46.18 ? 13  ARG B NE  1 
ATOM   1812 C CZ  . ARG B 1 8   ? 16.646  -2.238  -48.238 1.00 49.25 ? 13  ARG B CZ  1 
ATOM   1813 N NH1 . ARG B 1 8   ? 17.094  -1.958  -47.012 1.00 52.40 ? 13  ARG B NH1 1 
ATOM   1814 N NH2 . ARG B 1 8   ? 16.018  -3.380  -48.451 1.00 53.23 ? 13  ARG B NH2 1 
ATOM   1815 N N   . PHE B 1 9   ? 18.423  4.011   -46.156 1.00 23.57 ? 14  PHE B N   1 
ATOM   1816 C CA  . PHE B 1 9   ? 19.452  4.902   -45.705 1.00 25.37 ? 14  PHE B CA  1 
ATOM   1817 C C   . PHE B 1 9   ? 20.670  4.115   -45.276 1.00 25.74 ? 14  PHE B C   1 
ATOM   1818 O O   . PHE B 1 9   ? 20.559  2.906   -44.962 1.00 24.96 ? 14  PHE B O   1 
ATOM   1819 C CB  . PHE B 1 9   ? 18.960  5.841   -44.565 1.00 26.50 ? 14  PHE B CB  1 
ATOM   1820 C CG  . PHE B 1 9   ? 18.757  5.164   -43.213 1.00 28.03 ? 14  PHE B CG  1 
ATOM   1821 C CD1 . PHE B 1 9   ? 19.801  5.083   -42.318 1.00 29.02 ? 14  PHE B CD1 1 
ATOM   1822 C CD2 . PHE B 1 9   ? 17.539  4.655   -42.851 1.00 30.65 ? 14  PHE B CD2 1 
ATOM   1823 C CE1 . PHE B 1 9   ? 19.659  4.463   -41.104 1.00 33.06 ? 14  PHE B CE1 1 
ATOM   1824 C CE2 . PHE B 1 9   ? 17.355  4.054   -41.611 1.00 35.17 ? 14  PHE B CE2 1 
ATOM   1825 C CZ  . PHE B 1 9   ? 18.422  3.959   -40.736 1.00 33.97 ? 14  PHE B CZ  1 
ATOM   1826 N N   . LYS B 1 10  ? 21.811  4.793   -45.280 1.00 23.06 ? 15  LYS B N   1 
ATOM   1827 C CA  . LYS B 1 10  ? 23.052  4.267   -44.666 1.00 24.67 ? 15  LYS B CA  1 
ATOM   1828 C C   . LYS B 1 10  ? 23.568  5.292   -43.706 1.00 24.27 ? 15  LYS B C   1 
ATOM   1829 O O   . LYS B 1 10  ? 23.385  6.551   -43.912 1.00 26.04 ? 15  LYS B O   1 
ATOM   1830 C CB  . LYS B 1 10  ? 24.127  4.013   -45.742 1.00 28.11 ? 15  LYS B CB  1 
ATOM   1831 C CG  . LYS B 1 10  ? 23.646  3.113   -46.871 1.00 34.27 ? 15  LYS B CG  1 
ATOM   1832 C CD  . LYS B 1 10  ? 24.776  2.837   -47.848 1.00 39.90 ? 15  LYS B CD  1 
ATOM   1833 C CE  . LYS B 1 10  ? 24.300  1.980   -49.002 1.00 45.44 ? 15  LYS B CE  1 
ATOM   1834 N NZ  . LYS B 1 10  ? 25.455  1.275   -49.609 1.00 51.38 ? 15  LYS B NZ  1 
ATOM   1835 N N   . VAL B 1 11  ? 24.195  4.827   -42.641 1.00 23.59 ? 16  VAL B N   1 
ATOM   1836 C CA  . VAL B 1 11  ? 24.735  5.742   -41.723 1.00 22.04 ? 16  VAL B CA  1 
ATOM   1837 C C   . VAL B 1 11  ? 26.111  5.362   -41.283 1.00 24.60 ? 16  VAL B C   1 
ATOM   1838 O O   . VAL B 1 11  ? 26.487  4.156   -41.262 1.00 24.12 ? 16  VAL B O   1 
ATOM   1839 C CB  . VAL B 1 11  ? 23.801  5.893   -40.482 1.00 23.80 ? 16  VAL B CB  1 
ATOM   1840 C CG1 . VAL B 1 11  ? 23.521  4.522   -39.767 1.00 23.68 ? 16  VAL B CG1 1 
ATOM   1841 C CG2 . VAL B 1 11  ? 24.408  6.859   -39.502 1.00 24.96 ? 16  VAL B CG2 1 
ATOM   1842 N N   . HIS B 1 12  ? 26.908  6.389   -40.960 1.00 22.85 ? 17  HIS B N   1 
ATOM   1843 C CA  . HIS B 1 12  ? 28.230  6.184   -40.395 1.00 23.96 ? 17  HIS B CA  1 
ATOM   1844 C C   . HIS B 1 12  ? 28.351  7.113   -39.256 1.00 23.97 ? 17  HIS B C   1 
ATOM   1845 O O   . HIS B 1 12  ? 28.103  8.312   -39.430 1.00 25.38 ? 17  HIS B O   1 
ATOM   1846 C CB  . HIS B 1 12  ? 29.348  6.518   -41.355 1.00 24.95 ? 17  HIS B CB  1 
ATOM   1847 C CG  . HIS B 1 12  ? 30.724  6.429   -40.742 1.00 27.58 ? 17  HIS B CG  1 
ATOM   1848 N ND1 . HIS B 1 12  ? 31.363  7.497   -40.133 1.00 30.62 ? 17  HIS B ND1 1 
ATOM   1849 C CD2 . HIS B 1 12  ? 31.568  5.377   -40.615 1.00 30.01 ? 17  HIS B CD2 1 
ATOM   1850 C CE1 . HIS B 1 12  ? 32.569  7.133   -39.745 1.00 30.39 ? 17  HIS B CE1 1 
ATOM   1851 N NE2 . HIS B 1 12  ? 32.711  5.850   -40.009 1.00 31.67 ? 17  HIS B NE2 1 
ATOM   1852 N N   . MET B 1 13  ? 28.815  6.614   -38.102 1.00 22.32 ? 18  MET B N   1 
ATOM   1853 C CA  . MET B 1 13  ? 29.086  7.476   -36.912 1.00 21.22 ? 18  MET B CA  1 
ATOM   1854 C C   . MET B 1 13  ? 30.516  7.310   -36.471 1.00 23.13 ? 18  MET B C   1 
ATOM   1855 O O   . MET B 1 13  ? 31.020  6.172   -36.398 1.00 21.72 ? 18  MET B O   1 
ATOM   1856 C CB  . MET B 1 13  ? 28.186  7.126   -35.699 1.00 22.05 ? 18  MET B CB  1 
ATOM   1857 C CG  . MET B 1 13  ? 28.551  7.881   -34.378 1.00 22.83 ? 18  MET B CG  1 
ATOM   1858 S SD  . MET B 1 13  ? 27.583  7.373   -32.932 1.00 25.68 ? 18  MET B SD  1 
ATOM   1859 C CE  . MET B 1 13  ? 26.023  8.166   -33.206 1.00 23.76 ? 18  MET B CE  1 
ATOM   1860 N N   . GLU B 1 14  ? 31.177  8.433   -36.139 1.00 22.67 ? 19  GLU B N   1 
ATOM   1861 C CA  . GLU B 1 14  ? 32.525  8.457   -35.625 1.00 23.81 ? 19  GLU B CA  1 
ATOM   1862 C C   . GLU B 1 14  ? 32.346  9.113   -34.276 1.00 22.12 ? 19  GLU B C   1 
ATOM   1863 O O   . GLU B 1 14  ? 31.673  10.117  -34.149 1.00 21.95 ? 19  GLU B O   1 
ATOM   1864 C CB  . GLU B 1 14  ? 33.490  9.251   -36.553 1.00 27.51 ? 19  GLU B CB  1 
ATOM   1865 C CG  . GLU B 1 14  ? 34.661  9.951   -35.890 1.00 34.54 ? 19  GLU B CG  1 
ATOM   1866 C CD  . GLU B 1 14  ? 35.262  11.072  -36.742 1.00 41.76 ? 19  GLU B CD  1 
ATOM   1867 O OE1 . GLU B 1 14  ? 35.242  10.969  -38.003 1.00 45.53 ? 19  GLU B OE1 1 
ATOM   1868 O OE2 . GLU B 1 14  ? 35.729  12.084  -36.157 1.00 43.78 ? 19  GLU B OE2 1 
ATOM   1869 N N   . GLY B 1 15  ? 32.844  8.495   -33.233 1.00 22.60 ? 20  GLY B N   1 
ATOM   1870 C CA  . GLY B 1 15  ? 32.599  9.102   -31.929 1.00 22.49 ? 20  GLY B CA  1 
ATOM   1871 C C   . GLY B 1 15  ? 33.581  8.723   -30.870 1.00 23.05 ? 20  GLY B C   1 
ATOM   1872 O O   . GLY B 1 15  ? 34.458  7.912   -31.073 1.00 20.60 ? 20  GLY B O   1 
ATOM   1873 N N   . SER B 1 16  ? 33.487  9.416   -29.731 1.00 22.09 ? 21  SER B N   1 
ATOM   1874 C CA  . SER B 1 16  ? 34.231  8.973   -28.599 1.00 24.87 ? 21  SER B CA  1 
ATOM   1875 C C   . SER B 1 16  ? 33.404  9.378   -27.403 1.00 23.97 ? 21  SER B C   1 
ATOM   1876 O O   . SER B 1 16  ? 32.686  10.370  -27.445 1.00 24.02 ? 21  SER B O   1 
ATOM   1877 C CB  . SER B 1 16  ? 35.631  9.558   -28.524 1.00 30.86 ? 21  SER B CB  1 
ATOM   1878 O OG  . SER B 1 16  ? 35.626  10.858  -27.990 1.00 31.39 ? 21  SER B OG  1 
ATOM   1879 N N   . VAL B 1 17  ? 33.476  8.587   -26.363 1.00 23.49 ? 22  VAL B N   1 
ATOM   1880 C CA  . VAL B 1 17  ? 32.744  8.866   -25.110 1.00 25.22 ? 22  VAL B CA  1 
ATOM   1881 C C   . VAL B 1 17  ? 33.668  8.550   -23.987 1.00 27.47 ? 22  VAL B C   1 
ATOM   1882 O O   . VAL B 1 17  ? 34.184  7.409   -23.908 1.00 24.61 ? 22  VAL B O   1 
ATOM   1883 C CB  . VAL B 1 17  ? 31.510  7.921   -24.942 1.00 24.62 ? 22  VAL B CB  1 
ATOM   1884 C CG1 . VAL B 1 17  ? 30.878  8.101   -23.574 1.00 25.16 ? 22  VAL B CG1 1 
ATOM   1885 C CG2 . VAL B 1 17  ? 30.441  8.240   -25.996 1.00 24.67 ? 22  VAL B CG2 1 
ATOM   1886 N N   . ASN B 1 18  ? 33.822  9.502   -23.076 1.00 24.16 ? 23  ASN B N   1 
ATOM   1887 C CA  . ASN B 1 18  ? 34.883  9.428   -22.122 1.00 26.87 ? 23  ASN B CA  1 
ATOM   1888 C C   . ASN B 1 18  ? 36.221  8.926   -22.687 1.00 28.10 ? 23  ASN B C   1 
ATOM   1889 O O   . ASN B 1 18  ? 36.959  8.230   -22.032 1.00 28.22 ? 23  ASN B O   1 
ATOM   1890 C CB  . ASN B 1 18  ? 34.430  8.651   -20.890 1.00 26.97 ? 23  ASN B CB  1 
ATOM   1891 C CG  . ASN B 1 18  ? 33.572  9.467   -19.939 1.00 25.05 ? 23  ASN B CG  1 
ATOM   1892 O OD1 . ASN B 1 18  ? 32.914  10.482  -20.314 1.00 30.70 ? 23  ASN B OD1 1 
ATOM   1893 N ND2 . ASN B 1 18  ? 33.511  9.004   -18.672 1.00 30.03 ? 23  ASN B ND2 1 
ATOM   1894 N N   . GLY B 1 19  ? 36.579  9.342   -23.891 1.00 27.32 ? 24  GLY B N   1 
ATOM   1895 C CA  . GLY B 1 19  ? 37.875  8.999   -24.406 1.00 26.66 ? 24  GLY B CA  1 
ATOM   1896 C C   . GLY B 1 19  ? 37.872  7.725   -25.239 1.00 28.45 ? 24  GLY B C   1 
ATOM   1897 O O   . GLY B 1 19  ? 38.873  7.462   -25.883 1.00 27.38 ? 24  GLY B O   1 
ATOM   1898 N N   . HIS B 1 20  ? 36.804  6.942   -25.188 1.00 24.33 ? 25  HIS B N   1 
ATOM   1899 C CA  . HIS B 1 20  ? 36.767  5.669   -25.908 1.00 26.94 ? 25  HIS B CA  1 
ATOM   1900 C C   . HIS B 1 20  ? 36.217  5.955   -27.293 1.00 23.97 ? 25  HIS B C   1 
ATOM   1901 O O   . HIS B 1 20  ? 35.050  6.317   -27.418 1.00 21.85 ? 25  HIS B O   1 
ATOM   1902 C CB  . HIS B 1 20  ? 35.881  4.644   -25.215 1.00 25.27 ? 25  HIS B CB  1 
ATOM   1903 C CG  . HIS B 1 20  ? 35.991  3.259   -25.786 1.00 28.11 ? 25  HIS B CG  1 
ATOM   1904 N ND1 . HIS B 1 20  ? 35.293  2.837   -26.903 1.00 28.73 ? 25  HIS B ND1 1 
ATOM   1905 C CD2 . HIS B 1 20  ? 36.708  2.194   -25.366 1.00 26.40 ? 25  HIS B CD2 1 
ATOM   1906 C CE1 . HIS B 1 20  ? 35.598  1.570   -27.163 1.00 26.68 ? 25  HIS B CE1 1 
ATOM   1907 N NE2 . HIS B 1 20  ? 36.455  1.160   -26.245 1.00 30.53 ? 25  HIS B NE2 1 
ATOM   1908 N N   . GLU B 1 21  ? 37.046  5.694   -28.287 1.00 24.57 ? 26  GLU B N   1 
ATOM   1909 C CA  . GLU B 1 21  ? 36.741  6.020   -29.659 1.00 23.56 ? 26  GLU B CA  1 
ATOM   1910 C C   . GLU B 1 21  ? 36.105  4.826   -30.356 1.00 24.39 ? 26  GLU B C   1 
ATOM   1911 O O   . GLU B 1 21  ? 36.482  3.668   -30.093 1.00 23.28 ? 26  GLU B O   1 
ATOM   1912 C CB  . GLU B 1 21  ? 38.034  6.381   -30.385 1.00 27.89 ? 26  GLU B CB  1 
ATOM   1913 C CG  . GLU B 1 21  ? 38.698  7.585   -29.704 1.00 30.61 ? 26  GLU B CG  1 
ATOM   1914 C CD  . GLU B 1 21  ? 39.878  8.150   -30.433 1.00 40.85 ? 26  GLU B CD  1 
ATOM   1915 O OE1 . GLU B 1 21  ? 40.514  7.419   -31.238 1.00 46.61 ? 26  GLU B OE1 1 
ATOM   1916 O OE2 . GLU B 1 21  ? 40.193  9.330   -30.150 1.00 49.10 ? 26  GLU B OE2 1 
ATOM   1917 N N   . PHE B 1 22  ? 35.215  5.104   -31.294 1.00 19.54 ? 27  PHE B N   1 
ATOM   1918 C CA  . PHE B 1 22  ? 34.503  3.998   -31.967 1.00 19.99 ? 27  PHE B CA  1 
ATOM   1919 C C   . PHE B 1 22  ? 33.916  4.466   -33.208 1.00 20.50 ? 27  PHE B C   1 
ATOM   1920 O O   . PHE B 1 22  ? 33.910  5.645   -33.500 1.00 21.77 ? 27  PHE B O   1 
ATOM   1921 C CB  . PHE B 1 22  ? 33.403  3.427   -31.044 1.00 20.52 ? 27  PHE B CB  1 
ATOM   1922 C CG  . PHE B 1 22  ? 32.366  4.459   -30.703 1.00 21.02 ? 27  PHE B CG  1 
ATOM   1923 C CD1 . PHE B 1 22  ? 32.597  5.340   -29.647 1.00 20.32 ? 27  PHE B CD1 1 
ATOM   1924 C CD2 . PHE B 1 22  ? 31.259  4.597   -31.484 1.00 21.72 ? 27  PHE B CD2 1 
ATOM   1925 C CE1 . PHE B 1 22  ? 31.658  6.318   -29.340 1.00 23.32 ? 27  PHE B CE1 1 
ATOM   1926 C CE2 . PHE B 1 22  ? 30.295  5.591   -31.197 1.00 24.59 ? 27  PHE B CE2 1 
ATOM   1927 C CZ  . PHE B 1 22  ? 30.530  6.443   -30.090 1.00 23.35 ? 27  PHE B CZ  1 
ATOM   1928 N N   . GLU B 1 23  ? 33.469  3.512   -34.019 1.00 22.44 ? 28  GLU B N   1 
ATOM   1929 C CA  . GLU B 1 23  ? 32.746  3.848   -35.245 1.00 24.25 ? 28  GLU B CA  1 
ATOM   1930 C C   . GLU B 1 23  ? 31.611  2.869   -35.366 1.00 23.74 ? 28  GLU B C   1 
ATOM   1931 O O   . GLU B 1 23  ? 31.761  1.680   -34.943 1.00 22.11 ? 28  GLU B O   1 
ATOM   1932 C CB  . GLU B 1 23  ? 33.617  3.755   -36.483 1.00 25.40 ? 28  GLU B CB  1 
ATOM   1933 C CG  . GLU B 1 23  ? 34.698  4.835   -36.550 1.00 29.71 ? 28  GLU B CG  1 
ATOM   1934 C CD  . GLU B 1 23  ? 35.439  4.903   -37.871 1.00 33.64 ? 28  GLU B CD  1 
ATOM   1935 O OE1 . GLU B 1 23  ? 36.428  5.656   -37.914 1.00 38.96 ? 28  GLU B OE1 1 
ATOM   1936 O OE2 . GLU B 1 23  ? 35.015  4.280   -38.893 1.00 34.60 ? 28  GLU B OE2 1 
ATOM   1937 N N   . ILE B 1 24  ? 30.492  3.364   -35.921 1.00 21.66 ? 29  ILE B N   1 
ATOM   1938 C CA  . ILE B 1 24  ? 29.344  2.554   -36.188 1.00 23.30 ? 29  ILE B CA  1 
ATOM   1939 C C   . ILE B 1 24  ? 28.987  2.729   -37.635 1.00 24.53 ? 29  ILE B C   1 
ATOM   1940 O O   . ILE B 1 24  ? 29.014  3.846   -38.173 1.00 23.89 ? 29  ILE B O   1 
ATOM   1941 C CB  . ILE B 1 24  ? 28.177  2.918   -35.247 1.00 27.27 ? 29  ILE B CB  1 
ATOM   1942 C CG1 . ILE B 1 24  ? 28.575  2.510   -33.825 1.00 27.32 ? 29  ILE B CG1 1 
ATOM   1943 C CG2 . ILE B 1 24  ? 26.896  2.168   -35.664 1.00 26.36 ? 29  ILE B CG2 1 
ATOM   1944 C CD1 . ILE B 1 24  ? 27.963  3.304   -32.717 1.00 33.23 ? 29  ILE B CD1 1 
ATOM   1945 N N   . GLU B 1 25  ? 28.584  1.651   -38.265 1.00 25.87 ? 30  GLU B N   1 
ATOM   1946 C CA  . GLU B 1 25  ? 28.068  1.705   -39.597 1.00 25.63 ? 30  GLU B CA  1 
ATOM   1947 C C   . GLU B 1 25  ? 26.750  0.990   -39.595 1.00 26.08 ? 30  GLU B C   1 
ATOM   1948 O O   . GLU B 1 25  ? 26.625  -0.124  -39.033 1.00 26.42 ? 30  GLU B O   1 
ATOM   1949 C CB  . GLU B 1 25  ? 29.011  1.041   -40.612 1.00 28.86 ? 30  GLU B CB  1 
ATOM   1950 C CG  . GLU B 1 25  ? 30.269  1.863   -40.837 1.00 34.94 ? 30  GLU B CG  1 
ATOM   1951 C CD  . GLU B 1 25  ? 31.207  1.258   -41.860 1.00 42.85 ? 30  GLU B CD  1 
ATOM   1952 O OE1 . GLU B 1 25  ? 31.889  2.042   -42.573 1.00 49.90 ? 30  GLU B OE1 1 
ATOM   1953 O OE2 . GLU B 1 25  ? 31.274  0.003   -41.932 1.00 51.41 ? 30  GLU B OE2 1 
ATOM   1954 N N   . GLY B 1 26  ? 25.792  1.540   -40.335 1.00 24.01 ? 31  GLY B N   1 
ATOM   1955 C CA  . GLY B 1 26  ? 24.453  1.056   -40.311 1.00 24.96 ? 31  GLY B CA  1 
ATOM   1956 C C   . GLY B 1 26  ? 23.762  1.247   -41.636 1.00 25.53 ? 31  GLY B C   1 
ATOM   1957 O O   . GLY B 1 26  ? 24.226  1.980   -42.531 1.00 22.81 ? 31  GLY B O   1 
ATOM   1958 N N   . GLU B 1 27  ? 22.656  0.550   -41.740 1.00 25.39 ? 32  GLU B N   1 
ATOM   1959 C CA  . GLU B 1 27  ? 21.752  0.647   -42.860 1.00 29.61 ? 32  GLU B CA  1 
ATOM   1960 C C   . GLU B 1 27  ? 20.372  0.477   -42.275 1.00 27.99 ? 32  GLU B C   1 
ATOM   1961 O O   . GLU B 1 27  ? 20.212  -0.090  -41.231 1.00 29.59 ? 32  GLU B O   1 
ATOM   1962 C CB  . GLU B 1 27  ? 21.999  -0.450  -43.924 1.00 34.20 ? 32  GLU B CB  1 
ATOM   1963 C CG  . GLU B 1 27  ? 23.430  -0.604  -44.402 1.00 46.41 ? 32  GLU B CG  1 
ATOM   1964 C CD  . GLU B 1 27  ? 24.091  -1.934  -43.994 1.00 54.95 ? 32  GLU B CD  1 
ATOM   1965 O OE1 . GLU B 1 27  ? 23.402  -2.822  -43.420 1.00 56.65 ? 32  GLU B OE1 1 
ATOM   1966 O OE2 . GLU B 1 27  ? 25.311  -2.098  -44.271 1.00 62.39 ? 32  GLU B OE2 1 
ATOM   1967 N N   . GLY B 1 28  ? 19.382  0.986   -42.982 1.00 28.11 ? 33  GLY B N   1 
ATOM   1968 C CA  . GLY B 1 28  ? 18.046  0.862   -42.563 1.00 28.90 ? 33  GLY B CA  1 
ATOM   1969 C C   . GLY B 1 28  ? 17.094  1.255   -43.651 1.00 28.33 ? 33  GLY B C   1 
ATOM   1970 O O   . GLY B 1 28  ? 17.512  1.534   -44.769 1.00 24.66 ? 33  GLY B O   1 
ATOM   1971 N N   . GLU B 1 29  ? 15.819  1.249   -43.312 1.00 27.15 ? 34  GLU B N   1 
ATOM   1972 C CA  . GLU B 1 29  ? 14.774  1.556   -44.276 1.00 27.12 ? 34  GLU B CA  1 
ATOM   1973 C C   . GLU B 1 29  ? 13.586  2.025   -43.537 1.00 24.36 ? 34  GLU B C   1 
ATOM   1974 O O   . GLU B 1 29  ? 13.469  1.798   -42.381 1.00 23.61 ? 34  GLU B O   1 
ATOM   1975 C CB  . GLU B 1 29  ? 14.398  0.324   -45.133 1.00 29.53 ? 34  GLU B CB  1 
ATOM   1976 C CG  . GLU B 1 29  ? 13.930  -0.907  -44.323 1.00 33.01 ? 34  GLU B CG  1 
ATOM   1977 C CD  . GLU B 1 29  ? 13.643  -2.119  -45.208 1.00 37.63 ? 34  GLU B CD  1 
ATOM   1978 O OE1 . GLU B 1 29  ? 14.256  -2.210  -46.280 1.00 42.54 ? 34  GLU B OE1 1 
ATOM   1979 O OE2 . GLU B 1 29  ? 12.809  -2.965  -44.842 1.00 41.48 ? 34  GLU B OE2 1 
ATOM   1980 N N   . GLY B 1 30  ? 12.716  2.709   -44.207 1.00 24.91 ? 35  GLY B N   1 
ATOM   1981 C CA  . GLY B 1 30  ? 11.518  3.147   -43.544 1.00 25.58 ? 35  GLY B CA  1 
ATOM   1982 C C   . GLY B 1 30  ? 10.571  3.765   -44.501 1.00 24.97 ? 35  GLY B C   1 
ATOM   1983 O O   . GLY B 1 30  ? 10.795  3.764   -45.701 1.00 26.71 ? 35  GLY B O   1 
ATOM   1984 N N   . ARG B 1 31  ? 9.506   4.336   -43.940 1.00 24.43 ? 36  ARG B N   1 
ATOM   1985 C CA  . ARG B 1 31  ? 8.470   4.993   -44.713 1.00 23.61 ? 36  ARG B CA  1 
ATOM   1986 C C   . ARG B 1 31  ? 8.400   6.461   -44.183 1.00 22.89 ? 36  ARG B C   1 
ATOM   1987 O O   . ARG B 1 31  ? 7.747   6.708   -43.153 1.00 23.41 ? 36  ARG B O   1 
ATOM   1988 C CB  . ARG B 1 31  ? 7.164   4.266   -44.494 1.00 26.82 ? 36  ARG B CB  1 
ATOM   1989 C CG  . ARG B 1 31  ? 7.249   2.748   -44.601 1.00 29.41 ? 36  ARG B CG  1 
ATOM   1990 C CD  . ARG B 1 31  ? 5.885   2.059   -44.666 1.00 33.60 ? 36  ARG B CD  1 
ATOM   1991 N NE  . ARG B 1 31  ? 5.911   0.579   -44.551 1.00 37.73 ? 36  ARG B NE  1 
ATOM   1992 C CZ  . ARG B 1 31  ? 6.429   -0.273  -45.445 1.00 50.68 ? 36  ARG B CZ  1 
ATOM   1993 N NH1 . ARG B 1 31  ? 7.018   0.132   -46.585 1.00 51.05 ? 36  ARG B NH1 1 
ATOM   1994 N NH2 . ARG B 1 31  ? 6.350   -1.582  -45.194 1.00 54.59 ? 36  ARG B NH2 1 
ATOM   1995 N N   . PRO B 1 32  ? 9.042   7.354   -44.902 1.00 24.37 ? 37  PRO B N   1 
ATOM   1996 C CA  . PRO B 1 32  ? 9.215   8.777   -44.429 1.00 26.47 ? 37  PRO B CA  1 
ATOM   1997 C C   . PRO B 1 32  ? 7.903   9.454   -44.168 1.00 28.31 ? 37  PRO B C   1 
ATOM   1998 O O   . PRO B 1 32  ? 7.845   10.296  -43.278 1.00 28.12 ? 37  PRO B O   1 
ATOM   1999 C CB  . PRO B 1 32  ? 9.980   9.448   -45.531 1.00 25.98 ? 37  PRO B CB  1 
ATOM   2000 C CG  . PRO B 1 32  ? 10.627  8.342   -46.325 1.00 27.69 ? 37  PRO B CG  1 
ATOM   2001 C CD  . PRO B 1 32  ? 9.697   7.140   -46.189 1.00 24.49 ? 37  PRO B CD  1 
ATOM   2002 N N   . TYR B 1 33  ? 6.826   9.098   -44.905 1.00 28.70 ? 38  TYR B N   1 
ATOM   2003 C CA  . TYR B 1 33  ? 5.534   9.748   -44.648 1.00 29.41 ? 38  TYR B CA  1 
ATOM   2004 C C   . TYR B 1 33  ? 4.656   9.097   -43.602 1.00 29.89 ? 38  TYR B C   1 
ATOM   2005 O O   . TYR B 1 33  ? 3.649   9.664   -43.226 1.00 33.16 ? 38  TYR B O   1 
ATOM   2006 C CB  . TYR B 1 33  ? 4.769   9.980   -45.941 1.00 28.88 ? 38  TYR B CB  1 
ATOM   2007 C CG  . TYR B 1 33  ? 5.563   10.692  -46.981 1.00 29.37 ? 38  TYR B CG  1 
ATOM   2008 C CD1 . TYR B 1 33  ? 6.443   10.009  -47.791 1.00 32.17 ? 38  TYR B CD1 1 
ATOM   2009 C CD2 . TYR B 1 33  ? 5.475   12.059  -47.156 1.00 29.45 ? 38  TYR B CD2 1 
ATOM   2010 C CE1 . TYR B 1 33  ? 7.162   10.657  -48.766 1.00 28.42 ? 38  TYR B CE1 1 
ATOM   2011 C CE2 . TYR B 1 33  ? 6.177   12.720  -48.124 1.00 29.91 ? 38  TYR B CE2 1 
ATOM   2012 C CZ  . TYR B 1 33  ? 7.039   12.026  -48.928 1.00 31.70 ? 38  TYR B CZ  1 
ATOM   2013 O OH  . TYR B 1 33  ? 7.754   12.692  -49.874 1.00 31.04 ? 38  TYR B OH  1 
ATOM   2014 N N   . GLU B 1 34  ? 5.021   7.938   -43.112 1.00 26.64 ? 39  GLU B N   1 
ATOM   2015 C CA  . GLU B 1 34  ? 4.338   7.287   -42.019 1.00 28.38 ? 39  GLU B CA  1 
ATOM   2016 C C   . GLU B 1 34  ? 5.095   7.473   -40.752 1.00 26.45 ? 39  GLU B C   1 
ATOM   2017 O O   . GLU B 1 34  ? 4.615   7.101   -39.723 1.00 25.86 ? 39  GLU B O   1 
ATOM   2018 C CB  . GLU B 1 34  ? 4.153   5.784   -42.316 1.00 30.50 ? 39  GLU B CB  1 
ATOM   2019 C CG  . GLU B 1 34  ? 3.502   5.605   -43.679 1.00 34.68 ? 39  GLU B CG  1 
ATOM   2020 C CD  . GLU B 1 34  ? 3.085   4.196   -44.014 1.00 39.68 ? 39  GLU B CD  1 
ATOM   2021 O OE1 . GLU B 1 34  ? 2.972   3.291   -43.114 1.00 41.79 ? 39  GLU B OE1 1 
ATOM   2022 O OE2 . GLU B 1 34  ? 2.906   3.995   -45.245 1.00 41.21 ? 39  GLU B OE2 1 
ATOM   2023 N N   . GLY B 1 35  ? 6.317   8.014   -40.839 1.00 26.98 ? 40  GLY B N   1 
ATOM   2024 C CA  . GLY B 1 35  ? 7.133   8.167   -39.654 1.00 24.65 ? 40  GLY B CA  1 
ATOM   2025 C C   . GLY B 1 35  ? 7.729   6.939   -39.010 1.00 24.80 ? 40  GLY B C   1 
ATOM   2026 O O   . GLY B 1 35  ? 7.961   6.904   -37.836 1.00 24.98 ? 40  GLY B O   1 
ATOM   2027 N N   . THR B 1 36  ? 8.023   5.895   -39.785 1.00 24.21 ? 41  THR B N   1 
ATOM   2028 C CA  . THR B 1 36  ? 8.567   4.727   -39.203 1.00 22.74 ? 41  THR B CA  1 
ATOM   2029 C C   . THR B 1 36  ? 9.860   4.378   -39.926 1.00 22.67 ? 41  THR B C   1 
ATOM   2030 O O   . THR B 1 36  ? 9.993   4.566   -41.099 1.00 24.67 ? 41  THR B O   1 
ATOM   2031 C CB  . THR B 1 36  ? 7.564   3.536   -39.328 1.00 24.46 ? 41  THR B CB  1 
ATOM   2032 O OG1 . THR B 1 36  ? 7.231   3.410   -40.687 1.00 25.46 ? 41  THR B OG1 1 
ATOM   2033 C CG2 . THR B 1 36  ? 6.301   3.812   -38.540 1.00 27.30 ? 41  THR B CG2 1 
ATOM   2034 N N   . GLN B 1 37  ? 10.781  3.848   -39.180 1.00 22.15 ? 42  GLN B N   1 
ATOM   2035 C CA  . GLN B 1 37  ? 12.023  3.400   -39.744 1.00 26.39 ? 42  GLN B CA  1 
ATOM   2036 C C   . GLN B 1 37  ? 12.673  2.396   -38.830 1.00 26.03 ? 42  GLN B C   1 
ATOM   2037 O O   . GLN B 1 37  ? 12.482  2.359   -37.611 1.00 23.48 ? 42  GLN B O   1 
ATOM   2038 C CB  . GLN B 1 37  ? 12.968  4.582   -40.000 1.00 27.42 ? 42  GLN B CB  1 
ATOM   2039 C CG  . GLN B 1 37  ? 13.329  5.303   -38.738 1.00 28.85 ? 42  GLN B CG  1 
ATOM   2040 C CD  . GLN B 1 37  ? 14.216  6.510   -38.979 1.00 30.43 ? 42  GLN B CD  1 
ATOM   2041 O OE1 . GLN B 1 37  ? 15.216  6.413   -39.664 1.00 39.99 ? 42  GLN B OE1 1 
ATOM   2042 N NE2 . GLN B 1 37  ? 13.866  7.633   -38.389 1.00 29.93 ? 42  GLN B NE2 1 
ATOM   2043 N N   . THR B 1 38  ? 13.490  1.543   -39.447 1.00 27.02 ? 43  THR B N   1 
ATOM   2044 C CA  . THR B 1 38  ? 14.245  0.575   -38.668 1.00 25.81 ? 43  THR B CA  1 
ATOM   2045 C C   . THR B 1 38  ? 15.698  0.608   -39.148 1.00 26.17 ? 43  THR B C   1 
ATOM   2046 O O   . THR B 1 38  ? 15.951  0.972   -40.299 1.00 25.43 ? 43  THR B O   1 
ATOM   2047 C CB  . THR B 1 38  ? 13.704  -0.829  -38.902 1.00 29.49 ? 43  THR B CB  1 
ATOM   2048 O OG1 . THR B 1 38  ? 13.777  -1.120  -40.304 1.00 35.61 ? 43  THR B OG1 1 
ATOM   2049 C CG2 . THR B 1 38  ? 12.233  -0.945  -38.428 1.00 31.53 ? 43  THR B CG2 1 
ATOM   2050 N N   . ALA B 1 39  ? 16.623  0.244   -38.265 1.00 24.69 ? 44  ALA B N   1 
ATOM   2051 C CA  . ALA B 1 39  ? 18.002  0.272   -38.627 1.00 24.30 ? 44  ALA B CA  1 
ATOM   2052 C C   . ALA B 1 39  ? 18.704  -0.867  -37.995 1.00 25.30 ? 44  ALA B C   1 
ATOM   2053 O O   . ALA B 1 39  ? 18.335  -1.299  -36.921 1.00 25.15 ? 44  ALA B O   1 
ATOM   2054 C CB  . ALA B 1 39  ? 18.660  1.573   -38.131 1.00 23.99 ? 44  ALA B CB  1 
ATOM   2055 N N   . LYS B 1 40  ? 19.749  -1.293  -38.674 1.00 25.08 ? 45  LYS B N   1 
ATOM   2056 C CA  . LYS B 1 40  ? 20.645  -2.329  -38.210 1.00 27.91 ? 45  LYS B CA  1 
ATOM   2057 C C   . LYS B 1 40  ? 22.015  -1.701  -38.173 1.00 24.09 ? 45  LYS B C   1 
ATOM   2058 O O   . LYS B 1 40  ? 22.531  -1.287  -39.210 1.00 23.18 ? 45  LYS B O   1 
ATOM   2059 C CB  . LYS B 1 40  ? 20.634  -3.502  -39.157 1.00 31.96 ? 45  LYS B CB  1 
ATOM   2060 C CG  . LYS B 1 40  ? 21.465  -4.656  -38.582 1.00 36.18 ? 45  LYS B CG  1 
ATOM   2061 C CD  . LYS B 1 40  ? 21.262  -5.961  -39.349 1.00 41.01 ? 45  LYS B CD  1 
ATOM   2062 C CE  . LYS B 1 40  ? 19.792  -6.237  -39.693 1.00 45.46 ? 45  LYS B CE  1 
ATOM   2063 N NZ  . LYS B 1 40  ? 19.259  -5.641  -40.948 1.00 50.73 ? 45  LYS B NZ  1 
ATOM   2064 N N   . LEU B 1 41  ? 22.544  -1.547  -36.975 1.00 23.02 ? 46  LEU B N   1 
ATOM   2065 C CA  . LEU B 1 41  ? 23.781  -0.898  -36.764 1.00 23.88 ? 46  LEU B CA  1 
ATOM   2066 C C   . LEU B 1 41  ? 24.859  -1.896  -36.323 1.00 23.14 ? 46  LEU B C   1 
ATOM   2067 O O   . LEU B 1 41  ? 24.596  -2.812  -35.556 1.00 25.04 ? 46  LEU B O   1 
ATOM   2068 C CB  . LEU B 1 41  ? 23.661  0.094   -35.605 1.00 26.06 ? 46  LEU B CB  1 
ATOM   2069 C CG  . LEU B 1 41  ? 22.677  1.294   -35.746 1.00 28.97 ? 46  LEU B CG  1 
ATOM   2070 C CD1 . LEU B 1 41  ? 22.794  1.945   -37.070 1.00 28.19 ? 46  LEU B CD1 1 
ATOM   2071 C CD2 . LEU B 1 41  ? 21.250  0.926   -35.470 1.00 31.26 ? 46  LEU B CD2 1 
ATOM   2072 N N   . LYS B 1 42  ? 26.079  -1.666  -36.719 1.00 21.76 ? 47  LYS B N   1 
ATOM   2073 C CA  . LYS B 1 42  ? 27.187  -2.523  -36.280 1.00 24.51 ? 47  LYS B CA  1 
ATOM   2074 C C   . LYS B 1 42  ? 28.302  -1.606  -35.719 1.00 22.98 ? 47  LYS B C   1 
ATOM   2075 O O   . LYS B 1 42  ? 28.663  -0.611  -36.390 1.00 22.46 ? 47  LYS B O   1 
ATOM   2076 C CB  . LYS B 1 42  ? 27.652  -3.353  -37.491 1.00 27.83 ? 47  LYS B CB  1 
ATOM   2077 C CG  . LYS B 1 42  ? 26.521  -4.133  -38.171 1.00 30.81 ? 47  LYS B CG  1 
ATOM   2078 C CD  . LYS B 1 42  ? 27.005  -4.882  -39.430 1.00 36.61 ? 47  LYS B CD  1 
ATOM   2079 C CE  . LYS B 1 42  ? 25.970  -5.912  -39.871 1.00 40.81 ? 47  LYS B CE  1 
ATOM   2080 N NZ  . LYS B 1 42  ? 24.933  -5.237  -40.723 1.00 46.83 ? 47  LYS B NZ  1 
ATOM   2081 N N   . VAL B 1 43  ? 28.804  -1.872  -34.498 1.00 21.75 ? 48  VAL B N   1 
ATOM   2082 C CA  . VAL B 1 43  ? 30.028  -1.268  -34.129 1.00 21.59 ? 48  VAL B CA  1 
ATOM   2083 C C   . VAL B 1 43  ? 31.187  -1.862  -34.999 1.00 22.64 ? 48  VAL B C   1 
ATOM   2084 O O   . VAL B 1 43  ? 31.481  -3.065  -34.918 1.00 23.40 ? 48  VAL B O   1 
ATOM   2085 C CB  . VAL B 1 43  ? 30.332  -1.481  -32.647 1.00 20.52 ? 48  VAL B CB  1 
ATOM   2086 C CG1 . VAL B 1 43  ? 31.611  -0.802  -32.286 1.00 21.18 ? 48  VAL B CG1 1 
ATOM   2087 C CG2 . VAL B 1 43  ? 29.166  -1.010  -31.816 1.00 23.51 ? 48  VAL B CG2 1 
ATOM   2088 N N   . THR B 1 44  ? 31.807  -1.059  -35.841 1.00 24.01 ? 49  THR B N   1 
ATOM   2089 C CA  . THR B 1 44  ? 32.864  -1.536  -36.745 1.00 25.27 ? 49  THR B CA  1 
ATOM   2090 C C   . THR B 1 44  ? 34.277  -1.165  -36.388 1.00 22.94 ? 49  THR B C   1 
ATOM   2091 O O   . THR B 1 44  ? 35.248  -1.705  -36.967 1.00 22.61 ? 49  THR B O   1 
ATOM   2092 C CB  . THR B 1 44  ? 32.654  -1.008  -38.173 1.00 26.10 ? 49  THR B CB  1 
ATOM   2093 O OG1 . THR B 1 44  ? 32.502  0.404   -38.116 1.00 27.80 ? 49  THR B OG1 1 
ATOM   2094 C CG2 . THR B 1 44  ? 31.406  -1.623  -38.815 1.00 28.42 ? 49  THR B CG2 1 
ATOM   2095 N N   . LYS B 1 45  ? 34.411  -0.300  -35.390 1.00 21.06 ? 50  LYS B N   1 
ATOM   2096 C CA  . LYS B 1 45  ? 35.688  -0.052  -34.754 1.00 21.21 ? 50  LYS B CA  1 
ATOM   2097 C C   . LYS B 1 45  ? 35.433  0.381   -33.321 1.00 21.64 ? 50  LYS B C   1 
ATOM   2098 O O   . LYS B 1 45  ? 34.446  1.006   -33.023 1.00 21.61 ? 50  LYS B O   1 
ATOM   2099 C CB  . LYS B 1 45  ? 36.447  1.111   -35.451 1.00 24.63 ? 50  LYS B CB  1 
ATOM   2100 C CG  . LYS B 1 45  ? 36.933  0.808   -36.834 1.00 29.18 ? 50  LYS B CG  1 
ATOM   2101 C CD  . LYS B 1 45  ? 37.863  1.906   -37.318 1.00 33.08 ? 50  LYS B CD  1 
ATOM   2102 C CE  . LYS B 1 45  ? 38.258  1.680   -38.764 1.00 34.52 ? 50  LYS B CE  1 
ATOM   2103 N NZ  . LYS B 1 45  ? 39.057  2.858   -39.213 1.00 41.87 ? 50  LYS B NZ  1 
ATOM   2104 N N   . GLY B 1 46  ? 36.324  -0.037  -32.448 1.00 23.55 ? 51  GLY B N   1 
ATOM   2105 C CA  . GLY B 1 46  ? 36.284  0.256   -31.036 1.00 23.48 ? 51  GLY B CA  1 
ATOM   2106 C C   . GLY B 1 46  ? 35.360  -0.659  -30.232 1.00 24.54 ? 51  GLY B C   1 
ATOM   2107 O O   . GLY B 1 46  ? 35.184  -0.407  -29.017 1.00 25.71 ? 51  GLY B O   1 
ATOM   2108 N N   . GLY B 1 47  ? 34.813  -1.751  -30.810 1.00 23.00 ? 52  GLY B N   1 
ATOM   2109 C CA  . GLY B 1 47  ? 33.886  -2.606  -30.043 1.00 24.18 ? 52  GLY B CA  1 
ATOM   2110 C C   . GLY B 1 47  ? 34.621  -3.672  -29.242 1.00 24.57 ? 52  GLY B C   1 
ATOM   2111 O O   . GLY B 1 47  ? 35.756  -4.030  -29.620 1.00 24.03 ? 52  GLY B O   1 
ATOM   2112 N N   . PRO B 1 48  ? 34.026  -4.155  -28.131 1.00 26.22 ? 53  PRO B N   1 
ATOM   2113 C CA  . PRO B 1 48  ? 32.687  -3.780  -27.583 1.00 26.78 ? 53  PRO B CA  1 
ATOM   2114 C C   . PRO B 1 48  ? 32.777  -2.458  -26.834 1.00 25.61 ? 53  PRO B C   1 
ATOM   2115 O O   . PRO B 1 48  ? 33.853  -2.168  -26.293 1.00 27.25 ? 53  PRO B O   1 
ATOM   2116 C CB  . PRO B 1 48  ? 32.396  -4.872  -26.522 1.00 27.56 ? 53  PRO B CB  1 
ATOM   2117 C CG  . PRO B 1 48  ? 33.768  -5.280  -26.082 1.00 27.36 ? 53  PRO B CG  1 
ATOM   2118 C CD  . PRO B 1 48  ? 34.701  -5.158  -27.283 1.00 28.41 ? 53  PRO B CD  1 
ATOM   2119 N N   . LEU B 1 49  ? 31.684  -1.701  -26.786 1.00 26.82 ? 54  LEU B N   1 
ATOM   2120 C CA  . LEU B 1 49  ? 31.723  -0.367  -26.174 1.00 24.84 ? 54  LEU B CA  1 
ATOM   2121 C C   . LEU B 1 49  ? 31.575  -0.508  -24.704 1.00 25.58 ? 54  LEU B C   1 
ATOM   2122 O O   . LEU B 1 49  ? 30.839  -1.378  -24.254 1.00 30.25 ? 54  LEU B O   1 
ATOM   2123 C CB  . LEU B 1 49  ? 30.614  0.563   -26.715 1.00 24.38 ? 54  LEU B CB  1 
ATOM   2124 C CG  . LEU B 1 49  ? 30.570  0.683   -28.261 1.00 24.78 ? 54  LEU B CG  1 
ATOM   2125 C CD1 . LEU B 1 49  ? 29.369  1.482   -28.699 1.00 24.68 ? 54  LEU B CD1 1 
ATOM   2126 C CD2 . LEU B 1 49  ? 31.859  1.246   -28.752 1.00 28.30 ? 54  LEU B CD2 1 
ATOM   2127 N N   . PRO B 1 50  ? 32.236  0.371   -23.950 1.00 25.41 ? 55  PRO B N   1 
ATOM   2128 C CA  . PRO B 1 50  ? 32.150  0.308   -22.467 1.00 27.82 ? 55  PRO B CA  1 
ATOM   2129 C C   . PRO B 1 50  ? 31.154  1.310   -21.883 1.00 32.22 ? 55  PRO B C   1 
ATOM   2130 O O   . PRO B 1 50  ? 31.419  1.875   -20.805 1.00 32.35 ? 55  PRO B O   1 
ATOM   2131 C CB  . PRO B 1 50  ? 33.528  0.779   -22.052 1.00 27.78 ? 55  PRO B CB  1 
ATOM   2132 C CG  . PRO B 1 50  ? 33.869  1.827   -23.061 1.00 28.81 ? 55  PRO B CG  1 
ATOM   2133 C CD  . PRO B 1 50  ? 33.280  1.321   -24.374 1.00 27.95 ? 55  PRO B CD  1 
ATOM   2134 N N   . PHE B 1 51  ? 30.042  1.551   -22.581 1.00 28.12 ? 56  PHE B N   1 
ATOM   2135 C CA  . PHE B 1 51  ? 29.014  2.516   -22.100 1.00 27.02 ? 56  PHE B CA  1 
ATOM   2136 C C   . PHE B 1 51  ? 27.714  2.150   -22.739 1.00 24.82 ? 56  PHE B C   1 
ATOM   2137 O O   . PHE B 1 51  ? 27.644  1.340   -23.718 1.00 26.38 ? 56  PHE B O   1 
ATOM   2138 C CB  . PHE B 1 51  ? 29.449  3.970   -22.378 1.00 27.00 ? 56  PHE B CB  1 
ATOM   2139 C CG  . PHE B 1 51  ? 29.701  4.249   -23.814 1.00 25.79 ? 56  PHE B CG  1 
ATOM   2140 C CD1 . PHE B 1 51  ? 28.624  4.449   -24.659 1.00 25.14 ? 56  PHE B CD1 1 
ATOM   2141 C CD2 . PHE B 1 51  ? 30.996  4.248   -24.334 1.00 25.88 ? 56  PHE B CD2 1 
ATOM   2142 C CE1 . PHE B 1 51  ? 28.829  4.640   -26.024 1.00 26.26 ? 56  PHE B CE1 1 
ATOM   2143 C CE2 . PHE B 1 51  ? 31.208  4.397   -25.705 1.00 27.79 ? 56  PHE B CE2 1 
ATOM   2144 C CZ  . PHE B 1 51  ? 30.139  4.592   -26.541 1.00 25.99 ? 56  PHE B CZ  1 
ATOM   2145 N N   . ALA B 1 52  ? 26.652  2.700   -22.185 1.00 25.93 ? 57  ALA B N   1 
ATOM   2146 C CA  . ALA B 1 52  ? 25.279  2.414   -22.590 1.00 23.65 ? 57  ALA B CA  1 
ATOM   2147 C C   . ALA B 1 52  ? 24.998  2.769   -23.996 1.00 22.41 ? 57  ALA B C   1 
ATOM   2148 O O   . ALA B 1 52  ? 25.236  3.937   -24.419 1.00 23.33 ? 57  ALA B O   1 
ATOM   2149 C CB  . ALA B 1 52  ? 24.328  3.212   -21.696 1.00 23.99 ? 57  ALA B CB  1 
ATOM   2150 N N   . TRP B 1 53  ? 24.499  1.805   -24.747 1.00 22.56 ? 58  TRP B N   1 
ATOM   2151 C CA  . TRP B 1 53  ? 24.109  2.048   -26.077 1.00 24.97 ? 58  TRP B CA  1 
ATOM   2152 C C   . TRP B 1 53  ? 23.113  3.227   -26.168 1.00 26.25 ? 58  TRP B C   1 
ATOM   2153 O O   . TRP B 1 53  ? 23.146  4.013   -27.117 1.00 22.71 ? 58  TRP B O   1 
ATOM   2154 C CB  . TRP B 1 53  ? 23.576  0.789   -26.695 1.00 26.30 ? 58  TRP B CB  1 
ATOM   2155 C CG  . TRP B 1 53  ? 23.115  1.048   -28.059 1.00 28.93 ? 58  TRP B CG  1 
ATOM   2156 C CD1 . TRP B 1 53  ? 21.871  1.414   -28.431 1.00 29.94 ? 58  TRP B CD1 1 
ATOM   2157 C CD2 . TRP B 1 53  ? 23.904  1.000   -29.251 1.00 27.95 ? 58  TRP B CD2 1 
ATOM   2158 N NE1 . TRP B 1 53  ? 21.816  1.601   -29.781 1.00 28.95 ? 58  TRP B NE1 1 
ATOM   2159 C CE2 . TRP B 1 53  ? 23.045  1.343   -30.320 1.00 27.75 ? 58  TRP B CE2 1 
ATOM   2160 C CE3 . TRP B 1 53  ? 25.235  0.641   -29.525 1.00 31.32 ? 58  TRP B CE3 1 
ATOM   2161 C CZ2 . TRP B 1 53  ? 23.482  1.419   -31.655 1.00 26.78 ? 58  TRP B CZ2 1 
ATOM   2162 C CZ3 . TRP B 1 53  ? 25.674  0.711   -30.841 1.00 28.40 ? 58  TRP B CZ3 1 
ATOM   2163 C CH2 . TRP B 1 53  ? 24.786  1.082   -31.890 1.00 29.59 ? 58  TRP B CH2 1 
ATOM   2164 N N   . ASP B 1 54  ? 22.239  3.371   -25.166 1.00 24.84 ? 59  ASP B N   1 
ATOM   2165 C CA  . ASP B 1 54  ? 21.198  4.390   -25.217 1.00 24.83 ? 59  ASP B CA  1 
ATOM   2166 C C   . ASP B 1 54  ? 21.669  5.816   -25.527 1.00 24.97 ? 59  ASP B C   1 
ATOM   2167 O O   . ASP B 1 54  ? 20.914  6.571   -26.103 1.00 29.21 ? 59  ASP B O   1 
ATOM   2168 C CB  . ASP B 1 54  ? 20.472  4.440   -23.915 1.00 25.98 ? 59  ASP B CB  1 
ATOM   2169 C CG  . ASP B 1 54  ? 19.581  3.203   -23.690 1.00 26.88 ? 59  ASP B CG  1 
ATOM   2170 O OD1 . ASP B 1 54  ? 19.065  2.611   -24.673 1.00 29.72 ? 59  ASP B OD1 1 
ATOM   2171 O OD2 . ASP B 1 54  ? 19.422  2.800   -22.532 1.00 29.84 ? 59  ASP B OD2 1 
ATOM   2172 N N   . ILE B 1 55  ? 22.874  6.178   -25.182 1.00 24.27 ? 60  ILE B N   1 
ATOM   2173 C CA  . ILE B 1 55  ? 23.276  7.569   -25.491 1.00 26.80 ? 60  ILE B CA  1 
ATOM   2174 C C   . ILE B 1 55  ? 23.565  7.742   -26.968 1.00 24.38 ? 60  ILE B C   1 
ATOM   2175 O O   . ILE B 1 55  ? 23.494  8.910   -27.459 1.00 25.21 ? 60  ILE B O   1 
ATOM   2176 C CB  . ILE B 1 55  ? 24.451  8.119   -24.687 1.00 28.80 ? 60  ILE B CB  1 
ATOM   2177 C CG1 . ILE B 1 55  ? 25.743  7.320   -24.883 1.00 30.11 ? 60  ILE B CG1 1 
ATOM   2178 C CG2 . ILE B 1 55  ? 24.125  8.269   -23.219 1.00 30.98 ? 60  ILE B CG2 1 
ATOM   2179 C CD1 . ILE B 1 55  ? 26.993  8.056   -24.440 1.00 30.29 ? 60  ILE B CD1 1 
ATOM   2180 N N   . LEU B 1 56  ? 23.799  6.664   -27.728 1.00 22.43 ? 61  LEU B N   1 
ATOM   2181 C CA  . LEU B 1 56  ? 23.952  6.734   -29.173 1.00 24.45 ? 61  LEU B CA  1 
ATOM   2182 C C   . LEU B 1 56  ? 22.650  6.589   -29.937 1.00 25.23 ? 61  LEU B C   1 
ATOM   2183 O O   . LEU B 1 56  ? 22.525  7.089   -31.046 1.00 23.59 ? 61  LEU B O   1 
ATOM   2184 C CB  . LEU B 1 56  ? 24.936  5.617   -29.656 1.00 21.66 ? 61  LEU B CB  1 
ATOM   2185 C CG  . LEU B 1 56  ? 26.251  5.560   -28.908 1.00 23.28 ? 61  LEU B CG  1 
ATOM   2186 C CD1 . LEU B 1 56  ? 27.141  4.488   -29.514 1.00 24.64 ? 61  LEU B CD1 1 
ATOM   2187 C CD2 . LEU B 1 56  ? 27.078  6.828   -28.840 1.00 24.01 ? 61  LEU B CD2 1 
ATOM   2188 N N   . SER B 1 57  ? 21.671  5.876   -29.359 1.00 23.86 ? 62  SER B N   1 
ATOM   2189 C CA  . SER B 1 57  ? 20.480  5.522   -30.080 1.00 25.29 ? 62  SER B CA  1 
ATOM   2190 C C   . SER B 1 57  ? 19.781  6.667   -30.761 1.00 22.02 ? 62  SER B C   1 
ATOM   2191 O O   . SER B 1 57  ? 19.421  6.519   -31.891 1.00 23.73 ? 62  SER B O   1 
ATOM   2192 C CB  . SER B 1 57  ? 19.530  4.675   -29.180 1.00 28.50 ? 62  SER B CB  1 
ATOM   2193 O OG  . SER B 1 57  ? 19.216  5.392   -27.990 1.00 31.56 ? 62  SER B OG  1 
ATOM   2194 N N   . PRO B 1 58  ? 19.574  7.817   -30.109 1.00 22.88 ? 63  PRO B N   1 
ATOM   2195 C CA  . PRO B 1 58  ? 18.832  8.884   -30.739 1.00 24.10 ? 63  PRO B CA  1 
ATOM   2196 C C   . PRO B 1 58  ? 19.572  9.644   -31.827 1.00 25.90 ? 63  PRO B C   1 
ATOM   2197 O O   . PRO B 1 58  ? 18.980  10.549  -32.432 1.00 26.29 ? 63  PRO B O   1 
ATOM   2198 C CB  . PRO B 1 58  ? 18.530  9.853   -29.592 1.00 26.49 ? 63  PRO B CB  1 
ATOM   2199 C CG  . PRO B 1 58  ? 19.085  9.274   -28.405 1.00 27.19 ? 63  PRO B CG  1 
ATOM   2200 C CD  . PRO B 1 58  ? 20.049  8.201   -28.778 1.00 25.08 ? 63  PRO B CD  1 
ATOM   2201 N N   . GLN B 1 59  ? 20.820  9.286   -32.110 1.00 25.36 ? 64  GLN B N   1 
ATOM   2202 C CA  . GLN B 1 59  ? 21.608  10.002  -33.100 1.00 26.28 ? 64  GLN B CA  1 
ATOM   2203 C C   . GLN B 1 59  ? 21.447  9.409   -34.485 1.00 30.39 ? 64  GLN B C   1 
ATOM   2204 O O   . GLN B 1 59  ? 21.773  10.068  -35.476 1.00 30.41 ? 64  GLN B O   1 
ATOM   2205 C CB  . GLN B 1 59  ? 23.075  10.097  -32.750 1.00 28.45 ? 64  GLN B CB  1 
ATOM   2206 C CG  . GLN B 1 59  ? 23.420  10.320  -31.302 1.00 26.65 ? 64  GLN B CG  1 
ATOM   2207 C CD  . GLN B 1 59  ? 22.750  11.506  -30.597 1.00 28.23 ? 64  GLN B CD  1 
ATOM   2208 O OE1 . GLN B 1 59  ? 22.243  12.423  -31.230 1.00 27.21 ? 64  GLN B OE1 1 
ATOM   2209 N NE2 . GLN B 1 59  ? 22.769  11.489  -29.270 1.00 26.85 ? 64  GLN B NE2 1 
ATOM   2210 N N   . PHE B 1 60  ? 20.869  8.214   -34.576 1.00 27.28 ? 65  PHE B N   1 
ATOM   2211 C CA  . PHE B 1 60  ? 20.546  7.575   -35.889 1.00 33.24 ? 65  PHE B CA  1 
ATOM   2212 C C   . PHE B 1 60  ? 19.135  7.930   -36.433 1.00 37.63 ? 65  PHE B C   1 
ATOM   2213 O O   . PHE B 1 60  ? 18.424  7.084   -37.035 1.00 42.38 ? 65  PHE B O   1 
ATOM   2214 C CB  . PHE B 1 60  ? 20.762  6.061   -35.725 1.00 31.44 ? 65  PHE B CB  1 
ATOM   2215 C CG  . PHE B 1 60  ? 22.113  5.729   -35.144 1.00 29.67 ? 65  PHE B CG  1 
ATOM   2216 C CD1 . PHE B 1 60  ? 23.261  5.923   -35.900 1.00 33.86 ? 65  PHE B CD1 1 
ATOM   2217 C CD2 . PHE B 1 60  ? 22.256  5.211   -33.872 1.00 29.93 ? 65  PHE B CD2 1 
ATOM   2218 C CE1 . PHE B 1 60  ? 24.507  5.658   -35.371 1.00 33.46 ? 65  PHE B CE1 1 
ATOM   2219 C CE2 . PHE B 1 60  ? 23.483  4.943   -33.345 1.00 30.32 ? 65  PHE B CE2 1 
ATOM   2220 C CZ  . PHE B 1 60  ? 24.630  5.145   -34.122 1.00 31.68 ? 65  PHE B CZ  1 
HETATM 2221 N N1  . CH6 B 1 61  ? 18.229  8.792   -36.156 1.00 44.72 ? 66  CH6 B N1  1 
HETATM 2222 C CE  . CH6 B 1 61  ? 15.758  3.616   -36.333 1.00 50.75 ? 66  CH6 B CE  1 
HETATM 2223 S SD  . CH6 B 1 61  ? 16.416  4.569   -35.007 1.00 56.10 ? 66  CH6 B SD  1 
HETATM 2224 C CG1 . CH6 B 1 61  ? 16.191  6.294   -35.433 1.00 57.63 ? 66  CH6 B CG1 1 
HETATM 2225 C CB1 . CH6 B 1 61  ? 17.012  7.295   -34.565 1.00 58.02 ? 66  CH6 B CB1 1 
HETATM 2226 C CA1 . CH6 B 1 61  ? 17.064  8.683   -35.274 1.00 54.09 ? 66  CH6 B CA1 1 
HETATM 2227 C C1  . CH6 B 1 61  ? 16.930  9.926   -34.434 1.00 56.18 ? 66  CH6 B C1  1 
HETATM 2228 N N2  . CH6 B 1 61  ? 16.178  9.939   -33.253 1.00 57.65 ? 66  CH6 B N2  1 
HETATM 2229 O OH  . CH6 B 1 61  ? 13.206  9.433   -26.958 1.00 57.40 ? 66  CH6 B OH  1 
HETATM 2230 C CD2 . CH6 B 1 61  ? 14.520  11.881  -29.379 1.00 60.30 ? 66  CH6 B CD2 1 
HETATM 2231 C CE2 . CH6 B 1 61  ? 13.878  11.338  -28.251 1.00 59.70 ? 66  CH6 B CE2 1 
HETATM 2232 C CZ  . CH6 B 1 61  ? 13.819  9.959   -28.068 1.00 63.50 ? 66  CH6 B CZ  1 
HETATM 2233 C CE1 . CH6 B 1 61  ? 14.383  9.137   -29.063 1.00 61.63 ? 66  CH6 B CE1 1 
HETATM 2234 C CD1 . CH6 B 1 61  ? 15.014  9.675   -30.205 1.00 60.52 ? 66  CH6 B CD1 1 
HETATM 2235 C CG2 . CH6 B 1 61  ? 15.085  11.067  -30.361 1.00 61.01 ? 66  CH6 B CG2 1 
HETATM 2236 C CB2 . CH6 B 1 61  ? 15.666  11.784  -31.526 1.00 60.41 ? 66  CH6 B CB2 1 
HETATM 2237 C CA2 . CH6 B 1 61  ? 16.207  11.204  -32.780 1.00 57.47 ? 66  CH6 B CA2 1 
HETATM 2238 C C2  . CH6 B 1 61  ? 16.997  11.961  -33.726 1.00 58.05 ? 66  CH6 B C2  1 
HETATM 2239 O O2  . CH6 B 1 61  ? 17.218  13.212  -33.553 1.00 58.05 ? 66  CH6 B O2  1 
HETATM 2240 N N3  . CH6 B 1 61  ? 17.414  11.213  -34.742 1.00 49.29 ? 66  CH6 B N3  1 
HETATM 2241 C CA3 . CH6 B 1 61  ? 18.295  11.836  -35.762 1.00 49.66 ? 66  CH6 B CA3 1 
HETATM 2242 C C3  . CH6 B 1 61  ? 18.325  11.398  -37.233 1.00 46.85 ? 66  CH6 B C3  1 
HETATM 2243 O O3  . CH6 B 1 61  ? 19.384  11.591  -37.917 1.00 48.11 ? 66  CH6 B O3  1 
ATOM   2244 N N   . SER B 1 62  ? 17.117  11.345  -37.550 1.00 33.81 ? 69  SER B N   1 
ATOM   2245 C CA  . SER B 1 62  ? 16.702  10.814  -38.853 1.00 34.29 ? 69  SER B CA  1 
ATOM   2246 C C   . SER B 1 62  ? 15.376  11.504  -39.173 1.00 36.52 ? 69  SER B C   1 
ATOM   2247 O O   . SER B 1 62  ? 14.286  10.914  -39.296 1.00 33.80 ? 69  SER B O   1 
ATOM   2248 C CB  . SER B 1 62  ? 16.611  9.309   -38.786 1.00 34.31 ? 69  SER B CB  1 
ATOM   2249 O OG  . SER B 1 62  ? 16.203  9.037   -37.467 1.00 33.31 ? 69  SER B OG  1 
ATOM   2250 N N   . LYS B 1 63  ? 15.526  12.808  -39.328 1.00 33.56 ? 70  LYS B N   1 
ATOM   2251 C CA  . LYS B 1 63  ? 14.399  13.717  -39.334 1.00 32.97 ? 70  LYS B CA  1 
ATOM   2252 C C   . LYS B 1 63  ? 13.619  13.663  -40.610 1.00 29.66 ? 70  LYS B C   1 
ATOM   2253 O O   . LYS B 1 63  ? 12.510  14.153  -40.662 1.00 31.56 ? 70  LYS B O   1 
ATOM   2254 C CB  . LYS B 1 63  ? 14.910  15.127  -39.136 1.00 36.40 ? 70  LYS B CB  1 
ATOM   2255 C CG  . LYS B 1 63  ? 15.147  15.435  -37.667 1.00 35.49 ? 70  LYS B CG  1 
ATOM   2256 C CD  . LYS B 1 63  ? 13.798  15.554  -36.949 1.00 36.67 ? 70  LYS B CD  1 
ATOM   2257 C CE  . LYS B 1 63  ? 13.886  15.962  -35.479 1.00 41.29 ? 70  LYS B CE  1 
ATOM   2258 N NZ  . LYS B 1 63  ? 14.537  14.958  -34.596 1.00 43.62 ? 70  LYS B NZ  1 
ATOM   2259 N N   . ALA B 1 64  ? 14.196  13.057  -41.637 1.00 25.39 ? 71  ALA B N   1 
ATOM   2260 C CA  . ALA B 1 64  ? 13.485  12.852  -42.846 1.00 27.12 ? 71  ALA B CA  1 
ATOM   2261 C C   . ALA B 1 64  ? 12.273  11.936  -42.639 1.00 23.41 ? 71  ALA B C   1 
ATOM   2262 O O   . ALA B 1 64  ? 11.336  12.003  -43.468 1.00 25.80 ? 71  ALA B O   1 
ATOM   2263 C CB  . ALA B 1 64  ? 14.411  12.260  -43.926 1.00 25.77 ? 71  ALA B CB  1 
ATOM   2264 N N   . TYR B 1 65  ? 12.294  11.129  -41.615 1.00 23.42 ? 72  TYR B N   1 
ATOM   2265 C CA  . TYR B 1 65  ? 11.246  10.077  -41.367 1.00 23.67 ? 72  TYR B CA  1 
ATOM   2266 C C   . TYR B 1 65  ? 10.304  10.462  -40.221 1.00 24.62 ? 72  TYR B C   1 
ATOM   2267 O O   . TYR B 1 65  ? 10.109  9.721   -39.238 1.00 29.03 ? 72  TYR B O   1 
ATOM   2268 C CB  . TYR B 1 65  ? 11.871  8.697   -41.035 1.00 22.39 ? 72  TYR B CB  1 
ATOM   2269 C CG  . TYR B 1 65  ? 12.683  8.017   -42.132 1.00 23.76 ? 72  TYR B CG  1 
ATOM   2270 C CD1 . TYR B 1 65  ? 14.016  8.312   -42.338 1.00 24.37 ? 72  TYR B CD1 1 
ATOM   2271 C CD2 . TYR B 1 65  ? 12.112  7.017   -42.921 1.00 23.74 ? 72  TYR B CD2 1 
ATOM   2272 C CE1 . TYR B 1 65  ? 14.763  7.661   -43.341 1.00 25.53 ? 72  TYR B CE1 1 
ATOM   2273 C CE2 . TYR B 1 65  ? 12.863  6.322   -43.887 1.00 25.06 ? 72  TYR B CE2 1 
ATOM   2274 C CZ  . TYR B 1 65  ? 14.164  6.671   -44.112 1.00 25.65 ? 72  TYR B CZ  1 
ATOM   2275 O OH  . TYR B 1 65  ? 14.943  6.046   -45.062 1.00 25.93 ? 72  TYR B OH  1 
ATOM   2276 N N   . VAL B 1 66  ? 9.783   11.666  -40.281 1.00 24.59 ? 73  VAL B N   1 
ATOM   2277 C CA  . VAL B 1 66  ? 8.807   12.096  -39.321 1.00 23.01 ? 73  VAL B CA  1 
ATOM   2278 C C   . VAL B 1 66  ? 7.511   12.323  -40.107 1.00 21.19 ? 73  VAL B C   1 
ATOM   2279 O O   . VAL B 1 66  ? 7.475   13.084  -41.098 1.00 23.78 ? 73  VAL B O   1 
ATOM   2280 C CB  . VAL B 1 66  ? 9.286   13.418  -38.613 1.00 22.60 ? 73  VAL B CB  1 
ATOM   2281 C CG1 . VAL B 1 66  ? 8.197   13.915  -37.670 1.00 22.04 ? 73  VAL B CG1 1 
ATOM   2282 C CG2 . VAL B 1 66  ? 10.582  13.229  -37.866 1.00 20.96 ? 73  VAL B CG2 1 
ATOM   2283 N N   . LYS B 1 67  ? 6.410   11.734  -39.646 1.00 22.28 ? 74  LYS B N   1 
ATOM   2284 C CA  . LYS B 1 67  ? 5.160   11.959  -40.293 1.00 24.65 ? 74  LYS B CA  1 
ATOM   2285 C C   . LYS B 1 67  ? 4.722   13.408  -39.987 1.00 25.03 ? 74  LYS B C   1 
ATOM   2286 O O   . LYS B 1 67  ? 4.601   13.744  -38.843 1.00 27.26 ? 74  LYS B O   1 
ATOM   2287 C CB  . LYS B 1 67  ? 4.108   11.016  -39.757 1.00 27.04 ? 74  LYS B CB  1 
ATOM   2288 C CG  . LYS B 1 67  ? 2.787   11.155  -40.487 1.00 28.81 ? 74  LYS B CG  1 
ATOM   2289 C CD  . LYS B 1 67  ? 1.776   10.195  -39.889 1.00 32.12 ? 74  LYS B CD  1 
ATOM   2290 C CE  . LYS B 1 67  ? 0.388   10.503  -40.473 1.00 34.77 ? 74  LYS B CE  1 
ATOM   2291 N NZ  . LYS B 1 67  ? -0.541  9.395   -40.143 1.00 39.71 ? 74  LYS B NZ  1 
ATOM   2292 N N   . HIS B 1 68  ? 4.492   14.180  -41.005 1.00 26.88 ? 75  HIS B N   1 
ATOM   2293 C CA  . HIS B 1 68  ? 3.922   15.530  -40.849 1.00 26.76 ? 75  HIS B CA  1 
ATOM   2294 C C   . HIS B 1 68  ? 2.518   15.651  -41.429 1.00 30.16 ? 75  HIS B C   1 
ATOM   2295 O O   . HIS B 1 68  ? 2.280   15.287  -42.596 1.00 31.03 ? 75  HIS B O   1 
ATOM   2296 C CB  . HIS B 1 68  ? 4.839   16.557  -41.517 1.00 27.12 ? 75  HIS B CB  1 
ATOM   2297 C CG  . HIS B 1 68  ? 6.059   16.881  -40.693 1.00 30.59 ? 75  HIS B CG  1 
ATOM   2298 N ND1 . HIS B 1 68  ? 7.151   16.041  -40.589 1.00 24.79 ? 75  HIS B ND1 1 
ATOM   2299 C CD2 . HIS B 1 68  ? 6.342   17.961  -39.916 1.00 28.88 ? 75  HIS B CD2 1 
ATOM   2300 C CE1 . HIS B 1 68  ? 8.051   16.587  -39.780 1.00 27.08 ? 75  HIS B CE1 1 
ATOM   2301 N NE2 . HIS B 1 68  ? 7.580   17.751  -39.358 1.00 27.24 ? 75  HIS B NE2 1 
ATOM   2302 N N   . PRO B 1 69  ? 1.599   16.275  -40.662 1.00 31.07 ? 76  PRO B N   1 
ATOM   2303 C CA  . PRO B 1 69  ? 0.395   16.850  -41.294 1.00 32.25 ? 76  PRO B CA  1 
ATOM   2304 C C   . PRO B 1 69  ? 0.680   17.739  -42.509 1.00 31.29 ? 76  PRO B C   1 
ATOM   2305 O O   . PRO B 1 69  ? 1.695   18.460  -42.605 1.00 29.93 ? 76  PRO B O   1 
ATOM   2306 C CB  . PRO B 1 69  ? -0.222  17.701  -40.156 1.00 32.22 ? 76  PRO B CB  1 
ATOM   2307 C CG  . PRO B 1 69  ? 0.428   17.257  -38.890 1.00 32.03 ? 76  PRO B CG  1 
ATOM   2308 C CD  . PRO B 1 69  ? 1.772   16.712  -39.270 1.00 29.33 ? 76  PRO B CD  1 
ATOM   2309 N N   . ALA B 1 70  ? -0.206  17.742  -43.492 1.00 31.90 ? 77  ALA B N   1 
ATOM   2310 C CA  . ALA B 1 70  ? 0.054   18.527  -44.665 1.00 31.49 ? 77  ALA B CA  1 
ATOM   2311 C C   . ALA B 1 70  ? 0.182   20.033  -44.406 1.00 30.85 ? 77  ALA B C   1 
ATOM   2312 O O   . ALA B 1 70  ? 0.855   20.740  -45.151 1.00 31.98 ? 77  ALA B O   1 
ATOM   2313 C CB  . ALA B 1 70  ? -1.006  18.277  -45.730 1.00 33.70 ? 77  ALA B CB  1 
ATOM   2314 N N   . ASP B 1 71  ? -0.410  20.521  -43.339 1.00 30.54 ? 78  ASP B N   1 
ATOM   2315 C CA  . ASP B 1 71  ? -0.316  21.975  -43.068 1.00 32.69 ? 78  ASP B CA  1 
ATOM   2316 C C   . ASP B 1 71  ? 0.785   22.390  -42.068 1.00 29.85 ? 78  ASP B C   1 
ATOM   2317 O O   . ASP B 1 71  ? 0.822   23.533  -41.580 1.00 31.78 ? 78  ASP B O   1 
ATOM   2318 C CB  . ASP B 1 71  ? -1.647  22.543  -42.657 1.00 34.61 ? 78  ASP B CB  1 
ATOM   2319 C CG  . ASP B 1 71  ? -2.222  21.869  -41.480 1.00 37.10 ? 78  ASP B CG  1 
ATOM   2320 O OD1 . ASP B 1 71  ? -1.800  20.749  -41.064 1.00 39.53 ? 78  ASP B OD1 1 
ATOM   2321 O OD2 . ASP B 1 71  ? -3.162  22.488  -40.956 1.00 44.52 ? 78  ASP B OD2 1 
ATOM   2322 N N   . ILE B 1 72  ? 1.719   21.488  -41.837 1.00 26.39 ? 79  ILE B N   1 
ATOM   2323 C CA  . ILE B 1 72  ? 2.970   21.813  -41.137 1.00 27.45 ? 79  ILE B CA  1 
ATOM   2324 C C   . ILE B 1 72  ? 4.109   21.568  -42.110 1.00 27.44 ? 79  ILE B C   1 
ATOM   2325 O O   . ILE B 1 72  ? 4.335   20.388  -42.443 1.00 28.40 ? 79  ILE B O   1 
ATOM   2326 C CB  . ILE B 1 72  ? 3.205   20.957  -39.915 1.00 28.50 ? 79  ILE B CB  1 
ATOM   2327 C CG1 . ILE B 1 72  ? 2.033   21.073  -38.947 1.00 30.42 ? 79  ILE B CG1 1 
ATOM   2328 C CG2 . ILE B 1 72  ? 4.527   21.309  -39.198 1.00 28.32 ? 79  ILE B CG2 1 
ATOM   2329 C CD1 . ILE B 1 72  ? 2.241   20.380  -37.667 1.00 29.76 ? 79  ILE B CD1 1 
ATOM   2330 N N   . PRO B 1 73  ? 4.762   22.631  -42.591 1.00 26.50 ? 80  PRO B N   1 
ATOM   2331 C CA  . PRO B 1 73  ? 5.824   22.476  -43.611 1.00 26.78 ? 80  PRO B CA  1 
ATOM   2332 C C   . PRO B 1 73  ? 6.855   21.490  -43.107 1.00 25.83 ? 80  PRO B C   1 
ATOM   2333 O O   . PRO B 1 73  ? 7.318   21.619  -41.996 1.00 24.91 ? 80  PRO B O   1 
ATOM   2334 C CB  . PRO B 1 73  ? 6.417   23.864  -43.719 1.00 26.91 ? 80  PRO B CB  1 
ATOM   2335 C CG  . PRO B 1 73  ? 5.267   24.779  -43.423 1.00 27.92 ? 80  PRO B CG  1 
ATOM   2336 C CD  . PRO B 1 73  ? 4.481   24.071  -42.359 1.00 27.74 ? 80  PRO B CD  1 
ATOM   2337 N N   . ASP B 1 74  ? 7.164   20.505  -43.937 1.00 25.36 ? 81  ASP B N   1 
ATOM   2338 C CA  . ASP B 1 74  ? 8.108   19.483  -43.618 1.00 24.30 ? 81  ASP B CA  1 
ATOM   2339 C C   . ASP B 1 74  ? 9.481   19.955  -44.094 1.00 24.48 ? 81  ASP B C   1 
ATOM   2340 O O   . ASP B 1 74  ? 10.053  19.492  -45.111 1.00 23.83 ? 81  ASP B O   1 
ATOM   2341 C CB  . ASP B 1 74  ? 7.661   18.165  -44.249 1.00 27.38 ? 81  ASP B CB  1 
ATOM   2342 C CG  . ASP B 1 74  ? 8.324   16.972  -43.640 1.00 25.52 ? 81  ASP B CG  1 
ATOM   2343 O OD1 . ASP B 1 74  ? 9.414   17.130  -43.013 1.00 28.92 ? 81  ASP B OD1 1 
ATOM   2344 O OD2 . ASP B 1 74  ? 7.740   15.841  -43.639 1.00 28.11 ? 81  ASP B OD2 1 
ATOM   2345 N N   . TYR B 1 75  ? 10.024  20.886  -43.333 1.00 21.53 ? 82  TYR B N   1 
ATOM   2346 C CA  . TYR B 1 75  ? 11.291  21.537  -43.640 1.00 21.91 ? 82  TYR B CA  1 
ATOM   2347 C C   . TYR B 1 75  ? 12.435  20.598  -44.000 1.00 20.96 ? 82  TYR B C   1 
ATOM   2348 O O   . TYR B 1 75  ? 13.119  20.833  -45.006 1.00 22.33 ? 82  TYR B O   1 
ATOM   2349 C CB  . TYR B 1 75  ? 11.623  22.386  -42.420 1.00 21.76 ? 82  TYR B CB  1 
ATOM   2350 C CG  . TYR B 1 75  ? 12.928  23.150  -42.448 1.00 20.44 ? 82  TYR B CG  1 
ATOM   2351 C CD1 . TYR B 1 75  ? 13.108  24.283  -43.259 1.00 21.65 ? 82  TYR B CD1 1 
ATOM   2352 C CD2 . TYR B 1 75  ? 13.975  22.773  -41.601 1.00 19.59 ? 82  TYR B CD2 1 
ATOM   2353 C CE1 . TYR B 1 75  ? 14.297  25.004  -43.259 1.00 21.56 ? 82  TYR B CE1 1 
ATOM   2354 C CE2 . TYR B 1 75  ? 15.145  23.503  -41.569 1.00 21.30 ? 82  TYR B CE2 1 
ATOM   2355 C CZ  . TYR B 1 75  ? 15.330  24.588  -42.417 1.00 20.57 ? 82  TYR B CZ  1 
ATOM   2356 O OH  . TYR B 1 75  ? 16.478  25.365  -42.423 1.00 22.49 ? 82  TYR B OH  1 
ATOM   2357 N N   . LEU B 1 76  ? 12.637  19.565  -43.212 1.00 20.91 ? 83  LEU B N   1 
ATOM   2358 C CA  . LEU B 1 76  ? 13.748  18.626  -43.433 1.00 22.10 ? 83  LEU B CA  1 
ATOM   2359 C C   . LEU B 1 76  ? 13.502  17.724  -44.631 1.00 22.78 ? 83  LEU B C   1 
ATOM   2360 O O   . LEU B 1 76  ? 14.431  17.463  -45.380 1.00 22.43 ? 83  LEU B O   1 
ATOM   2361 C CB  . LEU B 1 76  ? 14.045  17.857  -42.180 1.00 24.14 ? 83  LEU B CB  1 
ATOM   2362 C CG  . LEU B 1 76  ? 14.444  18.929  -41.143 1.00 25.14 ? 83  LEU B CG  1 
ATOM   2363 C CD1 . LEU B 1 76  ? 14.729  18.219  -39.872 1.00 28.53 ? 83  LEU B CD1 1 
ATOM   2364 C CD2 . LEU B 1 76  ? 15.645  19.728  -41.634 1.00 27.25 ? 83  LEU B CD2 1 
ATOM   2365 N N   . LYS B 1 77  ? 12.256  17.382  -44.936 1.00 24.09 ? 84  LYS B N   1 
ATOM   2366 C CA  . LYS B 1 77  ? 12.068  16.718  -46.267 1.00 24.09 ? 84  LYS B CA  1 
ATOM   2367 C C   . LYS B 1 77  ? 12.300  17.656  -47.418 1.00 24.05 ? 84  LYS B C   1 
ATOM   2368 O O   . LYS B 1 77  ? 12.898  17.256  -48.455 1.00 26.61 ? 84  LYS B O   1 
ATOM   2369 C CB  . LYS B 1 77  ? 10.669  16.073  -46.432 1.00 23.52 ? 84  LYS B CB  1 
ATOM   2370 C CG  . LYS B 1 77  ? 10.414  14.879  -45.597 1.00 24.45 ? 84  LYS B CG  1 
ATOM   2371 C CD  . LYS B 1 77  ? 9.061   14.220  -45.932 1.00 24.90 ? 84  LYS B CD  1 
ATOM   2372 C CE  . LYS B 1 77  ? 8.886   12.957  -45.124 1.00 24.95 ? 84  LYS B CE  1 
ATOM   2373 N NZ  . LYS B 1 77  ? 8.592   13.149  -43.676 1.00 23.90 ? 84  LYS B NZ  1 
ATOM   2374 N N   . LEU B 1 78  ? 11.818  18.906  -47.316 1.00 24.95 ? 85  LEU B N   1 
ATOM   2375 C CA  . LEU B 1 78  ? 11.954  19.929  -48.340 1.00 25.80 ? 85  LEU B CA  1 
ATOM   2376 C C   . LEU B 1 78  ? 13.413  20.239  -48.689 1.00 24.69 ? 85  LEU B C   1 
ATOM   2377 O O   . LEU B 1 78  ? 13.689  20.651  -49.786 1.00 24.67 ? 85  LEU B O   1 
ATOM   2378 C CB  . LEU B 1 78  ? 11.270  21.272  -47.944 1.00 26.94 ? 85  LEU B CB  1 
ATOM   2379 C CG  . LEU B 1 78  ? 9.726   21.183  -47.940 1.00 31.34 ? 85  LEU B CG  1 
ATOM   2380 C CD1 . LEU B 1 78  ? 9.097   22.369  -47.199 1.00 33.11 ? 85  LEU B CD1 1 
ATOM   2381 C CD2 . LEU B 1 78  ? 9.171   21.042  -49.351 1.00 32.95 ? 85  LEU B CD2 1 
ATOM   2382 N N   . SER B 1 79  ? 14.337  19.969  -47.765 1.00 23.09 ? 86  SER B N   1 
ATOM   2383 C CA  . SER B 1 79  ? 15.737  20.293  -47.941 1.00 22.43 ? 86  SER B CA  1 
ATOM   2384 C C   . SER B 1 79  ? 16.455  19.391  -48.948 1.00 23.22 ? 86  SER B C   1 
ATOM   2385 O O   . SER B 1 79  ? 17.519  19.742  -49.436 1.00 22.82 ? 86  SER B O   1 
ATOM   2386 C CB  . SER B 1 79  ? 16.504  20.175  -46.634 1.00 21.88 ? 86  SER B CB  1 
ATOM   2387 O OG  . SER B 1 79  ? 16.726  18.855  -46.188 1.00 21.77 ? 86  SER B OG  1 
ATOM   2388 N N   . PHE B 1 80  ? 15.831  18.256  -49.254 1.00 22.33 ? 87  PHE B N   1 
ATOM   2389 C CA  . PHE B 1 80  ? 16.411  17.326  -50.279 1.00 24.79 ? 87  PHE B CA  1 
ATOM   2390 C C   . PHE B 1 80  ? 16.206  17.808  -51.702 1.00 24.63 ? 87  PHE B C   1 
ATOM   2391 O O   . PHE B 1 80  ? 15.232  18.540  -51.984 1.00 28.96 ? 87  PHE B O   1 
ATOM   2392 C CB  . PHE B 1 80  ? 15.918  15.908  -49.974 1.00 23.78 ? 87  PHE B CB  1 
ATOM   2393 C CG  . PHE B 1 80  ? 16.525  15.369  -48.716 1.00 23.94 ? 87  PHE B CG  1 
ATOM   2394 C CD1 . PHE B 1 80  ? 17.807  14.803  -48.741 1.00 24.72 ? 87  PHE B CD1 1 
ATOM   2395 C CD2 . PHE B 1 80  ? 15.880  15.475  -47.519 1.00 23.37 ? 87  PHE B CD2 1 
ATOM   2396 C CE1 . PHE B 1 80  ? 18.397  14.346  -47.593 1.00 23.97 ? 87  PHE B CE1 1 
ATOM   2397 C CE2 . PHE B 1 80  ? 16.461  15.005  -46.348 1.00 24.37 ? 87  PHE B CE2 1 
ATOM   2398 C CZ  . PHE B 1 80  ? 17.723  14.434  -46.390 1.00 24.19 ? 87  PHE B CZ  1 
ATOM   2399 N N   . PRO B 1 81  ? 17.096  17.436  -52.629 1.00 26.13 ? 88  PRO B N   1 
ATOM   2400 C CA  . PRO B 1 81  ? 18.059  16.350  -52.480 1.00 25.80 ? 88  PRO B CA  1 
ATOM   2401 C C   . PRO B 1 81  ? 19.370  16.696  -51.744 1.00 25.48 ? 88  PRO B C   1 
ATOM   2402 O O   . PRO B 1 81  ? 20.036  15.799  -51.249 1.00 25.68 ? 88  PRO B O   1 
ATOM   2403 C CB  . PRO B 1 81  ? 18.395  15.996  -53.944 1.00 26.96 ? 88  PRO B CB  1 
ATOM   2404 C CG  . PRO B 1 81  ? 18.142  17.219  -54.698 1.00 28.04 ? 88  PRO B CG  1 
ATOM   2405 C CD  . PRO B 1 81  ? 16.951  17.835  -54.045 1.00 27.27 ? 88  PRO B CD  1 
ATOM   2406 N N   . GLU B 1 82  ? 19.685  17.964  -51.629 1.00 23.20 ? 89  GLU B N   1 
ATOM   2407 C CA  . GLU B 1 82  ? 20.955  18.379  -51.032 1.00 24.60 ? 89  GLU B CA  1 
ATOM   2408 C C   . GLU B 1 82  ? 20.996  17.957  -49.555 1.00 21.27 ? 89  GLU B C   1 
ATOM   2409 O O   . GLU B 1 82  ? 22.008  17.335  -49.080 1.00 20.21 ? 89  GLU B O   1 
ATOM   2410 C CB  . GLU B 1 82  ? 21.168  19.888  -51.231 1.00 25.25 ? 89  GLU B CB  1 
ATOM   2411 C CG  . GLU B 1 82  ? 21.242  20.323  -52.731 1.00 29.88 ? 89  GLU B CG  1 
ATOM   2412 C CD  . GLU B 1 82  ? 19.868  20.589  -53.384 1.00 29.73 ? 89  GLU B CD  1 
ATOM   2413 O OE1 . GLU B 1 82  ? 18.764  20.310  -52.811 1.00 31.43 ? 89  GLU B OE1 1 
ATOM   2414 O OE2 . GLU B 1 82  ? 19.852  21.094  -54.548 1.00 34.53 ? 89  GLU B OE2 1 
ATOM   2415 N N   . GLY B 1 83  ? 19.880  18.175  -48.860 1.00 19.99 ? 90  GLY B N   1 
ATOM   2416 C CA  . GLY B 1 83  ? 19.746  17.720  -47.475 1.00 19.85 ? 90  GLY B CA  1 
ATOM   2417 C C   . GLY B 1 83  ? 19.947  18.796  -46.396 1.00 19.23 ? 90  GLY B C   1 
ATOM   2418 O O   . GLY B 1 83  ? 19.683  19.952  -46.593 1.00 20.39 ? 90  GLY B O   1 
ATOM   2419 N N   . PHE B 1 84  ? 20.472  18.355  -45.274 1.00 19.69 ? 91  PHE B N   1 
ATOM   2420 C CA  . PHE B 1 84  ? 20.422  19.187  -44.033 1.00 18.85 ? 91  PHE B CA  1 
ATOM   2421 C C   . PHE B 1 84  ? 21.536  18.825  -43.095 1.00 18.40 ? 91  PHE B C   1 
ATOM   2422 O O   . PHE B 1 84  ? 22.115  17.737  -43.181 1.00 19.77 ? 91  PHE B O   1 
ATOM   2423 C CB  . PHE B 1 84  ? 19.043  19.191  -43.349 1.00 19.05 ? 91  PHE B CB  1 
ATOM   2424 C CG  . PHE B 1 84  ? 18.646  17.887  -42.757 1.00 20.31 ? 91  PHE B CG  1 
ATOM   2425 C CD1 . PHE B 1 84  ? 18.950  17.559  -41.457 1.00 22.24 ? 91  PHE B CD1 1 
ATOM   2426 C CD2 . PHE B 1 84  ? 17.905  16.989  -43.481 1.00 21.16 ? 91  PHE B CD2 1 
ATOM   2427 C CE1 . PHE B 1 84  ? 18.525  16.342  -40.925 1.00 23.10 ? 91  PHE B CE1 1 
ATOM   2428 C CE2 . PHE B 1 84  ? 17.545  15.756  -42.972 1.00 22.08 ? 91  PHE B CE2 1 
ATOM   2429 C CZ  . PHE B 1 84  ? 17.858  15.423  -41.696 1.00 23.87 ? 91  PHE B CZ  1 
ATOM   2430 N N   . LYS B 1 85  ? 21.851  19.757  -42.198 1.00 18.50 ? 92  LYS B N   1 
ATOM   2431 C CA  . LYS B 1 85  ? 22.735  19.484  -41.072 1.00 18.22 ? 92  LYS B CA  1 
ATOM   2432 C C   . LYS B 1 85  ? 22.112  19.761  -39.754 1.00 18.79 ? 92  LYS B C   1 
ATOM   2433 O O   . LYS B 1 85  ? 21.150  20.504  -39.606 1.00 18.24 ? 92  LYS B O   1 
ATOM   2434 C CB  . LYS B 1 85  ? 24.018  20.348  -41.156 1.00 21.38 ? 92  LYS B CB  1 
ATOM   2435 C CG  . LYS B 1 85  ? 24.838  20.150  -42.385 1.00 22.85 ? 92  LYS B CG  1 
ATOM   2436 C CD  . LYS B 1 85  ? 26.058  21.097  -42.424 1.00 24.92 ? 92  LYS B CD  1 
ATOM   2437 C CE  . LYS B 1 85  ? 26.716  21.074  -43.782 1.00 28.83 ? 92  LYS B CE  1 
ATOM   2438 N NZ  . LYS B 1 85  ? 27.401  19.798  -43.989 1.00 31.89 ? 92  LYS B NZ  1 
ATOM   2439 N N   . TRP B 1 86  ? 22.646  19.126  -38.743 1.00 18.40 ? 93  TRP B N   1 
ATOM   2440 C CA  . TRP B 1 86  ? 22.220  19.479  -37.404 1.00 18.14 ? 93  TRP B CA  1 
ATOM   2441 C C   . TRP B 1 86  ? 23.326  19.417  -36.391 1.00 18.35 ? 93  TRP B C   1 
ATOM   2442 O O   . TRP B 1 86  ? 24.369  18.796  -36.599 1.00 17.88 ? 93  TRP B O   1 
ATOM   2443 C CB  . TRP B 1 86  ? 20.962  18.770  -36.912 1.00 19.04 ? 93  TRP B CB  1 
ATOM   2444 C CG  . TRP B 1 86  ? 20.940  17.294  -36.881 1.00 20.15 ? 93  TRP B CG  1 
ATOM   2445 C CD1 . TRP B 1 86  ? 20.337  16.495  -37.809 1.00 22.46 ? 93  TRP B CD1 1 
ATOM   2446 C CD2 . TRP B 1 86  ? 21.394  16.402  -35.838 1.00 19.23 ? 93  TRP B CD2 1 
ATOM   2447 N NE1 . TRP B 1 86  ? 20.434  15.174  -37.440 1.00 20.65 ? 93  TRP B NE1 1 
ATOM   2448 C CE2 . TRP B 1 86  ? 21.092  15.099  -36.242 1.00 19.86 ? 93  TRP B CE2 1 
ATOM   2449 C CE3 . TRP B 1 86  ? 22.116  16.569  -34.668 1.00 19.19 ? 93  TRP B CE3 1 
ATOM   2450 C CZ2 . TRP B 1 86  ? 21.454  13.980  -35.488 1.00 20.61 ? 93  TRP B CZ2 1 
ATOM   2451 C CZ3 . TRP B 1 86  ? 22.406  15.430  -33.871 1.00 20.10 ? 93  TRP B CZ3 1 
ATOM   2452 C CH2 . TRP B 1 86  ? 22.124  14.174  -34.308 1.00 19.60 ? 93  TRP B CH2 1 
ATOM   2453 N N   . GLU B 1 87  ? 23.105  20.177  -35.324 1.00 18.39 ? 94  GLU B N   1 
ATOM   2454 C CA  . GLU B 1 87  ? 24.009  20.333  -34.175 1.00 20.18 ? 94  GLU B CA  1 
ATOM   2455 C C   . GLU B 1 87  ? 23.206  20.227  -32.855 1.00 18.22 ? 94  GLU B C   1 
ATOM   2456 O O   . GLU B 1 87  ? 22.179  20.859  -32.688 1.00 17.35 ? 94  GLU B O   1 
ATOM   2457 C CB  . GLU B 1 87  ? 24.792  21.658  -34.192 1.00 24.78 ? 94  GLU B CB  1 
ATOM   2458 C CG  . GLU B 1 87  ? 25.629  21.769  -35.465 1.00 30.14 ? 94  GLU B CG  1 
ATOM   2459 C CD  . GLU B 1 87  ? 26.708  22.839  -35.501 1.00 41.43 ? 94  GLU B CD  1 
ATOM   2460 O OE1 . GLU B 1 87  ? 27.718  22.605  -36.266 1.00 41.52 ? 94  GLU B OE1 1 
ATOM   2461 O OE2 . GLU B 1 87  ? 26.503  23.934  -34.889 1.00 48.77 ? 94  GLU B OE2 1 
ATOM   2462 N N   . ARG B 1 88  ? 23.636  19.308  -31.973 1.00 17.34 ? 95  ARG B N   1 
ATOM   2463 C CA  . ARG B 1 88  ? 22.923  18.988  -30.773 1.00 18.19 ? 95  ARG B CA  1 
ATOM   2464 C C   . ARG B 1 88  ? 23.811  19.035  -29.560 1.00 18.70 ? 95  ARG B C   1 
ATOM   2465 O O   . ARG B 1 88  ? 25.009  18.660  -29.627 1.00 18.88 ? 95  ARG B O   1 
ATOM   2466 C CB  . ARG B 1 88  ? 22.287  17.578  -30.925 1.00 18.07 ? 95  ARG B CB  1 
ATOM   2467 C CG  . ARG B 1 88  ? 21.623  17.036  -29.691 1.00 19.81 ? 95  ARG B CG  1 
ATOM   2468 C CD  . ARG B 1 88  ? 21.074  15.667  -30.062 1.00 21.16 ? 95  ARG B CD  1 
ATOM   2469 N NE  . ARG B 1 88  ? 19.957  15.808  -30.936 1.00 23.35 ? 95  ARG B NE  1 
ATOM   2470 C CZ  . ARG B 1 88  ? 19.347  14.839  -31.617 1.00 25.19 ? 95  ARG B CZ  1 
ATOM   2471 N NH1 . ARG B 1 88  ? 19.751  13.573  -31.531 1.00 22.77 ? 95  ARG B NH1 1 
ATOM   2472 N NH2 . ARG B 1 88  ? 18.297  15.133  -32.339 1.00 24.35 ? 95  ARG B NH2 1 
ATOM   2473 N N   . VAL B 1 89  ? 23.235  19.542  -28.486 1.00 18.29 ? 96  VAL B N   1 
ATOM   2474 C CA  . VAL B 1 89  ? 23.815  19.459  -27.185 1.00 20.16 ? 96  VAL B CA  1 
ATOM   2475 C C   . VAL B 1 89  ? 22.895  18.732  -26.241 1.00 18.98 ? 96  VAL B C   1 
ATOM   2476 O O   . VAL B 1 89  ? 21.733  19.043  -26.183 1.00 17.92 ? 96  VAL B O   1 
ATOM   2477 C CB  . VAL B 1 89  ? 24.062  20.869  -26.600 1.00 21.61 ? 96  VAL B CB  1 
ATOM   2478 C CG1 . VAL B 1 89  ? 24.598  20.754  -25.196 1.00 23.61 ? 96  VAL B CG1 1 
ATOM   2479 C CG2 . VAL B 1 89  ? 25.087  21.626  -27.423 1.00 24.14 ? 96  VAL B CG2 1 
ATOM   2480 N N   . MET B 1 90  ? 23.445  17.808  -25.454 1.00 20.07 ? 97  MET B N   1 
ATOM   2481 C CA  . MET B 1 90  ? 22.685  17.055  -24.466 1.00 22.08 ? 97  MET B CA  1 
ATOM   2482 C C   . MET B 1 90  ? 23.374  17.288  -23.123 1.00 20.28 ? 97  MET B C   1 
ATOM   2483 O O   . MET B 1 90  ? 24.567  16.978  -22.951 1.00 23.19 ? 97  MET B O   1 
ATOM   2484 C CB  . MET B 1 90  ? 22.718  15.577  -24.778 1.00 22.02 ? 97  MET B CB  1 
ATOM   2485 C CG  . MET B 1 90  ? 22.418  15.193  -26.216 1.00 25.23 ? 97  MET B CG  1 
ATOM   2486 S SD  . MET B 1 90  ? 22.452  13.432  -26.562 1.00 30.69 ? 97  MET B SD  1 
ATOM   2487 C CE  . MET B 1 90  ? 20.741  13.089  -26.277 1.00 33.61 ? 97  MET B CE  1 
ATOM   2488 N N   . ASN B 1 91  ? 22.668  17.840  -22.199 1.00 21.46 ? 98  ASN B N   1 
ATOM   2489 C CA  . ASN B 1 91  ? 23.150  17.955  -20.822 1.00 21.74 ? 98  ASN B CA  1 
ATOM   2490 C C   . ASN B 1 91  ? 22.395  16.936  -19.949 1.00 22.14 ? 98  ASN B C   1 
ATOM   2491 O O   . ASN B 1 91  ? 21.199  17.126  -19.670 1.00 22.22 ? 98  ASN B O   1 
ATOM   2492 C CB  . ASN B 1 91  ? 22.896  19.307  -20.245 1.00 21.76 ? 98  ASN B CB  1 
ATOM   2493 C CG  . ASN B 1 91  ? 24.000  20.342  -20.592 1.00 23.49 ? 98  ASN B CG  1 
ATOM   2494 O OD1 . ASN B 1 91  ? 25.169  20.032  -20.377 1.00 25.09 ? 98  ASN B OD1 1 
ATOM   2495 N ND2 . ASN B 1 91  ? 23.616  21.547  -21.083 1.00 23.49 ? 98  ASN B ND2 1 
ATOM   2496 N N   . PHE B 1 92  ? 23.153  15.986  -19.446 1.00 21.22 ? 99  PHE B N   1 
ATOM   2497 C CA  . PHE B 1 92  ? 22.596  14.894  -18.638 1.00 22.92 ? 99  PHE B CA  1 
ATOM   2498 C C   . PHE B 1 92  ? 22.580  15.370  -17.204 1.00 23.20 ? 99  PHE B C   1 
ATOM   2499 O O   . PHE B 1 92  ? 23.390  16.192  -16.772 1.00 26.16 ? 99  PHE B O   1 
ATOM   2500 C CB  . PHE B 1 92  ? 23.388  13.635  -18.779 1.00 21.53 ? 99  PHE B CB  1 
ATOM   2501 C CG  . PHE B 1 92  ? 23.222  12.967  -20.082 1.00 23.65 ? 99  PHE B CG  1 
ATOM   2502 C CD1 . PHE B 1 92  ? 23.956  13.391  -21.165 1.00 23.07 ? 99  PHE B CD1 1 
ATOM   2503 C CD2 . PHE B 1 92  ? 22.280  12.001  -20.247 1.00 21.20 ? 99  PHE B CD2 1 
ATOM   2504 C CE1 . PHE B 1 92  ? 23.767  12.777  -22.386 1.00 23.90 ? 99  PHE B CE1 1 
ATOM   2505 C CE2 . PHE B 1 92  ? 22.096  11.386  -21.475 1.00 24.05 ? 99  PHE B CE2 1 
ATOM   2506 C CZ  . PHE B 1 92  ? 22.861  11.773  -22.534 1.00 23.76 ? 99  PHE B CZ  1 
ATOM   2507 N N   . GLU B 1 93  ? 21.679  14.821  -16.406 1.00 27.26 ? 100 GLU B N   1 
ATOM   2508 C CA  . GLU B 1 93  ? 21.462  15.411  -15.086 1.00 26.60 ? 100 GLU B CA  1 
ATOM   2509 C C   . GLU B 1 93  ? 22.648  15.195  -14.136 1.00 30.77 ? 100 GLU B C   1 
ATOM   2510 O O   . GLU B 1 93  ? 22.754  15.925  -13.162 1.00 29.41 ? 100 GLU B O   1 
ATOM   2511 C CB  . GLU B 1 93  ? 20.191  14.797  -14.406 1.00 29.32 ? 100 GLU B CB  1 
ATOM   2512 C CG  . GLU B 1 93  ? 20.276  13.309  -14.244 1.00 29.98 ? 100 GLU B CG  1 
ATOM   2513 C CD  . GLU B 1 93  ? 19.128  12.773  -13.400 1.00 32.96 ? 100 GLU B CD  1 
ATOM   2514 O OE1 . GLU B 1 93  ? 18.129  12.278  -13.944 1.00 34.06 ? 100 GLU B OE1 1 
ATOM   2515 O OE2 . GLU B 1 93  ? 19.233  12.886  -12.153 1.00 36.93 ? 100 GLU B OE2 1 
ATOM   2516 N N   . ASP B 1 94  ? 23.500  14.204  -14.407 1.00 30.37 ? 101 ASP B N   1 
ATOM   2517 C CA  . ASP B 1 94  ? 24.713  13.960  -13.605 1.00 31.56 ? 101 ASP B CA  1 
ATOM   2518 C C   . ASP B 1 94  ? 25.972  14.684  -14.130 1.00 28.15 ? 101 ASP B C   1 
ATOM   2519 O O   . ASP B 1 94  ? 27.087  14.416  -13.664 1.00 30.16 ? 101 ASP B O   1 
ATOM   2520 C CB  . ASP B 1 94  ? 24.965  12.442  -13.338 1.00 29.59 ? 101 ASP B CB  1 
ATOM   2521 C CG  . ASP B 1 94  ? 25.292  11.610  -14.585 1.00 32.07 ? 101 ASP B CG  1 
ATOM   2522 O OD1 . ASP B 1 94  ? 25.140  12.138  -15.705 1.00 29.60 ? 101 ASP B OD1 1 
ATOM   2523 O OD2 . ASP B 1 94  ? 25.687  10.408  -14.463 1.00 30.65 ? 101 ASP B OD2 1 
ATOM   2524 N N   . GLY B 1 95  ? 25.821  15.566  -15.120 1.00 28.55 ? 102 GLY B N   1 
ATOM   2525 C CA  . GLY B 1 95  ? 26.978  16.314  -15.687 1.00 26.08 ? 102 GLY B CA  1 
ATOM   2526 C C   . GLY B 1 95  ? 27.672  15.785  -16.931 1.00 27.20 ? 102 GLY B C   1 
ATOM   2527 O O   . GLY B 1 95  ? 28.575  16.465  -17.460 1.00 26.25 ? 102 GLY B O   1 
ATOM   2528 N N   . GLY B 1 96  ? 27.256  14.613  -17.375 1.00 22.45 ? 103 GLY B N   1 
ATOM   2529 C CA  . GLY B 1 96  ? 27.640  14.075  -18.681 1.00 22.63 ? 103 GLY B CA  1 
ATOM   2530 C C   . GLY B 1 96  ? 27.160  15.064  -19.736 1.00 22.46 ? 103 GLY B C   1 
ATOM   2531 O O   . GLY B 1 96  ? 26.126  15.680  -19.577 1.00 23.74 ? 103 GLY B O   1 
ATOM   2532 N N   . VAL B 1 97  ? 27.927  15.179  -20.785 1.00 23.83 ? 104 VAL B N   1 
ATOM   2533 C CA  . VAL B 1 97  ? 27.605  16.096  -21.925 1.00 20.46 ? 104 VAL B CA  1 
ATOM   2534 C C   . VAL B 1 97  ? 27.881  15.359  -23.194 1.00 22.23 ? 104 VAL B C   1 
ATOM   2535 O O   . VAL B 1 97  ? 28.877  14.670  -23.268 1.00 21.56 ? 104 VAL B O   1 
ATOM   2536 C CB  . VAL B 1 97  ? 28.505  17.335  -21.878 1.00 21.82 ? 104 VAL B CB  1 
ATOM   2537 C CG1 . VAL B 1 97  ? 28.242  18.263  -23.061 1.00 19.77 ? 104 VAL B CG1 1 
ATOM   2538 C CG2 . VAL B 1 97  ? 28.263  18.128  -20.639 1.00 21.38 ? 104 VAL B CG2 1 
ATOM   2539 N N   . VAL B 1 98  ? 26.969  15.424  -24.156 1.00 19.76 ? 105 VAL B N   1 
ATOM   2540 C CA  . VAL B 1 98  ? 27.209  14.869  -25.462 1.00 19.83 ? 105 VAL B CA  1 
ATOM   2541 C C   . VAL B 1 98  ? 26.923  15.994  -26.399 1.00 20.01 ? 105 VAL B C   1 
ATOM   2542 O O   . VAL B 1 98  ? 25.884  16.658  -26.262 1.00 20.35 ? 105 VAL B O   1 
ATOM   2543 C CB  . VAL B 1 98  ? 26.268  13.718  -25.720 1.00 20.96 ? 105 VAL B CB  1 
ATOM   2544 C CG1 . VAL B 1 98  ? 26.309  13.235  -27.179 1.00 21.69 ? 105 VAL B CG1 1 
ATOM   2545 C CG2 . VAL B 1 98  ? 26.634  12.571  -24.774 1.00 23.11 ? 105 VAL B CG2 1 
ATOM   2546 N N   . THR B 1 99  ? 27.875  16.198  -27.313 1.00 20.56 ? 106 THR B N   1 
ATOM   2547 C CA  . THR B 1 99  ? 27.675  17.102  -28.441 1.00 20.39 ? 106 THR B CA  1 
ATOM   2548 C C   . THR B 1 99  ? 27.731  16.253  -29.662 1.00 20.09 ? 106 THR B C   1 
ATOM   2549 O O   . THR B 1 99  ? 28.501  15.260  -29.738 1.00 19.91 ? 106 THR B O   1 
ATOM   2550 C CB  . THR B 1 99  ? 28.673  18.288  -28.407 1.00 24.20 ? 106 THR B CB  1 
ATOM   2551 O OG1 . THR B 1 99  ? 29.999  17.796  -28.447 1.00 25.37 ? 106 THR B OG1 1 
ATOM   2552 C CG2 . THR B 1 99  ? 28.539  19.123  -27.145 1.00 23.38 ? 106 THR B CG2 1 
ATOM   2553 N N   . VAL B 1 100 ? 26.887  16.596  -30.634 1.00 17.43 ? 107 VAL B N   1 
ATOM   2554 C CA  . VAL B 1 100 ? 26.730  15.807  -31.827 1.00 19.55 ? 107 VAL B CA  1 
ATOM   2555 C C   . VAL B 1 100 ? 26.605  16.740  -32.979 1.00 19.88 ? 107 VAL B C   1 
ATOM   2556 O O   . VAL B 1 100 ? 25.890  17.736  -32.859 1.00 19.38 ? 107 VAL B O   1 
ATOM   2557 C CB  . VAL B 1 100 ? 25.471  14.914  -31.781 1.00 18.84 ? 107 VAL B CB  1 
ATOM   2558 C CG1 . VAL B 1 100 ? 25.430  13.912  -32.917 1.00 20.49 ? 107 VAL B CG1 1 
ATOM   2559 C CG2 . VAL B 1 100 ? 25.319  14.233  -30.445 1.00 19.96 ? 107 VAL B CG2 1 
ATOM   2560 N N   . THR B 1 101 ? 27.205  16.366  -34.096 1.00 20.05 ? 108 THR B N   1 
ATOM   2561 C CA  . THR B 1 101 ? 26.941  17.072  -35.357 1.00 20.71 ? 108 THR B CA  1 
ATOM   2562 C C   . THR B 1 101 ? 26.545  16.023  -36.407 1.00 21.35 ? 108 THR B C   1 
ATOM   2563 O O   . THR B 1 101 ? 26.960  14.818  -36.360 1.00 21.46 ? 108 THR B O   1 
ATOM   2564 C CB  . THR B 1 101 ? 28.151  17.947  -35.803 1.00 23.07 ? 108 THR B CB  1 
ATOM   2565 O OG1 . THR B 1 101 ? 29.261  17.105  -36.104 1.00 23.99 ? 108 THR B OG1 1 
ATOM   2566 C CG2 . THR B 1 101 ? 28.579  18.967  -34.765 1.00 24.56 ? 108 THR B CG2 1 
ATOM   2567 N N   . GLN B 1 102 ? 25.718  16.412  -37.355 1.00 19.03 ? 109 GLN B N   1 
ATOM   2568 C CA  . GLN B 1 102 ? 25.221  15.463  -38.303 1.00 19.51 ? 109 GLN B CA  1 
ATOM   2569 C C   . GLN B 1 102 ? 25.095  16.106  -39.651 1.00 20.42 ? 109 GLN B C   1 
ATOM   2570 O O   . GLN B 1 102 ? 24.676  17.272  -39.728 1.00 19.54 ? 109 GLN B O   1 
ATOM   2571 C CB  . GLN B 1 102 ? 23.870  14.936  -37.853 1.00 21.65 ? 109 GLN B CB  1 
ATOM   2572 C CG  . GLN B 1 102 ? 23.461  13.637  -38.491 1.00 22.10 ? 109 GLN B CG  1 
ATOM   2573 C CD  . GLN B 1 102 ? 22.606  13.786  -39.686 1.00 25.63 ? 109 GLN B CD  1 
ATOM   2574 O OE1 . GLN B 1 102 ? 22.394  14.878  -40.237 1.00 24.09 ? 109 GLN B OE1 1 
ATOM   2575 N NE2 . GLN B 1 102 ? 22.033  12.678  -40.085 1.00 33.36 ? 109 GLN B NE2 1 
ATOM   2576 N N   . ASP B 1 103 ? 25.365  15.317  -40.699 1.00 18.81 ? 110 ASP B N   1 
ATOM   2577 C CA  . ASP B 1 103 ? 25.068  15.736  -42.048 1.00 20.19 ? 110 ASP B CA  1 
ATOM   2578 C C   . ASP B 1 103 ? 24.258  14.698  -42.786 1.00 20.98 ? 110 ASP B C   1 
ATOM   2579 O O   . ASP B 1 103 ? 24.619  13.534  -42.742 1.00 22.20 ? 110 ASP B O   1 
ATOM   2580 C CB  . ASP B 1 103 ? 26.366  15.959  -42.798 1.00 22.77 ? 110 ASP B CB  1 
ATOM   2581 C CG  . ASP B 1 103 ? 26.107  16.464  -44.212 1.00 27.47 ? 110 ASP B CG  1 
ATOM   2582 O OD1 . ASP B 1 103 ? 25.805  15.653  -45.157 1.00 35.24 ? 110 ASP B OD1 1 
ATOM   2583 O OD2 . ASP B 1 103 ? 26.174  17.663  -44.365 1.00 34.37 ? 110 ASP B OD2 1 
ATOM   2584 N N   . SER B 1 104 ? 23.216  15.132  -43.497 1.00 20.15 ? 111 SER B N   1 
ATOM   2585 C CA  . SER B 1 104 ? 22.327  14.278  -44.257 1.00 22.86 ? 111 SER B CA  1 
ATOM   2586 C C   . SER B 1 104 ? 22.317  14.674  -45.685 1.00 23.82 ? 111 SER B C   1 
ATOM   2587 O O   . SER B 1 104 ? 22.067  15.859  -45.955 1.00 22.95 ? 111 SER B O   1 
ATOM   2588 C CB  . SER B 1 104 ? 20.898  14.380  -43.656 1.00 25.21 ? 111 SER B CB  1 
ATOM   2589 O OG  . SER B 1 104 ? 20.924  13.974  -42.251 1.00 24.85 ? 111 SER B OG  1 
ATOM   2590 N N   . SER B 1 105 ? 22.488  13.693  -46.596 1.00 23.80 ? 112 SER B N   1 
ATOM   2591 C CA  . SER B 1 105 ? 22.312  13.922  -48.000 1.00 24.51 ? 112 SER B CA  1 
ATOM   2592 C C   . SER B 1 105 ? 21.618  12.722  -48.662 1.00 25.18 ? 112 SER B C   1 
ATOM   2593 O O   . SER B 1 105 ? 21.168  11.800  -48.012 1.00 22.94 ? 112 SER B O   1 
ATOM   2594 C CB  . SER B 1 105 ? 23.677  14.178  -48.646 1.00 25.26 ? 112 SER B CB  1 
ATOM   2595 O OG  . SER B 1 105 ? 24.616  13.151  -48.377 1.00 28.88 ? 112 SER B OG  1 
ATOM   2596 N N   . LEU B 1 106 ? 21.527  12.769  -49.986 1.00 28.70 ? 113 LEU B N   1 
ATOM   2597 C CA  . LEU B 1 106 ? 20.877  11.740  -50.721 1.00 28.32 ? 113 LEU B CA  1 
ATOM   2598 C C   . LEU B 1 106 ? 21.827  11.289  -51.887 1.00 28.58 ? 113 LEU B C   1 
ATOM   2599 O O   . LEU B 1 106 ? 22.370  12.101  -52.630 1.00 30.06 ? 113 LEU B O   1 
ATOM   2600 C CB  . LEU B 1 106 ? 19.639  12.363  -51.281 1.00 32.12 ? 113 LEU B CB  1 
ATOM   2601 C CG  . LEU B 1 106 ? 18.604  11.499  -51.929 1.00 33.12 ? 113 LEU B CG  1 
ATOM   2602 C CD1 . LEU B 1 106 ? 17.920  10.596  -50.922 1.00 34.75 ? 113 LEU B CD1 1 
ATOM   2603 C CD2 . LEU B 1 106 ? 17.600  12.430  -52.584 1.00 34.40 ? 113 LEU B CD2 1 
ATOM   2604 N N   . GLN B 1 107 ? 21.948  9.984   -52.055 1.00 31.01 ? 114 GLN B N   1 
ATOM   2605 C CA  . GLN B 1 107 ? 22.914  9.382   -52.966 1.00 32.83 ? 114 GLN B CA  1 
ATOM   2606 C C   . GLN B 1 107 ? 22.287  8.149   -53.554 1.00 34.13 ? 114 GLN B C   1 
ATOM   2607 O O   . GLN B 1 107 ? 21.949  7.236   -52.837 1.00 35.27 ? 114 GLN B O   1 
ATOM   2608 C CB  . GLN B 1 107 ? 24.180  9.010   -52.203 1.00 37.58 ? 114 GLN B CB  1 
ATOM   2609 C CG  . GLN B 1 107 ? 24.962  10.181  -51.646 1.00 42.04 ? 114 GLN B CG  1 
ATOM   2610 C CD  . GLN B 1 107 ? 26.440  9.856   -51.432 1.00 47.29 ? 114 GLN B CD  1 
ATOM   2611 O OE1 . GLN B 1 107 ? 26.794  8.831   -50.838 1.00 52.61 ? 114 GLN B OE1 1 
ATOM   2612 N NE2 . GLN B 1 107 ? 27.311  10.724  -51.925 1.00 44.48 ? 114 GLN B NE2 1 
ATOM   2613 N N   . ASP B 1 108 ? 22.101  8.152   -54.876 1.00 39.18 ? 115 ASP B N   1 
ATOM   2614 C CA  . ASP B 1 108 ? 21.435  7.040   -55.597 1.00 39.18 ? 115 ASP B CA  1 
ATOM   2615 C C   . ASP B 1 108 ? 20.149  6.509   -54.919 1.00 34.90 ? 115 ASP B C   1 
ATOM   2616 O O   . ASP B 1 108 ? 20.008  5.281   -54.657 1.00 36.26 ? 115 ASP B O   1 
ATOM   2617 C CB  . ASP B 1 108 ? 22.454  5.912   -55.815 1.00 44.09 ? 115 ASP B CB  1 
ATOM   2618 C CG  . ASP B 1 108 ? 23.717  6.391   -56.553 1.00 47.00 ? 115 ASP B CG  1 
ATOM   2619 O OD1 . ASP B 1 108 ? 23.581  7.072   -57.597 1.00 51.70 ? 115 ASP B OD1 1 
ATOM   2620 O OD2 . ASP B 1 108 ? 24.843  6.075   -56.082 1.00 49.87 ? 115 ASP B OD2 1 
ATOM   2621 N N   . GLY B 1 109 ? 19.252  7.452   -54.601 1.00 31.74 ? 116 GLY B N   1 
ATOM   2622 C CA  . GLY B 1 109 ? 17.921  7.225   -54.083 1.00 32.45 ? 116 GLY B CA  1 
ATOM   2623 C C   . GLY B 1 109 ? 17.912  6.848   -52.604 1.00 30.39 ? 116 GLY B C   1 
ATOM   2624 O O   . GLY B 1 109 ? 16.885  6.383   -52.060 1.00 33.91 ? 116 GLY B O   1 
ATOM   2625 N N   . GLU B 1 110 ? 19.067  6.991   -51.978 1.00 29.85 ? 117 GLU B N   1 
ATOM   2626 C CA  . GLU B 1 110 ? 19.208  6.580   -50.582 1.00 29.20 ? 117 GLU B CA  1 
ATOM   2627 C C   . GLU B 1 110 ? 19.685  7.728   -49.712 1.00 27.88 ? 117 GLU B C   1 
ATOM   2628 O O   . GLU B 1 110 ? 20.584  8.428   -50.119 1.00 26.61 ? 117 GLU B O   1 
ATOM   2629 C CB  . GLU B 1 110 ? 20.232  5.476   -50.481 1.00 32.43 ? 117 GLU B CB  1 
ATOM   2630 C CG  . GLU B 1 110 ? 19.759  4.175   -51.118 1.00 38.00 ? 117 GLU B CG  1 
ATOM   2631 C CD  . GLU B 1 110 ? 20.445  2.935   -50.541 1.00 42.63 ? 117 GLU B CD  1 
ATOM   2632 O OE1 . GLU B 1 110 ? 21.285  3.083   -49.610 1.00 43.25 ? 117 GLU B OE1 1 
ATOM   2633 O OE2 . GLU B 1 110 ? 20.127  1.813   -51.029 1.00 44.22 ? 117 GLU B OE2 1 
ATOM   2634 N N   . PHE B 1 111 ? 19.192  7.829   -48.462 1.00 25.14 ? 118 PHE B N   1 
ATOM   2635 C CA  . PHE B 1 111 ? 19.743  8.819   -47.552 1.00 24.31 ? 118 PHE B CA  1 
ATOM   2636 C C   . PHE B 1 111 ? 21.109  8.379   -47.076 1.00 25.02 ? 118 PHE B C   1 
ATOM   2637 O O   . PHE B 1 111 ? 21.318  7.162   -46.827 1.00 27.37 ? 118 PHE B O   1 
ATOM   2638 C CB  . PHE B 1 111 ? 18.878  8.984   -46.318 1.00 24.88 ? 118 PHE B CB  1 
ATOM   2639 C CG  . PHE B 1 111 ? 17.542  9.580   -46.597 1.00 24.23 ? 118 PHE B CG  1 
ATOM   2640 C CD1 . PHE B 1 111 ? 17.453  10.851  -47.149 1.00 25.33 ? 118 PHE B CD1 1 
ATOM   2641 C CD2 . PHE B 1 111 ? 16.378  8.866   -46.356 1.00 22.83 ? 118 PHE B CD2 1 
ATOM   2642 C CE1 . PHE B 1 111 ? 16.195  11.397  -47.397 1.00 25.90 ? 118 PHE B CE1 1 
ATOM   2643 C CE2 . PHE B 1 111 ? 15.137  9.402   -46.603 1.00 22.08 ? 118 PHE B CE2 1 
ATOM   2644 C CZ  . PHE B 1 111 ? 15.033  10.692  -47.094 1.00 24.19 ? 118 PHE B CZ  1 
ATOM   2645 N N   . ILE B 1 112 ? 22.029  9.340   -46.955 1.00 24.21 ? 119 ILE B N   1 
ATOM   2646 C CA  . ILE B 1 112 ? 23.323  9.126   -46.355 1.00 25.29 ? 119 ILE B CA  1 
ATOM   2647 C C   . ILE B 1 112 ? 23.517  10.045  -45.206 1.00 26.83 ? 119 ILE B C   1 
ATOM   2648 O O   . ILE B 1 112 ? 23.389  11.270  -45.333 1.00 26.16 ? 119 ILE B O   1 
ATOM   2649 C CB  . ILE B 1 112 ? 24.443  9.412   -47.366 1.00 29.46 ? 119 ILE B CB  1 
ATOM   2650 C CG1 . ILE B 1 112 ? 24.288  8.502   -48.577 1.00 30.19 ? 119 ILE B CG1 1 
ATOM   2651 C CG2 . ILE B 1 112 ? 25.824  9.273   -46.710 1.00 29.06 ? 119 ILE B CG2 1 
ATOM   2652 C CD1 . ILE B 1 112 ? 24.418  7.037   -48.219 1.00 31.37 ? 119 ILE B CD1 1 
ATOM   2653 N N   . TYR B 1 113 ? 23.866  9.454   -44.079 1.00 24.66 ? 120 TYR B N   1 
ATOM   2654 C CA  . TYR B 1 113 ? 23.944  10.114  -42.781 1.00 25.80 ? 120 TYR B CA  1 
ATOM   2655 C C   . TYR B 1 113 ? 25.354  9.959   -42.314 1.00 24.15 ? 120 TYR B C   1 
ATOM   2656 O O   . TYR B 1 113 ? 25.873  8.858   -42.311 1.00 26.44 ? 120 TYR B O   1 
ATOM   2657 C CB  . TYR B 1 113 ? 22.990  9.541   -41.691 1.00 26.59 ? 120 TYR B CB  1 
ATOM   2658 C CG  . TYR B 1 113 ? 21.519  9.591   -41.981 1.00 27.99 ? 120 TYR B CG  1 
ATOM   2659 C CD1 . TYR B 1 113 ? 20.941  10.684  -42.614 1.00 31.60 ? 120 TYR B CD1 1 
ATOM   2660 C CD2 . TYR B 1 113 ? 20.662  8.589   -41.504 1.00 33.82 ? 120 TYR B CD2 1 
ATOM   2661 C CE1 . TYR B 1 113 ? 19.578  10.743  -42.864 1.00 32.31 ? 120 TYR B CE1 1 
ATOM   2662 C CE2 . TYR B 1 113 ? 19.304  8.648   -41.726 1.00 34.26 ? 120 TYR B CE2 1 
ATOM   2663 C CZ  . TYR B 1 113 ? 18.766  9.712   -42.408 1.00 33.20 ? 120 TYR B CZ  1 
ATOM   2664 O OH  . TYR B 1 113 ? 17.420  9.782   -42.645 1.00 34.50 ? 120 TYR B OH  1 
ATOM   2665 N N   . LYS B 1 114 ? 25.970  11.064  -41.907 1.00 22.82 ? 121 LYS B N   1 
ATOM   2666 C CA  . LYS B 1 114 ? 27.280  11.129  -41.316 1.00 23.97 ? 121 LYS B CA  1 
ATOM   2667 C C   . LYS B 1 114 ? 27.172  11.814  -39.961 1.00 23.22 ? 121 LYS B C   1 
ATOM   2668 O O   . LYS B 1 114 ? 26.746  12.971  -39.851 1.00 21.89 ? 121 LYS B O   1 
ATOM   2669 C CB  . LYS B 1 114 ? 28.268  11.949  -42.196 1.00 26.97 ? 121 LYS B CB  1 
ATOM   2670 C CG  . LYS B 1 114 ? 29.052  11.183  -43.219 1.00 32.95 ? 121 LYS B CG  1 
ATOM   2671 C CD  . LYS B 1 114 ? 28.278  10.594  -44.353 1.00 36.93 ? 121 LYS B CD  1 
ATOM   2672 C CE  . LYS B 1 114 ? 29.227  9.796   -45.305 1.00 38.87 ? 121 LYS B CE  1 
ATOM   2673 N NZ  . LYS B 1 114 ? 29.803  8.572   -44.672 1.00 43.05 ? 121 LYS B NZ  1 
ATOM   2674 N N   . VAL B 1 115 ? 27.558  11.108  -38.909 1.00 19.95 ? 122 VAL B N   1 
ATOM   2675 C CA  . VAL B 1 115 ? 27.415  11.625  -37.563 1.00 20.07 ? 122 VAL B CA  1 
ATOM   2676 C C   . VAL B 1 115 ? 28.738  11.700  -36.847 1.00 20.44 ? 122 VAL B C   1 
ATOM   2677 O O   . VAL B 1 115 ? 29.597  10.812  -37.036 1.00 19.60 ? 122 VAL B O   1 
ATOM   2678 C CB  . VAL B 1 115 ? 26.469  10.693  -36.683 1.00 19.95 ? 122 VAL B CB  1 
ATOM   2679 C CG1 . VAL B 1 115 ? 26.228  11.355  -35.366 1.00 19.79 ? 122 VAL B CG1 1 
ATOM   2680 C CG2 . VAL B 1 115 ? 25.173  10.344  -37.379 1.00 21.11 ? 122 VAL B CG2 1 
ATOM   2681 N N   . LYS B 1 116 ? 28.944  12.779  -36.058 1.00 19.26 ? 123 LYS B N   1 
ATOM   2682 C CA  . LYS B 1 116 ? 30.127  12.927  -35.211 1.00 22.18 ? 123 LYS B CA  1 
ATOM   2683 C C   . LYS B 1 116 ? 29.645  13.198  -33.796 1.00 21.83 ? 123 LYS B C   1 
ATOM   2684 O O   . LYS B 1 116 ? 28.809  14.066  -33.572 1.00 21.53 ? 123 LYS B O   1 
ATOM   2685 C CB  . LYS B 1 116 ? 31.124  14.045  -35.645 1.00 24.16 ? 123 LYS B CB  1 
ATOM   2686 C CG  . LYS B 1 116 ? 31.673  13.821  -37.036 1.00 30.47 ? 123 LYS B CG  1 
ATOM   2687 C CD  . LYS B 1 116 ? 32.593  14.946  -37.487 1.00 35.14 ? 123 LYS B CD  1 
ATOM   2688 C CE  . LYS B 1 116 ? 32.933  14.758  -38.969 1.00 41.75 ? 123 LYS B CE  1 
ATOM   2689 N NZ  . LYS B 1 116 ? 31.742  14.968  -39.859 1.00 44.07 ? 123 LYS B NZ  1 
ATOM   2690 N N   . LEU B 1 117 ? 30.167  12.449  -32.820 1.00 21.96 ? 124 LEU B N   1 
ATOM   2691 C CA  . LEU B 1 117 ? 29.663  12.565  -31.484 1.00 21.98 ? 124 LEU B CA  1 
ATOM   2692 C C   . LEU B 1 117 ? 30.797  12.602  -30.492 1.00 23.24 ? 124 LEU B C   1 
ATOM   2693 O O   . LEU B 1 117 ? 31.768  11.838  -30.619 1.00 19.57 ? 124 LEU B O   1 
ATOM   2694 C CB  . LEU B 1 117 ? 28.791  11.345  -31.175 1.00 22.24 ? 124 LEU B CB  1 
ATOM   2695 C CG  . LEU B 1 117 ? 28.222  11.210  -29.793 1.00 22.78 ? 124 LEU B CG  1 
ATOM   2696 C CD1 . LEU B 1 117 ? 26.834  10.622  -29.834 1.00 22.52 ? 124 LEU B CD1 1 
ATOM   2697 C CD2 . LEU B 1 117 ? 29.156  10.347  -28.922 1.00 21.54 ? 124 LEU B CD2 1 
ATOM   2698 N N   . ARG B 1 118 ? 30.634  13.467  -29.490 1.00 20.14 ? 125 ARG B N   1 
ATOM   2699 C CA  . ARG B 1 118 ? 31.593  13.532  -28.415 1.00 23.18 ? 125 ARG B CA  1 
ATOM   2700 C C   . ARG B 1 118 ? 30.874  13.564  -27.104 1.00 24.35 ? 125 ARG B C   1 
ATOM   2701 O O   . ARG B 1 118 ? 30.211  14.552  -26.762 1.00 23.99 ? 125 ARG B O   1 
ATOM   2702 C CB  . ARG B 1 118 ? 32.521  14.751  -28.503 1.00 26.51 ? 125 ARG B CB  1 
ATOM   2703 C CG  . ARG B 1 118 ? 33.522  14.846  -27.328 1.00 28.63 ? 125 ARG B CG  1 
ATOM   2704 C CD  . ARG B 1 118 ? 34.229  16.195  -27.270 1.00 33.65 ? 125 ARG B CD  1 
ATOM   2705 N NE  . ARG B 1 118 ? 33.296  17.253  -26.881 1.00 37.82 ? 125 ARG B NE  1 
ATOM   2706 C CZ  . ARG B 1 118 ? 33.272  18.515  -27.306 1.00 40.61 ? 125 ARG B CZ  1 
ATOM   2707 N NH1 . ARG B 1 118 ? 32.333  19.329  -26.817 1.00 44.55 ? 125 ARG B NH1 1 
ATOM   2708 N NH2 . ARG B 1 118 ? 34.137  18.989  -28.197 1.00 37.34 ? 125 ARG B NH2 1 
ATOM   2709 N N   . GLY B 1 119 ? 31.061  12.511  -26.309 1.00 21.86 ? 126 GLY B N   1 
ATOM   2710 C CA  . GLY B 1 119 ? 30.579  12.550  -24.912 1.00 23.60 ? 126 GLY B CA  1 
ATOM   2711 C C   . GLY B 1 119 ? 31.704  12.648  -23.913 1.00 23.27 ? 126 GLY B C   1 
ATOM   2712 O O   . GLY B 1 119 ? 32.717  11.989  -24.032 1.00 21.29 ? 126 GLY B O   1 
ATOM   2713 N N   . THR B 1 120 ? 31.490  13.457  -22.895 1.00 21.01 ? 127 THR B N   1 
ATOM   2714 C CA  . THR B 1 120 ? 32.509  13.826  -21.944 1.00 25.04 ? 127 THR B CA  1 
ATOM   2715 C C   . THR B 1 120 ? 31.870  13.931  -20.572 1.00 24.88 ? 127 THR B C   1 
ATOM   2716 O O   . THR B 1 120 ? 30.638  14.009  -20.422 1.00 25.34 ? 127 THR B O   1 
ATOM   2717 C CB  . THR B 1 120 ? 33.244  15.176  -22.224 1.00 25.94 ? 127 THR B CB  1 
ATOM   2718 O OG1 . THR B 1 120 ? 32.280  16.232  -22.295 1.00 26.00 ? 127 THR B OG1 1 
ATOM   2719 C CG2 . THR B 1 120 ? 34.054  15.086  -23.528 1.00 27.13 ? 127 THR B CG2 1 
ATOM   2720 N N   . ASN B 1 121 ? 32.744  13.814  -19.572 1.00 27.14 ? 128 ASN B N   1 
ATOM   2721 C CA  . ASN B 1 121 ? 32.412  14.058  -18.163 1.00 26.70 ? 128 ASN B CA  1 
ATOM   2722 C C   . ASN B 1 121 ? 31.321  13.116  -17.536 1.00 24.56 ? 128 ASN B C   1 
ATOM   2723 O O   . ASN B 1 121 ? 30.669  13.561  -16.628 1.00 26.50 ? 128 ASN B O   1 
ATOM   2724 C CB  . ASN B 1 121 ? 31.981  15.496  -18.002 1.00 28.28 ? 128 ASN B CB  1 
ATOM   2725 C CG  . ASN B 1 121 ? 32.189  16.077  -16.569 1.00 28.76 ? 128 ASN B CG  1 
ATOM   2726 O OD1 . ASN B 1 121 ? 33.198  15.843  -15.937 1.00 30.15 ? 128 ASN B OD1 1 
ATOM   2727 N ND2 . ASN B 1 121 ? 31.228  16.835  -16.090 1.00 29.82 ? 128 ASN B ND2 1 
ATOM   2728 N N   . PHE B 1 122 ? 31.126  11.892  -18.041 1.00 24.79 ? 129 PHE B N   1 
ATOM   2729 C CA  . PHE B 1 122 ? 30.215  10.885  -17.466 1.00 23.17 ? 129 PHE B CA  1 
ATOM   2730 C C   . PHE B 1 122 ? 30.972  10.305  -16.253 1.00 24.86 ? 129 PHE B C   1 
ATOM   2731 O O   . PHE B 1 122 ? 32.098  9.874   -16.414 1.00 27.75 ? 129 PHE B O   1 
ATOM   2732 C CB  . PHE B 1 122 ? 29.926  9.809   -18.526 1.00 25.10 ? 129 PHE B CB  1 
ATOM   2733 C CG  . PHE B 1 122 ? 28.939  10.287  -19.559 1.00 23.36 ? 129 PHE B CG  1 
ATOM   2734 C CD1 . PHE B 1 122 ? 27.612  10.389  -19.224 1.00 24.33 ? 129 PHE B CD1 1 
ATOM   2735 C CD2 . PHE B 1 122 ? 29.358  10.724  -20.813 1.00 26.73 ? 129 PHE B CD2 1 
ATOM   2736 C CE1 . PHE B 1 122 ? 26.666  10.840  -20.095 1.00 23.53 ? 129 PHE B CE1 1 
ATOM   2737 C CE2 . PHE B 1 122 ? 28.428  11.183  -21.708 1.00 24.98 ? 129 PHE B CE2 1 
ATOM   2738 C CZ  . PHE B 1 122 ? 27.091  11.274  -21.355 1.00 24.75 ? 129 PHE B CZ  1 
ATOM   2739 N N   . PRO B 1 123 ? 30.388  10.407  -15.062 1.00 26.60 ? 130 PRO B N   1 
ATOM   2740 C CA  . PRO B 1 123 ? 30.939  9.725   -13.838 1.00 32.13 ? 130 PRO B CA  1 
ATOM   2741 C C   . PRO B 1 123 ? 31.123  8.261   -14.057 1.00 32.41 ? 130 PRO B C   1 
ATOM   2742 O O   . PRO B 1 123 ? 30.211  7.575   -14.510 1.00 32.84 ? 130 PRO B O   1 
ATOM   2743 C CB  . PRO B 1 123 ? 29.844  9.978   -12.775 1.00 29.79 ? 130 PRO B CB  1 
ATOM   2744 C CG  . PRO B 1 123 ? 29.083  11.149  -13.337 1.00 31.08 ? 130 PRO B CG  1 
ATOM   2745 C CD  . PRO B 1 123 ? 29.002  10.743  -14.814 1.00 28.00 ? 130 PRO B CD  1 
ATOM   2746 N N   . SER B 1 124 ? 32.330  7.807   -13.721 1.00 34.61 ? 131 SER B N   1 
ATOM   2747 C CA  . SER B 1 124 ? 32.781  6.434   -13.750 1.00 38.32 ? 131 SER B CA  1 
ATOM   2748 C C   . SER B 1 124 ? 31.754  5.440   -13.222 1.00 35.09 ? 131 SER B C   1 
ATOM   2749 O O   . SER B 1 124 ? 31.613  4.390   -13.784 1.00 37.79 ? 131 SER B O   1 
ATOM   2750 C CB  . SER B 1 124 ? 34.058  6.327   -12.913 1.00 41.05 ? 131 SER B CB  1 
ATOM   2751 O OG  . SER B 1 124 ? 33.846  6.884   -11.636 1.00 42.89 ? 131 SER B OG  1 
ATOM   2752 N N   . ASP B 1 125 ? 31.004  5.814   -12.200 1.00 35.93 ? 132 ASP B N   1 
ATOM   2753 C CA  . ASP B 1 125 ? 30.047  4.891   -11.577 1.00 37.21 ? 132 ASP B CA  1 
ATOM   2754 C C   . ASP B 1 125 ? 28.595  5.194   -11.908 1.00 37.44 ? 132 ASP B C   1 
ATOM   2755 O O   . ASP B 1 125 ? 27.666  4.802   -11.157 1.00 35.33 ? 132 ASP B O   1 
ATOM   2756 C CB  . ASP B 1 125 ? 30.212  4.960   -10.050 1.00 41.06 ? 132 ASP B CB  1 
ATOM   2757 C CG  . ASP B 1 125 ? 30.042  6.383   -9.508  1.00 43.54 ? 132 ASP B CG  1 
ATOM   2758 O OD1 . ASP B 1 125 ? 30.138  7.376   -10.302 1.00 49.42 ? 132 ASP B OD1 1 
ATOM   2759 O OD2 . ASP B 1 125 ? 29.880  6.529   -8.273  1.00 44.07 ? 132 ASP B OD2 1 
ATOM   2760 N N   . GLY B 1 126 ? 28.354  5.900   -13.014 1.00 31.94 ? 133 GLY B N   1 
ATOM   2761 C CA  . GLY B 1 126 ? 27.011  6.321   -13.292 1.00 27.84 ? 133 GLY B CA  1 
ATOM   2762 C C   . GLY B 1 126 ? 26.376  5.414   -14.271 1.00 27.71 ? 133 GLY B C   1 
ATOM   2763 O O   . GLY B 1 126 ? 27.022  4.484   -14.812 1.00 28.63 ? 133 GLY B O   1 
ATOM   2764 N N   . PRO B 1 127 ? 25.104  5.682   -14.534 1.00 28.82 ? 134 PRO B N   1 
ATOM   2765 C CA  . PRO B 1 127 ? 24.373  4.763   -15.354 1.00 27.02 ? 134 PRO B CA  1 
ATOM   2766 C C   . PRO B 1 127 ? 24.870  4.636   -16.748 1.00 24.29 ? 134 PRO B C   1 
ATOM   2767 O O   . PRO B 1 127 ? 24.609  3.607   -17.348 1.00 26.54 ? 134 PRO B O   1 
ATOM   2768 C CB  . PRO B 1 127 ? 22.923  5.267   -15.292 1.00 30.09 ? 134 PRO B CB  1 
ATOM   2769 C CG  . PRO B 1 127 ? 23.005  6.625   -14.769 1.00 31.94 ? 134 PRO B CG  1 
ATOM   2770 C CD  . PRO B 1 127 ? 24.244  6.694   -13.915 1.00 31.48 ? 134 PRO B CD  1 
ATOM   2771 N N   . VAL B 1 128 ? 25.563  5.657   -17.300 1.00 23.53 ? 135 VAL B N   1 
ATOM   2772 C CA  . VAL B 1 128 ? 26.033  5.478   -18.661 1.00 24.74 ? 135 VAL B CA  1 
ATOM   2773 C C   . VAL B 1 128 ? 27.257  4.548   -18.722 1.00 22.81 ? 135 VAL B C   1 
ATOM   2774 O O   . VAL B 1 128 ? 27.276  3.559   -19.508 1.00 26.37 ? 135 VAL B O   1 
ATOM   2775 C CB  . VAL B 1 128 ? 26.318  6.846   -19.312 1.00 25.03 ? 135 VAL B CB  1 
ATOM   2776 C CG1 . VAL B 1 128 ? 26.934  6.621   -20.688 1.00 26.43 ? 135 VAL B CG1 1 
ATOM   2777 C CG2 . VAL B 1 128 ? 24.984  7.573   -19.432 1.00 27.89 ? 135 VAL B CG2 1 
ATOM   2778 N N   . MET B 1 129 ? 28.249  4.828   -17.897 1.00 22.96 ? 136 MET B N   1 
ATOM   2779 C CA  . MET B 1 129 ? 29.512  4.105   -17.977 1.00 27.48 ? 136 MET B CA  1 
ATOM   2780 C C   . MET B 1 129 ? 29.318  2.754   -17.308 1.00 30.07 ? 136 MET B C   1 
ATOM   2781 O O   . MET B 1 129 ? 29.963  1.801   -17.709 1.00 32.84 ? 136 MET B O   1 
ATOM   2782 C CB  . MET B 1 129 ? 30.702  4.892   -17.370 1.00 29.76 ? 136 MET B CB  1 
ATOM   2783 C CG  . MET B 1 129 ? 31.060  6.257   -18.029 1.00 31.15 ? 136 MET B CG  1 
ATOM   2784 S SD  . MET B 1 129 ? 31.268  6.085   -19.814 1.00 31.76 ? 136 MET B SD  1 
ATOM   2785 C CE  . MET B 1 129 ? 32.714  5.038   -19.901 1.00 30.27 ? 136 MET B CE  1 
ATOM   2786 N N   . GLN B 1 130 ? 28.346  2.653   -16.405 1.00 30.62 ? 137 GLN B N   1 
ATOM   2787 C CA  . GLN B 1 130 ? 27.959  1.332   -15.813 1.00 34.41 ? 137 GLN B CA  1 
ATOM   2788 C C   . GLN B 1 130 ? 26.840  0.534   -16.504 1.00 34.11 ? 137 GLN B C   1 
ATOM   2789 O O   . GLN B 1 130 ? 26.395  -0.533  -16.041 1.00 33.87 ? 137 GLN B O   1 
ATOM   2790 C CB  . GLN B 1 130 ? 27.589  1.551   -14.368 1.00 32.91 ? 137 GLN B CB  1 
ATOM   2791 C CG  . GLN B 1 130 ? 28.725  2.126   -13.576 1.00 36.32 ? 137 GLN B CG  1 
ATOM   2792 C CD  . GLN B 1 130 ? 29.920  1.175   -13.468 1.00 43.20 ? 137 GLN B CD  1 
ATOM   2793 O OE1 . GLN B 1 130 ? 29.754  -0.061  -13.379 1.00 44.68 ? 137 GLN B OE1 1 
ATOM   2794 N NE2 . GLN B 1 130 ? 31.140  1.745   -13.460 1.00 43.95 ? 137 GLN B NE2 1 
ATOM   2795 N N   . LYS B 1 131 ? 26.363  1.030   -17.616 1.00 30.76 ? 138 LYS B N   1 
ATOM   2796 C CA  . LYS B 1 131 ? 25.349  0.331   -18.424 1.00 28.89 ? 138 LYS B CA  1 
ATOM   2797 C C   . LYS B 1 131 ? 24.100  -0.013  -17.584 1.00 30.03 ? 138 LYS B C   1 
ATOM   2798 O O   . LYS B 1 131 ? 23.602  -1.101  -17.668 1.00 29.95 ? 138 LYS B O   1 
ATOM   2799 C CB  . LYS B 1 131 ? 25.897  -0.914  -19.170 1.00 30.24 ? 138 LYS B CB  1 
ATOM   2800 C CG  . LYS B 1 131 ? 27.045  -0.654  -20.153 1.00 28.67 ? 138 LYS B CG  1 
ATOM   2801 C CD  . LYS B 1 131 ? 27.613  -1.939  -20.801 1.00 33.56 ? 138 LYS B CD  1 
ATOM   2802 C CE  . LYS B 1 131 ? 28.845  -1.609  -21.626 1.00 37.93 ? 138 LYS B CE  1 
ATOM   2803 N NZ  . LYS B 1 131 ? 29.759  -2.757  -21.938 1.00 40.31 ? 138 LYS B NZ  1 
ATOM   2804 N N   . LYS B 1 132 ? 23.592  0.958   -16.834 1.00 29.94 ? 139 LYS B N   1 
ATOM   2805 C CA  . LYS B 1 132 ? 22.361  0.821   -16.038 1.00 31.65 ? 139 LYS B CA  1 
ATOM   2806 C C   . LYS B 1 132 ? 21.048  1.232   -16.665 1.00 29.74 ? 139 LYS B C   1 
ATOM   2807 O O   . LYS B 1 132 ? 20.026  1.209   -15.970 1.00 30.46 ? 139 LYS B O   1 
ATOM   2808 C CB  . LYS B 1 132 ? 22.480  1.678   -14.780 1.00 31.09 ? 139 LYS B CB  1 
ATOM   2809 C CG  . LYS B 1 132 ? 23.666  1.321   -13.925 1.00 36.36 ? 139 LYS B CG  1 
ATOM   2810 C CD  . LYS B 1 132 ? 23.733  2.170   -12.665 1.00 37.53 ? 139 LYS B CD  1 
ATOM   2811 C CE  . LYS B 1 132 ? 24.828  1.645   -11.760 1.00 41.35 ? 139 LYS B CE  1 
ATOM   2812 N NZ  . LYS B 1 132 ? 24.874  2.423   -10.498 1.00 43.81 ? 139 LYS B NZ  1 
ATOM   2813 N N   . THR B 1 133 ? 21.053  1.682   -17.925 1.00 30.07 ? 140 THR B N   1 
ATOM   2814 C CA  . THR B 1 133 ? 19.866  2.172   -18.565 1.00 27.49 ? 140 THR B CA  1 
ATOM   2815 C C   . THR B 1 133 ? 19.251  1.064   -19.359 1.00 27.77 ? 140 THR B C   1 
ATOM   2816 O O   . THR B 1 133 ? 19.920  0.066   -19.685 1.00 30.11 ? 140 THR B O   1 
ATOM   2817 C CB  . THR B 1 133 ? 20.151  3.437   -19.466 1.00 30.00 ? 140 THR B CB  1 
ATOM   2818 O OG1 . THR B 1 133 ? 20.894  3.055   -20.624 1.00 32.23 ? 140 THR B OG1 1 
ATOM   2819 C CG2 . THR B 1 133 ? 20.947  4.374   -18.798 1.00 29.93 ? 140 THR B CG2 1 
ATOM   2820 N N   . MET B 1 134 ? 17.964  1.203   -19.645 1.00 25.46 ? 141 MET B N   1 
ATOM   2821 C CA  . MET B 1 134 ? 17.251  0.235   -20.411 1.00 27.12 ? 141 MET B CA  1 
ATOM   2822 C C   . MET B 1 134 ? 16.221  0.883   -21.269 1.00 28.55 ? 141 MET B C   1 
ATOM   2823 O O   . MET B 1 134 ? 15.069  0.481   -21.320 1.00 29.68 ? 141 MET B O   1 
ATOM   2824 C CB  . MET B 1 134 ? 16.638  -0.835  -19.509 1.00 31.05 ? 141 MET B CB  1 
ATOM   2825 C CG  . MET B 1 134 ? 15.877  -0.274  -18.360 1.00 30.77 ? 141 MET B CG  1 
ATOM   2826 S SD  . MET B 1 134 ? 15.114  -1.602  -17.349 1.00 34.79 ? 141 MET B SD  1 
ATOM   2827 C CE  . MET B 1 134 ? 14.228  -2.647  -18.475 1.00 33.95 ? 141 MET B CE  1 
ATOM   2828 N N   . GLY B 1 135 ? 16.668  1.870   -22.035 1.00 26.73 ? 142 GLY B N   1 
ATOM   2829 C CA  . GLY B 1 135 ? 15.823  2.426   -23.075 1.00 26.76 ? 142 GLY B CA  1 
ATOM   2830 C C   . GLY B 1 135 ? 15.233  3.785   -22.747 1.00 27.65 ? 142 GLY B C   1 
ATOM   2831 O O   . GLY B 1 135 ? 15.254  4.262   -21.608 1.00 30.30 ? 142 GLY B O   1 
HETATM 2832 N N1  . 4OO B 1 136 ? 19.373  8.937   -25.070 1.00 41.85 ? 143 4OO B N1  1 
HETATM 2833 N N2  . 4OO B 1 136 ? 19.177  10.166  -25.048 1.00 57.15 ? 143 4OO B N2  1 
HETATM 2834 N N3  . 4OO B 1 136 ? 18.960  11.446  -25.020 1.00 56.91 ? 143 4OO B N3  1 
HETATM 2835 C C   . 4OO B 1 136 ? 12.614  5.693   -23.369 1.00 27.13 ? 143 4OO B C   1 
HETATM 2836 O O   . 4OO B 1 136 ? 11.913  4.967   -24.046 1.00 26.29 ? 143 4OO B O   1 
HETATM 2837 C CA  . 4OO B 1 136 ? 14.077  5.756   -23.569 1.00 28.66 ? 143 4OO B CA  1 
HETATM 2838 N N   . 4OO B 1 136 ? 14.732  4.453   -23.767 1.00 26.93 ? 143 4OO B N   1 
HETATM 2839 C CB  . 4OO B 1 136 ? 14.248  6.612   -24.822 1.00 30.55 ? 143 4OO B CB  1 
HETATM 2840 C CG  . 4OO B 1 136 ? 15.595  7.231   -24.874 1.00 32.54 ? 143 4OO B CG  1 
HETATM 2841 C CD2 . 4OO B 1 136 ? 16.589  6.638   -25.642 1.00 31.35 ? 143 4OO B CD2 1 
HETATM 2842 C CE2 . 4OO B 1 136 ? 17.848  7.186   -25.703 1.00 33.41 ? 143 4OO B CE2 1 
HETATM 2843 C CZ  . 4OO B 1 136 ? 18.123  8.347   -25.006 1.00 36.71 ? 143 4OO B CZ  1 
HETATM 2844 C CE1 . 4OO B 1 136 ? 17.116  8.977   -24.253 1.00 36.50 ? 143 4OO B CE1 1 
HETATM 2845 C CD1 . 4OO B 1 136 ? 15.857  8.401   -24.161 1.00 31.79 ? 143 4OO B CD1 1 
ATOM   2846 N N   . GLU B 1 137 ? 12.111  6.514   -22.469 1.00 27.95 ? 144 GLU B N   1 
ATOM   2847 C CA  . GLU B 1 137 ? 10.676  6.783   -22.458 1.00 28.07 ? 144 GLU B CA  1 
ATOM   2848 C C   . GLU B 1 137 ? 10.279  7.568   -23.692 1.00 28.47 ? 144 GLU B C   1 
ATOM   2849 O O   . GLU B 1 137 ? 11.073  8.389   -24.180 1.00 25.29 ? 144 GLU B O   1 
ATOM   2850 C CB  . GLU B 1 137 ? 10.260  7.616   -21.224 1.00 31.07 ? 144 GLU B CB  1 
ATOM   2851 C CG  . GLU B 1 137 ? 10.522  7.003   -19.876 1.00 35.96 ? 144 GLU B CG  1 
ATOM   2852 C CD  . GLU B 1 137 ? 9.520   5.951   -19.477 1.00 38.04 ? 144 GLU B CD  1 
ATOM   2853 O OE1 . GLU B 1 137 ? 8.574   5.657   -20.232 1.00 42.61 ? 144 GLU B OE1 1 
ATOM   2854 O OE2 . GLU B 1 137 ? 9.708   5.402   -18.381 1.00 39.03 ? 144 GLU B OE2 1 
ATOM   2855 N N   . ALA B 1 138 ? 9.070   7.342   -24.169 1.00 26.90 ? 145 ALA B N   1 
ATOM   2856 C CA  . ALA B 1 138 ? 8.505   8.131   -25.227 1.00 25.49 ? 145 ALA B CA  1 
ATOM   2857 C C   . ALA B 1 138 ? 8.542   9.628   -24.841 1.00 26.07 ? 145 ALA B C   1 
ATOM   2858 O O   . ALA B 1 138 ? 8.377   9.988   -23.674 1.00 26.98 ? 145 ALA B O   1 
ATOM   2859 C CB  . ALA B 1 138 ? 7.093   7.711   -25.524 1.00 27.63 ? 145 ALA B CB  1 
ATOM   2860 N N   . SER B 1 139 ? 8.783   10.445  -25.848 1.00 28.97 ? 146 SER B N   1 
ATOM   2861 C CA  . SER B 1 139 ? 9.138   11.853  -25.686 1.00 27.54 ? 146 SER B CA  1 
ATOM   2862 C C   . SER B 1 139 ? 8.518   12.725  -26.676 1.00 26.53 ? 146 SER B C   1 
ATOM   2863 O O   . SER B 1 139 ? 8.022   12.274  -27.678 1.00 26.01 ? 146 SER B O   1 
ATOM   2864 C CB  . SER B 1 139 ? 10.628  11.999  -25.794 1.00 32.11 ? 146 SER B CB  1 
ATOM   2865 O OG  . SER B 1 139 ? 11.024  12.309  -24.478 1.00 38.44 ? 146 SER B OG  1 
ATOM   2866 N N   . SER B 1 140 ? 8.535   14.037  -26.409 1.00 23.98 ? 147 SER B N   1 
ATOM   2867 C CA  . SER B 1 140 ? 8.021   14.941  -27.391 1.00 24.05 ? 147 SER B CA  1 
ATOM   2868 C C   . SER B 1 140 ? 9.036   16.108  -27.566 1.00 22.05 ? 147 SER B C   1 
ATOM   2869 O O   . SER B 1 140 ? 9.498   16.669  -26.554 1.00 22.50 ? 147 SER B O   1 
ATOM   2870 C CB  . SER B 1 140 ? 6.660   15.436  -26.887 1.00 29.10 ? 147 SER B CB  1 
ATOM   2871 O OG  . SER B 1 140 ? 6.184   16.564  -27.589 1.00 31.78 ? 147 SER B OG  1 
ATOM   2872 N N   . GLU B 1 141 ? 9.417   16.365  -28.805 1.00 21.22 ? 148 GLU B N   1 
ATOM   2873 C CA  . GLU B 1 141 ? 10.392  17.387  -29.106 1.00 19.82 ? 148 GLU B CA  1 
ATOM   2874 C C   . GLU B 1 141 ? 9.595   18.639  -29.465 1.00 19.53 ? 148 GLU B C   1 
ATOM   2875 O O   . GLU B 1 141 ? 8.784   18.627  -30.346 1.00 18.93 ? 148 GLU B O   1 
ATOM   2876 C CB  . GLU B 1 141 ? 11.301  16.921  -30.262 1.00 20.71 ? 148 GLU B CB  1 
ATOM   2877 C CG  . GLU B 1 141 ? 12.520  17.811  -30.417 1.00 23.93 ? 148 GLU B CG  1 
ATOM   2878 C CD  . GLU B 1 141 ? 13.482  17.405  -31.529 1.00 27.98 ? 148 GLU B CD  1 
ATOM   2879 O OE1 . GLU B 1 141 ? 13.208  16.422  -32.281 1.00 30.11 ? 148 GLU B OE1 1 
ATOM   2880 O OE2 . GLU B 1 141 ? 14.512  18.103  -31.678 1.00 26.75 ? 148 GLU B OE2 1 
ATOM   2881 N N   . ARG B 1 142 ? 9.790   19.724  -28.734 1.00 19.27 ? 149 ARG B N   1 
ATOM   2882 C CA  . ARG B 1 142 ? 9.113   20.978  -29.109 1.00 19.87 ? 149 ARG B CA  1 
ATOM   2883 C C   . ARG B 1 142 ? 9.917   21.760  -30.152 1.00 17.88 ? 149 ARG B C   1 
ATOM   2884 O O   . ARG B 1 142 ? 11.082  22.010  -29.944 1.00 18.93 ? 149 ARG B O   1 
ATOM   2885 C CB  . ARG B 1 142 ? 8.970   21.804  -27.853 1.00 23.38 ? 149 ARG B CB  1 
ATOM   2886 C CG  . ARG B 1 142 ? 7.964   21.243  -26.841 1.00 31.63 ? 149 ARG B CG  1 
ATOM   2887 C CD  . ARG B 1 142 ? 8.396   21.636  -25.453 1.00 40.61 ? 149 ARG B CD  1 
ATOM   2888 N NE  . ARG B 1 142 ? 9.448   20.671  -25.060 1.00 49.01 ? 149 ARG B NE  1 
ATOM   2889 C CZ  . ARG B 1 142 ? 10.536  20.926  -24.326 1.00 51.77 ? 149 ARG B CZ  1 
ATOM   2890 N NH1 . ARG B 1 142 ? 11.384  19.939  -24.085 1.00 57.09 ? 149 ARG B NH1 1 
ATOM   2891 N NH2 . ARG B 1 142 ? 10.799  22.129  -23.833 1.00 53.02 ? 149 ARG B NH2 1 
ATOM   2892 N N   . MET B 1 143 ? 9.322   22.033  -31.291 1.00 17.70 ? 150 MET B N   1 
ATOM   2893 C CA  . MET B 1 143 ? 9.998   22.536  -32.458 1.00 17.20 ? 150 MET B CA  1 
ATOM   2894 C C   . MET B 1 143 ? 9.592   23.980  -32.634 1.00 17.59 ? 150 MET B C   1 
ATOM   2895 O O   . MET B 1 143 ? 8.416   24.309  -32.459 1.00 17.83 ? 150 MET B O   1 
ATOM   2896 C CB  . MET B 1 143 ? 9.630   21.791  -33.768 1.00 19.45 ? 150 MET B CB  1 
ATOM   2897 C CG  . MET B 1 143 ? 9.728   20.289  -33.768 1.00 20.53 ? 150 MET B CG  1 
ATOM   2898 S SD  . MET B 1 143 ? 11.308  19.629  -33.216 1.00 24.06 ? 150 MET B SD  1 
ATOM   2899 C CE  . MET B 1 143 ? 12.390  20.217  -34.423 1.00 20.96 ? 150 MET B CE  1 
ATOM   2900 N N   . TYR B 1 144 ? 10.550  24.833  -33.009 1.00 17.30 ? 151 TYR B N   1 
ATOM   2901 C CA  . TYR B 1 144 ? 10.197  26.244  -33.419 1.00 17.78 ? 151 TYR B CA  1 
ATOM   2902 C C   . TYR B 1 144 ? 11.232  26.809  -34.339 1.00 17.60 ? 151 TYR B C   1 
ATOM   2903 O O   . TYR B 1 144 ? 12.398  26.444  -34.259 1.00 18.43 ? 151 TYR B O   1 
ATOM   2904 C CB  . TYR B 1 144 ? 10.051  27.123  -32.181 1.00 18.81 ? 151 TYR B CB  1 
ATOM   2905 C CG  . TYR B 1 144 ? 11.280  27.223  -31.339 1.00 21.30 ? 151 TYR B CG  1 
ATOM   2906 C CD1 . TYR B 1 144 ? 11.503  26.290  -30.360 1.00 23.44 ? 151 TYR B CD1 1 
ATOM   2907 C CD2 . TYR B 1 144 ? 12.193  28.268  -31.470 1.00 23.02 ? 151 TYR B CD2 1 
ATOM   2908 C CE1 . TYR B 1 144 ? 12.607  26.346  -29.573 1.00 24.91 ? 151 TYR B CE1 1 
ATOM   2909 C CE2 . TYR B 1 144 ? 13.327  28.319  -30.656 1.00 23.91 ? 151 TYR B CE2 1 
ATOM   2910 C CZ  . TYR B 1 144 ? 13.505  27.324  -29.705 1.00 25.95 ? 151 TYR B CZ  1 
ATOM   2911 O OH  . TYR B 1 144 ? 14.588  27.257  -28.846 1.00 29.06 ? 151 TYR B OH  1 
ATOM   2912 N N   . PRO B 1 145 ? 10.851  27.762  -35.217 1.00 18.28 ? 152 PRO B N   1 
ATOM   2913 C CA  . PRO B 1 145 ? 11.794  28.377  -36.070 1.00 18.71 ? 152 PRO B CA  1 
ATOM   2914 C C   . PRO B 1 145 ? 12.569  29.472  -35.348 1.00 20.69 ? 152 PRO B C   1 
ATOM   2915 O O   . PRO B 1 145 ? 12.028  30.161  -34.490 1.00 20.07 ? 152 PRO B O   1 
ATOM   2916 C CB  . PRO B 1 145 ? 10.922  28.974  -37.173 1.00 18.82 ? 152 PRO B CB  1 
ATOM   2917 C CG  . PRO B 1 145 ? 9.645   29.369  -36.445 1.00 17.55 ? 152 PRO B CG  1 
ATOM   2918 C CD  . PRO B 1 145 ? 9.473   28.220  -35.451 1.00 18.64 ? 152 PRO B CD  1 
ATOM   2919 N N   . GLU B 1 146 ? 13.815  29.636  -35.725 1.00 21.97 ? 153 GLU B N   1 
ATOM   2920 C CA  . GLU B 1 146 ? 14.604  30.776  -35.171 1.00 22.91 ? 153 GLU B CA  1 
ATOM   2921 C C   . GLU B 1 146 ? 15.821  31.033  -36.030 1.00 23.60 ? 153 GLU B C   1 
ATOM   2922 O O   . GLU B 1 146 ? 16.590  30.092  -36.306 1.00 22.98 ? 153 GLU B O   1 
ATOM   2923 C CB  . GLU B 1 146 ? 15.054  30.447  -33.767 1.00 22.67 ? 153 GLU B CB  1 
ATOM   2924 C CG  . GLU B 1 146 ? 15.783  31.618  -33.101 1.00 26.56 ? 153 GLU B CG  1 
ATOM   2925 C CD  . GLU B 1 146 ? 16.053  31.379  -31.627 1.00 27.91 ? 153 GLU B CD  1 
ATOM   2926 O OE1 . GLU B 1 146 ? 16.377  30.244  -31.251 1.00 30.47 ? 153 GLU B OE1 1 
ATOM   2927 O OE2 . GLU B 1 146 ? 15.910  32.285  -30.807 1.00 31.73 ? 153 GLU B OE2 1 
ATOM   2928 N N   . ASP B 1 147 ? 15.969  32.306  -36.434 1.00 27.53 ? 154 ASP B N   1 
ATOM   2929 C CA  . ASP B 1 147 ? 17.120  32.750  -37.218 1.00 29.87 ? 154 ASP B CA  1 
ATOM   2930 C C   . ASP B 1 147 ? 17.334  31.918  -38.429 1.00 27.09 ? 154 ASP B C   1 
ATOM   2931 O O   . ASP B 1 147 ? 18.462  31.546  -38.723 1.00 30.20 ? 154 ASP B O   1 
ATOM   2932 C CB  . ASP B 1 147 ? 18.392  32.670  -36.415 1.00 32.61 ? 154 ASP B CB  1 
ATOM   2933 C CG  . ASP B 1 147 ? 18.457  33.711  -35.331 1.00 37.16 ? 154 ASP B CG  1 
ATOM   2934 O OD1 . ASP B 1 147 ? 18.246  34.904  -35.647 1.00 44.32 ? 154 ASP B OD1 1 
ATOM   2935 O OD2 . ASP B 1 147 ? 18.744  33.329  -34.182 1.00 38.34 ? 154 ASP B OD2 1 
ATOM   2936 N N   . GLY B 1 148 ? 16.263  31.593  -39.113 1.00 23.89 ? 155 GLY B N   1 
ATOM   2937 C CA  . GLY B 1 148 ? 16.380  30.949  -40.421 1.00 24.08 ? 155 GLY B CA  1 
ATOM   2938 C C   . GLY B 1 148 ? 16.675  29.479  -40.297 1.00 24.24 ? 155 GLY B C   1 
ATOM   2939 O O   . GLY B 1 148 ? 16.975  28.862  -41.289 1.00 24.86 ? 155 GLY B O   1 
ATOM   2940 N N   . ALA B 1 149 ? 16.591  28.944  -39.090 1.00 24.33 ? 156 ALA B N   1 
ATOM   2941 C CA  . ALA B 1 149 ? 16.807  27.502  -38.859 1.00 22.36 ? 156 ALA B CA  1 
ATOM   2942 C C   . ALA B 1 149 ? 15.665  26.928  -38.018 1.00 20.37 ? 156 ALA B C   1 
ATOM   2943 O O   . ALA B 1 149 ? 14.817  27.687  -37.560 1.00 20.07 ? 156 ALA B O   1 
ATOM   2944 C CB  . ALA B 1 149 ? 18.139  27.313  -38.176 1.00 23.12 ? 156 ALA B CB  1 
ATOM   2945 N N   . LEU B 1 150 ? 15.599  25.591  -37.872 1.00 19.04 ? 157 LEU B N   1 
ATOM   2946 C CA  . LEU B 1 150 ? 14.582  24.959  -37.020 1.00 18.59 ? 157 LEU B CA  1 
ATOM   2947 C C   . LEU B 1 150 ? 15.203  24.463  -35.762 1.00 19.31 ? 157 LEU B C   1 
ATOM   2948 O O   . LEU B 1 150 ? 16.200  23.788  -35.823 1.00 19.77 ? 157 LEU B O   1 
ATOM   2949 C CB  . LEU B 1 150 ? 13.898  23.838  -37.750 1.00 19.05 ? 157 LEU B CB  1 
ATOM   2950 C CG  . LEU B 1 150 ? 12.764  23.112  -37.038 1.00 21.16 ? 157 LEU B CG  1 
ATOM   2951 C CD1 . LEU B 1 150 ? 11.574  24.028  -36.803 1.00 21.73 ? 157 LEU B CD1 1 
ATOM   2952 C CD2 . LEU B 1 150 ? 12.426  21.941  -37.927 1.00 23.76 ? 157 LEU B CD2 1 
ATOM   2953 N N   . LYS B 1 151 ? 14.674  24.853  -34.610 1.00 17.73 ? 158 LYS B N   1 
ATOM   2954 C CA  . LYS B 1 151 ? 15.160  24.434  -33.335 1.00 18.41 ? 158 LYS B CA  1 
ATOM   2955 C C   . LYS B 1 151 ? 14.252  23.375  -32.738 1.00 17.78 ? 158 LYS B C   1 
ATOM   2956 O O   . LYS B 1 151 ? 13.031  23.412  -32.930 1.00 16.98 ? 158 LYS B O   1 
ATOM   2957 C CB  . LYS B 1 151 ? 15.133  25.639  -32.387 1.00 20.21 ? 158 LYS B CB  1 
ATOM   2958 C CG  . LYS B 1 151 ? 15.886  26.859  -32.900 1.00 25.02 ? 158 LYS B CG  1 
ATOM   2959 C CD  . LYS B 1 151 ? 17.333  26.632  -32.797 1.00 25.91 ? 158 LYS B CD  1 
ATOM   2960 C CE  . LYS B 1 151 ? 18.085  27.855  -33.363 1.00 29.53 ? 158 LYS B CE  1 
ATOM   2961 N NZ  . LYS B 1 151 ? 19.058  28.265  -32.363 1.00 33.03 ? 158 LYS B NZ  1 
ATOM   2962 N N   . GLY B 1 152 ? 14.839  22.450  -31.965 1.00 16.63 ? 159 GLY B N   1 
ATOM   2963 C CA  . GLY B 1 152 ? 14.047  21.505  -31.219 1.00 17.35 ? 159 GLY B CA  1 
ATOM   2964 C C   . GLY B 1 152 ? 14.608  21.379  -29.816 1.00 18.16 ? 159 GLY B C   1 
ATOM   2965 O O   . GLY B 1 152 ? 15.836  21.339  -29.641 1.00 17.96 ? 159 GLY B O   1 
ATOM   2966 N N   . GLU B 1 153 ? 13.702  21.253  -28.874 1.00 18.31 ? 160 GLU B N   1 
ATOM   2967 C CA  . GLU B 1 153 ? 14.028  21.085  -27.450 1.00 19.37 ? 160 GLU B CA  1 
ATOM   2968 C C   . GLU B 1 153 ? 13.274  19.857  -26.847 1.00 19.84 ? 160 GLU B C   1 
ATOM   2969 O O   . GLU B 1 153 ? 12.105  19.685  -27.077 1.00 18.09 ? 160 GLU B O   1 
ATOM   2970 C CB  . GLU B 1 153 ? 13.693  22.335  -26.652 1.00 22.44 ? 160 GLU B CB  1 
ATOM   2971 C CG  . GLU B 1 153 ? 14.640  23.507  -26.811 1.00 25.97 ? 160 GLU B CG  1 
ATOM   2972 C CD  . GLU B 1 153 ? 14.160  24.826  -26.205 1.00 32.62 ? 160 GLU B CD  1 
ATOM   2973 O OE1 . GLU B 1 153 ? 14.663  25.863  -26.636 1.00 38.24 ? 160 GLU B OE1 1 
ATOM   2974 O OE2 . GLU B 1 153 ? 13.215  24.851  -25.384 1.00 36.97 ? 160 GLU B OE2 1 
ATOM   2975 N N   . ILE B 1 154 ? 13.995  19.016  -26.135 1.00 19.80 ? 161 ILE B N   1 
ATOM   2976 C CA  . ILE B 1 154 ? 13.386  17.758  -25.546 1.00 23.23 ? 161 ILE B CA  1 
ATOM   2977 C C   . ILE B 1 154 ? 13.962  17.574  -24.161 1.00 24.33 ? 161 ILE B C   1 
ATOM   2978 O O   . ILE B 1 154 ? 15.170  17.789  -23.955 1.00 22.79 ? 161 ILE B O   1 
ATOM   2979 C CB  . ILE B 1 154 ? 13.802  16.405  -26.162 1.00 27.59 ? 161 ILE B CB  1 
ATOM   2980 C CG1 . ILE B 1 154 ? 14.605  16.497  -27.381 1.00 29.35 ? 161 ILE B CG1 1 
ATOM   2981 C CG2 . ILE B 1 154 ? 12.623  15.370  -26.158 1.00 29.10 ? 161 ILE B CG2 1 
ATOM   2982 C CD1 . ILE B 1 154 ? 14.860  15.163  -28.075 1.00 34.78 ? 161 ILE B CD1 1 
ATOM   2983 N N   . LYS B 1 155 ? 13.125  17.074  -23.248 1.00 25.76 ? 162 LYS B N   1 
ATOM   2984 C CA  . LYS B 1 155 ? 13.610  16.484  -21.999 1.00 29.98 ? 162 LYS B CA  1 
ATOM   2985 C C   . LYS B 1 155 ? 13.574  15.004  -22.205 1.00 30.88 ? 162 LYS B C   1 
ATOM   2986 O O   . LYS B 1 155 ? 12.492  14.459  -22.464 1.00 31.95 ? 162 LYS B O   1 
ATOM   2987 C CB  . LYS B 1 155 ? 12.714  16.829  -20.804 1.00 37.15 ? 162 LYS B CB  1 
ATOM   2988 C CG  . LYS B 1 155 ? 12.934  18.224  -20.278 1.00 43.46 ? 162 LYS B CG  1 
ATOM   2989 C CD  . LYS B 1 155 ? 14.300  18.378  -19.578 1.00 50.60 ? 162 LYS B CD  1 
ATOM   2990 C CE  . LYS B 1 155 ? 14.266  18.171  -18.058 1.00 53.79 ? 162 LYS B CE  1 
ATOM   2991 N NZ  . LYS B 1 155 ? 15.112  19.177  -17.326 1.00 54.91 ? 162 LYS B NZ  1 
ATOM   2992 N N   . GLN B 1 156 ? 14.740  14.389  -22.234 1.00 29.45 ? 163 GLN B N   1 
ATOM   2993 C CA  . GLN B 1 156 ? 14.839  12.930  -22.482 1.00 28.78 ? 163 GLN B CA  1 
ATOM   2994 C C   . GLN B 1 156 ? 14.803  12.262  -21.161 1.00 27.84 ? 163 GLN B C   1 
ATOM   2995 O O   . GLN B 1 156 ? 15.187  12.860  -20.205 1.00 25.87 ? 163 GLN B O   1 
ATOM   2996 C CB  . GLN B 1 156 ? 16.120  12.551  -23.158 1.00 31.03 ? 163 GLN B CB  1 
ATOM   2997 C CG  . GLN B 1 156 ? 16.245  13.037  -24.547 1.00 33.17 ? 163 GLN B CG  1 
ATOM   2998 C CD  . GLN B 1 156 ? 15.388  12.302  -25.505 1.00 39.01 ? 163 GLN B CD  1 
ATOM   2999 O OE1 . GLN B 1 156 ? 14.296  11.840  -25.161 1.00 41.45 ? 163 GLN B OE1 1 
ATOM   3000 N NE2 . GLN B 1 156 ? 15.894  12.153  -26.740 1.00 38.24 ? 163 GLN B NE2 1 
ATOM   3001 N N   . ARG B 1 157 ? 14.241  11.044  -21.106 1.00 26.06 ? 164 ARG B N   1 
ATOM   3002 C CA  . ARG B 1 157 ? 14.250  10.262  -19.846 1.00 26.90 ? 164 ARG B CA  1 
ATOM   3003 C C   . ARG B 1 157 ? 14.655  8.875   -20.246 1.00 23.69 ? 164 ARG B C   1 
ATOM   3004 O O   . ARG B 1 157 ? 14.005  8.267   -21.139 1.00 25.83 ? 164 ARG B O   1 
ATOM   3005 C CB  . ARG B 1 157 ? 12.867  10.195  -19.183 1.00 27.45 ? 164 ARG B CB  1 
ATOM   3006 C CG  . ARG B 1 157 ? 12.143  11.531  -19.051 1.00 31.96 ? 164 ARG B CG  1 
ATOM   3007 C CD  . ARG B 1 157 ? 11.133  11.521  -17.937 1.00 33.39 ? 164 ARG B CD  1 
ATOM   3008 N NE  . ARG B 1 157 ? 11.865  11.621  -16.663 1.00 42.12 ? 164 ARG B NE  1 
ATOM   3009 C CZ  . ARG B 1 157 ? 11.360  11.449  -15.438 1.00 42.29 ? 164 ARG B CZ  1 
ATOM   3010 N NH1 . ARG B 1 157 ? 10.073  11.155  -15.261 1.00 40.42 ? 164 ARG B NH1 1 
ATOM   3011 N NH2 . ARG B 1 157 ? 12.162  11.589  -14.369 1.00 45.15 ? 164 ARG B NH2 1 
ATOM   3012 N N   . LEU B 1 158 ? 15.799  8.424   -19.741 1.00 24.44 ? 165 LEU B N   1 
ATOM   3013 C CA  . LEU B 1 158 ? 16.195  7.038   -19.877 1.00 24.81 ? 165 LEU B CA  1 
ATOM   3014 C C   . LEU B 1 158 ? 15.727  6.252   -18.616 1.00 24.48 ? 165 LEU B C   1 
ATOM   3015 O O   . LEU B 1 158 ? 15.925  6.677   -17.506 1.00 23.82 ? 165 LEU B O   1 
ATOM   3016 C CB  . LEU B 1 158 ? 17.699  6.949   -19.950 1.00 27.10 ? 165 LEU B CB  1 
ATOM   3017 C CG  . LEU B 1 158 ? 18.499  6.595   -21.218 1.00 31.32 ? 165 LEU B CG  1 
ATOM   3018 C CD1 . LEU B 1 158 ? 17.784  6.304   -22.530 1.00 33.56 ? 165 LEU B CD1 1 
ATOM   3019 C CD2 . LEU B 1 158 ? 19.753  7.423   -21.394 1.00 27.66 ? 165 LEU B CD2 1 
ATOM   3020 N N   . LYS B 1 159 ? 15.164  5.096   -18.884 1.00 26.32 ? 166 LYS B N   1 
ATOM   3021 C CA  . LYS B 1 159 ? 14.749  4.182   -17.835 1.00 25.98 ? 166 LYS B CA  1 
ATOM   3022 C C   . LYS B 1 159 ? 15.973  3.534   -17.176 1.00 27.37 ? 166 LYS B C   1 
ATOM   3023 O O   . LYS B 1 159 ? 16.912  3.122   -17.858 1.00 28.30 ? 166 LYS B O   1 
ATOM   3024 C CB  . LYS B 1 159 ? 13.812  3.159   -18.448 1.00 27.95 ? 166 LYS B CB  1 
ATOM   3025 C CG  . LYS B 1 159 ? 12.542  3.825   -18.955 1.00 31.03 ? 166 LYS B CG  1 
ATOM   3026 C CD  . LYS B 1 159 ? 11.551  2.891   -19.643 1.00 34.40 ? 166 LYS B CD  1 
ATOM   3027 C CE  . LYS B 1 159 ? 12.092  2.157   -20.858 1.00 37.87 ? 166 LYS B CE  1 
ATOM   3028 N NZ  . LYS B 1 159 ? 11.012  1.480   -21.681 1.00 37.95 ? 166 LYS B NZ  1 
ATOM   3029 N N   . LEU B 1 160 ? 15.942  3.430   -15.835 1.00 26.11 ? 167 LEU B N   1 
ATOM   3030 C CA  . LEU B 1 160 ? 16.991  2.858   -15.120 1.00 22.71 ? 167 LEU B CA  1 
ATOM   3031 C C   . LEU B 1 160 ? 16.549  1.423   -14.692 1.00 24.74 ? 167 LEU B C   1 
ATOM   3032 O O   . LEU B 1 160 ? 15.395  1.188   -14.404 1.00 24.02 ? 167 LEU B O   1 
ATOM   3033 C CB  . LEU B 1 160 ? 17.289  3.663   -13.872 1.00 23.59 ? 167 LEU B CB  1 
ATOM   3034 C CG  . LEU B 1 160 ? 18.010  5.000   -14.177 1.00 24.30 ? 167 LEU B CG  1 
ATOM   3035 C CD1 . LEU B 1 160 ? 18.016  5.852   -12.955 1.00 25.14 ? 167 LEU B CD1 1 
ATOM   3036 C CD2 . LEU B 1 160 ? 19.417  4.715   -14.599 1.00 23.98 ? 167 LEU B CD2 1 
ATOM   3037 N N   . LYS B 1 161 ? 17.482  0.529   -14.812 1.00 25.38 ? 168 LYS B N   1 
ATOM   3038 C CA  . LYS B 1 161 ? 17.255  -0.879  -14.501 1.00 27.20 ? 168 LYS B CA  1 
ATOM   3039 C C   . LYS B 1 161 ? 16.704  -1.045  -13.095 1.00 29.60 ? 168 LYS B C   1 
ATOM   3040 O O   . LYS B 1 161 ? 15.805  -1.879  -12.865 1.00 29.36 ? 168 LYS B O   1 
ATOM   3041 C CB  . LYS B 1 161 ? 18.538  -1.665  -14.685 1.00 28.53 ? 168 LYS B CB  1 
ATOM   3042 C CG  . LYS B 1 161 ? 18.849  -1.946  -16.131 1.00 29.30 ? 168 LYS B CG  1 
ATOM   3043 C CD  . LYS B 1 161 ? 20.175  -2.651  -16.303 1.00 30.72 ? 168 LYS B CD  1 
ATOM   3044 C CE  . LYS B 1 161 ? 20.498  -2.687  -17.761 1.00 33.08 ? 168 LYS B CE  1 
ATOM   3045 N NZ  . LYS B 1 161 ? 21.666  -3.509  -18.107 1.00 35.31 ? 168 LYS B NZ  1 
ATOM   3046 N N   . ASP B 1 162 ? 17.189  -0.254  -12.175 1.00 29.73 ? 169 ASP B N   1 
ATOM   3047 C CA  . ASP B 1 162 ? 16.743  -0.370  -10.789 1.00 30.16 ? 169 ASP B CA  1 
ATOM   3048 C C   . ASP B 1 162 ? 15.560  0.489   -10.370 1.00 30.57 ? 169 ASP B C   1 
ATOM   3049 O O   . ASP B 1 162 ? 15.216  0.502   -9.189  1.00 33.76 ? 169 ASP B O   1 
ATOM   3050 C CB  . ASP B 1 162 ? 17.917  -0.197  -9.840  1.00 33.98 ? 169 ASP B CB  1 
ATOM   3051 C CG  . ASP B 1 162 ? 18.923  -1.331  -9.957  1.00 39.76 ? 169 ASP B CG  1 
ATOM   3052 O OD1 . ASP B 1 162 ? 18.590  -2.450  -10.469 1.00 39.29 ? 169 ASP B OD1 1 
ATOM   3053 O OD2 . ASP B 1 162 ? 20.092  -1.102  -9.569  1.00 44.10 ? 169 ASP B OD2 1 
ATOM   3054 N N   . GLY B 1 163 ? 14.939  1.173   -11.337 1.00 27.93 ? 170 GLY B N   1 
ATOM   3055 C CA  . GLY B 1 163 ? 13.742  1.976   -11.187 1.00 28.49 ? 170 GLY B CA  1 
ATOM   3056 C C   . GLY B 1 163 ? 14.059  3.465   -11.422 1.00 27.86 ? 170 GLY B C   1 
ATOM   3057 O O   . GLY B 1 163 ? 15.181  3.882   -11.191 1.00 27.29 ? 170 GLY B O   1 
ATOM   3058 N N   . GLY B 1 164 ? 13.032  4.221   -11.757 1.00 30.02 ? 171 GLY B N   1 
ATOM   3059 C CA  . GLY B 1 164 ? 13.149  5.709   -11.920 1.00 30.25 ? 171 GLY B CA  1 
ATOM   3060 C C   . GLY B 1 164 ? 13.856  5.927   -13.218 1.00 26.82 ? 171 GLY B C   1 
ATOM   3061 O O   . GLY B 1 164 ? 13.872  5.051   -14.105 1.00 26.88 ? 171 GLY B O   1 
ATOM   3062 N N   . HIS B 1 165 ? 14.403  7.125   -13.329 1.00 29.36 ? 172 HIS B N   1 
ATOM   3063 C CA  . HIS B 1 165 ? 14.779  7.681   -14.628 1.00 27.64 ? 172 HIS B CA  1 
ATOM   3064 C C   . HIS B 1 165 ? 16.044  8.479   -14.530 1.00 26.28 ? 172 HIS B C   1 
ATOM   3065 O O   . HIS B 1 165 ? 16.393  8.992   -13.492 1.00 26.32 ? 172 HIS B O   1 
ATOM   3066 C CB  . HIS B 1 165 ? 13.679  8.600   -15.177 1.00 33.22 ? 172 HIS B CB  1 
ATOM   3067 C CG  . HIS B 1 165 ? 12.507  7.858   -15.725 1.00 34.74 ? 172 HIS B CG  1 
ATOM   3068 N ND1 . HIS B 1 165 ? 11.317  7.744   -15.037 1.00 40.80 ? 172 HIS B ND1 1 
ATOM   3069 C CD2 . HIS B 1 165 ? 12.357  7.124   -16.852 1.00 40.08 ? 172 HIS B CD2 1 
ATOM   3070 C CE1 . HIS B 1 165 ? 10.472  7.009   -15.731 1.00 39.40 ? 172 HIS B CE1 1 
ATOM   3071 N NE2 . HIS B 1 165 ? 11.083  6.602   -16.826 1.00 39.76 ? 172 HIS B NE2 1 
ATOM   3072 N N   . TYR B 1 166 ? 16.767  8.529   -15.663 1.00 25.30 ? 173 TYR B N   1 
ATOM   3073 C CA  . TYR B 1 166 ? 17.978  9.300   -15.746 1.00 23.31 ? 173 TYR B CA  1 
ATOM   3074 C C   . TYR B 1 166 ? 17.706  10.314  -16.886 1.00 21.42 ? 173 TYR B C   1 
ATOM   3075 O O   . TYR B 1 166 ? 17.482  9.886   -18.011 1.00 24.08 ? 173 TYR B O   1 
ATOM   3076 C CB  . TYR B 1 166 ? 19.142  8.389   -16.091 1.00 23.20 ? 173 TYR B CB  1 
ATOM   3077 C CG  . TYR B 1 166 ? 20.486  9.071   -16.439 1.00 23.26 ? 173 TYR B CG  1 
ATOM   3078 C CD1 . TYR B 1 166 ? 21.179  9.817   -15.524 1.00 25.94 ? 173 TYR B CD1 1 
ATOM   3079 C CD2 . TYR B 1 166 ? 21.057  8.868   -17.688 1.00 26.80 ? 173 TYR B CD2 1 
ATOM   3080 C CE1 . TYR B 1 166 ? 22.411  10.383  -15.841 1.00 27.52 ? 173 TYR B CE1 1 
ATOM   3081 C CE2 . TYR B 1 166 ? 22.268  9.413   -18.011 1.00 24.54 ? 173 TYR B CE2 1 
ATOM   3082 C CZ  . TYR B 1 166 ? 22.942  10.167  -17.124 1.00 24.98 ? 173 TYR B CZ  1 
ATOM   3083 O OH  . TYR B 1 166 ? 24.195  10.638  -17.514 1.00 27.64 ? 173 TYR B OH  1 
ATOM   3084 N N   . ASP B 1 167 ? 17.755  11.593  -16.567 1.00 22.28 ? 174 ASP B N   1 
ATOM   3085 C CA  . ASP B 1 167 ? 17.278  12.647  -17.532 1.00 24.36 ? 174 ASP B CA  1 
ATOM   3086 C C   . ASP B 1 167 ? 18.391  13.461  -18.205 1.00 23.44 ? 174 ASP B C   1 
ATOM   3087 O O   . ASP B 1 167 ? 19.496  13.574  -17.690 1.00 24.23 ? 174 ASP B O   1 
ATOM   3088 C CB  . ASP B 1 167 ? 16.368  13.573  -16.788 1.00 26.46 ? 174 ASP B CB  1 
ATOM   3089 C CG  . ASP B 1 167 ? 15.136  12.855  -16.213 1.00 31.72 ? 174 ASP B CG  1 
ATOM   3090 O OD1 . ASP B 1 167 ? 14.720  11.751  -16.718 1.00 31.04 ? 174 ASP B OD1 1 
ATOM   3091 O OD2 . ASP B 1 167 ? 14.619  13.415  -15.253 1.00 33.63 ? 174 ASP B OD2 1 
ATOM   3092 N N   . ALA B 1 168 ? 18.031  14.037  -19.352 1.00 22.01 ? 175 ALA B N   1 
ATOM   3093 C CA  . ALA B 1 168 ? 18.915  14.954  -20.121 1.00 23.13 ? 175 ALA B CA  1 
ATOM   3094 C C   . ALA B 1 168 ? 17.999  15.988  -20.723 1.00 23.54 ? 175 ALA B C   1 
ATOM   3095 O O   . ALA B 1 168 ? 16.893  15.700  -21.120 1.00 24.59 ? 175 ALA B O   1 
ATOM   3096 C CB  . ALA B 1 168 ? 19.622  14.227  -21.272 1.00 24.49 ? 175 ALA B CB  1 
ATOM   3097 N N   . GLU B 1 169 ? 18.545  17.186  -20.865 1.00 21.51 ? 176 GLU B N   1 
ATOM   3098 C CA  . GLU B 1 169 ? 17.922  18.296  -21.547 1.00 23.61 ? 176 GLU B CA  1 
ATOM   3099 C C   . GLU B 1 169 ? 18.693  18.385  -22.848 1.00 21.28 ? 176 GLU B C   1 
ATOM   3100 O O   . GLU B 1 169 ? 19.932  18.398  -22.810 1.00 21.12 ? 176 GLU B O   1 
ATOM   3101 C CB  . GLU B 1 169 ? 18.191  19.551  -20.802 1.00 26.00 ? 176 GLU B CB  1 
ATOM   3102 C CG  . GLU B 1 169 ? 17.474  19.793  -19.501 1.00 32.00 ? 176 GLU B CG  1 
ATOM   3103 C CD  . GLU B 1 169 ? 18.156  20.923  -18.713 1.00 38.96 ? 176 GLU B CD  1 
ATOM   3104 O OE1 . GLU B 1 169 ? 19.045  21.683  -19.254 1.00 41.07 ? 176 GLU B OE1 1 
ATOM   3105 O OE2 . GLU B 1 169 ? 17.821  21.054  -17.510 1.00 46.88 ? 176 GLU B OE2 1 
ATOM   3106 N N   . VAL B 1 170 ? 17.981  18.470  -23.961 1.00 20.13 ? 177 VAL B N   1 
ATOM   3107 C CA  . VAL B 1 170 ? 18.565  18.391  -25.271 1.00 19.10 ? 177 VAL B CA  1 
ATOM   3108 C C   . VAL B 1 170 ? 18.041  19.548  -26.101 1.00 18.19 ? 177 VAL B C   1 
ATOM   3109 O O   . VAL B 1 170 ? 16.852  19.864  -26.044 1.00 17.36 ? 177 VAL B O   1 
ATOM   3110 C CB  . VAL B 1 170 ? 18.235  17.080  -25.943 1.00 20.11 ? 177 VAL B CB  1 
ATOM   3111 C CG1 . VAL B 1 170 ? 18.861  17.005  -27.310 1.00 21.03 ? 177 VAL B CG1 1 
ATOM   3112 C CG2 . VAL B 1 170 ? 18.697  15.903  -25.075 1.00 21.08 ? 177 VAL B CG2 1 
ATOM   3113 N N   . LYS B 1 171 ? 18.957  20.173  -26.824 1.00 17.66 ? 178 LYS B N   1 
ATOM   3114 C CA  . LYS B 1 171 ? 18.603  21.243  -27.772 1.00 19.50 ? 178 LYS B CA  1 
ATOM   3115 C C   . LYS B 1 171 ? 19.360  20.985  -29.043 1.00 18.90 ? 178 LYS B C   1 
ATOM   3116 O O   . LYS B 1 171 ? 20.552  20.695  -29.022 1.00 18.42 ? 178 LYS B O   1 
ATOM   3117 C CB  . LYS B 1 171 ? 18.893  22.651  -27.187 1.00 23.72 ? 178 LYS B CB  1 
ATOM   3118 C CG  . LYS B 1 171 ? 18.367  23.776  -28.094 1.00 27.45 ? 178 LYS B CG  1 
ATOM   3119 C CD  . LYS B 1 171 ? 18.426  25.105  -27.344 1.00 34.47 ? 178 LYS B CD  1 
ATOM   3120 C CE  . LYS B 1 171 ? 17.950  26.282  -28.183 1.00 37.17 ? 178 LYS B CE  1 
ATOM   3121 N NZ  . LYS B 1 171 ? 18.399  27.584  -27.600 1.00 39.02 ? 178 LYS B NZ  1 
ATOM   3122 N N   . THR B 1 172 ? 18.656  21.089  -30.145 1.00 17.43 ? 179 THR B N   1 
ATOM   3123 C CA  . THR B 1 172 ? 19.175  20.843  -31.475 1.00 17.55 ? 179 THR B CA  1 
ATOM   3124 C C   . THR B 1 172 ? 18.807  21.974  -32.435 1.00 16.63 ? 179 THR B C   1 
ATOM   3125 O O   . THR B 1 172 ? 17.675  22.462  -32.405 1.00 16.56 ? 179 THR B O   1 
ATOM   3126 C CB  . THR B 1 172 ? 18.622  19.521  -32.020 1.00 17.13 ? 179 THR B CB  1 
ATOM   3127 O OG1 . THR B 1 172 ? 18.808  18.496  -31.015 1.00 17.47 ? 179 THR B OG1 1 
ATOM   3128 C CG2 . THR B 1 172 ? 19.316  19.092  -33.258 1.00 18.51 ? 179 THR B CG2 1 
ATOM   3129 N N   . THR B 1 173 ? 19.737  22.343  -33.314 1.00 17.33 ? 180 THR B N   1 
ATOM   3130 C CA  . THR B 1 173 ? 19.486  23.239  -34.442 1.00 17.38 ? 180 THR B CA  1 
ATOM   3131 C C   . THR B 1 173 ? 19.602  22.426  -35.672 1.00 18.06 ? 180 THR B C   1 
ATOM   3132 O O   . THR B 1 173 ? 20.671  21.851  -35.938 1.00 18.57 ? 180 THR B O   1 
ATOM   3133 C CB  . THR B 1 173 ? 20.498  24.396  -34.476 1.00 19.91 ? 180 THR B CB  1 
ATOM   3134 O OG1 . THR B 1 173 ? 20.404  25.087  -33.203 1.00 20.96 ? 180 THR B OG1 1 
ATOM   3135 C CG2 . THR B 1 173 ? 20.185  25.341  -35.559 1.00 19.78 ? 180 THR B CG2 1 
ATOM   3136 N N   . TYR B 1 174 ? 18.546  22.444  -36.452 1.00 17.52 ? 181 TYR B N   1 
ATOM   3137 C CA  . TYR B 1 174 ? 18.503  21.849  -37.797 1.00 18.64 ? 181 TYR B CA  1 
ATOM   3138 C C   . TYR B 1 174 ? 18.559  22.879  -38.908 1.00 19.18 ? 181 TYR B C   1 
ATOM   3139 O O   . TYR B 1 174 ? 17.755  23.813  -38.896 1.00 20.68 ? 181 TYR B O   1 
ATOM   3140 C CB  . TYR B 1 174 ? 17.234  21.025  -37.924 1.00 18.61 ? 181 TYR B CB  1 
ATOM   3141 C CG  . TYR B 1 174 ? 16.975  20.071  -36.757 1.00 19.73 ? 181 TYR B CG  1 
ATOM   3142 C CD1 . TYR B 1 174 ? 16.269  20.460  -35.616 1.00 21.04 ? 181 TYR B CD1 1 
ATOM   3143 C CD2 . TYR B 1 174 ? 17.438  18.756  -36.799 1.00 21.46 ? 181 TYR B CD2 1 
ATOM   3144 C CE1 . TYR B 1 174 ? 16.053  19.577  -34.565 1.00 20.95 ? 181 TYR B CE1 1 
ATOM   3145 C CE2 . TYR B 1 174 ? 17.197  17.876  -35.768 1.00 22.49 ? 181 TYR B CE2 1 
ATOM   3146 C CZ  . TYR B 1 174 ? 16.491  18.265  -34.631 1.00 22.94 ? 181 TYR B CZ  1 
ATOM   3147 O OH  . TYR B 1 174 ? 16.317  17.375  -33.534 1.00 22.50 ? 181 TYR B OH  1 
ATOM   3148 N N   . LYS B 1 175 ? 19.393  22.686  -39.920 1.00 19.56 ? 182 LYS B N   1 
ATOM   3149 C CA  . LYS B 1 175 ? 19.510  23.671  -40.970 1.00 20.18 ? 182 LYS B CA  1 
ATOM   3150 C C   . LYS B 1 175 ? 19.601  23.060  -42.371 1.00 19.75 ? 182 LYS B C   1 
ATOM   3151 O O   . LYS B 1 175 ? 20.517  22.292  -42.681 1.00 18.92 ? 182 LYS B O   1 
ATOM   3152 C CB  . LYS B 1 175 ? 20.742  24.534  -40.717 1.00 24.67 ? 182 LYS B CB  1 
ATOM   3153 C CG  . LYS B 1 175 ? 20.853  25.716  -41.687 1.00 28.43 ? 182 LYS B CG  1 
ATOM   3154 C CD  . LYS B 1 175 ? 19.610  26.630  -41.635 1.00 32.63 ? 182 LYS B CD  1 
ATOM   3155 C CE  . LYS B 1 175 ? 19.865  27.969  -42.305 1.00 38.06 ? 182 LYS B CE  1 
ATOM   3156 N NZ  . LYS B 1 175 ? 20.672  28.897  -41.458 1.00 44.74 ? 182 LYS B NZ  1 
ATOM   3157 N N   . ALA B 1 176 ? 18.629  23.431  -43.172 1.00 20.15 ? 183 ALA B N   1 
ATOM   3158 C CA  . ALA B 1 176 ? 18.550  22.958  -44.536 1.00 20.14 ? 183 ALA B CA  1 
ATOM   3159 C C   . ALA B 1 176 ? 19.716  23.536  -45.287 1.00 21.37 ? 183 ALA B C   1 
ATOM   3160 O O   . ALA B 1 176 ? 20.182  24.692  -45.054 1.00 21.24 ? 183 ALA B O   1 
ATOM   3161 C CB  . ALA B 1 176 ? 17.237  23.420  -45.159 1.00 19.64 ? 183 ALA B CB  1 
ATOM   3162 N N   . LYS B 1 177 ? 20.133  22.838  -46.321 1.00 22.52 ? 184 LYS B N   1 
ATOM   3163 C CA  . LYS B 1 177 ? 21.240  23.303  -47.163 1.00 22.14 ? 184 LYS B CA  1 
ATOM   3164 C C   . LYS B 1 177 ? 20.850  24.304  -48.273 1.00 24.48 ? 184 LYS B C   1 
ATOM   3165 O O   . LYS B 1 177 ? 21.704  24.766  -49.017 1.00 26.26 ? 184 LYS B O   1 
ATOM   3166 C CB  . LYS B 1 177 ? 21.984  22.110  -47.763 1.00 22.49 ? 184 LYS B CB  1 
ATOM   3167 C CG  . LYS B 1 177 ? 22.703  21.293  -46.724 1.00 21.98 ? 184 LYS B CG  1 
ATOM   3168 C CD  . LYS B 1 177 ? 23.213  19.994  -47.298 1.00 22.55 ? 184 LYS B CD  1 
ATOM   3169 C CE  . LYS B 1 177 ? 23.958  19.176  -46.263 1.00 20.55 ? 184 LYS B CE  1 
ATOM   3170 N NZ  . LYS B 1 177 ? 24.087  17.722  -46.575 1.00 21.79 ? 184 LYS B NZ  1 
ATOM   3171 N N   . LYS B 1 178 ? 19.561  24.569  -48.359 1.00 24.74 ? 185 LYS B N   1 
ATOM   3172 C CA  . LYS B 1 178 ? 19.032  25.553  -49.256 1.00 26.09 ? 185 LYS B CA  1 
ATOM   3173 C C   . LYS B 1 178 ? 17.855  26.209  -48.567 1.00 25.28 ? 185 LYS B C   1 
ATOM   3174 O O   . LYS B 1 178 ? 17.274  25.654  -47.620 1.00 26.76 ? 185 LYS B O   1 
ATOM   3175 C CB  . LYS B 1 178 ? 18.635  24.855  -50.573 1.00 27.22 ? 185 LYS B CB  1 
ATOM   3176 C CG  . LYS B 1 178 ? 17.576  23.809  -50.402 1.00 27.56 ? 185 LYS B CG  1 
ATOM   3177 C CD  . LYS B 1 178 ? 17.189  23.275  -51.758 1.00 29.71 ? 185 LYS B CD  1 
ATOM   3178 C CE  . LYS B 1 178 ? 16.227  22.125  -51.629 1.00 30.08 ? 185 LYS B CE  1 
ATOM   3179 N NZ  . LYS B 1 178 ? 16.088  21.674  -53.067 1.00 33.51 ? 185 LYS B NZ  1 
ATOM   3180 N N   . PRO B 1 179 ? 17.473  27.396  -49.023 1.00 28.20 ? 186 PRO B N   1 
ATOM   3181 C CA  . PRO B 1 179 ? 16.339  28.034  -48.368 1.00 29.21 ? 186 PRO B CA  1 
ATOM   3182 C C   . PRO B 1 179 ? 15.025  27.347  -48.700 1.00 29.98 ? 186 PRO B C   1 
ATOM   3183 O O   . PRO B 1 179 ? 14.631  27.227  -49.885 1.00 34.61 ? 186 PRO B O   1 
ATOM   3184 C CB  . PRO B 1 179 ? 16.381  29.468  -48.904 1.00 30.98 ? 186 PRO B CB  1 
ATOM   3185 C CG  . PRO B 1 179 ? 17.029  29.331  -50.237 1.00 30.66 ? 186 PRO B CG  1 
ATOM   3186 C CD  . PRO B 1 179 ? 17.985  28.193  -50.166 1.00 28.49 ? 186 PRO B CD  1 
ATOM   3187 N N   . VAL B 1 180 ? 14.372  26.822  -47.698 1.00 28.03 ? 187 VAL B N   1 
ATOM   3188 C CA  . VAL B 1 180 ? 13.067  26.262  -47.854 1.00 28.82 ? 187 VAL B CA  1 
ATOM   3189 C C   . VAL B 1 180 ? 12.193  26.688  -46.652 1.00 29.66 ? 187 VAL B C   1 
ATOM   3190 O O   . VAL B 1 180 ? 12.690  27.172  -45.606 1.00 27.01 ? 187 VAL B O   1 
ATOM   3191 C CB  . VAL B 1 180 ? 13.131  24.748  -48.075 1.00 33.64 ? 187 VAL B CB  1 
ATOM   3192 C CG1 . VAL B 1 180 ? 13.682  24.411  -49.468 1.00 38.41 ? 187 VAL B CG1 1 
ATOM   3193 C CG2 . VAL B 1 180 ? 14.017  24.133  -47.037 1.00 31.94 ? 187 VAL B CG2 1 
ATOM   3194 N N   . GLN B 1 181 ? 10.897  26.464  -46.793 1.00 28.82 ? 188 GLN B N   1 
ATOM   3195 C CA  . GLN B 1 181 ? 9.927   26.982  -45.846 1.00 29.67 ? 188 GLN B CA  1 
ATOM   3196 C C   . GLN B 1 181 ? 10.028  26.397  -44.456 1.00 24.51 ? 188 GLN B C   1 
ATOM   3197 O O   . GLN B 1 181 ? 9.910   25.191  -44.237 1.00 23.50 ? 188 GLN B O   1 
ATOM   3198 C CB  . GLN B 1 181 ? 8.505   26.719  -46.337 1.00 32.22 ? 188 GLN B CB  1 
ATOM   3199 C CG  . GLN B 1 181 ? 7.470   27.454  -45.506 1.00 35.68 ? 188 GLN B CG  1 
ATOM   3200 C CD  . GLN B 1 181 ? 6.064   27.253  -46.036 1.00 41.61 ? 188 GLN B CD  1 
ATOM   3201 O OE1 . GLN B 1 181 ? 5.205   28.126  -45.871 1.00 45.42 ? 188 GLN B OE1 1 
ATOM   3202 N NE2 . GLN B 1 181 ? 5.799   26.067  -46.628 1.00 41.70 ? 188 GLN B NE2 1 
ATOM   3203 N N   . LEU B 1 182 ? 10.230  27.272  -43.498 1.00 24.50 ? 189 LEU B N   1 
ATOM   3204 C CA  . LEU B 1 182 ? 10.129  26.859  -42.129 1.00 22.88 ? 189 LEU B CA  1 
ATOM   3205 C C   . LEU B 1 182 ? 8.688   26.705  -41.585 1.00 23.62 ? 189 LEU B C   1 
ATOM   3206 O O   . LEU B 1 182 ? 7.806   27.493  -41.935 1.00 26.76 ? 189 LEU B O   1 
ATOM   3207 C CB  . LEU B 1 182 ? 10.848  27.895  -41.252 1.00 23.70 ? 189 LEU B CB  1 
ATOM   3208 C CG  . LEU B 1 182 ? 12.365  27.837  -41.277 1.00 23.61 ? 189 LEU B CG  1 
ATOM   3209 C CD1 . LEU B 1 182 ? 12.830  29.117  -40.612 1.00 24.88 ? 189 LEU B CD1 1 
ATOM   3210 C CD2 . LEU B 1 182 ? 12.962  26.673  -40.484 1.00 24.52 ? 189 LEU B CD2 1 
ATOM   3211 N N   . PRO B 1 183 ? 8.477   25.785  -40.638 1.00 22.02 ? 190 PRO B N   1 
ATOM   3212 C CA  . PRO B 1 183 ? 7.177   25.718  -39.982 1.00 21.90 ? 190 PRO B CA  1 
ATOM   3213 C C   . PRO B 1 183 ? 7.084   26.710  -38.843 1.00 21.47 ? 190 PRO B C   1 
ATOM   3214 O O   . PRO B 1 183 ? 8.088   27.368  -38.537 1.00 22.38 ? 190 PRO B O   1 
ATOM   3215 C CB  . PRO B 1 183 ? 7.191   24.337  -39.405 1.00 22.07 ? 190 PRO B CB  1 
ATOM   3216 C CG  . PRO B 1 183 ? 8.622   24.150  -38.974 1.00 22.24 ? 190 PRO B CG  1 
ATOM   3217 C CD  . PRO B 1 183 ? 9.419   24.809  -40.056 1.00 22.12 ? 190 PRO B CD  1 
ATOM   3218 N N   . GLY B 1 184 ? 5.919   26.775  -38.220 1.00 22.50 ? 191 GLY B N   1 
ATOM   3219 C CA  . GLY B 1 184 ? 5.758   27.418  -36.916 1.00 20.55 ? 191 GLY B CA  1 
ATOM   3220 C C   . GLY B 1 184 ? 6.110   26.464  -35.788 1.00 19.95 ? 191 GLY B C   1 
ATOM   3221 O O   . GLY B 1 184 ? 6.795   25.436  -35.979 1.00 20.62 ? 191 GLY B O   1 
ATOM   3222 N N   . ALA B 1 185 ? 5.623   26.775  -34.602 1.00 19.46 ? 192 ALA B N   1 
ATOM   3223 C CA  . ALA B 1 185 ? 5.829   25.929  -33.463 1.00 19.10 ? 192 ALA B CA  1 
ATOM   3224 C C   . ALA B 1 185 ? 4.917   24.692  -33.542 1.00 19.64 ? 192 ALA B C   1 
ATOM   3225 O O   . ALA B 1 185 ? 3.755   24.801  -33.964 1.00 19.28 ? 192 ALA B O   1 
ATOM   3226 C CB  . ALA B 1 185 ? 5.534   26.685  -32.191 1.00 20.24 ? 192 ALA B CB  1 
ATOM   3227 N N   . TYR B 1 186 ? 5.478   23.552  -33.205 1.00 18.76 ? 193 TYR B N   1 
ATOM   3228 C CA  . TYR B 1 186 ? 4.708   22.306  -33.182 1.00 18.38 ? 193 TYR B CA  1 
ATOM   3229 C C   . TYR B 1 186 ? 5.543   21.274  -32.419 1.00 19.18 ? 193 TYR B C   1 
ATOM   3230 O O   . TYR B 1 186 ? 6.682   21.574  -32.023 1.00 18.85 ? 193 TYR B O   1 
ATOM   3231 C CB  . TYR B 1 186 ? 4.383   21.814  -34.609 1.00 18.33 ? 193 TYR B CB  1 
ATOM   3232 C CG  . TYR B 1 186 ? 5.525   21.238  -35.414 1.00 18.86 ? 193 TYR B CG  1 
ATOM   3233 C CD1 . TYR B 1 186 ? 6.532   22.042  -35.961 1.00 20.06 ? 193 TYR B CD1 1 
ATOM   3234 C CD2 . TYR B 1 186 ? 5.608   19.849  -35.652 1.00 19.76 ? 193 TYR B CD2 1 
ATOM   3235 C CE1 . TYR B 1 186 ? 7.576   21.511  -36.701 1.00 21.11 ? 193 TYR B CE1 1 
ATOM   3236 C CE2 . TYR B 1 186 ? 6.641   19.311  -36.445 1.00 20.22 ? 193 TYR B CE2 1 
ATOM   3237 C CZ  . TYR B 1 186 ? 7.655   20.110  -36.920 1.00 21.52 ? 193 TYR B CZ  1 
ATOM   3238 O OH  . TYR B 1 186 ? 8.656   19.583  -37.685 1.00 23.18 ? 193 TYR B OH  1 
ATOM   3239 N N   . ASN B 1 187 ? 4.982   20.059  -32.216 1.00 18.36 ? 194 ASN B N   1 
ATOM   3240 C CA  . ASN B 1 187 ? 5.622   19.067  -31.381 1.00 20.10 ? 194 ASN B CA  1 
ATOM   3241 C C   . ASN B 1 187 ? 5.838   17.783  -32.206 1.00 20.06 ? 194 ASN B C   1 
ATOM   3242 O O   . ASN B 1 187 ? 5.091   17.499  -33.143 1.00 21.30 ? 194 ASN B O   1 
ATOM   3243 C CB  . ASN B 1 187 ? 4.781   18.645  -30.167 1.00 23.08 ? 194 ASN B CB  1 
ATOM   3244 C CG  . ASN B 1 187 ? 4.548   19.762  -29.209 1.00 27.29 ? 194 ASN B CG  1 
ATOM   3245 O OD1 . ASN B 1 187 ? 5.411   20.587  -29.044 1.00 30.16 ? 194 ASN B OD1 1 
ATOM   3246 N ND2 . ASN B 1 187 ? 3.358   19.831  -28.635 1.00 31.09 ? 194 ASN B ND2 1 
ATOM   3247 N N   . VAL B 1 188 ? 6.890   17.065  -31.851 1.00 19.77 ? 195 VAL B N   1 
ATOM   3248 C CA  . VAL B 1 188 ? 7.182   15.785  -32.539 1.00 20.53 ? 195 VAL B CA  1 
ATOM   3249 C C   . VAL B 1 188 ? 7.191   14.753  -31.459 1.00 20.54 ? 195 VAL B C   1 
ATOM   3250 O O   . VAL B 1 188 ? 8.023   14.786  -30.522 1.00 20.56 ? 195 VAL B O   1 
ATOM   3251 C CB  . VAL B 1 188 ? 8.470   15.810  -33.422 1.00 20.18 ? 195 VAL B CB  1 
ATOM   3252 C CG1 . VAL B 1 188 ? 8.685   14.372  -34.019 1.00 22.20 ? 195 VAL B CG1 1 
ATOM   3253 C CG2 . VAL B 1 188 ? 8.385   16.787  -34.534 1.00 21.53 ? 195 VAL B CG2 1 
ATOM   3254 N N   . ASN B 1 189 ? 6.283   13.778  -31.570 1.00 21.04 ? 196 ASN B N   1 
ATOM   3255 C CA  . ASN B 1 189 ? 6.226   12.712  -30.545 1.00 21.66 ? 196 ASN B CA  1 
ATOM   3256 C C   . ASN B 1 189 ? 7.065   11.519  -31.053 1.00 19.86 ? 196 ASN B C   1 
ATOM   3257 O O   . ASN B 1 189 ? 6.945   11.188  -32.228 1.00 21.98 ? 196 ASN B O   1 
ATOM   3258 C CB  . ASN B 1 189 ? 4.815   12.203  -30.268 1.00 25.80 ? 196 ASN B CB  1 
ATOM   3259 C CG  . ASN B 1 189 ? 3.938   13.239  -29.587 1.00 29.87 ? 196 ASN B CG  1 
ATOM   3260 O OD1 . ASN B 1 189 ? 4.400   13.997  -28.756 1.00 38.82 ? 196 ASN B OD1 1 
ATOM   3261 N ND2 . ASN B 1 189 ? 2.684   13.287  -29.978 1.00 34.56 ? 196 ASN B ND2 1 
ATOM   3262 N N   . ILE B 1 190 ? 7.939   11.025  -30.222 1.00 20.14 ? 197 ILE B N   1 
ATOM   3263 C CA  . ILE B 1 190 ? 8.970   10.092  -30.687 1.00 22.22 ? 197 ILE B CA  1 
ATOM   3264 C C   . ILE B 1 190 ? 8.976   8.900   -29.778 1.00 21.68 ? 197 ILE B C   1 
ATOM   3265 O O   . ILE B 1 190 ? 8.903   9.024   -28.588 1.00 21.18 ? 197 ILE B O   1 
ATOM   3266 C CB  . ILE B 1 190 ? 10.369  10.731  -30.628 1.00 25.05 ? 197 ILE B CB  1 
ATOM   3267 C CG1 . ILE B 1 190 ? 10.431  11.916  -31.567 1.00 27.94 ? 197 ILE B CG1 1 
ATOM   3268 C CG2 . ILE B 1 190 ? 11.472  9.718   -30.920 1.00 26.04 ? 197 ILE B CG2 1 
ATOM   3269 C CD1 . ILE B 1 190 ? 11.487  12.923  -31.131 1.00 30.64 ? 197 ILE B CD1 1 
ATOM   3270 N N   . LYS B 1 191 ? 9.043   7.706   -30.373 1.00 23.25 ? 198 LYS B N   1 
ATOM   3271 C CA  . LYS B 1 191 ? 9.261   6.504   -29.570 1.00 23.65 ? 198 LYS B CA  1 
ATOM   3272 C C   . LYS B 1 191 ? 10.401  5.733   -30.232 1.00 21.30 ? 198 LYS B C   1 
ATOM   3273 O O   . LYS B 1 191 ? 10.378  5.508   -31.416 1.00 25.51 ? 198 LYS B O   1 
ATOM   3274 C CB  . LYS B 1 191 ? 8.015   5.610   -29.567 1.00 28.75 ? 198 LYS B CB  1 
ATOM   3275 C CG  . LYS B 1 191 ? 7.976   4.796   -28.277 1.00 37.88 ? 198 LYS B CG  1 
ATOM   3276 C CD  . LYS B 1 191 ? 6.773   3.846   -28.183 1.00 42.24 ? 198 LYS B CD  1 
ATOM   3277 C CE  . LYS B 1 191 ? 6.598   3.237   -26.778 1.00 43.23 ? 198 LYS B CE  1 
ATOM   3278 N NZ  . LYS B 1 191 ? 7.876   3.138   -26.000 1.00 48.65 ? 198 LYS B NZ  1 
ATOM   3279 N N   . LEU B 1 192 ? 11.390  5.406   -29.458 1.00 21.82 ? 199 LEU B N   1 
ATOM   3280 C CA  . LEU B 1 192 ? 12.569  4.735   -29.972 1.00 23.03 ? 199 LEU B CA  1 
ATOM   3281 C C   . LEU B 1 192 ? 12.815  3.483   -29.134 1.00 23.39 ? 199 LEU B C   1 
ATOM   3282 O O   . LEU B 1 192 ? 12.997  3.578   -27.901 1.00 24.25 ? 199 LEU B O   1 
ATOM   3283 C CB  . LEU B 1 192 ? 13.743  5.677   -29.754 1.00 26.37 ? 199 LEU B CB  1 
ATOM   3284 C CG  . LEU B 1 192 ? 15.184  5.542   -30.220 1.00 31.97 ? 199 LEU B CG  1 
ATOM   3285 C CD1 . LEU B 1 192 ? 16.227  5.670   -29.135 1.00 34.52 ? 199 LEU B CD1 1 
ATOM   3286 C CD2 . LEU B 1 192 ? 15.368  4.363   -31.161 1.00 33.56 ? 199 LEU B CD2 1 
ATOM   3287 N N   . ASP B 1 193 ? 12.884  2.366   -29.815 1.00 25.96 ? 200 ASP B N   1 
ATOM   3288 C CA  . ASP B 1 193 ? 13.100  1.116   -29.175 1.00 28.76 ? 200 ASP B CA  1 
ATOM   3289 C C   . ASP B 1 193 ? 14.286  0.361   -29.792 1.00 26.95 ? 200 ASP B C   1 
ATOM   3290 O O   . ASP B 1 193 ? 14.419  0.321   -31.015 1.00 27.43 ? 200 ASP B O   1 
ATOM   3291 C CB  . ASP B 1 193 ? 11.860  0.223   -29.362 1.00 32.45 ? 200 ASP B CB  1 
ATOM   3292 C CG  . ASP B 1 193 ? 10.618  0.755   -28.660 1.00 38.43 ? 200 ASP B CG  1 
ATOM   3293 O OD1 . ASP B 1 193 ? 10.669  1.044   -27.449 1.00 40.09 ? 200 ASP B OD1 1 
ATOM   3294 O OD2 . ASP B 1 193 ? 9.606   0.896   -29.366 1.00 43.46 ? 200 ASP B OD2 1 
ATOM   3295 N N   . ILE B 1 194 ? 15.065  -0.253  -28.921 1.00 26.44 ? 201 ILE B N   1 
ATOM   3296 C CA  . ILE B 1 194 ? 16.056  -1.313  -29.298 1.00 27.15 ? 201 ILE B CA  1 
ATOM   3297 C C   . ILE B 1 194 ? 15.343  -2.640  -29.402 1.00 28.19 ? 201 ILE B C   1 
ATOM   3298 O O   . ILE B 1 194 ? 14.869  -3.122  -28.398 1.00 30.12 ? 201 ILE B O   1 
ATOM   3299 C CB  . ILE B 1 194 ? 17.173  -1.438  -28.235 1.00 31.73 ? 201 ILE B CB  1 
ATOM   3300 C CG1 . ILE B 1 194 ? 17.833  -0.103  -27.916 1.00 35.13 ? 201 ILE B CG1 1 
ATOM   3301 C CG2 . ILE B 1 194 ? 18.207  -2.461  -28.695 1.00 34.67 ? 201 ILE B CG2 1 
ATOM   3302 C CD1 . ILE B 1 194 ? 18.076  0.746   -29.150 1.00 36.57 ? 201 ILE B CD1 1 
ATOM   3303 N N   . THR B 1 195 ? 15.282  -3.235  -30.603 1.00 30.71 ? 202 THR B N   1 
ATOM   3304 C CA  . THR B 1 195 ? 14.447  -4.380  -30.874 1.00 29.94 ? 202 THR B CA  1 
ATOM   3305 C C   . THR B 1 195 ? 15.211  -5.693  -30.839 1.00 30.83 ? 202 THR B C   1 
ATOM   3306 O O   . THR B 1 195 ? 14.602  -6.768  -30.690 1.00 29.71 ? 202 THR B O   1 
ATOM   3307 C CB  . THR B 1 195 ? 13.806  -4.252  -32.218 1.00 32.14 ? 202 THR B CB  1 
ATOM   3308 O OG1 . THR B 1 195 ? 14.813  -4.009  -33.184 1.00 35.19 ? 202 THR B OG1 1 
ATOM   3309 C CG2 . THR B 1 195 ? 12.814  -3.074  -32.222 1.00 33.74 ? 202 THR B CG2 1 
ATOM   3310 N N   . SER B 1 196 ? 16.515  -5.621  -30.937 1.00 28.53 ? 203 SER B N   1 
ATOM   3311 C CA  . SER B 1 196 ? 17.370  -6.805  -30.670 1.00 29.39 ? 203 SER B CA  1 
ATOM   3312 C C   . SER B 1 196 ? 18.783  -6.366  -30.662 1.00 27.39 ? 203 SER B C   1 
ATOM   3313 O O   . SER B 1 196 ? 19.124  -5.260  -31.107 1.00 26.53 ? 203 SER B O   1 
ATOM   3314 C CB  . SER B 1 196 ? 17.193  -7.929  -31.697 1.00 29.87 ? 203 SER B CB  1 
ATOM   3315 O OG  . SER B 1 196 ? 17.488  -7.520  -33.000 1.00 31.40 ? 203 SER B OG  1 
ATOM   3316 N N   . HIS B 1 197 ? 19.624  -7.192  -30.097 1.00 25.85 ? 204 HIS B N   1 
ATOM   3317 C CA  . HIS B 1 197 ? 21.029  -6.915  -30.137 1.00 25.00 ? 204 HIS B CA  1 
ATOM   3318 C C   . HIS B 1 197 ? 21.784  -8.166  -29.772 1.00 25.79 ? 204 HIS B C   1 
ATOM   3319 O O   . HIS B 1 197 ? 21.257  -9.026  -29.078 1.00 25.84 ? 204 HIS B O   1 
ATOM   3320 C CB  . HIS B 1 197 ? 21.384  -5.856  -29.097 1.00 24.11 ? 204 HIS B CB  1 
ATOM   3321 C CG  . HIS B 1 197 ? 20.975  -6.186  -27.691 1.00 24.65 ? 204 HIS B CG  1 
ATOM   3322 N ND1 . HIS B 1 197 ? 21.854  -6.689  -26.753 1.00 28.13 ? 204 HIS B ND1 1 
ATOM   3323 C CD2 . HIS B 1 197 ? 19.792  -6.036  -27.040 1.00 27.34 ? 204 HIS B CD2 1 
ATOM   3324 C CE1 . HIS B 1 197 ? 21.238  -6.863  -25.607 1.00 27.19 ? 204 HIS B CE1 1 
ATOM   3325 N NE2 . HIS B 1 197 ? 19.982  -6.467  -25.748 1.00 29.13 ? 204 HIS B NE2 1 
ATOM   3326 N N   . ASN B 1 198 ? 23.048  -8.219  -30.139 1.00 24.52 ? 205 ASN B N   1 
ATOM   3327 C CA  . ASN B 1 198 ? 23.870  -9.315  -29.600 1.00 26.22 ? 205 ASN B CA  1 
ATOM   3328 C C   . ASN B 1 198 ? 24.353  -8.929  -28.207 1.00 25.74 ? 205 ASN B C   1 
ATOM   3329 O O   . ASN B 1 198 ? 24.130  -7.835  -27.746 1.00 23.46 ? 205 ASN B O   1 
ATOM   3330 C CB  . ASN B 1 198 ? 24.999  -9.676  -30.574 1.00 27.30 ? 205 ASN B CB  1 
ATOM   3331 C CG  . ASN B 1 198 ? 26.036  -8.555  -30.773 1.00 28.32 ? 205 ASN B CG  1 
ATOM   3332 O OD1 . ASN B 1 198 ? 25.972  -7.468  -30.171 1.00 26.34 ? 205 ASN B OD1 1 
ATOM   3333 N ND2 . ASN B 1 198 ? 27.014  -8.849  -31.603 1.00 27.17 ? 205 ASN B ND2 1 
ATOM   3334 N N   . GLU B 1 199 ? 24.889  -9.897  -27.468 1.00 27.81 ? 206 GLU B N   1 
ATOM   3335 C CA  . GLU B 1 199 ? 25.191  -9.745  -26.087 1.00 27.28 ? 206 GLU B CA  1 
ATOM   3336 C C   . GLU B 1 199 ? 26.102  -8.620  -25.695 1.00 28.04 ? 206 GLU B C   1 
ATOM   3337 O O   . GLU B 1 199 ? 25.917  -8.050  -24.602 1.00 27.13 ? 206 GLU B O   1 
ATOM   3338 C CB  . GLU B 1 199 ? 25.776  -11.085 -25.572 1.00 32.04 ? 206 GLU B CB  1 
ATOM   3339 C CG  . GLU B 1 199 ? 26.312  -11.041 -24.167 1.00 33.84 ? 206 GLU B CG  1 
ATOM   3340 C CD  . GLU B 1 199 ? 26.554  -12.444 -23.616 1.00 38.51 ? 206 GLU B CD  1 
ATOM   3341 O OE1 . GLU B 1 199 ? 25.893  -13.390 -24.102 1.00 36.65 ? 206 GLU B OE1 1 
ATOM   3342 O OE2 . GLU B 1 199 ? 27.410  -12.557 -22.723 1.00 39.74 ? 206 GLU B OE2 1 
ATOM   3343 N N   . ASP B 1 200 ? 27.049  -8.235  -26.573 1.00 28.05 ? 207 ASP B N   1 
ATOM   3344 C CA  . ASP B 1 200 ? 27.952  -7.127  -26.278 1.00 26.02 ? 207 ASP B CA  1 
ATOM   3345 C C   . ASP B 1 200 ? 27.559  -5.836  -27.006 1.00 28.57 ? 207 ASP B C   1 
ATOM   3346 O O   . ASP B 1 200 ? 28.371  -4.874  -27.029 1.00 28.55 ? 207 ASP B O   1 
ATOM   3347 C CB  . ASP B 1 200 ? 29.426  -7.429  -26.631 1.00 28.96 ? 207 ASP B CB  1 
ATOM   3348 C CG  . ASP B 1 200 ? 29.644  -7.862  -28.104 1.00 31.56 ? 207 ASP B CG  1 
ATOM   3349 O OD1 . ASP B 1 200 ? 28.689  -7.838  -28.935 1.00 31.39 ? 207 ASP B OD1 1 
ATOM   3350 O OD2 . ASP B 1 200 ? 30.799  -8.269  -28.427 1.00 32.25 ? 207 ASP B OD2 1 
ATOM   3351 N N   . TYR B 1 201 ? 26.396  -5.844  -27.659 1.00 25.71 ? 208 TYR B N   1 
ATOM   3352 C CA  . TYR B 1 201 ? 25.902  -4.658  -28.358 1.00 27.18 ? 208 TYR B CA  1 
ATOM   3353 C C   . TYR B 1 201 ? 26.801  -4.174  -29.477 1.00 27.39 ? 208 TYR B C   1 
ATOM   3354 O O   . TYR B 1 201 ? 26.821  -2.939  -29.800 1.00 25.38 ? 208 TYR B O   1 
ATOM   3355 C CB  . TYR B 1 201 ? 25.663  -3.515  -27.361 1.00 26.88 ? 208 TYR B CB  1 
ATOM   3356 C CG  . TYR B 1 201 ? 24.435  -3.656  -26.475 1.00 31.64 ? 208 TYR B CG  1 
ATOM   3357 C CD1 . TYR B 1 201 ? 24.465  -4.348  -25.246 1.00 33.10 ? 208 TYR B CD1 1 
ATOM   3358 C CD2 . TYR B 1 201 ? 23.251  -2.995  -26.813 1.00 33.38 ? 208 TYR B CD2 1 
ATOM   3359 C CE1 . TYR B 1 201 ? 23.338  -4.409  -24.440 1.00 34.43 ? 208 TYR B CE1 1 
ATOM   3360 C CE2 . TYR B 1 201 ? 22.131  -3.065  -25.993 1.00 35.90 ? 208 TYR B CE2 1 
ATOM   3361 C CZ  . TYR B 1 201 ? 22.173  -3.778  -24.830 1.00 33.70 ? 208 TYR B CZ  1 
ATOM   3362 O OH  . TYR B 1 201 ? 21.011  -3.779  -24.063 1.00 38.35 ? 208 TYR B OH  1 
ATOM   3363 N N   . THR B 1 202 ? 27.453  -5.094  -30.165 1.00 24.93 ? 209 THR B N   1 
ATOM   3364 C CA  . THR B 1 202 ? 28.162  -4.711  -31.432 1.00 24.98 ? 209 THR B CA  1 
ATOM   3365 C C   . THR B 1 202 ? 27.298  -4.800  -32.670 1.00 24.95 ? 209 THR B C   1 
ATOM   3366 O O   . THR B 1 202 ? 27.673  -4.347  -33.793 1.00 24.11 ? 209 THR B O   1 
ATOM   3367 C CB  . THR B 1 202 ? 29.436  -5.584  -31.635 1.00 27.62 ? 209 THR B CB  1 
ATOM   3368 O OG1 . THR B 1 202 ? 29.109  -6.992  -31.571 1.00 28.95 ? 209 THR B OG1 1 
ATOM   3369 C CG2 . THR B 1 202 ? 30.419  -5.255  -30.621 1.00 26.56 ? 209 THR B CG2 1 
ATOM   3370 N N   . ILE B 1 203 ? 26.164  -5.460  -32.523 1.00 24.99 ? 210 ILE B N   1 
ATOM   3371 C CA  . ILE B 1 203 ? 25.145  -5.542  -33.547 1.00 23.27 ? 210 ILE B CA  1 
ATOM   3372 C C   . ILE B 1 203 ? 23.833  -5.208  -32.838 1.00 25.14 ? 210 ILE B C   1 
ATOM   3373 O O   . ILE B 1 203 ? 23.431  -5.882  -31.892 1.00 26.37 ? 210 ILE B O   1 
ATOM   3374 C CB  . ILE B 1 203 ? 25.084  -6.926  -34.238 1.00 26.44 ? 210 ILE B CB  1 
ATOM   3375 C CG1 . ILE B 1 203 ? 26.522  -7.340  -34.680 1.00 29.59 ? 210 ILE B CG1 1 
ATOM   3376 C CG2 . ILE B 1 203 ? 24.051  -6.883  -35.384 1.00 26.80 ? 210 ILE B CG2 1 
ATOM   3377 C CD1 . ILE B 1 203 ? 26.848  -7.068  -36.131 1.00 36.18 ? 210 ILE B CD1 1 
ATOM   3378 N N   . VAL B 1 204 ? 23.231  -4.082  -33.232 1.00 25.21 ? 211 VAL B N   1 
ATOM   3379 C CA  . VAL B 1 204 ? 22.012  -3.569  -32.594 1.00 25.01 ? 211 VAL B CA  1 
ATOM   3380 C C   . VAL B 1 204 ? 20.995  -3.223  -33.644 1.00 25.18 ? 211 VAL B C   1 
ATOM   3381 O O   . VAL B 1 204 ? 21.358  -2.659  -34.709 1.00 23.45 ? 211 VAL B O   1 
ATOM   3382 C CB  . VAL B 1 204 ? 22.309  -2.337  -31.778 1.00 25.33 ? 211 VAL B CB  1 
ATOM   3383 C CG1 . VAL B 1 204 ? 21.076  -1.882  -31.075 1.00 28.14 ? 211 VAL B CG1 1 
ATOM   3384 C CG2 . VAL B 1 204 ? 23.402  -2.577  -30.795 1.00 25.78 ? 211 VAL B CG2 1 
ATOM   3385 N N   . GLU B 1 205 ? 19.727  -3.564  -33.379 1.00 25.07 ? 212 GLU B N   1 
ATOM   3386 C CA  . GLU B 1 205 ? 18.618  -3.158  -34.260 1.00 26.06 ? 212 GLU B CA  1 
ATOM   3387 C C   . GLU B 1 205 ? 17.699  -2.203  -33.509 1.00 24.61 ? 212 GLU B C   1 
ATOM   3388 O O   . GLU B 1 205 ? 17.490  -2.359  -32.318 1.00 24.52 ? 212 GLU B O   1 
ATOM   3389 C CB  . GLU B 1 205 ? 17.885  -4.360  -34.827 1.00 30.13 ? 212 GLU B CB  1 
ATOM   3390 C CG  . GLU B 1 205 ? 18.890  -5.268  -35.573 1.00 35.21 ? 212 GLU B CG  1 
ATOM   3391 C CD  . GLU B 1 205 ? 18.231  -6.288  -36.460 1.00 39.92 ? 212 GLU B CD  1 
ATOM   3392 O OE1 . GLU B 1 205 ? 17.007  -6.324  -36.513 1.00 41.92 ? 212 GLU B OE1 1 
ATOM   3393 O OE2 . GLU B 1 205 ? 18.951  -7.088  -37.080 1.00 49.23 ? 212 GLU B OE2 1 
ATOM   3394 N N   . GLN B 1 206 ? 17.246  -1.160  -34.207 1.00 22.47 ? 213 GLN B N   1 
ATOM   3395 C CA  . GLN B 1 206 ? 16.413  -0.106  -33.597 1.00 22.05 ? 213 GLN B CA  1 
ATOM   3396 C C   . GLN B 1 206 ? 15.218  0.072   -34.442 1.00 21.12 ? 213 GLN B C   1 
ATOM   3397 O O   . GLN B 1 206 ? 15.257  -0.095  -35.676 1.00 22.27 ? 213 GLN B O   1 
ATOM   3398 C CB  . GLN B 1 206 ? 17.150  1.286   -33.543 1.00 23.24 ? 213 GLN B CB  1 
ATOM   3399 C CG  . GLN B 1 206 ? 18.497  1.268   -32.946 1.00 26.29 ? 213 GLN B CG  1 
ATOM   3400 C CD  . GLN B 1 206 ? 19.007  2.601   -32.412 1.00 22.98 ? 213 GLN B CD  1 
ATOM   3401 O OE1 . GLN B 1 206 ? 19.839  2.620   -31.540 1.00 26.89 ? 213 GLN B OE1 1 
ATOM   3402 N NE2 . GLN B 1 206 ? 18.607  3.690   -33.035 1.00 22.69 ? 213 GLN B NE2 1 
ATOM   3403 N N   . TYR B 1 207 ? 14.149  0.603   -33.812 1.00 21.55 ? 214 TYR B N   1 
ATOM   3404 C CA  . TYR B 1 207 ? 12.939  0.891   -34.483 1.00 20.64 ? 214 TYR B CA  1 
ATOM   3405 C C   . TYR B 1 207 ? 12.430  2.229   -33.868 1.00 20.45 ? 214 TYR B C   1 
ATOM   3406 O O   . TYR B 1 207 ? 12.396  2.389   -32.654 1.00 20.99 ? 214 TYR B O   1 
ATOM   3407 C CB  . TYR B 1 207 ? 11.936  -0.214  -34.148 1.00 22.33 ? 214 TYR B CB  1 
ATOM   3408 C CG  . TYR B 1 207 ? 10.566  0.037   -34.502 1.00 22.70 ? 214 TYR B CG  1 
ATOM   3409 C CD1 . TYR B 1 207 ? 10.214  0.468   -35.771 1.00 22.88 ? 214 TYR B CD1 1 
ATOM   3410 C CD2 . TYR B 1 207 ? 9.548   -0.252  -33.600 1.00 24.94 ? 214 TYR B CD2 1 
ATOM   3411 C CE1 . TYR B 1 207 ? 8.901   0.710   -36.088 1.00 26.04 ? 214 TYR B CE1 1 
ATOM   3412 C CE2 . TYR B 1 207 ? 8.227   -0.055  -33.939 1.00 25.87 ? 214 TYR B CE2 1 
ATOM   3413 C CZ  . TYR B 1 207 ? 7.919   0.419   -35.198 1.00 25.12 ? 214 TYR B CZ  1 
ATOM   3414 O OH  . TYR B 1 207 ? 6.619   0.673   -35.521 1.00 32.32 ? 214 TYR B OH  1 
ATOM   3415 N N   . GLU B 1 208 ? 12.197  3.139   -34.756 1.00 22.51 ? 215 GLU B N   1 
ATOM   3416 C CA  . GLU B 1 208 ? 11.710  4.470   -34.357 1.00 25.21 ? 215 GLU B CA  1 
ATOM   3417 C C   . GLU B 1 208 ? 10.435  4.849   -35.067 1.00 24.24 ? 215 GLU B C   1 
ATOM   3418 O O   . GLU B 1 208 ? 10.226  4.581   -36.271 1.00 23.62 ? 215 GLU B O   1 
ATOM   3419 C CB  . GLU B 1 208 ? 12.818  5.553   -34.572 1.00 28.63 ? 215 GLU B CB  1 
ATOM   3420 C CG  . GLU B 1 208 ? 12.284  6.949   -34.136 1.00 35.06 ? 215 GLU B CG  1 
ATOM   3421 C CD  . GLU B 1 208 ? 13.290  8.130   -34.085 1.00 40.76 ? 215 GLU B CD  1 
ATOM   3422 O OE1 . GLU B 1 208 ? 14.144  8.209   -33.126 1.00 46.54 ? 215 GLU B OE1 1 
ATOM   3423 O OE2 . GLU B 1 208 ? 13.140  9.035   -34.946 1.00 52.91 ? 215 GLU B OE2 1 
ATOM   3424 N N   . ARG B 1 209 ? 9.578   5.518   -34.298 1.00 24.07 ? 216 ARG B N   1 
ATOM   3425 C CA  . ARG B 1 209 ? 8.360   6.058   -34.769 1.00 23.81 ? 216 ARG B CA  1 
ATOM   3426 C C   . ARG B 1 209 ? 8.341   7.541   -34.336 1.00 23.56 ? 216 ARG B C   1 
ATOM   3427 O O   . ARG B 1 209 ? 8.575   7.811   -33.173 1.00 22.66 ? 216 ARG B O   1 
ATOM   3428 C CB  . ARG B 1 209 ? 7.151   5.385   -34.122 1.00 26.54 ? 216 ARG B CB  1 
ATOM   3429 C CG  . ARG B 1 209 ? 7.048   3.867   -34.360 1.00 30.09 ? 216 ARG B CG  1 
ATOM   3430 C CD  . ARG B 1 209 ? 6.014   3.255   -33.429 1.00 31.28 ? 216 ARG B CD  1 
ATOM   3431 N NE  . ARG B 1 209 ? 6.725   2.665   -32.330 1.00 30.78 ? 216 ARG B NE  1 
ATOM   3432 C CZ  . ARG B 1 209 ? 6.174   2.014   -31.325 1.00 33.57 ? 216 ARG B CZ  1 
ATOM   3433 N NH1 . ARG B 1 209 ? 4.846   1.907   -31.229 1.00 34.77 ? 216 ARG B NH1 1 
ATOM   3434 N NH2 . ARG B 1 209 ? 6.989   1.533   -30.391 1.00 33.02 ? 216 ARG B NH2 1 
ATOM   3435 N N   . ALA B 1 210 ? 8.013   8.376   -35.266 1.00 22.43 ? 217 ALA B N   1 
ATOM   3436 C CA  . ALA B 1 210 ? 7.960   9.885   -35.013 1.00 21.27 ? 217 ALA B CA  1 
ATOM   3437 C C   . ALA B 1 210 ? 6.863   10.549  -35.822 1.00 21.25 ? 217 ALA B C   1 
ATOM   3438 O O   . ALA B 1 210 ? 6.714   10.361  -36.997 1.00 20.13 ? 217 ALA B O   1 
ATOM   3439 C CB  . ALA B 1 210 ? 9.298   10.528  -35.345 1.00 21.18 ? 217 ALA B CB  1 
ATOM   3440 N N   . GLU B 1 211 ? 6.068   11.381  -35.170 1.00 22.28 ? 218 GLU B N   1 
ATOM   3441 C CA  . GLU B 1 211 ? 4.995   12.061  -35.840 1.00 22.73 ? 218 GLU B CA  1 
ATOM   3442 C C   . GLU B 1 211 ? 4.874   13.496  -35.302 1.00 22.94 ? 218 GLU B C   1 
ATOM   3443 O O   . GLU B 1 211 ? 4.858   13.687  -34.093 1.00 23.65 ? 218 GLU B O   1 
ATOM   3444 C CB  . GLU B 1 211 ? 3.662   11.354  -35.458 1.00 25.55 ? 218 GLU B CB  1 
ATOM   3445 C CG  . GLU B 1 211 ? 2.446   11.910  -36.201 1.00 29.47 ? 218 GLU B CG  1 
ATOM   3446 C CD  . GLU B 1 211 ? 1.144   11.143  -35.887 1.00 35.68 ? 218 GLU B CD  1 
ATOM   3447 O OE1 . GLU B 1 211 ? 1.209   10.131  -35.148 1.00 41.99 ? 218 GLU B OE1 1 
ATOM   3448 O OE2 . GLU B 1 211 ? 0.073   11.572  -36.402 1.00 37.91 ? 218 GLU B OE2 1 
ATOM   3449 N N   . GLY B 1 212 ? 4.758   14.398  -36.237 1.00 21.51 ? 219 GLY B N   1 
ATOM   3450 C CA  . GLY B 1 212 ? 4.480   15.850  -35.950 1.00 23.23 ? 219 GLY B CA  1 
ATOM   3451 C C   . GLY B 1 212 ? 3.050   16.039  -35.559 1.00 26.47 ? 219 GLY B C   1 
ATOM   3452 O O   . GLY B 1 212 ? 2.151   15.485  -36.242 1.00 26.06 ? 219 GLY B O   1 
ATOM   3453 N N   . ARG B 1 213 ? 2.815   16.778  -34.461 1.00 24.02 ? 220 ARG B N   1 
ATOM   3454 C CA  . ARG B 1 213 ? 1.446   17.102  -34.040 1.00 25.71 ? 220 ARG B CA  1 
ATOM   3455 C C   . ARG B 1 213 ? 1.372   18.631  -33.891 1.00 25.31 ? 220 ARG B C   1 
ATOM   3456 O O   . ARG B 1 213 ? 2.336   19.242  -33.494 1.00 23.52 ? 220 ARG B O   1 
ATOM   3457 C CB  . ARG B 1 213 ? 1.096   16.425  -32.723 1.00 28.55 ? 220 ARG B CB  1 
ATOM   3458 C CG  . ARG B 1 213 ? 1.185   14.875  -32.804 1.00 33.25 ? 220 ARG B CG  1 
ATOM   3459 C CD  . ARG B 1 213 ? 0.065   14.361  -33.679 1.00 37.29 ? 220 ARG B CD  1 
ATOM   3460 N NE  . ARG B 1 213 ? -0.161  12.912  -33.523 1.00 46.34 ? 220 ARG B NE  1 
ATOM   3461 C CZ  . ARG B 1 213 ? -0.953  12.345  -32.611 1.00 50.27 ? 220 ARG B CZ  1 
ATOM   3462 N NH1 . ARG B 1 213 ? -1.612  13.082  -31.727 1.00 53.39 ? 220 ARG B NH1 1 
ATOM   3463 N NH2 . ARG B 1 213 ? -1.082  11.015  -32.579 1.00 52.05 ? 220 ARG B NH2 1 
ATOM   3464 N N   . HIS B 1 214 ? 0.237   19.216  -34.245 1.00 26.67 ? 221 HIS B N   1 
ATOM   3465 C CA  . HIS B 1 214 ? -0.010  20.629  -33.937 1.00 27.28 ? 221 HIS B CA  1 
ATOM   3466 C C   . HIS B 1 214 ? 0.072   20.909  -32.463 1.00 26.84 ? 221 HIS B C   1 
ATOM   3467 O O   . HIS B 1 214 ? -0.306  20.124  -31.603 1.00 26.68 ? 221 HIS B O   1 
ATOM   3468 C CB  . HIS B 1 214 ? -1.366  21.149  -34.463 1.00 30.83 ? 221 HIS B CB  1 
ATOM   3469 C CG  . HIS B 1 214 ? -1.489  21.109  -35.945 1.00 32.07 ? 221 HIS B CG  1 
ATOM   3470 N ND1 . HIS B 1 214 ? -2.032  20.023  -36.598 1.00 39.55 ? 221 HIS B ND1 1 
ATOM   3471 C CD2 . HIS B 1 214 ? -1.089  21.969  -36.907 1.00 35.68 ? 221 HIS B CD2 1 
ATOM   3472 C CE1 . HIS B 1 214 ? -1.983  20.227  -37.903 1.00 36.84 ? 221 HIS B CE1 1 
ATOM   3473 N NE2 . HIS B 1 214 ? -1.405  21.397  -38.119 1.00 39.85 ? 221 HIS B NE2 1 
ATOM   3474 N N   . SER B 1 215 ? 0.623   22.073  -32.175 1.00 26.42 ? 222 SER B N   1 
ATOM   3475 C CA  . SER B 1 215 ? 0.722   22.620  -30.846 1.00 26.50 ? 222 SER B CA  1 
ATOM   3476 C C   . SER B 1 215 ? -0.393  23.706  -30.711 1.00 26.63 ? 222 SER B C   1 
ATOM   3477 O O   . SER B 1 215 ? -0.765  24.019  -29.603 1.00 27.69 ? 222 SER B O   1 
ATOM   3478 C CB  . SER B 1 215 ? 2.073   23.371  -30.694 1.00 29.66 ? 222 SER B CB  1 
ATOM   3479 O OG  . SER B 1 215 ? 3.105   22.459  -30.830 1.00 36.79 ? 222 SER B OG  1 
ATOM   3480 N N   . THR B 1 216 ? -0.892  24.268  -31.824 1.00 24.20 ? 223 THR B N   1 
ATOM   3481 C CA  . THR B 1 216 ? -2.039  25.186  -31.834 1.00 28.30 ? 223 THR B CA  1 
ATOM   3482 C C   . THR B 1 216 ? -3.036  24.747  -32.935 1.00 34.33 ? 223 THR B C   1 
ATOM   3483 O O   . THR B 1 216 ? -2.625  24.090  -33.894 1.00 34.36 ? 223 THR B O   1 
ATOM   3484 C CB  . THR B 1 216 ? -1.633  26.666  -32.139 1.00 25.31 ? 223 THR B CB  1 
ATOM   3485 O OG1 . THR B 1 216 ? -0.990  26.802  -33.420 1.00 25.92 ? 223 THR B OG1 1 
ATOM   3486 C CG2 . THR B 1 216 ? -0.705  27.159  -31.168 1.00 25.92 ? 223 THR B CG2 1 
ATOM   3487 N N   . GLY B 1 217 ? -4.285  25.202  -32.844 1.00 38.34 ? 224 GLY B N   1 
ATOM   3488 C CA  . GLY B 1 217 ? -5.362  24.809  -33.798 1.00 40.36 ? 224 GLY B CA  1 
ATOM   3489 C C   . GLY B 1 217 ? -5.343  23.345  -34.281 1.00 45.14 ? 224 GLY B C   1 
ATOM   3490 O O   . GLY B 1 217 ? -4.996  22.397  -33.538 1.00 43.83 ? 224 GLY B O   1 
ATOM   3491 N N   . ALA C 1 1   ? 12.062  -16.000 -75.695 1.00 62.72 ? 6   ALA C N   1 
ATOM   3492 C CA  . ALA C 1 1   ? 11.254  -15.778 -76.928 1.00 63.85 ? 6   ALA C CA  1 
ATOM   3493 C C   . ALA C 1 1   ? 9.795   -15.551 -76.558 1.00 62.07 ? 6   ALA C C   1 
ATOM   3494 O O   . ALA C 1 1   ? 9.169   -14.630 -77.066 1.00 65.80 ? 6   ALA C O   1 
ATOM   3495 C CB  . ALA C 1 1   ? 11.384  -16.953 -77.885 1.00 62.92 ? 6   ALA C CB  1 
ATOM   3496 N N   . ILE C 1 2   ? 9.246   -16.378 -75.676 1.00 55.98 ? 7   ILE C N   1 
ATOM   3497 C CA  . ILE C 1 2   ? 7.849   -16.178 -75.270 1.00 52.82 ? 7   ILE C CA  1 
ATOM   3498 C C   . ILE C 1 2   ? 7.785   -15.439 -73.919 1.00 48.25 ? 7   ILE C C   1 
ATOM   3499 O O   . ILE C 1 2   ? 6.820   -14.740 -73.654 1.00 48.16 ? 7   ILE C O   1 
ATOM   3500 C CB  . ILE C 1 2   ? 6.952   -17.477 -75.358 1.00 53.91 ? 7   ILE C CB  1 
ATOM   3501 C CG1 . ILE C 1 2   ? 7.765   -18.790 -75.261 1.00 51.16 ? 7   ILE C CG1 1 
ATOM   3502 C CG2 . ILE C 1 2   ? 6.165   -17.482 -76.675 1.00 55.92 ? 7   ILE C CG2 1 
ATOM   3503 C CD1 . ILE C 1 2   ? 7.066   -20.034 -75.807 1.00 51.15 ? 7   ILE C CD1 1 
ATOM   3504 N N   . ILE C 1 3   ? 8.807   -15.596 -73.083 1.00 45.00 ? 8   ILE C N   1 
ATOM   3505 C CA  . ILE C 1 3   ? 8.966   -14.769 -71.882 1.00 42.86 ? 8   ILE C CA  1 
ATOM   3506 C C   . ILE C 1 3   ? 10.136  -13.849 -72.203 1.00 43.11 ? 8   ILE C C   1 
ATOM   3507 O O   . ILE C 1 3   ? 11.293  -14.274 -72.302 1.00 44.01 ? 8   ILE C O   1 
ATOM   3508 C CB  . ILE C 1 3   ? 9.178   -15.594 -70.601 1.00 39.89 ? 8   ILE C CB  1 
ATOM   3509 C CG1 . ILE C 1 3   ? 7.965   -16.525 -70.436 1.00 39.33 ? 8   ILE C CG1 1 
ATOM   3510 C CG2 . ILE C 1 3   ? 9.446   -14.669 -69.393 1.00 38.94 ? 8   ILE C CG2 1 
ATOM   3511 C CD1 . ILE C 1 3   ? 7.831   -17.240 -69.113 1.00 39.09 ? 8   ILE C CD1 1 
ATOM   3512 N N   . LYS C 1 4   ? 9.780   -12.594 -72.389 1.00 39.46 ? 9   LYS C N   1 
ATOM   3513 C CA  . LYS C 1 4   ? 10.722  -11.515 -72.685 1.00 41.42 ? 9   LYS C CA  1 
ATOM   3514 C C   . LYS C 1 4   ? 11.444  -11.084 -71.452 1.00 40.12 ? 9   LYS C C   1 
ATOM   3515 O O   . LYS C 1 4   ? 11.119  -11.547 -70.348 1.00 38.21 ? 9   LYS C O   1 
ATOM   3516 C CB  . LYS C 1 4   ? 9.960   -10.302 -73.175 1.00 41.49 ? 9   LYS C CB  1 
ATOM   3517 C CG  . LYS C 1 4   ? 8.888   -10.609 -74.182 1.00 46.96 ? 9   LYS C CG  1 
ATOM   3518 C CD  . LYS C 1 4   ? 9.395   -11.468 -75.316 1.00 51.62 ? 9   LYS C CD  1 
ATOM   3519 C CE  . LYS C 1 4   ? 8.477   -11.325 -76.511 1.00 53.03 ? 9   LYS C CE  1 
ATOM   3520 N NZ  . LYS C 1 4   ? 8.662   -12.418 -77.488 1.00 56.13 ? 9   LYS C NZ  1 
ATOM   3521 N N   . GLU C 1 5   ? 12.397  -10.187 -71.639 1.00 41.01 ? 10  GLU C N   1 
ATOM   3522 C CA  . GLU C 1 5   ? 13.146  -9.616  -70.518 1.00 43.12 ? 10  GLU C CA  1 
ATOM   3523 C C   . GLU C 1 5   ? 12.331  -8.570  -69.763 1.00 42.54 ? 10  GLU C C   1 
ATOM   3524 O O   . GLU C 1 5   ? 12.667  -8.248  -68.630 1.00 39.97 ? 10  GLU C O   1 
ATOM   3525 C CB  . GLU C 1 5   ? 14.450  -8.996  -71.016 1.00 47.33 ? 10  GLU C CB  1 
ATOM   3526 C CG  . GLU C 1 5   ? 15.324  -9.997  -71.759 1.00 51.94 ? 10  GLU C CG  1 
ATOM   3527 C CD  . GLU C 1 5   ? 16.707  -9.459  -72.024 1.00 57.07 ? 10  GLU C CD  1 
ATOM   3528 O OE1 . GLU C 1 5   ? 17.220  -8.692  -71.152 1.00 57.46 ? 10  GLU C OE1 1 
ATOM   3529 O OE2 . GLU C 1 5   ? 17.269  -9.809  -73.095 1.00 58.97 ? 10  GLU C OE2 1 
ATOM   3530 N N   . PHE C 1 6   ? 11.308  -8.026  -70.424 1.00 40.33 ? 11  PHE C N   1 
ATOM   3531 C CA  . PHE C 1 6   ? 10.259  -7.214  -69.813 1.00 39.05 ? 11  PHE C CA  1 
ATOM   3532 C C   . PHE C 1 6   ? 8.903   -7.875  -70.084 1.00 38.07 ? 11  PHE C C   1 
ATOM   3533 O O   . PHE C 1 6   ? 8.565   -8.144  -71.216 1.00 35.36 ? 11  PHE C O   1 
ATOM   3534 C CB  . PHE C 1 6   ? 10.308  -5.773  -70.387 1.00 40.26 ? 11  PHE C CB  1 
ATOM   3535 C CG  . PHE C 1 6   ? 9.240   -4.842  -69.856 1.00 40.92 ? 11  PHE C CG  1 
ATOM   3536 C CD1 . PHE C 1 6   ? 9.299   -4.324  -68.559 1.00 42.10 ? 11  PHE C CD1 1 
ATOM   3537 C CD2 . PHE C 1 6   ? 8.180   -4.452  -70.676 1.00 43.35 ? 11  PHE C CD2 1 
ATOM   3538 C CE1 . PHE C 1 6   ? 8.316   -3.465  -68.097 1.00 40.13 ? 11  PHE C CE1 1 
ATOM   3539 C CE2 . PHE C 1 6   ? 7.209   -3.579  -70.214 1.00 43.45 ? 11  PHE C CE2 1 
ATOM   3540 C CZ  . PHE C 1 6   ? 7.267   -3.095  -68.924 1.00 41.21 ? 11  PHE C CZ  1 
ATOM   3541 N N   . MET C 1 7   ? 8.095   -8.067  -69.045 1.00 35.46 ? 12  MET C N   1 
ATOM   3542 C CA  . MET C 1 7   ? 6.750   -8.648  -69.171 1.00 35.43 ? 12  MET C CA  1 
ATOM   3543 C C   . MET C 1 7   ? 5.844   -7.904  -68.193 1.00 35.22 ? 12  MET C C   1 
ATOM   3544 O O   . MET C 1 7   ? 6.252   -7.647  -67.072 1.00 31.75 ? 12  MET C O   1 
ATOM   3545 C CB  . MET C 1 7   ? 6.756   -10.137 -68.788 1.00 37.99 ? 12  MET C CB  1 
ATOM   3546 C CG  . MET C 1 7   ? 7.548   -11.019 -69.746 1.00 39.34 ? 12  MET C CG  1 
ATOM   3547 S SD  . MET C 1 7   ? 6.718   -11.005 -71.360 1.00 43.63 ? 12  MET C SD  1 
ATOM   3548 C CE  . MET C 1 7   ? 5.442   -12.250 -71.147 1.00 41.09 ? 12  MET C CE  1 
ATOM   3549 N N   . ARG C 1 8   ? 4.650   -7.544  -68.656 1.00 36.06 ? 13  ARG C N   1 
ATOM   3550 C CA  . ARG C 1 8   ? 3.610   -6.932  -67.846 1.00 36.28 ? 13  ARG C CA  1 
ATOM   3551 C C   . ARG C 1 8   ? 2.640   -8.020  -67.460 1.00 34.36 ? 13  ARG C C   1 
ATOM   3552 O O   . ARG C 1 8   ? 2.677   -9.144  -68.009 1.00 36.49 ? 13  ARG C O   1 
ATOM   3553 C CB  . ARG C 1 8   ? 2.848   -5.870  -68.651 1.00 38.22 ? 13  ARG C CB  1 
ATOM   3554 C CG  . ARG C 1 8   ? 3.724   -4.765  -69.190 1.00 39.64 ? 13  ARG C CG  1 
ATOM   3555 C CD  . ARG C 1 8   ? 2.883   -3.754  -69.950 1.00 41.67 ? 13  ARG C CD  1 
ATOM   3556 N NE  . ARG C 1 8   ? 3.629   -2.520  -70.153 1.00 44.56 ? 13  ARG C NE  1 
ATOM   3557 C CZ  . ARG C 1 8   ? 3.891   -1.630  -69.192 1.00 46.98 ? 13  ARG C CZ  1 
ATOM   3558 N NH1 . ARG C 1 8   ? 3.448   -1.816  -67.951 1.00 44.88 ? 13  ARG C NH1 1 
ATOM   3559 N NH2 . ARG C 1 8   ? 4.586   -0.527  -69.480 1.00 46.93 ? 13  ARG C NH2 1 
ATOM   3560 N N   . PHE C 1 9   ? 1.778   -7.710  -66.511 1.00 35.16 ? 14  PHE C N   1 
ATOM   3561 C CA  . PHE C 1 9   ? 0.797   -8.704  -66.043 1.00 34.10 ? 14  PHE C CA  1 
ATOM   3562 C C   . PHE C 1 9   ? -0.477  -8.038  -65.535 1.00 33.04 ? 14  PHE C C   1 
ATOM   3563 O O   . PHE C 1 9   ? -0.446  -6.865  -65.197 1.00 32.55 ? 14  PHE C O   1 
ATOM   3564 C CB  . PHE C 1 9   ? 1.424   -9.712  -65.022 1.00 33.74 ? 14  PHE C CB  1 
ATOM   3565 C CG  . PHE C 1 9   ? 1.706   -9.178  -63.621 1.00 34.90 ? 14  PHE C CG  1 
ATOM   3566 C CD1 . PHE C 1 9   ? 0.674   -9.004  -62.707 1.00 34.89 ? 14  PHE C CD1 1 
ATOM   3567 C CD2 . PHE C 1 9   ? 3.025   -8.952  -63.195 1.00 33.55 ? 14  PHE C CD2 1 
ATOM   3568 C CE1 . PHE C 1 9   ? 0.947   -8.594  -61.391 1.00 34.04 ? 14  PHE C CE1 1 
ATOM   3569 C CE2 . PHE C 1 9   ? 3.295   -8.498  -61.904 1.00 35.60 ? 14  PHE C CE2 1 
ATOM   3570 C CZ  . PHE C 1 9   ? 2.248   -8.339  -61.002 1.00 34.13 ? 14  PHE C CZ  1 
ATOM   3571 N N   . LYS C 1 10  ? -1.588  -8.774  -65.569 1.00 32.58 ? 15  LYS C N   1 
ATOM   3572 C CA  . LYS C 1 10  ? -2.865  -8.348  -65.005 1.00 35.25 ? 15  LYS C CA  1 
ATOM   3573 C C   . LYS C 1 10  ? -3.377  -9.357  -63.992 1.00 32.16 ? 15  LYS C C   1 
ATOM   3574 O O   . LYS C 1 10  ? -3.290  -10.588 -64.188 1.00 30.60 ? 15  LYS C O   1 
ATOM   3575 C CB  . LYS C 1 10  ? -3.915  -8.127  -66.092 1.00 39.55 ? 15  LYS C CB  1 
ATOM   3576 C CG  . LYS C 1 10  ? -3.690  -6.802  -66.789 1.00 43.47 ? 15  LYS C CG  1 
ATOM   3577 C CD  . LYS C 1 10  ? -4.002  -6.891  -68.262 1.00 49.38 ? 15  LYS C CD  1 
ATOM   3578 C CE  . LYS C 1 10  ? -3.893  -5.507  -68.886 1.00 51.38 ? 15  LYS C CE  1 
ATOM   3579 N NZ  . LYS C 1 10  ? -3.884  -5.636  -70.355 1.00 52.40 ? 15  LYS C NZ  1 
ATOM   3580 N N   . VAL C 1 11  ? -3.965  -8.854  -62.917 1.00 31.51 ? 16  VAL C N   1 
ATOM   3581 C CA  . VAL C 1 11  ? -4.382  -9.757  -61.843 1.00 30.47 ? 16  VAL C CA  1 
ATOM   3582 C C   . VAL C 1 11  ? -5.743  -9.352  -61.343 1.00 30.59 ? 16  VAL C C   1 
ATOM   3583 O O   . VAL C 1 11  ? -6.048  -8.184  -61.243 1.00 30.97 ? 16  VAL C O   1 
ATOM   3584 C CB  . VAL C 1 11  ? -3.366  -9.849  -60.678 1.00 30.63 ? 16  VAL C CB  1 
ATOM   3585 C CG1 . VAL C 1 11  ? -3.099  -8.450  -60.054 1.00 29.76 ? 16  VAL C CG1 1 
ATOM   3586 C CG2 . VAL C 1 11  ? -3.842  -10.920 -59.657 1.00 30.14 ? 16  VAL C CG2 1 
ATOM   3587 N N   . HIS C 1 12  ? -6.567  -10.342 -61.074 1.00 30.88 ? 17  HIS C N   1 
ATOM   3588 C CA  . HIS C 1 12  ? -7.837  -10.158 -60.410 1.00 32.02 ? 17  HIS C CA  1 
ATOM   3589 C C   . HIS C 1 12  ? -7.911  -11.109 -59.228 1.00 30.07 ? 17  HIS C C   1 
ATOM   3590 O O   . HIS C 1 12  ? -7.628  -12.272 -59.391 1.00 29.88 ? 17  HIS C O   1 
ATOM   3591 C CB  . HIS C 1 12  ? -8.975  -10.501 -61.381 1.00 34.03 ? 17  HIS C CB  1 
ATOM   3592 C CG  . HIS C 1 12  ? -10.319 -10.337 -60.769 1.00 37.62 ? 17  HIS C CG  1 
ATOM   3593 N ND1 . HIS C 1 12  ? -11.083 -11.403 -60.357 1.00 43.33 ? 17  HIS C ND1 1 
ATOM   3594 C CD2 . HIS C 1 12  ? -11.020 -9.224  -60.451 1.00 39.66 ? 17  HIS C CD2 1 
ATOM   3595 C CE1 . HIS C 1 12  ? -12.220 -10.952 -59.853 1.00 44.83 ? 17  HIS C CE1 1 
ATOM   3596 N NE2 . HIS C 1 12  ? -12.203 -9.634  -59.893 1.00 39.73 ? 17  HIS C NE2 1 
ATOM   3597 N N   . MET C 1 13  ? -8.372  -10.624 -58.075 1.00 28.65 ? 18  MET C N   1 
ATOM   3598 C CA  . MET C 1 13  ? -8.542  -11.454 -56.883 1.00 28.75 ? 18  MET C CA  1 
ATOM   3599 C C   . MET C 1 13  ? -9.962  -11.334 -56.371 1.00 28.89 ? 18  MET C C   1 
ATOM   3600 O O   . MET C 1 13  ? -10.461 -10.212 -56.281 1.00 28.46 ? 18  MET C O   1 
ATOM   3601 C CB  . MET C 1 13  ? -7.630  -10.976 -55.747 1.00 29.31 ? 18  MET C CB  1 
ATOM   3602 C CG  . MET C 1 13  ? -7.861  -11.734 -54.442 1.00 28.14 ? 18  MET C CG  1 
ATOM   3603 S SD  . MET C 1 13  ? -6.974  -11.061 -53.009 1.00 28.49 ? 18  MET C SD  1 
ATOM   3604 C CE  . MET C 1 13  ? -5.353  -11.747 -53.467 1.00 31.92 ? 18  MET C CE  1 
ATOM   3605 N N   . GLU C 1 14  ? -10.578 -12.448 -55.982 1.00 25.99 ? 19  GLU C N   1 
ATOM   3606 C CA  . GLU C 1 14  ? -11.847 -12.470 -55.248 1.00 27.90 ? 19  GLU C CA  1 
ATOM   3607 C C   . GLU C 1 14  ? -11.590 -13.086 -53.920 1.00 27.83 ? 19  GLU C C   1 
ATOM   3608 O O   . GLU C 1 14  ? -10.955 -14.128 -53.810 1.00 29.45 ? 19  GLU C O   1 
ATOM   3609 C CB  . GLU C 1 14  ? -12.986 -13.266 -55.919 1.00 33.41 ? 19  GLU C CB  1 
ATOM   3610 C CG  . GLU C 1 14  ? -12.668 -14.061 -57.179 1.00 40.21 ? 19  GLU C CG  1 
ATOM   3611 C CD  . GLU C 1 14  ? -13.851 -14.938 -57.610 1.00 44.78 ? 19  GLU C CD  1 
ATOM   3612 O OE1 . GLU C 1 14  ? -13.613 -16.031 -58.180 1.00 47.58 ? 19  GLU C OE1 1 
ATOM   3613 O OE2 . GLU C 1 14  ? -15.020 -14.543 -57.344 1.00 49.96 ? 19  GLU C OE2 1 
ATOM   3614 N N   . GLY C 1 15  ? -12.066 -12.451 -52.867 1.00 27.30 ? 20  GLY C N   1 
ATOM   3615 C CA  . GLY C 1 15  ? -11.750 -12.969 -51.572 1.00 28.65 ? 20  GLY C CA  1 
ATOM   3616 C C   . GLY C 1 15  ? -12.737 -12.644 -50.514 1.00 27.46 ? 20  GLY C C   1 
ATOM   3617 O O   . GLY C 1 15  ? -13.642 -11.825 -50.728 1.00 25.66 ? 20  GLY C O   1 
ATOM   3618 N N   . SER C 1 16  ? -12.571 -13.347 -49.415 1.00 26.15 ? 21  SER C N   1 
ATOM   3619 C CA  . SER C 1 16  ? -13.216 -12.981 -48.186 1.00 26.94 ? 21  SER C CA  1 
ATOM   3620 C C   . SER C 1 16  ? -12.260 -13.203 -47.052 1.00 23.74 ? 21  SER C C   1 
ATOM   3621 O O   . SER C 1 16  ? -11.522 -14.208 -47.042 1.00 24.34 ? 21  SER C O   1 
ATOM   3622 C CB  . SER C 1 16  ? -14.525 -13.769 -48.019 1.00 29.66 ? 21  SER C CB  1 
ATOM   3623 O OG  . SER C 1 16  ? -14.274 -15.119 -48.020 1.00 38.77 ? 21  SER C OG  1 
ATOM   3624 N N   . VAL C 1 17  ? -12.346 -12.353 -46.042 1.00 22.71 ? 22  VAL C N   1 
ATOM   3625 C CA  . VAL C 1 17  ? -11.617 -12.502 -44.788 1.00 22.03 ? 22  VAL C CA  1 
ATOM   3626 C C   . VAL C 1 17  ? -12.542 -12.222 -43.645 1.00 23.28 ? 22  VAL C C   1 
ATOM   3627 O O   . VAL C 1 17  ? -13.089 -11.119 -43.551 1.00 23.59 ? 22  VAL C O   1 
ATOM   3628 C CB  . VAL C 1 17  ? -10.434 -11.496 -44.709 1.00 21.25 ? 22  VAL C CB  1 
ATOM   3629 C CG1 . VAL C 1 17  ? -9.757  -11.494 -43.341 1.00 22.78 ? 22  VAL C CG1 1 
ATOM   3630 C CG2 . VAL C 1 17  ? -9.443  -11.785 -45.817 1.00 22.99 ? 22  VAL C CG2 1 
ATOM   3631 N N   . ASN C 1 18  ? -12.693 -13.198 -42.754 1.00 22.76 ? 23  ASN C N   1 
ATOM   3632 C CA  . ASN C 1 18  ? -13.610 -13.151 -41.672 1.00 24.26 ? 23  ASN C CA  1 
ATOM   3633 C C   . ASN C 1 18  ? -15.008 -12.754 -42.157 1.00 27.38 ? 23  ASN C C   1 
ATOM   3634 O O   . ASN C 1 18  ? -15.773 -12.012 -41.498 1.00 26.62 ? 23  ASN C O   1 
ATOM   3635 C CB  . ASN C 1 18  ? -13.053 -12.267 -40.535 1.00 23.57 ? 23  ASN C CB  1 
ATOM   3636 C CG  . ASN C 1 18  ? -12.165 -13.016 -39.585 1.00 24.23 ? 23  ASN C CG  1 
ATOM   3637 O OD1 . ASN C 1 18  ? -11.567 -14.051 -39.913 1.00 25.12 ? 23  ASN C OD1 1 
ATOM   3638 N ND2 . ASN C 1 18  ? -12.091 -12.506 -38.360 1.00 25.27 ? 23  ASN C ND2 1 
ATOM   3639 N N   . GLY C 1 19  ? -15.361 -13.304 -43.308 1.00 26.25 ? 24  GLY C N   1 
ATOM   3640 C CA  . GLY C 1 19  ? -16.658 -13.037 -43.909 1.00 29.14 ? 24  GLY C CA  1 
ATOM   3641 C C   . GLY C 1 19  ? -16.767 -11.766 -44.731 1.00 29.75 ? 24  GLY C C   1 
ATOM   3642 O O   . GLY C 1 19  ? -17.769 -11.571 -45.393 1.00 29.93 ? 24  GLY C O   1 
ATOM   3643 N N   . HIS C 1 20  ? -15.732 -10.933 -44.729 1.00 27.07 ? 25  HIS C N   1 
ATOM   3644 C CA  . HIS C 1 20  ? -15.792 -9.659  -45.453 1.00 27.42 ? 25  HIS C CA  1 
ATOM   3645 C C   . HIS C 1 20  ? -15.366 -9.930  -46.888 1.00 26.20 ? 25  HIS C C   1 
ATOM   3646 O O   . HIS C 1 20  ? -14.201 -10.209 -47.162 1.00 25.00 ? 25  HIS C O   1 
ATOM   3647 C CB  . HIS C 1 20  ? -14.910 -8.599  -44.820 1.00 28.12 ? 25  HIS C CB  1 
ATOM   3648 C CG  . HIS C 1 20  ? -15.156 -7.231  -45.380 1.00 31.38 ? 25  HIS C CG  1 
ATOM   3649 N ND1 . HIS C 1 20  ? -14.574 -6.800  -46.552 1.00 32.36 ? 25  HIS C ND1 1 
ATOM   3650 C CD2 . HIS C 1 20  ? -15.978 -6.232  -44.972 1.00 28.94 ? 25  HIS C CD2 1 
ATOM   3651 C CE1 . HIS C 1 20  ? -14.999 -5.580  -46.831 1.00 29.21 ? 25  HIS C CE1 1 
ATOM   3652 N NE2 . HIS C 1 20  ? -15.864 -5.225  -45.905 1.00 32.51 ? 25  HIS C NE2 1 
ATOM   3653 N N   . GLU C 1 21  ? -16.312 -9.816  -47.792 1.00 26.86 ? 26  GLU C N   1 
ATOM   3654 C CA  . GLU C 1 21  ? -16.081 -10.129 -49.199 1.00 26.81 ? 26  GLU C CA  1 
ATOM   3655 C C   . GLU C 1 21  ? -15.568 -8.892  -49.919 1.00 28.20 ? 26  GLU C C   1 
ATOM   3656 O O   . GLU C 1 21  ? -15.988 -7.743  -49.629 1.00 29.39 ? 26  GLU C O   1 
ATOM   3657 C CB  . GLU C 1 21  ? -17.350 -10.687 -49.823 1.00 30.67 ? 26  GLU C CB  1 
ATOM   3658 C CG  . GLU C 1 21  ? -17.696 -12.100 -49.325 1.00 33.77 ? 26  GLU C CG  1 
ATOM   3659 C CD  . GLU C 1 21  ? -19.014 -12.658 -49.825 1.00 39.82 ? 26  GLU C CD  1 
ATOM   3660 O OE1 . GLU C 1 21  ? -19.599 -12.106 -50.783 1.00 43.64 ? 26  GLU C OE1 1 
ATOM   3661 O OE2 . GLU C 1 21  ? -19.465 -13.676 -49.255 1.00 43.16 ? 26  GLU C OE2 1 
ATOM   3662 N N   . PHE C 1 22  ? -14.699 -9.111  -50.912 1.00 25.54 ? 27  PHE C N   1 
ATOM   3663 C CA  . PHE C 1 22  ? -14.089 -8.059  -51.646 1.00 25.39 ? 27  PHE C CA  1 
ATOM   3664 C C   . PHE C 1 22  ? -13.503 -8.560  -52.957 1.00 25.46 ? 27  PHE C C   1 
ATOM   3665 O O   . PHE C 1 22  ? -13.347 -9.761  -53.154 1.00 27.85 ? 27  PHE C O   1 
ATOM   3666 C CB  . PHE C 1 22  ? -12.952 -7.419  -50.810 1.00 25.79 ? 27  PHE C CB  1 
ATOM   3667 C CG  . PHE C 1 22  ? -11.805 -8.359  -50.544 1.00 26.93 ? 27  PHE C CG  1 
ATOM   3668 C CD1 . PHE C 1 22  ? -11.846 -9.195  -49.445 1.00 27.48 ? 27  PHE C CD1 1 
ATOM   3669 C CD2 . PHE C 1 22  ? -10.716 -8.408  -51.388 1.00 28.22 ? 27  PHE C CD2 1 
ATOM   3670 C CE1 . PHE C 1 22  ? -10.817 -10.077 -49.205 1.00 28.23 ? 27  PHE C CE1 1 
ATOM   3671 C CE2 . PHE C 1 22  ? -9.665  -9.297  -51.155 1.00 30.60 ? 27  PHE C CE2 1 
ATOM   3672 C CZ  . PHE C 1 22  ? -9.732  -10.124 -50.057 1.00 27.66 ? 27  PHE C CZ  1 
ATOM   3673 N N   . GLU C 1 23  ? -13.202 -7.628  -53.841 1.00 27.08 ? 28  GLU C N   1 
ATOM   3674 C CA  . GLU C 1 23  ? -12.449 -7.874  -55.092 1.00 27.05 ? 28  GLU C CA  1 
ATOM   3675 C C   . GLU C 1 23  ? -11.323 -6.872  -55.315 1.00 28.49 ? 28  GLU C C   1 
ATOM   3676 O O   . GLU C 1 23  ? -11.437 -5.725  -54.936 1.00 26.13 ? 28  GLU C O   1 
ATOM   3677 C CB  . GLU C 1 23  ? -13.388 -7.842  -56.309 1.00 30.92 ? 28  GLU C CB  1 
ATOM   3678 C CG  . GLU C 1 23  ? -14.339 -9.029  -56.292 1.00 32.01 ? 28  GLU C CG  1 
ATOM   3679 C CD  . GLU C 1 23  ? -15.148 -9.189  -57.548 1.00 36.90 ? 28  GLU C CD  1 
ATOM   3680 O OE1 . GLU C 1 23  ? -16.136 -9.947  -57.458 1.00 38.55 ? 28  GLU C OE1 1 
ATOM   3681 O OE2 . GLU C 1 23  ? -14.802 -8.566  -58.584 1.00 37.64 ? 28  GLU C OE2 1 
ATOM   3682 N N   . ILE C 1 24  ? -10.217 -7.307  -55.936 1.00 26.40 ? 29  ILE C N   1 
ATOM   3683 C CA  . ILE C 1 24  ? -9.091  -6.433  -56.278 1.00 26.72 ? 29  ILE C CA  1 
ATOM   3684 C C   . ILE C 1 24  ? -8.765  -6.659  -57.747 1.00 27.87 ? 29  ILE C C   1 
ATOM   3685 O O   . ILE C 1 24  ? -8.839  -7.772  -58.187 1.00 28.75 ? 29  ILE C O   1 
ATOM   3686 C CB  . ILE C 1 24  ? -7.876  -6.780  -55.432 1.00 27.23 ? 29  ILE C CB  1 
ATOM   3687 C CG1 . ILE C 1 24  ? -8.171  -6.314  -53.993 1.00 28.73 ? 29  ILE C CG1 1 
ATOM   3688 C CG2 . ILE C 1 24  ? -6.594  -6.135  -55.905 1.00 26.98 ? 29  ILE C CG2 1 
ATOM   3689 C CD1 . ILE C 1 24  ? -7.210  -6.862  -52.957 1.00 29.32 ? 29  ILE C CD1 1 
ATOM   3690 N N   . GLU C 1 25  ? -8.423  -5.599  -58.459 1.00 29.11 ? 30  GLU C N   1 
ATOM   3691 C CA  . GLU C 1 25  ? -7.863  -5.706  -59.784 1.00 31.02 ? 30  GLU C CA  1 
ATOM   3692 C C   . GLU C 1 25  ? -6.527  -5.000  -59.796 1.00 30.26 ? 30  GLU C C   1 
ATOM   3693 O O   . GLU C 1 25  ? -6.376  -3.910  -59.256 1.00 28.93 ? 30  GLU C O   1 
ATOM   3694 C CB  . GLU C 1 25  ? -8.787  -5.041  -60.840 1.00 36.53 ? 30  GLU C CB  1 
ATOM   3695 C CG  . GLU C 1 25  ? -10.253 -5.464  -60.753 1.00 40.63 ? 30  GLU C CG  1 
ATOM   3696 C CD  . GLU C 1 25  ? -11.175 -4.824  -61.803 1.00 47.10 ? 30  GLU C CD  1 
ATOM   3697 O OE1 . GLU C 1 25  ? -12.375 -5.195  -61.847 1.00 51.21 ? 30  GLU C OE1 1 
ATOM   3698 O OE2 . GLU C 1 25  ? -10.737 -3.951  -62.579 1.00 55.03 ? 30  GLU C OE2 1 
ATOM   3699 N N   . GLY C 1 26  ? -5.533  -5.578  -60.449 1.00 29.40 ? 31  GLY C N   1 
ATOM   3700 C CA  . GLY C 1 26  ? -4.308  -4.832  -60.582 1.00 30.53 ? 31  GLY C CA  1 
ATOM   3701 C C   . GLY C 1 26  ? -3.552  -5.070  -61.842 1.00 30.59 ? 31  GLY C C   1 
ATOM   3702 O O   . GLY C 1 26  ? -3.926  -5.938  -62.653 1.00 31.04 ? 31  GLY C O   1 
ATOM   3703 N N   . GLU C 1 27  ? -2.498  -4.294  -61.992 1.00 30.77 ? 32  GLU C N   1 
ATOM   3704 C CA  . GLU C 1 27  ? -1.566  -4.453  -63.118 1.00 33.81 ? 32  GLU C CA  1 
ATOM   3705 C C   . GLU C 1 27  ? -0.150  -4.350  -62.617 1.00 32.21 ? 32  GLU C C   1 
ATOM   3706 O O   . GLU C 1 27  ? 0.117   -3.646  -61.669 1.00 34.84 ? 32  GLU C O   1 
ATOM   3707 C CB  . GLU C 1 27  ? -1.801  -3.336  -64.146 1.00 39.49 ? 32  GLU C CB  1 
ATOM   3708 C CG  . GLU C 1 27  ? -3.091  -3.469  -64.925 1.00 46.70 ? 32  GLU C CG  1 
ATOM   3709 C CD  . GLU C 1 27  ? -3.932  -2.211  -64.888 1.00 52.63 ? 32  GLU C CD  1 
ATOM   3710 O OE1 . GLU C 1 27  ? -3.683  -1.295  -65.706 1.00 52.91 ? 32  GLU C OE1 1 
ATOM   3711 O OE2 . GLU C 1 27  ? -4.842  -2.158  -64.010 1.00 59.86 ? 32  GLU C OE2 1 
ATOM   3712 N N   . GLY C 1 28  ? 0.771   -5.088  -63.222 1.00 31.18 ? 33  GLY C N   1 
ATOM   3713 C CA  . GLY C 1 28  ? 2.172   -4.949  -62.852 1.00 31.67 ? 33  GLY C CA  1 
ATOM   3714 C C   . GLY C 1 28  ? 3.093   -5.202  -64.018 1.00 33.88 ? 33  GLY C C   1 
ATOM   3715 O O   . GLY C 1 28  ? 2.653   -5.548  -65.078 1.00 34.01 ? 33  GLY C O   1 
ATOM   3716 N N   . GLU C 1 29  ? 4.380   -4.991  -63.793 1.00 37.62 ? 34  GLU C N   1 
ATOM   3717 C CA  . GLU C 1 29  ? 5.395   -5.275  -64.781 1.00 37.15 ? 34  GLU C CA  1 
ATOM   3718 C C   . GLU C 1 29  ? 6.666   -5.689  -64.071 1.00 37.32 ? 34  GLU C C   1 
ATOM   3719 O O   . GLU C 1 29  ? 6.814   -5.509  -62.853 1.00 34.64 ? 34  GLU C O   1 
ATOM   3720 C CB  . GLU C 1 29  ? 5.657   -4.042  -65.618 1.00 41.69 ? 34  GLU C CB  1 
ATOM   3721 C CG  . GLU C 1 29  ? 6.358   -2.920  -64.852 1.00 42.85 ? 34  GLU C CG  1 
ATOM   3722 C CD  . GLU C 1 29  ? 6.297   -1.598  -65.599 1.00 45.52 ? 34  GLU C CD  1 
ATOM   3723 O OE1 . GLU C 1 29  ? 5.169   -1.112  -65.846 1.00 51.01 ? 34  GLU C OE1 1 
ATOM   3724 O OE2 . GLU C 1 29  ? 7.366   -1.056  -65.962 1.00 50.92 ? 34  GLU C OE2 1 
ATOM   3725 N N   . GLY C 1 30  ? 7.585   -6.246  -64.838 1.00 34.38 ? 35  GLY C N   1 
ATOM   3726 C CA  . GLY C 1 30  ? 8.868   -6.642  -64.302 1.00 33.87 ? 35  GLY C CA  1 
ATOM   3727 C C   . GLY C 1 30  ? 9.823   -7.245  -65.309 1.00 36.08 ? 35  GLY C C   1 
ATOM   3728 O O   . GLY C 1 30  ? 9.543   -7.296  -66.510 1.00 35.62 ? 35  GLY C O   1 
ATOM   3729 N N   . ARG C 1 31  ? 10.935  -7.748  -64.793 1.00 36.53 ? 36  ARG C N   1 
ATOM   3730 C CA  . ARG C 1 31  ? 11.986  -8.321  -65.614 1.00 38.39 ? 36  ARG C CA  1 
ATOM   3731 C C   . ARG C 1 31  ? 12.232  -9.744  -65.146 1.00 36.91 ? 36  ARG C C   1 
ATOM   3732 O O   . ARG C 1 31  ? 12.961  -9.969  -64.185 1.00 38.92 ? 36  ARG C O   1 
ATOM   3733 C CB  . ARG C 1 31  ? 13.236  -7.431  -65.542 1.00 42.24 ? 36  ARG C CB  1 
ATOM   3734 C CG  . ARG C 1 31  ? 12.879  -5.968  -65.843 1.00 42.60 ? 36  ARG C CG  1 
ATOM   3735 C CD  . ARG C 1 31  ? 14.078  -5.109  -66.179 1.00 45.64 ? 36  ARG C CD  1 
ATOM   3736 N NE  . ARG C 1 31  ? 14.680  -5.599  -67.411 1.00 45.74 ? 36  ARG C NE  1 
ATOM   3737 C CZ  . ARG C 1 31  ? 14.411  -5.143  -68.633 1.00 45.14 ? 36  ARG C CZ  1 
ATOM   3738 N NH1 . ARG C 1 31  ? 15.016  -5.727  -69.641 1.00 45.77 ? 36  ARG C NH1 1 
ATOM   3739 N NH2 . ARG C 1 31  ? 13.534  -4.141  -68.860 1.00 44.53 ? 36  ARG C NH2 1 
ATOM   3740 N N   . PRO C 1 32  ? 11.569  -10.710 -65.781 1.00 35.73 ? 37  PRO C N   1 
ATOM   3741 C CA  . PRO C 1 32  ? 11.484  -12.061 -65.235 1.00 36.14 ? 37  PRO C CA  1 
ATOM   3742 C C   . PRO C 1 32  ? 12.836  -12.724 -64.966 1.00 34.93 ? 37  PRO C C   1 
ATOM   3743 O O   . PRO C 1 32  ? 12.966  -13.454 -63.973 1.00 35.87 ? 37  PRO C O   1 
ATOM   3744 C CB  . PRO C 1 32  ? 10.688  -12.826 -66.284 1.00 36.09 ? 37  PRO C CB  1 
ATOM   3745 C CG  . PRO C 1 32  ? 9.903   -11.755 -66.983 1.00 36.37 ? 37  PRO C CG  1 
ATOM   3746 C CD  . PRO C 1 32  ? 10.774  -10.557 -67.018 1.00 35.72 ? 37  PRO C CD  1 
ATOM   3747 N N   . TYR C 1 33  ? 13.841  -12.407 -65.792 1.00 36.14 ? 38  TYR C N   1 
ATOM   3748 C CA  . TYR C 1 33  ? 15.150  -13.002 -65.644 1.00 36.65 ? 38  TYR C CA  1 
ATOM   3749 C C   . TYR C 1 33  ? 16.015  -12.353 -64.573 1.00 38.56 ? 38  TYR C C   1 
ATOM   3750 O O   . TYR C 1 33  ? 17.057  -12.896 -64.194 1.00 40.64 ? 38  TYR C O   1 
ATOM   3751 C CB  . TYR C 1 33  ? 15.849  -13.012 -66.967 1.00 37.13 ? 38  TYR C CB  1 
ATOM   3752 C CG  . TYR C 1 33  ? 15.042  -13.795 -67.935 1.00 35.91 ? 38  TYR C CG  1 
ATOM   3753 C CD1 . TYR C 1 33  ? 15.173  -15.158 -68.023 1.00 35.95 ? 38  TYR C CD1 1 
ATOM   3754 C CD2 . TYR C 1 33  ? 14.124  -13.181 -68.733 1.00 36.94 ? 38  TYR C CD2 1 
ATOM   3755 C CE1 . TYR C 1 33  ? 14.437  -15.889 -68.919 1.00 37.57 ? 38  TYR C CE1 1 
ATOM   3756 C CE2 . TYR C 1 33  ? 13.363  -13.910 -69.611 1.00 36.92 ? 38  TYR C CE2 1 
ATOM   3757 C CZ  . TYR C 1 33  ? 13.534  -15.260 -69.702 1.00 37.73 ? 38  TYR C CZ  1 
ATOM   3758 O OH  . TYR C 1 33  ? 12.787  -15.967 -70.620 1.00 39.02 ? 38  TYR C OH  1 
ATOM   3759 N N   . GLU C 1 34  ? 15.561  -11.223 -64.066 1.00 36.63 ? 39  GLU C N   1 
ATOM   3760 C CA  . GLU C 1 34  ? 16.311  -10.459 -63.081 1.00 37.18 ? 39  GLU C CA  1 
ATOM   3761 C C   . GLU C 1 34  ? 15.637  -10.504 -61.740 1.00 35.46 ? 39  GLU C C   1 
ATOM   3762 O O   . GLU C 1 34  ? 16.195  -9.979  -60.774 1.00 35.33 ? 39  GLU C O   1 
ATOM   3763 C CB  . GLU C 1 34  ? 16.465  -9.011  -63.521 1.00 39.81 ? 39  GLU C CB  1 
ATOM   3764 C CG  . GLU C 1 34  ? 17.313  -8.880  -64.785 1.00 43.17 ? 39  GLU C CG  1 
ATOM   3765 C CD  . GLU C 1 34  ? 17.210  -7.532  -65.485 1.00 44.95 ? 39  GLU C CD  1 
ATOM   3766 O OE1 . GLU C 1 34  ? 16.659  -6.568  -64.920 1.00 44.61 ? 39  GLU C OE1 1 
ATOM   3767 O OE2 . GLU C 1 34  ? 17.686  -7.428  -66.641 1.00 51.49 ? 39  GLU C OE2 1 
ATOM   3768 N N   . GLY C 1 35  ? 14.440  -11.081 -61.697 1.00 31.51 ? 40  GLY C N   1 
ATOM   3769 C CA  . GLY C 1 35  ? 13.752  -11.341 -60.442 1.00 33.00 ? 40  GLY C CA  1 
ATOM   3770 C C   . GLY C 1 35  ? 13.105  -10.145 -59.803 1.00 31.71 ? 40  GLY C C   1 
ATOM   3771 O O   . GLY C 1 35  ? 12.897  -10.112 -58.568 1.00 30.42 ? 40  GLY C O   1 
ATOM   3772 N N   . THR C 1 36  ? 12.766  -9.139  -60.611 1.00 31.80 ? 41  THR C N   1 
ATOM   3773 C CA  . THR C 1 36  ? 12.231  -7.888  -60.044 1.00 34.07 ? 41  THR C CA  1 
ATOM   3774 C C   . THR C 1 36  ? 10.859  -7.578  -60.642 1.00 30.88 ? 41  THR C C   1 
ATOM   3775 O O   . THR C 1 36  ? 10.585  -7.876  -61.837 1.00 33.51 ? 41  THR C O   1 
ATOM   3776 C CB  . THR C 1 36  ? 13.219  -6.710  -60.227 1.00 36.56 ? 41  THR C CB  1 
ATOM   3777 O OG1 . THR C 1 36  ? 13.533  -6.576  -61.606 1.00 36.97 ? 41  THR C OG1 1 
ATOM   3778 C CG2 . THR C 1 36  ? 14.525  -6.958  -59.431 1.00 38.16 ? 41  THR C CG2 1 
ATOM   3779 N N   . GLN C 1 37  ? 9.940   -7.057  -59.804 1.00 28.71 ? 42  GLN C N   1 
ATOM   3780 C CA  . GLN C 1 37  ? 8.638   -6.658  -60.360 1.00 30.82 ? 42  GLN C CA  1 
ATOM   3781 C C   . GLN C 1 37  ? 7.934   -5.680  -59.513 1.00 31.56 ? 42  GLN C C   1 
ATOM   3782 O O   . GLN C 1 37  ? 8.201   -5.529  -58.301 1.00 32.89 ? 42  GLN C O   1 
ATOM   3783 C CB  . GLN C 1 37  ? 7.682   -7.866  -60.592 1.00 30.97 ? 42  GLN C CB  1 
ATOM   3784 C CG  . GLN C 1 37  ? 7.382   -8.619  -59.302 1.00 32.54 ? 42  GLN C CG  1 
ATOM   3785 C CD  . GLN C 1 37  ? 6.501   -9.868  -59.441 1.00 37.65 ? 42  GLN C CD  1 
ATOM   3786 O OE1 . GLN C 1 37  ? 5.359   -9.842  -59.964 1.00 40.91 ? 42  GLN C OE1 1 
ATOM   3787 N NE2 . GLN C 1 37  ? 7.022   -10.969 -58.929 1.00 37.40 ? 42  GLN C NE2 1 
ATOM   3788 N N   . THR C 1 38  ? 6.984   -5.030  -60.142 1.00 30.52 ? 43  THR C N   1 
ATOM   3789 C CA  . THR C 1 38  ? 6.147   -4.093  -59.388 1.00 32.65 ? 43  THR C CA  1 
ATOM   3790 C C   . THR C 1 38  ? 4.721   -4.334  -59.755 1.00 29.54 ? 43  THR C C   1 
ATOM   3791 O O   . THR C 1 38  ? 4.425   -4.840  -60.844 1.00 33.83 ? 43  THR C O   1 
ATOM   3792 C CB  . THR C 1 38  ? 6.518   -2.628  -59.669 1.00 35.11 ? 43  THR C CB  1 
ATOM   3793 O OG1 . THR C 1 38  ? 6.383   -2.362  -61.075 1.00 34.58 ? 43  THR C OG1 1 
ATOM   3794 C CG2 . THR C 1 38  ? 7.964   -2.326  -59.214 1.00 35.62 ? 43  THR C CG2 1 
ATOM   3795 N N   . ALA C 1 39  ? 3.834   -3.955  -58.849 1.00 32.08 ? 44  ALA C N   1 
ATOM   3796 C CA  . ALA C 1 39  ? 2.423   -3.992  -59.152 1.00 31.12 ? 44  ALA C CA  1 
ATOM   3797 C C   . ALA C 1 39  ? 1.650   -2.893  -58.452 1.00 32.26 ? 44  ALA C C   1 
ATOM   3798 O O   . ALA C 1 39  ? 2.080   -2.379  -57.439 1.00 29.74 ? 44  ALA C O   1 
ATOM   3799 C CB  . ALA C 1 39  ? 1.852   -5.336  -58.801 1.00 33.60 ? 44  ALA C CB  1 
ATOM   3800 N N   . LYS C 1 40  ? 0.532   -2.529  -59.084 1.00 32.02 ? 45  LYS C N   1 
ATOM   3801 C CA  . LYS C 1 40  ? -0.408  -1.533  -58.628 1.00 31.97 ? 45  LYS C CA  1 
ATOM   3802 C C   . LYS C 1 40  ? -1.761  -2.215  -58.471 1.00 28.23 ? 45  LYS C C   1 
ATOM   3803 O O   . LYS C 1 40  ? -2.375  -2.698  -59.416 1.00 30.47 ? 45  LYS C O   1 
ATOM   3804 C CB  . LYS C 1 40  ? -0.480  -0.357  -59.632 1.00 36.92 ? 45  LYS C CB  1 
ATOM   3805 C CG  . LYS C 1 40  ? 0.785   0.493   -59.656 1.00 40.07 ? 45  LYS C CG  1 
ATOM   3806 C CD  . LYS C 1 40  ? 1.191   1.108   -60.996 1.00 44.83 ? 45  LYS C CD  1 
ATOM   3807 C CE  . LYS C 1 40  ? 2.657   1.542   -60.883 1.00 47.30 ? 45  LYS C CE  1 
ATOM   3808 N NZ  . LYS C 1 40  ? 3.105   2.458   -61.971 1.00 50.39 ? 45  LYS C NZ  1 
ATOM   3809 N N   . LEU C 1 41  ? -2.233  -2.301  -57.249 1.00 28.37 ? 46  LEU C N   1 
ATOM   3810 C CA  . LEU C 1 41  ? -3.506  -2.970  -57.003 1.00 27.77 ? 46  LEU C CA  1 
ATOM   3811 C C   . LEU C 1 41  ? -4.598  -1.952  -56.576 1.00 29.03 ? 46  LEU C C   1 
ATOM   3812 O O   . LEU C 1 41  ? -4.269  -0.947  -55.945 1.00 28.16 ? 46  LEU C O   1 
ATOM   3813 C CB  . LEU C 1 41  ? -3.355  -3.983  -55.871 1.00 26.63 ? 46  LEU C CB  1 
ATOM   3814 C CG  . LEU C 1 41  ? -2.344  -5.116  -55.944 1.00 26.64 ? 46  LEU C CG  1 
ATOM   3815 C CD1 . LEU C 1 41  ? -2.374  -5.789  -57.345 1.00 28.05 ? 46  LEU C CD1 1 
ATOM   3816 C CD2 . LEU C 1 41  ? -0.918  -4.722  -55.571 1.00 26.53 ? 46  LEU C CD2 1 
ATOM   3817 N N   . LYS C 1 42  ? -5.860  -2.247  -56.906 1.00 28.85 ? 47  LYS C N   1 
ATOM   3818 C CA  . LYS C 1 42  ? -7.048  -1.433  -56.505 1.00 30.01 ? 47  LYS C CA  1 
ATOM   3819 C C   . LYS C 1 42  ? -8.158  -2.324  -55.988 1.00 29.77 ? 47  LYS C C   1 
ATOM   3820 O O   . LYS C 1 42  ? -8.550  -3.302  -56.627 1.00 28.94 ? 47  LYS C O   1 
ATOM   3821 C CB  . LYS C 1 42  ? -7.674  -0.702  -57.699 1.00 32.74 ? 47  LYS C CB  1 
ATOM   3822 C CG  . LYS C 1 42  ? -6.771  0.294   -58.351 1.00 36.22 ? 47  LYS C CG  1 
ATOM   3823 C CD  . LYS C 1 42  ? -7.594  1.101   -59.362 1.00 39.13 ? 47  LYS C CD  1 
ATOM   3824 C CE  . LYS C 1 42  ? -6.937  2.435   -59.661 1.00 44.73 ? 47  LYS C CE  1 
ATOM   3825 N NZ  . LYS C 1 42  ? -5.507  2.218   -60.040 1.00 46.84 ? 47  LYS C NZ  1 
ATOM   3826 N N   . VAL C 1 43  ? -8.667  -1.980  -54.812 1.00 28.68 ? 48  VAL C N   1 
ATOM   3827 C CA  . VAL C 1 43  ? -9.843  -2.630  -54.273 1.00 28.02 ? 48  VAL C CA  1 
ATOM   3828 C C   . VAL C 1 43  ? -11.031 -2.138  -55.104 1.00 30.72 ? 48  VAL C C   1 
ATOM   3829 O O   . VAL C 1 43  ? -11.345 -0.920  -55.091 1.00 29.36 ? 48  VAL C O   1 
ATOM   3830 C CB  . VAL C 1 43  ? -9.996  -2.244  -52.794 1.00 26.59 ? 48  VAL C CB  1 
ATOM   3831 C CG1 . VAL C 1 43  ? -11.189 -2.938  -52.203 1.00 26.91 ? 48  VAL C CG1 1 
ATOM   3832 C CG2 . VAL C 1 43  ? -8.727  -2.649  -52.073 1.00 26.72 ? 48  VAL C CG2 1 
ATOM   3833 N N   . THR C 1 44  ? -11.631 -3.038  -55.889 1.00 28.25 ? 49  THR C N   1 
ATOM   3834 C CA  . THR C 1 44  ? -12.761 -2.643  -56.730 1.00 31.29 ? 49  THR C CA  1 
ATOM   3835 C C   . THR C 1 44  ? -14.140 -2.959  -56.143 1.00 32.90 ? 49  THR C C   1 
ATOM   3836 O O   . THR C 1 44  ? -15.136 -2.335  -56.521 1.00 38.32 ? 49  THR C O   1 
ATOM   3837 C CB  . THR C 1 44  ? -12.610 -3.292  -58.108 1.00 31.09 ? 49  THR C CB  1 
ATOM   3838 O OG1 . THR C 1 44  ? -12.384 -4.709  -57.937 1.00 28.82 ? 49  THR C OG1 1 
ATOM   3839 C CG2 . THR C 1 44  ? -11.419 -2.714  -58.744 1.00 32.42 ? 49  THR C CG2 1 
ATOM   3840 N N   . LYS C 1 45  ? -14.239 -3.942  -55.276 1.00 33.28 ? 50  LYS C N   1 
ATOM   3841 C CA  . LYS C 1 45  ? -15.450 -4.174  -54.477 1.00 31.82 ? 50  LYS C CA  1 
ATOM   3842 C C   . LYS C 1 45  ? -15.075 -4.357  -53.018 1.00 32.10 ? 50  LYS C C   1 
ATOM   3843 O O   . LYS C 1 45  ? -14.027 -4.885  -52.747 1.00 31.73 ? 50  LYS C O   1 
ATOM   3844 C CB  . LYS C 1 45  ? -16.150 -5.429  -54.964 1.00 35.54 ? 50  LYS C CB  1 
ATOM   3845 C CG  . LYS C 1 45  ? -16.503 -5.328  -56.446 1.00 38.87 ? 50  LYS C CG  1 
ATOM   3846 C CD  . LYS C 1 45  ? -17.564 -6.352  -56.829 1.00 43.62 ? 50  LYS C CD  1 
ATOM   3847 C CE  . LYS C 1 45  ? -18.235 -6.000  -58.147 1.00 46.96 ? 50  LYS C CE  1 
ATOM   3848 N NZ  . LYS C 1 45  ? -19.429 -6.879  -58.320 1.00 51.17 ? 50  LYS C NZ  1 
ATOM   3849 N N   . GLY C 1 46  ? -15.944 -3.959  -52.096 1.00 34.76 ? 51  GLY C N   1 
ATOM   3850 C CA  . GLY C 1 46  ? -15.760 -4.250  -50.668 1.00 32.81 ? 51  GLY C CA  1 
ATOM   3851 C C   . GLY C 1 46  ? -14.794 -3.309  -49.949 1.00 31.88 ? 51  GLY C C   1 
ATOM   3852 O O   . GLY C 1 46  ? -14.414 -3.569  -48.803 1.00 30.30 ? 51  GLY C O   1 
ATOM   3853 N N   . GLY C 1 47  ? -14.350 -2.230  -50.601 1.00 30.65 ? 52  GLY C N   1 
ATOM   3854 C CA  . GLY C 1 47  ? -13.440 -1.273  -49.944 1.00 31.00 ? 52  GLY C CA  1 
ATOM   3855 C C   . GLY C 1 47  ? -14.215 -0.290  -49.048 1.00 32.09 ? 52  GLY C C   1 
ATOM   3856 O O   . GLY C 1 47  ? -15.376 -0.029  -49.298 1.00 34.28 ? 52  GLY C O   1 
ATOM   3857 N N   . PRO C 1 48  ? -13.600 0.249   -48.013 1.00 30.38 ? 53  PRO C N   1 
ATOM   3858 C CA  . PRO C 1 48  ? -12.260 -0.094  -47.572 1.00 30.35 ? 53  PRO C CA  1 
ATOM   3859 C C   . PRO C 1 48  ? -12.231 -1.416  -46.780 1.00 27.79 ? 53  PRO C C   1 
ATOM   3860 O O   . PRO C 1 48  ? -13.222 -1.805  -46.156 1.00 27.29 ? 53  PRO C O   1 
ATOM   3861 C CB  . PRO C 1 48  ? -11.898 1.068   -46.647 1.00 32.28 ? 53  PRO C CB  1 
ATOM   3862 C CG  . PRO C 1 48  ? -13.206 1.487   -46.061 1.00 31.97 ? 53  PRO C CG  1 
ATOM   3863 C CD  . PRO C 1 48  ? -14.226 1.280   -47.149 1.00 32.12 ? 53  PRO C CD  1 
ATOM   3864 N N   . LEU C 1 49  ? -11.073 -2.081  -46.808 1.00 27.48 ? 54  LEU C N   1 
ATOM   3865 C CA  . LEU C 1 49  ? -10.925 -3.369  -46.164 1.00 25.58 ? 54  LEU C CA  1 
ATOM   3866 C C   . LEU C 1 49  ? -10.687 -3.214  -44.679 1.00 23.73 ? 54  LEU C C   1 
ATOM   3867 O O   . LEU C 1 49  ? -9.749  -2.529  -44.278 1.00 24.62 ? 54  LEU C O   1 
ATOM   3868 C CB  . LEU C 1 49  ? -9.790  -4.130  -46.788 1.00 27.21 ? 54  LEU C CB  1 
ATOM   3869 C CG  . LEU C 1 49  ? -9.979  -4.352  -48.286 1.00 28.29 ? 54  LEU C CG  1 
ATOM   3870 C CD1 . LEU C 1 49  ? -8.783  -5.105  -48.787 1.00 31.36 ? 54  LEU C CD1 1 
ATOM   3871 C CD2 . LEU C 1 49  ? -11.313 -5.021  -48.637 1.00 28.14 ? 54  LEU C CD2 1 
ATOM   3872 N N   . PRO C 1 50  ? -11.493 -3.904  -43.868 1.00 25.00 ? 55  PRO C N   1 
ATOM   3873 C CA  . PRO C 1 50  ? -11.300 -3.719  -42.424 1.00 26.07 ? 55  PRO C CA  1 
ATOM   3874 C C   . PRO C 1 50  ? -10.306 -4.724  -41.833 1.00 27.27 ? 55  PRO C C   1 
ATOM   3875 O O   . PRO C 1 50  ? -10.556 -5.324  -40.746 1.00 29.28 ? 55  PRO C O   1 
ATOM   3876 C CB  . PRO C 1 50  ? -12.708 -3.952  -41.890 1.00 27.81 ? 55  PRO C CB  1 
ATOM   3877 C CG  . PRO C 1 50  ? -13.171 -5.092  -42.736 1.00 27.79 ? 55  PRO C CG  1 
ATOM   3878 C CD  . PRO C 1 50  ? -12.627 -4.803  -44.131 1.00 25.85 ? 55  PRO C CD  1 
ATOM   3879 N N   . PHE C 1 51  ? -9.169  -4.900  -42.480 1.00 27.24 ? 56  PHE C N   1 
ATOM   3880 C CA  . PHE C 1 51  ? -8.118  -5.823  -41.973 1.00 25.60 ? 56  PHE C CA  1 
ATOM   3881 C C   . PHE C 1 51  ? -6.831  -5.463  -42.663 1.00 28.01 ? 56  PHE C C   1 
ATOM   3882 O O   . PHE C 1 51  ? -6.820  -4.682  -43.666 1.00 26.72 ? 56  PHE C O   1 
ATOM   3883 C CB  . PHE C 1 51  ? -8.511  -7.287  -42.226 1.00 24.20 ? 56  PHE C CB  1 
ATOM   3884 C CG  . PHE C 1 51  ? -8.763  -7.596  -43.683 1.00 23.23 ? 56  PHE C CG  1 
ATOM   3885 C CD1 . PHE C 1 51  ? -7.734  -7.834  -44.536 1.00 24.00 ? 56  PHE C CD1 1 
ATOM   3886 C CD2 . PHE C 1 51  ? -10.046 -7.696  -44.147 1.00 22.93 ? 56  PHE C CD2 1 
ATOM   3887 C CE1 . PHE C 1 51  ? -7.969  -8.081  -45.878 1.00 22.96 ? 56  PHE C CE1 1 
ATOM   3888 C CE2 . PHE C 1 51  ? -10.284 -7.948  -45.483 1.00 23.10 ? 56  PHE C CE2 1 
ATOM   3889 C CZ  . PHE C 1 51  ? -9.261  -8.158  -46.314 1.00 24.12 ? 56  PHE C CZ  1 
ATOM   3890 N N   . ALA C 1 52  ? -5.731  -6.014  -42.142 1.00 26.77 ? 57  ALA C N   1 
ATOM   3891 C CA  . ALA C 1 52  ? -4.398  -5.676  -42.653 1.00 27.44 ? 57  ALA C CA  1 
ATOM   3892 C C   . ALA C 1 52  ? -4.199  -6.040  -44.109 1.00 27.91 ? 57  ALA C C   1 
ATOM   3893 O O   . ALA C 1 52  ? -4.390  -7.185  -44.469 1.00 28.81 ? 57  ALA C O   1 
ATOM   3894 C CB  . ALA C 1 52  ? -3.344  -6.406  -41.838 1.00 27.88 ? 57  ALA C CB  1 
ATOM   3895 N N   . TRP C 1 53  ? -3.678  -5.110  -44.909 1.00 25.06 ? 58  TRP C N   1 
ATOM   3896 C CA  . TRP C 1 53  ? -3.323  -5.420  -46.322 1.00 23.83 ? 58  TRP C CA  1 
ATOM   3897 C C   . TRP C 1 53  ? -2.254  -6.517  -46.468 1.00 23.85 ? 58  TRP C C   1 
ATOM   3898 O O   . TRP C 1 53  ? -2.218  -7.274  -47.467 1.00 25.68 ? 58  TRP C O   1 
ATOM   3899 C CB  . TRP C 1 53  ? -2.763  -4.162  -46.998 1.00 23.81 ? 58  TRP C CB  1 
ATOM   3900 C CG  . TRP C 1 53  ? -2.306  -4.435  -48.417 1.00 22.69 ? 58  TRP C CG  1 
ATOM   3901 C CD1 . TRP C 1 53  ? -1.018  -4.693  -48.851 1.00 24.69 ? 58  TRP C CD1 1 
ATOM   3902 C CD2 . TRP C 1 53  ? -3.132  -4.514  -49.585 1.00 24.27 ? 58  TRP C CD2 1 
ATOM   3903 N NE1 . TRP C 1 53  ? -1.021  -4.918  -50.212 1.00 23.85 ? 58  TRP C NE1 1 
ATOM   3904 C CE2 . TRP C 1 53  ? -2.302  -4.798  -50.665 1.00 23.86 ? 58  TRP C CE2 1 
ATOM   3905 C CE3 . TRP C 1 53  ? -4.490  -4.329  -49.810 1.00 26.40 ? 58  TRP C CE3 1 
ATOM   3906 C CZ2 . TRP C 1 53  ? -2.795  -4.953  -51.951 1.00 26.35 ? 58  TRP C CZ2 1 
ATOM   3907 C CZ3 . TRP C 1 53  ? -4.974  -4.483  -51.066 1.00 29.49 ? 58  TRP C CZ3 1 
ATOM   3908 C CH2 . TRP C 1 53  ? -4.126  -4.806  -52.126 1.00 26.40 ? 58  TRP C CH2 1 
ATOM   3909 N N   . ASP C 1 54  ? -1.406  -6.666  -45.458 1.00 22.79 ? 59  ASP C N   1 
ATOM   3910 C CA  . ASP C 1 54  ? -0.275  -7.576  -45.591 1.00 25.20 ? 59  ASP C CA  1 
ATOM   3911 C C   . ASP C 1 54  ? -0.705  -9.022  -45.877 1.00 24.81 ? 59  ASP C C   1 
ATOM   3912 O O   . ASP C 1 54  ? -0.004  -9.778  -46.571 1.00 27.98 ? 59  ASP C O   1 
ATOM   3913 C CB  . ASP C 1 54  ? 0.605   -7.518  -44.314 1.00 24.79 ? 59  ASP C CB  1 
ATOM   3914 C CG  . ASP C 1 54  ? 1.368   -6.222  -44.223 1.00 27.66 ? 59  ASP C CG  1 
ATOM   3915 O OD1 . ASP C 1 54  ? 1.844   -5.685  -45.292 1.00 26.03 ? 59  ASP C OD1 1 
ATOM   3916 O OD2 . ASP C 1 54  ? 1.464   -5.753  -43.084 1.00 30.01 ? 59  ASP C OD2 1 
ATOM   3917 N N   . ILE C 1 55  ? -1.882  -9.404  -45.465 1.00 24.21 ? 60  ILE C N   1 
ATOM   3918 C CA  . ILE C 1 55  ? -2.191  -10.842 -45.664 1.00 26.77 ? 60  ILE C CA  1 
ATOM   3919 C C   . ILE C 1 55  ? -2.471  -11.067 -47.130 1.00 23.54 ? 60  ILE C C   1 
ATOM   3920 O O   . ILE C 1 55  ? -2.378  -12.168 -47.562 1.00 26.12 ? 60  ILE C O   1 
ATOM   3921 C CB  . ILE C 1 55  ? -3.284  -11.381 -44.784 1.00 27.60 ? 60  ILE C CB  1 
ATOM   3922 C CG1 . ILE C 1 55  ? -4.618  -10.697 -45.079 1.00 27.08 ? 60  ILE C CG1 1 
ATOM   3923 C CG2 . ILE C 1 55  ? -2.853  -11.292 -43.311 1.00 27.78 ? 60  ILE C CG2 1 
ATOM   3924 C CD1 . ILE C 1 55  ? -5.773  -11.384 -44.372 1.00 30.36 ? 60  ILE C CD1 1 
ATOM   3925 N N   . LEU C 1 56  ? -2.789  -10.020 -47.917 1.00 22.50 ? 61  LEU C N   1 
ATOM   3926 C CA  . LEU C 1 56  ? -3.090  -10.215 -49.365 1.00 23.81 ? 61  LEU C CA  1 
ATOM   3927 C C   . LEU C 1 56  ? -1.838  -10.017 -50.246 1.00 25.41 ? 61  LEU C C   1 
ATOM   3928 O O   . LEU C 1 56  ? -1.752  -10.480 -51.389 1.00 24.58 ? 61  LEU C O   1 
ATOM   3929 C CB  . LEU C 1 56  ? -4.110  -9.103  -49.812 1.00 23.73 ? 61  LEU C CB  1 
ATOM   3930 C CG  . LEU C 1 56  ? -5.390  -9.001  -48.948 1.00 24.60 ? 61  LEU C CG  1 
ATOM   3931 C CD1 . LEU C 1 56  ? -6.295  -7.901  -49.500 1.00 25.59 ? 61  LEU C CD1 1 
ATOM   3932 C CD2 . LEU C 1 56  ? -6.111  -10.336 -48.833 1.00 25.44 ? 61  LEU C CD2 1 
ATOM   3933 N N   . SER C 1 57  ? -0.868  -9.277  -49.707 1.00 25.83 ? 62  SER C N   1 
ATOM   3934 C CA  . SER C 1 57  ? 0.267   -8.804  -50.482 1.00 26.30 ? 62  SER C CA  1 
ATOM   3935 C C   . SER C 1 57  ? 1.033   -9.889  -51.241 1.00 26.66 ? 62  SER C C   1 
ATOM   3936 O O   . SER C 1 57  ? 1.340   -9.676  -52.415 1.00 25.10 ? 62  SER C O   1 
ATOM   3937 C CB  . SER C 1 57  ? 1.196   -7.839  -49.662 1.00 26.72 ? 62  SER C CB  1 
ATOM   3938 O OG  . SER C 1 57  ? 1.993   -8.572  -48.738 1.00 35.05 ? 62  SER C OG  1 
ATOM   3939 N N   . PRO C 1 58  ? 1.329   -11.060 -50.612 1.00 26.04 ? 63  PRO C N   1 
ATOM   3940 C CA  . PRO C 1 58  ? 2.063   -12.097 -51.351 1.00 27.90 ? 63  PRO C CA  1 
ATOM   3941 C C   . PRO C 1 58  ? 1.233   -12.892 -52.343 1.00 28.97 ? 63  PRO C C   1 
ATOM   3942 O O   . PRO C 1 58  ? 1.758   -13.817 -52.947 1.00 29.65 ? 63  PRO C O   1 
ATOM   3943 C CB  . PRO C 1 58  ? 2.583   -13.050 -50.269 1.00 29.53 ? 63  PRO C CB  1 
ATOM   3944 C CG  . PRO C 1 58  ? 1.976   -12.597 -49.009 1.00 28.66 ? 63  PRO C CG  1 
ATOM   3945 C CD  . PRO C 1 58  ? 1.023   -11.470 -49.239 1.00 27.84 ? 63  PRO C CD  1 
ATOM   3946 N N   . GLN C 1 59  ? -0.041  -12.576 -52.519 1.00 26.76 ? 64  GLN C N   1 
ATOM   3947 C CA  . GLN C 1 59  ? -0.816  -13.416 -53.441 1.00 28.49 ? 64  GLN C CA  1 
ATOM   3948 C C   . GLN C 1 59  ? -0.742  -12.905 -54.812 1.00 29.50 ? 64  GLN C C   1 
ATOM   3949 O O   . GLN C 1 59  ? -1.164  -13.599 -55.743 1.00 30.43 ? 64  GLN C O   1 
ATOM   3950 C CB  . GLN C 1 59  ? -2.293  -13.530 -53.044 1.00 28.61 ? 64  GLN C CB  1 
ATOM   3951 C CG  . GLN C 1 59  ? -2.540  -13.645 -51.556 1.00 25.61 ? 64  GLN C CG  1 
ATOM   3952 C CD  . GLN C 1 59  ? -1.755  -14.733 -50.809 1.00 26.54 ? 64  GLN C CD  1 
ATOM   3953 O OE1 . GLN C 1 59  ? -1.159  -15.641 -51.376 1.00 26.88 ? 64  GLN C OE1 1 
ATOM   3954 N NE2 . GLN C 1 59  ? -1.797  -14.625 -49.493 1.00 26.96 ? 64  GLN C NE2 1 
ATOM   3955 N N   . PHE C 1 60  ? -0.269  -11.666 -54.969 1.00 29.55 ? 65  PHE C N   1 
ATOM   3956 C CA  . PHE C 1 60  ? -0.234  -11.036 -56.303 1.00 33.52 ? 65  PHE C CA  1 
ATOM   3957 C C   . PHE C 1 60  ? 1.010   -11.431 -57.120 1.00 39.24 ? 65  PHE C C   1 
ATOM   3958 O O   . PHE C 1 60  ? 1.501   -10.647 -57.930 1.00 45.51 ? 65  PHE C O   1 
ATOM   3959 C CB  . PHE C 1 60  ? -0.396  -9.502  -56.158 1.00 31.00 ? 65  PHE C CB  1 
ATOM   3960 C CG  . PHE C 1 60  ? -1.672  -9.137  -55.495 1.00 31.35 ? 65  PHE C CG  1 
ATOM   3961 C CD1 . PHE C 1 60  ? -2.876  -9.382  -56.136 1.00 32.09 ? 65  PHE C CD1 1 
ATOM   3962 C CD2 . PHE C 1 60  ? -1.696  -8.696  -54.192 1.00 30.39 ? 65  PHE C CD2 1 
ATOM   3963 C CE1 . PHE C 1 60  ? -4.075  -9.085  -55.534 1.00 32.34 ? 65  PHE C CE1 1 
ATOM   3964 C CE2 . PHE C 1 60  ? -2.882  -8.407  -53.575 1.00 29.73 ? 65  PHE C CE2 1 
ATOM   3965 C CZ  . PHE C 1 60  ? -4.079  -8.601  -54.231 1.00 31.07 ? 65  PHE C CZ  1 
HETATM 3966 N N1  . CH6 C 1 61  ? 1.972   -11.833 -56.378 1.00 45.00 ? 66  CH6 C N1  1 
HETATM 3967 C CE  . CH6 C 1 61  ? 3.487   -7.590  -56.997 1.00 49.44 ? 66  CH6 C CE  1 
HETATM 3968 S SD  . CH6 C 1 61  ? 4.666   -7.999  -55.748 1.00 48.58 ? 66  CH6 C SD  1 
HETATM 3969 C CG1 . CH6 C 1 61  ? 4.690   -9.756  -55.987 1.00 50.95 ? 66  CH6 C CG1 1 
HETATM 3970 C CB1 . CH6 C 1 61  ? 3.659   -10.524 -55.135 1.00 50.46 ? 66  CH6 C CB1 1 
HETATM 3971 C CA1 . CH6 C 1 61  ? 3.336   -11.857 -55.855 1.00 48.57 ? 66  CH6 C CA1 1 
HETATM 3972 C C1  . CH6 C 1 61  ? 3.753   -13.055 -55.062 1.00 45.47 ? 66  CH6 C C1  1 
HETATM 3973 N N2  . CH6 C 1 61  ? 4.706   -13.012 -54.041 1.00 42.62 ? 66  CH6 C N2  1 
HETATM 3974 O OH  . CH6 C 1 61  ? 8.282   -12.343 -48.185 1.00 43.11 ? 66  CH6 C OH  1 
HETATM 3975 C CD2 . CH6 C 1 61  ? 7.006   -14.941 -50.468 1.00 43.70 ? 66  CH6 C CD2 1 
HETATM 3976 C CE2 . CH6 C 1 61  ? 7.651   -14.355 -49.384 1.00 46.92 ? 66  CH6 C CE2 1 
HETATM 3977 C CZ  . CH6 C 1 61  ? 7.634   -12.964 -49.222 1.00 46.88 ? 66  CH6 C CZ  1 
HETATM 3978 C CE1 . CH6 C 1 61  ? 6.957   -12.198 -50.151 1.00 47.20 ? 66  CH6 C CE1 1 
HETATM 3979 C CD1 . CH6 C 1 61  ? 6.298   -12.776 -51.244 1.00 44.92 ? 66  CH6 C CD1 1 
HETATM 3980 C CG2 . CH6 C 1 61  ? 6.322   -14.157 -51.397 1.00 44.30 ? 66  CH6 C CG2 1 
HETATM 3981 C CB2 . CH6 C 1 61  ? 5.681   -14.876 -52.521 1.00 44.83 ? 66  CH6 C CB2 1 
HETATM 3982 C CA2 . CH6 C 1 61  ? 4.883   -14.288 -53.632 1.00 42.54 ? 66  CH6 C CA2 1 
HETATM 3983 C C2  . CH6 C 1 61  ? 3.992   -15.084 -54.451 1.00 43.75 ? 66  CH6 C C2  1 
HETATM 3984 O O2  . CH6 C 1 61  ? 3.894   -16.352 -54.354 1.00 42.69 ? 66  CH6 C O2  1 
HETATM 3985 N N3  . CH6 C 1 61  ? 3.351   -14.353 -55.331 1.00 41.45 ? 66  CH6 C N3  1 
HETATM 3986 C CA3 . CH6 C 1 61  ? 2.345   -14.950 -56.219 1.00 42.57 ? 66  CH6 C CA3 1 
HETATM 3987 C C3  . CH6 C 1 61  ? 2.626   -14.933 -57.701 1.00 42.44 ? 66  CH6 C C3  1 
HETATM 3988 O O3  . CH6 C 1 61  ? 1.649   -14.981 -58.495 1.00 45.33 ? 66  CH6 C O3  1 
ATOM   3989 N N   . SER C 1 62  ? 3.678   -14.319 -58.040 1.00 41.94 ? 69  SER C N   1 
ATOM   3990 C CA  . SER C 1 62  ? 3.939   -14.027 -59.461 1.00 39.00 ? 69  SER C CA  1 
ATOM   3991 C C   . SER C 1 62  ? 5.270   -14.712 -59.725 1.00 41.04 ? 69  SER C C   1 
ATOM   3992 O O   . SER C 1 62  ? 6.307   -14.078 -59.890 1.00 36.82 ? 69  SER C O   1 
ATOM   3993 C CB  . SER C 1 62  ? 4.002   -12.513 -59.630 1.00 42.27 ? 69  SER C CB  1 
ATOM   3994 O OG  . SER C 1 62  ? 4.187   -12.125 -60.965 1.00 41.47 ? 69  SER C OG  1 
ATOM   3995 N N   . LYS C 1 63  ? 5.231   -16.047 -59.727 1.00 40.92 ? 70  LYS C N   1 
ATOM   3996 C CA  . LYS C 1 63  ? 6.467   -16.832 -59.706 1.00 41.01 ? 70  LYS C CA  1 
ATOM   3997 C C   . LYS C 1 63  ? 7.201   -16.857 -61.025 1.00 36.81 ? 70  LYS C C   1 
ATOM   3998 O O   . LYS C 1 63  ? 8.282   -17.394 -61.112 1.00 35.17 ? 70  LYS C O   1 
ATOM   3999 C CB  . LYS C 1 63  ? 6.186   -18.268 -59.240 1.00 46.18 ? 70  LYS C CB  1 
ATOM   4000 C CG  . LYS C 1 63  ? 5.597   -18.335 -57.841 1.00 48.15 ? 70  LYS C CG  1 
ATOM   4001 C CD  . LYS C 1 63  ? 6.467   -17.645 -56.810 1.00 47.79 ? 70  LYS C CD  1 
ATOM   4002 C CE  . LYS C 1 63  ? 6.343   -18.355 -55.462 1.00 49.72 ? 70  LYS C CE  1 
ATOM   4003 N NZ  . LYS C 1 63  ? 7.181   -17.792 -54.373 1.00 49.23 ? 70  LYS C NZ  1 
ATOM   4004 N N   . ALA C 1 64  ? 6.624   -16.282 -62.058 1.00 35.36 ? 71  ALA C N   1 
ATOM   4005 C CA  . ALA C 1 64  ? 7.339   -16.190 -63.326 1.00 37.22 ? 71  ALA C CA  1 
ATOM   4006 C C   . ALA C 1 64  ? 8.541   -15.252 -63.245 1.00 36.46 ? 71  ALA C C   1 
ATOM   4007 O O   . ALA C 1 64  ? 9.427   -15.318 -64.086 1.00 34.37 ? 71  ALA C O   1 
ATOM   4008 C CB  . ALA C 1 64  ? 6.396   -15.731 -64.393 1.00 41.37 ? 71  ALA C CB  1 
ATOM   4009 N N   . TYR C 1 65  ? 8.561   -14.348 -62.243 1.00 33.54 ? 72  TYR C N   1 
ATOM   4010 C CA  . TYR C 1 65  ? 9.623   -13.360 -62.194 1.00 32.92 ? 72  TYR C CA  1 
ATOM   4011 C C   . TYR C 1 65  ? 10.588  -13.711 -61.068 1.00 32.32 ? 72  TYR C C   1 
ATOM   4012 O O   . TYR C 1 65  ? 10.822  -12.867 -60.205 1.00 39.17 ? 72  TYR C O   1 
ATOM   4013 C CB  . TYR C 1 65  ? 9.084   -11.955 -61.932 1.00 32.68 ? 72  TYR C CB  1 
ATOM   4014 C CG  . TYR C 1 65  ? 8.085   -11.419 -62.900 1.00 33.18 ? 72  TYR C CG  1 
ATOM   4015 C CD1 . TYR C 1 65  ? 6.799   -11.923 -62.951 1.00 32.49 ? 72  TYR C CD1 1 
ATOM   4016 C CD2 . TYR C 1 65  ? 8.404   -10.346 -63.723 1.00 33.56 ? 72  TYR C CD2 1 
ATOM   4017 C CE1 . TYR C 1 65  ? 5.876   -11.396 -63.844 1.00 33.61 ? 72  TYR C CE1 1 
ATOM   4018 C CE2 . TYR C 1 65  ? 7.486   -9.801  -64.596 1.00 33.67 ? 72  TYR C CE2 1 
ATOM   4019 C CZ  . TYR C 1 65  ? 6.224   -10.340 -64.649 1.00 33.89 ? 72  TYR C CZ  1 
ATOM   4020 O OH  . TYR C 1 65  ? 5.292   -9.810  -65.490 1.00 30.96 ? 72  TYR C OH  1 
ATOM   4021 N N   . VAL C 1 66  ? 11.046  -14.956 -61.009 1.00 31.87 ? 73  VAL C N   1 
ATOM   4022 C CA  . VAL C 1 66  ? 12.122  -15.346 -60.099 1.00 31.35 ? 73  VAL C CA  1 
ATOM   4023 C C   . VAL C 1 66  ? 13.385  -15.589 -60.926 1.00 34.98 ? 73  VAL C C   1 
ATOM   4024 O O   . VAL C 1 66  ? 13.342  -16.277 -61.986 1.00 32.37 ? 73  VAL C O   1 
ATOM   4025 C CB  . VAL C 1 66  ? 11.788  -16.624 -59.336 1.00 30.72 ? 73  VAL C CB  1 
ATOM   4026 C CG1 . VAL C 1 66  ? 12.909  -17.000 -58.379 1.00 30.01 ? 73  VAL C CG1 1 
ATOM   4027 C CG2 . VAL C 1 66  ? 10.429  -16.532 -58.643 1.00 29.76 ? 73  VAL C CG2 1 
ATOM   4028 N N   . LYS C 1 67  ? 14.475  -14.957 -60.491 1.00 33.71 ? 74  LYS C N   1 
ATOM   4029 C CA  . LYS C 1 67  ? 15.771  -15.180 -61.117 1.00 34.92 ? 74  LYS C CA  1 
ATOM   4030 C C   . LYS C 1 67  ? 16.327  -16.553 -60.766 1.00 35.43 ? 74  LYS C C   1 
ATOM   4031 O O   . LYS C 1 67  ? 16.666  -16.782 -59.603 1.00 35.00 ? 74  LYS C O   1 
ATOM   4032 C CB  . LYS C 1 67  ? 16.772  -14.121 -60.626 1.00 36.94 ? 74  LYS C CB  1 
ATOM   4033 C CG  . LYS C 1 67  ? 18.148  -14.209 -61.290 1.00 38.48 ? 74  LYS C CG  1 
ATOM   4034 C CD  . LYS C 1 67  ? 18.995  -12.956 -61.048 1.00 40.73 ? 74  LYS C CD  1 
ATOM   4035 C CE  . LYS C 1 67  ? 20.478  -13.282 -61.206 1.00 40.44 ? 74  LYS C CE  1 
ATOM   4036 N NZ  . LYS C 1 67  ? 21.334  -12.088 -60.951 1.00 42.00 ? 74  LYS C NZ  1 
ATOM   4037 N N   . HIS C 1 68  ? 16.485  -17.430 -61.762 1.00 34.54 ? 75  HIS C N   1 
ATOM   4038 C CA  . HIS C 1 68  ? 17.148  -18.687 -61.546 1.00 36.20 ? 75  HIS C CA  1 
ATOM   4039 C C   . HIS C 1 68  ? 18.538  -18.791 -62.165 1.00 34.86 ? 75  HIS C C   1 
ATOM   4040 O O   . HIS C 1 68  ? 18.784  -18.313 -63.268 1.00 35.55 ? 75  HIS C O   1 
ATOM   4041 C CB  . HIS C 1 68  ? 16.287  -19.802 -62.120 1.00 36.46 ? 75  HIS C CB  1 
ATOM   4042 C CG  . HIS C 1 68  ? 15.045  -20.051 -61.336 1.00 35.43 ? 75  HIS C CG  1 
ATOM   4043 N ND1 . HIS C 1 68  ? 13.965  -19.199 -61.363 1.00 36.26 ? 75  HIS C ND1 1 
ATOM   4044 C CD2 . HIS C 1 68  ? 14.722  -21.037 -60.478 1.00 35.68 ? 75  HIS C CD2 1 
ATOM   4045 C CE1 . HIS C 1 68  ? 13.014  -19.664 -60.579 1.00 34.89 ? 75  HIS C CE1 1 
ATOM   4046 N NE2 . HIS C 1 68  ? 13.452  -20.770 -60.019 1.00 37.00 ? 75  HIS C NE2 1 
ATOM   4047 N N   . PRO C 1 69  ? 19.450  -19.478 -61.469 1.00 37.95 ? 76  PRO C N   1 
ATOM   4048 C CA  . PRO C 1 69  ? 20.677  -19.856 -62.161 1.00 38.53 ? 76  PRO C CA  1 
ATOM   4049 C C   . PRO C 1 69  ? 20.300  -20.817 -63.271 1.00 38.68 ? 76  PRO C C   1 
ATOM   4050 O O   . PRO C 1 69  ? 19.228  -21.423 -63.242 1.00 37.77 ? 76  PRO C O   1 
ATOM   4051 C CB  . PRO C 1 69  ? 21.516  -20.526 -61.072 1.00 38.02 ? 76  PRO C CB  1 
ATOM   4052 C CG  . PRO C 1 69  ? 20.866  -20.185 -59.774 1.00 39.65 ? 76  PRO C CG  1 
ATOM   4053 C CD  . PRO C 1 69  ? 19.435  -19.902 -60.068 1.00 35.92 ? 76  PRO C CD  1 
ATOM   4054 N N   . ALA C 1 70  ? 21.162  -20.905 -64.276 1.00 40.75 ? 77  ALA C N   1 
ATOM   4055 C CA  . ALA C 1 70  ? 20.890  -21.635 -65.469 1.00 43.84 ? 77  ALA C CA  1 
ATOM   4056 C C   . ALA C 1 70  ? 20.792  -23.119 -65.240 1.00 44.02 ? 77  ALA C C   1 
ATOM   4057 O O   . ALA C 1 70  ? 20.145  -23.800 -66.009 1.00 45.02 ? 77  ALA C O   1 
ATOM   4058 C CB  . ALA C 1 70  ? 21.960  -21.330 -66.491 1.00 42.90 ? 77  ALA C CB  1 
ATOM   4059 N N   . ASP C 1 71  ? 21.460  -23.640 -64.212 1.00 43.49 ? 78  ASP C N   1 
ATOM   4060 C CA  . ASP C 1 71  ? 21.381  -25.073 -63.936 1.00 45.70 ? 78  ASP C CA  1 
ATOM   4061 C C   . ASP C 1 71  ? 20.352  -25.419 -62.837 1.00 42.95 ? 78  ASP C C   1 
ATOM   4062 O O   . ASP C 1 71  ? 20.415  -26.473 -62.201 1.00 43.78 ? 78  ASP C O   1 
ATOM   4063 C CB  . ASP C 1 71  ? 22.774  -25.640 -63.631 1.00 48.11 ? 78  ASP C CB  1 
ATOM   4064 C CG  . ASP C 1 71  ? 23.405  -25.026 -62.423 1.00 48.29 ? 78  ASP C CG  1 
ATOM   4065 O OD1 . ASP C 1 71  ? 22.943  -23.957 -61.968 1.00 52.95 ? 78  ASP C OD1 1 
ATOM   4066 O OD2 . ASP C 1 71  ? 24.366  -25.633 -61.898 1.00 52.02 ? 78  ASP C OD2 1 
ATOM   4067 N N   . ILE C 1 72  ? 19.419  -24.511 -62.594 1.00 40.93 ? 79  ILE C N   1 
ATOM   4068 C CA  . ILE C 1 72  ? 18.248  -24.830 -61.752 1.00 39.08 ? 79  ILE C CA  1 
ATOM   4069 C C   . ILE C 1 72  ? 17.076  -24.669 -62.687 1.00 39.93 ? 79  ILE C C   1 
ATOM   4070 O O   . ILE C 1 72  ? 16.682  -23.547 -62.953 1.00 35.00 ? 79  ILE C O   1 
ATOM   4071 C CB  . ILE C 1 72  ? 18.053  -23.864 -60.557 1.00 38.69 ? 79  ILE C CB  1 
ATOM   4072 C CG1 . ILE C 1 72  ? 19.227  -23.973 -59.581 1.00 37.90 ? 79  ILE C CG1 1 
ATOM   4073 C CG2 . ILE C 1 72  ? 16.736  -24.183 -59.848 1.00 37.48 ? 79  ILE C CG2 1 
ATOM   4074 C CD1 . ILE C 1 72  ? 19.103  -23.099 -58.347 1.00 38.12 ? 79  ILE C CD1 1 
ATOM   4075 N N   . PRO C 1 73  ? 16.526  -25.783 -63.221 1.00 40.57 ? 80  PRO C N   1 
ATOM   4076 C CA  . PRO C 1 73  ? 15.423  -25.581 -64.170 1.00 39.98 ? 80  PRO C CA  1 
ATOM   4077 C C   . PRO C 1 73  ? 14.368  -24.599 -63.615 1.00 39.96 ? 80  PRO C C   1 
ATOM   4078 O O   . PRO C 1 73  ? 14.016  -24.676 -62.411 1.00 37.14 ? 80  PRO C O   1 
ATOM   4079 C CB  . PRO C 1 73  ? 14.838  -26.975 -64.340 1.00 42.82 ? 80  PRO C CB  1 
ATOM   4080 C CG  . PRO C 1 73  ? 15.916  -27.937 -63.897 1.00 41.61 ? 80  PRO C CG  1 
ATOM   4081 C CD  . PRO C 1 73  ? 16.901  -27.196 -63.052 1.00 42.70 ? 80  PRO C CD  1 
ATOM   4082 N N   . ASP C 1 74  ? 13.912  -23.682 -64.472 1.00 34.91 ? 81  ASP C N   1 
ATOM   4083 C CA  . ASP C 1 74  ? 12.946  -22.642 -64.089 1.00 37.30 ? 81  ASP C CA  1 
ATOM   4084 C C   . ASP C 1 74  ? 11.577  -23.172 -64.472 1.00 34.33 ? 81  ASP C C   1 
ATOM   4085 O O   . ASP C 1 74  ? 10.948  -22.681 -65.393 1.00 35.90 ? 81  ASP C O   1 
ATOM   4086 C CB  . ASP C 1 74  ? 13.241  -21.276 -64.755 1.00 38.39 ? 81  ASP C CB  1 
ATOM   4087 C CG  . ASP C 1 74  ? 12.521  -20.118 -64.055 1.00 41.54 ? 81  ASP C CG  1 
ATOM   4088 O OD1 . ASP C 1 74  ? 11.411  -20.375 -63.522 1.00 36.13 ? 81  ASP C OD1 1 
ATOM   4089 O OD2 . ASP C 1 74  ? 13.053  -18.961 -64.016 1.00 44.18 ? 81  ASP C OD2 1 
ATOM   4090 N N   . TYR C 1 75  ? 11.143  -24.157 -63.701 1.00 34.03 ? 82  TYR C N   1 
ATOM   4091 C CA  . TYR C 1 75  ? 9.904   -24.932 -63.912 1.00 33.87 ? 82  TYR C CA  1 
ATOM   4092 C C   . TYR C 1 75  ? 8.688   -24.072 -64.245 1.00 34.25 ? 82  TYR C C   1 
ATOM   4093 O O   . TYR C 1 75  ? 7.939   -24.395 -65.132 1.00 33.79 ? 82  TYR C O   1 
ATOM   4094 C CB  . TYR C 1 75  ? 9.633   -25.768 -62.644 1.00 33.72 ? 82  TYR C CB  1 
ATOM   4095 C CG  . TYR C 1 75  ? 8.338   -26.562 -62.585 1.00 31.96 ? 82  TYR C CG  1 
ATOM   4096 C CD1 . TYR C 1 75  ? 8.198   -27.757 -63.265 1.00 32.01 ? 82  TYR C CD1 1 
ATOM   4097 C CD2 . TYR C 1 75  ? 7.276   -26.148 -61.780 1.00 32.76 ? 82  TYR C CD2 1 
ATOM   4098 C CE1 . TYR C 1 75  ? 7.052   -28.485 -63.176 1.00 30.91 ? 82  TYR C CE1 1 
ATOM   4099 C CE2 . TYR C 1 75  ? 6.126   -26.920 -61.648 1.00 33.21 ? 82  TYR C CE2 1 
ATOM   4100 C CZ  . TYR C 1 75  ? 6.004   -28.076 -62.400 1.00 31.92 ? 82  TYR C CZ  1 
ATOM   4101 O OH  . TYR C 1 75  ? 4.865   -28.867 -62.341 1.00 30.81 ? 82  TYR C OH  1 
ATOM   4102 N N   . LEU C 1 76  ? 8.479   -22.984 -63.484 1.00 33.44 ? 83  LEU C N   1 
ATOM   4103 C CA  . LEU C 1 76  ? 7.300   -22.137 -63.729 1.00 31.85 ? 83  LEU C CA  1 
ATOM   4104 C C   . LEU C 1 76  ? 7.464   -21.251 -65.005 1.00 32.60 ? 83  LEU C C   1 
ATOM   4105 O O   . LEU C 1 76  ? 6.502   -20.998 -65.719 1.00 35.15 ? 83  LEU C O   1 
ATOM   4106 C CB  . LEU C 1 76  ? 6.920   -21.363 -62.430 1.00 30.65 ? 83  LEU C CB  1 
ATOM   4107 C CG  . LEU C 1 76  ? 6.649   -22.311 -61.242 1.00 30.29 ? 83  LEU C CG  1 
ATOM   4108 C CD1 . LEU C 1 76  ? 6.451   -21.538 -59.951 1.00 30.29 ? 83  LEU C CD1 1 
ATOM   4109 C CD2 . LEU C 1 76  ? 5.456   -23.214 -61.440 1.00 30.41 ? 83  LEU C CD2 1 
ATOM   4110 N N   . LYS C 1 77  ? 8.683   -20.836 -65.340 1.00 33.33 ? 84  LYS C N   1 
ATOM   4111 C CA  . LYS C 1 77  ? 8.931   -20.234 -66.630 1.00 36.80 ? 84  LYS C CA  1 
ATOM   4112 C C   . LYS C 1 77  ? 8.755   -21.252 -67.758 1.00 37.89 ? 84  LYS C C   1 
ATOM   4113 O O   . LYS C 1 77  ? 8.246   -20.915 -68.830 1.00 39.20 ? 84  LYS C O   1 
ATOM   4114 C CB  . LYS C 1 77  ? 10.334  -19.627 -66.691 1.00 38.06 ? 84  LYS C CB  1 
ATOM   4115 C CG  . LYS C 1 77  ? 10.421  -18.195 -66.198 1.00 35.61 ? 84  LYS C CG  1 
ATOM   4116 C CD  . LYS C 1 77  ? 11.687  -17.485 -66.678 1.00 35.29 ? 84  LYS C CD  1 
ATOM   4117 C CE  . LYS C 1 77  ? 11.965  -16.205 -65.904 1.00 35.15 ? 84  LYS C CE  1 
ATOM   4118 N NZ  . LYS C 1 77  ? 12.094  -16.496 -64.451 1.00 33.74 ? 84  LYS C NZ  1 
ATOM   4119 N N   . LEU C 1 78  ? 9.144   -22.497 -67.530 1.00 39.85 ? 85  LEU C N   1 
ATOM   4120 C CA  . LEU C 1 78  ? 8.994   -23.528 -68.608 1.00 38.93 ? 85  LEU C CA  1 
ATOM   4121 C C   . LEU C 1 78  ? 7.517   -23.813 -68.888 1.00 39.33 ? 85  LEU C C   1 
ATOM   4122 O O   . LEU C 1 78  ? 7.141   -24.062 -70.050 1.00 41.73 ? 85  LEU C O   1 
ATOM   4123 C CB  . LEU C 1 78  ? 9.716   -24.807 -68.223 1.00 39.84 ? 85  LEU C CB  1 
ATOM   4124 C CG  . LEU C 1 78  ? 11.249  -24.714 -68.195 1.00 39.76 ? 85  LEU C CG  1 
ATOM   4125 C CD1 . LEU C 1 78  ? 11.787  -25.840 -67.349 1.00 39.47 ? 85  LEU C CD1 1 
ATOM   4126 C CD2 . LEU C 1 78  ? 11.862  -24.763 -69.598 1.00 38.73 ? 85  LEU C CD2 1 
ATOM   4127 N N   . SER C 1 79  ? 6.664   -23.692 -67.856 1.00 36.29 ? 86  SER C N   1 
ATOM   4128 C CA  . SER C 1 79  ? 5.233   -24.001 -67.975 1.00 35.17 ? 86  SER C CA  1 
ATOM   4129 C C   . SER C 1 79  ? 4.474   -23.213 -69.072 1.00 34.97 ? 86  SER C C   1 
ATOM   4130 O O   . SER C 1 79  ? 3.427   -23.657 -69.470 1.00 35.07 ? 86  SER C O   1 
ATOM   4131 C CB  . SER C 1 79  ? 4.482   -23.804 -66.658 1.00 35.03 ? 86  SER C CB  1 
ATOM   4132 O OG  . SER C 1 79  ? 4.124   -22.447 -66.536 1.00 32.34 ? 86  SER C OG  1 
ATOM   4133 N N   . PHE C 1 80  ? 4.962   -22.049 -69.523 1.00 37.64 ? 87  PHE C N   1 
ATOM   4134 C CA  . PHE C 1 80  ? 4.167   -21.177 -70.399 1.00 38.75 ? 87  PHE C CA  1 
ATOM   4135 C C   . PHE C 1 80  ? 4.339   -21.596 -71.862 1.00 40.65 ? 87  PHE C C   1 
ATOM   4136 O O   . PHE C 1 80  ? 5.376   -22.132 -72.203 1.00 42.10 ? 87  PHE C O   1 
ATOM   4137 C CB  . PHE C 1 80  ? 4.552   -19.718 -70.147 1.00 38.84 ? 87  PHE C CB  1 
ATOM   4138 C CG  . PHE C 1 80  ? 4.112   -19.224 -68.781 1.00 39.82 ? 87  PHE C CG  1 
ATOM   4139 C CD1 . PHE C 1 80  ? 2.780   -18.868 -68.557 1.00 39.86 ? 87  PHE C CD1 1 
ATOM   4140 C CD2 . PHE C 1 80  ? 5.004   -19.146 -67.738 1.00 39.47 ? 87  PHE C CD2 1 
ATOM   4141 C CE1 . PHE C 1 80  ? 2.354   -18.407 -67.332 1.00 39.74 ? 87  PHE C CE1 1 
ATOM   4142 C CE2 . PHE C 1 80  ? 4.583   -18.711 -66.479 1.00 40.17 ? 87  PHE C CE2 1 
ATOM   4143 C CZ  . PHE C 1 80  ? 3.254   -18.334 -66.283 1.00 38.89 ? 87  PHE C CZ  1 
ATOM   4144 N N   . PRO C 1 81  ? 3.381   -21.305 -72.741 1.00 45.08 ? 88  PRO C N   1 
ATOM   4145 C CA  . PRO C 1 81  ? 2.344   -20.278 -72.551 1.00 45.26 ? 88  PRO C CA  1 
ATOM   4146 C C   . PRO C 1 81  ? 1.079   -20.766 -71.857 1.00 44.84 ? 88  PRO C C   1 
ATOM   4147 O O   . PRO C 1 81  ? 0.303   -19.920 -71.365 1.00 44.73 ? 88  PRO C O   1 
ATOM   4148 C CB  . PRO C 1 81  ? 2.028   -19.852 -73.978 1.00 48.28 ? 88  PRO C CB  1 
ATOM   4149 C CG  . PRO C 1 81  ? 2.272   -21.104 -74.791 1.00 47.44 ? 88  PRO C CG  1 
ATOM   4150 C CD  . PRO C 1 81  ? 3.467   -21.753 -74.152 1.00 48.30 ? 88  PRO C CD  1 
ATOM   4151 N N   . GLU C 1 82  ? 0.900   -22.094 -71.771 1.00 45.03 ? 89  GLU C N   1 
ATOM   4152 C CA  . GLU C 1 82  ? -0.188  -22.696 -70.972 1.00 42.82 ? 89  GLU C CA  1 
ATOM   4153 C C   . GLU C 1 82  ? -0.209  -22.165 -69.536 1.00 40.54 ? 89  GLU C C   1 
ATOM   4154 O O   . GLU C 1 82  ? -1.265  -21.813 -69.014 1.00 40.29 ? 89  GLU C O   1 
ATOM   4155 C CB  . GLU C 1 82  ? -0.092  -24.237 -70.896 1.00 44.65 ? 89  GLU C CB  1 
ATOM   4156 C CG  . GLU C 1 82  ? -0.243  -24.963 -72.236 1.00 50.11 ? 89  GLU C CG  1 
ATOM   4157 C CD  . GLU C 1 82  ? 1.068   -25.143 -73.004 1.00 55.19 ? 89  GLU C CD  1 
ATOM   4158 O OE1 . GLU C 1 82  ? 2.080   -24.436 -72.727 1.00 55.04 ? 89  GLU C OE1 1 
ATOM   4159 O OE2 . GLU C 1 82  ? 1.076   -26.009 -73.916 1.00 61.19 ? 89  GLU C OE2 1 
ATOM   4160 N N   . GLY C 1 83  ? 0.953   -22.141 -68.897 1.00 36.78 ? 90  GLY C N   1 
ATOM   4161 C CA  . GLY C 1 83  ? 1.030   -21.739 -67.475 1.00 34.11 ? 90  GLY C CA  1 
ATOM   4162 C C   . GLY C 1 83  ? 0.867   -22.808 -66.430 1.00 31.76 ? 90  GLY C C   1 
ATOM   4163 O O   . GLY C 1 83  ? 1.107   -24.034 -66.654 1.00 32.29 ? 90  GLY C O   1 
ATOM   4164 N N   . PHE C 1 84  ? 0.495   -22.342 -65.221 1.00 31.26 ? 91  PHE C N   1 
ATOM   4165 C CA  . PHE C 1 84  ? 0.435   -23.180 -64.071 1.00 30.81 ? 91  PHE C CA  1 
ATOM   4166 C C   . PHE C 1 84  ? -0.645  -22.708 -63.113 1.00 28.91 ? 91  PHE C C   1 
ATOM   4167 O O   . PHE C 1 84  ? -1.187  -21.663 -63.293 1.00 28.29 ? 91  PHE C O   1 
ATOM   4168 C CB  . PHE C 1 84  ? 1.787   -23.169 -63.329 1.00 31.94 ? 91  PHE C CB  1 
ATOM   4169 C CG  . PHE C 1 84  ? 2.200   -21.817 -62.824 1.00 32.18 ? 91  PHE C CG  1 
ATOM   4170 C CD1 . PHE C 1 84  ? 2.915   -20.982 -63.599 1.00 33.41 ? 91  PHE C CD1 1 
ATOM   4171 C CD2 . PHE C 1 84  ? 1.922   -21.435 -61.512 1.00 33.33 ? 91  PHE C CD2 1 
ATOM   4172 C CE1 . PHE C 1 84  ? 3.337   -19.749 -63.148 1.00 34.98 ? 91  PHE C CE1 1 
ATOM   4173 C CE2 . PHE C 1 84  ? 2.315   -20.173 -61.046 1.00 35.00 ? 91  PHE C CE2 1 
ATOM   4174 C CZ  . PHE C 1 84  ? 3.011   -19.319 -61.876 1.00 34.87 ? 91  PHE C CZ  1 
ATOM   4175 N N   . LYS C 1 85  ? -0.906  -23.516 -62.099 1.00 28.80 ? 92  LYS C N   1 
ATOM   4176 C CA  . LYS C 1 85  ? -1.857  -23.192 -61.052 1.00 31.75 ? 92  LYS C CA  1 
ATOM   4177 C C   . LYS C 1 85  ? -1.099  -23.274 -59.738 1.00 29.11 ? 92  LYS C C   1 
ATOM   4178 O O   . LYS C 1 85  ? -0.154  -24.068 -59.615 1.00 29.92 ? 92  LYS C O   1 
ATOM   4179 C CB  . LYS C 1 85  ? -2.969  -24.247 -61.038 1.00 34.31 ? 92  LYS C CB  1 
ATOM   4180 C CG  . LYS C 1 85  ? -3.915  -24.321 -62.229 1.00 37.37 ? 92  LYS C CG  1 
ATOM   4181 C CD  . LYS C 1 85  ? -4.982  -25.400 -61.923 1.00 37.49 ? 92  LYS C CD  1 
ATOM   4182 C CE  . LYS C 1 85  ? -5.887  -25.826 -63.073 1.00 41.88 ? 92  LYS C CE  1 
ATOM   4183 N NZ  . LYS C 1 85  ? -6.770  -24.700 -63.504 1.00 43.66 ? 92  LYS C NZ  1 
ATOM   4184 N N   . TRP C 1 86  ? -1.522  -22.560 -58.699 1.00 27.53 ? 93  TRP C N   1 
ATOM   4185 C CA  . TRP C 1 86  ? -1.003  -22.918 -57.387 1.00 26.56 ? 93  TRP C CA  1 
ATOM   4186 C C   . TRP C 1 86  ? -2.055  -22.881 -56.263 1.00 24.64 ? 93  TRP C C   1 
ATOM   4187 O O   . TRP C 1 86  ? -3.175  -22.375 -56.443 1.00 23.84 ? 93  TRP C O   1 
ATOM   4188 C CB  . TRP C 1 86  ? 0.214   -22.057 -57.031 1.00 28.17 ? 93  TRP C CB  1 
ATOM   4189 C CG  . TRP C 1 86  ? 0.114   -20.562 -57.083 1.00 26.26 ? 93  TRP C CG  1 
ATOM   4190 C CD1 . TRP C 1 86  ? 0.569   -19.764 -58.086 1.00 26.65 ? 93  TRP C CD1 1 
ATOM   4191 C CD2 . TRP C 1 86  ? -0.279  -19.668 -56.038 1.00 25.89 ? 93  TRP C CD2 1 
ATOM   4192 N NE1 . TRP C 1 86  ? 0.386   -18.466 -57.802 1.00 27.45 ? 93  TRP C NE1 1 
ATOM   4193 C CE2 . TRP C 1 86  ? -0.106  -18.364 -56.528 1.00 25.92 ? 93  TRP C CE2 1 
ATOM   4194 C CE3 . TRP C 1 86  ? -0.843  -19.842 -54.780 1.00 26.21 ? 93  TRP C CE3 1 
ATOM   4195 C CZ2 . TRP C 1 86  ? -0.449  -17.239 -55.790 1.00 24.99 ? 93  TRP C CZ2 1 
ATOM   4196 C CZ3 . TRP C 1 86  ? -1.141  -18.734 -54.050 1.00 25.78 ? 93  TRP C CZ3 1 
ATOM   4197 C CH2 . TRP C 1 86  ? -0.955  -17.451 -54.560 1.00 26.03 ? 93  TRP C CH2 1 
ATOM   4198 N N   . GLU C 1 87  ? -1.747  -23.599 -55.194 1.00 26.22 ? 94  GLU C N   1 
ATOM   4199 C CA  . GLU C 1 87  ? -2.644  -23.769 -54.118 1.00 26.49 ? 94  GLU C CA  1 
ATOM   4200 C C   . GLU C 1 87  ? -1.823  -23.511 -52.878 1.00 24.68 ? 94  GLU C C   1 
ATOM   4201 O O   . GLU C 1 87  ? -0.768  -24.112 -52.718 1.00 26.71 ? 94  GLU C O   1 
ATOM   4202 C CB  . GLU C 1 87  ? -3.188  -25.189 -54.075 1.00 30.42 ? 94  GLU C CB  1 
ATOM   4203 C CG  . GLU C 1 87  ? -3.789  -25.591 -55.363 1.00 35.19 ? 94  GLU C CG  1 
ATOM   4204 C CD  . GLU C 1 87  ? -4.609  -26.860 -55.250 1.00 40.57 ? 94  GLU C CD  1 
ATOM   4205 O OE1 . GLU C 1 87  ? -4.722  -27.385 -54.113 1.00 44.73 ? 94  GLU C OE1 1 
ATOM   4206 O OE2 . GLU C 1 87  ? -5.109  -27.321 -56.319 1.00 47.98 ? 94  GLU C OE2 1 
ATOM   4207 N N   . ARG C 1 88  ? -2.280  -22.657 -51.991 1.00 23.54 ? 95  ARG C N   1 
ATOM   4208 C CA  . ARG C 1 88  ? -1.479  -22.261 -50.826 1.00 22.37 ? 95  ARG C CA  1 
ATOM   4209 C C   . ARG C 1 88  ? -2.302  -22.291 -49.557 1.00 21.27 ? 95  ARG C C   1 
ATOM   4210 O O   . ARG C 1 88  ? -3.493  -21.922 -49.584 1.00 21.79 ? 95  ARG C O   1 
ATOM   4211 C CB  . ARG C 1 88  ? -0.966  -20.788 -51.033 1.00 20.76 ? 95  ARG C CB  1 
ATOM   4212 C CG  . ARG C 1 88  ? -0.238  -20.110 -49.872 1.00 22.37 ? 95  ARG C CG  1 
ATOM   4213 C CD  . ARG C 1 88  ? 0.278   -18.753 -50.373 1.00 23.28 ? 95  ARG C CD  1 
ATOM   4214 N NE  . ARG C 1 88  ? 1.348   -18.952 -51.369 1.00 24.18 ? 95  ARG C NE  1 
ATOM   4215 C CZ  . ARG C 1 88  ? 1.896   -17.980 -52.124 1.00 28.06 ? 95  ARG C CZ  1 
ATOM   4216 N NH1 . ARG C 1 88  ? 1.478   -16.731 -52.040 1.00 27.70 ? 95  ARG C NH1 1 
ATOM   4217 N NH2 . ARG C 1 88  ? 2.850   -18.268 -53.002 1.00 27.98 ? 95  ARG C NH2 1 
ATOM   4218 N N   . VAL C 1 89  ? -1.704  -22.772 -48.489 1.00 19.99 ? 96  VAL C N   1 
ATOM   4219 C CA  . VAL C 1 89  ? -2.202  -22.601 -47.176 1.00 21.41 ? 96  VAL C CA  1 
ATOM   4220 C C   . VAL C 1 89  ? -1.262  -21.777 -46.341 1.00 22.02 ? 96  VAL C C   1 
ATOM   4221 O O   . VAL C 1 89  ? -0.045  -22.051 -46.283 1.00 22.32 ? 96  VAL C O   1 
ATOM   4222 C CB  . VAL C 1 89  ? -2.398  -23.978 -46.512 1.00 21.27 ? 96  VAL C CB  1 
ATOM   4223 C CG1 . VAL C 1 89  ? -2.845  -23.906 -45.069 1.00 22.87 ? 96  VAL C CG1 1 
ATOM   4224 C CG2 . VAL C 1 89  ? -3.277  -24.856 -47.422 1.00 24.63 ? 96  VAL C CG2 1 
ATOM   4225 N N   . MET C 1 90  ? -1.848  -20.860 -45.586 1.00 20.46 ? 97  MET C N   1 
ATOM   4226 C CA  . MET C 1 90  ? -1.112  -20.087 -44.608 1.00 22.25 ? 97  MET C CA  1 
ATOM   4227 C C   . MET C 1 90  ? -1.762  -20.298 -43.283 1.00 20.12 ? 97  MET C C   1 
ATOM   4228 O O   . MET C 1 90  ? -2.937  -19.937 -43.138 1.00 21.35 ? 97  MET C O   1 
ATOM   4229 C CB  . MET C 1 90  ? -1.159  -18.573 -44.927 1.00 21.42 ? 97  MET C CB  1 
ATOM   4230 C CG  . MET C 1 90  ? -0.882  -18.227 -46.349 1.00 25.54 ? 97  MET C CG  1 
ATOM   4231 S SD  . MET C 1 90  ? -1.055  -16.461 -46.676 1.00 33.17 ? 97  MET C SD  1 
ATOM   4232 C CE  . MET C 1 90  ? 0.534   -15.906 -46.141 1.00 30.16 ? 97  MET C CE  1 
ATOM   4233 N N   . ASN C 1 91  ? -1.037  -20.836 -42.333 1.00 19.16 ? 98  ASN C N   1 
ATOM   4234 C CA  . ASN C 1 91  ? -1.440  -20.915 -40.966 1.00 19.09 ? 98  ASN C CA  1 
ATOM   4235 C C   . ASN C 1 91  ? -0.732  -19.910 -40.069 1.00 19.95 ? 98  ASN C C   1 
ATOM   4236 O O   . ASN C 1 91  ? 0.470   -20.014 -39.819 1.00 18.98 ? 98  ASN C O   1 
ATOM   4237 C CB  . ASN C 1 91  ? -1.172  -22.324 -40.410 1.00 18.50 ? 98  ASN C CB  1 
ATOM   4238 C CG  . ASN C 1 91  ? -2.250  -23.332 -40.861 1.00 19.92 ? 98  ASN C CG  1 
ATOM   4239 O OD1 . ASN C 1 91  ? -3.413  -23.032 -40.764 1.00 19.72 ? 98  ASN C OD1 1 
ATOM   4240 N ND2 . ASN C 1 91  ? -1.843  -24.470 -41.454 1.00 20.40 ? 98  ASN C ND2 1 
ATOM   4241 N N   . PHE C 1 92  ? -1.524  -18.999 -39.500 1.00 21.74 ? 99  PHE C N   1 
ATOM   4242 C CA  . PHE C 1 92  ? -0.958  -17.975 -38.620 1.00 21.21 ? 99  PHE C CA  1 
ATOM   4243 C C   . PHE C 1 92  ? -0.929  -18.436 -37.237 1.00 23.00 ? 99  PHE C C   1 
ATOM   4244 O O   . PHE C 1 92  ? -1.738  -19.295 -36.818 1.00 22.56 ? 99  PHE C O   1 
ATOM   4245 C CB  . PHE C 1 92  ? -1.767  -16.673 -38.749 1.00 21.87 ? 99  PHE C CB  1 
ATOM   4246 C CG  . PHE C 1 92  ? -1.645  -16.040 -40.106 1.00 20.60 ? 99  PHE C CG  1 
ATOM   4247 C CD1 . PHE C 1 92  ? -2.380  -16.488 -41.196 1.00 22.29 ? 99  PHE C CD1 1 
ATOM   4248 C CD2 . PHE C 1 92  ? -0.767  -14.965 -40.325 1.00 23.99 ? 99  PHE C CD2 1 
ATOM   4249 C CE1 . PHE C 1 92  ? -2.256  -15.945 -42.446 1.00 21.64 ? 99  PHE C CE1 1 
ATOM   4250 C CE2 . PHE C 1 92  ? -0.654  -14.361 -41.603 1.00 22.45 ? 99  PHE C CE2 1 
ATOM   4251 C CZ  . PHE C 1 92  ? -1.386  -14.882 -42.694 1.00 24.21 ? 99  PHE C CZ  1 
ATOM   4252 N N   . GLU C 1 93  ? 0.003   -17.842 -36.493 1.00 19.78 ? 100 GLU C N   1 
ATOM   4253 C CA  . GLU C 1 93  ? 0.277   -18.256 -35.119 1.00 23.22 ? 100 GLU C CA  1 
ATOM   4254 C C   . GLU C 1 93  ? -0.888  -18.175 -34.182 1.00 21.26 ? 100 GLU C C   1 
ATOM   4255 O O   . GLU C 1 93  ? -0.996  -18.993 -33.226 1.00 24.14 ? 100 GLU C O   1 
ATOM   4256 C CB  . GLU C 1 93  ? 1.508   -17.533 -34.580 1.00 23.39 ? 100 GLU C CB  1 
ATOM   4257 C CG  . GLU C 1 93  ? 1.276   -16.082 -34.295 1.00 25.69 ? 100 GLU C CG  1 
ATOM   4258 C CD  . GLU C 1 93  ? 2.444   -15.397 -33.627 1.00 29.72 ? 100 GLU C CD  1 
ATOM   4259 O OE1 . GLU C 1 93  ? 3.509   -15.095 -34.244 1.00 26.83 ? 100 GLU C OE1 1 
ATOM   4260 O OE2 . GLU C 1 93  ? 2.222   -15.131 -32.437 1.00 37.90 ? 100 GLU C OE2 1 
ATOM   4261 N N   . ASP C 1 94  ? -1.779  -17.242 -34.405 1.00 22.14 ? 101 ASP C N   1 
ATOM   4262 C CA  . ASP C 1 94  ? -2.937  -17.085 -33.535 1.00 22.07 ? 101 ASP C CA  1 
ATOM   4263 C C   . ASP C 1 94  ? -4.225  -17.787 -34.006 1.00 23.58 ? 101 ASP C C   1 
ATOM   4264 O O   . ASP C 1 94  ? -5.297  -17.466 -33.510 1.00 25.65 ? 101 ASP C O   1 
ATOM   4265 C CB  . ASP C 1 94  ? -3.187  -15.575 -33.243 1.00 21.08 ? 101 ASP C CB  1 
ATOM   4266 C CG  . ASP C 1 94  ? -3.609  -14.780 -34.471 1.00 24.73 ? 101 ASP C CG  1 
ATOM   4267 O OD1 . ASP C 1 94  ? -3.476  -15.315 -35.605 1.00 22.84 ? 101 ASP C OD1 1 
ATOM   4268 O OD2 . ASP C 1 94  ? -4.073  -13.608 -34.298 1.00 25.31 ? 101 ASP C OD2 1 
ATOM   4269 N N   . GLY C 1 95  ? -4.109  -18.727 -34.949 1.00 24.00 ? 102 GLY C N   1 
ATOM   4270 C CA  . GLY C 1 95  ? -5.245  -19.528 -35.468 1.00 23.61 ? 102 GLY C CA  1 
ATOM   4271 C C   . GLY C 1 95  ? -5.825  -19.020 -36.801 1.00 22.24 ? 102 GLY C C   1 
ATOM   4272 O O   . GLY C 1 95  ? -6.661  -19.671 -37.441 1.00 21.17 ? 102 GLY C O   1 
ATOM   4273 N N   . GLY C 1 96  ? -5.435  -17.824 -37.251 1.00 22.07 ? 103 GLY C N   1 
ATOM   4274 C CA  . GLY C 1 96  ? -5.835  -17.351 -38.506 1.00 19.40 ? 103 GLY C CA  1 
ATOM   4275 C C   . GLY C 1 96  ? -5.378  -18.278 -39.613 1.00 21.99 ? 103 GLY C C   1 
ATOM   4276 O O   . GLY C 1 96  ? -4.306  -18.872 -39.530 1.00 20.63 ? 103 GLY C O   1 
ATOM   4277 N N   . VAL C 1 97  ? -6.206  -18.378 -40.649 1.00 19.64 ? 104 VAL C N   1 
ATOM   4278 C CA  . VAL C 1 97  ? -5.963  -19.219 -41.781 1.00 20.42 ? 104 VAL C CA  1 
ATOM   4279 C C   . VAL C 1 97  ? -6.291  -18.533 -43.066 1.00 21.58 ? 104 VAL C C   1 
ATOM   4280 O O   . VAL C 1 97  ? -7.381  -17.976 -43.272 1.00 22.16 ? 104 VAL C O   1 
ATOM   4281 C CB  . VAL C 1 97  ? -6.842  -20.529 -41.705 1.00 20.05 ? 104 VAL C CB  1 
ATOM   4282 C CG1 . VAL C 1 97  ? -6.691  -21.312 -42.988 1.00 20.82 ? 104 VAL C CG1 1 
ATOM   4283 C CG2 . VAL C 1 97  ? -6.444  -21.288 -40.499 1.00 19.75 ? 104 VAL C CG2 1 
ATOM   4284 N N   . VAL C 1 98  ? -5.394  -18.661 -44.046 1.00 20.51 ? 105 VAL C N   1 
ATOM   4285 C CA  . VAL C 1 98  ? -5.668  -18.227 -45.341 1.00 20.48 ? 105 VAL C CA  1 
ATOM   4286 C C   . VAL C 1 98  ? -5.379  -19.271 -46.343 1.00 21.96 ? 105 VAL C C   1 
ATOM   4287 O O   . VAL C 1 98  ? -4.282  -19.861 -46.327 1.00 22.22 ? 105 VAL C O   1 
ATOM   4288 C CB  . VAL C 1 98  ? -4.835  -16.945 -45.739 1.00 21.66 ? 105 VAL C CB  1 
ATOM   4289 C CG1 . VAL C 1 98  ? -5.083  -16.643 -47.174 1.00 23.05 ? 105 VAL C CG1 1 
ATOM   4290 C CG2 . VAL C 1 98  ? -5.293  -15.775 -44.876 1.00 21.12 ? 105 VAL C CG2 1 
ATOM   4291 N N   . THR C 1 99  ? -6.359  -19.576 -47.160 1.00 20.01 ? 106 THR C N   1 
ATOM   4292 C CA  . THR C 1 99  ? -6.123  -20.522 -48.252 1.00 22.56 ? 106 THR C CA  1 
ATOM   4293 C C   . THR C 1 99  ? -6.350  -19.801 -49.532 1.00 23.98 ? 106 THR C C   1 
ATOM   4294 O O   . THR C 1 99  ? -7.204  -18.893 -49.645 1.00 23.02 ? 106 THR C O   1 
ATOM   4295 C CB  . THR C 1 99  ? -6.996  -21.785 -48.235 1.00 25.78 ? 106 THR C CB  1 
ATOM   4296 O OG1 . THR C 1 99  ? -8.350  -21.428 -48.403 1.00 26.70 ? 106 THR C OG1 1 
ATOM   4297 C CG2 . THR C 1 99  ? -6.827  -22.531 -46.969 1.00 25.63 ? 106 THR C CG2 1 
ATOM   4298 N N   . VAL C 1 100 ? -5.589  -20.196 -50.535 1.00 22.20 ? 107 VAL C N   1 
ATOM   4299 C CA  . VAL C 1 100 ? -5.505  -19.427 -51.737 1.00 23.54 ? 107 VAL C CA  1 
ATOM   4300 C C   . VAL C 1 100 ? -5.376  -20.375 -52.906 1.00 23.96 ? 107 VAL C C   1 
ATOM   4301 O O   . VAL C 1 100 ? -4.646  -21.357 -52.809 1.00 26.21 ? 107 VAL C O   1 
ATOM   4302 C CB  . VAL C 1 100 ? -4.260  -18.557 -51.807 1.00 24.03 ? 107 VAL C CB  1 
ATOM   4303 C CG1 . VAL C 1 100 ? -4.326  -17.622 -52.972 1.00 25.70 ? 107 VAL C CG1 1 
ATOM   4304 C CG2 . VAL C 1 100 ? -4.024  -17.827 -50.492 1.00 25.93 ? 107 VAL C CG2 1 
ATOM   4305 N N   . THR C 1 101 ? -6.048  -20.058 -53.981 1.00 24.17 ? 108 THR C N   1 
ATOM   4306 C CA  . THR C 1 101 ? -5.851  -20.760 -55.238 1.00 26.54 ? 108 THR C CA  1 
ATOM   4307 C C   . THR C 1 101 ? -5.612  -19.732 -56.363 1.00 27.26 ? 108 THR C C   1 
ATOM   4308 O O   . THR C 1 101 ? -6.177  -18.590 -56.398 1.00 25.91 ? 108 THR C O   1 
ATOM   4309 C CB  . THR C 1 101 ? -7.025  -21.732 -55.596 1.00 27.99 ? 108 THR C CB  1 
ATOM   4310 O OG1 . THR C 1 101 ? -8.212  -20.973 -55.892 1.00 29.03 ? 108 THR C OG1 1 
ATOM   4311 C CG2 . THR C 1 101 ? -7.308  -22.712 -54.455 1.00 28.24 ? 108 THR C CG2 1 
ATOM   4312 N N   . GLN C 1 102 ? -4.801  -20.133 -57.336 1.00 26.50 ? 109 GLN C N   1 
ATOM   4313 C CA  . GLN C 1 102 ? -4.339  -19.208 -58.339 1.00 26.78 ? 109 GLN C CA  1 
ATOM   4314 C C   . GLN C 1 102 ? -4.157  -19.909 -59.644 1.00 27.65 ? 109 GLN C C   1 
ATOM   4315 O O   . GLN C 1 102 ? -3.673  -21.014 -59.686 1.00 27.62 ? 109 GLN C O   1 
ATOM   4316 C CB  . GLN C 1 102 ? -2.982  -18.632 -57.987 1.00 27.46 ? 109 GLN C CB  1 
ATOM   4317 C CG  . GLN C 1 102 ? -2.732  -17.288 -58.564 1.00 27.60 ? 109 GLN C CG  1 
ATOM   4318 C CD  . GLN C 1 102 ? -1.860  -17.287 -59.810 1.00 29.15 ? 109 GLN C CD  1 
ATOM   4319 O OE1 . GLN C 1 102 ? -1.566  -18.336 -60.350 1.00 32.67 ? 109 GLN C OE1 1 
ATOM   4320 N NE2 . GLN C 1 102 ? -1.449  -16.096 -60.260 1.00 28.29 ? 109 GLN C NE2 1 
ATOM   4321 N N   . ASP C 1 103 ? -4.541  -19.217 -60.669 1.00 29.34 ? 110 ASP C N   1 
ATOM   4322 C CA  . ASP C 1 103 ? -4.263  -19.622 -62.062 1.00 32.00 ? 110 ASP C CA  1 
ATOM   4323 C C   . ASP C 1 103 ? -3.480  -18.551 -62.815 1.00 31.37 ? 110 ASP C C   1 
ATOM   4324 O O   . ASP C 1 103 ? -3.808  -17.346 -62.778 1.00 32.34 ? 110 ASP C O   1 
ATOM   4325 C CB  . ASP C 1 103 ? -5.553  -19.905 -62.797 1.00 35.38 ? 110 ASP C CB  1 
ATOM   4326 C CG  . ASP C 1 103 ? -5.296  -20.430 -64.213 1.00 36.21 ? 110 ASP C CG  1 
ATOM   4327 O OD1 . ASP C 1 103 ? -4.825  -19.645 -65.039 1.00 41.43 ? 110 ASP C OD1 1 
ATOM   4328 O OD2 . ASP C 1 103 ? -5.541  -21.608 -64.452 1.00 35.55 ? 110 ASP C OD2 1 
ATOM   4329 N N   . SER C 1 104 ? -2.422  -18.992 -63.519 1.00 29.72 ? 111 SER C N   1 
ATOM   4330 C CA  . SER C 1 104 ? -1.524  -18.117 -64.216 1.00 30.22 ? 111 SER C CA  1 
ATOM   4331 C C   . SER C 1 104 ? -1.467  -18.608 -65.663 1.00 30.90 ? 111 SER C C   1 
ATOM   4332 O O   . SER C 1 104 ? -1.174  -19.774 -65.873 1.00 32.26 ? 111 SER C O   1 
ATOM   4333 C CB  . SER C 1 104 ? -0.111  -18.246 -63.651 1.00 29.50 ? 111 SER C CB  1 
ATOM   4334 O OG  . SER C 1 104 ? -0.053  -17.772 -62.281 1.00 27.34 ? 111 SER C OG  1 
ATOM   4335 N N   . SER C 1 105 ? -1.711  -17.700 -66.585 1.00 31.66 ? 112 SER C N   1 
ATOM   4336 C CA  . SER C 1 105 ? -1.620  -17.990 -68.031 1.00 34.28 ? 112 SER C CA  1 
ATOM   4337 C C   . SER C 1 105 ? -0.923  -16.861 -68.776 1.00 34.51 ? 112 SER C C   1 
ATOM   4338 O O   . SER C 1 105 ? -0.645  -15.771 -68.219 1.00 33.82 ? 112 SER C O   1 
ATOM   4339 C CB  . SER C 1 105 ? -3.014  -18.234 -68.590 1.00 36.23 ? 112 SER C CB  1 
ATOM   4340 O OG  . SER C 1 105 ? -3.802  -17.077 -68.476 1.00 38.56 ? 112 SER C OG  1 
ATOM   4341 N N   . LEU C 1 106 ? -0.621  -17.099 -70.052 1.00 36.65 ? 113 LEU C N   1 
ATOM   4342 C CA  . LEU C 1 106 ? -0.041  -16.054 -70.877 1.00 40.11 ? 113 LEU C CA  1 
ATOM   4343 C C   . LEU C 1 106 ? -0.910  -15.852 -72.147 1.00 43.05 ? 113 LEU C C   1 
ATOM   4344 O O   . LEU C 1 106 ? -1.119  -16.781 -72.929 1.00 46.16 ? 113 LEU C O   1 
ATOM   4345 C CB  . LEU C 1 106 ? 1.397   -16.412 -71.283 1.00 40.53 ? 113 LEU C CB  1 
ATOM   4346 C CG  . LEU C 1 106 ? 2.139   -15.473 -72.252 1.00 44.25 ? 113 LEU C CG  1 
ATOM   4347 C CD1 . LEU C 1 106 ? 2.641   -14.221 -71.548 1.00 43.41 ? 113 LEU C CD1 1 
ATOM   4348 C CD2 . LEU C 1 106 ? 3.320   -16.174 -72.891 1.00 46.53 ? 113 LEU C CD2 1 
ATOM   4349 N N   . GLN C 1 107 ? -1.435  -14.653 -72.300 1.00 43.86 ? 114 GLN C N   1 
ATOM   4350 C CA  . GLN C 1 107 ? -2.213  -14.309 -73.499 1.00 51.45 ? 114 GLN C CA  1 
ATOM   4351 C C   . GLN C 1 107 ? -1.871  -12.896 -73.967 1.00 48.83 ? 114 GLN C C   1 
ATOM   4352 O O   . GLN C 1 107 ? -1.670  -11.973 -73.169 1.00 40.64 ? 114 GLN C O   1 
ATOM   4353 C CB  . GLN C 1 107 ? -3.736  -14.470 -73.274 1.00 56.53 ? 114 GLN C CB  1 
ATOM   4354 C CG  . GLN C 1 107 ? -4.258  -15.922 -73.326 1.00 59.44 ? 114 GLN C CG  1 
ATOM   4355 C CD  . GLN C 1 107 ? -4.274  -16.537 -74.731 1.00 58.91 ? 114 GLN C CD  1 
ATOM   4356 O OE1 . GLN C 1 107 ? -3.625  -17.555 -74.980 1.00 59.84 ? 114 GLN C OE1 1 
ATOM   4357 N NE2 . GLN C 1 107 ? -5.012  -15.922 -75.651 1.00 57.78 ? 114 GLN C NE2 1 
ATOM   4358 N N   . ASP C 1 108 ? -1.788  -12.743 -75.284 1.00 45.69 ? 115 ASP C N   1 
ATOM   4359 C CA  . ASP C 1 108 ? -1.498  -11.461 -75.912 1.00 46.76 ? 115 ASP C CA  1 
ATOM   4360 C C   . ASP C 1 108 ? -0.240  -10.850 -75.313 1.00 45.70 ? 115 ASP C C   1 
ATOM   4361 O O   . ASP C 1 108 ? -0.185  -9.641  -75.050 1.00 43.47 ? 115 ASP C O   1 
ATOM   4362 C CB  . ASP C 1 108 ? -2.678  -10.482 -75.760 1.00 49.31 ? 115 ASP C CB  1 
ATOM   4363 C CG  . ASP C 1 108 ? -3.769  -10.668 -76.799 1.00 53.86 ? 115 ASP C CG  1 
ATOM   4364 O OD1 . ASP C 1 108 ? -3.817  -11.712 -77.498 1.00 52.94 ? 115 ASP C OD1 1 
ATOM   4365 O OD2 . ASP C 1 108 ? -4.607  -9.733  -76.904 1.00 51.53 ? 115 ASP C OD2 1 
ATOM   4366 N N   . GLY C 1 109 ? 0.782   -11.674 -75.110 1.00 44.90 ? 116 GLY C N   1 
ATOM   4367 C CA  . GLY C 1 109 ? 2.080   -11.175 -74.627 1.00 44.58 ? 116 GLY C CA  1 
ATOM   4368 C C   . GLY C 1 109 ? 2.098   -10.713 -73.184 1.00 42.38 ? 116 GLY C C   1 
ATOM   4369 O O   . GLY C 1 109 ? 3.049   -10.054 -72.763 1.00 42.58 ? 116 GLY C O   1 
ATOM   4370 N N   . GLU C 1 110 ? 1.075   -11.067 -72.411 1.00 43.64 ? 117 GLU C N   1 
ATOM   4371 C CA  . GLU C 1 110 ? 1.029   -10.663 -70.971 1.00 41.52 ? 117 GLU C CA  1 
ATOM   4372 C C   . GLU C 1 110 ? 0.674   -11.818 -70.099 1.00 41.15 ? 117 GLU C C   1 
ATOM   4373 O O   . GLU C 1 110 ? 0.022   -12.763 -70.558 1.00 39.58 ? 117 GLU C O   1 
ATOM   4374 C CB  . GLU C 1 110 ? -0.002  -9.566  -70.761 1.00 42.91 ? 117 GLU C CB  1 
ATOM   4375 C CG  . GLU C 1 110 ? 0.436   -8.239  -71.337 1.00 45.48 ? 117 GLU C CG  1 
ATOM   4376 C CD  . GLU C 1 110 ? -0.324  -7.061  -70.747 1.00 49.77 ? 117 GLU C CD  1 
ATOM   4377 O OE1 . GLU C 1 110 ? -1.072  -7.259  -69.753 1.00 53.70 ? 117 GLU C OE1 1 
ATOM   4378 O OE2 . GLU C 1 110 ? -0.159  -5.937  -71.264 1.00 50.18 ? 117 GLU C OE2 1 
ATOM   4379 N N   . PHE C 1 111 ? 1.049   -11.738 -68.821 1.00 37.48 ? 118 PHE C N   1 
ATOM   4380 C CA  . PHE C 1 111 ? 0.622   -12.750 -67.902 1.00 37.14 ? 118 PHE C CA  1 
ATOM   4381 C C   . PHE C 1 111 ? -0.748  -12.351 -67.351 1.00 35.81 ? 118 PHE C C   1 
ATOM   4382 O O   . PHE C 1 111 ? -1.014  -11.185 -67.090 1.00 37.94 ? 118 PHE C O   1 
ATOM   4383 C CB  . PHE C 1 111 ? 1.613   -12.957 -66.734 1.00 36.78 ? 118 PHE C CB  1 
ATOM   4384 C CG  . PHE C 1 111 ? 2.985   -13.471 -67.148 1.00 35.58 ? 118 PHE C CG  1 
ATOM   4385 C CD1 . PHE C 1 111 ? 3.147   -14.762 -67.669 1.00 35.17 ? 118 PHE C CD1 1 
ATOM   4386 C CD2 . PHE C 1 111 ? 4.122   -12.686 -66.937 1.00 35.83 ? 118 PHE C CD2 1 
ATOM   4387 C CE1 . PHE C 1 111 ? 4.392   -15.233 -68.024 1.00 33.27 ? 118 PHE C CE1 1 
ATOM   4388 C CE2 . PHE C 1 111 ? 5.374   -13.160 -67.256 1.00 34.85 ? 118 PHE C CE2 1 
ATOM   4389 C CZ  . PHE C 1 111 ? 5.505   -14.440 -67.823 1.00 36.60 ? 118 PHE C CZ  1 
ATOM   4390 N N   . ILE C 1 112 ? -1.613  -13.329 -67.217 1.00 33.51 ? 119 ILE C N   1 
ATOM   4391 C CA  . ILE C 1 112 ? -2.929  -13.144 -66.640 1.00 34.20 ? 119 ILE C CA  1 
ATOM   4392 C C   . ILE C 1 112 ? -3.049  -14.028 -65.389 1.00 32.69 ? 119 ILE C C   1 
ATOM   4393 O O   . ILE C 1 112 ? -2.933  -15.292 -65.425 1.00 31.36 ? 119 ILE C O   1 
ATOM   4394 C CB  . ILE C 1 112 ? -4.018  -13.490 -67.654 1.00 33.94 ? 119 ILE C CB  1 
ATOM   4395 C CG1 . ILE C 1 112 ? -3.830  -12.646 -68.933 1.00 37.85 ? 119 ILE C CG1 1 
ATOM   4396 C CG2 . ILE C 1 112 ? -5.404  -13.363 -67.046 1.00 33.50 ? 119 ILE C CG2 1 
ATOM   4397 C CD1 . ILE C 1 112 ? -3.796  -11.132 -68.730 1.00 38.07 ? 119 ILE C CD1 1 
ATOM   4398 N N   . TYR C 1 113 ? -3.275  -13.373 -64.248 1.00 31.87 ? 120 TYR C N   1 
ATOM   4399 C CA  . TYR C 1 113 ? -3.419  -14.083 -63.012 1.00 31.20 ? 120 TYR C CA  1 
ATOM   4400 C C   . TYR C 1 113 ? -4.847  -13.959 -62.440 1.00 31.80 ? 120 TYR C C   1 
ATOM   4401 O O   . TYR C 1 113 ? -5.399  -12.863 -62.430 1.00 32.47 ? 120 TYR C O   1 
ATOM   4402 C CB  . TYR C 1 113 ? -2.497  -13.458 -61.972 1.00 29.07 ? 120 TYR C CB  1 
ATOM   4403 C CG  . TYR C 1 113 ? -1.042  -13.386 -62.321 1.00 31.35 ? 120 TYR C CG  1 
ATOM   4404 C CD1 . TYR C 1 113 ? -0.428  -14.364 -63.093 1.00 30.40 ? 120 TYR C CD1 1 
ATOM   4405 C CD2 . TYR C 1 113 ? -0.223  -12.399 -61.747 1.00 35.24 ? 120 TYR C CD2 1 
ATOM   4406 C CE1 . TYR C 1 113 ? 0.938   -14.351 -63.328 1.00 32.02 ? 120 TYR C CE1 1 
ATOM   4407 C CE2 . TYR C 1 113 ? 1.151   -12.362 -62.015 1.00 35.80 ? 120 TYR C CE2 1 
ATOM   4408 C CZ  . TYR C 1 113 ? 1.737   -13.348 -62.793 1.00 34.05 ? 120 TYR C CZ  1 
ATOM   4409 O OH  . TYR C 1 113 ? 3.114   -13.329 -63.037 1.00 31.68 ? 120 TYR C OH  1 
ATOM   4410 N N   . LYS C 1 114 ? -5.360  -15.067 -61.893 1.00 31.04 ? 121 LYS C N   1 
ATOM   4411 C CA  . LYS C 1 114 ? -6.663  -15.124 -61.271 1.00 31.15 ? 121 LYS C CA  1 
ATOM   4412 C C   . LYS C 1 114 ? -6.514  -15.789 -59.919 1.00 28.80 ? 121 LYS C C   1 
ATOM   4413 O O   . LYS C 1 114 ? -6.076  -16.945 -59.816 1.00 27.73 ? 121 LYS C O   1 
ATOM   4414 C CB  . LYS C 1 114 ? -7.660  -15.895 -62.138 1.00 33.75 ? 121 LYS C CB  1 
ATOM   4415 C CG  . LYS C 1 114 ? -8.018  -15.162 -63.404 1.00 37.73 ? 121 LYS C CG  1 
ATOM   4416 C CD  . LYS C 1 114 ? -8.809  -16.101 -64.293 1.00 42.75 ? 121 LYS C CD  1 
ATOM   4417 C CE  . LYS C 1 114 ? -9.233  -15.411 -65.568 1.00 46.76 ? 121 LYS C CE  1 
ATOM   4418 N NZ  . LYS C 1 114 ? -10.244 -16.244 -66.286 1.00 50.85 ? 121 LYS C NZ  1 
ATOM   4419 N N   . VAL C 1 115 ? -6.887  -15.057 -58.867 1.00 27.98 ? 122 VAL C N   1 
ATOM   4420 C CA  . VAL C 1 115 ? -6.689  -15.522 -57.505 1.00 27.61 ? 122 VAL C CA  1 
ATOM   4421 C C   . VAL C 1 115 ? -8.015  -15.546 -56.753 1.00 26.58 ? 122 VAL C C   1 
ATOM   4422 O O   . VAL C 1 115 ? -8.873  -14.657 -56.970 1.00 28.24 ? 122 VAL C O   1 
ATOM   4423 C CB  . VAL C 1 115 ? -5.748  -14.557 -56.762 1.00 27.92 ? 122 VAL C CB  1 
ATOM   4424 C CG1 . VAL C 1 115 ? -5.297  -15.129 -55.422 1.00 27.17 ? 122 VAL C CG1 1 
ATOM   4425 C CG2 . VAL C 1 115 ? -4.588  -14.153 -57.632 1.00 29.30 ? 122 VAL C CG2 1 
ATOM   4426 N N   . LYS C 1 116 ? -8.190  -16.571 -55.927 1.00 25.35 ? 123 LYS C N   1 
ATOM   4427 C CA  . LYS C 1 116 ? -9.296  -16.709 -54.984 1.00 27.30 ? 123 LYS C CA  1 
ATOM   4428 C C   . LYS C 1 116 ? -8.704  -16.927 -53.598 1.00 25.40 ? 123 LYS C C   1 
ATOM   4429 O O   . LYS C 1 116 ? -7.781  -17.728 -53.435 1.00 25.59 ? 123 LYS C O   1 
ATOM   4430 C CB  . LYS C 1 116 ? -10.196 -17.884 -55.375 1.00 28.40 ? 123 LYS C CB  1 
ATOM   4431 C CG  . LYS C 1 116 ? -10.890 -17.772 -56.724 1.00 33.23 ? 123 LYS C CG  1 
ATOM   4432 C CD  . LYS C 1 116 ? -11.430 -19.134 -57.144 1.00 40.26 ? 123 LYS C CD  1 
ATOM   4433 C CE  . LYS C 1 116 ? -12.284 -19.050 -58.388 1.00 44.04 ? 123 LYS C CE  1 
ATOM   4434 N NZ  . LYS C 1 116 ? -12.281 -20.366 -59.083 1.00 48.56 ? 123 LYS C NZ  1 
ATOM   4435 N N   . LEU C 1 117 ? -9.211  -16.217 -52.588 1.00 22.70 ? 124 LEU C N   1 
ATOM   4436 C CA  . LEU C 1 117 ? -8.627  -16.255 -51.280 1.00 24.06 ? 124 LEU C CA  1 
ATOM   4437 C C   . LEU C 1 117 ? -9.707  -16.316 -50.192 1.00 23.07 ? 124 LEU C C   1 
ATOM   4438 O O   . LEU C 1 117 ? -10.766 -15.590 -50.285 1.00 23.59 ? 124 LEU C O   1 
ATOM   4439 C CB  . LEU C 1 117 ? -7.783  -15.013 -51.053 1.00 22.47 ? 124 LEU C CB  1 
ATOM   4440 C CG  . LEU C 1 117 ? -7.203  -14.752 -49.663 1.00 22.43 ? 124 LEU C CG  1 
ATOM   4441 C CD1 . LEU C 1 117 ? -5.904  -14.002 -49.935 1.00 22.65 ? 124 LEU C CD1 1 
ATOM   4442 C CD2 . LEU C 1 117 ? -8.175  -13.998 -48.742 1.00 23.20 ? 124 LEU C CD2 1 
ATOM   4443 N N   . ARG C 1 118 ? -9.456  -17.174 -49.222 1.00 24.36 ? 125 ARG C N   1 
ATOM   4444 C CA  . ARG C 1 118 ? -10.318 -17.279 -48.060 1.00 23.26 ? 125 ARG C CA  1 
ATOM   4445 C C   . ARG C 1 118 ? -9.519  -17.195 -46.794 1.00 21.83 ? 125 ARG C C   1 
ATOM   4446 O O   . ARG C 1 118 ? -8.765  -18.127 -46.452 1.00 22.49 ? 125 ARG C O   1 
ATOM   4447 C CB  . ARG C 1 118 ? -11.194 -18.583 -48.164 1.00 27.65 ? 125 ARG C CB  1 
ATOM   4448 C CG  . ARG C 1 118 ? -12.224 -18.672 -47.034 1.00 29.02 ? 125 ARG C CG  1 
ATOM   4449 C CD  . ARG C 1 118 ? -12.789 -20.041 -46.753 1.00 32.18 ? 125 ARG C CD  1 
ATOM   4450 N NE  . ARG C 1 118 ? -13.478 -20.582 -47.914 1.00 36.41 ? 125 ARG C NE  1 
ATOM   4451 C CZ  . ARG C 1 118 ? -13.184 -21.724 -48.543 1.00 34.50 ? 125 ARG C CZ  1 
ATOM   4452 N NH1 . ARG C 1 118 ? -13.937 -22.067 -49.582 1.00 37.47 ? 125 ARG C NH1 1 
ATOM   4453 N NH2 . ARG C 1 118 ? -12.173 -22.481 -48.178 1.00 36.23 ? 125 ARG C NH2 1 
ATOM   4454 N N   . GLY C 1 119 ? -9.826  -16.197 -45.986 1.00 20.08 ? 126 GLY C N   1 
ATOM   4455 C CA  . GLY C 1 119 ? -9.226  -15.951 -44.708 1.00 21.23 ? 126 GLY C CA  1 
ATOM   4456 C C   . GLY C 1 119 ? -10.292 -16.185 -43.649 1.00 21.06 ? 126 GLY C C   1 
ATOM   4457 O O   . GLY C 1 119 ? -11.385 -15.580 -43.749 1.00 21.97 ? 126 GLY C O   1 
ATOM   4458 N N   . THR C 1 120 ? -10.010 -17.019 -42.670 1.00 20.23 ? 127 THR C N   1 
ATOM   4459 C CA  . THR C 1 120 ? -10.954 -17.297 -41.569 1.00 19.85 ? 127 THR C CA  1 
ATOM   4460 C C   . THR C 1 120 ? -10.265 -17.347 -40.266 1.00 19.88 ? 127 THR C C   1 
ATOM   4461 O O   . THR C 1 120 ? -9.053  -17.536 -40.202 1.00 19.84 ? 127 THR C O   1 
ATOM   4462 C CB  . THR C 1 120 ? -11.650 -18.651 -41.917 1.00 21.98 ? 127 THR C CB  1 
ATOM   4463 O OG1 . THR C 1 120 ? -10.638 -19.637 -42.113 1.00 20.68 ? 127 THR C OG1 1 
ATOM   4464 C CG2 . THR C 1 120 ? -12.414 -18.568 -43.176 1.00 22.58 ? 127 THR C CG2 1 
ATOM   4465 N N   . ASN C 1 121 ? -11.042 -17.267 -39.220 1.00 17.86 ? 128 ASN C N   1 
ATOM   4466 C CA  . ASN C 1 121 ? -10.624 -17.524 -37.883 1.00 24.03 ? 128 ASN C CA  1 
ATOM   4467 C C   . ASN C 1 121 ? -9.550  -16.554 -37.369 1.00 20.21 ? 128 ASN C C   1 
ATOM   4468 O O   . ASN C 1 121 ? -8.803  -16.897 -36.477 1.00 21.09 ? 128 ASN C O   1 
ATOM   4469 C CB  . ASN C 1 121 ? -10.130 -18.950 -37.754 1.00 23.01 ? 128 ASN C CB  1 
ATOM   4470 C CG  . ASN C 1 121 ? -10.218 -19.463 -36.354 1.00 25.48 ? 128 ASN C CG  1 
ATOM   4471 O OD1 . ASN C 1 121 ? -11.242 -19.315 -35.725 1.00 27.81 ? 128 ASN C OD1 1 
ATOM   4472 N ND2 . ASN C 1 121 ? -9.168  -20.069 -35.871 1.00 26.31 ? 128 ASN C ND2 1 
ATOM   4473 N N   . PHE C 1 122 ? -9.557  -15.336 -37.905 1.00 20.41 ? 129 PHE C N   1 
ATOM   4474 C CA  . PHE C 1 122 ? -8.740  -14.272 -37.310 1.00 20.28 ? 129 PHE C CA  1 
ATOM   4475 C C   . PHE C 1 122 ? -9.376  -13.689 -36.040 1.00 20.39 ? 129 PHE C C   1 
ATOM   4476 O O   . PHE C 1 122 ? -10.583 -13.384 -36.086 1.00 22.70 ? 129 PHE C O   1 
ATOM   4477 C CB  . PHE C 1 122 ? -8.511  -13.221 -38.346 1.00 20.73 ? 129 PHE C CB  1 
ATOM   4478 C CG  . PHE C 1 122 ? -7.517  -13.617 -39.371 1.00 20.98 ? 129 PHE C CG  1 
ATOM   4479 C CD1 . PHE C 1 122 ? -6.173  -13.711 -39.069 1.00 19.96 ? 129 PHE C CD1 1 
ATOM   4480 C CD2 . PHE C 1 122 ? -7.925  -13.888 -40.667 1.00 20.49 ? 129 PHE C CD2 1 
ATOM   4481 C CE1 . PHE C 1 122 ? -5.221  -14.078 -40.018 1.00 19.59 ? 129 PHE C CE1 1 
ATOM   4482 C CE2 . PHE C 1 122 ? -7.019  -14.321 -41.601 1.00 21.49 ? 129 PHE C CE2 1 
ATOM   4483 C CZ  . PHE C 1 122 ? -5.646  -14.419 -41.286 1.00 20.75 ? 129 PHE C CZ  1 
ATOM   4484 N N   . PRO C 1 123 ? -8.616  -13.668 -34.905 1.00 22.95 ? 130 PRO C N   1 
ATOM   4485 C CA  . PRO C 1 123 ? -9.205  -13.151 -33.653 1.00 22.92 ? 130 PRO C CA  1 
ATOM   4486 C C   . PRO C 1 123 ? -9.636  -11.690 -33.855 1.00 24.95 ? 130 PRO C C   1 
ATOM   4487 O O   . PRO C 1 123 ? -8.960  -11.005 -34.546 1.00 21.73 ? 130 PRO C O   1 
ATOM   4488 C CB  . PRO C 1 123 ? -8.044  -13.235 -32.648 1.00 23.59 ? 130 PRO C CB  1 
ATOM   4489 C CG  . PRO C 1 123 ? -7.113  -14.254 -33.200 1.00 25.64 ? 130 PRO C CG  1 
ATOM   4490 C CD  . PRO C 1 123 ? -7.244  -14.169 -34.704 1.00 22.19 ? 130 PRO C CD  1 
ATOM   4491 N N   . SER C 1 124 ? -10.746 -11.261 -33.243 1.00 25.16 ? 131 SER C N   1 
ATOM   4492 C CA  . SER C 1 124 ? -11.301 -9.919  -33.492 1.00 26.89 ? 131 SER C CA  1 
ATOM   4493 C C   . SER C 1 124 ? -10.305 -8.875  -33.084 1.00 27.45 ? 131 SER C C   1 
ATOM   4494 O O   . SER C 1 124 ? -10.246 -7.843  -33.682 1.00 28.66 ? 131 SER C O   1 
ATOM   4495 C CB  . SER C 1 124 ? -12.586 -9.661  -32.699 1.00 29.30 ? 131 SER C CB  1 
ATOM   4496 O OG  . SER C 1 124 ? -12.476 -10.299 -31.422 1.00 36.63 ? 131 SER C OG  1 
ATOM   4497 N N   . ASP C 1 125 ? -9.531  -9.167  -32.045 1.00 24.95 ? 132 ASP C N   1 
ATOM   4498 C CA  . ASP C 1 125 ? -8.582  -8.190  -31.519 1.00 26.21 ? 132 ASP C CA  1 
ATOM   4499 C C   . ASP C 1 125 ? -7.121  -8.477  -31.847 1.00 24.82 ? 132 ASP C C   1 
ATOM   4500 O O   . ASP C 1 125 ? -6.218  -7.959  -31.171 1.00 24.26 ? 132 ASP C O   1 
ATOM   4501 C CB  . ASP C 1 125 ? -8.791  -8.130  -29.989 1.00 27.71 ? 132 ASP C CB  1 
ATOM   4502 C CG  . ASP C 1 125 ? -8.432  -9.446  -29.289 1.00 33.06 ? 132 ASP C CG  1 
ATOM   4503 O OD1 . ASP C 1 125 ? -8.216  -10.503 -29.930 1.00 30.39 ? 132 ASP C OD1 1 
ATOM   4504 O OD2 . ASP C 1 125 ? -8.373  -9.430  -28.034 1.00 37.51 ? 132 ASP C OD2 1 
ATOM   4505 N N   . GLY C 1 126 ? -6.866  -9.337  -32.876 1.00 22.51 ? 133 GLY C N   1 
ATOM   4506 C CA  . GLY C 1 126 ? -5.535  -9.668  -33.302 1.00 23.14 ? 133 GLY C CA  1 
ATOM   4507 C C   . GLY C 1 126 ? -4.967  -8.718  -34.310 1.00 22.85 ? 133 GLY C C   1 
ATOM   4508 O O   . GLY C 1 126 ? -5.625  -7.707  -34.657 1.00 21.71 ? 133 GLY C O   1 
ATOM   4509 N N   . PRO C 1 127 ? -3.721  -8.966  -34.708 1.00 22.32 ? 134 PRO C N   1 
ATOM   4510 C CA  . PRO C 1 127 ? -2.966  -8.045  -35.547 1.00 21.64 ? 134 PRO C CA  1 
ATOM   4511 C C   . PRO C 1 127 ? -3.518  -7.872  -36.940 1.00 22.53 ? 134 PRO C C   1 
ATOM   4512 O O   . PRO C 1 127 ? -3.354  -6.823  -37.544 1.00 23.66 ? 134 PRO C O   1 
ATOM   4513 C CB  . PRO C 1 127 ? -1.574  -8.680  -35.674 1.00 24.53 ? 134 PRO C CB  1 
ATOM   4514 C CG  . PRO C 1 127 ? -1.607  -9.897  -34.876 1.00 24.45 ? 134 PRO C CG  1 
ATOM   4515 C CD  . PRO C 1 127 ? -2.835  -9.963  -34.058 1.00 22.24 ? 134 PRO C CD  1 
ATOM   4516 N N   . VAL C 1 128 ? -4.191  -8.880  -37.459 1.00 20.09 ? 135 VAL C N   1 
ATOM   4517 C CA  . VAL C 1 128 ? -4.783  -8.708  -38.755 1.00 19.80 ? 135 VAL C CA  1 
ATOM   4518 C C   . VAL C 1 128 ? -6.088  -7.871  -38.703 1.00 20.96 ? 135 VAL C C   1 
ATOM   4519 O O   . VAL C 1 128 ? -6.185  -6.884  -39.420 1.00 24.95 ? 135 VAL C O   1 
ATOM   4520 C CB  . VAL C 1 128 ? -5.031  -10.085 -39.402 1.00 20.54 ? 135 VAL C CB  1 
ATOM   4521 C CG1 . VAL C 1 128 ? -5.875  -9.921  -40.624 1.00 21.52 ? 135 VAL C CG1 1 
ATOM   4522 C CG2 . VAL C 1 128 ? -3.710  -10.756 -39.707 1.00 20.41 ? 135 VAL C CG2 1 
ATOM   4523 N N   . MET C 1 129 ? -6.989  -8.142  -37.760 1.00 21.74 ? 136 MET C N   1 
ATOM   4524 C CA  . MET C 1 129 ? -8.235  -7.389  -37.754 1.00 22.66 ? 136 MET C CA  1 
ATOM   4525 C C   . MET C 1 129 ? -8.098  -6.003  -37.070 1.00 23.24 ? 136 MET C C   1 
ATOM   4526 O O   . MET C 1 129 ? -8.989  -5.179  -37.185 1.00 23.12 ? 136 MET C O   1 
ATOM   4527 C CB  . MET C 1 129 ? -9.354  -8.189  -37.117 1.00 23.05 ? 136 MET C CB  1 
ATOM   4528 C CG  . MET C 1 129 ? -9.644  -9.586  -37.721 1.00 24.50 ? 136 MET C CG  1 
ATOM   4529 S SD  . MET C 1 129 ? -9.865  -9.525  -39.510 1.00 28.28 ? 136 MET C SD  1 
ATOM   4530 C CE  . MET C 1 129 ? -11.420 -8.716  -39.749 1.00 29.05 ? 136 MET C CE  1 
ATOM   4531 N N   . GLN C 1 130 ? -7.032  -5.799  -36.318 1.00 22.79 ? 137 GLN C N   1 
ATOM   4532 C CA  . GLN C 1 130 ? -6.723  -4.496  -35.696 1.00 21.13 ? 137 GLN C CA  1 
ATOM   4533 C C   . GLN C 1 130 ? -5.635  -3.739  -36.409 1.00 22.65 ? 137 GLN C C   1 
ATOM   4534 O O   . GLN C 1 130 ? -5.106  -2.710  -35.918 1.00 21.73 ? 137 GLN C O   1 
ATOM   4535 C CB  . GLN C 1 130 ? -6.426  -4.735  -34.192 1.00 20.78 ? 137 GLN C CB  1 
ATOM   4536 C CG  . GLN C 1 130 ? -7.593  -5.261  -33.414 1.00 20.84 ? 137 GLN C CG  1 
ATOM   4537 C CD  . GLN C 1 130 ? -8.772  -4.268  -33.480 1.00 23.30 ? 137 GLN C CD  1 
ATOM   4538 O OE1 . GLN C 1 130 ? -8.554  -3.056  -33.373 1.00 25.37 ? 137 GLN C OE1 1 
ATOM   4539 N NE2 . GLN C 1 130 ? -9.988  -4.762  -33.592 1.00 24.67 ? 137 GLN C NE2 1 
ATOM   4540 N N   . LYS C 1 131 ? -5.296  -4.165  -37.639 1.00 22.02 ? 138 LYS C N   1 
ATOM   4541 C CA  . LYS C 1 131 ? -4.330  -3.487  -38.488 1.00 21.92 ? 138 LYS C CA  1 
ATOM   4542 C C   . LYS C 1 131 ? -2.995  -3.140  -37.749 1.00 23.09 ? 138 LYS C C   1 
ATOM   4543 O O   . LYS C 1 131 ? -2.568  -1.980  -37.785 1.00 21.46 ? 138 LYS C O   1 
ATOM   4544 C CB  . LYS C 1 131 ? -4.971  -2.268  -39.130 1.00 22.66 ? 138 LYS C CB  1 
ATOM   4545 C CG  . LYS C 1 131 ? -6.141  -2.526  -40.053 1.00 25.61 ? 138 LYS C CG  1 
ATOM   4546 C CD  . LYS C 1 131 ? -6.710  -1.263  -40.707 1.00 30.09 ? 138 LYS C CD  1 
ATOM   4547 C CE  . LYS C 1 131 ? -7.920  -1.602  -41.580 1.00 32.47 ? 138 LYS C CE  1 
ATOM   4548 N NZ  . LYS C 1 131 ? -8.571  -0.321  -42.042 1.00 40.10 ? 138 LYS C NZ  1 
ATOM   4549 N N   . LYS C 1 132 ? -2.385  -4.132  -37.069 1.00 21.68 ? 139 LYS C N   1 
ATOM   4550 C CA  . LYS C 1 132 ? -1.134  -3.986  -36.328 1.00 22.50 ? 139 LYS C CA  1 
ATOM   4551 C C   . LYS C 1 132 ? 0.110   -4.337  -37.133 1.00 23.08 ? 139 LYS C C   1 
ATOM   4552 O O   . LYS C 1 132 ? 1.194   -4.194  -36.648 1.00 23.59 ? 139 LYS C O   1 
ATOM   4553 C CB  . LYS C 1 132 ? -1.154  -4.775  -35.015 1.00 24.45 ? 139 LYS C CB  1 
ATOM   4554 C CG  . LYS C 1 132 ? -2.244  -4.369  -34.076 1.00 25.72 ? 139 LYS C CG  1 
ATOM   4555 C CD  . LYS C 1 132 ? -2.212  -5.241  -32.819 1.00 26.71 ? 139 LYS C CD  1 
ATOM   4556 C CE  . LYS C 1 132 ? -3.426  -5.079  -31.942 1.00 28.33 ? 139 LYS C CE  1 
ATOM   4557 N NZ  . LYS C 1 132 ? -3.026  -5.399  -30.527 1.00 30.62 ? 139 LYS C NZ  1 
ATOM   4558 N N   . THR C 1 133 ? -0.036  -4.763  -38.395 1.00 24.88 ? 140 THR C N   1 
ATOM   4559 C CA  . THR C 1 133 ? 1.105   -5.255  -39.132 1.00 23.88 ? 140 THR C CA  1 
ATOM   4560 C C   . THR C 1 133 ? 1.634   -4.153  -39.996 1.00 24.92 ? 140 THR C C   1 
ATOM   4561 O O   . THR C 1 133 ? 0.900   -3.229  -40.359 1.00 25.33 ? 140 THR C O   1 
ATOM   4562 C CB  . THR C 1 133 ? 0.819   -6.531  -39.978 1.00 24.77 ? 140 THR C CB  1 
ATOM   4563 O OG1 . THR C 1 133 ? -0.150  -6.270  -40.984 1.00 27.71 ? 140 THR C OG1 1 
ATOM   4564 C CG2 . THR C 1 133 ? 0.290   -7.638  -39.101 1.00 23.75 ? 140 THR C CG2 1 
ATOM   4565 N N   . MET C 1 134 ? 2.914   -4.270  -40.330 1.00 24.45 ? 141 MET C N   1 
ATOM   4566 C CA  . MET C 1 134 ? 3.588   -3.262  -41.157 1.00 27.75 ? 141 MET C CA  1 
ATOM   4567 C C   . MET C 1 134 ? 4.644   -3.875  -42.039 1.00 28.97 ? 141 MET C C   1 
ATOM   4568 O O   . MET C 1 134 ? 5.778   -3.416  -42.135 1.00 33.10 ? 141 MET C O   1 
ATOM   4569 C CB  . MET C 1 134 ? 4.169   -2.106  -40.334 1.00 32.11 ? 141 MET C CB  1 
ATOM   4570 C CG  . MET C 1 134 ? 5.094   -2.472  -39.232 1.00 33.11 ? 141 MET C CG  1 
ATOM   4571 S SD  . MET C 1 134 ? 5.906   -0.910  -38.666 1.00 37.69 ? 141 MET C SD  1 
ATOM   4572 C CE  . MET C 1 134 ? 7.411   -1.675  -38.080 1.00 39.56 ? 141 MET C CE  1 
ATOM   4573 N N   . GLY C 1 135 ? 4.260   -4.945  -42.696 1.00 25.59 ? 142 GLY C N   1 
ATOM   4574 C CA  . GLY C 1 135 ? 5.119   -5.516  -43.730 1.00 25.27 ? 142 GLY C CA  1 
ATOM   4575 C C   . GLY C 1 135 ? 5.800   -6.827  -43.390 1.00 26.62 ? 142 GLY C C   1 
ATOM   4576 O O   . GLY C 1 135 ? 5.923   -7.233  -42.245 1.00 27.04 ? 142 GLY C O   1 
HETATM 4577 N N1  . 4OO C 1 136 ? 1.805   -11.988 -45.549 1.00 35.83 ? 143 4OO C N1  1 
HETATM 4578 N N2  . 4OO C 1 136 ? 1.655   -12.994 -44.840 1.00 47.97 ? 143 4OO C N2  1 
HETATM 4579 N N3  . 4OO C 1 136 ? 1.519   -14.059 -44.076 1.00 59.47 ? 143 4OO C N3  1 
HETATM 4580 C C   . 4OO C 1 136 ? 8.559   -8.621  -44.080 1.00 29.01 ? 143 4OO C C   1 
HETATM 4581 O O   . 4OO C 1 136 ? 9.169   -7.875  -44.875 1.00 30.33 ? 143 4OO C O   1 
HETATM 4582 C CA  . 4OO C 1 136 ? 7.081   -8.744  -44.130 1.00 26.24 ? 143 4OO C CA  1 
HETATM 4583 N N   . 4OO C 1 136 ? 6.298   -7.506  -44.403 1.00 25.17 ? 143 4OO C N   1 
HETATM 4584 C CB  . 4OO C 1 136 ? 6.939   -9.642  -45.336 1.00 28.31 ? 143 4OO C CB  1 
HETATM 4585 C CG  . 4OO C 1 136 ? 5.598   -10.268 -45.368 1.00 32.38 ? 143 4OO C CG  1 
HETATM 4586 C CD2 . 4OO C 1 136 ? 4.639   -9.716  -46.175 1.00 28.32 ? 143 4OO C CD2 1 
HETATM 4587 C CE2 . 4OO C 1 136 ? 3.390   -10.295 -46.229 1.00 30.26 ? 143 4OO C CE2 1 
HETATM 4588 C CZ  . 4OO C 1 136 ? 3.093   -11.426 -45.491 1.00 30.67 ? 143 4OO C CZ  1 
HETATM 4589 C CE1 . 4OO C 1 136 ? 4.082   -12.009 -44.686 1.00 32.21 ? 143 4OO C CE1 1 
HETATM 4590 C CD1 . 4OO C 1 136 ? 5.352   -11.431 -44.601 1.00 30.49 ? 143 4OO C CD1 1 
ATOM   4591 N N   . GLU C 1 137 ? 9.183   -9.420  -43.247 1.00 27.03 ? 144 GLU C N   1 
ATOM   4592 C CA  . GLU C 1 137 ? 10.622  -9.498  -43.221 1.00 28.60 ? 144 GLU C CA  1 
ATOM   4593 C C   . GLU C 1 137 ? 10.991  -10.241 -44.485 1.00 28.41 ? 144 GLU C C   1 
ATOM   4594 O O   . GLU C 1 137 ? 10.166  -10.972 -45.031 1.00 28.54 ? 144 GLU C O   1 
ATOM   4595 C CB  . GLU C 1 137 ? 11.077  -10.284 -42.007 1.00 29.38 ? 144 GLU C CB  1 
ATOM   4596 C CG  . GLU C 1 137 ? 10.937  -9.574  -40.638 1.00 35.21 ? 144 GLU C CG  1 
ATOM   4597 C CD  . GLU C 1 137 ? 11.941  -8.460  -40.427 1.00 39.89 ? 144 GLU C CD  1 
ATOM   4598 O OE1 . GLU C 1 137 ? 12.745  -8.170  -41.333 1.00 42.56 ? 144 GLU C OE1 1 
ATOM   4599 O OE2 . GLU C 1 137 ? 11.889  -7.824  -39.339 1.00 42.65 ? 144 GLU C OE2 1 
ATOM   4600 N N   . ALA C 1 138 ? 12.192  -10.011 -44.997 1.00 31.62 ? 145 ALA C N   1 
ATOM   4601 C CA  . ALA C 1 138 ? 12.733  -10.849 -46.082 1.00 28.28 ? 145 ALA C CA  1 
ATOM   4602 C C   . ALA C 1 138 ? 12.521  -12.299 -45.690 1.00 27.66 ? 145 ALA C C   1 
ATOM   4603 O O   . ALA C 1 138 ? 12.685  -12.649 -44.524 1.00 26.27 ? 145 ALA C O   1 
ATOM   4604 C CB  . ALA C 1 138 ? 14.230  -10.644 -46.175 1.00 30.45 ? 145 ALA C CB  1 
ATOM   4605 N N   . SER C 1 139 ? 12.244  -13.163 -46.633 1.00 26.12 ? 146 SER C N   1 
ATOM   4606 C CA  . SER C 1 139 ? 12.003  -14.571 -46.273 1.00 28.54 ? 146 SER C CA  1 
ATOM   4607 C C   . SER C 1 139 ? 12.575  -15.480 -47.305 1.00 26.94 ? 146 SER C C   1 
ATOM   4608 O O   . SER C 1 139 ? 12.962  -15.019 -48.350 1.00 28.14 ? 146 SER C O   1 
ATOM   4609 C CB  . SER C 1 139 ? 10.527  -14.858 -46.139 1.00 32.41 ? 146 SER C CB  1 
ATOM   4610 O OG  . SER C 1 139 ? 9.919   -14.836 -47.403 1.00 36.05 ? 146 SER C OG  1 
ATOM   4611 N N   . SER C 1 140 ? 12.659  -16.765 -46.972 1.00 25.69 ? 147 SER C N   1 
ATOM   4612 C CA  . SER C 1 140 ? 13.276  -17.737 -47.911 1.00 25.62 ? 147 SER C CA  1 
ATOM   4613 C C   . SER C 1 140 ? 12.266  -18.858 -48.134 1.00 24.16 ? 147 SER C C   1 
ATOM   4614 O O   . SER C 1 140 ? 11.771  -19.418 -47.155 1.00 24.70 ? 147 SER C O   1 
ATOM   4615 C CB  . SER C 1 140 ? 14.515  -18.292 -47.198 1.00 30.26 ? 147 SER C CB  1 
ATOM   4616 O OG  . SER C 1 140 ? 15.079  -19.342 -47.932 1.00 34.77 ? 147 SER C OG  1 
ATOM   4617 N N   . GLU C 1 141 ? 11.955  -19.170 -49.378 1.00 23.59 ? 148 GLU C N   1 
ATOM   4618 C CA  . GLU C 1 141 ? 11.044  -20.287 -49.642 1.00 25.10 ? 148 GLU C CA  1 
ATOM   4619 C C   . GLU C 1 141 ? 11.876  -21.552 -49.992 1.00 24.87 ? 148 GLU C C   1 
ATOM   4620 O O   . GLU C 1 141 ? 12.680  -21.516 -50.898 1.00 26.26 ? 148 GLU C O   1 
ATOM   4621 C CB  . GLU C 1 141 ? 10.106  -19.959 -50.771 1.00 26.03 ? 148 GLU C CB  1 
ATOM   4622 C CG  . GLU C 1 141 ? 8.959   -20.954 -50.949 1.00 28.27 ? 148 GLU C CG  1 
ATOM   4623 C CD  . GLU C 1 141 ? 7.884   -20.492 -51.963 1.00 32.80 ? 148 GLU C CD  1 
ATOM   4624 O OE1 . GLU C 1 141 ? 8.177   -19.576 -52.772 1.00 34.35 ? 148 GLU C OE1 1 
ATOM   4625 O OE2 . GLU C 1 141 ? 6.750   -21.064 -51.995 1.00 33.24 ? 148 GLU C OE2 1 
ATOM   4626 N N   . ARG C 1 142 ? 11.686  -22.630 -49.265 1.00 23.40 ? 149 ARG C N   1 
ATOM   4627 C CA  . ARG C 1 142 ? 12.469  -23.862 -49.543 1.00 27.17 ? 149 ARG C CA  1 
ATOM   4628 C C   . ARG C 1 142 ? 11.650  -24.665 -50.549 1.00 25.40 ? 149 ARG C C   1 
ATOM   4629 O O   . ARG C 1 142 ? 10.507  -24.977 -50.198 1.00 25.06 ? 149 ARG C O   1 
ATOM   4630 C CB  . ARG C 1 142 ? 12.666  -24.633 -48.275 1.00 30.20 ? 149 ARG C CB  1 
ATOM   4631 C CG  . ARG C 1 142 ? 13.651  -23.992 -47.294 1.00 36.51 ? 149 ARG C CG  1 
ATOM   4632 C CD  . ARG C 1 142 ? 12.953  -23.198 -46.200 1.00 42.52 ? 149 ARG C CD  1 
ATOM   4633 N NE  . ARG C 1 142 ? 12.129  -24.039 -45.308 1.00 47.93 ? 149 ARG C NE  1 
ATOM   4634 C CZ  . ARG C 1 142 ? 11.033  -23.619 -44.661 1.00 50.62 ? 149 ARG C CZ  1 
ATOM   4635 N NH1 . ARG C 1 142 ? 10.601  -22.387 -44.821 1.00 49.45 ? 149 ARG C NH1 1 
ATOM   4636 N NH2 . ARG C 1 142 ? 10.345  -24.436 -43.866 1.00 55.59 ? 149 ARG C NH2 1 
ATOM   4637 N N   . MET C 1 143 ? 12.217  -24.963 -51.732 1.00 24.16 ? 150 MET C N   1 
ATOM   4638 C CA  . MET C 1 143 ? 11.521  -25.611 -52.861 1.00 26.90 ? 150 MET C CA  1 
ATOM   4639 C C   . MET C 1 143 ? 11.926  -27.042 -52.985 1.00 28.43 ? 150 MET C C   1 
ATOM   4640 O O   . MET C 1 143 ? 13.106  -27.389 -52.775 1.00 28.20 ? 150 MET C O   1 
ATOM   4641 C CB  . MET C 1 143 ? 11.816  -24.966 -54.208 1.00 29.00 ? 150 MET C CB  1 
ATOM   4642 C CG  . MET C 1 143 ? 11.778  -23.446 -54.171 1.00 29.84 ? 150 MET C CG  1 
ATOM   4643 S SD  . MET C 1 143 ? 10.184  -22.786 -53.605 1.00 34.72 ? 150 MET C SD  1 
ATOM   4644 C CE  . MET C 1 143 ? 9.165   -23.518 -54.821 1.00 30.60 ? 150 MET C CE  1 
ATOM   4645 N N   . TYR C 1 144 ? 10.976  -27.906 -53.339 1.00 27.50 ? 151 TYR C N   1 
ATOM   4646 C CA  . TYR C 1 144 ? 11.346  -29.329 -53.620 1.00 27.18 ? 151 TYR C CA  1 
ATOM   4647 C C   . TYR C 1 144 ? 10.265  -30.032 -54.388 1.00 28.36 ? 151 TYR C C   1 
ATOM   4648 O O   . TYR C 1 144 ? 9.118   -29.660 -54.329 1.00 27.13 ? 151 TYR C O   1 
ATOM   4649 C CB  . TYR C 1 144 ? 11.595  -30.136 -52.352 1.00 26.36 ? 151 TYR C CB  1 
ATOM   4650 C CG  . TYR C 1 144 ? 10.402  -30.271 -51.448 1.00 26.72 ? 151 TYR C CG  1 
ATOM   4651 C CD1 . TYR C 1 144 ? 10.119  -29.275 -50.527 1.00 29.78 ? 151 TYR C CD1 1 
ATOM   4652 C CD2 . TYR C 1 144 ? 9.520   -31.336 -51.550 1.00 28.27 ? 151 TYR C CD2 1 
ATOM   4653 C CE1 . TYR C 1 144 ? 9.049   -29.396 -49.655 1.00 28.47 ? 151 TYR C CE1 1 
ATOM   4654 C CE2 . TYR C 1 144 ? 8.433   -31.461 -50.659 1.00 27.96 ? 151 TYR C CE2 1 
ATOM   4655 C CZ  . TYR C 1 144 ? 8.173   -30.442 -49.786 1.00 28.18 ? 151 TYR C CZ  1 
ATOM   4656 O OH  . TYR C 1 144 ? 7.136   -30.467 -48.873 1.00 31.90 ? 151 TYR C OH  1 
ATOM   4657 N N   . PRO C 1 145 ? 10.623  -31.070 -55.130 1.00 27.35 ? 152 PRO C N   1 
ATOM   4658 C CA  . PRO C 1 145 ? 9.626   -31.757 -55.941 1.00 29.58 ? 152 PRO C CA  1 
ATOM   4659 C C   . PRO C 1 145 ? 8.997   -32.913 -55.241 1.00 31.30 ? 152 PRO C C   1 
ATOM   4660 O O   . PRO C 1 145 ? 9.644   -33.526 -54.406 1.00 31.40 ? 152 PRO C O   1 
ATOM   4661 C CB  . PRO C 1 145 ? 10.466  -32.284 -57.105 1.00 29.85 ? 152 PRO C CB  1 
ATOM   4662 C CG  . PRO C 1 145 ? 11.755  -32.599 -56.428 1.00 28.45 ? 152 PRO C CG  1 
ATOM   4663 C CD  . PRO C 1 145 ? 11.990  -31.489 -55.484 1.00 29.71 ? 152 PRO C CD  1 
ATOM   4664 N N   . GLU C 1 146 ? 7.705   -33.164 -55.489 1.00 32.09 ? 153 GLU C N   1 
ATOM   4665 C CA  . GLU C 1 146 ? 7.009   -34.317 -54.880 1.00 33.10 ? 153 GLU C CA  1 
ATOM   4666 C C   . GLU C 1 146 ? 5.764   -34.555 -55.706 1.00 36.36 ? 153 GLU C C   1 
ATOM   4667 O O   . GLU C 1 146 ? 5.083   -33.578 -56.051 1.00 31.77 ? 153 GLU C O   1 
ATOM   4668 C CB  . GLU C 1 146 ? 6.572   -34.011 -53.466 1.00 32.28 ? 153 GLU C CB  1 
ATOM   4669 C CG  . GLU C 1 146 ? 5.897   -35.150 -52.705 1.00 34.66 ? 153 GLU C CG  1 
ATOM   4670 C CD  . GLU C 1 146 ? 5.778   -34.805 -51.238 1.00 34.42 ? 153 GLU C CD  1 
ATOM   4671 O OE1 . GLU C 1 146 ? 5.397   -33.660 -50.947 1.00 38.47 ? 153 GLU C OE1 1 
ATOM   4672 O OE2 . GLU C 1 146 ? 6.084   -35.660 -50.365 1.00 35.14 ? 153 GLU C OE2 1 
ATOM   4673 N N   . ASP C 1 147 ? 5.499   -35.837 -55.981 1.00 38.88 ? 154 ASP C N   1 
ATOM   4674 C CA  . ASP C 1 147 ? 4.280   -36.282 -56.676 1.00 41.75 ? 154 ASP C CA  1 
ATOM   4675 C C   . ASP C 1 147 ? 4.032   -35.426 -57.924 1.00 39.62 ? 154 ASP C C   1 
ATOM   4676 O O   . ASP C 1 147 ? 2.899   -35.083 -58.185 1.00 39.77 ? 154 ASP C O   1 
ATOM   4677 C CB  . ASP C 1 147 ? 3.032   -36.138 -55.783 1.00 43.22 ? 154 ASP C CB  1 
ATOM   4678 C CG  . ASP C 1 147 ? 3.078   -36.966 -54.521 1.00 47.01 ? 154 ASP C CG  1 
ATOM   4679 O OD1 . ASP C 1 147 ? 3.728   -38.040 -54.507 1.00 55.53 ? 154 ASP C OD1 1 
ATOM   4680 O OD2 . ASP C 1 147 ? 2.402   -36.549 -53.551 1.00 46.95 ? 154 ASP C OD2 1 
ATOM   4681 N N   . GLY C 1 148 ? 5.076   -35.019 -58.635 1.00 36.02 ? 155 GLY C N   1 
ATOM   4682 C CA  . GLY C 1 148 ? 4.897   -34.354 -59.907 1.00 34.44 ? 155 GLY C CA  1 
ATOM   4683 C C   . GLY C 1 148 ? 4.621   -32.864 -59.904 1.00 33.03 ? 155 GLY C C   1 
ATOM   4684 O O   . GLY C 1 148 ? 4.284   -32.285 -60.925 1.00 34.27 ? 155 GLY C O   1 
ATOM   4685 N N   . ALA C 1 149 ? 4.847   -32.212 -58.775 1.00 29.67 ? 156 ALA C N   1 
ATOM   4686 C CA  . ALA C 1 149 ? 4.593   -30.803 -58.609 1.00 31.04 ? 156 ALA C CA  1 
ATOM   4687 C C   . ALA C 1 149 ? 5.808   -30.268 -57.865 1.00 27.88 ? 156 ALA C C   1 
ATOM   4688 O O   . ALA C 1 149 ? 6.643   -31.056 -57.351 1.00 30.86 ? 156 ALA C O   1 
ATOM   4689 C CB  . ALA C 1 149 ? 3.342   -30.605 -57.752 1.00 31.44 ? 156 ALA C CB  1 
ATOM   4690 N N   . LEU C 1 150 ? 5.839   -28.960 -57.731 1.00 29.38 ? 157 LEU C N   1 
ATOM   4691 C CA  . LEU C 1 150 ? 6.860   -28.264 -57.004 1.00 27.71 ? 157 LEU C CA  1 
ATOM   4692 C C   . LEU C 1 150 ? 6.215   -27.752 -55.723 1.00 27.74 ? 157 LEU C C   1 
ATOM   4693 O O   . LEU C 1 150 ? 5.183   -27.099 -55.778 1.00 27.07 ? 157 LEU C O   1 
ATOM   4694 C CB  . LEU C 1 150 ? 7.384   -27.131 -57.879 1.00 28.55 ? 157 LEU C CB  1 
ATOM   4695 C CG  . LEU C 1 150 ? 8.541   -26.292 -57.303 1.00 29.17 ? 157 LEU C CG  1 
ATOM   4696 C CD1 . LEU C 1 150 ? 9.748   -27.183 -57.056 1.00 29.68 ? 157 LEU C CD1 1 
ATOM   4697 C CD2 . LEU C 1 150 ? 8.836   -25.182 -58.296 1.00 29.97 ? 157 LEU C CD2 1 
ATOM   4698 N N   . LYS C 1 151 ? 6.805   -28.061 -54.586 1.00 25.65 ? 158 LYS C N   1 
ATOM   4699 C CA  . LYS C 1 151 ? 6.313   -27.565 -53.333 1.00 26.13 ? 158 LYS C CA  1 
ATOM   4700 C C   . LYS C 1 151 ? 7.264   -26.511 -52.822 1.00 27.01 ? 158 LYS C C   1 
ATOM   4701 O O   . LYS C 1 151 ? 8.488   -26.669 -52.922 1.00 29.25 ? 158 LYS C O   1 
ATOM   4702 C CB  . LYS C 1 151 ? 6.272   -28.679 -52.323 1.00 29.50 ? 158 LYS C CB  1 
ATOM   4703 C CG  . LYS C 1 151 ? 5.696   -29.968 -52.876 1.00 30.43 ? 158 LYS C CG  1 
ATOM   4704 C CD  . LYS C 1 151 ? 4.203   -29.962 -52.787 1.00 33.25 ? 158 LYS C CD  1 
ATOM   4705 C CE  . LYS C 1 151 ? 3.580   -31.241 -53.345 1.00 33.39 ? 158 LYS C CE  1 
ATOM   4706 N NZ  . LYS C 1 151 ? 3.238   -32.164 -52.248 1.00 34.80 ? 158 LYS C NZ  1 
ATOM   4707 N N   . GLY C 1 152 ? 6.714   -25.438 -52.266 1.00 26.46 ? 159 GLY C N   1 
ATOM   4708 C CA  . GLY C 1 152 ? 7.487   -24.496 -51.459 1.00 24.26 ? 159 GLY C CA  1 
ATOM   4709 C C   . GLY C 1 152 ? 6.985   -24.295 -50.076 1.00 24.27 ? 159 GLY C C   1 
ATOM   4710 O O   . GLY C 1 152 ? 5.781   -24.314 -49.832 1.00 24.44 ? 159 GLY C O   1 
ATOM   4711 N N   . GLU C 1 153 ? 7.900   -24.166 -49.138 1.00 23.64 ? 160 GLU C N   1 
ATOM   4712 C CA  . GLU C 1 153 ? 7.543   -23.946 -47.732 1.00 25.03 ? 160 GLU C CA  1 
ATOM   4713 C C   . GLU C 1 153 ? 8.253   -22.692 -47.190 1.00 25.14 ? 160 GLU C C   1 
ATOM   4714 O O   . GLU C 1 153 ? 9.409   -22.501 -47.486 1.00 24.11 ? 160 GLU C O   1 
ATOM   4715 C CB  . GLU C 1 153 ? 7.929   -25.144 -46.867 1.00 28.17 ? 160 GLU C CB  1 
ATOM   4716 C CG  . GLU C 1 153 ? 7.469   -26.494 -47.440 1.00 34.34 ? 160 GLU C CG  1 
ATOM   4717 C CD  . GLU C 1 153 ? 7.969   -27.668 -46.601 1.00 39.12 ? 160 GLU C CD  1 
ATOM   4718 O OE1 . GLU C 1 153 ? 7.554   -28.804 -46.866 1.00 41.36 ? 160 GLU C OE1 1 
ATOM   4719 O OE2 . GLU C 1 153 ? 8.813   -27.453 -45.712 1.00 43.85 ? 160 GLU C OE2 1 
ATOM   4720 N N   . ILE C 1 154 ? 7.550   -21.892 -46.380 1.00 23.44 ? 161 ILE C N   1 
ATOM   4721 C CA  . ILE C 1 154 ? 8.101   -20.601 -45.836 1.00 24.94 ? 161 ILE C CA  1 
ATOM   4722 C C   . ILE C 1 154 ? 7.635   -20.398 -44.435 1.00 27.59 ? 161 ILE C C   1 
ATOM   4723 O O   . ILE C 1 154 ? 6.472   -20.723 -44.101 1.00 26.33 ? 161 ILE C O   1 
ATOM   4724 C CB  . ILE C 1 154 ? 7.648   -19.360 -46.623 1.00 28.46 ? 161 ILE C CB  1 
ATOM   4725 C CG1 . ILE C 1 154 ? 7.655   -19.545 -48.107 1.00 30.57 ? 161 ILE C CG1 1 
ATOM   4726 C CG2 . ILE C 1 154 ? 8.480   -18.131 -46.166 1.00 28.81 ? 161 ILE C CG2 1 
ATOM   4727 C CD1 . ILE C 1 154 ? 6.800   -18.520 -48.832 1.00 32.91 ? 161 ILE C CD1 1 
ATOM   4728 N N   . LYS C 1 155 ? 8.547   -19.901 -43.591 1.00 26.04 ? 162 LYS C N   1 
ATOM   4729 C CA  . LYS C 1 155 ? 8.244   -19.431 -42.286 1.00 30.71 ? 162 LYS C CA  1 
ATOM   4730 C C   . LYS C 1 155 ? 8.216   -17.909 -42.391 1.00 32.39 ? 162 LYS C C   1 
ATOM   4731 O O   . LYS C 1 155 ? 9.270   -17.300 -42.619 1.00 32.73 ? 162 LYS C O   1 
ATOM   4732 C CB  . LYS C 1 155 ? 9.358   -19.811 -41.348 1.00 35.22 ? 162 LYS C CB  1 
ATOM   4733 C CG  . LYS C 1 155 ? 8.965   -20.852 -40.337 1.00 45.87 ? 162 LYS C CG  1 
ATOM   4734 C CD  . LYS C 1 155 ? 9.277   -22.264 -40.792 1.00 46.38 ? 162 LYS C CD  1 
ATOM   4735 C CE  . LYS C 1 155 ? 9.287   -23.172 -39.582 1.00 49.55 ? 162 LYS C CE  1 
ATOM   4736 N NZ  . LYS C 1 155 ? 8.069   -22.931 -38.747 1.00 53.70 ? 162 LYS C NZ  1 
ATOM   4737 N N   . GLN C 1 156 ? 7.024   -17.322 -42.370 1.00 29.12 ? 163 GLN C N   1 
ATOM   4738 C CA  . GLN C 1 156 ? 6.859   -15.876 -42.696 1.00 27.91 ? 163 GLN C CA  1 
ATOM   4739 C C   . GLN C 1 156 ? 6.785   -15.142 -41.401 1.00 25.19 ? 163 GLN C C   1 
ATOM   4740 O O   . GLN C 1 156 ? 6.254   -15.657 -40.416 1.00 24.28 ? 163 GLN C O   1 
ATOM   4741 C CB  . GLN C 1 156 ? 5.573   -15.559 -43.463 1.00 31.50 ? 163 GLN C CB  1 
ATOM   4742 C CG  . GLN C 1 156 ? 5.399   -16.026 -44.904 1.00 32.49 ? 163 GLN C CG  1 
ATOM   4743 C CD  . GLN C 1 156 ? 6.168   -15.252 -45.920 1.00 36.52 ? 163 GLN C CD  1 
ATOM   4744 O OE1 . GLN C 1 156 ? 5.760   -15.152 -47.098 1.00 45.16 ? 163 GLN C OE1 1 
ATOM   4745 N NE2 . GLN C 1 156 ? 7.279   -14.690 -45.509 1.00 33.18 ? 163 GLN C NE2 1 
ATOM   4746 N N   . ARG C 1 157 ? 7.324   -13.906 -41.399 1.00 26.14 ? 164 ARG C N   1 
ATOM   4747 C CA  . ARG C 1 157 ? 7.220   -13.048 -40.236 1.00 25.38 ? 164 ARG C CA  1 
ATOM   4748 C C   . ARG C 1 157 ? 6.710   -11.698 -40.719 1.00 24.82 ? 164 ARG C C   1 
ATOM   4749 O O   . ARG C 1 157 ? 7.285   -11.104 -41.608 1.00 26.41 ? 164 ARG C O   1 
ATOM   4750 C CB  . ARG C 1 157 ? 8.574   -12.897 -39.526 1.00 29.09 ? 164 ARG C CB  1 
ATOM   4751 C CG  . ARG C 1 157 ? 9.030   -14.190 -38.814 1.00 33.45 ? 164 ARG C CG  1 
ATOM   4752 C CD  . ARG C 1 157 ? 9.827   -13.861 -37.559 1.00 39.94 ? 164 ARG C CD  1 
ATOM   4753 N NE  . ARG C 1 157 ? 11.112  -13.295 -37.961 1.00 48.77 ? 164 ARG C NE  1 
ATOM   4754 C CZ  . ARG C 1 157 ? 11.791  -12.349 -37.301 1.00 53.76 ? 164 ARG C CZ  1 
ATOM   4755 N NH1 . ARG C 1 157 ? 11.315  -11.811 -36.188 1.00 54.28 ? 164 ARG C NH1 1 
ATOM   4756 N NH2 . ARG C 1 157 ? 12.961  -11.927 -37.775 1.00 55.50 ? 164 ARG C NH2 1 
ATOM   4757 N N   . LEU C 1 158 ? 5.605   -11.267 -40.153 1.00 23.84 ? 165 LEU C N   1 
ATOM   4758 C CA  . LEU C 1 158 ? 5.076   -9.932  -40.390 1.00 24.65 ? 165 LEU C CA  1 
ATOM   4759 C C   . LEU C 1 158 ? 5.566   -9.045  -39.263 1.00 23.24 ? 165 LEU C C   1 
ATOM   4760 O O   . LEU C 1 158 ? 5.505   -9.451  -38.095 1.00 23.65 ? 165 LEU C O   1 
ATOM   4761 C CB  . LEU C 1 158 ? 3.548   -10.028 -40.355 1.00 25.75 ? 165 LEU C CB  1 
ATOM   4762 C CG  . LEU C 1 158 ? 2.712   -9.787  -41.593 1.00 30.14 ? 165 LEU C CG  1 
ATOM   4763 C CD1 . LEU C 1 158 ? 3.500   -9.603  -42.850 1.00 32.16 ? 165 LEU C CD1 1 
ATOM   4764 C CD2 . LEU C 1 158 ? 1.420   -10.586 -41.727 1.00 29.36 ? 165 LEU C CD2 1 
ATOM   4765 N N   . LYS C 1 159 ? 6.074   -7.865  -39.598 1.00 23.24 ? 166 LYS C N   1 
ATOM   4766 C CA  . LYS C 1 159 ? 6.475   -6.921  -38.522 1.00 24.12 ? 166 LYS C CA  1 
ATOM   4767 C C   . LYS C 1 159 ? 5.252   -6.292  -37.880 1.00 22.87 ? 166 LYS C C   1 
ATOM   4768 O O   . LYS C 1 159 ? 4.278   -6.010  -38.546 1.00 23.04 ? 166 LYS C O   1 
ATOM   4769 C CB  . LYS C 1 159 ? 7.338   -5.833  -39.138 1.00 28.05 ? 166 LYS C CB  1 
ATOM   4770 C CG  . LYS C 1 159 ? 8.616   -6.318  -39.769 1.00 33.67 ? 166 LYS C CG  1 
ATOM   4771 C CD  . LYS C 1 159 ? 9.346   -5.175  -40.490 1.00 40.81 ? 166 LYS C CD  1 
ATOM   4772 C CE  . LYS C 1 159 ? 9.008   -5.154  -41.973 1.00 44.41 ? 166 LYS C CE  1 
ATOM   4773 N NZ  . LYS C 1 159 ? 10.081  -4.531  -42.825 1.00 44.67 ? 166 LYS C NZ  1 
ATOM   4774 N N   . LEU C 1 160 ? 5.308   -6.025  -36.564 1.00 20.08 ? 167 LEU C N   1 
ATOM   4775 C CA  . LEU C 1 160 ? 4.186   -5.400  -35.877 1.00 20.45 ? 167 LEU C CA  1 
ATOM   4776 C C   . LEU C 1 160 ? 4.564   -3.965  -35.571 1.00 22.59 ? 167 LEU C C   1 
ATOM   4777 O O   . LEU C 1 160 ? 5.734   -3.703  -35.310 1.00 24.06 ? 167 LEU C O   1 
ATOM   4778 C CB  . LEU C 1 160 ? 3.954   -6.097  -34.543 1.00 20.85 ? 167 LEU C CB  1 
ATOM   4779 C CG  . LEU C 1 160 ? 3.429   -7.500  -34.733 1.00 21.37 ? 167 LEU C CG  1 
ATOM   4780 C CD1 . LEU C 1 160 ? 3.460   -8.353  -33.452 1.00 23.60 ? 167 LEU C CD1 1 
ATOM   4781 C CD2 . LEU C 1 160 ? 2.051   -7.360  -35.300 1.00 21.87 ? 167 LEU C CD2 1 
ATOM   4782 N N   . LYS C 1 161 ? 3.566   -3.101  -35.615 1.00 24.47 ? 168 LYS C N   1 
ATOM   4783 C CA  . LYS C 1 161 ? 3.785   -1.650  -35.368 1.00 25.98 ? 168 LYS C CA  1 
ATOM   4784 C C   . LYS C 1 161 ? 4.310   -1.383  -33.985 1.00 28.12 ? 168 LYS C C   1 
ATOM   4785 O O   . LYS C 1 161 ? 5.070   -0.464  -33.809 1.00 28.74 ? 168 LYS C O   1 
ATOM   4786 C CB  . LYS C 1 161 ? 2.488   -0.850  -35.603 1.00 28.57 ? 168 LYS C CB  1 
ATOM   4787 C CG  . LYS C 1 161 ? 2.069   -0.817  -37.042 1.00 29.81 ? 168 LYS C CG  1 
ATOM   4788 C CD  . LYS C 1 161 ? 0.765   -0.055  -37.283 1.00 34.72 ? 168 LYS C CD  1 
ATOM   4789 C CE  . LYS C 1 161 ? 0.247   -0.362  -38.691 1.00 36.05 ? 168 LYS C CE  1 
ATOM   4790 N NZ  . LYS C 1 161 ? -0.959  0.412   -39.050 1.00 41.41 ? 168 LYS C NZ  1 
ATOM   4791 N N   . ASP C 1 162 ? 3.923   -2.163  -33.013 1.00 30.69 ? 169 ASP C N   1 
ATOM   4792 C CA  . ASP C 1 162 ? 4.372   -1.961  -31.640 1.00 36.11 ? 169 ASP C CA  1 
ATOM   4793 C C   . ASP C 1 162 ? 5.747   -2.547  -31.368 1.00 37.50 ? 169 ASP C C   1 
ATOM   4794 O O   . ASP C 1 162 ? 6.273   -2.408  -30.262 1.00 36.97 ? 169 ASP C O   1 
ATOM   4795 C CB  . ASP C 1 162 ? 3.323   -2.514  -30.682 1.00 43.22 ? 169 ASP C CB  1 
ATOM   4796 C CG  . ASP C 1 162 ? 2.311   -1.454  -30.288 1.00 51.10 ? 169 ASP C CG  1 
ATOM   4797 O OD1 . ASP C 1 162 ? 2.762   -0.407  -29.769 1.00 58.05 ? 169 ASP C OD1 1 
ATOM   4798 O OD2 . ASP C 1 162 ? 1.086   -1.665  -30.485 1.00 59.81 ? 169 ASP C OD2 1 
ATOM   4799 N N   . GLY C 1 163 ? 6.358   -3.134  -32.392 1.00 35.54 ? 170 GLY C N   1 
ATOM   4800 C CA  . GLY C 1 163 ? 7.531   -3.956  -32.244 1.00 41.24 ? 170 GLY C CA  1 
ATOM   4801 C C   . GLY C 1 163 ? 7.079   -5.412  -32.192 1.00 36.83 ? 170 GLY C C   1 
ATOM   4802 O O   . GLY C 1 163 ? 5.938   -5.745  -31.827 1.00 44.15 ? 170 GLY C O   1 
ATOM   4803 N N   . GLY C 1 164 ? 7.985   -6.280  -32.541 1.00 37.23 ? 171 GLY C N   1 
ATOM   4804 C CA  . GLY C 1 164 ? 7.706   -7.705  -32.512 1.00 32.35 ? 171 GLY C CA  1 
ATOM   4805 C C   . GLY C 1 164 ? 7.263   -8.107  -33.907 1.00 30.01 ? 171 GLY C C   1 
ATOM   4806 O O   . GLY C 1 164 ? 7.333   -7.319  -34.852 1.00 23.93 ? 171 GLY C O   1 
ATOM   4807 N N   . HIS C 1 165 ? 6.757   -9.323  -33.972 1.00 24.95 ? 172 HIS C N   1 
ATOM   4808 C CA  . HIS C 1 165 ? 6.551   -10.030 -35.213 1.00 23.59 ? 172 HIS C CA  1 
ATOM   4809 C C   . HIS C 1 165 ? 5.341   -10.939 -34.971 1.00 22.17 ? 172 HIS C C   1 
ATOM   4810 O O   . HIS C 1 165 ? 5.057   -11.432 -33.848 1.00 26.53 ? 172 HIS C O   1 
ATOM   4811 C CB  . HIS C 1 165 ? 7.783   -10.888 -35.554 1.00 26.80 ? 172 HIS C CB  1 
ATOM   4812 C CG  . HIS C 1 165 ? 8.181   -11.853 -34.440 1.00 32.23 ? 172 HIS C CG  1 
ATOM   4813 N ND1 . HIS C 1 165 ? 7.764   -13.180 -34.395 1.00 33.92 ? 172 HIS C ND1 1 
ATOM   4814 C CD2 . HIS C 1 165 ? 8.959   -11.681 -33.340 1.00 36.78 ? 172 HIS C CD2 1 
ATOM   4815 C CE1 . HIS C 1 165 ? 8.272   -13.776 -33.328 1.00 36.09 ? 172 HIS C CE1 1 
ATOM   4816 N NE2 . HIS C 1 165 ? 9.000   -12.888 -32.665 1.00 36.61 ? 172 HIS C NE2 1 
ATOM   4817 N N   . TYR C 1 166 ? 4.674   -11.232 -36.044 1.00 20.37 ? 173 TYR C N   1 
ATOM   4818 C CA  . TYR C 1 166 ? 3.531   -12.128 -36.061 1.00 19.74 ? 173 TYR C CA  1 
ATOM   4819 C C   . TYR C 1 166 ? 3.781   -13.121 -37.196 1.00 20.58 ? 173 TYR C C   1 
ATOM   4820 O O   . TYR C 1 166 ? 4.053   -12.756 -38.285 1.00 22.28 ? 173 TYR C O   1 
ATOM   4821 C CB  . TYR C 1 166 ? 2.307   -11.312 -36.387 1.00 21.17 ? 173 TYR C CB  1 
ATOM   4822 C CG  . TYR C 1 166 ? 1.029   -12.051 -36.701 1.00 19.20 ? 173 TYR C CG  1 
ATOM   4823 C CD1 . TYR C 1 166 ? 0.410   -12.842 -35.783 1.00 20.67 ? 173 TYR C CD1 1 
ATOM   4824 C CD2 . TYR C 1 166 ? 0.404   -11.867 -37.912 1.00 19.07 ? 173 TYR C CD2 1 
ATOM   4825 C CE1 . TYR C 1 166 ? -0.829  -13.469 -36.055 1.00 19.72 ? 173 TYR C CE1 1 
ATOM   4826 C CE2 . TYR C 1 166 ? -0.864  -12.429 -38.191 1.00 19.91 ? 173 TYR C CE2 1 
ATOM   4827 C CZ  . TYR C 1 166 ? -1.452  -13.251 -37.286 1.00 18.78 ? 173 TYR C CZ  1 
ATOM   4828 O OH  . TYR C 1 166 ? -2.689  -13.822 -37.503 1.00 22.35 ? 173 TYR C OH  1 
ATOM   4829 N N   . ASP C 1 167 ? 3.775   -14.395 -36.852 1.00 21.45 ? 174 ASP C N   1 
ATOM   4830 C CA  . ASP C 1 167 ? 4.334   -15.414 -37.734 1.00 23.24 ? 174 ASP C CA  1 
ATOM   4831 C C   . ASP C 1 167 ? 3.261   -16.288 -38.394 1.00 22.15 ? 174 ASP C C   1 
ATOM   4832 O O   . ASP C 1 167 ? 2.191   -16.452 -37.858 1.00 21.59 ? 174 ASP C O   1 
ATOM   4833 C CB  . ASP C 1 167 ? 5.179   -16.316 -36.870 1.00 25.05 ? 174 ASP C CB  1 
ATOM   4834 C CG  . ASP C 1 167 ? 6.388   -15.597 -36.277 1.00 28.71 ? 174 ASP C CG  1 
ATOM   4835 O OD1 . ASP C 1 167 ? 6.581   -14.369 -36.523 1.00 29.32 ? 174 ASP C OD1 1 
ATOM   4836 O OD2 . ASP C 1 167 ? 7.120   -16.268 -35.540 1.00 34.92 ? 174 ASP C OD2 1 
ATOM   4837 N N   . ALA C 1 168 ? 3.608   -16.830 -39.553 1.00 23.14 ? 175 ALA C N   1 
ATOM   4838 C CA  . ALA C 1 168 ? 2.762   -17.860 -40.288 1.00 23.37 ? 175 ALA C CA  1 
ATOM   4839 C C   . ALA C 1 168 ? 3.693   -18.919 -40.822 1.00 23.92 ? 175 ALA C C   1 
ATOM   4840 O O   . ALA C 1 168 ? 4.862   -18.674 -41.097 1.00 23.71 ? 175 ALA C O   1 
ATOM   4841 C CB  . ALA C 1 168 ? 2.028   -17.292 -41.452 1.00 21.88 ? 175 ALA C CB  1 
ATOM   4842 N N   . GLU C 1 169 ? 3.123   -20.087 -41.024 1.00 22.60 ? 176 GLU C N   1 
ATOM   4843 C CA  . GLU C 1 169 ? 3.794   -21.120 -41.757 1.00 24.17 ? 176 GLU C CA  1 
ATOM   4844 C C   . GLU C 1 169 ? 3.027   -21.214 -43.047 1.00 23.56 ? 176 GLU C C   1 
ATOM   4845 O O   . GLU C 1 169 ? 1.754   -21.285 -43.047 1.00 23.17 ? 176 GLU C O   1 
ATOM   4846 C CB  . GLU C 1 169 ? 3.594   -22.453 -41.089 1.00 27.37 ? 176 GLU C CB  1 
ATOM   4847 C CG  . GLU C 1 169 ? 4.274   -22.706 -39.757 1.00 33.46 ? 176 GLU C CG  1 
ATOM   4848 C CD  . GLU C 1 169 ? 3.910   -24.099 -39.231 1.00 45.40 ? 176 GLU C CD  1 
ATOM   4849 O OE1 . GLU C 1 169 ? 2.941   -24.762 -39.765 1.00 42.93 ? 176 GLU C OE1 1 
ATOM   4850 O OE2 . GLU C 1 169 ? 4.590   -24.546 -38.275 1.00 52.77 ? 176 GLU C OE2 1 
ATOM   4851 N N   . VAL C 1 170 ? 3.734   -21.234 -44.165 1.00 21.60 ? 177 VAL C N   1 
ATOM   4852 C CA  . VAL C 1 170 ? 3.126   -21.243 -45.450 1.00 20.95 ? 177 VAL C CA  1 
ATOM   4853 C C   . VAL C 1 170 ? 3.586   -22.385 -46.301 1.00 22.19 ? 177 VAL C C   1 
ATOM   4854 O O   . VAL C 1 170 ? 4.789   -22.663 -46.396 1.00 22.16 ? 177 VAL C O   1 
ATOM   4855 C CB  . VAL C 1 170 ? 3.432   -19.928 -46.185 1.00 22.88 ? 177 VAL C CB  1 
ATOM   4856 C CG1 . VAL C 1 170 ? 2.841   -19.913 -47.598 1.00 22.95 ? 177 VAL C CG1 1 
ATOM   4857 C CG2 . VAL C 1 170 ? 2.960   -18.751 -45.349 1.00 22.75 ? 177 VAL C CG2 1 
ATOM   4858 N N   . LYS C 1 171 ? 2.658   -23.019 -47.019 1.00 22.27 ? 178 LYS C N   1 
ATOM   4859 C CA  . LYS C 1 171 ? 3.012   -24.068 -47.952 1.00 23.12 ? 178 LYS C CA  1 
ATOM   4860 C C   . LYS C 1 171 ? 2.259   -23.972 -49.212 1.00 23.59 ? 178 LYS C C   1 
ATOM   4861 O O   . LYS C 1 171 ? 1.031   -23.795 -49.189 1.00 21.35 ? 178 LYS C O   1 
ATOM   4862 C CB  . LYS C 1 171 ? 2.810   -25.490 -47.377 1.00 23.64 ? 178 LYS C CB  1 
ATOM   4863 C CG  . LYS C 1 171 ? 3.213   -26.539 -48.419 1.00 28.82 ? 178 LYS C CG  1 
ATOM   4864 C CD  . LYS C 1 171 ? 3.408   -27.871 -47.711 1.00 32.01 ? 178 LYS C CD  1 
ATOM   4865 C CE  . LYS C 1 171 ? 3.994   -28.943 -48.601 1.00 35.74 ? 178 LYS C CE  1 
ATOM   4866 N NZ  . LYS C 1 171 ? 3.906   -30.218 -47.845 1.00 40.25 ? 178 LYS C NZ  1 
ATOM   4867 N N   . THR C 1 172 ? 2.952   -24.139 -50.342 1.00 22.87 ? 179 THR C N   1 
ATOM   4868 C CA  . THR C 1 172 ? 2.342   -23.937 -51.569 1.00 23.49 ? 179 THR C CA  1 
ATOM   4869 C C   . THR C 1 172 ? 2.691   -25.058 -52.538 1.00 24.90 ? 179 THR C C   1 
ATOM   4870 O O   . THR C 1 172 ? 3.828   -25.545 -52.604 1.00 25.28 ? 179 THR C O   1 
ATOM   4871 C CB  . THR C 1 172 ? 2.742   -22.559 -52.193 1.00 22.78 ? 179 THR C CB  1 
ATOM   4872 O OG1 . THR C 1 172 ? 2.658   -21.474 -51.223 1.00 22.88 ? 179 THR C OG1 1 
ATOM   4873 C CG2 . THR C 1 172 ? 1.948   -22.245 -53.303 1.00 26.06 ? 179 THR C CG2 1 
ATOM   4874 N N   . THR C 1 173 ? 1.696   -25.510 -53.261 1.00 23.40 ? 180 THR C N   1 
ATOM   4875 C CA  . THR C 1 173 ? 1.931   -26.473 -54.331 1.00 25.30 ? 180 THR C CA  1 
ATOM   4876 C C   . THR C 1 173 ? 1.792   -25.748 -55.710 1.00 26.27 ? 180 THR C C   1 
ATOM   4877 O O   . THR C 1 173 ? 0.777   -25.080 -56.003 1.00 25.50 ? 180 THR C O   1 
ATOM   4878 C CB  . THR C 1 173 ? 0.981   -27.664 -54.165 1.00 25.92 ? 180 THR C CB  1 
ATOM   4879 O OG1 . THR C 1 173 ? 1.257   -28.392 -52.948 1.00 29.67 ? 180 THR C OG1 1 
ATOM   4880 C CG2 . THR C 1 173 ? 1.074   -28.641 -55.326 1.00 28.84 ? 180 THR C CG2 1 
ATOM   4881 N N   . TYR C 1 174 ? 2.826   -25.795 -56.563 1.00 27.06 ? 181 TYR C N   1 
ATOM   4882 C CA  . TYR C 1 174 ? 2.794   -25.133 -57.857 1.00 27.48 ? 181 TYR C CA  1 
ATOM   4883 C C   . TYR C 1 174 ? 2.872   -26.241 -58.931 1.00 29.14 ? 181 TYR C C   1 
ATOM   4884 O O   . TYR C 1 174 ? 3.802   -27.025 -58.942 1.00 32.30 ? 181 TYR C O   1 
ATOM   4885 C CB  . TYR C 1 174 ? 3.978   -24.204 -58.100 1.00 28.72 ? 181 TYR C CB  1 
ATOM   4886 C CG  . TYR C 1 174 ? 4.269   -23.244 -56.985 1.00 28.92 ? 181 TYR C CG  1 
ATOM   4887 C CD1 . TYR C 1 174 ? 4.954   -23.651 -55.848 1.00 27.26 ? 181 TYR C CD1 1 
ATOM   4888 C CD2 . TYR C 1 174 ? 3.860   -21.932 -57.067 1.00 28.43 ? 181 TYR C CD2 1 
ATOM   4889 C CE1 . TYR C 1 174 ? 5.230   -22.746 -54.845 1.00 28.77 ? 181 TYR C CE1 1 
ATOM   4890 C CE2 . TYR C 1 174 ? 4.113   -21.049 -56.045 1.00 29.39 ? 181 TYR C CE2 1 
ATOM   4891 C CZ  . TYR C 1 174 ? 4.822   -21.428 -54.966 1.00 28.17 ? 181 TYR C CZ  1 
ATOM   4892 O OH  . TYR C 1 174 ? 4.996   -20.495 -53.884 1.00 31.37 ? 181 TYR C OH  1 
ATOM   4893 N N   . LYS C 1 175 ? 1.878   -26.310 -59.788 1.00 28.03 ? 182 LYS C N   1 
ATOM   4894 C CA  . LYS C 1 175 ? 1.800   -27.413 -60.755 1.00 29.58 ? 182 LYS C CA  1 
ATOM   4895 C C   . LYS C 1 175 ? 1.648   -26.838 -62.144 1.00 31.04 ? 182 LYS C C   1 
ATOM   4896 O O   . LYS C 1 175 ? 0.706   -26.080 -62.438 1.00 31.68 ? 182 LYS C O   1 
ATOM   4897 C CB  . LYS C 1 175 ? 0.649   -28.319 -60.415 1.00 29.46 ? 182 LYS C CB  1 
ATOM   4898 C CG  . LYS C 1 175 ? 0.473   -29.483 -61.339 1.00 33.23 ? 182 LYS C CG  1 
ATOM   4899 C CD  . LYS C 1 175 ? 0.827   -30.799 -60.671 1.00 36.88 ? 182 LYS C CD  1 
ATOM   4900 C CE  . LYS C 1 175 ? 0.505   -31.958 -61.598 1.00 37.16 ? 182 LYS C CE  1 
ATOM   4901 N NZ  . LYS C 1 175 ? 1.194   -31.719 -62.859 1.00 41.84 ? 182 LYS C NZ  1 
ATOM   4902 N N   . ALA C 1 176 ? 2.572   -27.216 -63.036 1.00 33.49 ? 183 ALA C N   1 
ATOM   4903 C CA  . ALA C 1 176 ? 2.507   -26.814 -64.432 1.00 32.93 ? 183 ALA C CA  1 
ATOM   4904 C C   . ALA C 1 176 ? 1.380   -27.572 -65.144 1.00 33.87 ? 183 ALA C C   1 
ATOM   4905 O O   . ALA C 1 176 ? 1.079   -28.698 -64.825 1.00 35.65 ? 183 ALA C O   1 
ATOM   4906 C CB  . ALA C 1 176 ? 3.816   -27.084 -65.160 1.00 34.54 ? 183 ALA C CB  1 
ATOM   4907 N N   . LYS C 1 177 ? 0.738   -26.894 -66.056 1.00 33.50 ? 184 LYS C N   1 
ATOM   4908 C CA  . LYS C 1 177 ? -0.428  -27.421 -66.727 1.00 38.15 ? 184 LYS C CA  1 
ATOM   4909 C C   . LYS C 1 177 ? 0.001   -28.556 -67.646 1.00 42.90 ? 184 LYS C C   1 
ATOM   4910 O O   . LYS C 1 177 ? -0.712  -29.562 -67.750 1.00 47.38 ? 184 LYS C O   1 
ATOM   4911 C CB  . LYS C 1 177 ? -1.138  -26.325 -67.496 1.00 37.20 ? 184 LYS C CB  1 
ATOM   4912 C CG  . LYS C 1 177 ? -1.966  -25.420 -66.584 1.00 38.00 ? 184 LYS C CG  1 
ATOM   4913 C CD  . LYS C 1 177 ? -2.276  -24.109 -67.253 1.00 38.38 ? 184 LYS C CD  1 
ATOM   4914 C CE  . LYS C 1 177 ? -2.993  -23.177 -66.297 1.00 37.80 ? 184 LYS C CE  1 
ATOM   4915 N NZ  . LYS C 1 177 ? -3.367  -21.934 -66.983 1.00 35.89 ? 184 LYS C NZ  1 
ATOM   4916 N N   . LYS C 1 178 ? 1.155   -28.389 -68.303 1.00 46.49 ? 185 LYS C N   1 
ATOM   4917 C CA  . LYS C 1 178 ? 1.787   -29.477 -69.072 1.00 48.89 ? 185 LYS C CA  1 
ATOM   4918 C C   . LYS C 1 178 ? 3.069   -29.940 -68.358 1.00 50.08 ? 185 LYS C C   1 
ATOM   4919 O O   . LYS C 1 178 ? 3.758   -29.113 -67.736 1.00 49.32 ? 185 LYS C O   1 
ATOM   4920 C CB  . LYS C 1 178 ? 2.053   -29.027 -70.520 1.00 52.66 ? 185 LYS C CB  1 
ATOM   4921 C CG  . LYS C 1 178 ? 3.293   -28.169 -70.779 1.00 57.46 ? 185 LYS C CG  1 
ATOM   4922 C CD  . LYS C 1 178 ? 3.093   -26.658 -70.597 1.00 56.78 ? 185 LYS C CD  1 
ATOM   4923 C CE  . LYS C 1 178 ? 4.057   -25.860 -71.476 1.00 58.99 ? 185 LYS C CE  1 
ATOM   4924 N NZ  . LYS C 1 178 ? 5.481   -26.037 -71.098 1.00 58.12 ? 185 LYS C NZ  1 
ATOM   4925 N N   . PRO C 1 179 ? 3.400   -31.251 -68.418 1.00 46.74 ? 186 PRO C N   1 
ATOM   4926 C CA  . PRO C 1 179 ? 4.570   -31.698 -67.669 1.00 44.28 ? 186 PRO C CA  1 
ATOM   4927 C C   . PRO C 1 179 ? 5.884   -31.103 -68.213 1.00 44.95 ? 186 PRO C C   1 
ATOM   4928 O O   . PRO C 1 179 ? 6.200   -31.207 -69.391 1.00 41.61 ? 186 PRO C O   1 
ATOM   4929 C CB  . PRO C 1 179 ? 4.541   -33.216 -67.861 1.00 46.97 ? 186 PRO C CB  1 
ATOM   4930 C CG  . PRO C 1 179 ? 3.960   -33.392 -69.212 1.00 47.18 ? 186 PRO C CG  1 
ATOM   4931 C CD  . PRO C 1 179 ? 2.922   -32.300 -69.341 1.00 48.75 ? 186 PRO C CD  1 
ATOM   4932 N N   . VAL C 1 180 ? 6.617   -30.403 -67.367 1.00 38.62 ? 187 VAL C N   1 
ATOM   4933 C CA  . VAL C 1 180 ? 7.906   -29.901 -67.754 1.00 38.28 ? 187 VAL C CA  1 
ATOM   4934 C C   . VAL C 1 180 ? 8.849   -30.216 -66.600 1.00 37.77 ? 187 VAL C C   1 
ATOM   4935 O O   . VAL C 1 180 ? 8.407   -30.739 -65.574 1.00 35.76 ? 187 VAL C O   1 
ATOM   4936 C CB  . VAL C 1 180 ? 7.855   -28.383 -68.077 1.00 39.98 ? 187 VAL C CB  1 
ATOM   4937 C CG1 . VAL C 1 180 ? 7.043   -28.129 -69.313 1.00 43.03 ? 187 VAL C CG1 1 
ATOM   4938 C CG2 . VAL C 1 180 ? 7.259   -27.569 -66.939 1.00 38.79 ? 187 VAL C CG2 1 
ATOM   4939 N N   . GLN C 1 181 ? 10.138  -29.929 -66.783 1.00 37.33 ? 188 GLN C N   1 
ATOM   4940 C CA  . GLN C 1 181 ? 11.183  -30.439 -65.884 1.00 37.81 ? 188 GLN C CA  1 
ATOM   4941 C C   . GLN C 1 181 ? 11.105  -29.763 -64.511 1.00 33.82 ? 188 GLN C C   1 
ATOM   4942 O O   . GLN C 1 181 ? 11.180  -28.535 -64.469 1.00 32.94 ? 188 GLN C O   1 
ATOM   4943 C CB  . GLN C 1 181 ? 12.576  -30.194 -66.499 1.00 40.95 ? 188 GLN C CB  1 
ATOM   4944 C CG  . GLN C 1 181 ? 13.700  -31.034 -65.903 1.00 45.93 ? 188 GLN C CG  1 
ATOM   4945 C CD  . GLN C 1 181 ? 15.102  -30.581 -66.354 1.00 49.98 ? 188 GLN C CD  1 
ATOM   4946 O OE1 . GLN C 1 181 ? 16.108  -31.200 -65.989 1.00 49.83 ? 188 GLN C OE1 1 
ATOM   4947 N NE2 . GLN C 1 181 ? 15.172  -29.493 -67.129 1.00 47.20 ? 188 GLN C NE2 1 
ATOM   4948 N N   . LEU C 1 182 ? 10.992  -30.588 -63.464 1.00 33.50 ? 189 LEU C N   1 
ATOM   4949 C CA  . LEU C 1 182 ? 11.012  -30.162 -62.052 1.00 30.94 ? 189 LEU C CA  1 
ATOM   4950 C C   . LEU C 1 182 ? 12.453  -29.955 -61.611 1.00 29.77 ? 189 LEU C C   1 
ATOM   4951 O O   . LEU C 1 182 ? 13.327  -30.639 -62.044 1.00 32.76 ? 189 LEU C O   1 
ATOM   4952 C CB  . LEU C 1 182 ? 10.354  -31.231 -61.179 1.00 30.81 ? 189 LEU C CB  1 
ATOM   4953 C CG  . LEU C 1 182 ? 8.808   -31.323 -61.237 1.00 31.82 ? 189 LEU C CG  1 
ATOM   4954 C CD1 . LEU C 1 182 ? 8.291   -32.626 -60.668 1.00 31.46 ? 189 LEU C CD1 1 
ATOM   4955 C CD2 . LEU C 1 182 ? 8.238   -30.130 -60.424 1.00 31.67 ? 189 LEU C CD2 1 
ATOM   4956 N N   . PRO C 1 183 ? 12.707  -29.022 -60.697 1.00 29.75 ? 190 PRO C N   1 
ATOM   4957 C CA  . PRO C 1 183 ? 14.040  -28.852 -60.185 1.00 27.83 ? 190 PRO C CA  1 
ATOM   4958 C C   . PRO C 1 183 ? 14.247  -29.863 -59.100 1.00 28.39 ? 190 PRO C C   1 
ATOM   4959 O O   . PRO C 1 183 ? 13.299  -30.560 -58.730 1.00 28.33 ? 190 PRO C O   1 
ATOM   4960 C CB  . PRO C 1 183 ? 14.011  -27.415 -59.661 1.00 28.66 ? 190 PRO C CB  1 
ATOM   4961 C CG  . PRO C 1 183 ? 12.613  -27.275 -59.144 1.00 28.14 ? 190 PRO C CG  1 
ATOM   4962 C CD  . PRO C 1 183 ? 11.747  -28.105 -60.087 1.00 28.69 ? 190 PRO C CD  1 
ATOM   4963 N N   . GLY C 1 184 ? 15.460  -29.958 -58.572 1.00 29.82 ? 191 GLY C N   1 
ATOM   4964 C CA  . GLY C 1 184 ? 15.648  -30.572 -57.295 1.00 29.60 ? 191 GLY C CA  1 
ATOM   4965 C C   . GLY C 1 184 ? 15.362  -29.528 -56.222 1.00 30.20 ? 191 GLY C C   1 
ATOM   4966 O O   . GLY C 1 184 ? 14.686  -28.539 -56.460 1.00 30.39 ? 191 GLY C O   1 
ATOM   4967 N N   . ALA C 1 185 ? 15.871  -29.771 -55.046 1.00 26.50 ? 192 ALA C N   1 
ATOM   4968 C CA  . ALA C 1 185 ? 15.701  -28.852 -53.940 1.00 26.16 ? 192 ALA C CA  1 
ATOM   4969 C C   . ALA C 1 185 ? 16.590  -27.640 -54.131 1.00 28.05 ? 192 ALA C C   1 
ATOM   4970 O O   . ALA C 1 185 ? 17.775  -27.760 -54.482 1.00 27.74 ? 192 ALA C O   1 
ATOM   4971 C CB  . ALA C 1 185 ? 16.002  -29.531 -52.638 1.00 25.97 ? 192 ALA C CB  1 
ATOM   4972 N N   . TYR C 1 186 ? 16.020  -26.478 -53.789 1.00 27.21 ? 193 TYR C N   1 
ATOM   4973 C CA  . TYR C 1 186 ? 16.713  -25.190 -53.834 1.00 28.18 ? 193 TYR C CA  1 
ATOM   4974 C C   . TYR C 1 186 ? 15.881  -24.157 -53.055 1.00 28.73 ? 193 TYR C C   1 
ATOM   4975 O O   . TYR C 1 186 ? 14.838  -24.525 -52.503 1.00 25.18 ? 193 TYR C O   1 
ATOM   4976 C CB  . TYR C 1 186 ? 16.970  -24.751 -55.254 1.00 29.55 ? 193 TYR C CB  1 
ATOM   4977 C CG  . TYR C 1 186 ? 15.776  -24.223 -56.007 1.00 31.35 ? 193 TYR C CG  1 
ATOM   4978 C CD1 . TYR C 1 186 ? 14.768  -25.076 -56.463 1.00 31.12 ? 193 TYR C CD1 1 
ATOM   4979 C CD2 . TYR C 1 186 ? 15.662  -22.878 -56.289 1.00 30.08 ? 193 TYR C CD2 1 
ATOM   4980 C CE1 . TYR C 1 186 ? 13.655  -24.563 -57.149 1.00 31.85 ? 193 TYR C CE1 1 
ATOM   4981 C CE2 . TYR C 1 186 ? 14.597  -22.386 -56.969 1.00 32.73 ? 193 TYR C CE2 1 
ATOM   4982 C CZ  . TYR C 1 186 ? 13.587  -23.232 -57.416 1.00 31.72 ? 193 TYR C CZ  1 
ATOM   4983 O OH  . TYR C 1 186 ? 12.527  -22.673 -58.138 1.00 33.34 ? 193 TYR C OH  1 
ATOM   4984 N N   . ASN C 1 187 ? 16.422  -22.933 -52.911 1.00 27.36 ? 194 ASN C N   1 
ATOM   4985 C CA  . ASN C 1 187 ? 15.827  -21.888 -52.068 1.00 28.20 ? 194 ASN C CA  1 
ATOM   4986 C C   . ASN C 1 187 ? 15.580  -20.667 -52.829 1.00 26.26 ? 194 ASN C C   1 
ATOM   4987 O O   . ASN C 1 187 ? 16.301  -20.352 -53.788 1.00 26.32 ? 194 ASN C O   1 
ATOM   4988 C CB  . ASN C 1 187 ? 16.743  -21.475 -50.921 1.00 32.44 ? 194 ASN C CB  1 
ATOM   4989 C CG  . ASN C 1 187 ? 17.161  -22.602 -50.129 1.00 37.85 ? 194 ASN C CG  1 
ATOM   4990 O OD1 . ASN C 1 187 ? 16.328  -23.259 -49.518 1.00 41.78 ? 194 ASN C OD1 1 
ATOM   4991 N ND2 . ASN C 1 187 ? 18.466  -22.931 -50.206 1.00 43.95 ? 194 ASN C ND2 1 
ATOM   4992 N N   . VAL C 1 188 ? 14.562  -19.915 -52.415 1.00 25.66 ? 195 VAL C N   1 
ATOM   4993 C CA  . VAL C 1 188 ? 14.252  -18.665 -53.115 1.00 25.73 ? 195 VAL C CA  1 
ATOM   4994 C C   . VAL C 1 188 ? 14.220  -17.553 -52.067 1.00 26.19 ? 195 VAL C C   1 
ATOM   4995 O O   . VAL C 1 188 ? 13.442  -17.575 -51.149 1.00 26.25 ? 195 VAL C O   1 
ATOM   4996 C CB  . VAL C 1 188 ? 12.942  -18.696 -53.886 1.00 25.53 ? 195 VAL C CB  1 
ATOM   4997 C CG1 . VAL C 1 188 ? 12.644  -17.391 -54.546 1.00 25.65 ? 195 VAL C CG1 1 
ATOM   4998 C CG2 . VAL C 1 188 ? 12.943  -19.801 -54.919 1.00 25.34 ? 195 VAL C CG2 1 
ATOM   4999 N N   . ASN C 1 189 ? 15.097  -16.582 -52.249 1.00 28.80 ? 196 ASN C N   1 
ATOM   5000 C CA  . ASN C 1 189 ? 15.135  -15.428 -51.370 1.00 27.07 ? 196 ASN C CA  1 
ATOM   5001 C C   . ASN C 1 189 ? 14.186  -14.380 -51.891 1.00 26.91 ? 196 ASN C C   1 
ATOM   5002 O O   . ASN C 1 189 ? 14.304  -13.936 -53.023 1.00 26.15 ? 196 ASN C O   1 
ATOM   5003 C CB  . ASN C 1 189 ? 16.533  -14.859 -51.307 1.00 30.43 ? 196 ASN C CB  1 
ATOM   5004 C CG  . ASN C 1 189 ? 17.500  -15.808 -50.690 1.00 38.03 ? 196 ASN C CG  1 
ATOM   5005 O OD1 . ASN C 1 189 ? 17.159  -16.522 -49.726 1.00 41.70 ? 196 ASN C OD1 1 
ATOM   5006 N ND2 . ASN C 1 189 ? 18.722  -15.834 -51.221 1.00 40.86 ? 196 ASN C ND2 1 
ATOM   5007 N N   . ILE C 1 190 ? 13.271  -13.934 -51.049 1.00 25.45 ? 197 ILE C N   1 
ATOM   5008 C CA  . ILE C 1 190 ? 12.264  -12.978 -51.515 1.00 25.15 ? 197 ILE C CA  1 
ATOM   5009 C C   . ILE C 1 190 ? 12.186  -11.804 -50.583 1.00 25.90 ? 197 ILE C C   1 
ATOM   5010 O O   . ILE C 1 190 ? 12.194  -11.967 -49.360 1.00 26.46 ? 197 ILE C O   1 
ATOM   5011 C CB  . ILE C 1 190 ? 10.879  -13.638 -51.525 1.00 27.47 ? 197 ILE C CB  1 
ATOM   5012 C CG1 . ILE C 1 190 ? 10.872  -14.823 -52.486 1.00 29.50 ? 197 ILE C CG1 1 
ATOM   5013 C CG2 . ILE C 1 190 ? 9.776   -12.690 -51.943 1.00 28.20 ? 197 ILE C CG2 1 
ATOM   5014 C CD1 . ILE C 1 190 ? 9.733   -15.777 -52.206 1.00 32.57 ? 197 ILE C CD1 1 
ATOM   5015 N N   . LYS C 1 191 ? 11.993  -10.623 -51.157 1.00 26.23 ? 198 LYS C N   1 
ATOM   5016 C CA  . LYS C 1 191 ? 11.686  -9.478  -50.285 1.00 28.16 ? 198 LYS C CA  1 
ATOM   5017 C C   . LYS C 1 191 ? 10.621  -8.632  -50.946 1.00 26.12 ? 198 LYS C C   1 
ATOM   5018 O O   . LYS C 1 191 ? 10.764  -8.182  -52.107 1.00 25.30 ? 198 LYS C O   1 
ATOM   5019 C CB  . LYS C 1 191 ? 12.976  -8.705  -49.947 1.00 31.45 ? 198 LYS C CB  1 
ATOM   5020 C CG  . LYS C 1 191 ? 12.787  -7.438  -49.120 1.00 35.30 ? 198 LYS C CG  1 
ATOM   5021 C CD  . LYS C 1 191 ? 14.145  -6.949  -48.606 1.00 38.45 ? 198 LYS C CD  1 
ATOM   5022 C CE  . LYS C 1 191 ? 13.996  -5.937  -47.478 1.00 42.23 ? 198 LYS C CE  1 
ATOM   5023 N NZ  . LYS C 1 191 ? 13.326  -4.663  -47.877 1.00 44.54 ? 198 LYS C NZ  1 
ATOM   5024 N N   . LEU C 1 192 ? 9.533   -8.436  -50.219 1.00 25.30 ? 199 LEU C N   1 
ATOM   5025 C CA  . LEU C 1 192 ? 8.341   -7.768  -50.765 1.00 28.02 ? 199 LEU C CA  1 
ATOM   5026 C C   . LEU C 1 192 ? 8.141   -6.507  -49.982 1.00 28.17 ? 199 LEU C C   1 
ATOM   5027 O O   . LEU C 1 192 ? 8.053   -6.568  -48.743 1.00 26.86 ? 199 LEU C O   1 
ATOM   5028 C CB  . LEU C 1 192 ? 7.106   -8.654  -50.648 1.00 31.35 ? 199 LEU C CB  1 
ATOM   5029 C CG  . LEU C 1 192 ? 5.768   -8.197  -51.232 1.00 36.97 ? 199 LEU C CG  1 
ATOM   5030 C CD1 . LEU C 1 192 ? 4.754   -9.300  -50.935 1.00 40.35 ? 199 LEU C CD1 1 
ATOM   5031 C CD2 . LEU C 1 192 ? 5.255   -6.854  -50.699 1.00 39.48 ? 199 LEU C CD2 1 
ATOM   5032 N N   . ASP C 1 193 ? 8.088   -5.371  -50.708 1.00 28.69 ? 200 ASP C N   1 
ATOM   5033 C CA  . ASP C 1 193 ? 7.962   -4.051  -50.059 1.00 29.70 ? 200 ASP C CA  1 
ATOM   5034 C C   . ASP C 1 193 ? 6.678   -3.385  -50.558 1.00 29.24 ? 200 ASP C C   1 
ATOM   5035 O O   . ASP C 1 193 ? 6.388   -3.413  -51.742 1.00 29.77 ? 200 ASP C O   1 
ATOM   5036 C CB  . ASP C 1 193 ? 9.150   -3.156  -50.452 1.00 32.92 ? 200 ASP C CB  1 
ATOM   5037 C CG  . ASP C 1 193 ? 10.501  -3.700  -50.013 1.00 36.43 ? 200 ASP C CG  1 
ATOM   5038 O OD1 . ASP C 1 193 ? 10.654  -4.021  -48.816 1.00 35.23 ? 200 ASP C OD1 1 
ATOM   5039 O OD2 . ASP C 1 193 ? 11.443  -3.711  -50.837 1.00 38.94 ? 200 ASP C OD2 1 
ATOM   5040 N N   . ILE C 1 194 ? 5.887   -2.834  -49.649 1.00 28.01 ? 201 ILE C N   1 
ATOM   5041 C CA  . ILE C 1 194 ? 4.805   -1.912  -50.041 1.00 29.76 ? 201 ILE C CA  1 
ATOM   5042 C C   . ILE C 1 194 ? 5.510   -0.598  -50.338 1.00 29.66 ? 201 ILE C C   1 
ATOM   5043 O O   . ILE C 1 194 ? 6.201   -0.063  -49.456 1.00 31.57 ? 201 ILE C O   1 
ATOM   5044 C CB  . ILE C 1 194 ? 3.776   -1.652  -48.922 1.00 31.85 ? 201 ILE C CB  1 
ATOM   5045 C CG1 . ILE C 1 194 ? 3.127   -2.960  -48.419 1.00 30.49 ? 201 ILE C CG1 1 
ATOM   5046 C CG2 . ILE C 1 194 ? 2.720   -0.675  -49.442 1.00 30.83 ? 201 ILE C CG2 1 
ATOM   5047 C CD1 . ILE C 1 194 ? 2.308   -3.627  -49.488 1.00 33.10 ? 201 ILE C CD1 1 
ATOM   5048 N N   . THR C 1 195 ? 5.389   -0.110  -51.568 1.00 29.02 ? 202 THR C N   1 
ATOM   5049 C CA  . THR C 1 195 ? 6.096   1.106   -51.969 1.00 30.58 ? 202 THR C CA  1 
ATOM   5050 C C   . THR C 1 195 ? 5.236   2.356   -51.982 1.00 30.92 ? 202 THR C C   1 
ATOM   5051 O O   . THR C 1 195 ? 5.797   3.432   -51.980 1.00 31.57 ? 202 THR C O   1 
ATOM   5052 C CB  . THR C 1 195 ? 6.747   1.000   -53.342 1.00 32.40 ? 202 THR C CB  1 
ATOM   5053 O OG1 . THR C 1 195 ? 5.761   0.670   -54.331 1.00 33.30 ? 202 THR C OG1 1 
ATOM   5054 C CG2 . THR C 1 195 ? 7.850   0.001   -53.339 1.00 33.44 ? 202 THR C CG2 1 
ATOM   5055 N N   . SER C 1 196 ? 3.909   2.216   -52.008 1.00 29.79 ? 203 SER C N   1 
ATOM   5056 C CA  . SER C 1 196 ? 2.978   3.331   -51.746 1.00 32.58 ? 203 SER C CA  1 
ATOM   5057 C C   . SER C 1 196 ? 1.550   2.850   -51.571 1.00 33.14 ? 203 SER C C   1 
ATOM   5058 O O   . SER C 1 196 ? 1.187   1.749   -51.960 1.00 34.00 ? 203 SER C O   1 
ATOM   5059 C CB  . SER C 1 196 ? 3.000   4.401   -52.836 1.00 34.98 ? 203 SER C CB  1 
ATOM   5060 O OG  . SER C 1 196 ? 2.513   3.939   -54.050 1.00 35.83 ? 203 SER C OG  1 
ATOM   5061 N N   . HIS C 1 197 ? 0.734   3.696   -50.989 1.00 32.86 ? 204 HIS C N   1 
ATOM   5062 C CA  . HIS C 1 197 ? -0.666  3.414   -50.857 1.00 32.23 ? 204 HIS C CA  1 
ATOM   5063 C C   . HIS C 1 197 ? -1.411  4.693   -50.493 1.00 32.04 ? 204 HIS C C   1 
ATOM   5064 O O   . HIS C 1 197 ? -0.818  5.622   -49.941 1.00 32.38 ? 204 HIS C O   1 
ATOM   5065 C CB  . HIS C 1 197 ? -0.888  2.405   -49.755 1.00 32.05 ? 204 HIS C CB  1 
ATOM   5066 C CG  . HIS C 1 197 ? -0.324  2.821   -48.432 1.00 34.85 ? 204 HIS C CG  1 
ATOM   5067 N ND1 . HIS C 1 197 ? -0.981  3.698   -47.600 1.00 36.86 ? 204 HIS C ND1 1 
ATOM   5068 C CD2 . HIS C 1 197 ? 0.844   2.525   -47.818 1.00 35.07 ? 204 HIS C CD2 1 
ATOM   5069 C CE1 . HIS C 1 197 ? -0.261  3.896   -46.510 1.00 37.25 ? 204 HIS C CE1 1 
ATOM   5070 N NE2 . HIS C 1 197 ? 0.854   3.201   -46.623 1.00 36.24 ? 204 HIS C NE2 1 
ATOM   5071 N N   . ASN C 1 198 ? -2.712  4.681   -50.714 1.00 29.89 ? 205 ASN C N   1 
ATOM   5072 C CA  . ASN C 1 198 ? -3.592  5.743   -50.221 1.00 31.23 ? 205 ASN C CA  1 
ATOM   5073 C C   . ASN C 1 198 ? -4.069  5.481   -48.775 1.00 32.00 ? 205 ASN C C   1 
ATOM   5074 O O   . ASN C 1 198 ? -3.763  4.426   -48.166 1.00 32.68 ? 205 ASN C O   1 
ATOM   5075 C CB  . ASN C 1 198 ? -4.696  6.063   -51.253 1.00 32.35 ? 205 ASN C CB  1 
ATOM   5076 C CG  . ASN C 1 198 ? -5.716  4.940   -51.435 1.00 31.24 ? 205 ASN C CG  1 
ATOM   5077 O OD1 . ASN C 1 198 ? -5.656  3.925   -50.764 1.00 29.71 ? 205 ASN C OD1 1 
ATOM   5078 N ND2 . ASN C 1 198 ? -6.654  5.123   -52.403 1.00 32.85 ? 205 ASN C ND2 1 
ATOM   5079 N N   . GLU C 1 199 ? -4.760  6.454   -48.187 1.00 37.05 ? 206 GLU C N   1 
ATOM   5080 C CA  . GLU C 1 199 ? -4.972  6.432   -46.753 1.00 39.13 ? 206 GLU C CA  1 
ATOM   5081 C C   . GLU C 1 199 ? -5.761  5.212   -46.370 1.00 38.15 ? 206 GLU C C   1 
ATOM   5082 O O   . GLU C 1 199 ? -5.451  4.585   -45.367 1.00 39.44 ? 206 GLU C O   1 
ATOM   5083 C CB  . GLU C 1 199 ? -5.637  7.717   -46.254 1.00 45.75 ? 206 GLU C CB  1 
ATOM   5084 C CG  . GLU C 1 199 ? -6.004  7.658   -44.765 1.00 52.75 ? 206 GLU C CG  1 
ATOM   5085 C CD  . GLU C 1 199 ? -6.154  9.035   -44.124 1.00 55.72 ? 206 GLU C CD  1 
ATOM   5086 O OE1 . GLU C 1 199 ? -6.607  9.967   -44.820 1.00 57.80 ? 206 GLU C OE1 1 
ATOM   5087 O OE2 . GLU C 1 199 ? -5.844  9.180   -42.914 1.00 57.61 ? 206 GLU C OE2 1 
ATOM   5088 N N   . ASP C 1 200 ? -6.744  4.825   -47.175 1.00 34.69 ? 207 ASP C N   1 
ATOM   5089 C CA  . ASP C 1 200 ? -7.538  3.635   -46.825 1.00 34.34 ? 207 ASP C CA  1 
ATOM   5090 C C   . ASP C 1 200 ? -7.133  2.316   -47.536 1.00 32.33 ? 207 ASP C C   1 
ATOM   5091 O O   . ASP C 1 200 ? -7.829  1.311   -47.429 1.00 31.13 ? 207 ASP C O   1 
ATOM   5092 C CB  . ASP C 1 200 ? -9.026  3.938   -46.965 1.00 35.04 ? 207 ASP C CB  1 
ATOM   5093 C CG  . ASP C 1 200 ? -9.476  4.137   -48.401 1.00 37.18 ? 207 ASP C CG  1 
ATOM   5094 O OD1 . ASP C 1 200 ? -8.635  4.135   -49.351 1.00 37.42 ? 207 ASP C OD1 1 
ATOM   5095 O OD2 . ASP C 1 200 ? -10.717 4.291   -48.551 1.00 36.34 ? 207 ASP C OD2 1 
ATOM   5096 N N   . TYR C 1 201 ? -5.948  2.292   -48.136 1.00 30.79 ? 208 TYR C N   1 
ATOM   5097 C CA  . TYR C 1 201 ? -5.374  1.086   -48.749 1.00 30.59 ? 208 TYR C CA  1 
ATOM   5098 C C   . TYR C 1 201 ? -6.287  0.480   -49.804 1.00 31.66 ? 208 TYR C C   1 
ATOM   5099 O O   . TYR C 1 201 ? -6.308  -0.732  -50.011 1.00 31.97 ? 208 TYR C O   1 
ATOM   5100 C CB  . TYR C 1 201 ? -5.011  0.042   -47.716 1.00 31.58 ? 208 TYR C CB  1 
ATOM   5101 C CG  . TYR C 1 201 ? -3.680  0.223   -47.056 1.00 30.77 ? 208 TYR C CG  1 
ATOM   5102 C CD1 . TYR C 1 201 ? -3.568  0.986   -45.923 1.00 31.92 ? 208 TYR C CD1 1 
ATOM   5103 C CD2 . TYR C 1 201 ? -2.541  -0.423  -47.550 1.00 33.60 ? 208 TYR C CD2 1 
ATOM   5104 C CE1 . TYR C 1 201 ? -2.346  1.146   -45.303 1.00 32.50 ? 208 TYR C CE1 1 
ATOM   5105 C CE2 . TYR C 1 201 ? -1.315  -0.305  -46.928 1.00 33.43 ? 208 TYR C CE2 1 
ATOM   5106 C CZ  . TYR C 1 201 ? -1.234  0.513   -45.815 1.00 35.68 ? 208 TYR C CZ  1 
ATOM   5107 O OH  . TYR C 1 201 ? -0.043  0.647   -45.168 1.00 44.61 ? 208 TYR C OH  1 
ATOM   5108 N N   . THR C 1 202 ? -7.046  1.328   -50.465 1.00 29.36 ? 209 THR C N   1 
ATOM   5109 C CA  . THR C 1 202 ? -7.806  0.897   -51.626 1.00 29.19 ? 209 THR C CA  1 
ATOM   5110 C C   . THR C 1 202 ? -7.006  1.017   -52.912 1.00 27.93 ? 209 THR C C   1 
ATOM   5111 O O   . THR C 1 202 ? -7.432  0.478   -53.952 1.00 31.38 ? 209 THR C O   1 
ATOM   5112 C CB  . THR C 1 202 ? -9.132  1.631   -51.754 1.00 30.07 ? 209 THR C CB  1 
ATOM   5113 O OG1 . THR C 1 202 ? -8.881  3.041   -51.883 1.00 31.48 ? 209 THR C OG1 1 
ATOM   5114 C CG2 . THR C 1 202 ? -10.049 1.305   -50.544 1.00 33.38 ? 209 THR C CG2 1 
ATOM   5115 N N   . ILE C 1 203 ? -5.898  1.767   -52.861 1.00 29.25 ? 210 ILE C N   1 
ATOM   5116 C CA  . ILE C 1 203 ? -4.852  1.758   -53.895 1.00 28.88 ? 210 ILE C CA  1 
ATOM   5117 C C   . ILE C 1 203 ? -3.487  1.490   -53.259 1.00 28.44 ? 210 ILE C C   1 
ATOM   5118 O O   . ILE C 1 203 ? -3.072  2.146   -52.314 1.00 28.78 ? 210 ILE C O   1 
ATOM   5119 C CB  . ILE C 1 203 ? -4.765  3.081   -54.704 1.00 32.67 ? 210 ILE C CB  1 
ATOM   5120 C CG1 . ILE C 1 203 ? -6.162  3.480   -55.212 1.00 34.80 ? 210 ILE C CG1 1 
ATOM   5121 C CG2 . ILE C 1 203 ? -3.823  2.935   -55.913 1.00 30.55 ? 210 ILE C CG2 1 
ATOM   5122 C CD1 . ILE C 1 203 ? -6.106  4.752   -56.040 1.00 38.01 ? 210 ILE C CD1 1 
ATOM   5123 N N   . VAL C 1 204 ? -2.807  0.450   -53.719 1.00 27.64 ? 211 VAL C N   1 
ATOM   5124 C CA  . VAL C 1 204 ? -1.590  0.019   -53.082 1.00 28.08 ? 211 VAL C CA  1 
ATOM   5125 C C   . VAL C 1 204 ? -0.611  -0.328  -54.164 1.00 28.13 ? 211 VAL C C   1 
ATOM   5126 O O   . VAL C 1 204 ? -1.045  -0.945  -55.174 1.00 30.25 ? 211 VAL C O   1 
ATOM   5127 C CB  . VAL C 1 204 ? -1.797  -1.251  -52.230 1.00 27.13 ? 211 VAL C CB  1 
ATOM   5128 C CG1 . VAL C 1 204 ? -0.471  -1.684  -51.682 1.00 28.31 ? 211 VAL C CG1 1 
ATOM   5129 C CG2 . VAL C 1 204 ? -2.816  -1.023  -51.125 1.00 25.09 ? 211 VAL C CG2 1 
ATOM   5130 N N   . GLU C 1 205 ? 0.659   0.078   -53.981 1.00 28.62 ? 212 GLU C N   1 
ATOM   5131 C CA  . GLU C 1 205 ? 1.780   -0.359  -54.869 1.00 30.98 ? 212 GLU C CA  1 
ATOM   5132 C C   . GLU C 1 205 ? 2.821   -1.191  -54.129 1.00 30.14 ? 212 GLU C C   1 
ATOM   5133 O O   . GLU C 1 205 ? 3.147   -0.899  -52.985 1.00 28.80 ? 212 GLU C O   1 
ATOM   5134 C CB  . GLU C 1 205 ? 2.505   0.859   -55.487 1.00 31.56 ? 212 GLU C CB  1 
ATOM   5135 C CG  . GLU C 1 205 ? 1.607   1.628   -56.380 1.00 34.56 ? 212 GLU C CG  1 
ATOM   5136 C CD  . GLU C 1 205 ? 2.324   2.684   -57.202 1.00 40.48 ? 212 GLU C CD  1 
ATOM   5137 O OE1 . GLU C 1 205 ? 3.565   2.638   -57.359 1.00 45.57 ? 212 GLU C OE1 1 
ATOM   5138 O OE2 . GLU C 1 205 ? 1.603   3.536   -57.739 1.00 46.02 ? 212 GLU C OE2 1 
ATOM   5139 N N   . GLN C 1 206 ? 3.329   -2.238  -54.792 1.00 29.74 ? 213 GLN C N   1 
ATOM   5140 C CA  . GLN C 1 206 ? 4.239   -3.203  -54.171 1.00 28.32 ? 213 GLN C CA  1 
ATOM   5141 C C   . GLN C 1 206 ? 5.414   -3.461  -55.112 1.00 28.81 ? 213 GLN C C   1 
ATOM   5142 O O   . GLN C 1 206 ? 5.284   -3.272  -56.327 1.00 29.30 ? 213 GLN C O   1 
ATOM   5143 C CB  . GLN C 1 206 ? 3.571   -4.578  -53.951 1.00 29.57 ? 213 GLN C CB  1 
ATOM   5144 C CG  . GLN C 1 206 ? 2.113   -4.581  -53.653 1.00 31.13 ? 213 GLN C CG  1 
ATOM   5145 C CD  . GLN C 1 206 ? 1.634   -5.863  -52.997 1.00 30.55 ? 213 GLN C CD  1 
ATOM   5146 O OE1 . GLN C 1 206 ? 0.840   -5.816  -52.086 1.00 34.06 ? 213 GLN C OE1 1 
ATOM   5147 N NE2 . GLN C 1 206 ? 2.133   -7.002  -53.447 1.00 28.75 ? 213 GLN C NE2 1 
ATOM   5148 N N   . TYR C 1 207 ? 6.554   -3.835  -54.518 1.00 27.52 ? 214 TYR C N   1 
ATOM   5149 C CA  . TYR C 1 207 ? 7.780   -4.151  -55.255 1.00 28.62 ? 214 TYR C CA  1 
ATOM   5150 C C   . TYR C 1 207 ? 8.279   -5.483  -54.715 1.00 28.69 ? 214 TYR C C   1 
ATOM   5151 O O   . TYR C 1 207 ? 8.228   -5.700  -53.496 1.00 28.46 ? 214 TYR C O   1 
ATOM   5152 C CB  . TYR C 1 207 ? 8.862   -3.080  -55.031 1.00 29.05 ? 214 TYR C CB  1 
ATOM   5153 C CG  . TYR C 1 207 ? 10.221  -3.475  -55.589 1.00 31.64 ? 214 TYR C CG  1 
ATOM   5154 C CD1 . TYR C 1 207 ? 10.563  -3.268  -56.942 1.00 33.49 ? 214 TYR C CD1 1 
ATOM   5155 C CD2 . TYR C 1 207 ? 11.169  -4.079  -54.765 1.00 32.93 ? 214 TYR C CD2 1 
ATOM   5156 C CE1 . TYR C 1 207 ? 11.805  -3.660  -57.439 1.00 33.11 ? 214 TYR C CE1 1 
ATOM   5157 C CE2 . TYR C 1 207 ? 12.411  -4.475  -55.255 1.00 35.34 ? 214 TYR C CE2 1 
ATOM   5158 C CZ  . TYR C 1 207 ? 12.717  -4.271  -56.584 1.00 35.41 ? 214 TYR C CZ  1 
ATOM   5159 O OH  . TYR C 1 207 ? 13.970  -4.672  -57.001 1.00 40.90 ? 214 TYR C OH  1 
ATOM   5160 N N   . GLU C 1 208 ? 8.696   -6.391  -55.587 1.00 27.00 ? 215 GLU C N   1 
ATOM   5161 C CA  . GLU C 1 208 ? 9.213   -7.693  -55.116 1.00 31.03 ? 215 GLU C CA  1 
ATOM   5162 C C   . GLU C 1 208 ? 10.446  -8.079  -55.867 1.00 29.95 ? 215 GLU C C   1 
ATOM   5163 O O   . GLU C 1 208 ? 10.534  -7.855  -57.086 1.00 28.91 ? 215 GLU C O   1 
ATOM   5164 C CB  . GLU C 1 208 ? 8.190   -8.831  -55.280 1.00 33.93 ? 215 GLU C CB  1 
ATOM   5165 C CG  . GLU C 1 208 ? 8.658   -10.084 -54.538 1.00 38.51 ? 215 GLU C CG  1 
ATOM   5166 C CD  . GLU C 1 208 ? 7.716   -11.279 -54.631 1.00 45.57 ? 215 GLU C CD  1 
ATOM   5167 O OE1 . GLU C 1 208 ? 6.609   -11.214 -54.045 1.00 50.23 ? 215 GLU C OE1 1 
ATOM   5168 O OE2 . GLU C 1 208 ? 8.106   -12.293 -55.266 1.00 47.15 ? 215 GLU C OE2 1 
ATOM   5169 N N   . ARG C 1 209 ? 11.409  -8.600  -55.116 1.00 29.61 ? 216 ARG C N   1 
ATOM   5170 C CA  . ARG C 1 209 ? 12.614  -9.172  -55.676 1.00 31.86 ? 216 ARG C CA  1 
ATOM   5171 C C   . ARG C 1 209 ? 12.700  -10.611 -55.200 1.00 30.30 ? 216 ARG C C   1 
ATOM   5172 O O   . ARG C 1 209 ? 12.556  -10.897 -53.988 1.00 27.26 ? 216 ARG C O   1 
ATOM   5173 C CB  . ARG C 1 209 ? 13.870  -8.401  -55.214 1.00 38.93 ? 216 ARG C CB  1 
ATOM   5174 C CG  . ARG C 1 209 ? 15.166  -9.017  -55.745 1.00 46.42 ? 216 ARG C CG  1 
ATOM   5175 C CD  . ARG C 1 209 ? 16.402  -8.361  -55.119 1.00 52.89 ? 216 ARG C CD  1 
ATOM   5176 N NE  . ARG C 1 209 ? 16.938  -7.365  -56.045 1.00 62.56 ? 216 ARG C NE  1 
ATOM   5177 C CZ  . ARG C 1 209 ? 16.692  -6.052  -56.017 1.00 64.51 ? 216 ARG C CZ  1 
ATOM   5178 N NH1 . ARG C 1 209 ? 15.929  -5.502  -55.064 1.00 66.16 ? 216 ARG C NH1 1 
ATOM   5179 N NH2 . ARG C 1 209 ? 17.238  -5.280  -56.955 1.00 63.12 ? 216 ARG C NH2 1 
ATOM   5180 N N   . ALA C 1 210 ? 12.941  -11.520 -56.139 1.00 26.50 ? 217 ALA C N   1 
ATOM   5181 C CA  . ALA C 1 210 ? 13.013  -12.940 -55.783 1.00 30.18 ? 217 ALA C CA  1 
ATOM   5182 C C   . ALA C 1 210 ? 14.156  -13.536 -56.545 1.00 30.04 ? 217 ALA C C   1 
ATOM   5183 O O   . ALA C 1 210 ? 14.268  -13.284 -57.708 1.00 30.99 ? 217 ALA C O   1 
ATOM   5184 C CB  . ALA C 1 210 ? 11.747  -13.673 -56.208 1.00 28.18 ? 217 ALA C CB  1 
ATOM   5185 N N   . GLU C 1 211 ? 14.967  -14.336 -55.876 1.00 32.31 ? 218 GLU C N   1 
ATOM   5186 C CA  . GLU C 1 211 ? 16.124  -14.964 -56.539 1.00 32.89 ? 218 GLU C CA  1 
ATOM   5187 C C   . GLU C 1 211 ? 16.277  -16.379 -56.042 1.00 32.15 ? 218 GLU C C   1 
ATOM   5188 O O   . GLU C 1 211 ? 16.331  -16.593 -54.818 1.00 31.62 ? 218 GLU C O   1 
ATOM   5189 C CB  . GLU C 1 211 ? 17.416  -14.166 -56.230 1.00 36.86 ? 218 GLU C CB  1 
ATOM   5190 C CG  . GLU C 1 211 ? 18.558  -14.471 -57.180 1.00 41.67 ? 218 GLU C CG  1 
ATOM   5191 C CD  . GLU C 1 211 ? 19.871  -13.789 -56.815 1.00 44.66 ? 218 GLU C CD  1 
ATOM   5192 O OE1 . GLU C 1 211 ? 19.881  -12.717 -56.169 1.00 51.03 ? 218 GLU C OE1 1 
ATOM   5193 O OE2 . GLU C 1 211 ? 20.915  -14.347 -57.202 1.00 54.68 ? 218 GLU C OE2 1 
ATOM   5194 N N   . GLY C 1 212 ? 16.350  -17.331 -56.961 1.00 29.65 ? 219 GLY C N   1 
ATOM   5195 C CA  . GLY C 1 212 ? 16.631  -18.700 -56.592 1.00 31.91 ? 219 GLY C CA  1 
ATOM   5196 C C   . GLY C 1 212 ? 18.135  -18.900 -56.336 1.00 34.58 ? 219 GLY C C   1 
ATOM   5197 O O   . GLY C 1 212 ? 19.001  -18.358 -57.052 1.00 33.17 ? 219 GLY C O   1 
ATOM   5198 N N   . ARG C 1 213 ? 18.440  -19.700 -55.328 1.00 32.27 ? 220 ARG C N   1 
ATOM   5199 C CA  . ARG C 1 213 ? 19.807  -19.985 -54.974 1.00 35.55 ? 220 ARG C CA  1 
ATOM   5200 C C   . ARG C 1 213 ? 19.960  -21.479 -54.712 1.00 32.76 ? 220 ARG C C   1 
ATOM   5201 O O   . ARG C 1 213 ? 19.054  -22.140 -54.219 1.00 29.58 ? 220 ARG C O   1 
ATOM   5202 C CB  . ARG C 1 213 ? 20.199  -19.193 -53.729 1.00 38.62 ? 220 ARG C CB  1 
ATOM   5203 C CG  . ARG C 1 213 ? 20.273  -17.664 -53.933 1.00 43.08 ? 220 ARG C CG  1 
ATOM   5204 C CD  . ARG C 1 213 ? 21.640  -17.156 -54.399 1.00 50.33 ? 220 ARG C CD  1 
ATOM   5205 N NE  . ARG C 1 213 ? 22.083  -16.084 -53.486 1.00 59.19 ? 220 ARG C NE  1 
ATOM   5206 C CZ  . ARG C 1 213 ? 23.030  -16.190 -52.540 1.00 67.32 ? 220 ARG C CZ  1 
ATOM   5207 N NH1 . ARG C 1 213 ? 23.737  -17.310 -52.373 1.00 69.24 ? 220 ARG C NH1 1 
ATOM   5208 N NH2 . ARG C 1 213 ? 23.292  -15.143 -51.754 1.00 70.49 ? 220 ARG C NH2 1 
ATOM   5209 N N   . HIS C 1 214 ? 21.126  -22.019 -55.052 1.00 34.90 ? 221 HIS C N   1 
ATOM   5210 C CA  . HIS C 1 214 ? 21.428  -23.381 -54.643 1.00 33.10 ? 221 HIS C CA  1 
ATOM   5211 C C   . HIS C 1 214 ? 21.343  -23.623 -53.175 1.00 31.47 ? 221 HIS C C   1 
ATOM   5212 O O   . HIS C 1 214 ? 21.658  -22.770 -52.312 1.00 31.09 ? 221 HIS C O   1 
ATOM   5213 C CB  . HIS C 1 214 ? 22.786  -23.809 -55.221 1.00 35.11 ? 221 HIS C CB  1 
ATOM   5214 C CG  . HIS C 1 214 ? 22.764  -23.958 -56.705 1.00 35.49 ? 221 HIS C CG  1 
ATOM   5215 N ND1 . HIS C 1 214 ? 22.314  -25.101 -57.319 1.00 36.11 ? 221 HIS C ND1 1 
ATOM   5216 C CD2 . HIS C 1 214 ? 23.093  -23.098 -57.703 1.00 36.80 ? 221 HIS C CD2 1 
ATOM   5217 C CE1 . HIS C 1 214 ? 22.406  -24.961 -58.628 1.00 37.68 ? 221 HIS C CE1 1 
ATOM   5218 N NE2 . HIS C 1 214 ? 22.865  -23.749 -58.887 1.00 38.80 ? 221 HIS C NE2 1 
ATOM   5219 N N   . SER C 1 215 ? 20.875  -24.826 -52.877 1.00 29.57 ? 222 SER C N   1 
ATOM   5220 C CA  . SER C 1 215 ? 20.829  -25.381 -51.575 1.00 28.95 ? 222 SER C CA  1 
ATOM   5221 C C   . SER C 1 215 ? 21.894  -26.446 -51.351 1.00 27.21 ? 222 SER C C   1 
ATOM   5222 O O   . SER C 1 215 ? 22.197  -26.722 -50.238 1.00 27.84 ? 222 SER C O   1 
ATOM   5223 C CB  . SER C 1 215 ? 19.489  -26.114 -51.386 1.00 30.92 ? 222 SER C CB  1 
ATOM   5224 O OG  . SER C 1 215 ? 18.503  -25.203 -51.105 1.00 36.51 ? 222 SER C OG  1 
ATOM   5225 N N   . THR C 1 216 ? 22.342  -27.105 -52.410 1.00 27.14 ? 223 THR C N   1 
ATOM   5226 C CA  . THR C 1 216 ? 23.481  -28.022 -52.310 1.00 27.88 ? 223 THR C CA  1 
ATOM   5227 C C   . THR C 1 216 ? 24.469  -27.643 -53.419 1.00 31.25 ? 223 THR C C   1 
ATOM   5228 O O   . THR C 1 216 ? 24.145  -26.864 -54.316 1.00 31.76 ? 223 THR C O   1 
ATOM   5229 C CB  . THR C 1 216 ? 23.044  -29.490 -52.536 1.00 26.42 ? 223 THR C CB  1 
ATOM   5230 O OG1 . THR C 1 216 ? 22.484  -29.602 -53.843 1.00 26.28 ? 223 THR C OG1 1 
ATOM   5231 C CG2 . THR C 1 216 ? 21.993  -29.920 -51.590 1.00 25.96 ? 223 THR C CG2 1 
ATOM   5232 N N   . GLY C 1 217 ? 25.666  -28.254 -53.389 1.00 34.70 ? 224 GLY C N   1 
ATOM   5233 C CA  . GLY C 1 217 ? 26.687  -28.037 -54.424 1.00 38.54 ? 224 GLY C CA  1 
ATOM   5234 C C   . GLY C 1 217 ? 27.172  -26.602 -54.390 1.00 40.94 ? 224 GLY C C   1 
ATOM   5235 O O   . GLY C 1 217 ? 27.132  -25.957 -53.317 1.00 50.15 ? 224 GLY C O   1 
HETATM 5236 S S   . SO4 D 2 .   ? 18.480  -19.712 -5.729  1.00 56.84 ? 301 SO4 A S   1 
HETATM 5237 O O1  . SO4 D 2 .   ? 18.564  -20.229 -7.115  1.00 63.88 ? 301 SO4 A O1  1 
HETATM 5238 O O2  . SO4 D 2 .   ? 17.649  -18.492 -5.679  1.00 53.03 ? 301 SO4 A O2  1 
HETATM 5239 O O3  . SO4 D 2 .   ? 17.760  -20.621 -4.801  1.00 40.02 ? 301 SO4 A O3  1 
HETATM 5240 O O4  . SO4 D 2 .   ? 19.885  -19.453 -5.270  1.00 57.43 ? 301 SO4 A O4  1 
HETATM 5241 S S   . SO4 E 2 .   ? -10.178 -15.646 3.187   1.00 64.98 ? 302 SO4 A S   1 
HETATM 5242 O O1  . SO4 E 2 .   ? -9.569  -16.419 2.089   1.00 58.73 ? 302 SO4 A O1  1 
HETATM 5243 O O2  . SO4 E 2 .   ? -11.322 -14.801 2.718   1.00 61.36 ? 302 SO4 A O2  1 
HETATM 5244 O O3  . SO4 E 2 .   ? -10.728 -16.625 4.217   1.00 51.47 ? 302 SO4 A O3  1 
HETATM 5245 O O4  . SO4 E 2 .   ? -9.194  -14.650 3.665   1.00 36.12 ? 302 SO4 A O4  1 
HETATM 5246 S S   . SO4 F 2 .   ? 31.084  16.958  -31.895 1.00 65.87 ? 301 SO4 B S   1 
HETATM 5247 O O1  . SO4 F 2 .   ? 32.414  17.011  -31.235 1.00 69.64 ? 301 SO4 B O1  1 
HETATM 5248 O O2  . SO4 F 2 .   ? 31.261  17.192  -33.355 1.00 73.92 ? 301 SO4 B O2  1 
HETATM 5249 O O3  . SO4 F 2 .   ? 30.443  15.634  -31.733 1.00 73.09 ? 301 SO4 B O3  1 
HETATM 5250 O O4  . SO4 F 2 .   ? 30.245  18.039  -31.315 1.00 59.67 ? 301 SO4 B O4  1 
HETATM 5251 S S   . SO4 G 2 .   ? 4.733   8.373   -32.428 1.00 69.55 ? 302 SO4 B S   1 
HETATM 5252 O O1  . SO4 G 2 .   ? 5.668   8.823   -33.475 1.00 71.21 ? 302 SO4 B O1  1 
HETATM 5253 O O2  . SO4 G 2 .   ? 3.855   7.295   -32.985 1.00 65.56 ? 302 SO4 B O2  1 
HETATM 5254 O O3  . SO4 G 2 .   ? 5.521   7.968   -31.225 1.00 61.78 ? 302 SO4 B O3  1 
HETATM 5255 O O4  . SO4 G 2 .   ? 3.815   9.492   -32.080 1.00 74.20 ? 302 SO4 B O4  1 
HETATM 5256 S S   . SO4 H 2 .   ? 18.417  -28.253 -58.431 1.00 65.91 ? 301 SO4 C S   1 
HETATM 5257 O O1  . SO4 H 2 .   ? 19.745  -28.957 -58.341 1.00 56.82 ? 301 SO4 C O1  1 
HETATM 5258 O O2  . SO4 H 2 .   ? 17.552  -28.739 -59.525 1.00 45.84 ? 301 SO4 C O2  1 
HETATM 5259 O O3  . SO4 H 2 .   ? 17.740  -28.441 -57.128 1.00 68.08 ? 301 SO4 C O3  1 
HETATM 5260 O O4  . SO4 H 2 .   ? 18.574  -26.808 -58.717 1.00 70.68 ? 301 SO4 C O4  1 
HETATM 5261 S S   . SO4 I 2 .   ? -10.210 -20.663 -52.100 1.00 72.66 ? 302 SO4 C S   1 
HETATM 5262 O O1  . SO4 I 2 .   ? -9.144  -20.276 -53.047 1.00 65.18 ? 302 SO4 C O1  1 
HETATM 5263 O O2  . SO4 I 2 .   ? -11.096 -21.671 -52.760 1.00 64.65 ? 302 SO4 C O2  1 
HETATM 5264 O O3  . SO4 I 2 .   ? -9.569  -21.180 -50.866 1.00 61.05 ? 302 SO4 C O3  1 
HETATM 5265 O O4  . SO4 I 2 .   ? -11.052 -19.499 -51.764 1.00 67.02 ? 302 SO4 C O4  1 
HETATM 5266 C C1  . EDO J 3 .   ? -14.119 -16.779 -40.728 1.00 28.57 ? 303 EDO C C1  1 
HETATM 5267 O O1  . EDO J 3 .   ? -14.136 -17.066 -39.390 1.00 24.50 ? 303 EDO C O1  1 
HETATM 5268 C C2  . EDO J 3 .   ? -15.442 -16.695 -41.384 1.00 31.20 ? 303 EDO C C2  1 
HETATM 5269 O O2  . EDO J 3 .   ? -15.723 -15.338 -41.598 1.00 42.78 ? 303 EDO C O2  1 
HETATM 5270 O O   . HOH K 4 .   ? 3.483   -25.760 5.027   1.00 38.84 ? 401 HOH A O   1 
HETATM 5271 O O   . HOH K 4 .   ? 2.742   3.768   -7.100  1.00 44.43 ? 402 HOH A O   1 
HETATM 5272 O O   . HOH K 4 .   ? -9.462  -7.742  6.882   1.00 43.96 ? 403 HOH A O   1 
HETATM 5273 O O   . HOH K 4 .   ? 8.313   -38.851 -10.086 1.00 46.17 ? 404 HOH A O   1 
HETATM 5274 O O   . HOH K 4 .   ? 9.816   -0.926  -2.210  1.00 45.46 ? 405 HOH A O   1 
HETATM 5275 O O   . HOH K 4 .   ? 3.750   -11.264 7.193   1.00 39.90 ? 406 HOH A O   1 
HETATM 5276 O O   . HOH K 4 .   ? -4.599  2.239   -3.616  1.00 53.20 ? 407 HOH A O   1 
HETATM 5277 O O   . HOH K 4 .   ? 16.977  -4.279  -19.754 1.00 42.29 ? 408 HOH A O   1 
HETATM 5278 O O   . HOH K 4 .   ? 2.818   -29.012 2.150   1.00 44.70 ? 409 HOH A O   1 
HETATM 5279 O O   . HOH K 4 .   ? 2.738   -25.231 10.825  1.00 33.13 ? 410 HOH A O   1 
HETATM 5280 O O   . HOH K 4 .   ? -9.006  -7.634  -0.717  1.00 33.25 ? 411 HOH A O   1 
HETATM 5281 O O   . HOH K 4 .   ? 1.632   -10.331 8.745   1.00 34.60 ? 412 HOH A O   1 
HETATM 5282 O O   . HOH K 4 .   ? -2.847  -15.287 -24.090 1.00 36.91 ? 413 HOH A O   1 
HETATM 5283 O O   . HOH K 4 .   ? -0.723  -21.658 -16.615 1.00 34.99 ? 414 HOH A O   1 
HETATM 5284 O O   . HOH K 4 .   ? 3.737   4.266   -18.041 1.00 46.49 ? 415 HOH A O   1 
HETATM 5285 O O   . HOH K 4 .   ? 11.703  3.866   -15.540 1.00 38.92 ? 416 HOH A O   1 
HETATM 5286 O O   . HOH K 4 .   ? -3.483  -6.134  -18.446 1.00 38.73 ? 417 HOH A O   1 
HETATM 5287 O O   . HOH K 4 .   ? 0.181   -1.128  -0.582  1.00 36.19 ? 418 HOH A O   1 
HETATM 5288 O O   . HOH K 4 .   ? 2.089   -10.798 -24.097 1.00 28.95 ? 419 HOH A O   1 
HETATM 5289 O O   . HOH K 4 .   ? -0.565  -1.609  3.467   1.00 32.68 ? 420 HOH A O   1 
HETATM 5290 O O   . HOH K 4 .   ? 2.994   -36.582 -15.955 1.00 44.32 ? 421 HOH A O   1 
HETATM 5291 O O   . HOH K 4 .   ? 22.422  -34.315 -10.784 1.00 37.82 ? 422 HOH A O   1 
HETATM 5292 O O   . HOH K 4 .   ? 5.879   -21.682 -30.073 1.00 48.96 ? 423 HOH A O   1 
HETATM 5293 O O   . HOH K 4 .   ? 14.099  -1.274  -5.064  1.00 35.67 ? 424 HOH A O   1 
HETATM 5294 O O   . HOH K 4 .   ? 6.241   -22.844 -24.273 1.00 32.94 ? 425 HOH A O   1 
HETATM 5295 O O   . HOH K 4 .   ? 2.989   -11.224 -27.760 1.00 35.08 ? 426 HOH A O   1 
HETATM 5296 O O   . HOH K 4 .   ? 16.888  -13.364 -3.749  1.00 35.46 ? 427 HOH A O   1 
HETATM 5297 O O   . HOH K 4 .   ? 6.208   -9.922  7.494   1.00 34.39 ? 428 HOH A O   1 
HETATM 5298 O O   . HOH K 4 .   ? 9.841   -17.671 -33.478 1.00 44.65 ? 429 HOH A O   1 
HETATM 5299 O O   . HOH K 4 .   ? -11.160 -16.534 6.828   1.00 44.37 ? 430 HOH A O   1 
HETATM 5300 O O   . HOH K 4 .   ? 5.410   -21.000 -20.194 1.00 21.26 ? 431 HOH A O   1 
HETATM 5301 O O   . HOH K 4 .   ? -12.108 -12.978 -7.741  1.00 43.28 ? 432 HOH A O   1 
HETATM 5302 O O   . HOH K 4 .   ? 26.459  -22.496 -12.145 1.00 44.07 ? 433 HOH A O   1 
HETATM 5303 O O   . HOH K 4 .   ? -13.804 -11.968 -12.052 1.00 51.66 ? 434 HOH A O   1 
HETATM 5304 O O   . HOH K 4 .   ? 0.014   -26.138 -14.697 1.00 28.18 ? 435 HOH A O   1 
HETATM 5305 O O   . HOH K 4 .   ? 15.091  -39.042 -18.748 1.00 45.51 ? 436 HOH A O   1 
HETATM 5306 O O   . HOH K 4 .   ? 21.520  -34.504 -15.236 1.00 33.15 ? 437 HOH A O   1 
HETATM 5307 O O   . HOH K 4 .   ? -2.281  -9.323  -5.705  1.00 25.04 ? 438 HOH A O   1 
HETATM 5308 O O   . HOH K 4 .   ? 17.335  -18.579 -25.333 1.00 28.74 ? 439 HOH A O   1 
HETATM 5309 O O   . HOH K 4 .   ? 0.006   -18.395 -26.170 1.00 49.66 ? 440 HOH A O   1 
HETATM 5310 O O   . HOH K 4 .   ? -1.463  -11.620 -13.366 1.00 30.44 ? 441 HOH A O   1 
HETATM 5311 O O   . HOH K 4 .   ? -11.712 -19.096 1.016   1.00 23.84 ? 442 HOH A O   1 
HETATM 5312 O O   . HOH K 4 .   ? 9.248   -19.750 12.451  1.00 53.37 ? 443 HOH A O   1 
HETATM 5313 O O   . HOH K 4 .   ? -11.972 -7.742  -7.030  1.00 38.40 ? 444 HOH A O   1 
HETATM 5314 O O   . HOH K 4 .   ? 13.273  -5.558  -5.629  1.00 28.37 ? 445 HOH A O   1 
HETATM 5315 O O   . HOH K 4 .   ? -1.711  -21.692 -19.727 1.00 52.96 ? 446 HOH A O   1 
HETATM 5316 O O   . HOH K 4 .   ? 9.111   -38.862 -15.716 1.00 45.23 ? 447 HOH A O   1 
HETATM 5317 O O   . HOH K 4 .   ? 5.842   -4.989  3.496   1.00 33.17 ? 448 HOH A O   1 
HETATM 5318 O O   . HOH K 4 .   ? 14.599  -21.946 -24.480 1.00 25.55 ? 449 HOH A O   1 
HETATM 5319 O O   . HOH K 4 .   ? 7.031   -34.089 -8.813  1.00 31.33 ? 450 HOH A O   1 
HETATM 5320 O O   . HOH K 4 .   ? 26.986  -15.488 -22.538 1.00 44.55 ? 451 HOH A O   1 
HETATM 5321 O O   . HOH K 4 .   ? 20.370  -28.998 -23.883 1.00 26.19 ? 452 HOH A O   1 
HETATM 5322 O O   . HOH K 4 .   ? 26.633  -19.392 -19.885 1.00 24.64 ? 453 HOH A O   1 
HETATM 5323 O O   . HOH K 4 .   ? -5.705  -23.437 0.623   1.00 30.36 ? 454 HOH A O   1 
HETATM 5324 O O   . HOH K 4 .   ? 6.011   -37.054 -18.456 1.00 32.31 ? 455 HOH A O   1 
HETATM 5325 O O   . HOH K 4 .   ? 17.788  -29.079 -26.186 1.00 27.01 ? 456 HOH A O   1 
HETATM 5326 O O   . HOH K 4 .   ? 16.848  -36.620 -12.360 1.00 29.70 ? 457 HOH A O   1 
HETATM 5327 O O   . HOH K 4 .   ? 6.425   -10.649 -7.140  1.00 32.64 ? 458 HOH A O   1 
HETATM 5328 O O   . HOH K 4 .   ? 23.105  -38.578 -19.907 1.00 45.55 ? 459 HOH A O   1 
HETATM 5329 O O   . HOH K 4 .   ? 22.554  -25.109 -12.042 1.00 18.40 ? 460 HOH A O   1 
HETATM 5330 O O   . HOH K 4 .   ? -3.752  -16.457 -19.871 1.00 34.17 ? 461 HOH A O   1 
HETATM 5331 O O   . HOH K 4 .   ? 7.578   -6.381  -29.018 1.00 40.97 ? 462 HOH A O   1 
HETATM 5332 O O   . HOH K 4 .   ? -3.531  -12.630 -0.265  1.00 23.44 ? 463 HOH A O   1 
HETATM 5333 O O   . HOH K 4 .   ? 13.145  -32.833 -17.633 1.00 21.37 ? 464 HOH A O   1 
HETATM 5334 O O   . HOH K 4 .   ? 20.371  -19.161 -31.945 1.00 43.15 ? 465 HOH A O   1 
HETATM 5335 O O   . HOH K 4 .   ? -6.994  -6.094  -4.210  1.00 29.04 ? 466 HOH A O   1 
HETATM 5336 O O   . HOH K 4 .   ? 3.593   -22.128 -5.153  1.00 20.72 ? 467 HOH A O   1 
HETATM 5337 O O   . HOH K 4 .   ? -8.847  -2.014  -12.402 1.00 41.35 ? 468 HOH A O   1 
HETATM 5338 O O   . HOH K 4 .   ? -2.197  0.605   -3.108  1.00 48.24 ? 469 HOH A O   1 
HETATM 5339 O O   . HOH K 4 .   ? 12.860  -37.441 -18.027 1.00 26.80 ? 470 HOH A O   1 
HETATM 5340 O O   . HOH K 4 .   ? -11.658 -12.447 5.133   1.00 46.07 ? 471 HOH A O   1 
HETATM 5341 O O   . HOH K 4 .   ? 3.974   1.918   -13.245 1.00 30.50 ? 472 HOH A O   1 
HETATM 5342 O O   . HOH K 4 .   ? 2.699   4.214   -10.770 1.00 38.67 ? 473 HOH A O   1 
HETATM 5343 O O   . HOH K 4 .   ? 14.612  -39.525 -13.896 1.00 40.70 ? 474 HOH A O   1 
HETATM 5344 O O   . HOH K 4 .   ? -15.152 -8.352  -4.330  1.00 34.30 ? 475 HOH A O   1 
HETATM 5345 O O   . HOH K 4 .   ? 4.273   -8.468  -7.723  1.00 32.42 ? 476 HOH A O   1 
HETATM 5346 O O   . HOH K 4 .   ? 16.547  -21.617 -26.382 1.00 28.88 ? 477 HOH A O   1 
HETATM 5347 O O   . HOH K 4 .   ? -6.134  -2.805  -12.148 1.00 27.14 ? 478 HOH A O   1 
HETATM 5348 O O   . HOH K 4 .   ? 15.575  -32.430 -18.831 1.00 20.31 ? 479 HOH A O   1 
HETATM 5349 O O   . HOH K 4 .   ? -2.723  -27.378 -8.089  1.00 28.81 ? 480 HOH A O   1 
HETATM 5350 O O   . HOH K 4 .   ? 18.250  -26.832 -7.457  1.00 22.19 ? 481 HOH A O   1 
HETATM 5351 O O   . HOH K 4 .   ? -6.719  -21.874 -13.628 1.00 40.02 ? 482 HOH A O   1 
HETATM 5352 O O   . HOH K 4 .   ? 1.608   0.422   3.089   1.00 47.73 ? 483 HOH A O   1 
HETATM 5353 O O   . HOH K 4 .   ? -1.960  -11.236 -2.033  1.00 22.28 ? 484 HOH A O   1 
HETATM 5354 O O   . HOH K 4 .   ? -9.562  -6.753  -3.289  1.00 34.01 ? 485 HOH A O   1 
HETATM 5355 O O   . HOH K 4 .   ? 23.942  -16.120 -13.969 1.00 36.62 ? 486 HOH A O   1 
HETATM 5356 O O   . HOH K 4 .   ? 26.714  -27.416 -17.496 1.00 49.55 ? 487 HOH A O   1 
HETATM 5357 O O   . HOH K 4 .   ? 20.943  -37.443 -17.372 1.00 30.71 ? 488 HOH A O   1 
HETATM 5358 O O   . HOH K 4 .   ? 1.446   3.523   -12.846 1.00 38.81 ? 489 HOH A O   1 
HETATM 5359 O O   . HOH K 4 .   ? 7.535   -34.433 -26.180 1.00 31.77 ? 490 HOH A O   1 
HETATM 5360 O O   . HOH K 4 .   ? 2.621   -21.442 -20.939 1.00 23.62 ? 491 HOH A O   1 
HETATM 5361 O O   . HOH K 4 .   ? -7.933  -7.133  -6.856  1.00 33.86 ? 492 HOH A O   1 
HETATM 5362 O O   . HOH K 4 .   ? 20.454  -37.941 -11.467 1.00 41.14 ? 493 HOH A O   1 
HETATM 5363 O O   . HOH K 4 .   ? -10.269 -8.256  2.802   1.00 39.37 ? 494 HOH A O   1 
HETATM 5364 O O   . HOH K 4 .   ? 13.531  -15.827 -34.879 1.00 35.97 ? 495 HOH A O   1 
HETATM 5365 O O   . HOH K 4 .   ? 15.935  -16.681 -32.821 1.00 34.55 ? 496 HOH A O   1 
HETATM 5366 O O   . HOH K 4 .   ? 12.225  -37.523 -22.266 1.00 43.74 ? 497 HOH A O   1 
HETATM 5367 O O   . HOH K 4 .   ? 18.502  -10.923 -9.864  1.00 30.28 ? 498 HOH A O   1 
HETATM 5368 O O   . HOH K 4 .   ? 2.323   -20.900 -23.595 1.00 23.08 ? 499 HOH A O   1 
HETATM 5369 O O   . HOH K 4 .   ? 9.670   -11.853 -10.495 1.00 27.56 ? 500 HOH A O   1 
HETATM 5370 O O   . HOH K 4 .   ? -17.408 -11.151 3.454   1.00 46.19 ? 501 HOH A O   1 
HETATM 5371 O O   . HOH K 4 .   ? 10.253  5.474   -5.101  1.00 41.00 ? 502 HOH A O   1 
HETATM 5372 O O   . HOH K 4 .   ? 3.357   -28.502 -3.322  1.00 27.69 ? 503 HOH A O   1 
HETATM 5373 O O   . HOH K 4 .   ? -7.670  -13.366 7.560   1.00 42.05 ? 504 HOH A O   1 
HETATM 5374 O O   . HOH K 4 .   ? 6.533   -10.397 -30.999 1.00 32.71 ? 505 HOH A O   1 
HETATM 5375 O O   . HOH K 4 .   ? -2.993  -31.185 -23.373 1.00 51.30 ? 506 HOH A O   1 
HETATM 5376 O O   . HOH K 4 .   ? -3.511  3.589   -13.213 1.00 44.60 ? 507 HOH A O   1 
HETATM 5377 O O   . HOH K 4 .   ? -14.727 -16.581 -5.124  1.00 33.71 ? 508 HOH A O   1 
HETATM 5378 O O   . HOH K 4 .   ? 17.133  -38.174 -9.920  1.00 31.65 ? 509 HOH A O   1 
HETATM 5379 O O   . HOH K 4 .   ? -2.466  -11.446 9.695   1.00 31.60 ? 510 HOH A O   1 
HETATM 5380 O O   . HOH K 4 .   ? 10.268  -10.539 3.412   1.00 36.00 ? 511 HOH A O   1 
HETATM 5381 O O   . HOH K 4 .   ? -7.802  -29.496 2.152   1.00 32.33 ? 512 HOH A O   1 
HETATM 5382 O O   . HOH K 4 .   ? -2.311  -27.745 -14.620 1.00 50.41 ? 513 HOH A O   1 
HETATM 5383 O O   . HOH K 4 .   ? 18.532  -10.847 -26.368 1.00 42.65 ? 514 HOH A O   1 
HETATM 5384 O O   . HOH K 4 .   ? -2.837  -5.008  6.606   1.00 31.53 ? 515 HOH A O   1 
HETATM 5385 O O   . HOH K 4 .   ? -8.096  -23.563 -0.641  1.00 30.38 ? 516 HOH A O   1 
HETATM 5386 O O   . HOH K 4 .   ? 6.638   -1.563  -19.038 1.00 36.56 ? 517 HOH A O   1 
HETATM 5387 O O   . HOH K 4 .   ? 27.510  -21.360 -17.934 1.00 27.19 ? 518 HOH A O   1 
HETATM 5388 O O   . HOH K 4 .   ? -10.265 -6.268  -7.785  1.00 41.72 ? 519 HOH A O   1 
HETATM 5389 O O   . HOH K 4 .   ? -3.300  -26.905 -10.909 1.00 32.34 ? 520 HOH A O   1 
HETATM 5390 O O   . HOH K 4 .   ? 15.087  -11.911 -32.781 1.00 35.13 ? 521 HOH A O   1 
HETATM 5391 O O   . HOH K 4 .   ? -0.814  -21.082 -23.899 1.00 38.62 ? 522 HOH A O   1 
HETATM 5392 O O   . HOH K 4 .   ? 22.070  -23.253 -26.738 1.00 30.02 ? 523 HOH A O   1 
HETATM 5393 O O   . HOH K 4 .   ? 14.272  8.616   -10.693 1.00 50.00 ? 524 HOH A O   1 
HETATM 5394 O O   . HOH K 4 .   ? -1.409  -12.293 -4.530  1.00 27.04 ? 525 HOH A O   1 
HETATM 5395 O O   . HOH K 4 .   ? 9.691   -23.879 -23.263 1.00 28.70 ? 526 HOH A O   1 
HETATM 5396 O O   . HOH K 4 .   ? -7.747  -6.838  -17.866 1.00 40.46 ? 527 HOH A O   1 
HETATM 5397 O O   . HOH K 4 .   ? 18.438  -11.848 -29.508 1.00 44.01 ? 528 HOH A O   1 
HETATM 5398 O O   . HOH K 4 .   ? 7.988   -24.102 -25.643 1.00 43.67 ? 529 HOH A O   1 
HETATM 5399 O O   . HOH K 4 .   ? 7.373   4.954   -5.766  1.00 39.58 ? 530 HOH A O   1 
HETATM 5400 O O   . HOH K 4 .   ? -1.986  -14.810 -4.125  1.00 35.96 ? 531 HOH A O   1 
HETATM 5401 O O   . HOH K 4 .   ? 12.310  -33.634 -8.066  1.00 21.24 ? 532 HOH A O   1 
HETATM 5402 O O   . HOH K 4 .   ? 12.101  -23.046 -25.031 1.00 26.81 ? 533 HOH A O   1 
HETATM 5403 O O   . HOH K 4 .   ? -7.408  -16.424 -14.021 1.00 41.58 ? 534 HOH A O   1 
HETATM 5404 O O   . HOH K 4 .   ? -6.819  -6.205  0.771   1.00 28.28 ? 535 HOH A O   1 
HETATM 5405 O O   . HOH K 4 .   ? 22.140  -20.224 -9.690  1.00 43.33 ? 536 HOH A O   1 
HETATM 5406 O O   . HOH K 4 .   ? 21.123  -14.037 -25.690 1.00 38.26 ? 537 HOH A O   1 
HETATM 5407 O O   . HOH K 4 .   ? 10.644  -26.730 -24.555 1.00 23.95 ? 538 HOH A O   1 
HETATM 5408 O O   . HOH K 4 .   ? 9.012   -23.249 -0.356  1.00 36.56 ? 539 HOH A O   1 
HETATM 5409 O O   . HOH K 4 .   ? -13.299 -17.332 2.727   1.00 38.52 ? 540 HOH A O   1 
HETATM 5410 O O   . HOH K 4 .   ? 1.172   -21.006 11.893  1.00 20.03 ? 541 HOH A O   1 
HETATM 5411 O O   . HOH K 4 .   ? 26.247  -30.217 -15.558 1.00 47.75 ? 542 HOH A O   1 
HETATM 5412 O O   . HOH K 4 .   ? -9.990  -29.283 0.180   1.00 43.69 ? 543 HOH A O   1 
HETATM 5413 O O   . HOH K 4 .   ? 6.027   -16.409 -31.761 1.00 30.12 ? 544 HOH A O   1 
HETATM 5414 O O   . HOH K 4 .   ? 2.914   -23.111 12.266  1.00 40.78 ? 545 HOH A O   1 
HETATM 5415 O O   . HOH K 4 .   ? 14.765  -12.638 -1.749  1.00 38.06 ? 546 HOH A O   1 
HETATM 5416 O O   . HOH K 4 .   ? 8.963   -10.117 -29.589 1.00 32.85 ? 547 HOH A O   1 
HETATM 5417 O O   . HOH K 4 .   ? 5.716   -28.895 -14.831 1.00 32.10 ? 548 HOH A O   1 
HETATM 5418 O O   . HOH K 4 .   ? 8.281   3.883   -3.817  1.00 43.08 ? 549 HOH A O   1 
HETATM 5419 O O   . HOH K 4 .   ? 15.835  -37.259 -25.672 1.00 52.06 ? 550 HOH A O   1 
HETATM 5420 O O   . HOH K 4 .   ? 24.191  -17.758 -11.920 1.00 50.83 ? 551 HOH A O   1 
HETATM 5421 O O   . HOH K 4 .   ? 5.316   -21.866 -10.229 1.00 33.71 ? 552 HOH A O   1 
HETATM 5422 O O   . HOH K 4 .   ? 13.439  -39.867 -20.663 1.00 48.52 ? 553 HOH A O   1 
HETATM 5423 O O   . HOH K 4 .   ? -13.162 -10.571 -7.564  1.00 41.98 ? 554 HOH A O   1 
HETATM 5424 O O   . HOH K 4 .   ? 3.729   -22.320 -25.316 1.00 34.19 ? 555 HOH A O   1 
HETATM 5425 O O   . HOH K 4 .   ? 4.679   -20.730 -27.854 1.00 42.85 ? 556 HOH A O   1 
HETATM 5426 O O   . HOH K 4 .   ? 22.863  -33.086 -13.376 1.00 40.04 ? 557 HOH A O   1 
HETATM 5427 O O   . HOH K 4 .   ? 11.919  -40.557 -13.427 1.00 44.53 ? 558 HOH A O   1 
HETATM 5428 O O   . HOH K 4 .   ? 7.720   -9.263  9.394   1.00 53.12 ? 559 HOH A O   1 
HETATM 5429 O O   . HOH K 4 .   ? 18.769  -38.008 -14.075 1.00 44.89 ? 560 HOH A O   1 
HETATM 5430 O O   . HOH K 4 .   ? 8.343   -36.684 -19.505 1.00 34.78 ? 561 HOH A O   1 
HETATM 5431 O O   . HOH K 4 .   ? 9.223   -36.744 -22.270 1.00 41.51 ? 562 HOH A O   1 
HETATM 5432 O O   . HOH K 4 .   ? -14.764 -14.512 -6.620  1.00 36.85 ? 563 HOH A O   1 
HETATM 5433 O O   . HOH K 4 .   ? -1.732  -16.540 -26.363 1.00 42.24 ? 564 HOH A O   1 
HETATM 5434 O O   . HOH K 4 .   ? 10.191  -37.985 -18.421 1.00 42.61 ? 565 HOH A O   1 
HETATM 5435 O O   . HOH K 4 .   ? 16.116  -40.297 -16.193 1.00 49.19 ? 566 HOH A O   1 
HETATM 5436 O O   . HOH K 4 .   ? 23.316  -6.602  -21.236 1.00 43.38 ? 567 HOH A O   1 
HETATM 5437 O O   . HOH K 4 .   ? 8.014   -36.742 -24.442 1.00 38.12 ? 568 HOH A O   1 
HETATM 5438 O O   . HOH K 4 .   ? -6.376  -3.735  -2.839  1.00 37.21 ? 569 HOH A O   1 
HETATM 5439 O O   . HOH K 4 .   ? 10.280  -20.755 -34.044 1.00 42.30 ? 570 HOH A O   1 
HETATM 5440 O O   . HOH K 4 .   ? -2.301  -2.636  5.549   1.00 37.49 ? 571 HOH A O   1 
HETATM 5441 O O   . HOH K 4 .   ? -11.025 -4.380  -3.048  1.00 42.75 ? 572 HOH A O   1 
HETATM 5442 O O   . HOH L 4 .   ? 23.706  -14.062 -24.421 1.00 33.30 ? 401 HOH B O   1 
HETATM 5443 O O   . HOH L 4 .   ? 6.366   -3.412  -46.761 1.00 30.14 ? 402 HOH B O   1 
HETATM 5444 O O   . HOH L 4 .   ? 16.456  27.286  -43.881 1.00 45.36 ? 403 HOH B O   1 
HETATM 5445 O O   . HOH L 4 .   ? 33.972  1.726   -39.521 1.00 39.26 ? 404 HOH B O   1 
HETATM 5446 O O   . HOH L 4 .   ? 15.112  10.942  -36.190 1.00 40.58 ? 405 HOH B O   1 
HETATM 5447 O O   . HOH L 4 .   ? 25.836  8.752   -16.298 1.00 26.88 ? 406 HOH B O   1 
HETATM 5448 O O   . HOH L 4 .   ? 20.686  20.095  -56.661 1.00 33.51 ? 407 HOH B O   1 
HETATM 5449 O O   . HOH L 4 .   ? 14.021  29.052  -44.672 1.00 47.03 ? 408 HOH B O   1 
HETATM 5450 O O   . HOH L 4 .   ? 24.053  24.911  -48.162 1.00 33.94 ? 409 HOH B O   1 
HETATM 5451 O O   . HOH L 4 .   ? 16.466  29.549  -28.838 1.00 38.07 ? 410 HOH B O   1 
HETATM 5452 O O   . HOH L 4 .   ? 16.786  12.206  -42.212 1.00 43.92 ? 411 HOH B O   1 
HETATM 5453 O O   . HOH L 4 .   ? 32.461  -8.763  -26.554 1.00 40.43 ? 412 HOH B O   1 
HETATM 5454 O O   . HOH L 4 .   ? 29.445  16.932  -38.655 1.00 32.79 ? 413 HOH B O   1 
HETATM 5455 O O   . HOH L 4 .   ? 10.258  14.585  -41.817 1.00 28.31 ? 414 HOH B O   1 
HETATM 5456 O O   . HOH L 4 .   ? 5.063   23.138  -29.284 1.00 31.01 ? 415 HOH B O   1 
HETATM 5457 O O   . HOH L 4 .   ? 12.685  17.032  -51.052 1.00 34.65 ? 416 HOH B O   1 
HETATM 5458 O O   . HOH L 4 .   ? 28.763  -3.241  -25.019 1.00 39.90 ? 417 HOH B O   1 
HETATM 5459 O O   . HOH L 4 .   ? 10.891  2.741   -12.101 1.00 37.75 ? 418 HOH B O   1 
HETATM 5460 O O   . HOH L 4 .   ? 15.986  12.009  -12.448 1.00 47.88 ? 419 HOH B O   1 
HETATM 5461 O O   . HOH L 4 .   ? 20.685  30.203  -38.316 1.00 41.76 ? 420 HOH B O   1 
HETATM 5462 O O   . HOH L 4 .   ? 12.732  10.272  -23.359 1.00 28.29 ? 421 HOH B O   1 
HETATM 5463 O O   . HOH L 4 .   ? 23.370  -4.952  -44.985 1.00 47.82 ? 422 HOH B O   1 
HETATM 5464 O O   . HOH L 4 .   ? 27.550  2.918   -9.306  1.00 51.38 ? 423 HOH B O   1 
HETATM 5465 O O   . HOH L 4 .   ? 35.249  11.541  -25.454 1.00 26.26 ? 424 HOH B O   1 
HETATM 5466 O O   . HOH L 4 .   ? 19.067  13.317  -39.914 1.00 38.99 ? 425 HOH B O   1 
HETATM 5467 O O   . HOH L 4 .   ? 25.632  13.044  -45.656 1.00 28.74 ? 426 HOH B O   1 
HETATM 5468 O O   . HOH L 4 .   ? 25.579  9.484   -11.967 1.00 32.58 ? 427 HOH B O   1 
HETATM 5469 O O   . HOH L 4 .   ? 32.117  8.599   -43.336 1.00 39.59 ? 428 HOH B O   1 
HETATM 5470 O O   . HOH L 4 .   ? 15.240  26.457  -52.374 1.00 36.47 ? 429 HOH B O   1 
HETATM 5471 O O   . HOH L 4 .   ? 15.032  3.048   -26.246 1.00 28.49 ? 430 HOH B O   1 
HETATM 5472 O O   . HOH L 4 .   ? 22.863  9.813   -56.831 1.00 42.70 ? 431 HOH B O   1 
HETATM 5473 O O   . HOH L 4 .   ? 2.429   21.442  -26.706 1.00 42.31 ? 432 HOH B O   1 
HETATM 5474 O O   . HOH L 4 .   ? 38.321  2.138   -28.886 1.00 35.81 ? 433 HOH B O   1 
HETATM 5475 O O   . HOH L 4 .   ? 3.877   19.165  -44.785 1.00 31.65 ? 434 HOH B O   1 
HETATM 5476 O O   . HOH L 4 .   ? 29.424  -2.779  -28.331 1.00 27.46 ? 435 HOH B O   1 
HETATM 5477 O O   . HOH L 4 .   ? 12.025  21.510  -51.718 1.00 37.42 ? 436 HOH B O   1 
HETATM 5478 O O   . HOH L 4 .   ? 17.740  3.425   -26.896 1.00 26.96 ? 437 HOH B O   1 
HETATM 5479 O O   . HOH L 4 .   ? 9.858   11.200  -21.773 1.00 40.35 ? 438 HOH B O   1 
HETATM 5480 O O   . HOH L 4 .   ? 23.480  5.153   -52.037 1.00 37.02 ? 439 HOH B O   1 
HETATM 5481 O O   . HOH L 4 .   ? 28.244  7.376   -16.367 1.00 26.25 ? 440 HOH B O   1 
HETATM 5482 O O   . HOH L 4 .   ? 27.010  21.729  -38.736 1.00 36.63 ? 441 HOH B O   1 
HETATM 5483 O O   . HOH L 4 .   ? 17.540  3.131   -10.070 1.00 39.62 ? 442 HOH B O   1 
HETATM 5484 O O   . HOH L 4 .   ? 11.916  2.620   -25.424 1.00 40.36 ? 443 HOH B O   1 
HETATM 5485 O O   . HOH L 4 .   ? 6.468   7.170   -53.169 1.00 37.89 ? 444 HOH B O   1 
HETATM 5486 O O   . HOH L 4 .   ? 37.564  -6.043  -29.261 1.00 30.25 ? 445 HOH B O   1 
HETATM 5487 O O   . HOH L 4 .   ? 14.030  -2.962  -35.580 1.00 34.62 ? 446 HOH B O   1 
HETATM 5488 O O   . HOH L 4 .   ? 35.680  15.205  -16.879 1.00 48.13 ? 447 HOH B O   1 
HETATM 5489 O O   . HOH L 4 .   ? 26.946  7.169   -44.170 1.00 47.00 ? 448 HOH B O   1 
HETATM 5490 O O   . HOH L 4 .   ? 10.265  17.113  -23.965 1.00 27.55 ? 449 HOH B O   1 
HETATM 5491 O O   . HOH L 4 .   ? 2.557   22.807  -44.584 1.00 40.06 ? 450 HOH B O   1 
HETATM 5492 O O   . HOH L 4 .   ? 28.220  -10.466 -28.308 1.00 40.48 ? 451 HOH B O   1 
HETATM 5493 O O   . HOH L 4 .   ? 16.445  18.465  -29.616 1.00 23.31 ? 452 HOH B O   1 
HETATM 5494 O O   . HOH L 4 .   ? 1.202   23.830  -34.279 1.00 25.07 ? 453 HOH B O   1 
HETATM 5495 O O   . HOH L 4 .   ? 15.904  4.026   -51.037 1.00 32.11 ? 454 HOH B O   1 
HETATM 5496 O O   . HOH L 4 .   ? 23.561  -8.294  -23.201 1.00 32.91 ? 455 HOH B O   1 
HETATM 5497 O O   . HOH L 4 .   ? 25.260  -1.801  -13.874 1.00 47.48 ? 456 HOH B O   1 
HETATM 5498 O O   . HOH L 4 .   ? 6.083   6.823   -46.379 1.00 28.72 ? 457 HOH B O   1 
HETATM 5499 O O   . HOH L 4 .   ? 15.888  -0.991  -6.962  1.00 36.87 ? 458 HOH B O   1 
HETATM 5500 O O   . HOH L 4 .   ? 30.846  10.173  -39.420 1.00 32.17 ? 459 HOH B O   1 
HETATM 5501 O O   . HOH L 4 .   ? 18.965  27.152  -44.668 1.00 42.59 ? 460 HOH B O   1 
HETATM 5502 O O   . HOH L 4 .   ? 21.887  10.213  -38.244 1.00 32.80 ? 461 HOH B O   1 
HETATM 5503 O O   . HOH L 4 .   ? 4.970   13.225  -43.572 1.00 33.78 ? 462 HOH B O   1 
HETATM 5504 O O   . HOH L 4 .   ? 2.349   5.696   -38.913 1.00 45.41 ? 463 HOH B O   1 
HETATM 5505 O O   . HOH L 4 .   ? 9.292   20.813  -40.184 1.00 22.03 ? 464 HOH B O   1 
HETATM 5506 O O   . HOH L 4 .   ? 5.555   15.577  -45.368 1.00 30.82 ? 465 HOH B O   1 
HETATM 5507 O O   . HOH L 4 .   ? 15.607  -4.484  -13.879 1.00 39.94 ? 466 HOH B O   1 
HETATM 5508 O O   . HOH L 4 .   ? 22.680  14.981  -51.695 1.00 30.66 ? 467 HOH B O   1 
HETATM 5509 O O   . HOH L 4 .   ? 26.844  -0.790  -25.361 1.00 34.33 ? 468 HOH B O   1 
HETATM 5510 O O   . HOH L 4 .   ? 30.046  -0.872  -18.574 1.00 51.89 ? 469 HOH B O   1 
HETATM 5511 O O   . HOH L 4 .   ? 20.049  17.772  -17.188 1.00 38.76 ? 470 HOH B O   1 
HETATM 5512 O O   . HOH L 4 .   ? 20.686  1.023   -47.052 1.00 44.85 ? 471 HOH B O   1 
HETATM 5513 O O   . HOH L 4 .   ? 36.612  -2.223  -26.861 1.00 32.53 ? 472 HOH B O   1 
HETATM 5514 O O   . HOH L 4 .   ? 18.661  9.263   -11.842 1.00 39.26 ? 473 HOH B O   1 
HETATM 5515 O O   . HOH L 4 .   ? 10.863  18.569  -41.067 1.00 22.49 ? 474 HOH B O   1 
HETATM 5516 O O   . HOH L 4 .   ? 38.014  -2.776  -30.761 1.00 35.13 ? 475 HOH B O   1 
HETATM 5517 O O   . HOH L 4 .   ? 16.346  21.720  -23.970 1.00 34.64 ? 476 HOH B O   1 
HETATM 5518 O O   . HOH L 4 .   ? 0.517   13.103  -42.952 1.00 36.58 ? 477 HOH B O   1 
HETATM 5519 O O   . HOH L 4 .   ? 8.847   1.346   -41.758 1.00 35.03 ? 478 HOH B O   1 
HETATM 5520 O O   . HOH L 4 .   ? 31.282  16.594  -24.924 1.00 30.37 ? 479 HOH B O   1 
HETATM 5521 O O   . HOH L 4 .   ? 3.660   25.307  -39.119 1.00 27.95 ? 480 HOH B O   1 
HETATM 5522 O O   . HOH L 4 .   ? 3.252   16.387  -45.039 1.00 31.64 ? 481 HOH B O   1 
HETATM 5523 O O   . HOH L 4 .   ? 7.334   24.523  -29.829 1.00 27.31 ? 482 HOH B O   1 
HETATM 5524 O O   . HOH L 4 .   ? 22.646  0.595   -20.336 1.00 34.95 ? 483 HOH B O   1 
HETATM 5525 O O   . HOH L 4 .   ? 9.208   14.704  -23.708 1.00 34.04 ? 484 HOH B O   1 
HETATM 5526 O O   . HOH L 4 .   ? 11.048  7.670   -37.459 1.00 34.82 ? 485 HOH B O   1 
HETATM 5527 O O   . HOH L 4 .   ? -5.467  26.876  -30.830 1.00 32.31 ? 486 HOH B O   1 
HETATM 5528 O O   . HOH L 4 .   ? 35.327  6.931   -17.849 1.00 38.22 ? 487 HOH B O   1 
HETATM 5529 O O   . HOH L 4 .   ? 14.665  0.368   -26.139 1.00 35.74 ? 488 HOH B O   1 
HETATM 5530 O O   . HOH L 4 .   ? 26.153  6.243   -51.939 1.00 47.87 ? 489 HOH B O   1 
HETATM 5531 O O   . HOH L 4 .   ? 9.995   25.526  -49.373 1.00 31.82 ? 490 HOH B O   1 
HETATM 5532 O O   . HOH L 4 .   ? 9.651   2.574   -31.753 1.00 30.11 ? 491 HOH B O   1 
HETATM 5533 O O   . HOH L 4 .   ? 2.495   12.134  -44.214 1.00 38.45 ? 492 HOH B O   1 
HETATM 5534 O O   . HOH L 4 .   ? 0.334   6.852   -41.240 1.00 41.86 ? 493 HOH B O   1 
HETATM 5535 O O   . HOH L 4 .   ? 24.861  -12.535 -28.709 1.00 35.18 ? 494 HOH B O   1 
HETATM 5536 O O   . HOH L 4 .   ? -1.937  17.301  -34.652 1.00 32.78 ? 495 HOH B O   1 
HETATM 5537 O O   . HOH L 4 .   ? 21.829  1.230   -23.098 1.00 33.12 ? 496 HOH B O   1 
HETATM 5538 O O   . HOH L 4 .   ? 24.366  -1.014  -23.928 1.00 30.27 ? 497 HOH B O   1 
HETATM 5539 O O   . HOH L 4 .   ? 39.580  4.378   -27.584 1.00 33.12 ? 498 HOH B O   1 
HETATM 5540 O O   . HOH L 4 .   ? 27.100  18.912  -39.402 1.00 33.90 ? 499 HOH B O   1 
HETATM 5541 O O   . HOH L 4 .   ? 18.411  10.920  -20.609 1.00 34.09 ? 500 HOH B O   1 
HETATM 5542 O O   . HOH L 4 .   ? 23.207  23.242  -43.437 1.00 28.64 ? 501 HOH B O   1 
HETATM 5543 O O   . HOH L 4 .   ? 35.681  13.637  -19.885 1.00 29.90 ? 502 HOH B O   1 
HETATM 5544 O O   . HOH L 4 .   ? 5.041   28.352  -41.320 1.00 40.76 ? 503 HOH B O   1 
HETATM 5545 O O   . HOH L 4 .   ? 27.296  -11.607 -32.645 1.00 40.10 ? 504 HOH B O   1 
HETATM 5546 O O   . HOH L 4 .   ? 24.800  24.768  -32.608 1.00 44.86 ? 505 HOH B O   1 
HETATM 5547 O O   . HOH L 4 .   ? 15.501  -0.403  -51.738 1.00 45.56 ? 506 HOH B O   1 
HETATM 5548 O O   . HOH L 4 .   ? 5.873   20.227  -46.614 1.00 36.55 ? 507 HOH B O   1 
HETATM 5549 O O   . HOH L 4 .   ? 11.286  16.522  -39.302 1.00 24.20 ? 508 HOH B O   1 
HETATM 5550 O O   . HOH L 4 .   ? 10.901  17.731  -36.984 1.00 30.01 ? 509 HOH B O   1 
HETATM 5551 O O   . HOH L 4 .   ? 22.195  23.082  -29.827 1.00 33.18 ? 510 HOH B O   1 
HETATM 5552 O O   . HOH L 4 .   ? 19.887  1.031   -12.627 1.00 33.81 ? 511 HOH B O   1 
HETATM 5553 O O   . HOH L 4 .   ? 6.050   9.674   -27.801 1.00 39.10 ? 512 HOH B O   1 
HETATM 5554 O O   . HOH L 4 .   ? 25.279  18.349  -17.772 1.00 30.43 ? 513 HOH B O   1 
HETATM 5555 O O   . HOH L 4 .   ? 18.225  13.358  -28.278 1.00 41.04 ? 514 HOH B O   1 
HETATM 5556 O O   . HOH L 4 .   ? 21.494  -1.150  -12.278 1.00 44.26 ? 515 HOH B O   1 
HETATM 5557 O O   . HOH L 4 .   ? 19.648  10.332  -55.542 1.00 39.90 ? 516 HOH B O   1 
HETATM 5558 O O   . HOH L 4 .   ? 22.851  23.492  -37.352 1.00 35.77 ? 517 HOH B O   1 
HETATM 5559 O O   . HOH L 4 .   ? 12.816  12.048  -35.487 1.00 53.64 ? 518 HOH B O   1 
HETATM 5560 O O   . HOH L 4 .   ? 22.757  26.369  -44.793 1.00 49.08 ? 519 HOH B O   1 
HETATM 5561 O O   . HOH L 4 .   ? 34.661  12.892  -31.308 1.00 41.96 ? 520 HOH B O   1 
HETATM 5562 O O   . HOH L 4 .   ? 18.197  -9.369  -28.176 1.00 37.50 ? 521 HOH B O   1 
HETATM 5563 O O   . HOH L 4 .   ? 38.548  -0.969  -28.366 1.00 37.10 ? 522 HOH B O   1 
HETATM 5564 O O   . HOH L 4 .   ? 19.499  28.871  -46.563 1.00 35.25 ? 523 HOH B O   1 
HETATM 5565 O O   . HOH L 4 .   ? 24.568  -4.099  -20.716 1.00 46.02 ? 524 HOH B O   1 
HETATM 5566 O O   . HOH L 4 .   ? 24.904  22.982  -39.009 1.00 37.45 ? 525 HOH B O   1 
HETATM 5567 O O   . HOH L 4 .   ? 24.279  24.369  -45.442 1.00 45.67 ? 526 HOH B O   1 
HETATM 5568 O O   . HOH L 4 .   ? 20.024  3.171   -10.867 1.00 36.74 ? 527 HOH B O   1 
HETATM 5569 O O   . HOH L 4 .   ? 28.597  23.026  -40.686 1.00 45.99 ? 528 HOH B O   1 
HETATM 5570 O O   . HOH L 4 .   ? 24.792  24.240  -41.577 1.00 36.04 ? 529 HOH B O   1 
HETATM 5571 O O   . HOH L 4 .   ? 21.037  7.889   -12.373 1.00 37.18 ? 530 HOH B O   1 
HETATM 5572 O O   . HOH L 4 .   ? 27.268  24.520  -42.515 1.00 43.82 ? 531 HOH B O   1 
HETATM 5573 O O   . HOH M 4 .   ? 9.461   -10.731 -47.909 1.00 40.31 ? 401 HOH C O   1 
HETATM 5574 O O   . HOH M 4 .   ? 16.527  -26.052 -50.190 1.00 38.98 ? 402 HOH C O   1 
HETATM 5575 O O   . HOH M 4 .   ? 4.658   -31.134 -63.091 1.00 41.25 ? 403 HOH C O   1 
HETATM 5576 O O   . HOH M 4 .   ? 22.711  -13.828 -54.353 1.00 48.24 ? 404 HOH C O   1 
HETATM 5577 O O   . HOH M 4 .   ? 14.271  -27.436 -50.530 1.00 37.16 ? 405 HOH C O   1 
HETATM 5578 O O   . HOH M 4 .   ? -13.606 -6.215  -59.562 1.00 40.66 ? 406 HOH C O   1 
HETATM 5579 O O   . HOH M 4 .   ? 15.964  -21.482 -46.872 1.00 50.82 ? 407 HOH C O   1 
HETATM 5580 O O   . HOH M 4 .   ? 6.467   -0.382  -56.550 1.00 37.46 ? 408 HOH C O   1 
HETATM 5581 O O   . HOH M 4 .   ? -14.095 -16.059 -37.039 1.00 38.23 ? 409 HOH C O   1 
HETATM 5582 O O   . HOH M 4 .   ? -5.089  8.758   -49.266 1.00 47.62 ? 410 HOH C O   1 
HETATM 5583 O O   . HOH M 4 .   ? 12.400  -5.708  -52.158 1.00 36.69 ? 411 HOH C O   1 
HETATM 5584 O O   . HOH M 4 .   ? 8.132   -4.634  -35.581 1.00 37.72 ? 412 HOH C O   1 
HETATM 5585 O O   . HOH M 4 .   ? 3.027   -11.823 -32.284 1.00 43.42 ? 413 HOH C O   1 
HETATM 5586 O O   . HOH M 4 .   ? -11.514 -5.314  -38.330 1.00 33.17 ? 414 HOH C O   1 
HETATM 5587 O O   . HOH M 4 .   ? 17.495  -22.621 -65.256 1.00 47.52 ? 415 HOH C O   1 
HETATM 5588 O O   . HOH M 4 .   ? -12.438 -13.006 -32.278 1.00 36.85 ? 416 HOH C O   1 
HETATM 5589 O O   . HOH M 4 .   ? -4.923  -16.952 -65.809 1.00 36.29 ? 417 HOH C O   1 
HETATM 5590 O O   . HOH M 4 .   ? -0.165  -1.756  -32.785 1.00 38.27 ? 418 HOH C O   1 
HETATM 5591 O O   . HOH M 4 .   ? 3.219   -6.697  -47.370 1.00 27.05 ? 419 HOH C O   1 
HETATM 5592 O O   . HOH M 4 .   ? -13.702 -19.084 -36.622 1.00 37.33 ? 420 HOH C O   1 
HETATM 5593 O O   . HOH M 4 .   ? 5.971   -13.530 -57.025 1.00 44.17 ? 421 HOH C O   1 
HETATM 5594 O O   . HOH M 4 .   ? 20.164  -26.690 -54.776 1.00 27.17 ? 422 HOH C O   1 
HETATM 5595 O O   . HOH M 4 .   ? 8.634   -13.142 -43.852 1.00 32.18 ? 423 HOH C O   1 
HETATM 5596 O O   . HOH M 4 .   ? 14.970  -23.515 -66.890 1.00 47.94 ? 424 HOH C O   1 
HETATM 5597 O O   . HOH M 4 .   ? 11.357  -19.886 -44.389 1.00 27.77 ? 425 HOH C O   1 
HETATM 5598 O O   . HOH M 4 .   ? 4.978   -21.311 -49.955 1.00 27.78 ? 426 HOH C O   1 
HETATM 5599 O O   . HOH M 4 .   ? -4.004  -12.608 -31.843 1.00 30.55 ? 427 HOH C O   1 
HETATM 5600 O O   . HOH M 4 .   ? -18.036 -6.475  -48.515 1.00 35.82 ? 428 HOH C O   1 
HETATM 5601 O O   . HOH M 4 .   ? -4.418  -12.010 -36.403 1.00 23.42 ? 429 HOH C O   1 
HETATM 5602 O O   . HOH M 4 .   ? -12.967 -14.053 -35.082 1.00 36.60 ? 430 HOH C O   1 
HETATM 5603 O O   . HOH M 4 .   ? 2.263   -3.111  -44.680 1.00 35.98 ? 431 HOH C O   1 
HETATM 5604 O O   . HOH M 4 .   ? -8.135  -0.394  -45.378 1.00 47.30 ? 432 HOH C O   1 
HETATM 5605 O O   . HOH M 4 .   ? -1.218  -13.842 -58.424 1.00 32.65 ? 433 HOH C O   1 
HETATM 5606 O O   . HOH M 4 .   ? 11.928  -24.124 -60.333 1.00 26.75 ? 434 HOH C O   1 
HETATM 5607 O O   . HOH M 4 .   ? 1.670   -20.845 -37.549 1.00 39.60 ? 435 HOH C O   1 
HETATM 5608 O O   . HOH M 4 .   ? 10.724  -17.787 -62.515 1.00 33.26 ? 436 HOH C O   1 
HETATM 5609 O O   . HOH M 4 .   ? 5.999   -6.194  -47.018 1.00 26.33 ? 437 HOH C O   1 
HETATM 5610 O O   . HOH M 4 .   ? 20.176  -31.613 -58.669 1.00 50.62 ? 438 HOH C O   1 
HETATM 5611 O O   . HOH M 4 .   ? -3.652  -1.006  -61.116 1.00 38.40 ? 439 HOH C O   1 
HETATM 5612 O O   . HOH M 4 .   ? 4.048   -7.840  -71.520 1.00 35.60 ? 440 HOH C O   1 
HETATM 5613 O O   . HOH M 4 .   ? 12.042  -4.420  -62.380 1.00 45.99 ? 441 HOH C O   1 
HETATM 5614 O O   . HOH M 4 .   ? 11.372  -26.663 -45.166 1.00 50.78 ? 442 HOH C O   1 
HETATM 5615 O O   . HOH M 4 .   ? 17.951  -19.803 -65.403 1.00 46.96 ? 443 HOH C O   1 
HETATM 5616 O O   . HOH M 4 .   ? -7.973  -17.732 -34.001 1.00 28.00 ? 444 HOH C O   1 
HETATM 5617 O O   . HOH M 4 .   ? -15.937 -2.112  -46.552 1.00 36.03 ? 445 HOH C O   1 
HETATM 5618 O O   . HOH M 4 .   ? -14.569 -17.292 -49.714 1.00 56.12 ? 446 HOH C O   1 
HETATM 5619 O O   . HOH M 4 .   ? -4.703  -1.630  -33.398 1.00 23.75 ? 447 HOH C O   1 
HETATM 5620 O O   . HOH M 4 .   ? -6.132  -2.750  -45.541 1.00 33.28 ? 448 HOH C O   1 
HETATM 5621 O O   . HOH M 4 .   ? 9.876   -11.239 -58.161 1.00 36.44 ? 449 HOH C O   1 
HETATM 5622 O O   . HOH M 4 .   ? 1.542   -31.027 -50.352 1.00 46.28 ? 450 HOH C O   1 
HETATM 5623 O O   . HOH M 4 .   ? 3.710   -5.283  -30.213 1.00 40.97 ? 451 HOH C O   1 
HETATM 5624 O O   . HOH M 4 .   ? 9.309   -2.688  -46.752 1.00 42.41 ? 452 HOH C O   1 
HETATM 5625 O O   . HOH M 4 .   ? -8.927  -1.112  -48.328 1.00 37.47 ? 453 HOH C O   1 
HETATM 5626 O O   . HOH M 4 .   ? -18.935 -8.987  -47.225 1.00 34.49 ? 454 HOH C O   1 
HETATM 5627 O O   . HOH M 4 .   ? 14.369  -10.055 -67.240 1.00 32.74 ? 455 HOH C O   1 
HETATM 5628 O O   . HOH M 4 .   ? 10.228  -21.862 -61.445 1.00 31.86 ? 456 HOH C O   1 
HETATM 5629 O O   . HOH M 4 .   ? -6.728  -10.613 -36.225 1.00 22.49 ? 457 HOH C O   1 
HETATM 5630 O O   . HOH M 4 .   ? -14.778 -0.988  -53.099 1.00 39.20 ? 458 HOH C O   1 
HETATM 5631 O O   . HOH M 4 .   ? 21.669  -27.984 -56.509 1.00 48.51 ? 459 HOH C O   1 
HETATM 5632 O O   . HOH M 4 .   ? -3.597  -21.252 -38.173 1.00 25.87 ? 460 HOH C O   1 
HETATM 5633 O O   . HOH M 4 .   ? 10.447  -20.859 -57.444 1.00 37.38 ? 461 HOH C O   1 
HETATM 5634 O O   . HOH M 4 .   ? -13.909 -15.424 -45.062 1.00 21.80 ? 462 HOH C O   1 
HETATM 5635 O O   . HOH M 4 .   ? -9.714  -20.292 -44.728 1.00 26.62 ? 463 HOH C O   1 
HETATM 5636 O O   . HOH M 4 .   ? 8.417   4.284   -52.709 1.00 36.27 ? 464 HOH C O   1 
HETATM 5637 O O   . HOH M 4 .   ? 11.141  -29.076 -69.317 1.00 44.52 ? 465 HOH C O   1 
HETATM 5638 O O   . HOH M 4 .   ? 5.422   -30.327 -45.420 1.00 44.57 ? 466 HOH C O   1 
HETATM 5639 O O   . HOH M 4 .   ? 1.429   -3.367  -66.477 1.00 49.09 ? 467 HOH C O   1 
HETATM 5640 O O   . HOH M 4 .   ? 1.582   -3.830  -33.198 1.00 30.35 ? 468 HOH C O   1 
HETATM 5641 O O   . HOH M 4 .   ? -3.066  -20.344 -31.736 1.00 42.74 ? 469 HOH C O   1 
HETATM 5642 O O   . HOH M 4 .   ? -10.363 -14.053 -59.464 1.00 44.26 ? 470 HOH C O   1 
HETATM 5643 O O   . HOH M 4 .   ? -15.809 -11.282 -52.959 1.00 40.39 ? 471 HOH C O   1 
HETATM 5644 O O   . HOH M 4 .   ? -8.243  -21.162 -33.343 1.00 31.52 ? 472 HOH C O   1 
HETATM 5645 O O   . HOH M 4 .   ? -12.615 0.584   -52.927 1.00 44.42 ? 473 HOH C O   1 
HETATM 5646 O O   . HOH M 4 .   ? 16.924  -9.698  -68.325 1.00 42.16 ? 474 HOH C O   1 
HETATM 5647 O O   . HOH M 4 .   ? -2.015  -3.387  -40.849 1.00 33.64 ? 475 HOH C O   1 
HETATM 5648 O O   . HOH M 4 .   ? 11.960  -17.028 -44.101 1.00 32.53 ? 476 HOH C O   1 
HETATM 5649 O O   . HOH M 4 .   ? 6.281   -32.551 -64.565 1.00 48.33 ? 477 HOH C O   1 
HETATM 5650 O O   . HOH M 4 .   ? 5.559   2.579   -48.258 1.00 41.72 ? 478 HOH C O   1 
HETATM 5651 O O   . HOH M 4 .   ? -5.686  -12.072 -29.993 1.00 40.60 ? 479 HOH C O   1 
HETATM 5652 O O   . HOH M 4 .   ? -1.002  -4.168  -43.620 1.00 31.01 ? 480 HOH C O   1 
HETATM 5653 O O   . HOH M 4 .   ? -5.291  -24.218 -50.202 1.00 44.50 ? 481 HOH C O   1 
HETATM 5654 O O   . HOH M 4 .   ? -3.494  -2.199  -44.150 1.00 34.65 ? 482 HOH C O   1 
HETATM 5655 O O   . HOH M 4 .   ? 9.941   -9.129  -37.408 1.00 50.60 ? 483 HOH C O   1 
HETATM 5656 O O   . HOH M 4 .   ? 15.242  -18.468 -66.110 1.00 42.37 ? 484 HOH C O   1 
HETATM 5657 O O   . HOH M 4 .   ? 3.653   -16.290 -49.027 1.00 40.92 ? 485 HOH C O   1 
HETATM 5658 O O   . HOH M 4 .   ? 1.274   -0.869  -42.352 1.00 43.73 ? 486 HOH C O   1 
HETATM 5659 O O   . HOH M 4 .   ? -8.242  -19.163 -59.487 1.00 41.90 ? 487 HOH C O   1 
HETATM 5660 O O   . HOH M 4 .   ? 15.752  -16.419 -64.628 1.00 46.94 ? 488 HOH C O   1 
HETATM 5661 O O   . HOH M 4 .   ? -13.388 -9.887  -37.129 1.00 31.78 ? 489 HOH C O   1 
HETATM 5662 O O   . HOH M 4 .   ? 10.913  -14.409 -42.528 1.00 54.37 ? 490 HOH C O   1 
HETATM 5663 O O   . HOH M 4 .   ? 2.884   -13.810 -41.093 1.00 34.23 ? 491 HOH C O   1 
HETATM 5664 O O   . HOH M 4 .   ? -2.752  -1.329  -41.745 1.00 48.88 ? 492 HOH C O   1 
HETATM 5665 O O   . HOH M 4 .   ? 16.227  -25.711 -67.738 1.00 49.85 ? 493 HOH C O   1 
HETATM 5666 O O   . HOH M 4 .   ? 3.925   -19.935 -36.764 1.00 37.74 ? 494 HOH C O   1 
HETATM 5667 O O   . HOH M 4 .   ? -0.966  -12.485 -31.667 1.00 45.05 ? 495 HOH C O   1 
HETATM 5668 O O   . HOH M 4 .   ? 1.489   -5.795  -31.326 1.00 35.85 ? 496 HOH C O   1 
HETATM 5669 O O   . HOH M 4 .   ? 0.531   -10.772 -32.625 1.00 37.06 ? 497 HOH C O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ALA A 1   ? 0.8482 0.6619 0.6987 0.0163  0.0857  -0.0054 6   ALA A N   
2    C CA  . ALA A 1   ? 0.8145 0.6322 0.6699 0.0167  0.0823  -0.0046 6   ALA A CA  
3    C C   . ALA A 1   ? 0.7572 0.5789 0.6111 0.0153  0.0765  -0.0040 6   ALA A C   
4    O O   . ALA A 1   ? 0.8431 0.6705 0.7031 0.0159  0.0736  -0.0028 6   ALA A O   
5    C CB  . ALA A 1   ? 0.8146 0.6262 0.6660 0.0164  0.0837  -0.0059 6   ALA A CB  
6    N N   . ILE A 2   ? 0.7056 0.5243 0.5515 0.0134  0.0750  -0.0047 7   ILE A N   
7    C CA  . ILE A 2   ? 0.6807 0.5020 0.5245 0.0120  0.0697  -0.0043 7   ILE A CA  
8    C C   . ILE A 2   ? 0.5928 0.4224 0.4434 0.0127  0.0665  -0.0028 7   ILE A C   
9    O O   . ILE A 2   ? 0.6153 0.4488 0.4679 0.0123  0.0627  -0.0021 7   ILE A O   
10   C CB  . ILE A 2   ? 0.7273 0.5428 0.5607 0.0095  0.0683  -0.0053 7   ILE A CB  
11   C CG1 . ILE A 2   ? 0.6726 0.4895 0.5042 0.0088  0.0674  -0.0049 7   ILE A CG1 
12   C CG2 . ILE A 2   ? 0.7342 0.5406 0.5599 0.0089  0.0721  -0.0069 7   ILE A CG2 
13   C CD1 . ILE A 2   ? 0.7096 0.5254 0.5354 0.0066  0.0630  -0.0049 7   ILE A CD1 
14   N N   . ILE A 3   ? 0.5442 0.3765 0.3988 0.0137  0.0682  -0.0023 8   ILE A N   
15   C CA  . ILE A 3   ? 0.5521 0.3921 0.4139 0.0146  0.0655  -0.0010 8   ILE A CA  
16   C C   . ILE A 3   ? 0.5380 0.3815 0.4084 0.0166  0.0673  -0.0001 8   ILE A C   
17   O O   . ILE A 3   ? 0.5327 0.3748 0.4056 0.0176  0.0712  0.0000  8   ILE A O   
18   C CB  . ILE A 3   ? 0.5183 0.3594 0.3793 0.0143  0.0654  -0.0008 8   ILE A CB  
19   C CG1 . ILE A 3   ? 0.5560 0.3940 0.4089 0.0122  0.0630  -0.0014 8   ILE A CG1 
20   C CG2 . ILE A 3   ? 0.5046 0.3532 0.3733 0.0154  0.0630  0.0004  8   ILE A CG2 
21   C CD1 . ILE A 3   ? 0.6165 0.4567 0.4686 0.0113  0.0585  -0.0012 8   ILE A CD1 
22   N N   . LYS A 4   ? 0.5455 0.3935 0.4206 0.0171  0.0646  0.0007  9   LYS A N   
23   C CA  . LYS A 4   ? 0.5138 0.3647 0.3967 0.0187  0.0658  0.0017  9   LYS A CA  
24   C C   . LYS A 4   ? 0.4840 0.3408 0.3738 0.0197  0.0647  0.0030  9   LYS A C   
25   O O   . LYS A 4   ? 0.4720 0.3310 0.3604 0.0192  0.0627  0.0030  9   LYS A O   
26   C CB  . LYS A 4   ? 0.5542 0.4066 0.4384 0.0185  0.0634  0.0021  9   LYS A CB  
27   C CG  . LYS A 4   ? 0.5585 0.4048 0.4355 0.0173  0.0638  0.0009  9   LYS A CG  
28   C CD  . LYS A 4   ? 0.6214 0.4628 0.4989 0.0180  0.0681  0.0003  9   LYS A CD  
29   C CE  . LYS A 4   ? 0.6088 0.4432 0.4784 0.0167  0.0688  -0.0011 9   LYS A CE  
30   N NZ  . LYS A 4   ? 0.6853 0.5209 0.5529 0.0156  0.0646  -0.0008 9   LYS A NZ  
31   N N   . GLU A 5   ? 0.4782 0.3375 0.3755 0.0211  0.0660  0.0041  10  GLU A N   
32   C CA  . GLU A 5   ? 0.4701 0.3346 0.3744 0.0221  0.0651  0.0055  10  GLU A CA  
33   C C   . GLU A 5   ? 0.4538 0.3238 0.3593 0.0218  0.0603  0.0060  10  GLU A C   
34   O O   . GLU A 5   ? 0.4541 0.3281 0.3634 0.0222  0.0587  0.0068  10  GLU A O   
35   C CB  . GLU A 5   ? 0.5536 0.4192 0.4659 0.0235  0.0673  0.0067  10  GLU A CB  
36   C CG  . GLU A 5   ? 0.6323 0.4921 0.5431 0.0240  0.0724  0.0060  10  GLU A CG  
37   C CD  . GLU A 5   ? 0.6779 0.5384 0.5968 0.0255  0.0757  0.0073  10  GLU A CD  
38   O OE1 . GLU A 5   ? 0.7437 0.6080 0.6675 0.0260  0.0750  0.0085  10  GLU A OE1 
39   O OE2 . GLU A 5   ? 0.7675 0.6249 0.6883 0.0263  0.0790  0.0072  10  GLU A OE2 
40   N N   . PHE A 6   ? 0.4556 0.3254 0.3579 0.0210  0.0582  0.0057  11  PHE A N   
41   C CA  . PHE A 6   ? 0.4442 0.3187 0.3468 0.0206  0.0539  0.0061  11  PHE A CA  
42   C C   . PHE A 6   ? 0.4182 0.2900 0.3137 0.0192  0.0527  0.0050  11  PHE A C   
43   O O   . PHE A 6   ? 0.4706 0.3384 0.3630 0.0188  0.0540  0.0045  11  PHE A O   
44   C CB  . PHE A 6   ? 0.4655 0.3432 0.3731 0.0212  0.0526  0.0073  11  PHE A CB  
45   C CG  . PHE A 6   ? 0.4928 0.3745 0.3998 0.0207  0.0488  0.0076  11  PHE A CG  
46   C CD1 . PHE A 6   ? 0.5059 0.3920 0.4155 0.0211  0.0466  0.0081  11  PHE A CD1 
47   C CD2 . PHE A 6   ? 0.4841 0.3650 0.3879 0.0199  0.0475  0.0074  11  PHE A CD2 
48   C CE1 . PHE A 6   ? 0.5139 0.4037 0.4227 0.0207  0.0433  0.0083  11  PHE A CE1 
49   C CE2 . PHE A 6   ? 0.5251 0.4100 0.4286 0.0195  0.0442  0.0078  11  PHE A CE2 
50   C CZ  . PHE A 6   ? 0.4894 0.3787 0.3952 0.0200  0.0423  0.0082  11  PHE A CZ  
51   N N   . MET A 7   ? 0.4015 0.2754 0.2945 0.0186  0.0500  0.0047  12  MET A N   
52   C CA  . MET A 7   ? 0.3906 0.2622 0.2774 0.0172  0.0485  0.0039  12  MET A CA  
53   C C   . MET A 7   ? 0.3784 0.2549 0.2661 0.0170  0.0448  0.0044  12  MET A C   
54   O O   . MET A 7   ? 0.3551 0.2354 0.2460 0.0177  0.0437  0.0047  12  MET A O   
55   C CB  . MET A 7   ? 0.4324 0.2998 0.3139 0.0163  0.0498  0.0029  12  MET A CB  
56   C CG  . MET A 7   ? 0.4671 0.3287 0.3461 0.0163  0.0538  0.0023  12  MET A CG  
57   S SD  . MET A 7   ? 0.5124 0.3690 0.3865 0.0153  0.0543  0.0016  12  MET A SD  
58   C CE  . MET A 7   ? 0.4995 0.3527 0.3651 0.0131  0.0519  0.0009  12  MET A CE  
59   N N   . ARG A 8   ? 0.3839 0.2601 0.2687 0.0161  0.0430  0.0043  13  ARG A N   
60   C CA  . ARG A 8   ? 0.3658 0.2460 0.2507 0.0158  0.0398  0.0047  13  ARG A CA  
61   C C   . ARG A 8   ? 0.3714 0.2492 0.2512 0.0145  0.0387  0.0040  13  ARG A C   
62   O O   . ARG A 8   ? 0.4089 0.2816 0.2841 0.0135  0.0400  0.0034  13  ARG A O   
63   C CB  . ARG A 8   ? 0.4126 0.2944 0.2982 0.0155  0.0383  0.0054  13  ARG A CB  
64   C CG  . ARG A 8   ? 0.4391 0.3238 0.3300 0.0167  0.0389  0.0063  13  ARG A CG  
65   C CD  . ARG A 8   ? 0.4959 0.3835 0.3883 0.0165  0.0370  0.0073  13  ARG A CD  
66   N NE  . ARG A 8   ? 0.5136 0.4037 0.4110 0.0174  0.0374  0.0083  13  ARG A NE  
67   C CZ  . ARG A 8   ? 0.5912 0.4857 0.4926 0.0183  0.0364  0.0089  13  ARG A CZ  
68   N NH1 . ARG A 8   ? 0.6147 0.5117 0.5157 0.0186  0.0352  0.0085  13  ARG A NH1 
69   N NH2 . ARG A 8   ? 0.5760 0.4722 0.4817 0.0189  0.0367  0.0101  13  ARG A NH2 
70   N N   . PHE A 9   ? 0.3575 0.2391 0.2381 0.0144  0.0361  0.0042  14  PHE A N   
71   C CA  . PHE A 9   ? 0.3425 0.2224 0.2190 0.0132  0.0345  0.0039  14  PHE A CA  
72   C C   . PHE A 9   ? 0.3537 0.2376 0.2314 0.0130  0.0317  0.0045  14  PHE A C   
73   O O   . PHE A 9   ? 0.3727 0.2613 0.2545 0.0141  0.0310  0.0049  14  PHE A O   
74   C CB  . PHE A 9   ? 0.3527 0.2319 0.2285 0.0132  0.0350  0.0033  14  PHE A CB  
75   C CG  . PHE A 9   ? 0.3441 0.2282 0.2243 0.0144  0.0338  0.0034  14  PHE A CG  
76   C CD1 . PHE A 9   ? 0.3723 0.2592 0.2527 0.0142  0.0313  0.0035  14  PHE A CD1 
77   C CD2 . PHE A 9   ? 0.3625 0.2481 0.2464 0.0157  0.0353  0.0035  14  PHE A CD2 
78   C CE1 . PHE A 9   ? 0.3838 0.2746 0.2677 0.0153  0.0303  0.0034  14  PHE A CE1 
79   C CE2 . PHE A 9   ? 0.3937 0.2832 0.2811 0.0166  0.0341  0.0035  14  PHE A CE2 
80   C CZ  . PHE A 9   ? 0.3935 0.2855 0.2806 0.0165  0.0316  0.0033  14  PHE A CZ  
81   N N   . LYS A 10  ? 0.3504 0.2325 0.2247 0.0116  0.0301  0.0045  15  LYS A N   
82   C CA  . LYS A 10  ? 0.3641 0.2497 0.2396 0.0114  0.0274  0.0051  15  LYS A CA  
83   C C   . LYS A 10  ? 0.3770 0.2617 0.2508 0.0107  0.0262  0.0049  15  LYS A C   
84   O O   . LYS A 10  ? 0.3727 0.2527 0.2424 0.0096  0.0268  0.0044  15  LYS A O   
85   C CB  . LYS A 10  ? 0.3996 0.2838 0.2732 0.0101  0.0262  0.0059  15  LYS A CB  
86   C CG  . LYS A 10  ? 0.4374 0.3223 0.3127 0.0106  0.0272  0.0064  15  LYS A CG  
87   C CD  . LYS A 10  ? 0.4629 0.3446 0.3353 0.0092  0.0264  0.0070  15  LYS A CD  
88   C CE  . LYS A 10  ? 0.4977 0.3826 0.3734 0.0098  0.0262  0.0079  15  LYS A CE  
89   N NZ  . LYS A 10  ? 0.5032 0.3854 0.3788 0.0102  0.0284  0.0076  15  LYS A NZ  
90   N N   . VAL A 11  ? 0.3338 0.2228 0.2105 0.0113  0.0245  0.0051  16  VAL A N   
91   C CA  . VAL A 11  ? 0.3410 0.2297 0.2170 0.0108  0.0232  0.0049  16  VAL A CA  
92   C C   . VAL A 11  ? 0.3639 0.2558 0.2418 0.0106  0.0208  0.0056  16  VAL A C   
93   O O   . VAL A 11  ? 0.3514 0.2476 0.2326 0.0117  0.0206  0.0060  16  VAL A O   
94   C CB  . VAL A 11  ? 0.3463 0.2366 0.2244 0.0121  0.0240  0.0041  16  VAL A CB  
95   C CG1 . VAL A 11  ? 0.3450 0.2405 0.2278 0.0139  0.0240  0.0040  16  VAL A CG1 
96   C CG2 . VAL A 11  ? 0.3500 0.2395 0.2272 0.0114  0.0225  0.0040  16  VAL A CG2 
97   N N   . HIS A 12  ? 0.3398 0.2295 0.2156 0.0092  0.0191  0.0060  17  HIS A N   
98   C CA  . HIS A 12  ? 0.3417 0.2342 0.2198 0.0090  0.0169  0.0068  17  HIS A CA  
99   C C   . HIS A 12  ? 0.3562 0.2484 0.2346 0.0088  0.0158  0.0065  17  HIS A C   
100  O O   . HIS A 12  ? 0.3602 0.2478 0.2347 0.0075  0.0158  0.0063  17  HIS A O   
101  C CB  . HIS A 12  ? 0.3855 0.2756 0.2614 0.0071  0.0152  0.0079  17  HIS A CB  
102  C CG  . HIS A 12  ? 0.4675 0.3606 0.3465 0.0069  0.0129  0.0090  17  HIS A CG  
103  N ND1 . HIS A 12  ? 0.5244 0.4155 0.4024 0.0055  0.0109  0.0096  17  HIS A ND1 
104  C CD2 . HIS A 12  ? 0.4876 0.3855 0.3709 0.0079  0.0124  0.0097  17  HIS A CD2 
105  C CE1 . HIS A 12  ? 0.5273 0.4220 0.4093 0.0057  0.0092  0.0107  17  HIS A CE1 
106  N NE2 . HIS A 12  ? 0.5129 0.4118 0.3982 0.0072  0.0103  0.0107  17  HIS A NE2 
107  N N   . MET A 13  ? 0.3276 0.2241 0.2101 0.0101  0.0150  0.0063  18  MET A N   
108  C CA  . MET A 13  ? 0.3406 0.2369 0.2240 0.0098  0.0136  0.0062  18  MET A CA  
109  C C   . MET A 13  ? 0.3608 0.2595 0.2471 0.0096  0.0114  0.0073  18  MET A C   
110  O O   . MET A 13  ? 0.3366 0.2395 0.2263 0.0108  0.0116  0.0075  18  MET A O   
111  C CB  . MET A 13  ? 0.3330 0.2318 0.2190 0.0116  0.0145  0.0051  18  MET A CB  
112  C CG  . MET A 13  ? 0.3425 0.2413 0.2298 0.0115  0.0130  0.0049  18  MET A CG  
113  S SD  . MET A 13  ? 0.3534 0.2556 0.2444 0.0137  0.0137  0.0036  18  MET A SD  
114  C CE  . MET A 13  ? 0.3589 0.2575 0.2467 0.0134  0.0155  0.0031  18  MET A CE  
115  N N   . GLU A 14  ? 0.3443 0.2405 0.2294 0.0079  0.0094  0.0081  19  GLU A N   
116  C CA  . GLU A 14  ? 0.3442 0.2428 0.2331 0.0078  0.0072  0.0091  19  GLU A CA  
117  C C   . GLU A 14  ? 0.3469 0.2457 0.2373 0.0082  0.0065  0.0085  19  GLU A C   
118  O O   . GLU A 14  ? 0.3379 0.2330 0.2250 0.0071  0.0063  0.0084  19  GLU A O   
119  C CB  . GLU A 14  ? 0.4389 0.3340 0.3252 0.0053  0.0051  0.0108  19  GLU A CB  
120  C CG  . GLU A 14  ? 0.5406 0.4375 0.4309 0.0047  0.0025  0.0123  19  GLU A CG  
121  C CD  . GLU A 14  ? 0.6581 0.5503 0.5450 0.0018  -0.0001 0.0139  19  GLU A CD  
122  O OE1 . GLU A 14  ? 0.7361 0.6235 0.6171 0.0002  0.0001  0.0139  19  GLU A OE1 
123  O OE2 . GLU A 14  ? 0.7577 0.6506 0.6477 0.0010  -0.0025 0.0153  19  GLU A OE2 
124  N N   . GLY A 15  ? 0.3061 0.2091 0.2015 0.0099  0.0062  0.0082  20  GLY A N   
125  C CA  . GLY A 15  ? 0.3301 0.2334 0.2273 0.0105  0.0057  0.0075  20  GLY A CA  
126  C C   . GLY A 15  ? 0.3203 0.2271 0.2229 0.0115  0.0043  0.0079  20  GLY A C   
127  O O   . GLY A 15  ? 0.3178 0.2276 0.2234 0.0121  0.0043  0.0085  20  GLY A O   
128  N N   . SER A 16  ? 0.3028 0.2090 0.2068 0.0115  0.0032  0.0076  21  SER A N   
129  C CA  . SER A 16  ? 0.3144 0.2239 0.2239 0.0129  0.0024  0.0074  21  SER A CA  
130  C C   . SER A 16  ? 0.3179 0.2271 0.2281 0.0139  0.0025  0.0060  21  SER A C   
131  O O   . SER A 16  ? 0.2988 0.2046 0.2058 0.0126  0.0020  0.0061  21  SER A O   
132  C CB  . SER A 16  ? 0.3765 0.2857 0.2888 0.0116  0.0000  0.0092  21  SER A CB  
133  O OG  . SER A 16  ? 0.4530 0.3587 0.3635 0.0098  -0.0020 0.0100  21  SER A OG  
134  N N   . VAL A 17  ? 0.2663 0.1788 0.1802 0.0161  0.0032  0.0047  22  VAL A N   
135  C CA  . VAL A 17  ? 0.2782 0.1906 0.1934 0.0171  0.0029  0.0035  22  VAL A CA  
136  C C   . VAL A 17  ? 0.2821 0.1970 0.2028 0.0184  0.0020  0.0033  22  VAL A C   
137  O O   . VAL A 17  ? 0.2878 0.2059 0.2111 0.0199  0.0031  0.0028  22  VAL A O   
138  C CB  . VAL A 17  ? 0.2757 0.1891 0.1896 0.0187  0.0050  0.0017  22  VAL A CB  
139  C CG1 . VAL A 17  ? 0.2767 0.1904 0.1925 0.0200  0.0046  0.0003  22  VAL A CG1 
140  C CG2 . VAL A 17  ? 0.2837 0.1945 0.1927 0.0176  0.0061  0.0019  22  VAL A CG2 
141  N N   . ASN A 18  ? 0.2782 0.1917 0.2007 0.0177  0.0000  0.0037  23  ASN A N   
142  C CA  . ASN A 18  ? 0.2879 0.2033 0.2161 0.0186  -0.0011 0.0039  23  ASN A CA  
143  C C   . ASN A 18  ? 0.3017 0.2195 0.2332 0.0187  -0.0012 0.0052  23  ASN A C   
144  O O   . ASN A 18  ? 0.3255 0.2462 0.2617 0.0205  -0.0007 0.0046  23  ASN A O   
145  C CB  . ASN A 18  ? 0.2878 0.2052 0.2185 0.0211  -0.0001 0.0017  23  ASN A CB  
146  C CG  . ASN A 18  ? 0.2935 0.2088 0.2237 0.0210  -0.0012 0.0009  23  ASN A CG  
147  O OD1 . ASN A 18  ? 0.2955 0.2079 0.2222 0.0192  -0.0018 0.0017  23  ASN A OD1 
148  N ND2 . ASN A 18  ? 0.3131 0.2297 0.2467 0.0229  -0.0012 -0.0005 23  ASN A ND2 
149  N N   . GLY A 19  ? 0.2961 0.2123 0.2251 0.0166  -0.0020 0.0070  24  GLY A N   
150  C CA  . GLY A 19  ? 0.3212 0.2395 0.2535 0.0164  -0.0023 0.0086  24  GLY A CA  
151  C C   . GLY A 19  ? 0.3198 0.2405 0.2510 0.0175  0.0000  0.0081  24  GLY A C   
152  O O   . GLY A 19  ? 0.3554 0.2772 0.2882 0.0168  -0.0002 0.0098  24  GLY A O   
153  N N   . HIS A 20  ? 0.3087 0.2299 0.2369 0.0188  0.0022  0.0062  25  HIS A N   
154  C CA  . HIS A 20  ? 0.3080 0.2316 0.2354 0.0199  0.0044  0.0058  25  HIS A CA  
155  C C   . HIS A 20  ? 0.3105 0.2318 0.2329 0.0181  0.0046  0.0066  25  HIS A C   
156  O O   . HIS A 20  ? 0.3213 0.2402 0.2396 0.0178  0.0050  0.0057  25  HIS A O   
157  C CB  . HIS A 20  ? 0.3060 0.2312 0.2326 0.0221  0.0065  0.0035  25  HIS A CB  
158  C CG  . HIS A 20  ? 0.3673 0.2953 0.2936 0.0232  0.0086  0.0033  25  HIS A CG  
159  N ND1 . HIS A 20  ? 0.4180 0.3452 0.3401 0.0226  0.0096  0.0033  25  HIS A ND1 
160  C CD2 . HIS A 20  ? 0.3758 0.3074 0.3055 0.0247  0.0099  0.0032  25  HIS A CD2 
161  C CE1 . HIS A 20  ? 0.3827 0.3128 0.3055 0.0236  0.0112  0.0034  25  HIS A CE1 
162  N NE2 . HIS A 20  ? 0.3989 0.3317 0.3260 0.0250  0.0116  0.0032  25  HIS A NE2 
163  N N   . GLU A 21  ? 0.3272 0.2492 0.2501 0.0172  0.0043  0.0083  26  GLU A N   
164  C CA  . GLU A 21  ? 0.3249 0.2445 0.2435 0.0154  0.0041  0.0093  26  GLU A CA  
165  C C   . GLU A 21  ? 0.3472 0.2683 0.2637 0.0164  0.0065  0.0084  26  GLU A C   
166  O O   . GLU A 21  ? 0.3601 0.2850 0.2794 0.0182  0.0080  0.0080  26  GLU A O   
167  C CB  . GLU A 21  ? 0.3564 0.2756 0.2768 0.0136  0.0023  0.0118  26  GLU A CB  
168  C CG  . GLU A 21  ? 0.3921 0.3088 0.3135 0.0120  -0.0004 0.0129  26  GLU A CG  
169  C CD  . GLU A 21  ? 0.4878 0.4033 0.4106 0.0098  -0.0030 0.0155  26  GLU A CD  
170  O OE1 . GLU A 21  ? 0.5502 0.4678 0.4751 0.0098  -0.0028 0.0168  26  GLU A OE1 
171  O OE2 . GLU A 21  ? 0.5286 0.4411 0.4509 0.0080  -0.0055 0.0165  26  GLU A OE2 
172  N N   . PHE A 22  ? 0.3066 0.2249 0.2183 0.0154  0.0070  0.0081  27  PHE A N   
173  C CA  . PHE A 22  ? 0.2996 0.2191 0.2093 0.0163  0.0091  0.0074  27  PHE A CA  
174  C C   . PHE A 22  ? 0.3309 0.2467 0.2359 0.0146  0.0092  0.0080  27  PHE A C   
175  O O   . PHE A 22  ? 0.3128 0.2248 0.2152 0.0128  0.0079  0.0086  27  PHE A O   
176  C CB  . PHE A 22  ? 0.3101 0.2306 0.2195 0.0181  0.0106  0.0054  27  PHE A CB  
177  C CG  . PHE A 22  ? 0.3069 0.2239 0.2136 0.0175  0.0102  0.0046  27  PHE A CG  
178  C CD1 . PHE A 22  ? 0.3102 0.2265 0.2187 0.0174  0.0088  0.0044  27  PHE A CD1 
179  C CD2 . PHE A 22  ? 0.3235 0.2382 0.2265 0.0169  0.0112  0.0043  27  PHE A CD2 
180  C CE1 . PHE A 22  ? 0.3509 0.2641 0.2569 0.0167  0.0085  0.0039  27  PHE A CE1 
181  C CE2 . PHE A 22  ? 0.3589 0.2704 0.2595 0.0162  0.0111  0.0038  27  PHE A CE2 
182  C CZ  . PHE A 22  ? 0.3504 0.2613 0.2526 0.0162  0.0097  0.0036  27  PHE A CZ  
183  N N   . GLU A 23  ? 0.3180 0.2349 0.2218 0.0150  0.0106  0.0079  28  GLU A N   
184  C CA  . GLU A 23  ? 0.3439 0.2573 0.2434 0.0137  0.0112  0.0081  28  GLU A CA  
185  C C   . GLU A 23  ? 0.3500 0.2649 0.2488 0.0151  0.0133  0.0070  28  GLU A C   
186  O O   . GLU A 23  ? 0.3664 0.2851 0.2677 0.0167  0.0141  0.0066  28  GLU A O   
187  C CB  . GLU A 23  ? 0.3637 0.2765 0.2626 0.0123  0.0104  0.0099  28  GLU A CB  
188  C CG  . GLU A 23  ? 0.4181 0.3288 0.3172 0.0104  0.0080  0.0113  28  GLU A CG  
189  C CD  . GLU A 23  ? 0.4978 0.4068 0.3956 0.0086  0.0068  0.0131  28  GLU A CD  
190  O OE1 . GLU A 23  ? 0.5722 0.4803 0.4713 0.0072  0.0046  0.0145  28  GLU A OE1 
191  O OE2 . GLU A 23  ? 0.5076 0.4159 0.4033 0.0085  0.0079  0.0131  28  GLU A OE2 
192  N N   . ILE A 24  ? 0.3285 0.2401 0.2239 0.0145  0.0141  0.0065  29  ILE A N   
193  C CA  . ILE A 24  ? 0.3412 0.2536 0.2360 0.0156  0.0159  0.0056  29  ILE A CA  
194  C C   . ILE A 24  ? 0.3430 0.2523 0.2348 0.0145  0.0166  0.0062  29  ILE A C   
195  O O   . ILE A 24  ? 0.3206 0.2260 0.2096 0.0129  0.0160  0.0066  29  ILE A O   
196  C CB  . ILE A 24  ? 0.3569 0.2687 0.2518 0.0165  0.0164  0.0043  29  ILE A CB  
197  C CG1 . ILE A 24  ? 0.3587 0.2740 0.2569 0.0180  0.0158  0.0036  29  ILE A CG1 
198  C CG2 . ILE A 24  ? 0.3539 0.2654 0.2479 0.0172  0.0180  0.0037  29  ILE A CG2 
199  C CD1 . ILE A 24  ? 0.3876 0.3024 0.2863 0.0187  0.0157  0.0024  29  ILE A CD1 
200  N N   . GLU A 25  ? 0.3130 0.2241 0.2053 0.0152  0.0177  0.0063  30  GLU A N   
201  C CA  . GLU A 25  ? 0.3422 0.2505 0.2321 0.0143  0.0187  0.0066  30  GLU A CA  
202  C C   . GLU A 25  ? 0.3318 0.2408 0.2222 0.0155  0.0202  0.0059  30  GLU A C   
203  O O   . GLU A 25  ? 0.3765 0.2891 0.2693 0.0169  0.0204  0.0055  30  GLU A O   
204  C CB  . GLU A 25  ? 0.4202 0.3296 0.3105 0.0137  0.0181  0.0080  30  GLU A CB  
205  C CG  . GLU A 25  ? 0.4585 0.3671 0.3486 0.0123  0.0163  0.0091  30  GLU A CG  
206  C CD  . GLU A 25  ? 0.5601 0.4695 0.4507 0.0115  0.0158  0.0107  30  GLU A CD  
207  O OE1 . GLU A 25  ? 0.5949 0.5032 0.4854 0.0101  0.0140  0.0118  30  GLU A OE1 
208  O OE2 . GLU A 25  ? 0.6203 0.5318 0.5119 0.0123  0.0168  0.0108  30  GLU A OE2 
209  N N   . GLY A 26  ? 0.3345 0.2400 0.2227 0.0149  0.0214  0.0058  31  GLY A N   
210  C CA  . GLY A 26  ? 0.3349 0.2409 0.2242 0.0159  0.0228  0.0053  31  GLY A CA  
211  C C   . GLY A 26  ? 0.3224 0.2248 0.2098 0.0153  0.0243  0.0055  31  GLY A C   
212  O O   . GLY A 26  ? 0.3268 0.2256 0.2114 0.0140  0.0243  0.0058  31  GLY A O   
213  N N   . GLU A 27  ? 0.3545 0.2580 0.2438 0.0163  0.0255  0.0054  32  GLU A N   
214  C CA  . GLU A 27  ? 0.3903 0.2907 0.2789 0.0160  0.0272  0.0056  32  GLU A CA  
215  C C   . GLU A 27  ? 0.3580 0.2587 0.2487 0.0170  0.0284  0.0052  32  GLU A C   
216  O O   . GLU A 27  ? 0.3690 0.2732 0.2624 0.0180  0.0277  0.0051  32  GLU A O   
217  C CB  . GLU A 27  ? 0.4882 0.3909 0.3785 0.0163  0.0272  0.0065  32  GLU A CB  
218  C CG  . GLU A 27  ? 0.5408 0.4419 0.4291 0.0151  0.0266  0.0072  32  GLU A CG  
219  C CD  . GLU A 27  ? 0.6282 0.5309 0.5185 0.0154  0.0269  0.0082  32  GLU A CD  
220  O OE1 . GLU A 27  ? 0.6228 0.5298 0.5157 0.0163  0.0263  0.0086  32  GLU A OE1 
221  O OE2 . GLU A 27  ? 0.6811 0.5808 0.5703 0.0148  0.0278  0.0085  32  GLU A OE2 
222  N N   . GLY A 28  ? 0.3409 0.2381 0.2308 0.0168  0.0303  0.0050  33  GLY A N   
223  C CA  . GLY A 28  ? 0.3416 0.2390 0.2340 0.0177  0.0315  0.0049  33  GLY A CA  
224  C C   . GLY A 28  ? 0.3412 0.2355 0.2339 0.0177  0.0339  0.0051  33  GLY A C   
225  O O   . GLY A 28  ? 0.3404 0.2321 0.2310 0.0170  0.0346  0.0053  33  GLY A O   
226  N N   . GLU A 29  ? 0.3496 0.2444 0.2455 0.0186  0.0351  0.0053  34  GLU A N   
227  C CA  . GLU A 29  ? 0.3920 0.2841 0.2892 0.0189  0.0376  0.0056  34  GLU A CA  
228  C C   . GLU A 29  ? 0.3642 0.2563 0.2644 0.0196  0.0389  0.0057  34  GLU A C   
229  O O   . GLU A 29  ? 0.3938 0.2888 0.2962 0.0201  0.0375  0.0057  34  GLU A O   
230  C CB  . GLU A 29  ? 0.4136 0.3078 0.3140 0.0193  0.0374  0.0066  34  GLU A CB  
231  C CG  . GLU A 29  ? 0.4489 0.3477 0.3535 0.0202  0.0357  0.0073  34  GLU A CG  
232  C CD  . GLU A 29  ? 0.5233 0.4244 0.4305 0.0204  0.0349  0.0083  34  GLU A CD  
233  O OE1 . GLU A 29  ? 0.6001 0.5014 0.5052 0.0198  0.0342  0.0085  34  GLU A OE1 
234  O OE2 . GLU A 29  ? 0.5751 0.4780 0.4865 0.0211  0.0349  0.0092  34  GLU A OE2 
235  N N   . GLY A 30  ? 0.3702 0.2590 0.2709 0.0197  0.0417  0.0058  35  GLY A N   
236  C CA  . GLY A 30  ? 0.3815 0.2705 0.2860 0.0205  0.0432  0.0062  35  GLY A CA  
237  C C   . GLY A 30  ? 0.3460 0.2310 0.2507 0.0207  0.0469  0.0063  35  GLY A C   
238  O O   . GLY A 30  ? 0.3619 0.2441 0.2643 0.0203  0.0481  0.0060  35  GLY A O   
239  N N   . ARG A 31  ? 0.3611 0.2458 0.2687 0.0212  0.0485  0.0066  36  ARG A N   
240  C CA  . ARG A 31  ? 0.3829 0.2646 0.2925 0.0217  0.0524  0.0070  36  ARG A CA  
241  C C   . ARG A 31  ? 0.3627 0.2410 0.2683 0.0212  0.0542  0.0062  36  ARG A C   
242  O O   . ARG A 31  ? 0.3559 0.2358 0.2640 0.0215  0.0540  0.0067  36  ARG A O   
243  C CB  . ARG A 31  ? 0.4257 0.3105 0.3430 0.0229  0.0525  0.0085  36  ARG A CB  
244  C CG  . ARG A 31  ? 0.4843 0.3730 0.4055 0.0232  0.0498  0.0094  36  ARG A CG  
245  C CD  . ARG A 31  ? 0.5311 0.4182 0.4532 0.0234  0.0513  0.0097  36  ARG A CD  
246  N NE  . ARG A 31  ? 0.5507 0.4362 0.4777 0.0242  0.0547  0.0106  36  ARG A NE  
247  C CZ  . ARG A 31  ? 0.5887 0.4721 0.5173 0.0246  0.0569  0.0109  36  ARG A CZ  
248  N NH1 . ARG A 31  ? 0.6155 0.4983 0.5414 0.0241  0.0558  0.0105  36  ARG A NH1 
249  N NH2 . ARG A 31  ? 0.6393 0.5212 0.5727 0.0255  0.0602  0.0117  36  ARG A NH2 
250  N N   . PRO A 32  ? 0.3734 0.2470 0.2726 0.0202  0.0558  0.0051  37  PRO A N   
251  C CA  . PRO A 32  ? 0.3808 0.2512 0.2752 0.0194  0.0569  0.0044  37  PRO A CA  
252  C C   . PRO A 32  ? 0.4167 0.2859 0.3139 0.0200  0.0602  0.0050  37  PRO A C   
253  O O   . PRO A 32  ? 0.4082 0.2768 0.3035 0.0195  0.0602  0.0049  37  PRO A O   
254  C CB  . PRO A 32  ? 0.3884 0.2537 0.2754 0.0182  0.0579  0.0033  37  PRO A CB  
255  C CG  . PRO A 32  ? 0.4096 0.2763 0.2971 0.0182  0.0559  0.0033  37  PRO A CG  
256  C CD  . PRO A 32  ? 0.3855 0.2567 0.2809 0.0196  0.0557  0.0045  37  PRO A CD  
257  N N   . TYR A 33  ? 0.3897 0.2586 0.2916 0.0211  0.0631  0.0057  38  TYR A N   
258  C CA  . TYR A 33  ? 0.4130 0.2804 0.3178 0.0218  0.0668  0.0063  38  TYR A CA  
259  C C   . TYR A 33  ? 0.4289 0.3014 0.3416 0.0227  0.0651  0.0078  38  TYR A C   
260  O O   . TYR A 33  ? 0.4954 0.3680 0.4113 0.0231  0.0671  0.0087  38  TYR A O   
261  C CB  . TYR A 33  ? 0.4071 0.2710 0.3131 0.0225  0.0711  0.0063  38  TYR A CB  
262  C CG  . TYR A 33  ? 0.4311 0.2892 0.3286 0.0215  0.0726  0.0046  38  TYR A CG  
263  C CD1 . TYR A 33  ? 0.4267 0.2798 0.3180 0.0207  0.0756  0.0037  38  TYR A CD1 
264  C CD2 . TYR A 33  ? 0.4294 0.2869 0.3245 0.0211  0.0709  0.0040  38  TYR A CD2 
265  C CE1 . TYR A 33  ? 0.4506 0.2979 0.3334 0.0195  0.0767  0.0022  38  TYR A CE1 
266  C CE2 . TYR A 33  ? 0.4320 0.2840 0.3192 0.0200  0.0719  0.0026  38  TYR A CE2 
267  C CZ  . TYR A 33  ? 0.4444 0.2912 0.3254 0.0192  0.0748  0.0016  38  TYR A CZ  
268  O OH  . TYR A 33  ? 0.4866 0.3275 0.3593 0.0179  0.0755  0.0002  38  TYR A OH  
269  N N   . GLU A 34  ? 0.4262 0.3031 0.3418 0.0229  0.0613  0.0083  39  GLU A N   
270  C CA  . GLU A 34  ? 0.4194 0.3008 0.3417 0.0236  0.0593  0.0096  39  GLU A CA  
271  C C   . GLU A 34  ? 0.3811 0.2646 0.3013 0.0230  0.0559  0.0092  39  GLU A C   
272  O O   . GLU A 34  ? 0.3845 0.2710 0.3094 0.0234  0.0543  0.0102  39  GLU A O   
273  C CB  . GLU A 34  ? 0.4725 0.3574 0.4003 0.0243  0.0573  0.0106  39  GLU A CB  
274  C CG  . GLU A 34  ? 0.5115 0.3950 0.4439 0.0251  0.0606  0.0116  39  GLU A CG  
275  C CD  . GLU A 34  ? 0.5581 0.4437 0.4934 0.0254  0.0588  0.0122  39  GLU A CD  
276  O OE1 . GLU A 34  ? 0.7004 0.5897 0.6368 0.0253  0.0549  0.0125  39  GLU A OE1 
277  O OE2 . GLU A 34  ? 0.6452 0.5286 0.5816 0.0258  0.0613  0.0123  39  GLU A OE2 
278  N N   . GLY A 35  ? 0.3806 0.2624 0.2939 0.0219  0.0546  0.0078  40  GLY A N   
279  C CA  . GLY A 35  ? 0.3778 0.2610 0.2886 0.0213  0.0517  0.0073  40  GLY A CA  
280  C C   . GLY A 35  ? 0.3924 0.2797 0.3046 0.0215  0.0476  0.0072  40  GLY A C   
281  O O   . GLY A 35  ? 0.3684 0.2575 0.2804 0.0213  0.0452  0.0070  40  GLY A O   
282  N N   . THR A 36  ? 0.3529 0.2415 0.2663 0.0218  0.0469  0.0073  41  THR A N   
283  C CA  . THR A 36  ? 0.3762 0.2687 0.2907 0.0220  0.0433  0.0073  41  THR A CA  
284  C C   . THR A 36  ? 0.3525 0.2448 0.2626 0.0214  0.0421  0.0065  41  THR A C   
285  O O   . THR A 36  ? 0.3434 0.2330 0.2512 0.0211  0.0440  0.0063  41  THR A O   
286  C CB  . THR A 36  ? 0.4022 0.2976 0.3229 0.0229  0.0427  0.0086  41  THR A CB  
287  O OG1 . THR A 36  ? 0.4018 0.2954 0.3234 0.0231  0.0451  0.0090  41  THR A OG1 
288  C CG2 . THR A 36  ? 0.4389 0.3355 0.3650 0.0234  0.0429  0.0097  41  THR A CG2 
289  N N   . GLN A 37  ? 0.3426 0.2376 0.2516 0.0213  0.0391  0.0060  42  GLN A N   
290  C CA  . GLN A 37  ? 0.3600 0.2551 0.2654 0.0208  0.0378  0.0054  42  GLN A CA  
291  C C   . GLN A 37  ? 0.3378 0.2370 0.2442 0.0211  0.0347  0.0053  42  GLN A C   
292  O O   . GLN A 37  ? 0.3375 0.2387 0.2461 0.0215  0.0333  0.0052  42  GLN A O   
293  C CB  . GLN A 37  ? 0.3687 0.2604 0.2685 0.0196  0.0383  0.0046  42  GLN A CB  
294  C CG  . GLN A 37  ? 0.3955 0.2873 0.2941 0.0193  0.0372  0.0041  42  GLN A CG  
295  C CD  . GLN A 37  ? 0.4796 0.3679 0.3725 0.0180  0.0374  0.0035  42  GLN A CD  
296  O OE1 . GLN A 37  ? 0.4767 0.3643 0.3666 0.0173  0.0366  0.0032  42  GLN A OE1 
297  N NE2 . GLN A 37  ? 0.4499 0.3359 0.3414 0.0175  0.0383  0.0033  42  GLN A NE2 
298  N N   . THR A 38  ? 0.3636 0.2639 0.2686 0.0209  0.0337  0.0053  43  THR A N   
299  C CA  . THR A 38  ? 0.3657 0.2696 0.2707 0.0211  0.0311  0.0050  43  THR A CA  
300  C C   . THR A 38  ? 0.3604 0.2637 0.2616 0.0204  0.0305  0.0045  43  THR A C   
301  O O   . THR A 38  ? 0.3884 0.2888 0.2871 0.0196  0.0318  0.0046  43  THR A O   
302  C CB  . THR A 38  ? 0.3690 0.2757 0.2771 0.0217  0.0303  0.0059  43  THR A CB  
303  O OG1 . THR A 38  ? 0.4041 0.3094 0.3117 0.0214  0.0317  0.0064  43  THR A OG1 
304  C CG2 . THR A 38  ? 0.3894 0.2969 0.3016 0.0224  0.0304  0.0065  43  THR A CG2 
305  N N   . ALA A 39  ? 0.3547 0.2605 0.2553 0.0205  0.0285  0.0041  44  ALA A N   
306  C CA  . ALA A 39  ? 0.3452 0.2510 0.2429 0.0199  0.0277  0.0039  44  ALA A CA  
307  C C   . ALA A 39  ? 0.3437 0.2536 0.2425 0.0205  0.0260  0.0038  44  ALA A C   
308  O O   . ALA A 39  ? 0.3730 0.2848 0.2735 0.0213  0.0251  0.0034  44  ALA A O   
309  C CB  . ALA A 39  ? 0.3732 0.2771 0.2686 0.0192  0.0273  0.0032  44  ALA A CB  
310  N N   . LYS A 40  ? 0.3306 0.2413 0.2282 0.0201  0.0256  0.0042  45  LYS A N   
311  C CA  . LYS A 40  ? 0.3598 0.2739 0.2578 0.0205  0.0243  0.0042  45  LYS A CA  
312  C C   . LYS A 40  ? 0.3203 0.2341 0.2166 0.0198  0.0236  0.0041  45  LYS A C   
313  O O   . LYS A 40  ? 0.3545 0.2664 0.2490 0.0188  0.0239  0.0047  45  LYS A O   
314  C CB  . LYS A 40  ? 0.4058 0.3214 0.3044 0.0205  0.0246  0.0052  45  LYS A CB  
315  C CG  . LYS A 40  ? 0.4860 0.4025 0.3869 0.0211  0.0249  0.0056  45  LYS A CG  
316  C CD  . LYS A 40  ? 0.5765 0.4933 0.4780 0.0207  0.0253  0.0069  45  LYS A CD  
317  C CE  . LYS A 40  ? 0.6013 0.5178 0.5055 0.0211  0.0258  0.0074  45  LYS A CE  
318  N NZ  . LYS A 40  ? 0.6126 0.5304 0.5181 0.0210  0.0257  0.0087  45  LYS A NZ  
319  N N   . LEU A 41  ? 0.3443 0.2598 0.2410 0.0203  0.0226  0.0034  46  LEU A N   
320  C CA  . LEU A 41  ? 0.3358 0.2509 0.2316 0.0197  0.0217  0.0034  46  LEU A CA  
321  C C   . LEU A 41  ? 0.3159 0.2348 0.2129 0.0204  0.0210  0.0035  46  LEU A C   
322  O O   . LEU A 41  ? 0.3466 0.2679 0.2448 0.0215  0.0210  0.0029  46  LEU A O   
323  C CB  . LEU A 41  ? 0.3551 0.2691 0.2510 0.0199  0.0211  0.0025  46  LEU A CB  
324  C CG  . LEU A 41  ? 0.3828 0.2931 0.2774 0.0192  0.0218  0.0023  46  LEU A CG  
325  C CD1 . LEU A 41  ? 0.3666 0.2735 0.2586 0.0178  0.0226  0.0030  46  LEU A CD1 
326  C CD2 . LEU A 41  ? 0.3999 0.3102 0.2960 0.0200  0.0225  0.0019  46  LEU A CD2 
327  N N   . LYS A 42  ? 0.3155 0.2347 0.2123 0.0198  0.0205  0.0041  47  LYS A N   
328  C CA  . LYS A 42  ? 0.3439 0.2665 0.2423 0.0205  0.0200  0.0042  47  LYS A CA  
329  C C   . LYS A 42  ? 0.3127 0.2350 0.2117 0.0199  0.0189  0.0044  47  LYS A C   
330  O O   . LYS A 42  ? 0.3322 0.2519 0.2299 0.0185  0.0184  0.0052  47  LYS A O   
331  C CB  . LYS A 42  ? 0.3527 0.2773 0.2512 0.0203  0.0204  0.0053  47  LYS A CB  
332  C CG  . LYS A 42  ? 0.4153 0.3380 0.3129 0.0189  0.0201  0.0066  47  LYS A CG  
333  C CD  . LYS A 42  ? 0.4388 0.3638 0.3370 0.0188  0.0205  0.0079  47  LYS A CD  
334  C CE  . LYS A 42  ? 0.4565 0.3790 0.3535 0.0172  0.0201  0.0091  47  LYS A CE  
335  N NZ  . LYS A 42  ? 0.4625 0.3877 0.3607 0.0171  0.0202  0.0105  47  LYS A NZ  
336  N N   . VAL A 43  ? 0.3170 0.2420 0.2179 0.0210  0.0186  0.0039  48  VAL A N   
337  C CA  . VAL A 43  ? 0.3131 0.2384 0.2156 0.0206  0.0176  0.0044  48  VAL A CA  
338  C C   . VAL A 43  ? 0.3616 0.2888 0.2651 0.0201  0.0176  0.0059  48  VAL A C   
339  O O   . VAL A 43  ? 0.3598 0.2903 0.2644 0.0211  0.0185  0.0060  48  VAL A O   
340  C CB  . VAL A 43  ? 0.3227 0.2501 0.2274 0.0220  0.0174  0.0032  48  VAL A CB  
341  C CG1 . VAL A 43  ? 0.3499 0.2773 0.2567 0.0215  0.0162  0.0040  48  VAL A CG1 
342  C CG2 . VAL A 43  ? 0.3259 0.2516 0.2298 0.0226  0.0173  0.0018  48  VAL A CG2 
343  N N   . THR A 44  ? 0.3416 0.2668 0.2448 0.0186  0.0166  0.0071  49  THR A N   
344  C CA  . THR A 44  ? 0.3751 0.3016 0.2794 0.0178  0.0162  0.0089  49  THR A CA  
345  C C   . THR A 44  ? 0.4081 0.3365 0.3158 0.0178  0.0152  0.0097  49  THR A C   
346  O O   . THR A 44  ? 0.4159 0.3467 0.3258 0.0177  0.0152  0.0112  49  THR A O   
347  C CB  . THR A 44  ? 0.4047 0.3274 0.3062 0.0159  0.0155  0.0099  49  THR A CB  
348  O OG1 . THR A 44  ? 0.4329 0.3518 0.3328 0.0148  0.0143  0.0096  49  THR A OG1 
349  C CG2 . THR A 44  ? 0.4208 0.3422 0.3200 0.0161  0.0168  0.0092  49  THR A CG2 
350  N N   . LYS A 45  ? 0.3501 0.2772 0.2585 0.0178  0.0142  0.0091  50  LYS A N   
351  C CA  . LYS A 45  ? 0.3854 0.3140 0.2975 0.0178  0.0131  0.0100  50  LYS A CA  
352  C C   . LYS A 45  ? 0.3909 0.3199 0.3044 0.0191  0.0131  0.0084  50  LYS A C   
353  O O   . LYS A 45  ? 0.3643 0.2907 0.2753 0.0189  0.0129  0.0072  50  LYS A O   
354  C CB  . LYS A 45  ? 0.4477 0.3734 0.3593 0.0156  0.0110  0.0117  50  LYS A CB  
355  C CG  . LYS A 45  ? 0.5798 0.5062 0.4920 0.0145  0.0107  0.0136  50  LYS A CG  
356  C CD  . LYS A 45  ? 0.6818 0.6054 0.5942 0.0123  0.0081  0.0155  50  LYS A CD  
357  C CE  . LYS A 45  ? 0.7409 0.6661 0.6553 0.0114  0.0074  0.0177  50  LYS A CE  
358  N NZ  . LYS A 45  ? 0.7740 0.6955 0.6874 0.0088  0.0046  0.0195  50  LYS A NZ  
359  N N   . GLY A 46  ? 0.3815 0.3138 0.2991 0.0204  0.0134  0.0083  51  GLY A N   
360  C CA  . GLY A 46  ? 0.3590 0.2915 0.2784 0.0216  0.0132  0.0069  51  GLY A CA  
361  C C   . GLY A 46  ? 0.3657 0.2991 0.2837 0.0234  0.0147  0.0047  51  GLY A C   
362  O O   . GLY A 46  ? 0.3807 0.3131 0.2990 0.0241  0.0143  0.0033  51  GLY A O   
363  N N   . GLY A 47  ? 0.3642 0.2991 0.2805 0.0240  0.0163  0.0044  52  GLY A N   
364  C CA  . GLY A 47  ? 0.3685 0.3040 0.2832 0.0255  0.0174  0.0025  52  GLY A CA  
365  C C   . GLY A 47  ? 0.3712 0.3101 0.2880 0.0274  0.0189  0.0017  52  GLY A C   
366  O O   . GLY A 47  ? 0.4364 0.3775 0.3559 0.0275  0.0193  0.0029  52  GLY A O   
367  N N   . PRO A 48  ? 0.3864 0.3255 0.3020 0.0288  0.0196  -0.0001 53  PRO A N   
368  C CA  . PRO A 48  ? 0.3713 0.3077 0.2845 0.0287  0.0188  -0.0015 53  PRO A CA  
369  C C   . PRO A 48  ? 0.3460 0.2804 0.2610 0.0283  0.0172  -0.0018 53  PRO A C   
370  O O   . PRO A 48  ? 0.3511 0.2865 0.2693 0.0288  0.0169  -0.0016 53  PRO A O   
371  C CB  . PRO A 48  ? 0.3982 0.3358 0.3102 0.0304  0.0198  -0.0033 53  PRO A CB  
372  C CG  . PRO A 48  ? 0.4170 0.3574 0.3314 0.0316  0.0211  -0.0034 53  PRO A CG  
373  C CD  . PRO A 48  ? 0.4227 0.3645 0.3395 0.0306  0.0212  -0.0012 53  PRO A CD  
374  N N   . LEU A 49  ? 0.3301 0.2617 0.2431 0.0275  0.0163  -0.0021 54  LEU A N   
375  C CA  . LEU A 49  ? 0.3207 0.2500 0.2348 0.0268  0.0147  -0.0020 54  LEU A CA  
376  C C   . LEU A 49  ? 0.3140 0.2438 0.2298 0.0283  0.0145  -0.0037 54  LEU A C   
377  O O   . LEU A 49  ? 0.3340 0.2641 0.2484 0.0294  0.0151  -0.0052 54  LEU A O   
378  C CB  . LEU A 49  ? 0.3036 0.2299 0.2151 0.0255  0.0141  -0.0018 54  LEU A CB  
379  C CG  . LEU A 49  ? 0.3123 0.2374 0.2214 0.0240  0.0145  -0.0004 54  LEU A CG  
380  C CD1 . LEU A 49  ? 0.3306 0.2527 0.2373 0.0231  0.0144  -0.0006 54  LEU A CD1 
381  C CD2 . LEU A 49  ? 0.3108 0.2357 0.2210 0.0228  0.0137  0.0011  54  LEU A CD2 
382  N N   . PRO A 50  ? 0.3172 0.2467 0.2360 0.0282  0.0133  -0.0035 55  PRO A N   
383  C CA  . PRO A 50  ? 0.3315 0.2611 0.2522 0.0297  0.0130  -0.0052 55  PRO A CA  
384  C C   . PRO A 50  ? 0.3336 0.2604 0.2536 0.0291  0.0115  -0.0058 55  PRO A C   
385  O O   . PRO A 50  ? 0.4343 0.3607 0.3569 0.0297  0.0104  -0.0064 55  PRO A O   
386  C CB  . PRO A 50  ? 0.3511 0.2819 0.2761 0.0299  0.0125  -0.0044 55  PRO A CB  
387  C CG  . PRO A 50  ? 0.3475 0.2772 0.2724 0.0278  0.0113  -0.0022 55  PRO A CG  
388  C CD  . PRO A 50  ? 0.3169 0.2464 0.2380 0.0270  0.0124  -0.0017 55  PRO A CD  
389  N N   . PHE A 51  ? 0.2890 0.2141 0.2060 0.0280  0.0114  -0.0054 56  PHE A N   
390  C CA  . PHE A 51  ? 0.2825 0.2050 0.1987 0.0276  0.0103  -0.0058 56  PHE A CA  
391  C C   . PHE A 51  ? 0.2922 0.2139 0.2055 0.0272  0.0110  -0.0060 56  PHE A C   
392  O O   . PHE A 51  ? 0.3157 0.2384 0.2272 0.0272  0.0123  -0.0056 56  PHE A O   
393  C CB  . PHE A 51  ? 0.2834 0.2039 0.2001 0.0258  0.0089  -0.0043 56  PHE A CB  
394  C CG  . PHE A 51  ? 0.2642 0.1840 0.1787 0.0243  0.0094  -0.0028 56  PHE A CG  
395  C CD1 . PHE A 51  ? 0.2716 0.1894 0.1829 0.0233  0.0101  -0.0024 56  PHE A CD1 
396  C CD2 . PHE A 51  ? 0.2670 0.1880 0.1829 0.0237  0.0093  -0.0015 56  PHE A CD2 
397  C CE1 . PHE A 51  ? 0.2965 0.2134 0.2055 0.0219  0.0106  -0.0011 56  PHE A CE1 
398  C CE2 . PHE A 51  ? 0.2679 0.1879 0.1815 0.0222  0.0096  -0.0001 56  PHE A CE2 
399  C CZ  . PHE A 51  ? 0.2740 0.1919 0.1841 0.0214  0.0102  0.0000  56  PHE A CZ  
400  N N   . ALA A 52  ? 0.2865 0.2063 0.1994 0.0270  0.0102  -0.0063 57  ALA A N   
401  C CA  . ALA A 52  ? 0.2957 0.2146 0.2067 0.0268  0.0108  -0.0064 57  ALA A CA  
402  C C   . ALA A 52  ? 0.3035 0.2212 0.2124 0.0254  0.0117  -0.0050 57  ALA A C   
403  O O   . ALA A 52  ? 0.3006 0.2165 0.2090 0.0241  0.0114  -0.0039 57  ALA A O   
404  C CB  . ALA A 52  ? 0.3236 0.2407 0.2354 0.0268  0.0097  -0.0069 57  ALA A CB  
405  N N   . TRP A 53  ? 0.2826 0.2014 0.1902 0.0257  0.0129  -0.0049 58  TRP A N   
406  C CA  . TRP A 53  ? 0.2963 0.2138 0.2020 0.0245  0.0139  -0.0037 58  TRP A CA  
407  C C   . TRP A 53  ? 0.2895 0.2042 0.1946 0.0235  0.0140  -0.0032 58  TRP A C   
408  O O   . TRP A 53  ? 0.2993 0.2121 0.2026 0.0223  0.0147  -0.0022 58  TRP A O   
409  C CB  . TRP A 53  ? 0.3166 0.2355 0.2214 0.0251  0.0150  -0.0037 58  TRP A CB  
410  C CG  . TRP A 53  ? 0.3051 0.2228 0.2084 0.0240  0.0161  -0.0026 58  TRP A CG  
411  C CD1 . TRP A 53  ? 0.3156 0.2315 0.2184 0.0236  0.0167  -0.0022 58  TRP A CD1 
412  C CD2 . TRP A 53  ? 0.3070 0.2249 0.2091 0.0233  0.0168  -0.0017 58  TRP A CD2 
413  N NE1 . TRP A 53  ? 0.3121 0.2269 0.2135 0.0227  0.0178  -0.0012 58  TRP A NE1 
414  C CE2 . TRP A 53  ? 0.3234 0.2392 0.2240 0.0224  0.0178  -0.0009 58  TRP A CE2 
415  C CE3 . TRP A 53  ? 0.3358 0.2554 0.2382 0.0234  0.0166  -0.0013 58  TRP A CE3 
416  C CZ2 . TRP A 53  ? 0.3497 0.2649 0.2489 0.0215  0.0185  0.0000  58  TRP A CZ2 
417  C CZ3 . TRP A 53  ? 0.3565 0.2756 0.2576 0.0224  0.0173  -0.0002 58  TRP A CZ3 
418  C CH2 . TRP A 53  ? 0.3552 0.2720 0.2545 0.0214  0.0181  0.0003  58  TRP A CH2 
419  N N   . ASP A 54  ? 0.2940 0.2083 0.2003 0.0241  0.0133  -0.0038 59  ASP A N   
420  C CA  . ASP A 54  ? 0.3087 0.2207 0.2150 0.0234  0.0135  -0.0033 59  ASP A CA  
421  C C   . ASP A 54  ? 0.3066 0.2162 0.2116 0.0219  0.0134  -0.0024 59  ASP A C   
422  O O   . ASP A 54  ? 0.3336 0.2411 0.2372 0.0210  0.0145  -0.0017 59  ASP A O   
423  C CB  . ASP A 54  ? 0.3350 0.2471 0.2434 0.0241  0.0123  -0.0041 59  ASP A CB  
424  C CG  . ASP A 54  ? 0.3458 0.2594 0.2549 0.0252  0.0123  -0.0046 59  ASP A CG  
425  O OD1 . ASP A 54  ? 0.3832 0.2970 0.2915 0.0250  0.0135  -0.0040 59  ASP A OD1 
426  O OD2 . ASP A 54  ? 0.4140 0.3281 0.3243 0.0260  0.0109  -0.0056 59  ASP A OD2 
427  N N   . ILE A 55  ? 0.3207 0.2305 0.2260 0.0216  0.0123  -0.0025 60  ILE A N   
428  C CA  . ILE A 55  ? 0.3241 0.2312 0.2278 0.0200  0.0120  -0.0015 60  ILE A CA  
429  C C   . ILE A 55  ? 0.3237 0.2292 0.2243 0.0187  0.0131  -0.0005 60  ILE A C   
430  O O   . ILE A 55  ? 0.3206 0.2230 0.2186 0.0171  0.0133  0.0002  60  ILE A O   
431  C CB  . ILE A 55  ? 0.3303 0.2377 0.2356 0.0198  0.0100  -0.0015 60  ILE A CB  
432  C CG1 . ILE A 55  ? 0.3380 0.2474 0.2439 0.0201  0.0098  -0.0014 60  ILE A CG1 
433  C CG2 . ILE A 55  ? 0.3413 0.2496 0.2495 0.0209  0.0088  -0.0024 60  ILE A CG2 
434  C CD1 . ILE A 55  ? 0.3242 0.2337 0.2320 0.0197  0.0080  -0.0009 60  ILE A CD1 
435  N N   . LEU A 56  ? 0.2796 0.1869 0.1800 0.0193  0.0139  -0.0006 61  LEU A N   
436  C CA  . LEU A 56  ? 0.2860 0.1920 0.1837 0.0183  0.0151  0.0001  61  LEU A CA  
437  C C   . LEU A 56  ? 0.2725 0.1770 0.1688 0.0183  0.0170  0.0002  61  LEU A C   
438  O O   . LEU A 56  ? 0.2902 0.1921 0.1837 0.0171  0.0181  0.0008  61  LEU A O   
439  C CB  . LEU A 56  ? 0.2846 0.1932 0.1830 0.0189  0.0150  0.0001  61  LEU A CB  
440  C CG  . LEU A 56  ? 0.2953 0.2058 0.1957 0.0191  0.0135  0.0001  61  LEU A CG  
441  C CD1 . LEU A 56  ? 0.3295 0.2424 0.2304 0.0196  0.0140  0.0005  61  LEU A CD1 
442  C CD2 . LEU A 56  ? 0.3210 0.2292 0.2207 0.0176  0.0121  0.0010  61  LEU A CD2 
443  N N   . SER A 57  ? 0.2948 0.2009 0.1933 0.0195  0.0174  -0.0003 62  SER A N   
444  C CA  . SER A 57  ? 0.3275 0.2331 0.2258 0.0197  0.0191  0.0000  62  SER A CA  
445  C C   . SER A 57  ? 0.3188 0.2208 0.2150 0.0186  0.0207  0.0005  62  SER A C   
446  O O   . SER A 57  ? 0.3177 0.2184 0.2124 0.0182  0.0223  0.0009  62  SER A O   
447  C CB  . SER A 57  ? 0.3532 0.2611 0.2544 0.0211  0.0187  -0.0006 62  SER A CB  
448  O OG  . SER A 57  ? 0.3782 0.2852 0.2808 0.0211  0.0181  -0.0007 62  SER A OG  
449  N N   . PRO A 58  ? 0.3108 0.2109 0.2065 0.0179  0.0202  0.0006  63  PRO A N   
450  C CA  . PRO A 58  ? 0.3412 0.2375 0.2344 0.0168  0.0221  0.0013  63  PRO A CA  
451  C C   . PRO A 58  ? 0.3569 0.2501 0.2457 0.0152  0.0225  0.0017  63  PRO A C   
452  O O   . PRO A 58  ? 0.3575 0.2471 0.2434 0.0142  0.0242  0.0020  63  PRO A O   
453  C CB  . PRO A 58  ? 0.3601 0.2556 0.2543 0.0165  0.0213  0.0014  63  PRO A CB  
454  C CG  . PRO A 58  ? 0.3739 0.2724 0.2710 0.0174  0.0189  0.0007  63  PRO A CG  
455  C CD  . PRO A 58  ? 0.3403 0.2413 0.2377 0.0181  0.0182  0.0003  63  PRO A CD  
456  N N   . GLN A 59  ? 0.3227 0.2170 0.2109 0.0150  0.0211  0.0016  64  GLN A N   
457  C CA  . GLN A 59  ? 0.3337 0.2250 0.2178 0.0134  0.0211  0.0021  64  GLN A CA  
458  C C   . GLN A 59  ? 0.3662 0.2568 0.2489 0.0134  0.0227  0.0022  64  GLN A C   
459  O O   . GLN A 59  ? 0.3537 0.2410 0.2326 0.0120  0.0231  0.0026  64  GLN A O   
460  C CB  . GLN A 59  ? 0.3594 0.2515 0.2435 0.0127  0.0186  0.0024  64  GLN A CB  
461  C CG  . GLN A 59  ? 0.3494 0.2438 0.2367 0.0134  0.0168  0.0021  64  GLN A CG  
462  C CD  . GLN A 59  ? 0.3502 0.2424 0.2369 0.0128  0.0168  0.0023  64  GLN A CD  
463  O OE1 . GLN A 59  ? 0.3541 0.2426 0.2373 0.0115  0.0179  0.0027  64  GLN A OE1 
464  N NE2 . GLN A 59  ? 0.3461 0.2405 0.2362 0.0137  0.0155  0.0019  64  GLN A NE2 
465  N N   . PHE A 60  ? 0.3613 0.2548 0.2470 0.0148  0.0235  0.0020  65  PHE A N   
466  C CA  . PHE A 60  ? 0.4079 0.3009 0.2925 0.0148  0.0247  0.0022  65  PHE A CA  
467  C C   . PHE A 60  ? 0.5349 0.4253 0.4186 0.0148  0.0274  0.0023  65  PHE A C   
468  O O   . PHE A 60  ? 0.6284 0.5166 0.5098 0.0142  0.0285  0.0025  65  PHE A O   
469  C CB  . PHE A 60  ? 0.3844 0.2820 0.2726 0.0162  0.0241  0.0021  65  PHE A CB  
470  C CG  . PHE A 60  ? 0.3712 0.2715 0.2605 0.0164  0.0220  0.0020  65  PHE A CG  
471  C CD1 . PHE A 60  ? 0.3841 0.2837 0.2716 0.0154  0.0211  0.0025  65  PHE A CD1 
472  C CD2 . PHE A 60  ? 0.3716 0.2750 0.2638 0.0176  0.0209  0.0015  65  PHE A CD2 
473  C CE1 . PHE A 60  ? 0.3924 0.2947 0.2816 0.0156  0.0194  0.0026  65  PHE A CE1 
474  C CE2 . PHE A 60  ? 0.3726 0.2785 0.2662 0.0179  0.0193  0.0013  65  PHE A CE2 
475  C CZ  . PHE A 60  ? 0.3740 0.2795 0.2662 0.0170  0.0186  0.0020  65  PHE A CZ  
476  N N1  . CH6 A 61  ? 0.5633 0.4527 0.4478 0.0151  0.0284  0.0022  66  CH6 A N1  
477  C CE  . CH6 A 61  ? 0.5895 0.4878 0.4840 0.0186  0.0290  0.0025  66  CH6 A CE  
478  S SD  . CH6 A 61  ? 0.5583 0.4580 0.4563 0.0195  0.0286  0.0025  66  CH6 A SD  
479  C CG1 . CH6 A 61  ? 0.5879 0.4836 0.4832 0.0184  0.0296  0.0024  66  CH6 A CG1 
480  C CB1 . CH6 A 61  ? 0.5863 0.4812 0.4784 0.0174  0.0280  0.0020  66  CH6 A CB1 
481  C CA1 . CH6 A 61  ? 0.6053 0.4954 0.4928 0.0160  0.0295  0.0022  66  CH6 A CA1 
482  C C1  . CH6 A 61  ? 0.5763 0.4645 0.4629 0.0153  0.0296  0.0023  66  CH6 A C1  
483  N N2  . CH6 A 61  ? 0.5344 0.4244 0.4247 0.0162  0.0292  0.0023  66  CH6 A N2  
484  O OH  . CH6 A 61  ? 0.6350 0.5331 0.5434 0.0194  0.0237  0.0030  66  CH6 A OH  
485  C CD2 . CH6 A 61  ? 0.6104 0.5003 0.5064 0.0161  0.0275  0.0033  66  CH6 A CD2 
486  C CE2 . CH6 A 61  ? 0.6394 0.5320 0.5402 0.0171  0.0263  0.0034  66  CH6 A CE2 
487  C CZ  . CH6 A 61  ? 0.6467 0.5426 0.5509 0.0185  0.0253  0.0030  66  CH6 A CZ  
488  C CE1 . CH6 A 61  ? 0.5988 0.4952 0.5015 0.0187  0.0258  0.0026  66  CH6 A CE1 
489  C CD1 . CH6 A 61  ? 0.5786 0.4726 0.4771 0.0177  0.0271  0.0026  66  CH6 A CD1 
490  C CG2 . CH6 A 61  ? 0.6290 0.5196 0.5239 0.0164  0.0279  0.0029  66  CH6 A CG2 
491  C CB2 . CH6 A 61  ? 0.5968 0.4842 0.4867 0.0152  0.0291  0.0028  66  CH6 A CB2 
492  C CA2 . CH6 A 61  ? 0.6003 0.4875 0.4883 0.0151  0.0294  0.0025  66  CH6 A CA2 
493  C C2  . CH6 A 61  ? 0.5659 0.4495 0.4485 0.0136  0.0300  0.0026  66  CH6 A C2  
494  O O2  . CH6 A 61  ? 0.5290 0.4091 0.4078 0.0122  0.0301  0.0028  66  CH6 A O2  
495  N N3  . CH6 A 61  ? 0.5337 0.4177 0.4155 0.0138  0.0300  0.0024  66  CH6 A N3  
496  C CA3 . CH6 A 61  ? 0.5224 0.4029 0.3990 0.0122  0.0300  0.0024  66  CH6 A CA3 
497  C C3  . CH6 A 61  ? 0.5043 0.3826 0.3785 0.0120  0.0318  0.0023  66  CH6 A C3  
498  O O3  . CH6 A 61  ? 0.5414 0.4173 0.4117 0.0107  0.0310  0.0024  66  CH6 A O3  
499  N N   . SER A 62  ? 0.4515 0.3302 0.3282 0.0130  0.0340  0.0024  69  SER A N   
500  C CA  . SER A 62  ? 0.4499 0.3267 0.3256 0.0131  0.0362  0.0023  69  SER A CA  
501  C C   . SER A 62  ? 0.4835 0.3577 0.3592 0.0134  0.0395  0.0024  69  SER A C   
502  O O   . SER A 62  ? 0.4133 0.2894 0.2935 0.0147  0.0411  0.0027  69  SER A O   
503  C CB  . SER A 62  ? 0.4487 0.3301 0.3291 0.0145  0.0354  0.0025  69  SER A CB  
504  O OG  . SER A 62  ? 0.4441 0.3237 0.3238 0.0146  0.0373  0.0025  69  SER A OG  
505  N N   . LYS A 63  ? 0.4560 0.3257 0.3266 0.0120  0.0405  0.0022  70  LYS A N   
506  C CA  . LYS A 63  ? 0.4887 0.3558 0.3589 0.0120  0.0434  0.0024  70  LYS A CA  
507  C C   . LYS A 63  ? 0.4357 0.2992 0.3043 0.0122  0.0472  0.0022  70  LYS A C   
508  O O   . LYS A 63  ? 0.4603 0.3221 0.3297 0.0126  0.0503  0.0024  70  LYS A O   
509  C CB  . LYS A 63  ? 0.5112 0.3751 0.3765 0.0104  0.0428  0.0025  70  LYS A CB  
510  C CG  . LYS A 63  ? 0.5491 0.4168 0.4175 0.0105  0.0396  0.0028  70  LYS A CG  
511  C CD  . LYS A 63  ? 0.6031 0.4735 0.4770 0.0118  0.0406  0.0033  70  LYS A CD  
512  C CE  . LYS A 63  ? 0.6092 0.4824 0.4854 0.0118  0.0376  0.0035  70  LYS A CE  
513  N NZ  . LYS A 63  ? 0.6736 0.5501 0.5559 0.0132  0.0379  0.0040  70  LYS A NZ  
514  N N   . ALA A 64  ? 0.4099 0.2723 0.2768 0.0121  0.0472  0.0018  71  ALA A N   
515  C CA  . ALA A 64  ? 0.4066 0.2665 0.2737 0.0127  0.0507  0.0016  71  ALA A CA  
516  C C   . ALA A 64  ? 0.3952 0.2591 0.2700 0.0147  0.0520  0.0023  71  ALA A C   
517  O O   . ALA A 64  ? 0.4086 0.2703 0.2844 0.0153  0.0554  0.0023  71  ALA A O   
518  C CB  . ALA A 64  ? 0.4418 0.2999 0.3059 0.0122  0.0500  0.0012  71  ALA A CB  
519  N N   . TYR A 65  ? 0.3708 0.2400 0.2507 0.0155  0.0494  0.0028  72  TYR A N   
520  C CA  . TYR A 65  ? 0.3880 0.2612 0.2754 0.0172  0.0499  0.0036  72  TYR A CA  
521  C C   . TYR A 65  ? 0.3853 0.2603 0.2767 0.0178  0.0504  0.0043  72  TYR A C   
522  O O   . TYR A 65  ? 0.4501 0.3295 0.3464 0.0186  0.0482  0.0048  72  TYR A O   
523  C CB  . TYR A 65  ? 0.3712 0.2493 0.2619 0.0178  0.0465  0.0038  72  TYR A CB  
524  C CG  . TYR A 65  ? 0.3703 0.2478 0.2586 0.0174  0.0458  0.0035  72  TYR A CG  
525  C CD1 . TYR A 65  ? 0.3656 0.2415 0.2486 0.0161  0.0441  0.0029  72  TYR A CD1 
526  C CD2 . TYR A 65  ? 0.3835 0.2626 0.2754 0.0182  0.0464  0.0040  72  TYR A CD2 
527  C CE1 . TYR A 65  ? 0.3823 0.2577 0.2635 0.0156  0.0433  0.0028  72  TYR A CE1 
528  C CE2 . TYR A 65  ? 0.3632 0.2420 0.2534 0.0178  0.0455  0.0039  72  TYR A CE2 
529  C CZ  . TYR A 65  ? 0.3707 0.2475 0.2555 0.0166  0.0441  0.0033  72  TYR A CZ  
530  O OH  . TYR A 65  ? 0.3705 0.2471 0.2539 0.0162  0.0432  0.0033  72  TYR A OH  
531  N N   . VAL A 66  ? 0.3657 0.2370 0.2541 0.0172  0.0529  0.0042  73  VAL A N   
532  C CA  . VAL A 66  ? 0.3593 0.2320 0.2517 0.0177  0.0537  0.0051  73  VAL A CA  
533  C C   . VAL A 66  ? 0.3655 0.2360 0.2604 0.0184  0.0582  0.0057  73  VAL A C   
534  O O   . VAL A 66  ? 0.3820 0.2477 0.2721 0.0179  0.0613  0.0051  73  VAL A O   
535  C CB  . VAL A 66  ? 0.3684 0.2385 0.2559 0.0163  0.0534  0.0048  73  VAL A CB  
536  C CG1 . VAL A 66  ? 0.3776 0.2486 0.2693 0.0168  0.0549  0.0059  73  VAL A CG1 
537  C CG2 . VAL A 66  ? 0.3660 0.2380 0.2514 0.0156  0.0491  0.0044  73  VAL A CG2 
538  N N   . LYS A 67  ? 0.3719 0.2457 0.2742 0.0197  0.0585  0.0069  74  LYS A N   
539  C CA  . LYS A 67  ? 0.4071 0.2792 0.3129 0.0205  0.0629  0.0077  74  LYS A CA  
540  C C   . LYS A 67  ? 0.3758 0.2448 0.2792 0.0200  0.0658  0.0079  74  LYS A C   
541  O O   . LYS A 67  ? 0.3887 0.2597 0.2938 0.0198  0.0642  0.0085  74  LYS A O   
542  C CB  . LYS A 67  ? 0.4132 0.2900 0.3281 0.0218  0.0619  0.0092  74  LYS A CB  
543  C CG  . LYS A 67  ? 0.4597 0.3355 0.3798 0.0228  0.0661  0.0104  74  LYS A CG  
544  C CD  . LYS A 67  ? 0.4565 0.3370 0.3860 0.0239  0.0646  0.0122  74  LYS A CD  
545  C CE  . LYS A 67  ? 0.5049 0.3843 0.4400 0.0250  0.0689  0.0134  74  LYS A CE  
546  N NZ  . LYS A 67  ? 0.5697 0.4534 0.5141 0.0260  0.0672  0.0154  74  LYS A NZ  
547  N N   . HIS A 68  ? 0.3988 0.2630 0.2984 0.0198  0.0702  0.0075  75  HIS A N   
548  C CA  . HIS A 68  ? 0.4187 0.2797 0.3159 0.0193  0.0735  0.0078  75  HIS A CA  
549  C C   . HIS A 68  ? 0.4233 0.2833 0.3255 0.0205  0.0785  0.0088  75  HIS A C   
550  O O   . HIS A 68  ? 0.4548 0.3131 0.3576 0.0212  0.0809  0.0084  75  HIS A O   
551  C CB  . HIS A 68  ? 0.4209 0.2762 0.3078 0.0177  0.0746  0.0063  75  HIS A CB  
552  C CG  . HIS A 68  ? 0.4119 0.2675 0.2937 0.0161  0.0703  0.0057  75  HIS A CG  
553  N ND1 . HIS A 68  ? 0.4001 0.2578 0.2810 0.0158  0.0661  0.0050  75  HIS A ND1 
554  C CD2 . HIS A 68  ? 0.4440 0.2978 0.3212 0.0148  0.0697  0.0058  75  HIS A CD2 
555  C CE1 . HIS A 68  ? 0.3855 0.2429 0.2620 0.0145  0.0632  0.0047  75  HIS A CE1 
556  N NE2 . HIS A 68  ? 0.4094 0.2644 0.2836 0.0137  0.0652  0.0052  75  HIS A NE2 
557  N N   . PRO A 69  ? 0.4446 0.3056 0.3505 0.0207  0.0802  0.0102  76  PRO A N   
558  C CA  . PRO A 69  ? 0.4730 0.3319 0.3822 0.0217  0.0858  0.0110  76  PRO A CA  
559  C C   . PRO A 69  ? 0.4799 0.3320 0.3804 0.0210  0.0901  0.0094  76  PRO A C   
560  O O   . PRO A 69  ? 0.4979 0.3464 0.3890 0.0194  0.0889  0.0080  76  PRO A O   
561  C CB  . PRO A 69  ? 0.4964 0.3566 0.4082 0.0214  0.0864  0.0126  76  PRO A CB  
562  C CG  . PRO A 69  ? 0.4579 0.3222 0.3708 0.0208  0.0805  0.0127  76  PRO A CG  
563  C CD  . PRO A 69  ? 0.4313 0.2943 0.3373 0.0199  0.0775  0.0108  76  PRO A CD  
564  N N   . ALA A 70  ? 0.5000 0.3502 0.4037 0.0223  0.0949  0.0097  77  ALA A N   
565  C CA  . ALA A 70  ? 0.5262 0.3697 0.4221 0.0219  0.0993  0.0081  77  ALA A CA  
566  C C   . ALA A 70  ? 0.5074 0.3460 0.3943 0.0203  0.1016  0.0074  77  ALA A C   
567  O O   . ALA A 70  ? 0.5367 0.3694 0.4141 0.0192  0.1030  0.0057  77  ALA A O   
568  C CB  . ALA A 70  ? 0.5714 0.4140 0.4736 0.0237  0.1047  0.0088  77  ALA A CB  
569  N N   . ASP A 71  ? 0.4944 0.3352 0.3844 0.0202  0.1017  0.0089  78  ASP A N   
570  C CA  . ASP A 71  ? 0.5052 0.3416 0.3873 0.0187  0.1041  0.0087  78  ASP A CA  
571  C C   . ASP A 71  ? 0.4941 0.3308 0.3701 0.0167  0.0989  0.0083  78  ASP A C   
572  O O   . ASP A 71  ? 0.4807 0.3151 0.3520 0.0154  0.0999  0.0086  78  ASP A O   
573  C CB  . ASP A 71  ? 0.5289 0.3664 0.4170 0.0195  0.1083  0.0107  78  ASP A CB  
574  C CG  . ASP A 71  ? 0.5824 0.4272 0.4820 0.0206  0.1052  0.0129  78  ASP A CG  
575  O OD1 . ASP A 71  ? 0.5534 0.4026 0.4580 0.0212  0.1007  0.0130  78  ASP A OD1 
576  O OD2 . ASP A 71  ? 0.6689 0.5150 0.5730 0.0209  0.1076  0.0147  78  ASP A OD2 
577  N N   . ILE A 72  ? 0.4518 0.2916 0.3284 0.0164  0.0935  0.0077  79  ILE A N   
578  C CA  . ILE A 72  ? 0.4160 0.2558 0.2866 0.0146  0.0885  0.0072  79  ILE A CA  
579  C C   . ILE A 72  ? 0.4387 0.2750 0.3020 0.0137  0.0872  0.0053  79  ILE A C   
580  O O   . ILE A 72  ? 0.4170 0.2558 0.2842 0.0147  0.0854  0.0049  79  ILE A O   
581  C CB  . ILE A 72  ? 0.4081 0.2546 0.2856 0.0150  0.0830  0.0082  79  ILE A CB  
582  C CG1 . ILE A 72  ? 0.4252 0.2758 0.3110 0.0159  0.0837  0.0102  79  ILE A CG1 
583  C CG2 . ILE A 72  ? 0.3988 0.2448 0.2698 0.0130  0.0783  0.0075  79  ILE A CG2 
584  C CD1 . ILE A 72  ? 0.4246 0.2808 0.3159 0.0160  0.0784  0.0110  79  ILE A CD1 
585  N N   . PRO A 73  ? 0.4218 0.2518 0.2745 0.0118  0.0881  0.0042  80  PRO A N   
586  C CA  . PRO A 73  ? 0.4052 0.2315 0.2509 0.0108  0.0867  0.0025  80  PRO A CA  
587  C C   . PRO A 73  ? 0.3940 0.2251 0.2422 0.0106  0.0803  0.0025  80  PRO A C   
588  O O   . PRO A 73  ? 0.4024 0.2366 0.2519 0.0100  0.0768  0.0033  80  PRO A O   
589  C CB  . PRO A 73  ? 0.4539 0.2734 0.2883 0.0085  0.0877  0.0018  80  PRO A CB  
590  C CG  . PRO A 73  ? 0.4386 0.2571 0.2740 0.0087  0.0921  0.0028  80  PRO A CG  
591  C CD  . PRO A 73  ? 0.4498 0.2758 0.2963 0.0103  0.0904  0.0046  80  PRO A CD  
592  N N   . ASP A 74  ? 0.4125 0.2445 0.2625 0.0114  0.0795  0.0018  81  ASP A N   
593  C CA  . ASP A 74  ? 0.4071 0.2433 0.2595 0.0114  0.0744  0.0017  81  ASP A CA  
594  C C   . ASP A 74  ? 0.3878 0.2196 0.2310 0.0094  0.0720  0.0006  81  ASP A C   
595  O O   . ASP A 74  ? 0.4356 0.2656 0.2766 0.0093  0.0717  -0.0001 81  ASP A O   
596  C CB  . ASP A 74  ? 0.4119 0.2510 0.2706 0.0132  0.0748  0.0017  81  ASP A CB  
597  C CG  . ASP A 74  ? 0.4362 0.2813 0.3000 0.0137  0.0699  0.0021  81  ASP A CG  
598  O OD1 . ASP A 74  ? 0.4275 0.2737 0.2883 0.0124  0.0658  0.0020  81  ASP A OD1 
599  O OD2 . ASP A 74  ? 0.4154 0.2643 0.2867 0.0153  0.0702  0.0027  81  ASP A OD2 
600  N N   . TYR A 75  ? 0.3768 0.2073 0.2153 0.0076  0.0700  0.0009  82  TYR A N   
601  C CA  . TYR A 75  ? 0.3929 0.2187 0.2224 0.0053  0.0678  0.0002  82  TYR A CA  
602  C C   . TYR A 75  ? 0.3886 0.2165 0.2187 0.0051  0.0636  -0.0001 82  TYR A C   
603  O O   . TYR A 75  ? 0.3999 0.2233 0.2237 0.0039  0.0634  -0.0010 82  TYR A O   
604  C CB  . TYR A 75  ? 0.3895 0.2149 0.2159 0.0037  0.0659  0.0010  82  TYR A CB  
605  C CG  . TYR A 75  ? 0.3755 0.1973 0.1940 0.0011  0.0622  0.0008  82  TYR A CG  
606  C CD1 . TYR A 75  ? 0.3917 0.2059 0.2002 -0.0008 0.0640  0.0001  82  TYR A CD1 
607  C CD2 . TYR A 75  ? 0.3781 0.2041 0.1993 0.0007  0.0570  0.0014  82  TYR A CD2 
608  C CE1 . TYR A 75  ? 0.3998 0.2107 0.2012 -0.0033 0.0603  0.0002  82  TYR A CE1 
609  C CE2 . TYR A 75  ? 0.3889 0.2120 0.2037 -0.0016 0.0535  0.0015  82  TYR A CE2 
610  C CZ  . TYR A 75  ? 0.3972 0.2124 0.2018 -0.0038 0.0552  0.0009  82  TYR A CZ  
611  O OH  . TYR A 75  ? 0.3942 0.2059 0.1921 -0.0064 0.0516  0.0012  82  TYR A OH  
612  N N   . LEU A 76  ? 0.3805 0.2152 0.2183 0.0064  0.0607  0.0004  83  LEU A N   
613  C CA  . LEU A 76  ? 0.3937 0.2311 0.2327 0.0063  0.0568  0.0003  83  LEU A CA  
614  C C   . LEU A 76  ? 0.3812 0.2177 0.2211 0.0073  0.0585  -0.0003 83  LEU A C   
615  O O   . LEU A 76  ? 0.4100 0.2445 0.2461 0.0063  0.0566  -0.0008 83  LEU A O   
616  C CB  . LEU A 76  ? 0.4025 0.2469 0.2485 0.0072  0.0532  0.0011  83  LEU A CB  
617  C CG  . LEU A 76  ? 0.4235 0.2675 0.2669 0.0058  0.0510  0.0016  83  LEU A CG  
618  C CD1 . LEU A 76  ? 0.4488 0.2990 0.2983 0.0066  0.0472  0.0022  83  LEU A CD1 
619  C CD2 . LEU A 76  ? 0.4376 0.2763 0.2724 0.0033  0.0492  0.0013  83  LEU A CD2 
620  N N   . LYS A 77  ? 0.3945 0.2320 0.2392 0.0090  0.0620  -0.0002 84  LYS A N   
621  C CA  . LYS A 77  ? 0.4010 0.2366 0.2462 0.0099  0.0642  -0.0008 84  LYS A CA  
622  C C   . LYS A 77  ? 0.3958 0.2234 0.2317 0.0084  0.0666  -0.0020 84  LYS A C   
623  O O   . LYS A 77  ? 0.4182 0.2435 0.2512 0.0078  0.0657  -0.0026 84  LYS A O   
624  C CB  . LYS A 77  ? 0.4085 0.2467 0.2611 0.0120  0.0676  -0.0003 84  LYS A CB  
625  C CG  . LYS A 77  ? 0.3922 0.2379 0.2538 0.0135  0.0650  0.0006  84  LYS A CG  
626  C CD  . LYS A 77  ? 0.3917 0.2390 0.2603 0.0154  0.0682  0.0012  84  LYS A CD  
627  C CE  . LYS A 77  ? 0.3944 0.2488 0.2714 0.0167  0.0654  0.0023  84  LYS A CE  
628  N NZ  . LYS A 77  ? 0.3841 0.2422 0.2643 0.0168  0.0636  0.0031  84  LYS A NZ  
629  N N   . LEU A 78  ? 0.3938 0.2168 0.2246 0.0075  0.0695  -0.0023 85  LEU A N   
630  C CA  . LEU A 78  ? 0.4440 0.2587 0.2650 0.0060  0.0719  -0.0035 85  LEU A CA  
631  C C   . LEU A 78  ? 0.4339 0.2451 0.2472 0.0036  0.0680  -0.0039 85  LEU A C   
632  O O   . LEU A 78  ? 0.4609 0.2655 0.2668 0.0024  0.0694  -0.0050 85  LEU A O   
633  C CB  . LEU A 78  ? 0.4556 0.2664 0.2723 0.0053  0.0754  -0.0034 85  LEU A CB  
634  C CG  . LEU A 78  ? 0.4845 0.2970 0.3075 0.0075  0.0804  -0.0030 85  LEU A CG  
635  C CD1 . LEU A 78  ? 0.4872 0.2976 0.3073 0.0067  0.0828  -0.0025 85  LEU A CD1 
636  C CD2 . LEU A 78  ? 0.5167 0.3249 0.3388 0.0085  0.0850  -0.0041 85  LEU A CD2 
637  N N   . SER A 79  ? 0.4211 0.2364 0.2361 0.0028  0.0633  -0.0031 86  SER A N   
638  C CA  . SER A 79  ? 0.4163 0.2289 0.2249 0.0005  0.0592  -0.0031 86  SER A CA  
639  C C   . SER A 79  ? 0.4255 0.2376 0.2340 0.0005  0.0575  -0.0036 86  SER A C   
640  O O   . SER A 79  ? 0.4364 0.2457 0.2396 -0.0014 0.0543  -0.0036 86  SER A O   
641  C CB  . SER A 79  ? 0.4079 0.2263 0.2207 0.0002  0.0548  -0.0019 86  SER A CB  
642  O OG  . SER A 79  ? 0.4328 0.2581 0.2535 0.0017  0.0523  -0.0014 86  SER A OG  
643  N N   . PHE A 80  ? 0.4443 0.2599 0.2595 0.0026  0.0592  -0.0036 87  PHE A N   
644  C CA  . PHE A 80  ? 0.4666 0.2828 0.2830 0.0027  0.0573  -0.0038 87  PHE A CA  
645  C C   . PHE A 80  ? 0.5092 0.3180 0.3196 0.0023  0.0606  -0.0051 87  PHE A C   
646  O O   . PHE A 80  ? 0.5423 0.3481 0.3517 0.0031  0.0651  -0.0058 87  PHE A O   
647  C CB  . PHE A 80  ? 0.4648 0.2887 0.2914 0.0051  0.0570  -0.0030 87  PHE A CB  
648  C CG  . PHE A 80  ? 0.4347 0.2653 0.2663 0.0053  0.0531  -0.0020 87  PHE A CG  
649  C CD1 . PHE A 80  ? 0.4408 0.2732 0.2718 0.0042  0.0488  -0.0015 87  PHE A CD1 
650  C CD2 . PHE A 80  ? 0.4324 0.2673 0.2690 0.0064  0.0536  -0.0014 87  PHE A CD2 
651  C CE1 . PHE A 80  ? 0.4382 0.2766 0.2738 0.0045  0.0455  -0.0006 87  PHE A CE1 
652  C CE2 . PHE A 80  ? 0.4095 0.2498 0.2500 0.0066  0.0502  -0.0006 87  PHE A CE2 
653  C CZ  . PHE A 80  ? 0.4163 0.2587 0.2567 0.0058  0.0461  -0.0002 87  PHE A CZ  
654  N N   . PRO A 81  ? 0.5645 0.3704 0.3712 0.0011  0.0584  -0.0054 88  PRO A N   
655  C CA  . PRO A 81  ? 0.5501 0.3613 0.3610 0.0009  0.0536  -0.0044 88  PRO A CA  
656  C C   . PRO A 81  ? 0.5151 0.3275 0.3236 -0.0009 0.0489  -0.0035 88  PRO A C   
657  O O   . PRO A 81  ? 0.5672 0.3856 0.3812 -0.0005 0.0455  -0.0024 88  PRO A O   
658  C CB  . PRO A 81  ? 0.5564 0.3629 0.3637 0.0002  0.0535  -0.0050 88  PRO A CB  
659  C CG  . PRO A 81  ? 0.5703 0.3676 0.3680 -0.0011 0.0564  -0.0064 88  PRO A CG  
660  C CD  . PRO A 81  ? 0.6092 0.4074 0.4095 0.0004  0.0610  -0.0068 88  PRO A CD  
661  N N   . GLU A 82  ? 0.5106 0.3172 0.3110 -0.0031 0.0486  -0.0038 89  GLU A N   
662  C CA  . GLU A 82  ? 0.5138 0.3203 0.3112 -0.0052 0.0440  -0.0029 89  GLU A CA  
663  C C   . GLU A 82  ? 0.4881 0.3026 0.2930 -0.0041 0.0419  -0.0017 89  GLU A C   
664  O O   . GLU A 82  ? 0.4686 0.2873 0.2768 -0.0045 0.0379  -0.0006 89  GLU A O   
665  C CB  . GLU A 82  ? 0.5444 0.3435 0.3322 -0.0075 0.0446  -0.0033 89  GLU A CB  
666  C CG  . GLU A 82  ? 0.6384 0.4286 0.4172 -0.0089 0.0466  -0.0047 89  GLU A CG  
667  C CD  . GLU A 82  ? 0.7158 0.5036 0.4950 -0.0070 0.0524  -0.0061 89  GLU A CD  
668  O OE1 . GLU A 82  ? 0.6614 0.4530 0.4461 -0.0049 0.0557  -0.0061 89  GLU A OE1 
669  O OE2 . GLU A 82  ? 0.7696 0.5514 0.5437 -0.0076 0.0537  -0.0072 89  GLU A OE2 
670  N N   . GLY A 83  ? 0.4555 0.2721 0.2633 -0.0027 0.0446  -0.0018 90  GLY A N   
671  C CA  . GLY A 83  ? 0.4103 0.2343 0.2255 -0.0014 0.0430  -0.0009 90  GLY A CA  
672  C C   . GLY A 83  ? 0.4156 0.2389 0.2285 -0.0026 0.0421  -0.0004 90  GLY A C   
673  O O   . GLY A 83  ? 0.3943 0.2115 0.2002 -0.0040 0.0440  -0.0009 90  GLY A O   
674  N N   . PHE A 84  ? 0.3897 0.2188 0.2080 -0.0021 0.0391  0.0004  91  PHE A N   
675  C CA  . PHE A 84  ? 0.3862 0.2158 0.2039 -0.0029 0.0379  0.0010  91  PHE A CA  
676  C C   . PHE A 84  ? 0.3767 0.2114 0.1989 -0.0030 0.0334  0.0020  91  PHE A C   
677  O O   . PHE A 84  ? 0.3883 0.2270 0.2149 -0.0022 0.0317  0.0022  91  PHE A O   
678  C CB  . PHE A 84  ? 0.3866 0.2184 0.2084 -0.0011 0.0413  0.0008  91  PHE A CB  
679  C CG  . PHE A 84  ? 0.3746 0.2139 0.2058 0.0013  0.0411  0.0010  91  PHE A CG  
680  C CD1 . PHE A 84  ? 0.3997 0.2406 0.2345 0.0030  0.0433  0.0006  91  PHE A CD1 
681  C CD2 . PHE A 84  ? 0.4015 0.2459 0.2378 0.0020  0.0389  0.0017  91  PHE A CD2 
682  C CE1 . PHE A 84  ? 0.3707 0.2181 0.2136 0.0052  0.0431  0.0009  91  PHE A CE1 
683  C CE2 . PHE A 84  ? 0.3949 0.2456 0.2392 0.0042  0.0387  0.0018  91  PHE A CE2 
684  C CZ  . PHE A 84  ? 0.3715 0.2235 0.2187 0.0057  0.0407  0.0014  91  PHE A CZ  
685  N N   . LYS A 85  ? 0.3612 0.1959 0.1825 -0.0041 0.0317  0.0027  92  LYS A N   
686  C CA  . LYS A 85  ? 0.3615 0.2010 0.1875 -0.0041 0.0277  0.0036  92  LYS A CA  
687  C C   . LYS A 85  ? 0.3655 0.2083 0.1957 -0.0030 0.0282  0.0038  92  LYS A C   
688  O O   . LYS A 85  ? 0.3575 0.1974 0.1849 -0.0032 0.0309  0.0036  92  LYS A O   
689  C CB  . LYS A 85  ? 0.3984 0.2341 0.2191 -0.0069 0.0243  0.0045  92  LYS A CB  
690  C CG  . LYS A 85  ? 0.4797 0.3125 0.2969 -0.0082 0.0226  0.0047  92  LYS A CG  
691  C CD  . LYS A 85  ? 0.5250 0.3540 0.3372 -0.0111 0.0189  0.0058  92  LYS A CD  
692  C CE  . LYS A 85  ? 0.6146 0.4364 0.4184 -0.0135 0.0185  0.0057  92  LYS A CE  
693  N NZ  . LYS A 85  ? 0.6605 0.4842 0.4670 -0.0128 0.0179  0.0056  92  LYS A NZ  
694  N N   . TRP A 86  ? 0.3472 0.1956 0.1836 -0.0020 0.0256  0.0043  93  TRP A N   
695  C CA  . TRP A 86  ? 0.3366 0.1877 0.1766 -0.0014 0.0252  0.0047  93  TRP A CA  
696  C C   . TRP A 86  ? 0.3497 0.2039 0.1930 -0.0018 0.0212  0.0055  93  TRP A C   
697  O O   . TRP A 86  ? 0.3318 0.1879 0.1767 -0.0019 0.0187  0.0058  93  TRP A O   
698  C CB  . TRP A 86  ? 0.3483 0.2036 0.1943 0.0011  0.0277  0.0041  93  TRP A CB  
699  C CG  . TRP A 86  ? 0.3602 0.2209 0.2123 0.0032  0.0274  0.0037  93  TRP A CG  
700  C CD1 . TRP A 86  ? 0.3786 0.2397 0.2315 0.0043  0.0296  0.0031  93  TRP A CD1 
701  C CD2 . TRP A 86  ? 0.3346 0.2011 0.1930 0.0046  0.0251  0.0038  93  TRP A CD2 
702  N NE1 . TRP A 86  ? 0.3817 0.2481 0.2404 0.0060  0.0285  0.0030  93  TRP A NE1 
703  C CE2 . TRP A 86  ? 0.3611 0.2309 0.2231 0.0063  0.0259  0.0033  93  TRP A CE2 
704  C CE3 . TRP A 86  ? 0.3375 0.2063 0.1986 0.0045  0.0223  0.0042  93  TRP A CE3 
705  C CZ2 . TRP A 86  ? 0.3332 0.2086 0.2010 0.0079  0.0243  0.0032  93  TRP A CZ2 
706  C CZ3 . TRP A 86  ? 0.3366 0.2108 0.2036 0.0062  0.0208  0.0040  93  TRP A CZ3 
707  C CH2 . TRP A 86  ? 0.3309 0.2083 0.2009 0.0078  0.0219  0.0035  93  TRP A CH2 
708  N N   . GLU A 87  ? 0.3298 0.1844 0.1741 -0.0021 0.0204  0.0060  94  GLU A N   
709  C CA  . GLU A 87  ? 0.3405 0.1976 0.1879 -0.0025 0.0168  0.0068  94  GLU A CA  
710  C C   . GLU A 87  ? 0.3217 0.1825 0.1745 -0.0009 0.0171  0.0067  94  GLU A C   
711  O O   . GLU A 87  ? 0.3233 0.1820 0.1742 -0.0012 0.0191  0.0067  94  GLU A O   
712  C CB  . GLU A 87  ? 0.4100 0.2620 0.2514 -0.0054 0.0148  0.0079  94  GLU A CB  
713  C CG  . GLU A 87  ? 0.5109 0.3645 0.3548 -0.0064 0.0106  0.0090  94  GLU A CG  
714  C CD  . GLU A 87  ? 0.6101 0.4576 0.4466 -0.0097 0.0084  0.0102  94  GLU A CD  
715  O OE1 . GLU A 87  ? 0.6576 0.4996 0.4869 -0.0113 0.0104  0.0101  94  GLU A OE1 
716  O OE2 . GLU A 87  ? 0.7237 0.5717 0.5614 -0.0108 0.0049  0.0113  94  GLU A OE2 
717  N N   . ARG A 88  ? 0.2965 0.1624 0.1557 0.0005  0.0151  0.0066  95  ARG A N   
718  C CA  . ARG A 88  ? 0.2780 0.1477 0.1428 0.0022  0.0153  0.0062  95  ARG A CA  
719  C C   . ARG A 88  ? 0.2803 0.1527 0.1493 0.0023  0.0118  0.0068  95  ARG A C   
720  O O   . ARG A 88  ? 0.2865 0.1601 0.1566 0.0020  0.0096  0.0070  95  ARG A O   
721  C CB  . ARG A 88  ? 0.2793 0.1533 0.1487 0.0047  0.0169  0.0052  95  ARG A CB  
722  C CG  . ARG A 88  ? 0.2763 0.1542 0.1514 0.0066  0.0168  0.0047  95  ARG A CG  
723  C CD  . ARG A 88  ? 0.2884 0.1695 0.1668 0.0087  0.0186  0.0039  95  ARG A CD  
724  N NE  . ARG A 88  ? 0.3262 0.2049 0.2022 0.0087  0.0219  0.0038  95  ARG A NE  
725  C CZ  . ARG A 88  ? 0.3418 0.2217 0.2190 0.0099  0.0238  0.0033  95  ARG A CZ  
726  N NH1 . ARG A 88  ? 0.3286 0.2122 0.2090 0.0112  0.0228  0.0028  95  ARG A NH1 
727  N NH2 . ARG A 88  ? 0.3637 0.2411 0.2391 0.0098  0.0268  0.0034  95  ARG A NH2 
728  N N   . VAL A 89  ? 0.2651 0.1382 0.1364 0.0025  0.0114  0.0070  96  VAL A N   
729  C CA  . VAL A 89  ? 0.2730 0.1489 0.1491 0.0031  0.0086  0.0072  96  VAL A CA  
730  C C   . VAL A 89  ? 0.2715 0.1511 0.1530 0.0053  0.0094  0.0063  96  VAL A C   
731  O O   . VAL A 89  ? 0.2741 0.1527 0.1549 0.0055  0.0114  0.0063  96  VAL A O   
732  C CB  . VAL A 89  ? 0.2967 0.1695 0.1705 0.0008  0.0066  0.0085  96  VAL A CB  
733  C CG1 . VAL A 89  ? 0.3184 0.1941 0.1978 0.0015  0.0036  0.0088  96  VAL A CG1 
734  C CG2 . VAL A 89  ? 0.3278 0.1968 0.1961 -0.0014 0.0055  0.0095  96  VAL A CG2 
735  N N   . MET A 90  ? 0.2815 0.1652 0.1681 0.0070  0.0079  0.0056  97  MET A N   
736  C CA  . MET A 90  ? 0.2749 0.1618 0.1665 0.0090  0.0080  0.0047  97  MET A CA  
737  C C   . MET A 90  ? 0.2796 0.1680 0.1751 0.0093  0.0051  0.0048  97  MET A C   
738  O O   . MET A 90  ? 0.2878 0.1776 0.1850 0.0094  0.0032  0.0048  97  MET A O   
739  C CB  . MET A 90  ? 0.2920 0.1823 0.1859 0.0111  0.0090  0.0035  97  MET A CB  
740  C CG  . MET A 90  ? 0.3176 0.2064 0.2079 0.0108  0.0116  0.0035  97  MET A CG  
741  S SD  . MET A 90  ? 0.4045 0.2974 0.2976 0.0129  0.0122  0.0023  97  MET A SD  
742  C CE  . MET A 90  ? 0.4342 0.3291 0.3312 0.0146  0.0127  0.0016  97  MET A CE  
743  N N   . ASN A 91  ? 0.2682 0.1563 0.1654 0.0092  0.0046  0.0051  98  ASN A N   
744  C CA  . ASN A 91  ? 0.2662 0.1557 0.1676 0.0096  0.0019  0.0051  98  ASN A CA  
745  C C   . ASN A 91  ? 0.2698 0.1623 0.1757 0.0119  0.0020  0.0038  98  ASN A C   
746  O O   . ASN A 91  ? 0.2890 0.1812 0.1955 0.0121  0.0029  0.0039  98  ASN A O   
747  C CB  . ASN A 91  ? 0.2764 0.1632 0.1767 0.0078  0.0007  0.0065  98  ASN A CB  
748  C CG  . ASN A 91  ? 0.2946 0.1789 0.1919 0.0056  -0.0009 0.0079  98  ASN A CG  
749  O OD1 . ASN A 91  ? 0.2883 0.1740 0.1878 0.0058  -0.0029 0.0078  98  ASN A OD1 
750  N ND2 . ASN A 91  ? 0.3100 0.1905 0.2024 0.0034  -0.0004 0.0092  98  ASN A ND2 
751  N N   . PHE A 92  ? 0.2853 0.1805 0.1942 0.0134  0.0010  0.0027  99  PHE A N   
752  C CA  . PHE A 92  ? 0.2860 0.1837 0.1987 0.0154  0.0009  0.0013  99  PHE A CA  
753  C C   . PHE A 92  ? 0.3140 0.2118 0.2304 0.0157  -0.0014 0.0013  99  PHE A C   
754  O O   . PHE A 92  ? 0.3141 0.2110 0.2314 0.0147  -0.0033 0.0021  99  PHE A O   
755  C CB  . PHE A 92  ? 0.2948 0.1951 0.2087 0.0170  0.0010  0.0001  99  PHE A CB  
756  C CG  . PHE A 92  ? 0.2915 0.1921 0.2025 0.0171  0.0033  0.0000  99  PHE A CG  
757  C CD1 . PHE A 92  ? 0.2888 0.1882 0.1967 0.0157  0.0038  0.0008  99  PHE A CD1 
758  C CD2 . PHE A 92  ? 0.2986 0.2007 0.2101 0.0185  0.0047  -0.0009 99  PHE A CD2 
759  C CE1 . PHE A 92  ? 0.3012 0.2007 0.2064 0.0158  0.0059  0.0008  99  PHE A CE1 
760  C CE2 . PHE A 92  ? 0.3156 0.2178 0.2245 0.0185  0.0067  -0.0009 99  PHE A CE2 
761  C CZ  . PHE A 92  ? 0.3201 0.2211 0.2260 0.0172  0.0074  0.0000  99  PHE A CZ  
762  N N   . GLU A 93  ? 0.3165 0.2154 0.2354 0.0170  -0.0015 0.0004  100 GLU A N   
763  C CA  . GLU A 93  ? 0.3429 0.2415 0.2653 0.0172  -0.0037 0.0004  100 GLU A CA  
764  C C   . GLU A 93  ? 0.3245 0.2241 0.2501 0.0179  -0.0059 -0.0002 100 GLU A C   
765  O O   . GLU A 93  ? 0.3430 0.2418 0.2711 0.0174  -0.0080 0.0002  100 GLU A O   
766  C CB  . GLU A 93  ? 0.3663 0.2658 0.2908 0.0185  -0.0036 -0.0004 100 GLU A CB  
767  C CG  . GLU A 93  ? 0.3823 0.2839 0.3080 0.0205  -0.0035 -0.0023 100 GLU A CG  
768  C CD  . GLU A 93  ? 0.4357 0.3378 0.3635 0.0217  -0.0040 -0.0032 100 GLU A CD  
769  O OE1 . GLU A 93  ? 0.4115 0.3133 0.3385 0.0214  -0.0027 -0.0025 100 GLU A OE1 
770  O OE2 . GLU A 93  ? 0.5185 0.4212 0.4489 0.0229  -0.0058 -0.0046 100 GLU A OE2 
771  N N   . ASP A 94  ? 0.3194 0.2208 0.2454 0.0191  -0.0055 -0.0013 101 ASP A N   
772  C CA  . ASP A 94  ? 0.3381 0.2407 0.2676 0.0200  -0.0072 -0.0020 101 ASP A CA  
773  C C   . ASP A 94  ? 0.3336 0.2358 0.2627 0.0187  -0.0079 -0.0007 101 ASP A C   
774  O O   . ASP A 94  ? 0.3286 0.2321 0.2609 0.0195  -0.0089 -0.0011 101 ASP A O   
775  C CB  . ASP A 94  ? 0.3421 0.2470 0.2728 0.0223  -0.0064 -0.0041 101 ASP A CB  
776  C CG  . ASP A 94  ? 0.3576 0.2636 0.2853 0.0225  -0.0042 -0.0042 101 ASP A CG  
777  O OD1 . ASP A 94  ? 0.3399 0.2449 0.2645 0.0209  -0.0032 -0.0029 101 ASP A OD1 
778  O OD2 . ASP A 94  ? 0.3435 0.2515 0.2722 0.0242  -0.0035 -0.0058 101 ASP A OD2 
779  N N   . GLY A 95  ? 0.3342 0.2345 0.2596 0.0167  -0.0073 0.0008  102 GLY A N   
780  C CA  . GLY A 95  ? 0.3419 0.2412 0.2664 0.0150  -0.0084 0.0024  102 GLY A CA  
781  C C   . GLY A 95  ? 0.3186 0.2185 0.2406 0.0148  -0.0069 0.0025  102 GLY A C   
782  O O   . GLY A 95  ? 0.3099 0.2084 0.2302 0.0130  -0.0077 0.0040  102 GLY A O   
783  N N   . GLY A 96  ? 0.2780 0.1796 0.1990 0.0163  -0.0047 0.0011  103 GLY A N   
784  C CA  . GLY A 96  ? 0.2737 0.1757 0.1920 0.0159  -0.0033 0.0015  103 GLY A CA  
785  C C   . GLY A 96  ? 0.2527 0.1516 0.1658 0.0138  -0.0025 0.0028  103 GLY A C   
786  O O   . GLY A 96  ? 0.2689 0.1660 0.1803 0.0132  -0.0019 0.0030  103 GLY A O   
787  N N   . VAL A 97  ? 0.2658 0.1638 0.1765 0.0126  -0.0023 0.0037  104 VAL A N   
788  C CA  . VAL A 97  ? 0.2578 0.1524 0.1629 0.0104  -0.0015 0.0049  104 VAL A CA  
789  C C   . VAL A 97  ? 0.2771 0.1721 0.1797 0.0106  0.0001  0.0047  104 VAL A C   
790  O O   . VAL A 97  ? 0.2778 0.1750 0.1827 0.0111  -0.0005 0.0047  104 VAL A O   
791  C CB  . VAL A 97  ? 0.2758 0.1679 0.1799 0.0081  -0.0040 0.0067  104 VAL A CB  
792  C CG1 . VAL A 97  ? 0.2843 0.1723 0.1818 0.0057  -0.0032 0.0078  104 VAL A CG1 
793  C CG2 . VAL A 97  ? 0.2895 0.1811 0.1963 0.0079  -0.0058 0.0070  104 VAL A CG2 
794  N N   . VAL A 98  ? 0.2627 0.1559 0.1612 0.0101  0.0023  0.0046  105 VAL A N   
795  C CA  . VAL A 98  ? 0.2726 0.1653 0.1681 0.0097  0.0036  0.0047  105 VAL A CA  
796  C C   . VAL A 98  ? 0.2794 0.1674 0.1690 0.0073  0.0041  0.0058  105 VAL A C   
797  O O   . VAL A 98  ? 0.2904 0.1763 0.1777 0.0068  0.0053  0.0058  105 VAL A O   
798  C CB  . VAL A 98  ? 0.2746 0.1694 0.1706 0.0115  0.0060  0.0035  105 VAL A CB  
799  C CG1 . VAL A 98  ? 0.3053 0.1991 0.1979 0.0109  0.0076  0.0037  105 VAL A CG1 
800  C CG2 . VAL A 98  ? 0.2792 0.1782 0.1801 0.0137  0.0055  0.0024  105 VAL A CG2 
801  N N   . THR A 99  ? 0.2807 0.1672 0.1678 0.0059  0.0033  0.0067  106 THR A N   
802  C CA  . THR A 99  ? 0.2982 0.1799 0.1789 0.0037  0.0041  0.0074  106 THR A CA  
803  C C   . THR A 99  ? 0.3000 0.1818 0.1787 0.0040  0.0057  0.0070  106 THR A C   
804  O O   . THR A 99  ? 0.2862 0.1713 0.1682 0.0050  0.0051  0.0069  106 THR A O   
805  C CB  . THR A 99  ? 0.3360 0.2146 0.2144 0.0012  0.0013  0.0090  106 THR A CB  
806  O OG1 . THR A 99  ? 0.3603 0.2408 0.2414 0.0011  -0.0007 0.0097  106 THR A OG1 
807  C CG2 . THR A 99  ? 0.3232 0.2022 0.2042 0.0011  -0.0002 0.0093  106 THR A CG2 
808  N N   . VAL A 100 ? 0.2797 0.1581 0.1535 0.0032  0.0079  0.0068  107 VAL A N   
809  C CA  . VAL A 100 ? 0.2970 0.1752 0.1690 0.0036  0.0098  0.0064  107 VAL A CA  
810  C C   . VAL A 100 ? 0.3252 0.1977 0.1902 0.0014  0.0106  0.0068  107 VAL A C   
811  O O   . VAL A 100 ? 0.3182 0.1872 0.1795 0.0004  0.0116  0.0069  107 VAL A O   
812  C CB  . VAL A 100 ? 0.3201 0.2007 0.1942 0.0058  0.0125  0.0052  107 VAL A CB  
813  C CG1 . VAL A 100 ? 0.3495 0.2310 0.2232 0.0064  0.0140  0.0048  107 VAL A CG1 
814  C CG2 . VAL A 100 ? 0.3202 0.2054 0.2003 0.0077  0.0118  0.0046  107 VAL A CG2 
815  N N   . THR A 101 ? 0.3191 0.1906 0.1820 0.0008  0.0104  0.0071  108 THR A N   
816  C CA  . THR A 101 ? 0.3417 0.2075 0.1977 -0.0009 0.0117  0.0071  108 THR A CA  
817  C C   . THR A 101 ? 0.3474 0.2141 0.2034 0.0001  0.0138  0.0064  108 THR A C   
818  O O   . THR A 101 ? 0.3480 0.2191 0.2086 0.0015  0.0131  0.0064  108 THR A O   
819  C CB  . THR A 101 ? 0.3724 0.2344 0.2242 -0.0036 0.0089  0.0084  108 THR A CB  
820  O OG1 . THR A 101 ? 0.3876 0.2525 0.2428 -0.0034 0.0068  0.0091  108 THR A OG1 
821  C CG2 . THR A 101 ? 0.3808 0.2415 0.2321 -0.0050 0.0067  0.0093  108 THR A CG2 
822  N N   . GLN A 102 ? 0.3244 0.1871 0.1758 -0.0003 0.0164  0.0059  109 GLN A N   
823  C CA  . GLN A 102 ? 0.3263 0.1898 0.1782 0.0008  0.0186  0.0052  109 GLN A CA  
824  C C   . GLN A 102 ? 0.3524 0.2097 0.1974 -0.0007 0.0201  0.0050  109 GLN A C   
825  O O   . GLN A 102 ? 0.3373 0.1899 0.1773 -0.0020 0.0212  0.0049  109 GLN A O   
826  C CB  . GLN A 102 ? 0.3289 0.1956 0.1849 0.0031  0.0211  0.0044  109 GLN A CB  
827  C CG  . GLN A 102 ? 0.3425 0.2119 0.2013 0.0047  0.0227  0.0039  109 GLN A CG  
828  C CD  . GLN A 102 ? 0.3638 0.2295 0.2194 0.0047  0.0259  0.0033  109 GLN A CD  
829  O OE1 . GLN A 102 ? 0.3577 0.2179 0.2076 0.0032  0.0271  0.0032  109 GLN A OE1 
830  N NE2 . GLN A 102 ? 0.3886 0.2573 0.2480 0.0065  0.0275  0.0030  109 GLN A NE2 
831  N N   . ASP A 103 ? 0.3194 0.1765 0.1640 -0.0006 0.0203  0.0049  110 ASP A N   
832  C CA  . ASP A 103 ? 0.3703 0.2217 0.2089 -0.0017 0.0222  0.0045  110 ASP A CA  
833  C C   . ASP A 103 ? 0.3611 0.2144 0.2025 0.0002  0.0251  0.0037  110 ASP A C   
834  O O   . ASP A 103 ? 0.3812 0.2397 0.2281 0.0017  0.0244  0.0039  110 ASP A O   
835  C CB  . ASP A 103 ? 0.3934 0.2416 0.2281 -0.0039 0.0193  0.0053  110 ASP A CB  
836  C CG  . ASP A 103 ? 0.4444 0.2860 0.2721 -0.0053 0.0209  0.0047  110 ASP A CG  
837  O OD1 . ASP A 103 ? 0.4936 0.3355 0.3224 -0.0041 0.0231  0.0041  110 ASP A OD1 
838  O OD2 . ASP A 103 ? 0.4843 0.3200 0.3053 -0.0076 0.0201  0.0049  110 ASP A OD2 
839  N N   . SER A 104 ? 0.3686 0.2177 0.2064 0.0002  0.0284  0.0028  111 SER A N   
840  C CA  . SER A 104 ? 0.3758 0.2259 0.2160 0.0019  0.0314  0.0022  111 SER A CA  
841  C C   . SER A 104 ? 0.3981 0.2418 0.2322 0.0008  0.0331  0.0016  111 SER A C   
842  O O   . SER A 104 ? 0.4088 0.2466 0.2364 -0.0006 0.0343  0.0012  111 SER A O   
843  C CB  . SER A 104 ? 0.3822 0.2339 0.2255 0.0036  0.0344  0.0017  111 SER A CB  
844  O OG  . SER A 104 ? 0.3666 0.2238 0.2156 0.0048  0.0330  0.0021  111 SER A OG  
845  N N   . SER A 105 ? 0.4031 0.2478 0.2390 0.0014  0.0332  0.0016  112 SER A N   
846  C CA  . SER A 105 ? 0.4315 0.2704 0.2620 0.0003  0.0345  0.0011  112 SER A CA  
847  C C   . SER A 105 ? 0.4483 0.2897 0.2835 0.0022  0.0366  0.0008  112 SER A C   
848  O O   . SER A 105 ? 0.3793 0.2267 0.2213 0.0041  0.0368  0.0012  112 SER A O   
849  C CB  . SER A 105 ? 0.4575 0.2942 0.2845 -0.0017 0.0308  0.0018  112 SER A CB  
850  O OG  . SER A 105 ? 0.4677 0.3105 0.3006 -0.0009 0.0283  0.0028  112 SER A OG  
851  N N   . LEU A 106 ? 0.4769 0.3131 0.3081 0.0017  0.0384  0.0002  113 LEU A N   
852  C CA  . LEU A 106 ? 0.4917 0.3296 0.3272 0.0034  0.0404  0.0000  113 LEU A CA  
853  C C   . LEU A 106 ? 0.5038 0.3394 0.3369 0.0022  0.0385  0.0003  113 LEU A C   
854  O O   . LEU A 106 ? 0.5533 0.3828 0.3794 0.0001  0.0376  0.0000  113 LEU A O   
855  C CB  . LEU A 106 ? 0.4849 0.3186 0.3186 0.0041  0.0449  -0.0010 113 LEU A CB  
856  C CG  . LEU A 106 ? 0.5055 0.3406 0.3439 0.0058  0.0471  -0.0011 113 LEU A CG  
857  C CD1 . LEU A 106 ? 0.5141 0.3566 0.3611 0.0080  0.0473  -0.0003 113 LEU A CD1 
858  C CD2 . LEU A 106 ? 0.5622 0.3908 0.3966 0.0059  0.0514  -0.0023 113 LEU A CD2 
859  N N   . GLN A 107 ? 0.4786 0.3193 0.3175 0.0033  0.0374  0.0011  114 GLN A N   
860  C CA  . GLN A 107 ? 0.5183 0.3582 0.3565 0.0023  0.0353  0.0017  114 GLN A CA  
861  C C   . GLN A 107 ? 0.4934 0.3365 0.3372 0.0041  0.0368  0.0019  114 GLN A C   
862  O O   . GLN A 107 ? 0.4519 0.3016 0.3022 0.0057  0.0366  0.0026  114 GLN A O   
863  C CB  . GLN A 107 ? 0.5544 0.3984 0.3945 0.0015  0.0312  0.0031  114 GLN A CB  
864  C CG  . GLN A 107 ? 0.6243 0.4651 0.4591 -0.0005 0.0289  0.0032  114 GLN A CG  
865  C CD  . GLN A 107 ? 0.6601 0.4925 0.4868 -0.0026 0.0289  0.0025  114 GLN A CD  
866  O OE1 . GLN A 107 ? 0.7382 0.5678 0.5633 -0.0032 0.0286  0.0026  114 GLN A OE1 
867  N NE2 . GLN A 107 ? 0.6805 0.5084 0.5015 -0.0039 0.0292  0.0019  114 GLN A NE2 
868  N N   . ASP A 108 ? 0.5138 0.3521 0.3550 0.0037  0.0381  0.0014  115 ASP A N   
869  C CA  . ASP A 108 ? 0.5285 0.3692 0.3748 0.0051  0.0392  0.0018  115 ASP A CA  
870  C C   . ASP A 108 ? 0.4932 0.3383 0.3456 0.0073  0.0416  0.0018  115 ASP A C   
871  O O   . ASP A 108 ? 0.4727 0.3235 0.3312 0.0085  0.0409  0.0028  115 ASP A O   
872  C CB  . ASP A 108 ? 0.5939 0.4394 0.4437 0.0047  0.0357  0.0034  115 ASP A CB  
873  C CG  . ASP A 108 ? 0.6758 0.5176 0.5203 0.0024  0.0328  0.0037  115 ASP A CG  
874  O OD1 . ASP A 108 ? 0.8382 0.6793 0.6796 0.0013  0.0312  0.0037  115 ASP A OD1 
875  O OD2 . ASP A 108 ? 0.8231 0.6629 0.6668 0.0017  0.0318  0.0042  115 ASP A OD2 
876  N N   . GLY A 109 ? 0.4827 0.3253 0.3334 0.0077  0.0444  0.0008  116 GLY A N   
877  C CA  . GLY A 109 ? 0.4531 0.2992 0.3096 0.0097  0.0468  0.0009  116 GLY A CA  
878  C C   . GLY A 109 ? 0.4165 0.2691 0.2773 0.0105  0.0451  0.0017  116 GLY A C   
879  O O   . GLY A 109 ? 0.4958 0.3518 0.3619 0.0120  0.0465  0.0020  116 GLY A O   
880  N N   . GLU A 110 ? 0.4426 0.2967 0.3014 0.0094  0.0420  0.0020  117 GLU A N   
881  C CA  . GLU A 110 ? 0.4311 0.2910 0.2935 0.0100  0.0402  0.0026  117 GLU A CA  
882  C C   . GLU A 110 ? 0.3960 0.2540 0.2542 0.0089  0.0393  0.0021  117 GLU A C   
883  O O   . GLU A 110 ? 0.3888 0.2428 0.2416 0.0071  0.0380  0.0020  117 GLU A O   
884  C CB  . GLU A 110 ? 0.4771 0.3423 0.3428 0.0101  0.0371  0.0037  117 GLU A CB  
885  C CG  . GLU A 110 ? 0.5116 0.3799 0.3824 0.0113  0.0377  0.0044  117 GLU A CG  
886  C CD  . GLU A 110 ? 0.6230 0.4967 0.4968 0.0114  0.0349  0.0055  117 GLU A CD  
887  O OE1 . GLU A 110 ? 0.6499 0.5279 0.5258 0.0119  0.0335  0.0057  117 GLU A OE1 
888  O OE2 . GLU A 110 ? 0.6908 0.5643 0.5650 0.0109  0.0341  0.0062  117 GLU A OE2 
889  N N   . PHE A 111 ? 0.3838 0.2455 0.2452 0.0098  0.0393  0.0022  118 PHE A N   
890  C CA  . PHE A 111 ? 0.3876 0.2483 0.2460 0.0088  0.0381  0.0020  118 PHE A CA  
891  C C   . PHE A 111 ? 0.3865 0.2506 0.2457 0.0082  0.0344  0.0027  118 PHE A C   
892  O O   . PHE A 111 ? 0.4043 0.2738 0.2684 0.0093  0.0332  0.0033  118 PHE A O   
893  C CB  . PHE A 111 ? 0.3817 0.2451 0.2435 0.0101  0.0392  0.0019  118 PHE A CB  
894  C CG  . PHE A 111 ? 0.3862 0.2465 0.2477 0.0107  0.0429  0.0014  118 PHE A CG  
895  C CD1 . PHE A 111 ? 0.3928 0.2467 0.2479 0.0094  0.0447  0.0007  118 PHE A CD1 
896  C CD2 . PHE A 111 ? 0.3580 0.2213 0.2251 0.0124  0.0446  0.0016  118 PHE A CD2 
897  C CE1 . PHE A 111 ? 0.3989 0.2497 0.2536 0.0100  0.0485  0.0002  118 PHE A CE1 
898  C CE2 . PHE A 111 ? 0.3866 0.2472 0.2541 0.0130  0.0482  0.0014  118 PHE A CE2 
899  C CZ  . PHE A 111 ? 0.3833 0.2376 0.2445 0.0119  0.0503  0.0006  118 PHE A CZ  
900  N N   . ILE A 112 ? 0.3826 0.2436 0.2371 0.0065  0.0327  0.0027  119 ILE A N   
901  C CA  . ILE A 112 ? 0.4123 0.2762 0.2677 0.0057  0.0293  0.0036  119 ILE A CA  
902  C C   . ILE A 112 ? 0.3716 0.2355 0.2260 0.0052  0.0281  0.0035  119 ILE A C   
903  O O   . ILE A 112 ? 0.3888 0.2479 0.2382 0.0038  0.0285  0.0032  119 ILE A O   
904  C CB  . ILE A 112 ? 0.4032 0.2629 0.2540 0.0037  0.0276  0.0040  119 ILE A CB  
905  C CG1 . ILE A 112 ? 0.4360 0.2947 0.2872 0.0041  0.0288  0.0040  119 ILE A CG1 
906  C CG2 . ILE A 112 ? 0.4182 0.2807 0.2703 0.0028  0.0240  0.0052  119 ILE A CG2 
907  C CD1 . ILE A 112 ? 0.4437 0.3084 0.3011 0.0057  0.0286  0.0047  119 ILE A CD1 
908  N N   . TYR A 113 ? 0.3535 0.2231 0.2128 0.0063  0.0266  0.0039  120 TYR A N   
909  C CA  . TYR A 113 ? 0.3644 0.2349 0.2241 0.0061  0.0255  0.0039  120 TYR A CA  
910  C C   . TYR A 113 ? 0.3760 0.2491 0.2372 0.0054  0.0222  0.0048  120 TYR A C   
911  O O   . TYR A 113 ? 0.3813 0.2588 0.2465 0.0064  0.0213  0.0052  120 TYR A O   
912  C CB  . TYR A 113 ? 0.3481 0.2230 0.2129 0.0081  0.0266  0.0035  120 TYR A CB  
913  C CG  . TYR A 113 ? 0.3488 0.2224 0.2140 0.0091  0.0297  0.0029  120 TYR A CG  
914  C CD1 . TYR A 113 ? 0.3742 0.2423 0.2349 0.0082  0.0319  0.0025  120 TYR A CD1 
915  C CD2 . TYR A 113 ? 0.3815 0.2594 0.2519 0.0110  0.0304  0.0028  120 TYR A CD2 
916  C CE1 . TYR A 113 ? 0.3885 0.2559 0.2505 0.0093  0.0349  0.0021  120 TYR A CE1 
917  C CE2 . TYR A 113 ? 0.3884 0.2655 0.2602 0.0119  0.0331  0.0025  120 TYR A CE2 
918  C CZ  . TYR A 113 ? 0.3887 0.2606 0.2565 0.0111  0.0355  0.0022  120 TYR A CZ  
919  O OH  . TYR A 113 ? 0.4171 0.2885 0.2870 0.0121  0.0383  0.0021  120 TYR A OH  
920  N N   . LYS A 114 ? 0.3442 0.2144 0.2022 0.0038  0.0204  0.0051  121 LYS A N   
921  C CA  . LYS A 114 ? 0.3447 0.2173 0.2047 0.0031  0.0173  0.0061  121 LYS A CA  
922  C C   . LYS A 114 ? 0.3479 0.2213 0.2090 0.0032  0.0165  0.0060  121 LYS A C   
923  O O   . LYS A 114 ? 0.3179 0.1870 0.1749 0.0021  0.0171  0.0058  121 LYS A O   
924  C CB  . LYS A 114 ? 0.3973 0.2654 0.2528 0.0007  0.0153  0.0070  121 LYS A CB  
925  C CG  . LYS A 114 ? 0.4202 0.2874 0.2747 0.0005  0.0158  0.0073  121 LYS A CG  
926  C CD  . LYS A 114 ? 0.4938 0.3673 0.3544 0.0020  0.0151  0.0079  121 LYS A CD  
927  C CE  . LYS A 114 ? 0.5457 0.4184 0.4057 0.0010  0.0141  0.0088  121 LYS A CE  
928  N NZ  . LYS A 114 ? 0.5812 0.4513 0.4388 0.0013  0.0163  0.0081  121 LYS A NZ  
929  N N   . VAL A 115 ? 0.3221 0.2007 0.1887 0.0046  0.0153  0.0061  122 VAL A N   
930  C CA  . VAL A 115 ? 0.3128 0.1926 0.1812 0.0050  0.0147  0.0059  122 VAL A CA  
931  C C   . VAL A 115 ? 0.3521 0.2342 0.2233 0.0045  0.0116  0.0069  122 VAL A C   
932  O O   . VAL A 115 ? 0.3239 0.2097 0.1986 0.0052  0.0108  0.0074  122 VAL A O   
933  C CB  . VAL A 115 ? 0.3343 0.2186 0.2074 0.0074  0.0162  0.0049  122 VAL A CB  
934  C CG1 . VAL A 115 ? 0.3316 0.2163 0.2061 0.0078  0.0158  0.0046  122 VAL A CG1 
935  C CG2 . VAL A 115 ? 0.3488 0.2324 0.2211 0.0083  0.0191  0.0042  122 VAL A CG2 
936  N N   . LYS A 116 ? 0.3226 0.2028 0.1928 0.0033  0.0100  0.0073  123 LYS A N   
937  C CA  . LYS A 116 ? 0.3367 0.2196 0.2108 0.0032  0.0073  0.0082  123 LYS A CA  
938  C C   . LYS A 116 ? 0.3119 0.1965 0.1888 0.0043  0.0072  0.0076  123 LYS A C   
939  O O   . LYS A 116 ? 0.2919 0.1734 0.1657 0.0037  0.0081  0.0072  123 LYS A O   
940  C CB  . LYS A 116 ? 0.3707 0.2493 0.2412 0.0005  0.0047  0.0096  123 LYS A CB  
941  C CG  . LYS A 116 ? 0.4375 0.3143 0.3056 -0.0008 0.0040  0.0105  123 LYS A CG  
942  C CD  . LYS A 116 ? 0.5163 0.3881 0.3801 -0.0037 0.0012  0.0120  123 LYS A CD  
943  C CE  . LYS A 116 ? 0.5910 0.4617 0.4540 -0.0051 -0.0004 0.0133  123 LYS A CE  
944  N NZ  . LYS A 116 ? 0.6157 0.4816 0.4749 -0.0082 -0.0037 0.0149  123 LYS A NZ  
945  N N   . LEU A 117 ? 0.2952 0.1845 0.1778 0.0058  0.0063  0.0075  124 LEU A N   
946  C CA  . LEU A 117 ? 0.2961 0.1873 0.1817 0.0072  0.0063  0.0067  124 LEU A CA  
947  C C   . LEU A 117 ? 0.2948 0.1884 0.1849 0.0073  0.0039  0.0073  124 LEU A C   
948  O O   . LEU A 117 ? 0.2914 0.1877 0.1845 0.0078  0.0031  0.0078  124 LEU A O   
949  C CB  . LEU A 117 ? 0.2970 0.1916 0.1852 0.0095  0.0085  0.0053  124 LEU A CB  
950  C CG  . LEU A 117 ? 0.2927 0.1895 0.1841 0.0111  0.0086  0.0043  124 LEU A CG  
951  C CD1 . LEU A 117 ? 0.3309 0.2282 0.2219 0.0124  0.0109  0.0032  124 LEU A CD1 
952  C CD2 . LEU A 117 ? 0.2962 0.1969 0.1927 0.0125  0.0072  0.0040  124 LEU A CD2 
953  N N   . ARG A 118 ? 0.2785 0.1708 0.1691 0.0068  0.0026  0.0075  125 ARG A N   
954  C CA  . ARG A 118 ? 0.2902 0.1848 0.1857 0.0072  0.0003  0.0080  125 ARG A CA  
955  C C   . ARG A 118 ? 0.2759 0.1719 0.1741 0.0086  0.0006  0.0069  125 ARG A C   
956  O O   . ARG A 118 ? 0.2907 0.1840 0.1866 0.0077  0.0005  0.0069  125 ARG A O   
957  C CB  . ARG A 118 ? 0.3252 0.2164 0.2189 0.0046  -0.0023 0.0098  125 ARG A CB  
958  C CG  . ARG A 118 ? 0.3500 0.2436 0.2496 0.0049  -0.0048 0.0106  125 ARG A CG  
959  C CD  . ARG A 118 ? 0.4170 0.3070 0.3147 0.0021  -0.0078 0.0126  125 ARG A CD  
960  N NE  . ARG A 118 ? 0.4852 0.3725 0.3799 0.0015  -0.0075 0.0121  125 ARG A NE  
961  C CZ  . ARG A 118 ? 0.4977 0.3802 0.3868 -0.0009 -0.0083 0.0130  125 ARG A CZ  
962  N NH1 . ARG A 118 ? 0.5043 0.3854 0.3919 -0.0008 -0.0074 0.0124  125 ARG A NH1 
963  N NH2 . ARG A 118 ? 0.5019 0.3809 0.3871 -0.0034 -0.0100 0.0146  125 ARG A NH2 
964  N N   . GLY A 119 ? 0.2692 0.1694 0.1723 0.0109  0.0009  0.0059  126 GLY A N   
965  C CA  . GLY A 119 ? 0.2671 0.1689 0.1733 0.0125  0.0010  0.0046  126 GLY A CA  
966  C C   . GLY A 119 ? 0.2675 0.1709 0.1786 0.0128  -0.0012 0.0051  126 GLY A C   
967  O O   . GLY A 119 ? 0.2539 0.1595 0.1679 0.0133  -0.0016 0.0056  126 GLY A O   
968  N N   . THR A 120 ? 0.2468 0.1489 0.1591 0.0124  -0.0027 0.0053  127 THR A N   
969  C CA  . THR A 120 ? 0.2713 0.1746 0.1886 0.0125  -0.0049 0.0059  127 THR A CA  
970  C C   . THR A 120 ? 0.2545 0.1583 0.1747 0.0137  -0.0055 0.0048  127 THR A C   
971  O O   . THR A 120 ? 0.2563 0.1588 0.1741 0.0138  -0.0047 0.0041  127 THR A O   
972  C CB  . THR A 120 ? 0.2980 0.1983 0.2139 0.0098  -0.0075 0.0081  127 THR A CB  
973  O OG1 . THR A 120 ? 0.2953 0.1920 0.2067 0.0082  -0.0076 0.0084  127 THR A OG1 
974  C CG2 . THR A 120 ? 0.3052 0.2047 0.2186 0.0085  -0.0075 0.0093  127 THR A CG2 
975  N N   . ASN A 121 ? 0.2648 0.1705 0.1903 0.0148  -0.0069 0.0046  128 ASN A N   
976  C CA  . ASN A 121 ? 0.2760 0.1818 0.2047 0.0157  -0.0080 0.0038  128 ASN A CA  
977  C C   . ASN A 121 ? 0.2831 0.1902 0.2118 0.0178  -0.0063 0.0017  128 ASN A C   
978  O O   . ASN A 121 ? 0.2879 0.1943 0.2180 0.0183  -0.0070 0.0010  128 ASN A O   
979  C CB  . ASN A 121 ? 0.3029 0.2053 0.2297 0.0134  -0.0100 0.0053  128 ASN A CB  
980  C CG  . ASN A 121 ? 0.3135 0.2161 0.2450 0.0140  -0.0120 0.0052  128 ASN A CG  
981  O OD1 . ASN A 121 ? 0.3257 0.2299 0.2621 0.0147  -0.0132 0.0054  128 ASN A OD1 
982  N ND2 . ASN A 121 ? 0.3233 0.2240 0.2534 0.0134  -0.0124 0.0051  128 ASN A ND2 
983  N N   . PHE A 122 ? 0.2612 0.1704 0.1890 0.0193  -0.0041 0.0005  129 PHE A N   
984  C CA  . PHE A 122 ? 0.2667 0.1770 0.1949 0.0212  -0.0029 -0.0015 129 PHE A CA  
985  C C   . PHE A 122 ? 0.2808 0.1931 0.2139 0.0232  -0.0035 -0.0027 129 PHE A C   
986  O O   . PHE A 122 ? 0.2766 0.1908 0.2121 0.0238  -0.0032 -0.0024 129 PHE A O   
987  C CB  . PHE A 122 ? 0.2761 0.1878 0.2015 0.0221  -0.0005 -0.0023 129 PHE A CB  
988  C CG  . PHE A 122 ? 0.2572 0.1667 0.1778 0.0206  0.0004  -0.0015 129 PHE A CG  
989  C CD1 . PHE A 122 ? 0.2565 0.1648 0.1756 0.0206  0.0008  -0.0020 129 PHE A CD1 
990  C CD2 . PHE A 122 ? 0.2634 0.1721 0.1814 0.0191  0.0008  -0.0002 129 PHE A CD2 
991  C CE1 . PHE A 122 ? 0.2556 0.1621 0.1709 0.0194  0.0020  -0.0013 129 PHE A CE1 
992  C CE2 . PHE A 122 ? 0.2747 0.1813 0.1884 0.0178  0.0020  0.0003  129 PHE A CE2 
993  C CZ  . PHE A 122 ? 0.2571 0.1626 0.1695 0.0180  0.0027  -0.0002 129 PHE A CZ  
994  N N   . PRO A 123 ? 0.2917 0.2035 0.2264 0.0242  -0.0042 -0.0039 130 PRO A N   
995  C CA  . PRO A 123 ? 0.3127 0.2260 0.2517 0.0262  -0.0046 -0.0054 130 PRO A CA  
996  C C   . PRO A 123 ? 0.3096 0.2252 0.2481 0.0281  -0.0024 -0.0070 130 PRO A C   
997  O O   . PRO A 123 ? 0.2888 0.2047 0.2238 0.0283  -0.0008 -0.0076 130 PRO A O   
998  C CB  . PRO A 123 ? 0.3350 0.2469 0.2743 0.0267  -0.0055 -0.0067 130 PRO A CB  
999  C CG  . PRO A 123 ? 0.3344 0.2440 0.2708 0.0246  -0.0062 -0.0051 130 PRO A CG  
1000 C CD  . PRO A 123 ? 0.3195 0.2293 0.2520 0.0235  -0.0046 -0.0041 130 PRO A CD  
1001 N N   . SER A 124 ? 0.3083 0.2257 0.2507 0.0294  -0.0021 -0.0074 131 SER A N   
1002 C CA  . SER A 124 ? 0.3071 0.2269 0.2490 0.0310  0.0001  -0.0086 131 SER A CA  
1003 C C   . SER A 124 ? 0.3294 0.2490 0.2691 0.0327  0.0011  -0.0110 131 SER A C   
1004 O O   . SER A 124 ? 0.3321 0.2531 0.2692 0.0336  0.0031  -0.0119 131 SER A O   
1005 C CB  . SER A 124 ? 0.3418 0.2635 0.2886 0.0322  0.0004  -0.0085 131 SER A CB  
1006 O OG  . SER A 124 ? 0.4340 0.3551 0.3840 0.0337  -0.0003 -0.0101 131 SER A OG  
1007 N N   . ASP A 125 ? 0.3225 0.2403 0.2631 0.0331  -0.0003 -0.0121 132 ASP A N   
1008 C CA  . ASP A 125 ? 0.3650 0.2821 0.3037 0.0344  0.0000  -0.0143 132 ASP A CA  
1009 C C   . ASP A 125 ? 0.3634 0.2789 0.2985 0.0332  -0.0005 -0.0139 132 ASP A C   
1010 O O   . ASP A 125 ? 0.3704 0.2851 0.3041 0.0340  -0.0007 -0.0154 132 ASP A O   
1011 C CB  . ASP A 125 ? 0.4100 0.3260 0.3522 0.0357  -0.0014 -0.0158 132 ASP A CB  
1012 C CG  . ASP A 125 ? 0.4696 0.3837 0.4140 0.0343  -0.0040 -0.0145 132 ASP A CG  
1013 O OD1 . ASP A 125 ? 0.4395 0.3535 0.3841 0.0325  -0.0046 -0.0123 132 ASP A OD1 
1014 O OD2 . ASP A 125 ? 0.5720 0.4846 0.5181 0.0349  -0.0055 -0.0157 132 ASP A OD2 
1015 N N   . GLY A 126 ? 0.3265 0.2415 0.2602 0.0313  -0.0007 -0.0118 133 GLY A N   
1016 C CA  . GLY A 126 ? 0.3234 0.2371 0.2544 0.0302  -0.0009 -0.0113 133 GLY A CA  
1017 C C   . GLY A 126 ? 0.3160 0.2304 0.2433 0.0303  0.0009  -0.0115 133 GLY A C   
1018 O O   . GLY A 126 ? 0.3023 0.2186 0.2288 0.0312  0.0024  -0.0120 133 GLY A O   
1019 N N   . PRO A 127 ? 0.3164 0.2296 0.2417 0.0295  0.0008  -0.0110 134 PRO A N   
1020 C CA  . PRO A 127 ? 0.3096 0.2236 0.2320 0.0297  0.0023  -0.0112 134 PRO A CA  
1021 C C   . PRO A 127 ? 0.3195 0.2346 0.2399 0.0290  0.0040  -0.0101 134 PRO A C   
1022 O O   . PRO A 127 ? 0.3335 0.2497 0.2519 0.0295  0.0054  -0.0105 134 PRO A O   
1023 C CB  . PRO A 127 ? 0.3461 0.2585 0.2678 0.0288  0.0018  -0.0105 134 PRO A CB  
1024 C CG  . PRO A 127 ? 0.3650 0.2759 0.2884 0.0277  0.0005  -0.0095 134 PRO A CG  
1025 C CD  . PRO A 127 ? 0.3339 0.2452 0.2600 0.0285  -0.0006 -0.0103 134 PRO A CD  
1026 N N   . VAL A 128 ? 0.2958 0.2103 0.2165 0.0277  0.0039  -0.0086 135 VAL A N   
1027 C CA  . VAL A 128 ? 0.2838 0.1991 0.2026 0.0269  0.0052  -0.0075 135 VAL A CA  
1028 C C   . VAL A 128 ? 0.3032 0.2209 0.2232 0.0280  0.0060  -0.0080 135 VAL A C   
1029 O O   . VAL A 128 ? 0.2940 0.2132 0.2123 0.0284  0.0075  -0.0081 135 VAL A O   
1030 C CB  . VAL A 128 ? 0.2780 0.1913 0.1961 0.0249  0.0046  -0.0056 135 VAL A CB  
1031 C CG1 . VAL A 128 ? 0.2751 0.1890 0.1915 0.0240  0.0057  -0.0045 135 VAL A CG1 
1032 C CG2 . VAL A 128 ? 0.2683 0.1796 0.1848 0.0239  0.0047  -0.0051 135 VAL A CG2 
1033 N N   . MET A 129 ? 0.2854 0.2035 0.2085 0.0285  0.0050  -0.0083 136 MET A N   
1034 C CA  . MET A 129 ? 0.2981 0.2185 0.2228 0.0295  0.0059  -0.0085 136 MET A CA  
1035 C C   . MET A 129 ? 0.2983 0.2200 0.2225 0.0315  0.0070  -0.0106 136 MET A C   
1036 O O   . MET A 129 ? 0.3676 0.2914 0.2923 0.0324  0.0084  -0.0108 136 MET A O   
1037 C CB  . MET A 129 ? 0.2998 0.2204 0.2285 0.0295  0.0046  -0.0080 136 MET A CB  
1038 C CG  . MET A 129 ? 0.3057 0.2248 0.2344 0.0274  0.0034  -0.0058 136 MET A CG  
1039 S SD  . MET A 129 ? 0.3385 0.2577 0.2640 0.0257  0.0044  -0.0040 136 MET A SD  
1040 C CE  . MET A 129 ? 0.3429 0.2655 0.2711 0.0270  0.0057  -0.0040 136 MET A CE  
1041 N N   . GLN A 130 ? 0.3033 0.2238 0.2269 0.0321  0.0063  -0.0119 137 GLN A N   
1042 C CA  . GLN A 130 ? 0.3110 0.2322 0.2334 0.0339  0.0071  -0.0140 137 GLN A CA  
1043 C C   . GLN A 130 ? 0.3373 0.2585 0.2560 0.0336  0.0079  -0.0140 137 GLN A C   
1044 O O   . GLN A 130 ? 0.3493 0.2706 0.2662 0.0347  0.0083  -0.0156 137 GLN A O   
1045 C CB  . GLN A 130 ? 0.3221 0.2417 0.2461 0.0348  0.0056  -0.0156 137 GLN A CB  
1046 C CG  . GLN A 130 ? 0.3111 0.2307 0.2391 0.0354  0.0048  -0.0158 137 GLN A CG  
1047 C CD  . GLN A 130 ? 0.3466 0.2683 0.2758 0.0370  0.0066  -0.0168 137 GLN A CD  
1048 O OE1 . GLN A 130 ? 0.3280 0.2502 0.2547 0.0382  0.0079  -0.0183 137 GLN A OE1 
1049 N NE2 . GLN A 130 ? 0.3292 0.2520 0.2622 0.0370  0.0065  -0.0158 137 GLN A NE2 
1050 N N   . LYS A 131 ? 0.3096 0.2304 0.2269 0.0321  0.0081  -0.0124 138 LYS A N   
1051 C CA  . LYS A 131 ? 0.3244 0.2452 0.2389 0.0317  0.0088  -0.0121 138 LYS A CA  
1052 C C   . LYS A 131 ? 0.3542 0.2736 0.2678 0.0322  0.0078  -0.0132 138 LYS A C   
1053 O O   . LYS A 131 ? 0.3797 0.2997 0.2912 0.0329  0.0083  -0.0140 138 LYS A O   
1054 C CB  . LYS A 131 ? 0.3436 0.2665 0.2563 0.0323  0.0106  -0.0121 138 LYS A CB  
1055 C CG  . LYS A 131 ? 0.3813 0.3055 0.2947 0.0316  0.0115  -0.0107 138 LYS A CG  
1056 C CD  . LYS A 131 ? 0.4158 0.3421 0.3276 0.0319  0.0132  -0.0104 138 LYS A CD  
1057 C CE  . LYS A 131 ? 0.4260 0.3539 0.3397 0.0318  0.0138  -0.0094 138 LYS A CE  
1058 N NZ  . LYS A 131 ? 0.4731 0.4035 0.3861 0.0324  0.0155  -0.0092 138 LYS A NZ  
1059 N N   . LYS A 132 ? 0.3398 0.2575 0.2550 0.0317  0.0063  -0.0130 139 LYS A N   
1060 C CA  . LYS A 132 ? 0.3580 0.2742 0.2732 0.0320  0.0049  -0.0139 139 LYS A CA  
1061 C C   . LYS A 132 ? 0.3424 0.2575 0.2574 0.0307  0.0047  -0.0124 139 LYS A C   
1062 O O   . LYS A 132 ? 0.3531 0.2671 0.2686 0.0307  0.0034  -0.0126 139 LYS A O   
1063 C CB  . LYS A 132 ? 0.3943 0.3093 0.3120 0.0326  0.0032  -0.0149 139 LYS A CB  
1064 C CG  . LYS A 132 ? 0.4518 0.3675 0.3698 0.0342  0.0034  -0.0168 139 LYS A CG  
1065 C CD  . LYS A 132 ? 0.5872 0.5012 0.5076 0.0348  0.0016  -0.0180 139 LYS A CD  
1066 C CE  . LYS A 132 ? 0.6338 0.5479 0.5575 0.0343  0.0010  -0.0170 139 LYS A CE  
1067 N NZ  . LYS A 132 ? 0.6783 0.5912 0.6047 0.0353  -0.0005 -0.0185 139 LYS A NZ  
1068 N N   . THR A 133 ? 0.3517 0.2671 0.2660 0.0296  0.0060  -0.0108 140 THR A N   
1069 C CA  . THR A 133 ? 0.3734 0.2879 0.2875 0.0286  0.0063  -0.0094 140 THR A CA  
1070 C C   . THR A 133 ? 0.3887 0.3039 0.3012 0.0287  0.0072  -0.0092 140 THR A C   
1071 O O   . THR A 133 ? 0.4095 0.3261 0.3204 0.0292  0.0080  -0.0096 140 THR A O   
1072 C CB  . THR A 133 ? 0.3968 0.3105 0.3106 0.0272  0.0073  -0.0078 140 THR A CB  
1073 O OG1 . THR A 133 ? 0.4104 0.3252 0.3224 0.0270  0.0088  -0.0074 140 THR A OG1 
1074 C CG2 . THR A 133 ? 0.4130 0.3258 0.3283 0.0269  0.0062  -0.0079 140 THR A CG2 
1075 N N   . MET A 134 ? 0.3850 0.2992 0.2984 0.0281  0.0069  -0.0083 141 MET A N   
1076 C CA  . MET A 134 ? 0.4439 0.3586 0.3567 0.0282  0.0072  -0.0078 141 MET A CA  
1077 C C   . MET A 134 ? 0.4315 0.3454 0.3452 0.0271  0.0085  -0.0060 141 MET A C   
1078 O O   . MET A 134 ? 0.4394 0.3531 0.3542 0.0270  0.0081  -0.0053 141 MET A O   
1079 C CB  . MET A 134 ? 0.4985 0.4125 0.4122 0.0286  0.0053  -0.0084 141 MET A CB  
1080 C CG  . MET A 134 ? 0.5432 0.4574 0.4557 0.0297  0.0039  -0.0104 141 MET A CG  
1081 S SD  . MET A 134 ? 0.6516 0.5648 0.5642 0.0298  0.0017  -0.0107 141 MET A SD  
1082 C CE  . MET A 134 ? 0.5894 0.5009 0.5058 0.0292  0.0001  -0.0098 141 MET A CE  
1083 N N   . GLY A 135 ? 0.3418 0.2551 0.2548 0.0264  0.0099  -0.0052 142 GLY A N   
1084 C CA  . GLY A 135 ? 0.3613 0.2737 0.2746 0.0255  0.0115  -0.0037 142 GLY A CA  
1085 C C   . GLY A 135 ? 0.3664 0.2770 0.2813 0.0248  0.0116  -0.0028 142 GLY A C   
1086 O O   . GLY A 135 ? 0.3920 0.3023 0.3084 0.0250  0.0100  -0.0033 142 GLY A O   
1087 N N1  . 4OO A 136 ? 0.4908 0.3940 0.3950 0.0196  0.0144  -0.0007 143 4OO A N1  
1088 N N2  . 4OO A 136 ? 0.6921 0.5944 0.5967 0.0191  0.0131  -0.0006 143 4OO A N2  
1089 N N3  . 4OO A 136 ? 0.6841 0.5853 0.5891 0.0184  0.0116  -0.0003 143 4OO A N3  
1090 C C   . 4OO A 136 ? 0.4355 0.3429 0.3545 0.0234  0.0141  0.0003  143 4OO A C   
1091 O O   . 4OO A 136 ? 0.4515 0.3597 0.3715 0.0237  0.0146  0.0008  143 4OO A O   
1092 C CA  . 4OO A 136 ? 0.4029 0.3103 0.3186 0.0232  0.0140  -0.0006 143 4OO A CA  
1093 N N   . 4OO A 136 ? 0.3641 0.2735 0.2787 0.0240  0.0135  -0.0016 143 4OO A N   
1094 C CB  . 4OO A 136 ? 0.3976 0.3034 0.3111 0.0223  0.0164  0.0002  143 4OO A CB  
1095 C CG  . 4OO A 136 ? 0.4159 0.3209 0.3265 0.0217  0.0161  -0.0002 143 4OO A CG  
1096 C CD2 . 4OO A 136 ? 0.3759 0.2818 0.2844 0.0218  0.0164  -0.0007 143 4OO A CD2 
1097 C CE2 . 4OO A 136 ? 0.4050 0.3103 0.3114 0.0212  0.0160  -0.0009 143 4OO A CE2 
1098 C CZ  . 4OO A 136 ? 0.4266 0.3303 0.3327 0.0204  0.0151  -0.0007 143 4OO A CZ  
1099 C CE1 . 4OO A 136 ? 0.4339 0.3367 0.3418 0.0202  0.0148  -0.0003 143 4OO A CE1 
1100 C CD1 . 4OO A 136 ? 0.4143 0.3178 0.3246 0.0209  0.0153  -0.0001 143 4OO A CD1 
1101 N N   . GLU A 137 ? 0.4079 0.3144 0.3288 0.0231  0.0133  0.0008  144 GLU A N   
1102 C CA  . GLU A 137 ? 0.4283 0.3343 0.3525 0.0229  0.0140  0.0022  144 GLU A CA  
1103 C C   . GLU A 137 ? 0.4018 0.3064 0.3249 0.0223  0.0172  0.0033  144 GLU A C   
1104 O O   . GLU A 137 ? 0.4116 0.3149 0.3311 0.0216  0.0184  0.0030  144 GLU A O   
1105 C CB  . GLU A 137 ? 0.4360 0.3414 0.3626 0.0227  0.0124  0.0026  144 GLU A CB  
1106 C CG  . GLU A 137 ? 0.4772 0.3835 0.4049 0.0234  0.0092  0.0013  144 GLU A CG  
1107 C CD  . GLU A 137 ? 0.5227 0.4301 0.4530 0.0240  0.0077  0.0015  144 GLU A CD  
1108 O OE1 . GLU A 137 ? 0.5502 0.4580 0.4817 0.0240  0.0092  0.0026  144 GLU A OE1 
1109 O OE2 . GLU A 137 ? 0.5622 0.4698 0.4932 0.0245  0.0051  0.0005  144 GLU A OE2 
1110 N N   . ALA A 138 ? 0.3917 0.2963 0.3178 0.0223  0.0185  0.0047  145 ALA A N   
1111 C CA  . ALA A 138 ? 0.3931 0.2960 0.3187 0.0218  0.0219  0.0058  145 ALA A CA  
1112 C C   . ALA A 138 ? 0.3513 0.2521 0.2753 0.0209  0.0226  0.0061  145 ALA A C   
1113 O O   . ALA A 138 ? 0.3848 0.2859 0.3106 0.0208  0.0207  0.0062  145 ALA A O   
1114 C CB  . ALA A 138 ? 0.3838 0.2872 0.3142 0.0221  0.0231  0.0074  145 ALA A CB  
1115 N N   . SER A 139 ? 0.3654 0.2640 0.2859 0.0202  0.0253  0.0063  146 SER A N   
1116 C CA  . SER A 139 ? 0.3975 0.2937 0.3149 0.0190  0.0258  0.0064  146 SER A CA  
1117 C C   . SER A 139 ? 0.3419 0.2356 0.2585 0.0184  0.0295  0.0075  146 SER A C   
1118 O O   . SER A 139 ? 0.3698 0.2635 0.2872 0.0189  0.0317  0.0079  146 SER A O   
1119 C CB  . SER A 139 ? 0.4270 0.3220 0.3390 0.0184  0.0257  0.0053  146 SER A CB  
1120 O OG  . SER A 139 ? 0.5641 0.4603 0.4758 0.0185  0.0227  0.0044  146 SER A OG  
1121 N N   . SER A 140 ? 0.3423 0.2338 0.2567 0.0173  0.0302  0.0080  147 SER A N   
1122 C CA  . SER A 140 ? 0.3260 0.2145 0.2381 0.0166  0.0340  0.0089  147 SER A CA  
1123 C C   . SER A 140 ? 0.3212 0.2065 0.2267 0.0151  0.0342  0.0085  147 SER A C   
1124 O O   . SER A 140 ? 0.3665 0.2518 0.2714 0.0144  0.0317  0.0084  147 SER A O   
1125 C CB  . SER A 140 ? 0.3969 0.2856 0.3135 0.0168  0.0353  0.0105  147 SER A CB  
1126 O OG  . SER A 140 ? 0.5001 0.3855 0.4136 0.0158  0.0388  0.0113  147 SER A OG  
1127 N N   . GLU A 141 ? 0.3163 0.1988 0.2171 0.0145  0.0367  0.0081  148 GLU A N   
1128 C CA  . GLU A 141 ? 0.3288 0.2076 0.2227 0.0129  0.0368  0.0077  148 GLU A CA  
1129 C C   . GLU A 141 ? 0.3207 0.1962 0.2126 0.0120  0.0403  0.0088  148 GLU A C   
1130 O O   . GLU A 141 ? 0.3454 0.2195 0.2374 0.0125  0.0440  0.0091  148 GLU A O   
1131 C CB  . GLU A 141 ? 0.3260 0.2034 0.2157 0.0126  0.0374  0.0067  148 GLU A CB  
1132 C CG  . GLU A 141 ? 0.3461 0.2203 0.2292 0.0109  0.0362  0.0064  148 GLU A CG  
1133 C CD  . GLU A 141 ? 0.3996 0.2728 0.2791 0.0106  0.0358  0.0055  148 GLU A CD  
1134 O OE1 . GLU A 141 ? 0.4714 0.3459 0.3527 0.0117  0.0370  0.0050  148 GLU A OE1 
1135 O OE2 . GLU A 141 ? 0.4032 0.2745 0.2783 0.0091  0.0341  0.0053  148 GLU A OE2 
1136 N N   . ARG A 142 ? 0.3212 0.1951 0.2108 0.0106  0.0394  0.0094  149 ARG A N   
1137 C CA  . ARG A 142 ? 0.3445 0.2146 0.2307 0.0095  0.0428  0.0104  149 ARG A CA  
1138 C C   . ARG A 142 ? 0.3393 0.2045 0.2169 0.0079  0.0441  0.0097  149 ARG A C   
1139 O O   . ARG A 142 ? 0.3264 0.1907 0.2004 0.0067  0.0410  0.0093  149 ARG A O   
1140 C CB  . ARG A 142 ? 0.3835 0.2541 0.2713 0.0087  0.0409  0.0115  149 ARG A CB  
1141 C CG  . ARG A 142 ? 0.4838 0.3588 0.3800 0.0102  0.0396  0.0123  149 ARG A CG  
1142 C CD  . ARG A 142 ? 0.5391 0.4145 0.4373 0.0094  0.0378  0.0135  149 ARG A CD  
1143 N NE  . ARG A 142 ? 0.6562 0.5287 0.5524 0.0084  0.0415  0.0149  149 ARG A NE  
1144 C CZ  . ARG A 142 ? 0.6960 0.5684 0.5937 0.0076  0.0410  0.0164  149 ARG A CZ  
1145 N NH1 . ARG A 142 ? 0.7137 0.5885 0.6150 0.0076  0.0369  0.0167  149 ARG A NH1 
1146 N NH2 . ARG A 142 ? 0.7561 0.6256 0.6515 0.0067  0.0449  0.0177  149 ARG A NH2 
1147 N N   . MET A 143 ? 0.3120 0.1740 0.1866 0.0079  0.0483  0.0096  150 MET A N   
1148 C CA  . MET A 143 ? 0.3368 0.1940 0.2032 0.0065  0.0496  0.0088  150 MET A CA  
1149 C C   . MET A 143 ? 0.3423 0.1947 0.2031 0.0048  0.0525  0.0096  150 MET A C   
1150 O O   . MET A 143 ? 0.3356 0.1882 0.1993 0.0055  0.0556  0.0105  150 MET A O   
1151 C CB  . MET A 143 ? 0.3546 0.2109 0.2208 0.0076  0.0526  0.0080  150 MET A CB  
1152 C CG  . MET A 143 ? 0.3676 0.2288 0.2404 0.0094  0.0509  0.0075  150 MET A CG  
1153 S SD  . MET A 143 ? 0.3950 0.2587 0.2672 0.0091  0.0456  0.0066  150 MET A SD  
1154 C CE  . MET A 143 ? 0.3693 0.2272 0.2320 0.0072  0.0463  0.0058  150 MET A CE  
1155 N N   . TYR A 144 ? 0.3365 0.1844 0.1889 0.0028  0.0516  0.0092  151 TYR A N   
1156 C CA  . TYR A 144 ? 0.3591 0.2013 0.2043 0.0010  0.0547  0.0097  151 TYR A CA  
1157 C C   . TYR A 144 ? 0.3475 0.1843 0.1831 -0.0010 0.0541  0.0088  151 TYR A C   
1158 O O   . TYR A 144 ? 0.3386 0.1762 0.1733 -0.0016 0.0500  0.0084  151 TYR A O   
1159 C CB  . TYR A 144 ? 0.3541 0.1970 0.2002 0.0000  0.0532  0.0112  151 TYR A CB  
1160 C CG  . TYR A 144 ? 0.3551 0.1992 0.2007 -0.0013 0.0477  0.0114  151 TYR A CG  
1161 C CD1 . TYR A 144 ? 0.3611 0.2109 0.2142 0.0000  0.0440  0.0113  151 TYR A CD1 
1162 C CD2 . TYR A 144 ? 0.3795 0.2190 0.2170 -0.0039 0.0462  0.0116  151 TYR A CD2 
1163 C CE1 . TYR A 144 ? 0.3915 0.2425 0.2447 -0.0008 0.0393  0.0115  151 TYR A CE1 
1164 C CE2 . TYR A 144 ? 0.3815 0.2224 0.2194 -0.0049 0.0409  0.0120  151 TYR A CE2 
1165 C CZ  . TYR A 144 ? 0.4051 0.2519 0.2513 -0.0033 0.0377  0.0119  151 TYR A CZ  
1166 O OH  . TYR A 144 ? 0.4680 0.3169 0.3161 -0.0038 0.0328  0.0121  151 TYR A OH  
1167 N N   . PRO A 145 ? 0.3605 0.1913 0.1888 -0.0021 0.0581  0.0086  152 PRO A N   
1168 C CA  . PRO A 145 ? 0.3580 0.1829 0.1764 -0.0043 0.0574  0.0078  152 PRO A CA  
1169 C C   . PRO A 145 ? 0.3830 0.2052 0.1959 -0.0070 0.0544  0.0088  152 PRO A C   
1170 O O   . PRO A 145 ? 0.3731 0.1960 0.1874 -0.0073 0.0551  0.0101  152 PRO A O   
1171 C CB  . PRO A 145 ? 0.3736 0.1932 0.1867 -0.0043 0.0632  0.0072  152 PRO A CB  
1172 C CG  . PRO A 145 ? 0.3623 0.1839 0.1803 -0.0033 0.0666  0.0085  152 PRO A CG  
1173 C CD  . PRO A 145 ? 0.3514 0.1808 0.1804 -0.0013 0.0637  0.0091  152 PRO A CD  
1174 N N   . GLU A 146 ? 0.3822 0.2019 0.1896 -0.0088 0.0508  0.0085  153 GLU A N   
1175 C CA  . GLU A 146 ? 0.4124 0.2294 0.2146 -0.0116 0.0473  0.0096  153 GLU A CA  
1176 C C   . GLU A 146 ? 0.4532 0.2654 0.2474 -0.0138 0.0447  0.0091  153 GLU A C   
1177 O O   . GLU A 146 ? 0.4465 0.2611 0.2435 -0.0130 0.0422  0.0084  153 GLU A O   
1178 C CB  . GLU A 146 ? 0.4281 0.2510 0.2380 -0.0111 0.0429  0.0108  153 GLU A CB  
1179 C CG  . GLU A 146 ? 0.4634 0.2836 0.2686 -0.0140 0.0392  0.0122  153 GLU A CG  
1180 C CD  . GLU A 146 ? 0.4941 0.3200 0.3073 -0.0134 0.0351  0.0133  153 GLU A CD  
1181 O OE1 . GLU A 146 ? 0.5119 0.3433 0.3328 -0.0113 0.0331  0.0126  153 GLU A OE1 
1182 O OE2 . GLU A 146 ? 0.5079 0.3329 0.3200 -0.0150 0.0337  0.0148  153 GLU A OE2 
1183 N N   . ASP A 147 ? 0.4918 0.2972 0.2761 -0.0166 0.0454  0.0095  154 ASP A N   
1184 C CA  . ASP A 147 ? 0.5416 0.3412 0.3170 -0.0192 0.0428  0.0092  154 ASP A CA  
1185 C C   . ASP A 147 ? 0.4986 0.2972 0.2730 -0.0182 0.0437  0.0075  154 ASP A C   
1186 O O   . ASP A 147 ? 0.5300 0.3286 0.3038 -0.0191 0.0397  0.0075  154 ASP A O   
1187 C CB  . ASP A 147 ? 0.5939 0.3964 0.3723 -0.0204 0.0364  0.0104  154 ASP A CB  
1188 C CG  . ASP A 147 ? 0.6926 0.4893 0.4622 -0.0240 0.0342  0.0117  154 ASP A CG  
1189 O OD1 . ASP A 147 ? 0.7410 0.5318 0.5021 -0.0262 0.0331  0.0113  154 ASP A OD1 
1190 O OD2 . ASP A 147 ? 0.6998 0.4976 0.4709 -0.0246 0.0338  0.0131  154 ASP A OD2 
1191 N N   . GLY A 148 ? 0.4584 0.2559 0.2328 -0.0164 0.0490  0.0063  155 GLY A N   
1192 C CA  . GLY A 148 ? 0.4590 0.2540 0.2309 -0.0159 0.0505  0.0048  155 GLY A CA  
1193 C C   . GLY A 148 ? 0.4366 0.2387 0.2183 -0.0133 0.0488  0.0044  155 GLY A C   
1194 O O   . GLY A 148 ? 0.4645 0.2654 0.2449 -0.0130 0.0486  0.0034  155 GLY A O   
1195 N N   . ALA A 149 ? 0.4019 0.2110 0.1929 -0.0116 0.0472  0.0052  156 ALA A N   
1196 C CA  . ALA A 149 ? 0.3920 0.2079 0.1922 -0.0092 0.0455  0.0049  156 ALA A CA  
1197 C C   . ALA A 149 ? 0.3801 0.2019 0.1893 -0.0067 0.0474  0.0053  156 ALA A C   
1198 O O   . ALA A 149 ? 0.3767 0.1976 0.1855 -0.0069 0.0496  0.0059  156 ALA A O   
1199 C CB  . ALA A 149 ? 0.3924 0.2114 0.1949 -0.0101 0.0397  0.0056  156 ALA A CB  
1200 N N   . LEU A 150 ? 0.3607 0.1884 0.1779 -0.0045 0.0465  0.0049  157 LEU A N   
1201 C CA  . LEU A 150 ? 0.3550 0.1882 0.1810 -0.0020 0.0480  0.0052  157 LEU A CA  
1202 C C   . LEU A 150 ? 0.3523 0.1911 0.1846 -0.0016 0.0436  0.0059  157 LEU A C   
1203 O O   . LEU A 150 ? 0.3741 0.2150 0.2077 -0.0015 0.0403  0.0056  157 LEU A O   
1204 C CB  . LEU A 150 ? 0.3699 0.2053 0.2004 0.0001  0.0505  0.0043  157 LEU A CB  
1205 C CG  . LEU A 150 ? 0.3750 0.2160 0.2148 0.0026  0.0519  0.0048  157 LEU A CG  
1206 C CD1 . LEU A 150 ? 0.4114 0.2507 0.2510 0.0025  0.0554  0.0056  157 LEU A CD1 
1207 C CD2 . LEU A 150 ? 0.3972 0.2397 0.2406 0.0044  0.0541  0.0041  157 LEU A CD2 
1208 N N   . LYS A 151 ? 0.3350 0.1760 0.1709 -0.0013 0.0434  0.0068  158 LYS A N   
1209 C CA  . LYS A 151 ? 0.3280 0.1744 0.1703 -0.0007 0.0392  0.0074  158 LYS A CA  
1210 C C   . LYS A 151 ? 0.3210 0.1729 0.1721 0.0018  0.0400  0.0074  158 LYS A C   
1211 O O   . LYS A 151 ? 0.3230 0.1747 0.1759 0.0027  0.0435  0.0076  158 LYS A O   
1212 C CB  . LYS A 151 ? 0.3633 0.2087 0.2044 -0.0023 0.0373  0.0086  158 LYS A CB  
1213 C CG  . LYS A 151 ? 0.4102 0.2493 0.2418 -0.0051 0.0371  0.0089  158 LYS A CG  
1214 C CD  . LYS A 151 ? 0.4130 0.2517 0.2424 -0.0060 0.0334  0.0085  158 LYS A CD  
1215 C CE  . LYS A 151 ? 0.4477 0.2798 0.2675 -0.0093 0.0323  0.0091  158 LYS A CE  
1216 N NZ  . LYS A 151 ? 0.4677 0.3006 0.2885 -0.0106 0.0288  0.0105  158 LYS A NZ  
1217 N N   . GLY A 152 ? 0.3230 0.1796 0.1795 0.0027  0.0365  0.0072  159 GLY A N   
1218 C CA  . GLY A 152 ? 0.3031 0.1650 0.1678 0.0050  0.0364  0.0072  159 GLY A CA  
1219 C C   . GLY A 152 ? 0.3122 0.1775 0.1811 0.0052  0.0324  0.0075  159 GLY A C   
1220 O O   . GLY A 152 ? 0.3205 0.1860 0.1879 0.0044  0.0292  0.0073  159 GLY A O   
1221 N N   . GLU A 153 ? 0.2943 0.1624 0.1688 0.0062  0.0325  0.0081  160 GLU A N   
1222 C CA  . GLU A 153 ? 0.3112 0.1825 0.1901 0.0066  0.0289  0.0084  160 GLU A CA  
1223 C C   . GLU A 153 ? 0.3079 0.1838 0.1941 0.0088  0.0286  0.0080  160 GLU A C   
1224 O O   . GLU A 153 ? 0.3210 0.1974 0.2097 0.0097  0.0312  0.0084  160 GLU A O   
1225 C CB  . GLU A 153 ? 0.3620 0.2317 0.2404 0.0053  0.0286  0.0097  160 GLU A CB  
1226 C CG  . GLU A 153 ? 0.3984 0.2637 0.2697 0.0029  0.0279  0.0102  160 GLU A CG  
1227 C CD  . GLU A 153 ? 0.4823 0.3454 0.3522 0.0014  0.0281  0.0116  160 GLU A CD  
1228 O OE1 . GLU A 153 ? 0.5351 0.3943 0.3987 -0.0008 0.0275  0.0122  160 GLU A OE1 
1229 O OE2 . GLU A 153 ? 0.5443 0.4092 0.4187 0.0022  0.0293  0.0123  160 GLU A OE2 
1230 N N   . ILE A 154 ? 0.3186 0.1977 0.2079 0.0097  0.0254  0.0073  161 ILE A N   
1231 C CA  . ILE A 154 ? 0.3248 0.2080 0.2204 0.0116  0.0245  0.0068  161 ILE A CA  
1232 C C   . ILE A 154 ? 0.3481 0.2336 0.2471 0.0120  0.0208  0.0066  161 ILE A C   
1233 O O   . ILE A 154 ? 0.3423 0.2275 0.2394 0.0113  0.0186  0.0062  161 ILE A O   
1234 C CB  . ILE A 154 ? 0.3888 0.2739 0.2849 0.0128  0.0245  0.0057  161 ILE A CB  
1235 C CG1 . ILE A 154 ? 0.4463 0.3288 0.3381 0.0123  0.0273  0.0057  161 ILE A CG1 
1236 C CG2 . ILE A 154 ? 0.3575 0.2461 0.2595 0.0146  0.0242  0.0056  161 ILE A CG2 
1237 C CD1 . ILE A 154 ? 0.4499 0.3341 0.3415 0.0130  0.0267  0.0047  161 ILE A CD1 
1238 N N   . LYS A 155 ? 0.3498 0.2376 0.2539 0.0131  0.0201  0.0068  162 LYS A N   
1239 C CA  . LYS A 155 ? 0.4040 0.2944 0.3120 0.0140  0.0166  0.0061  162 LYS A CA  
1240 C C   . LYS A 155 ? 0.4038 0.2970 0.3142 0.0156  0.0164  0.0050  162 LYS A C   
1241 O O   . LYS A 155 ? 0.4470 0.3410 0.3599 0.0164  0.0178  0.0054  162 LYS A O   
1242 C CB  . LYS A 155 ? 0.4524 0.3432 0.3643 0.0140  0.0158  0.0071  162 LYS A CB  
1243 C CG  . LYS A 155 ? 0.5403 0.4285 0.4506 0.0126  0.0179  0.0087  162 LYS A CG  
1244 C CD  . LYS A 155 ? 0.5925 0.4796 0.5026 0.0114  0.0157  0.0094  162 LYS A CD  
1245 C CE  . LYS A 155 ? 0.6579 0.5436 0.5687 0.0105  0.0176  0.0112  162 LYS A CE  
1246 N NZ  . LYS A 155 ? 0.7261 0.6103 0.6359 0.0090  0.0156  0.0121  162 LYS A NZ  
1247 N N   . GLN A 156 ? 0.4014 0.2957 0.3107 0.0161  0.0150  0.0038  163 GLN A N   
1248 C CA  . GLN A 156 ? 0.3968 0.2935 0.3075 0.0175  0.0149  0.0028  163 GLN A CA  
1249 C C   . GLN A 156 ? 0.3825 0.2814 0.2967 0.0186  0.0122  0.0019  163 GLN A C   
1250 O O   . GLN A 156 ? 0.3388 0.2376 0.2536 0.0184  0.0101  0.0017  163 GLN A O   
1251 C CB  . GLN A 156 ? 0.3918 0.2889 0.2995 0.0175  0.0149  0.0020  163 GLN A CB  
1252 C CG  . GLN A 156 ? 0.4239 0.3187 0.3274 0.0164  0.0172  0.0025  163 GLN A CG  
1253 C CD  . GLN A 156 ? 0.5153 0.4104 0.4192 0.0171  0.0196  0.0026  163 GLN A CD  
1254 O OE1 . GLN A 156 ? 0.5037 0.4001 0.4110 0.0179  0.0199  0.0029  163 GLN A OE1 
1255 N NE2 . GLN A 156 ? 0.5789 0.4728 0.4795 0.0166  0.0211  0.0026  163 GLN A NE2 
1256 N N   . ARG A 157 ? 0.3730 0.2738 0.2896 0.0199  0.0121  0.0014  164 ARG A N   
1257 C CA  . ARG A 157 ? 0.3674 0.2700 0.2866 0.0210  0.0095  0.0003  164 ARG A CA  
1258 C C   . ARG A 157 ? 0.3484 0.2529 0.2669 0.0220  0.0095  -0.0008 164 ARG A C   
1259 O O   . ARG A 157 ? 0.3722 0.2771 0.2906 0.0222  0.0111  -0.0003 164 ARG A O   
1260 C CB  . ARG A 157 ? 0.3727 0.2756 0.2957 0.0214  0.0087  0.0009  164 ARG A CB  
1261 C CG  . ARG A 157 ? 0.4662 0.3675 0.3904 0.0203  0.0092  0.0024  164 ARG A CG  
1262 C CD  . ARG A 157 ? 0.5220 0.4238 0.4505 0.0207  0.0073  0.0028  164 ARG A CD  
1263 N NE  . ARG A 157 ? 0.5427 0.4446 0.4721 0.0210  0.0043  0.0017  164 ARG A NE  
1264 C CZ  . ARG A 157 ? 0.6042 0.5064 0.5369 0.0215  0.0020  0.0016  164 ARG A CZ  
1265 N NH1 . ARG A 157 ? 0.5679 0.4704 0.5037 0.0216  0.0019  0.0027  164 ARG A NH1 
1266 N NH2 . ARG A 157 ? 0.6485 0.5505 0.5817 0.0218  -0.0004 0.0005  164 ARG A NH2 
1267 N N   . LEU A 158 ? 0.3238 0.2292 0.2419 0.0227  0.0079  -0.0021 165 LEU A N   
1268 C CA  . LEU A 158 ? 0.3355 0.2427 0.2529 0.0237  0.0078  -0.0033 165 LEU A CA  
1269 C C   . LEU A 158 ? 0.3332 0.2412 0.2528 0.0248  0.0058  -0.0043 165 LEU A C   
1270 O O   . LEU A 158 ? 0.3377 0.2453 0.2589 0.0250  0.0040  -0.0047 165 LEU A O   
1271 C CB  . LEU A 158 ? 0.3399 0.2477 0.2557 0.0239  0.0075  -0.0040 165 LEU A CB  
1272 C CG  . LEU A 158 ? 0.4333 0.3418 0.3466 0.0236  0.0091  -0.0039 165 LEU A CG  
1273 C CD1 . LEU A 158 ? 0.4432 0.3515 0.3553 0.0233  0.0111  -0.0031 165 LEU A CD1 
1274 C CD2 . LEU A 158 ? 0.4040 0.3120 0.3160 0.0229  0.0089  -0.0037 165 LEU A CD2 
1275 N N   . LYS A 159 ? 0.3540 0.2632 0.2735 0.0255  0.0061  -0.0045 166 LYS A N   
1276 C CA  . LYS A 159 ? 0.3684 0.2781 0.2890 0.0264  0.0040  -0.0057 166 LYS A CA  
1277 C C   . LYS A 159 ? 0.3378 0.2482 0.2570 0.0274  0.0032  -0.0076 166 LYS A C   
1278 O O   . LYS A 159 ? 0.3527 0.2642 0.2700 0.0275  0.0045  -0.0078 166 LYS A O   
1279 C CB  . LYS A 159 ? 0.3731 0.2834 0.2936 0.0266  0.0044  -0.0053 166 LYS A CB  
1280 C CG  . LYS A 159 ? 0.4319 0.3416 0.3545 0.0258  0.0054  -0.0034 166 LYS A CG  
1281 C CD  . LYS A 159 ? 0.4848 0.3953 0.4080 0.0260  0.0056  -0.0027 166 LYS A CD  
1282 C CE  . LYS A 159 ? 0.5366 0.4478 0.4584 0.0257  0.0080  -0.0019 166 LYS A CE  
1283 N NZ  . LYS A 159 ? 0.5993 0.5104 0.5234 0.0254  0.0088  -0.0003 166 LYS A NZ  
1284 N N   . LEU A 160 ? 0.3369 0.2468 0.2572 0.0281  0.0011  -0.0088 167 LEU A N   
1285 C CA  . LEU A 160 ? 0.3272 0.2377 0.2466 0.0292  0.0005  -0.0107 167 LEU A CA  
1286 C C   . LEU A 160 ? 0.3689 0.2798 0.2867 0.0301  0.0000  -0.0120 167 LEU A C   
1287 O O   . LEU A 160 ? 0.3780 0.2880 0.2966 0.0299  -0.0014 -0.0117 167 LEU A O   
1288 C CB  . LEU A 160 ? 0.3554 0.2648 0.2769 0.0294  -0.0012 -0.0114 167 LEU A CB  
1289 C CG  . LEU A 160 ? 0.3642 0.2733 0.2867 0.0285  -0.0006 -0.0102 167 LEU A CG  
1290 C CD1 . LEU A 160 ? 0.3832 0.2911 0.3082 0.0285  -0.0026 -0.0105 167 LEU A CD1 
1291 C CD2 . LEU A 160 ? 0.4029 0.3132 0.3238 0.0286  0.0008  -0.0104 167 LEU A CD2 
1292 N N   . LYS A 161 ? 0.4129 0.3248 0.3285 0.0310  0.0007  -0.0133 168 LYS A N   
1293 C CA  . LYS A 161 ? 0.4593 0.3711 0.3727 0.0318  0.0000  -0.0147 168 LYS A CA  
1294 C C   . LYS A 161 ? 0.4964 0.4064 0.4105 0.0323  -0.0023 -0.0160 168 LYS A C   
1295 O O   . LYS A 161 ? 0.5093 0.4183 0.4220 0.0323  -0.0036 -0.0164 168 LYS A O   
1296 C CB  . LYS A 161 ? 0.4686 0.3819 0.3797 0.0328  0.0015  -0.0160 168 LYS A CB  
1297 C CG  . LYS A 161 ? 0.5096 0.4248 0.4195 0.0323  0.0036  -0.0148 168 LYS A CG  
1298 C CD  . LYS A 161 ? 0.5577 0.4744 0.4655 0.0333  0.0050  -0.0160 168 LYS A CD  
1299 C CE  . LYS A 161 ? 0.5895 0.5080 0.4961 0.0328  0.0070  -0.0147 168 LYS A CE  
1300 N NZ  . LYS A 161 ? 0.5834 0.5023 0.4919 0.0319  0.0077  -0.0131 168 LYS A NZ  
1301 N N   . ASP A 162 ? 0.5195 0.4285 0.4357 0.0326  -0.0033 -0.0167 169 ASP A N   
1302 C CA  . ASP A 162 ? 0.5387 0.4457 0.4555 0.0331  -0.0057 -0.0181 169 ASP A CA  
1303 C C   . ASP A 162 ? 0.5133 0.4190 0.4328 0.0321  -0.0075 -0.0166 169 ASP A C   
1304 O O   . ASP A 162 ? 0.5595 0.4634 0.4802 0.0323  -0.0098 -0.0174 169 ASP A O   
1305 C CB  . ASP A 162 ? 0.6083 0.5149 0.5262 0.0342  -0.0059 -0.0198 169 ASP A CB  
1306 C CG  . ASP A 162 ? 0.6687 0.5762 0.5837 0.0356  -0.0043 -0.0217 169 ASP A CG  
1307 O OD1 . ASP A 162 ? 0.6231 0.5308 0.5347 0.0358  -0.0037 -0.0222 169 ASP A OD1 
1308 O OD2 . ASP A 162 ? 0.7296 0.6374 0.6458 0.0364  -0.0037 -0.0227 169 ASP A OD2 
1309 N N   . GLY A 163 ? 0.4711 0.3778 0.3916 0.0310  -0.0064 -0.0144 170 GLY A N   
1310 C CA  . GLY A 163 ? 0.4949 0.4008 0.4184 0.0300  -0.0075 -0.0125 170 GLY A CA  
1311 C C   . GLY A 163 ? 0.5002 0.4059 0.4261 0.0294  -0.0071 -0.0115 170 GLY A C   
1312 O O   . GLY A 163 ? 0.5308 0.4367 0.4566 0.0298  -0.0068 -0.0124 170 GLY A O   
1313 N N   . GLY A 164 ? 0.5027 0.4081 0.4310 0.0283  -0.0071 -0.0095 171 GLY A N   
1314 C CA  . GLY A 164 ? 0.4683 0.3734 0.3984 0.0275  -0.0065 -0.0082 171 GLY A CA  
1315 C C   . GLY A 164 ? 0.4142 0.3204 0.3423 0.0270  -0.0037 -0.0074 171 GLY A C   
1316 O O   . GLY A 164 ? 0.3616 0.2689 0.2876 0.0273  -0.0022 -0.0076 171 GLY A O   
1317 N N   . HIS A 165 ? 0.3736 0.2792 0.3023 0.0262  -0.0032 -0.0065 172 HIS A N   
1318 C CA  . HIS A 165 ? 0.3955 0.3014 0.3225 0.0253  -0.0007 -0.0053 172 HIS A CA  
1319 C C   . HIS A 165 ? 0.3517 0.2572 0.2781 0.0249  -0.0009 -0.0054 172 HIS A C   
1320 O O   . HIS A 165 ? 0.4008 0.3057 0.3290 0.0251  -0.0027 -0.0059 172 HIS A O   
1321 C CB  . HIS A 165 ? 0.4366 0.3416 0.3647 0.0242  0.0003  -0.0032 172 HIS A CB  
1322 C CG  . HIS A 165 ? 0.5095 0.4150 0.4386 0.0244  0.0008  -0.0026 172 HIS A CG  
1323 N ND1 . HIS A 165 ? 0.5594 0.4647 0.4915 0.0246  -0.0010 -0.0023 172 HIS A ND1 
1324 C CD2 . HIS A 165 ? 0.5264 0.4327 0.4542 0.0245  0.0027  -0.0022 172 HIS A CD2 
1325 C CE1 . HIS A 165 ? 0.5748 0.4807 0.5075 0.0247  -0.0003 -0.0016 172 HIS A CE1 
1326 N NE2 . HIS A 165 ? 0.5698 0.4764 0.5000 0.0247  0.0019  -0.0016 172 HIS A NE2 
1327 N N   . TYR A 166 ? 0.3498 0.2555 0.2738 0.0243  0.0009  -0.0049 173 TYR A N   
1328 C CA  . TYR A 166 ? 0.3110 0.2164 0.2341 0.0237  0.0009  -0.0047 173 TYR A CA  
1329 C C   . TYR A 166 ? 0.3134 0.2175 0.2345 0.0222  0.0028  -0.0029 173 TYR A C   
1330 O O   . TYR A 166 ? 0.3277 0.2320 0.2469 0.0221  0.0047  -0.0026 173 TYR A O   
1331 C CB  . TYR A 166 ? 0.3111 0.2180 0.2326 0.0246  0.0016  -0.0058 173 TYR A CB  
1332 C CG  . TYR A 166 ? 0.2967 0.2036 0.2175 0.0239  0.0016  -0.0055 173 TYR A CG  
1333 C CD1 . TYR A 166 ? 0.3006 0.2068 0.2233 0.0237  -0.0001 -0.0054 173 TYR A CD1 
1334 C CD2 . TYR A 166 ? 0.3192 0.2265 0.2375 0.0234  0.0033  -0.0050 173 TYR A CD2 
1335 C CE1 . TYR A 166 ? 0.3051 0.2113 0.2275 0.0230  -0.0003 -0.0049 173 TYR A CE1 
1336 C CE2 . TYR A 166 ? 0.3009 0.2081 0.2186 0.0228  0.0030  -0.0045 173 TYR A CE2 
1337 C CZ  . TYR A 166 ? 0.2948 0.2013 0.2146 0.0225  0.0012  -0.0043 173 TYR A CZ  
1338 O OH  . TYR A 166 ? 0.3073 0.2138 0.2270 0.0217  0.0007  -0.0036 173 TYR A OH  
1339 N N   . ASP A 167 ? 0.3270 0.2294 0.2483 0.0209  0.0022  -0.0018 174 ASP A N   
1340 C CA  . ASP A 167 ? 0.3363 0.2368 0.2553 0.0194  0.0040  -0.0001 174 ASP A CA  
1341 C C   . ASP A 167 ? 0.3191 0.2184 0.2352 0.0181  0.0043  0.0003  174 ASP A C   
1342 O O   . ASP A 167 ? 0.3111 0.2108 0.2279 0.0182  0.0026  0.0000  174 ASP A O   
1343 C CB  . ASP A 167 ? 0.3686 0.2678 0.2895 0.0186  0.0034  0.0009  174 ASP A CB  
1344 C CG  . ASP A 167 ? 0.4607 0.3609 0.3849 0.0196  0.0028  0.0007  174 ASP A CG  
1345 O OD1 . ASP A 167 ? 0.4665 0.3679 0.3906 0.0206  0.0038  0.0001  174 ASP A OD1 
1346 O OD2 . ASP A 167 ? 0.4843 0.3841 0.4112 0.0195  0.0012  0.0012  174 ASP A OD2 
1347 N N   . ALA A 168 ? 0.3046 0.2022 0.2174 0.0170  0.0065  0.0013  175 ALA A N   
1348 C CA  . ALA A 168 ? 0.2935 0.1890 0.2027 0.0154  0.0068  0.0022  175 ALA A CA  
1349 C C   . ALA A 168 ? 0.3006 0.1934 0.2073 0.0140  0.0087  0.0035  175 ALA A C   
1350 O O   . ALA A 168 ? 0.3394 0.2322 0.2463 0.0143  0.0107  0.0037  175 ALA A O   
1351 C CB  . ALA A 168 ? 0.2874 0.1834 0.1941 0.0155  0.0079  0.0017  175 ALA A CB  
1352 N N   . GLU A 169 ? 0.2894 0.1797 0.1933 0.0122  0.0081  0.0045  176 GLU A N   
1353 C CA  . GLU A 169 ? 0.2980 0.1851 0.1979 0.0105  0.0102  0.0057  176 GLU A CA  
1354 C C   . GLU A 169 ? 0.2924 0.1778 0.1875 0.0096  0.0114  0.0057  176 GLU A C   
1355 O O   . GLU A 169 ? 0.2963 0.1818 0.1907 0.0091  0.0094  0.0055  176 GLU A O   
1356 C CB  . GLU A 169 ? 0.3411 0.2260 0.2399 0.0088  0.0087  0.0070  176 GLU A CB  
1357 C CG  . GLU A 169 ? 0.3923 0.2785 0.2957 0.0093  0.0069  0.0073  176 GLU A CG  
1358 C CD  . GLU A 169 ? 0.4991 0.3831 0.4014 0.0074  0.0051  0.0087  176 GLU A CD  
1359 O OE1 . GLU A 169 ? 0.4806 0.3617 0.3781 0.0055  0.0049  0.0095  176 GLU A OE1 
1360 O OE2 . GLU A 169 ? 0.5546 0.4394 0.4606 0.0077  0.0036  0.0090  176 GLU A OE2 
1361 N N   . VAL A 170 ? 0.2724 0.1560 0.1645 0.0093  0.0144  0.0059  177 VAL A N   
1362 C CA  . VAL A 170 ? 0.2747 0.1565 0.1623 0.0086  0.0157  0.0057  177 VAL A CA  
1363 C C   . VAL A 170 ? 0.3025 0.1798 0.1847 0.0069  0.0180  0.0066  177 VAL A C   
1364 O O   . VAL A 170 ? 0.3112 0.1877 0.1938 0.0070  0.0203  0.0070  177 VAL A O   
1365 C CB  . VAL A 170 ? 0.2989 0.1828 0.1878 0.0102  0.0174  0.0047  177 VAL A CB  
1366 C CG1 . VAL A 170 ? 0.3112 0.1931 0.1956 0.0094  0.0184  0.0046  177 VAL A CG1 
1367 C CG2 . VAL A 170 ? 0.3348 0.2229 0.2286 0.0120  0.0154  0.0038  177 VAL A CG2 
1368 N N   . LYS A 171 ? 0.3014 0.1757 0.1784 0.0051  0.0175  0.0069  178 LYS A N   
1369 C CA  . LYS A 171 ? 0.2897 0.1593 0.1605 0.0034  0.0199  0.0075  178 LYS A CA  
1370 C C   . LYS A 171 ? 0.2758 0.1430 0.1417 0.0026  0.0204  0.0070  178 LYS A C   
1371 O O   . LYS A 171 ? 0.2624 0.1304 0.1284 0.0022  0.0177  0.0070  178 LYS A O   
1372 C CB  . LYS A 171 ? 0.3213 0.1876 0.1888 0.0012  0.0184  0.0087  178 LYS A CB  
1373 C CG  . LYS A 171 ? 0.3602 0.2212 0.2205 -0.0005 0.0213  0.0092  178 LYS A CG  
1374 C CD  . LYS A 171 ? 0.4393 0.2973 0.2966 -0.0027 0.0198  0.0107  178 LYS A CD  
1375 C CE  . LYS A 171 ? 0.4741 0.3265 0.3239 -0.0046 0.0229  0.0112  178 LYS A CE  
1376 N NZ  . LYS A 171 ? 0.5330 0.3831 0.3804 -0.0067 0.0208  0.0127  178 LYS A NZ  
1377 N N   . THR A 172 ? 0.2828 0.1473 0.1452 0.0025  0.0238  0.0068  179 THR A N   
1378 C CA  . THR A 172 ? 0.2859 0.1480 0.1439 0.0019  0.0245  0.0063  179 THR A CA  
1379 C C   . THR A 172 ? 0.3057 0.1619 0.1564 0.0001  0.0271  0.0065  179 THR A C   
1380 O O   . THR A 172 ? 0.3111 0.1661 0.1615 0.0003  0.0299  0.0068  179 THR A O   
1381 C CB  . THR A 172 ? 0.3009 0.1661 0.1626 0.0040  0.0264  0.0053  179 THR A CB  
1382 O OG1 . THR A 172 ? 0.3087 0.1792 0.1770 0.0057  0.0243  0.0051  179 THR A OG1 
1383 C CG2 . THR A 172 ? 0.3195 0.1831 0.1777 0.0035  0.0264  0.0049  179 THR A CG2 
1384 N N   . THR A 173 ? 0.3076 0.1601 0.1525 -0.0016 0.0261  0.0066  180 THR A N   
1385 C CA  . THR A 173 ? 0.3284 0.1746 0.1652 -0.0033 0.0286  0.0065  180 THR A CA  
1386 C C   . THR A 173 ? 0.3284 0.1738 0.1638 -0.0026 0.0302  0.0055  180 THR A C   
1387 O O   . THR A 173 ? 0.3348 0.1818 0.1712 -0.0028 0.0275  0.0055  180 THR A O   
1388 C CB  . THR A 173 ? 0.3544 0.1960 0.1847 -0.0063 0.0259  0.0074  180 THR A CB  
1389 O OG1 . THR A 173 ? 0.3639 0.2064 0.1958 -0.0069 0.0243  0.0084  180 THR A OG1 
1390 C CG2 . THR A 173 ? 0.3900 0.2247 0.2113 -0.0081 0.0284  0.0071  180 THR A CG2 
1391 N N   . TYR A 174 ? 0.3311 0.1741 0.1646 -0.0020 0.0344  0.0049  181 TYR A N   
1392 C CA  . TYR A 174 ? 0.3464 0.1881 0.1784 -0.0014 0.0364  0.0040  181 TYR A CA  
1393 C C   . TYR A 174 ? 0.3925 0.2265 0.2151 -0.0035 0.0384  0.0037  181 TYR A C   
1394 O O   . TYR A 174 ? 0.3918 0.2227 0.2113 -0.0040 0.0411  0.0038  181 TYR A O   
1395 C CB  . TYR A 174 ? 0.3702 0.2151 0.2081 0.0011  0.0398  0.0035  181 TYR A CB  
1396 C CG  . TYR A 174 ? 0.3555 0.2073 0.2021 0.0031  0.0381  0.0038  181 TYR A CG  
1397 C CD1 . TYR A 174 ? 0.3528 0.2066 0.2030 0.0036  0.0383  0.0044  181 TYR A CD1 
1398 C CD2 . TYR A 174 ? 0.3591 0.2153 0.2104 0.0044  0.0363  0.0035  181 TYR A CD2 
1399 C CE1 . TYR A 174 ? 0.3511 0.2107 0.2088 0.0053  0.0367  0.0046  181 TYR A CE1 
1400 C CE2 . TYR A 174 ? 0.3459 0.2077 0.2042 0.0061  0.0348  0.0036  181 TYR A CE2 
1401 C CZ  . TYR A 174 ? 0.3613 0.2247 0.2227 0.0066  0.0350  0.0041  181 TYR A CZ  
1402 O OH  . TYR A 174 ? 0.3695 0.2381 0.2376 0.0081  0.0332  0.0041  181 TYR A OH  
1403 N N   . LYS A 175 ? 0.3750 0.2059 0.1929 -0.0048 0.0369  0.0034  182 LYS A N   
1404 C CA  . LYS A 175 ? 0.3950 0.2181 0.2032 -0.0069 0.0386  0.0030  182 LYS A CA  
1405 C C   . LYS A 175 ? 0.4020 0.2227 0.2079 -0.0066 0.0400  0.0020  182 LYS A C   
1406 O O   . LYS A 175 ? 0.3786 0.2012 0.1862 -0.0067 0.0370  0.0021  182 LYS A O   
1407 C CB  . LYS A 175 ? 0.4415 0.2613 0.2441 -0.0097 0.0347  0.0039  182 LYS A CB  
1408 C CG  . LYS A 175 ? 0.4882 0.2991 0.2797 -0.0123 0.0362  0.0035  182 LYS A CG  
1409 C CD  . LYS A 175 ? 0.5394 0.3465 0.3249 -0.0151 0.0337  0.0046  182 LYS A CD  
1410 C CE  . LYS A 175 ? 0.5736 0.3716 0.3476 -0.0174 0.0361  0.0040  182 LYS A CE  
1411 N NZ  . LYS A 175 ? 0.6285 0.4225 0.3962 -0.0206 0.0325  0.0053  182 LYS A NZ  
1412 N N   . ALA A 176 ? 0.3981 0.2144 0.2001 -0.0063 0.0445  0.0010  183 ALA A N   
1413 C CA  . ALA A 176 ? 0.4084 0.2212 0.2072 -0.0062 0.0461  0.0000  183 ALA A CA  
1414 C C   . ALA A 176 ? 0.4390 0.2458 0.2292 -0.0091 0.0433  0.0000  183 ALA A C   
1415 O O   . ALA A 176 ? 0.4219 0.2243 0.2055 -0.0115 0.0420  0.0004  183 ALA A O   
1416 C CB  . ALA A 176 ? 0.4164 0.2252 0.2126 -0.0053 0.0519  -0.0010 183 ALA A CB  
1417 N N   . LYS A 177 ? 0.4357 0.2419 0.2256 -0.0091 0.0421  -0.0004 184 LYS A N   
1418 C CA  . LYS A 177 ? 0.4785 0.2787 0.2605 -0.0118 0.0393  -0.0003 184 LYS A CA  
1419 C C   . LYS A 177 ? 0.5196 0.3103 0.2905 -0.0137 0.0425  -0.0014 184 LYS A C   
1420 O O   . LYS A 177 ? 0.5903 0.3753 0.3532 -0.0165 0.0401  -0.0011 184 LYS A O   
1421 C CB  . LYS A 177 ? 0.4705 0.2731 0.2559 -0.0112 0.0373  -0.0003 184 LYS A CB  
1422 C CG  . LYS A 177 ? 0.4600 0.2712 0.2546 -0.0101 0.0336  0.0008  184 LYS A CG  
1423 C CD  . LYS A 177 ? 0.4799 0.2949 0.2798 -0.0087 0.0327  0.0008  184 LYS A CD  
1424 C CE  . LYS A 177 ? 0.4731 0.2956 0.2807 -0.0080 0.0289  0.0020  184 LYS A CE  
1425 N NZ  . LYS A 177 ? 0.4821 0.3086 0.2950 -0.0064 0.0287  0.0020  184 LYS A NZ  
1426 N N   . LYS A 178 ? 0.5364 0.3257 0.3074 -0.0120 0.0478  -0.0026 185 LYS A N   
1427 C CA  . LYS A 178 ? 0.6118 0.3924 0.3731 -0.0132 0.0518  -0.0038 185 LYS A CA  
1428 C C   . LYS A 178 ? 0.6023 0.3841 0.3654 -0.0119 0.0560  -0.0038 185 LYS A C   
1429 O O   . LYS A 178 ? 0.5513 0.3403 0.3242 -0.0094 0.0570  -0.0033 185 LYS A O   
1430 C CB  . LYS A 178 ? 0.6232 0.4007 0.3833 -0.0121 0.0546  -0.0053 185 LYS A CB  
1431 C CG  . LYS A 178 ? 0.6600 0.4414 0.4277 -0.0089 0.0595  -0.0059 185 LYS A CG  
1432 C CD  . LYS A 178 ? 0.7010 0.4857 0.4748 -0.0071 0.0592  -0.0062 185 LYS A CD  
1433 C CE  . LYS A 178 ? 0.7016 0.4887 0.4818 -0.0042 0.0643  -0.0068 185 LYS A CE  
1434 N NZ  . LYS A 178 ? 0.7314 0.5099 0.5034 -0.0046 0.0695  -0.0084 185 LYS A NZ  
1435 N N   . PRO A 179 ? 0.5437 0.3184 0.2975 -0.0137 0.0584  -0.0041 186 PRO A N   
1436 C CA  . PRO A 179 ? 0.5744 0.3510 0.3309 -0.0126 0.0620  -0.0037 186 PRO A CA  
1437 C C   . PRO A 179 ? 0.5749 0.3529 0.3366 -0.0097 0.0676  -0.0047 186 PRO A C   
1438 O O   . PRO A 179 ? 0.6449 0.4170 0.4011 -0.0098 0.0706  -0.0062 186 PRO A O   
1439 C CB  . PRO A 179 ? 0.5968 0.3646 0.3410 -0.0155 0.0633  -0.0039 186 PRO A CB  
1440 C CG  . PRO A 179 ? 0.5960 0.3562 0.3309 -0.0174 0.0626  -0.0052 186 PRO A CG  
1441 C CD  . PRO A 179 ? 0.6093 0.3745 0.3502 -0.0171 0.0574  -0.0046 186 PRO A CD  
1442 N N   . VAL A 180 ? 0.5115 0.2973 0.2840 -0.0072 0.0683  -0.0039 187 VAL A N   
1443 C CA  . VAL A 180 ? 0.4905 0.2784 0.2693 -0.0044 0.0735  -0.0044 187 VAL A CA  
1444 C C   . VAL A 180 ? 0.4911 0.2827 0.2747 -0.0035 0.0755  -0.0032 187 VAL A C   
1445 O O   . VAL A 180 ? 0.4790 0.2718 0.2614 -0.0049 0.0725  -0.0021 187 VAL A O   
1446 C CB  . VAL A 180 ? 0.5147 0.3088 0.3029 -0.0021 0.0724  -0.0044 187 VAL A CB  
1447 C CG1 . VAL A 180 ? 0.5008 0.2902 0.2841 -0.0026 0.0722  -0.0057 187 VAL A CG1 
1448 C CG2 . VAL A 180 ? 0.4746 0.2760 0.2694 -0.0019 0.0670  -0.0031 187 VAL A CG2 
1449 N N   . GLN A 181 ? 0.4861 0.2791 0.2749 -0.0012 0.0805  -0.0033 188 GLN A N   
1450 C CA  . GLN A 181 ? 0.4773 0.2719 0.2689 -0.0007 0.0833  -0.0022 188 GLN A CA  
1451 C C   . GLN A 181 ? 0.4464 0.2496 0.2477 0.0001  0.0794  -0.0005 188 GLN A C   
1452 O O   . GLN A 181 ? 0.4400 0.2492 0.2501 0.0021  0.0780  -0.0003 188 GLN A O   
1453 C CB  . GLN A 181 ? 0.5131 0.3075 0.3092 0.0015  0.0894  -0.0025 188 GLN A CB  
1454 C CG  . GLN A 181 ? 0.5675 0.3652 0.3688 0.0024  0.0918  -0.0010 188 GLN A CG  
1455 C CD  . GLN A 181 ? 0.6336 0.4284 0.4356 0.0038  0.0986  -0.0013 188 GLN A CD  
1456 O OE1 . GLN A 181 ? 0.7149 0.5045 0.5101 0.0027  0.1022  -0.0014 188 GLN A OE1 
1457 N NE2 . GLN A 181 ? 0.6392 0.4374 0.4495 0.0062  0.1005  -0.0014 188 GLN A NE2 
1458 N N   . LEU A 182 ? 0.4200 0.2232 0.2191 -0.0013 0.0779  0.0004  189 LEU A N   
1459 C CA  . LEU A 182 ? 0.4116 0.2220 0.2189 -0.0006 0.0745  0.0019  189 LEU A CA  
1460 C C   . LEU A 182 ? 0.4221 0.2359 0.2372 0.0015  0.0786  0.0029  189 LEU A C   
1461 O O   . LEU A 182 ? 0.4369 0.2464 0.2484 0.0014  0.0838  0.0028  189 LEU A O   
1462 C CB  . LEU A 182 ? 0.4134 0.2219 0.2149 -0.0031 0.0713  0.0028  189 LEU A CB  
1463 C CG  . LEU A 182 ? 0.4045 0.2123 0.2021 -0.0049 0.0657  0.0025  189 LEU A CG  
1464 C CD1 . LEU A 182 ? 0.4188 0.2224 0.2085 -0.0078 0.0635  0.0032  189 LEU A CD1 
1465 C CD2 . LEU A 182 ? 0.4066 0.2222 0.2135 -0.0035 0.0612  0.0030  189 LEU A CD2 
1466 N N   . PRO A 183 ? 0.3872 0.2084 0.2126 0.0032  0.0763  0.0038  190 PRO A N   
1467 C CA  . PRO A 183 ? 0.3835 0.2083 0.2166 0.0048  0.0790  0.0051  190 PRO A CA  
1468 C C   . PRO A 183 ? 0.3760 0.2010 0.2080 0.0035  0.0782  0.0064  190 PRO A C   
1469 O O   . PRO A 183 ? 0.3893 0.2124 0.2152 0.0013  0.0746  0.0065  190 PRO A O   
1470 C CB  . PRO A 183 ? 0.3824 0.2147 0.2257 0.0067  0.0756  0.0055  190 PRO A CB  
1471 C CG  . PRO A 183 ? 0.3895 0.2228 0.2300 0.0054  0.0701  0.0051  190 PRO A CG  
1472 C CD  . PRO A 183 ? 0.3910 0.2176 0.2211 0.0035  0.0707  0.0039  190 PRO A CD  
1473 N N   . GLY A 184 ? 0.3772 0.2051 0.2159 0.0048  0.0808  0.0078  191 GLY A N   
1474 C CA  . GLY A 184 ? 0.3639 0.1942 0.2048 0.0040  0.0787  0.0094  191 GLY A CA  
1475 C C   . GLY A 184 ? 0.3584 0.1953 0.2070 0.0047  0.0734  0.0100  191 GLY A C   
1476 O O   . GLY A 184 ? 0.3671 0.2062 0.2172 0.0053  0.0702  0.0090  191 GLY A O   
1477 N N   . ALA A 185 ? 0.3307 0.1708 0.1845 0.0048  0.0725  0.0116  192 ALA A N   
1478 C CA  . ALA A 185 ? 0.3263 0.1724 0.1875 0.0056  0.0676  0.0122  192 ALA A CA  
1479 C C   . ALA A 185 ? 0.3413 0.1919 0.2119 0.0081  0.0687  0.0124  192 ALA A C   
1480 O O   . ALA A 185 ? 0.3482 0.1983 0.2217 0.0090  0.0733  0.0132  192 ALA A O   
1481 C CB  . ALA A 185 ? 0.3206 0.1683 0.1843 0.0049  0.0661  0.0138  192 ALA A CB  
1482 N N   . TYR A 186 ? 0.3420 0.1968 0.2170 0.0091  0.0647  0.0118  193 TYR A N   
1483 C CA  . TYR A 186 ? 0.3301 0.1895 0.2141 0.0112  0.0648  0.0122  193 TYR A CA  
1484 C C   . TYR A 186 ? 0.3275 0.1913 0.2151 0.0117  0.0594  0.0117  193 TYR A C   
1485 O O   . TYR A 186 ? 0.3008 0.1643 0.1845 0.0105  0.0560  0.0111  193 TYR A O   
1486 C CB  . TYR A 186 ? 0.3617 0.2194 0.2452 0.0122  0.0683  0.0113  193 TYR A CB  
1487 C CG  . TYR A 186 ? 0.3422 0.1986 0.2209 0.0119  0.0665  0.0096  193 TYR A CG  
1488 C CD1 . TYR A 186 ? 0.3506 0.2023 0.2199 0.0101  0.0661  0.0086  193 TYR A CD1 
1489 C CD2 . TYR A 186 ? 0.3418 0.2018 0.2255 0.0133  0.0648  0.0092  193 TYR A CD2 
1490 C CE1 . TYR A 186 ? 0.3522 0.2027 0.2175 0.0097  0.0644  0.0072  193 TYR A CE1 
1491 C CE2 . TYR A 186 ? 0.3447 0.2035 0.2242 0.0130  0.0633  0.0078  193 TYR A CE2 
1492 C CZ  . TYR A 186 ? 0.3473 0.2015 0.2178 0.0112  0.0628  0.0068  193 TYR A CZ  
1493 O OH  . TYR A 186 ? 0.3702 0.2233 0.2368 0.0108  0.0611  0.0056  193 TYR A OH  
1494 N N   . ASN A 187 ? 0.3152 0.1835 0.2107 0.0135  0.0586  0.0120  194 ASN A N   
1495 C CA  . ASN A 187 ? 0.3369 0.2091 0.2356 0.0140  0.0537  0.0115  194 ASN A CA  
1496 C C   . ASN A 187 ? 0.3154 0.1894 0.2159 0.0151  0.0533  0.0106  194 ASN A C   
1497 O O   . ASN A 187 ? 0.3281 0.2013 0.2304 0.0159  0.0567  0.0109  194 ASN A O   
1498 C CB  . ASN A 187 ? 0.3737 0.2501 0.2801 0.0148  0.0516  0.0128  194 ASN A CB  
1499 C CG  . ASN A 187 ? 0.4737 0.3490 0.3795 0.0137  0.0517  0.0139  194 ASN A CG  
1500 O OD1 . ASN A 187 ? 0.5743 0.4477 0.4747 0.0123  0.0500  0.0134  194 ASN A OD1 
1501 N ND2 . ASN A 187 ? 0.5143 0.3908 0.4259 0.0143  0.0537  0.0156  194 ASN A ND2 
1502 N N   . VAL A 188 ? 0.3069 0.1827 0.2064 0.0151  0.0494  0.0096  195 VAL A N   
1503 C CA  . VAL A 188 ? 0.3212 0.1993 0.2229 0.0162  0.0485  0.0089  195 VAL A CA  
1504 C C   . VAL A 188 ? 0.3346 0.2174 0.2418 0.0171  0.0445  0.0090  195 VAL A C   
1505 O O   . VAL A 188 ? 0.3509 0.2348 0.2569 0.0166  0.0412  0.0084  195 VAL A O   
1506 C CB  . VAL A 188 ? 0.3283 0.2041 0.2234 0.0154  0.0479  0.0075  195 VAL A CB  
1507 C CG1 . VAL A 188 ? 0.3257 0.2039 0.2231 0.0164  0.0468  0.0069  195 VAL A CG1 
1508 C CG2 . VAL A 188 ? 0.3331 0.2037 0.2220 0.0143  0.0515  0.0072  195 VAL A CG2 
1509 N N   . ASN A 189 ? 0.3297 0.2151 0.2429 0.0184  0.0449  0.0096  196 ASN A N   
1510 C CA  . ASN A 189 ? 0.3554 0.2447 0.2735 0.0192  0.0414  0.0097  196 ASN A CA  
1511 C C   . ASN A 189 ? 0.3145 0.2051 0.2309 0.0196  0.0398  0.0086  196 ASN A C   
1512 O O   . ASN A 189 ? 0.3396 0.2294 0.2557 0.0199  0.0418  0.0086  196 ASN A O   
1513 C CB  . ASN A 189 ? 0.3782 0.2693 0.3034 0.0202  0.0426  0.0113  196 ASN A CB  
1514 C CG  . ASN A 189 ? 0.4400 0.3305 0.3677 0.0199  0.0436  0.0127  196 ASN A CG  
1515 O OD1 . ASN A 189 ? 0.4926 0.3826 0.4180 0.0191  0.0420  0.0124  196 ASN A OD1 
1516 N ND2 . ASN A 189 ? 0.5311 0.4217 0.4637 0.0204  0.0464  0.0142  196 ASN A ND2 
1517 N N   . ILE A 190 ? 0.3185 0.2109 0.2338 0.0196  0.0363  0.0076  197 ILE A N   
1518 C CA  . ILE A 190 ? 0.3140 0.2076 0.2271 0.0198  0.0347  0.0065  197 ILE A CA  
1519 C C   . ILE A 190 ? 0.3189 0.2161 0.2356 0.0207  0.0314  0.0062  197 ILE A C   
1520 O O   . ILE A 190 ? 0.3254 0.2236 0.2438 0.0207  0.0293  0.0062  197 ILE A O   
1521 C CB  . ILE A 190 ? 0.3705 0.2624 0.2779 0.0188  0.0337  0.0055  197 ILE A CB  
1522 C CG1 . ILE A 190 ? 0.3973 0.2851 0.3003 0.0176  0.0366  0.0057  197 ILE A CG1 
1523 C CG2 . ILE A 190 ? 0.3758 0.2687 0.2811 0.0189  0.0327  0.0046  197 ILE A CG2 
1524 C CD1 . ILE A 190 ? 0.4171 0.3032 0.3155 0.0164  0.0349  0.0051  197 ILE A CD1 
1525 N N   . LYS A 191 ? 0.3252 0.2241 0.2428 0.0213  0.0309  0.0060  198 LYS A N   
1526 C CA  . LYS A 191 ? 0.3584 0.2603 0.2778 0.0220  0.0278  0.0055  198 LYS A CA  
1527 C C   . LYS A 191 ? 0.3328 0.2354 0.2492 0.0220  0.0273  0.0046  198 LYS A C   
1528 O O   . LYS A 191 ? 0.3474 0.2496 0.2634 0.0220  0.0290  0.0050  198 LYS A O   
1529 C CB  . LYS A 191 ? 0.3899 0.2936 0.3146 0.0227  0.0273  0.0066  198 LYS A CB  
1530 C CG  . LYS A 191 ? 0.4282 0.3342 0.3541 0.0232  0.0237  0.0059  198 LYS A CG  
1531 C CD  . LYS A 191 ? 0.5081 0.4157 0.4387 0.0237  0.0229  0.0071  198 LYS A CD  
1532 C CE  . LYS A 191 ? 0.5403 0.4493 0.4727 0.0239  0.0195  0.0067  198 LYS A CE  
1533 N NZ  . LYS A 191 ? 0.5734 0.4831 0.5018 0.0241  0.0176  0.0049  198 LYS A NZ  
1534 N N   . LEU A 192 ? 0.3449 0.2485 0.2592 0.0220  0.0251  0.0035  199 LEU A N   
1535 C CA  . LEU A 192 ? 0.3592 0.2638 0.2708 0.0220  0.0245  0.0027  199 LEU A CA  
1536 C C   . LEU A 192 ? 0.3300 0.2374 0.2428 0.0229  0.0221  0.0021  199 LEU A C   
1537 O O   . LEU A 192 ? 0.3278 0.2359 0.2416 0.0231  0.0203  0.0015  199 LEU A O   
1538 C CB  . LEU A 192 ? 0.3826 0.2855 0.2903 0.0212  0.0244  0.0021  199 LEU A CB  
1539 C CG  . LEU A 192 ? 0.4234 0.3275 0.3287 0.0212  0.0234  0.0013  199 LEU A CG  
1540 C CD1 . LEU A 192 ? 0.4609 0.3646 0.3647 0.0209  0.0248  0.0017  199 LEU A CD1 
1541 C CD2 . LEU A 192 ? 0.4592 0.3617 0.3618 0.0202  0.0227  0.0010  199 LEU A CD2 
1542 N N   . ASP A 193 ? 0.3570 0.2659 0.2699 0.0232  0.0221  0.0022  200 ASP A N   
1543 C CA  . ASP A 193 ? 0.3785 0.2899 0.2922 0.0239  0.0200  0.0016  200 ASP A CA  
1544 C C   . ASP A 193 ? 0.3392 0.2518 0.2502 0.0240  0.0199  0.0011  200 ASP A C   
1545 O O   . ASP A 193 ? 0.3339 0.2459 0.2437 0.0236  0.0215  0.0016  200 ASP A O   
1546 C CB  . ASP A 193 ? 0.4135 0.3257 0.3302 0.0242  0.0199  0.0027  200 ASP A CB  
1547 C CG  . ASP A 193 ? 0.4464 0.3576 0.3667 0.0242  0.0204  0.0037  200 ASP A CG  
1548 O OD1 . ASP A 193 ? 0.4751 0.3859 0.3962 0.0242  0.0194  0.0034  200 ASP A OD1 
1549 O OD2 . ASP A 193 ? 0.5020 0.4128 0.4246 0.0241  0.0218  0.0050  200 ASP A OD2 
1550 N N   . ILE A 194 ? 0.3575 0.2718 0.2678 0.0245  0.0182  0.0000  201 ILE A N   
1551 C CA  . ILE A 194 ? 0.3614 0.2774 0.2697 0.0247  0.0180  -0.0003 201 ILE A CA  
1552 C C   . ILE A 194 ? 0.3457 0.2631 0.2550 0.0251  0.0174  0.0001  201 ILE A C   
1553 O O   . ILE A 194 ? 0.3595 0.2774 0.2697 0.0256  0.0158  -0.0003 201 ILE A O   
1554 C CB  . ILE A 194 ? 0.3553 0.2724 0.2624 0.0253  0.0168  -0.0016 201 ILE A CB  
1555 C CG1 . ILE A 194 ? 0.3879 0.3036 0.2944 0.0248  0.0169  -0.0019 201 ILE A CG1 
1556 C CG2 . ILE A 194 ? 0.3637 0.2828 0.2691 0.0255  0.0169  -0.0019 201 ILE A CG2 
1557 C CD1 . ILE A 194 ? 0.3732 0.2874 0.2781 0.0238  0.0184  -0.0011 201 ILE A CD1 
1558 N N   . THR A 195 ? 0.3353 0.2531 0.2443 0.0248  0.0185  0.0010  202 THR A N   
1559 C CA  . THR A 195 ? 0.3555 0.2743 0.2657 0.0249  0.0181  0.0019  202 THR A CA  
1560 C C   . THR A 195 ? 0.4020 0.3231 0.3102 0.0252  0.0171  0.0014  202 THR A C   
1561 O O   . THR A 195 ? 0.3884 0.3103 0.2970 0.0254  0.0159  0.0017  202 THR A O   
1562 C CB  . THR A 195 ? 0.3679 0.2859 0.2795 0.0244  0.0197  0.0033  202 THR A CB  
1563 O OG1 . THR A 195 ? 0.3943 0.3119 0.3038 0.0240  0.0211  0.0034  202 THR A OG1 
1564 C CG2 . THR A 195 ? 0.4033 0.3191 0.3174 0.0242  0.0209  0.0039  202 THR A CG2 
1565 N N   . SER A 196 ? 0.3624 0.2841 0.2683 0.0252  0.0177  0.0008  203 SER A N   
1566 C CA  . SER A 196 ? 0.3920 0.3158 0.2959 0.0256  0.0172  0.0003  203 SER A CA  
1567 C C   . SER A 196 ? 0.3849 0.3094 0.2874 0.0258  0.0177  -0.0004 203 SER A C   
1568 O O   . SER A 196 ? 0.3831 0.3063 0.2857 0.0253  0.0185  -0.0002 203 SER A O   
1569 C CB  . SER A 196 ? 0.4768 0.4016 0.3806 0.0252  0.0177  0.0016  203 SER A CB  
1570 O OG  . SER A 196 ? 0.5709 0.4960 0.4738 0.0248  0.0189  0.0021  203 SER A OG  
1571 N N   . HIS A 197 ? 0.3408 0.2669 0.2418 0.0264  0.0172  -0.0013 204 HIS A N   
1572 C CA  . HIS A 197 ? 0.3480 0.2750 0.2482 0.0267  0.0177  -0.0019 204 HIS A CA  
1573 C C   . HIS A 197 ? 0.3634 0.2926 0.2620 0.0274  0.0176  -0.0025 204 HIS A C   
1574 O O   . HIS A 197 ? 0.3787 0.3080 0.2764 0.0278  0.0168  -0.0031 204 HIS A O   
1575 C CB  . HIS A 197 ? 0.3550 0.2808 0.2561 0.0270  0.0171  -0.0030 204 HIS A CB  
1576 C CG  . HIS A 197 ? 0.3507 0.2764 0.2518 0.0278  0.0159  -0.0043 204 HIS A CG  
1577 N ND1 . HIS A 197 ? 0.3844 0.3114 0.2843 0.0288  0.0157  -0.0056 204 HIS A ND1 
1578 C CD2 . HIS A 197 ? 0.3849 0.3092 0.2869 0.0278  0.0148  -0.0045 204 HIS A CD2 
1579 C CE1 . HIS A 197 ? 0.4120 0.3381 0.3118 0.0293  0.0144  -0.0067 204 HIS A CE1 
1580 N NE2 . HIS A 197 ? 0.4395 0.3640 0.3406 0.0287  0.0138  -0.0060 204 HIS A NE2 
1581 N N   . ASN A 198 ? 0.3398 0.2705 0.2380 0.0275  0.0185  -0.0024 205 ASN A N   
1582 C CA  . ASN A 198 ? 0.3652 0.2980 0.2620 0.0283  0.0189  -0.0030 205 ASN A CA  
1583 C C   . ASN A 198 ? 0.3631 0.2958 0.2603 0.0294  0.0186  -0.0048 205 ASN A C   
1584 O O   . ASN A 198 ? 0.3802 0.3112 0.2788 0.0293  0.0178  -0.0053 205 ASN A O   
1585 C CB  . ASN A 198 ? 0.3481 0.2829 0.2449 0.0280  0.0201  -0.0018 205 ASN A CB  
1586 C CG  . ASN A 198 ? 0.3947 0.3294 0.2932 0.0277  0.0205  -0.0015 205 ASN A CG  
1587 O OD1 . ASN A 198 ? 0.3830 0.3160 0.2826 0.0277  0.0198  -0.0021 205 ASN A OD1 
1588 N ND2 . ASN A 198 ? 0.3793 0.3156 0.2781 0.0274  0.0213  -0.0002 205 ASN A ND2 
1589 N N   . GLU A 199 ? 0.3947 0.3289 0.2904 0.0303  0.0192  -0.0057 206 GLU A N   
1590 C CA  . GLU A 199 ? 0.4362 0.3699 0.3320 0.0314  0.0188  -0.0076 206 GLU A CA  
1591 C C   . GLU A 199 ? 0.3989 0.3322 0.2974 0.0316  0.0188  -0.0078 206 GLU A C   
1592 O O   . GLU A 199 ? 0.4181 0.3500 0.3175 0.0321  0.0178  -0.0090 206 GLU A O   
1593 C CB  . GLU A 199 ? 0.5035 0.4389 0.3972 0.0325  0.0200  -0.0085 206 GLU A CB  
1594 C CG  . GLU A 199 ? 0.6001 0.5340 0.4923 0.0335  0.0193  -0.0107 206 GLU A CG  
1595 C CD  . GLU A 199 ? 0.7131 0.6483 0.6033 0.0348  0.0208  -0.0120 206 GLU A CD  
1596 O OE1 . GLU A 199 ? 0.7529 0.6904 0.6429 0.0348  0.0225  -0.0111 206 GLU A OE1 
1597 O OE2 . GLU A 199 ? 0.7137 0.6473 0.6023 0.0357  0.0203  -0.0140 206 GLU A OE2 
1598 N N   . ASP A 200 ? 0.3539 0.2885 0.2538 0.0311  0.0196  -0.0065 207 ASP A N   
1599 C CA  . ASP A 200 ? 0.3779 0.3123 0.2804 0.0311  0.0195  -0.0064 207 ASP A CA  
1600 C C   . ASP A 200 ? 0.3512 0.2838 0.2547 0.0296  0.0187  -0.0051 207 ASP A C   
1601 O O   . ASP A 200 ? 0.3350 0.2674 0.2404 0.0292  0.0185  -0.0046 207 ASP A O   
1602 C CB  . ASP A 200 ? 0.4024 0.3394 0.3063 0.0315  0.0208  -0.0057 207 ASP A CB  
1603 C CG  . ASP A 200 ? 0.3994 0.3377 0.3029 0.0305  0.0215  -0.0038 207 ASP A CG  
1604 O OD1 . ASP A 200 ? 0.4409 0.3781 0.3430 0.0295  0.0211  -0.0030 207 ASP A OD1 
1605 O OD2 . ASP A 200 ? 0.4605 0.4009 0.3653 0.0307  0.0225  -0.0030 207 ASP A OD2 
1606 N N   . TYR A 201 ? 0.3441 0.2753 0.2463 0.0289  0.0184  -0.0047 208 TYR A N   
1607 C CA  . TYR A 201 ? 0.3409 0.2700 0.2434 0.0276  0.0181  -0.0036 208 TYR A CA  
1608 C C   . TYR A 201 ? 0.3569 0.2863 0.2598 0.0267  0.0185  -0.0022 208 TYR A C   
1609 O O   . TYR A 201 ? 0.3497 0.2771 0.2529 0.0257  0.0181  -0.0016 208 TYR A O   
1610 C CB  . TYR A 201 ? 0.3664 0.2935 0.2700 0.0276  0.0170  -0.0044 208 TYR A CB  
1611 C CG  . TYR A 201 ? 0.3390 0.2650 0.2424 0.0281  0.0162  -0.0054 208 TYR A CG  
1612 C CD1 . TYR A 201 ? 0.3692 0.2961 0.2726 0.0293  0.0158  -0.0069 208 TYR A CD1 
1613 C CD2 . TYR A 201 ? 0.3642 0.2883 0.2676 0.0274  0.0160  -0.0048 208 TYR A CD2 
1614 C CE1 . TYR A 201 ? 0.3841 0.3097 0.2873 0.0297  0.0148  -0.0077 208 TYR A CE1 
1615 C CE2 . TYR A 201 ? 0.4074 0.3305 0.3112 0.0278  0.0151  -0.0055 208 TYR A CE2 
1616 C CZ  . TYR A 201 ? 0.3899 0.3137 0.2935 0.0289  0.0143  -0.0070 208 TYR A CZ  
1617 O OH  . TYR A 201 ? 0.4281 0.3508 0.3321 0.0291  0.0131  -0.0076 208 TYR A OH  
1618 N N   . THR A 202 ? 0.3150 0.2466 0.2176 0.0268  0.0194  -0.0015 209 THR A N   
1619 C CA  . THR A 202 ? 0.3083 0.2400 0.2111 0.0257  0.0197  0.0000  209 THR A CA  
1620 C C   . THR A 202 ? 0.3051 0.2355 0.2065 0.0247  0.0200  0.0011  209 THR A C   
1621 O O   . THR A 202 ? 0.3384 0.2679 0.2396 0.0236  0.0200  0.0023  209 THR A O   
1622 C CB  . THR A 202 ? 0.3484 0.2832 0.2523 0.0262  0.0204  0.0007  209 THR A CB  
1623 O OG1 . THR A 202 ? 0.3661 0.3027 0.2687 0.0270  0.0212  0.0003  209 THR A OG1 
1624 C CG2 . THR A 202 ? 0.3686 0.3043 0.2748 0.0269  0.0201  0.0002  209 THR A CG2 
1625 N N   . ILE A 203 ? 0.3036 0.2337 0.2041 0.0251  0.0201  0.0006  210 ILE A N   
1626 C CA  . ILE A 203 ? 0.3105 0.2391 0.2103 0.0244  0.0204  0.0014  210 ILE A CA  
1627 C C   . ILE A 203 ? 0.3198 0.2467 0.2197 0.0247  0.0200  0.0006  210 ILE A C   
1628 O O   . ILE A 203 ? 0.3633 0.2913 0.2633 0.0255  0.0195  -0.0003 210 ILE A O   
1629 C CB  . ILE A 203 ? 0.3217 0.2524 0.2209 0.0245  0.0209  0.0022  210 ILE A CB  
1630 C CG1 . ILE A 203 ? 0.3379 0.2706 0.2374 0.0242  0.0214  0.0032  210 ILE A CG1 
1631 C CG2 . ILE A 203 ? 0.3324 0.2613 0.2315 0.0237  0.0212  0.0031  210 ILE A CG2 
1632 C CD1 . ILE A 203 ? 0.3633 0.2984 0.2622 0.0243  0.0219  0.0041  210 ILE A CD1 
1633 N N   . VAL A 204 ? 0.3014 0.2256 0.2013 0.0238  0.0202  0.0009  211 VAL A N   
1634 C CA  . VAL A 204 ? 0.2986 0.2211 0.1992 0.0240  0.0200  0.0004  211 VAL A CA  
1635 C C   . VAL A 204 ? 0.2935 0.2138 0.1941 0.0233  0.0209  0.0013  211 VAL A C   
1636 O O   . VAL A 204 ? 0.3487 0.2675 0.2483 0.0224  0.0216  0.0020  211 VAL A O   
1637 C CB  . VAL A 204 ? 0.3037 0.2247 0.2045 0.0239  0.0194  -0.0002 211 VAL A CB  
1638 C CG1 . VAL A 204 ? 0.3192 0.2386 0.2209 0.0241  0.0191  -0.0007 211 VAL A CG1 
1639 C CG2 . VAL A 204 ? 0.3115 0.2345 0.2128 0.0246  0.0186  -0.0011 211 VAL A CG2 
1640 N N   . GLU A 205 ? 0.3050 0.2251 0.2068 0.0236  0.0208  0.0013  212 GLU A N   
1641 C CA  . GLU A 205 ? 0.3280 0.2461 0.2307 0.0232  0.0218  0.0021  212 GLU A CA  
1642 C C   . GLU A 205 ? 0.3051 0.2214 0.2090 0.0233  0.0218  0.0017  212 GLU A C   
1643 O O   . GLU A 205 ? 0.3151 0.2323 0.2199 0.0239  0.0206  0.0011  212 GLU A O   
1644 C CB  . GLU A 205 ? 0.3734 0.2928 0.2773 0.0234  0.0218  0.0030  212 GLU A CB  
1645 C CG  . GLU A 205 ? 0.4086 0.3292 0.3114 0.0230  0.0222  0.0037  212 GLU A CG  
1646 C CD  . GLU A 205 ? 0.4633 0.3852 0.3673 0.0231  0.0221  0.0048  212 GLU A CD  
1647 O OE1 . GLU A 205 ? 0.4796 0.4008 0.3857 0.0231  0.0222  0.0053  212 GLU A OE1 
1648 O OE2 . GLU A 205 ? 0.5699 0.4936 0.4730 0.0230  0.0219  0.0053  212 GLU A OE2 
1649 N N   . GLN A 206 ? 0.3140 0.2276 0.2177 0.0226  0.0231  0.0022  213 GLN A N   
1650 C CA  . GLN A 206 ? 0.3091 0.2209 0.2139 0.0226  0.0235  0.0021  213 GLN A CA  
1651 C C   . GLN A 206 ? 0.3114 0.2214 0.2178 0.0224  0.0252  0.0030  213 GLN A C   
1652 O O   . GLN A 206 ? 0.3539 0.2633 0.2598 0.0221  0.0264  0.0037  213 GLN A O   
1653 C CB  . GLN A 206 ? 0.3142 0.2237 0.2167 0.0218  0.0239  0.0017  213 GLN A CB  
1654 C CG  . GLN A 206 ? 0.3403 0.2512 0.2418 0.0219  0.0223  0.0009  213 GLN A CG  
1655 C CD  . GLN A 206 ? 0.3211 0.2300 0.2209 0.0211  0.0220  0.0007  213 GLN A CD  
1656 O OE1 . GLN A 206 ? 0.3426 0.2527 0.2423 0.0213  0.0207  0.0002  213 GLN A OE1 
1657 N NE2 . GLN A 206 ? 0.3298 0.2354 0.2282 0.0202  0.0233  0.0011  213 GLN A NE2 
1658 N N   . TYR A 207 ? 0.3289 0.2382 0.2375 0.0226  0.0254  0.0032  214 TYR A N   
1659 C CA  . TYR A 207 ? 0.3235 0.2311 0.2341 0.0226  0.0273  0.0041  214 TYR A CA  
1660 C C   . TYR A 207 ? 0.3265 0.2318 0.2370 0.0222  0.0282  0.0040  214 TYR A C   
1661 O O   . TYR A 207 ? 0.3192 0.2254 0.2304 0.0224  0.0266  0.0035  214 TYR A O   
1662 C CB  . TYR A 207 ? 0.3612 0.2707 0.2758 0.0232  0.0265  0.0049  214 TYR A CB  
1663 C CG  . TYR A 207 ? 0.3894 0.2974 0.3074 0.0232  0.0284  0.0061  214 TYR A CG  
1664 C CD1 . TYR A 207 ? 0.3938 0.3007 0.3125 0.0232  0.0303  0.0069  214 TYR A CD1 
1665 C CD2 . TYR A 207 ? 0.3983 0.3058 0.3189 0.0234  0.0283  0.0065  214 TYR A CD2 
1666 C CE1 . TYR A 207 ? 0.4315 0.3372 0.3539 0.0234  0.0323  0.0080  214 TYR A CE1 
1667 C CE2 . TYR A 207 ? 0.4564 0.3628 0.3807 0.0235  0.0304  0.0077  214 TYR A CE2 
1668 C CZ  . TYR A 207 ? 0.4424 0.3478 0.3676 0.0236  0.0325  0.0085  214 TYR A CZ  
1669 O OH  . TYR A 207 ? 0.5085 0.4127 0.4379 0.0238  0.0348  0.0098  214 TYR A OH  
1670 N N   . GLU A 208 ? 0.3225 0.2251 0.2325 0.0218  0.0307  0.0045  215 GLU A N   
1671 C CA  . GLU A 208 ? 0.3608 0.2612 0.2708 0.0215  0.0318  0.0046  215 GLU A CA  
1672 C C   . GLU A 208 ? 0.3493 0.2479 0.2618 0.0216  0.0346  0.0056  215 GLU A C   
1673 O O   . GLU A 208 ? 0.3695 0.2672 0.2819 0.0217  0.0362  0.0059  215 GLU A O   
1674 C CB  . GLU A 208 ? 0.3730 0.2708 0.2781 0.0205  0.0321  0.0038  215 GLU A CB  
1675 C CG  . GLU A 208 ? 0.3955 0.2914 0.3004 0.0200  0.0329  0.0040  215 GLU A CG  
1676 C CD  . GLU A 208 ? 0.5154 0.4082 0.4151 0.0188  0.0331  0.0035  215 GLU A CD  
1677 O OE1 . GLU A 208 ? 0.5896 0.4833 0.4882 0.0185  0.0308  0.0030  215 GLU A OE1 
1678 O OE2 . GLU A 208 ? 0.6006 0.4900 0.4975 0.0181  0.0355  0.0036  215 GLU A OE2 
1679 N N   . ARG A 209 ? 0.3431 0.2416 0.2584 0.0218  0.0349  0.0061  216 ARG A N   
1680 C CA  . ARG A 209 ? 0.3612 0.2578 0.2789 0.0219  0.0380  0.0072  216 ARG A CA  
1681 C C   . ARG A 209 ? 0.3221 0.2161 0.2375 0.0213  0.0393  0.0070  216 ARG A C   
1682 O O   . ARG A 209 ? 0.3547 0.2498 0.2704 0.0211  0.0372  0.0068  216 ARG A O   
1683 C CB  . ARG A 209 ? 0.3996 0.2985 0.3238 0.0228  0.0374  0.0085  216 ARG A CB  
1684 C CG  . ARG A 209 ? 0.4614 0.3586 0.3890 0.0230  0.0409  0.0097  216 ARG A CG  
1685 C CD  . ARG A 209 ? 0.5082 0.4075 0.4428 0.0237  0.0402  0.0113  216 ARG A CD  
1686 N NE  . ARG A 209 ? 0.5976 0.4977 0.5361 0.0242  0.0412  0.0124  216 ARG A NE  
1687 C CZ  . ARG A 209 ? 0.6457 0.5482 0.5855 0.0245  0.0387  0.0126  216 ARG A CZ  
1688 N NH1 . ARG A 209 ? 0.6894 0.5939 0.6270 0.0243  0.0352  0.0117  216 ARG A NH1 
1689 N NH2 . ARG A 209 ? 0.6781 0.5809 0.6216 0.0249  0.0398  0.0138  216 ARG A NH2 
1690 N N   . ALA A 210 ? 0.3400 0.2305 0.2531 0.0208  0.0426  0.0071  217 ALA A N   
1691 C CA  . ALA A 210 ? 0.3373 0.2249 0.2474 0.0200  0.0441  0.0071  217 ALA A CA  
1692 C C   . ALA A 210 ? 0.3354 0.2204 0.2468 0.0202  0.0483  0.0079  217 ALA A C   
1693 O O   . ALA A 210 ? 0.3471 0.2304 0.2576 0.0204  0.0505  0.0078  217 ALA A O   
1694 C CB  . ALA A 210 ? 0.3363 0.2213 0.2394 0.0188  0.0436  0.0059  217 ALA A CB  
1695 N N   . GLU A 211 ? 0.3483 0.2327 0.2615 0.0201  0.0495  0.0087  218 GLU A N   
1696 C CA  . GLU A 211 ? 0.3848 0.2670 0.2999 0.0204  0.0537  0.0097  218 GLU A CA  
1697 C C   . GLU A 211 ? 0.3580 0.2377 0.2704 0.0195  0.0554  0.0099  218 GLU A C   
1698 O O   . GLU A 211 ? 0.3366 0.2180 0.2508 0.0193  0.0532  0.0104  218 GLU A O   
1699 C CB  . GLU A 211 ? 0.4204 0.3058 0.3440 0.0216  0.0539  0.0113  218 GLU A CB  
1700 C CG  . GLU A 211 ? 0.4836 0.3668 0.4099 0.0221  0.0587  0.0123  218 GLU A CG  
1701 C CD  . GLU A 211 ? 0.5548 0.4412 0.4903 0.0233  0.0586  0.0142  218 GLU A CD  
1702 O OE1 . GLU A 211 ? 0.6104 0.5005 0.5494 0.0236  0.0547  0.0145  218 GLU A OE1 
1703 O OE2 . GLU A 211 ? 0.5475 0.4328 0.4868 0.0238  0.0625  0.0154  218 GLU A OE2 
1704 N N   . GLY A 212 ? 0.3572 0.2324 0.2647 0.0189  0.0590  0.0095  219 GLY A N   
1705 C CA  . GLY A 212 ? 0.3611 0.2333 0.2653 0.0180  0.0612  0.0099  219 GLY A CA  
1706 C C   . GLY A 212 ? 0.3730 0.2464 0.2839 0.0189  0.0640  0.0117  219 GLY A C   
1707 O O   . GLY A 212 ? 0.3956 0.2695 0.3113 0.0200  0.0665  0.0123  219 GLY A O   
1708 N N   . ARG A 213 ? 0.3603 0.2339 0.2719 0.0183  0.0636  0.0126  220 ARG A N   
1709 C CA  . ARG A 213 ? 0.3688 0.2434 0.2867 0.0190  0.0663  0.0145  220 ARG A CA  
1710 C C   . ARG A 213 ? 0.3875 0.2584 0.3003 0.0177  0.0688  0.0148  220 ARG A C   
1711 O O   . ARG A 213 ? 0.3372 0.2066 0.2439 0.0163  0.0665  0.0139  220 ARG A O   
1712 C CB  . ARG A 213 ? 0.4175 0.2967 0.3424 0.0194  0.0624  0.0157  220 ARG A CB  
1713 C CG  . ARG A 213 ? 0.4694 0.3524 0.3993 0.0205  0.0592  0.0155  220 ARG A CG  
1714 C CD  . ARG A 213 ? 0.5366 0.4210 0.4741 0.0217  0.0617  0.0171  220 ARG A CD  
1715 N NE  . ARG A 213 ? 0.6225 0.5104 0.5651 0.0226  0.0588  0.0173  220 ARG A NE  
1716 C CZ  . ARG A 213 ? 0.6596 0.5512 0.6084 0.0230  0.0553  0.0184  220 ARG A CZ  
1717 N NH1 . ARG A 213 ? 0.6153 0.5079 0.5662 0.0226  0.0537  0.0194  220 ARG A NH1 
1718 N NH2 . ARG A 213 ? 0.6836 0.5777 0.6360 0.0237  0.0530  0.0186  220 ARG A NH2 
1719 N N   . HIS A 214 ? 0.3783 0.2483 0.2945 0.0182  0.0731  0.0162  221 HIS A N   
1720 C CA  . HIS A 214 ? 0.3795 0.2465 0.2918 0.0171  0.0759  0.0169  221 HIS A CA  
1721 C C   . HIS A 214 ? 0.3746 0.2439 0.2887 0.0163  0.0723  0.0179  221 HIS A C   
1722 O O   . HIS A 214 ? 0.3709 0.2448 0.2925 0.0171  0.0689  0.0188  221 HIS A O   
1723 C CB  . HIS A 214 ? 0.4169 0.2830 0.3340 0.0181  0.0816  0.0184  221 HIS A CB  
1724 C CG  . HIS A 214 ? 0.4293 0.2917 0.3431 0.0186  0.0861  0.0173  221 HIS A CG  
1725 N ND1 . HIS A 214 ? 0.5035 0.3601 0.4078 0.0175  0.0895  0.0160  221 HIS A ND1 
1726 C CD2 . HIS A 214 ? 0.4773 0.3408 0.3959 0.0201  0.0875  0.0172  221 HIS A CD2 
1727 C CE1 . HIS A 214 ? 0.5117 0.3658 0.4149 0.0184  0.0929  0.0151  221 HIS A CE1 
1728 N NE2 . HIS A 214 ? 0.4878 0.3461 0.3999 0.0200  0.0918  0.0159  221 HIS A NE2 
1729 N N   . SER A 215 ? 0.3612 0.2275 0.2685 0.0147  0.0724  0.0176  222 SER A N   
1730 C CA  . SER A 215 ? 0.3634 0.2318 0.2732 0.0140  0.0693  0.0189  222 SER A CA  
1731 C C   . SER A 215 ? 0.3582 0.2249 0.2686 0.0135  0.0734  0.0207  222 SER A C   
1732 O O   . SER A 215 ? 0.3769 0.2453 0.2902 0.0129  0.0714  0.0221  222 SER A O   
1733 C CB  . SER A 215 ? 0.4249 0.2925 0.3285 0.0125  0.0650  0.0176  222 SER A CB  
1734 O OG  . SER A 215 ? 0.4464 0.3089 0.3408 0.0109  0.0672  0.0169  222 SER A OG  
1735 N N   . THR A 216 ? 0.3333 0.1961 0.2400 0.0135  0.0790  0.0206  223 THR A N   
1736 C CA  . THR A 216 ? 0.3517 0.2129 0.2601 0.0135  0.0842  0.0224  223 THR A CA  
1737 C C   . THR A 216 ? 0.3896 0.2503 0.3022 0.0151  0.0894  0.0228  223 THR A C   
1738 O O   . THR A 216 ? 0.4090 0.2692 0.3208 0.0160  0.0897  0.0213  223 THR A O   
1739 C CB  . THR A 216 ? 0.3549 0.2102 0.2523 0.0114  0.0868  0.0219  223 THR A CB  
1740 O OG1 . THR A 216 ? 0.3543 0.2052 0.2435 0.0111  0.0886  0.0197  223 THR A OG1 
1741 C CG2 . THR A 216 ? 0.3531 0.2085 0.2465 0.0097  0.0821  0.0218  223 THR A CG2 
1742 N N   . GLY A 217 ? 0.4293 0.2896 0.3455 0.0155  0.0941  0.0247  224 GLY A N   
1743 C CA  . GLY A 217 ? 0.4698 0.3291 0.3899 0.0170  0.1000  0.0252  224 GLY A CA  
1744 C C   . GLY A 217 ? 0.5233 0.3876 0.4564 0.0186  0.1005  0.0279  224 GLY A C   
1745 O O   . GLY A 217 ? 0.5912 0.4550 0.5289 0.0200  0.1056  0.0287  224 GLY A O   
1746 N N   . ALA B 1   ? 0.8265 0.7926 0.7112 -0.0054 -0.0038 0.0639  6   ALA B N   
1747 C CA  . ALA B 1   ? 0.7240 0.6895 0.6010 -0.0047 -0.0025 0.0612  6   ALA B CA  
1748 C C   . ALA B 1   ? 0.7007 0.6682 0.5753 -0.0031 0.0013  0.0589  6   ALA B C   
1749 O O   . ALA B 1   ? 0.6086 0.5757 0.4776 -0.0022 0.0028  0.0563  6   ALA B O   
1750 C CB  . ALA B 1   ? 0.7608 0.7264 0.6311 -0.0068 -0.0043 0.0632  6   ALA B CB  
1751 N N   . ILE B 2   ? 0.6608 0.6302 0.5396 -0.0028 0.0028  0.0599  7   ILE B N   
1752 C CA  . ILE B 2   ? 0.6722 0.6438 0.5490 -0.0016 0.0064  0.0585  7   ILE B CA  
1753 C C   . ILE B 2   ? 0.5679 0.5382 0.4468 0.0005  0.0081  0.0548  7   ILE B C   
1754 O O   . ILE B 2   ? 0.5884 0.5595 0.4639 0.0018  0.0105  0.0526  7   ILE B O   
1755 C CB  . ILE B 2   ? 0.7317 0.7062 0.6118 -0.0022 0.0073  0.0612  7   ILE B CB  
1756 C CG1 . ILE B 2   ? 0.7569 0.7308 0.6432 -0.0036 0.0046  0.0641  7   ILE B CG1 
1757 C CG2 . ILE B 2   ? 0.7619 0.7391 0.6363 -0.0033 0.0084  0.0630  7   ILE B CG2 
1758 C CD1 . ILE B 2   ? 0.7689 0.7432 0.6534 -0.0058 0.0019  0.0675  7   ILE B CD1 
1759 N N   . ILE B 3   ? 0.5255 0.4936 0.4100 0.0010  0.0067  0.0543  8   ILE B N   
1760 C CA  . ILE B 3   ? 0.4916 0.4580 0.3779 0.0028  0.0079  0.0510  8   ILE B CA  
1761 C C   . ILE B 3   ? 0.4740 0.4378 0.3582 0.0029  0.0062  0.0495  8   ILE B C   
1762 O O   . ILE B 3   ? 0.4439 0.4059 0.3313 0.0022  0.0038  0.0507  8   ILE B O   
1763 C CB  . ILE B 3   ? 0.4787 0.4439 0.3719 0.0032  0.0077  0.0513  8   ILE B CB  
1764 C CG1 . ILE B 3   ? 0.5066 0.4740 0.4019 0.0028  0.0089  0.0531  8   ILE B CG1 
1765 C CG2 . ILE B 3   ? 0.4615 0.4248 0.3562 0.0050  0.0090  0.0480  8   ILE B CG2 
1766 C CD1 . ILE B 3   ? 0.5059 0.4757 0.3980 0.0037  0.0116  0.0519  8   ILE B CD1 
1767 N N   . LYS B 4   ? 0.5060 0.4695 0.3852 0.0039  0.0075  0.0469  9   LYS B N   
1768 C CA  . LYS B 4   ? 0.4924 0.4533 0.3692 0.0041  0.0059  0.0453  9   LYS B CA  
1769 C C   . LYS B 4   ? 0.4774 0.4361 0.3587 0.0054  0.0059  0.0431  9   LYS B C   
1770 O O   . LYS B 4   ? 0.4437 0.4028 0.3287 0.0065  0.0076  0.0423  9   LYS B O   
1771 C CB  . LYS B 4   ? 0.5128 0.4739 0.3823 0.0046  0.0073  0.0433  9   LYS B CB  
1772 C CG  . LYS B 4   ? 0.5542 0.5174 0.4184 0.0033  0.0078  0.0452  9   LYS B CG  
1773 C CD  . LYS B 4   ? 0.6028 0.5659 0.4596 0.0042  0.0098  0.0427  9   LYS B CD  
1774 C CE  . LYS B 4   ? 0.6666 0.6305 0.5165 0.0026  0.0097  0.0445  9   LYS B CE  
1775 N NZ  . LYS B 4   ? 0.6797 0.6421 0.5215 0.0031  0.0108  0.0419  9   LYS B NZ  
1776 N N   . GLU B 5   ? 0.4333 0.3897 0.3143 0.0054  0.0041  0.0422  10  GLU B N   
1777 C CA  . GLU B 5   ? 0.4285 0.3829 0.3136 0.0068  0.0042  0.0401  10  GLU B CA  
1778 C C   . GLU B 5   ? 0.3774 0.3317 0.2606 0.0085  0.0068  0.0369  10  GLU B C   
1779 O O   . GLU B 5   ? 0.4089 0.3618 0.2956 0.0097  0.0074  0.0352  10  GLU B O   
1780 C CB  . GLU B 5   ? 0.4531 0.4051 0.3386 0.0062  0.0015  0.0403  10  GLU B CB  
1781 C CG  . GLU B 5   ? 0.5116 0.4628 0.4036 0.0052  -0.0005 0.0429  10  GLU B CG  
1782 C CD  . GLU B 5   ? 0.5560 0.5055 0.4480 0.0041  -0.0038 0.0440  10  GLU B CD  
1783 O OE1 . GLU B 5   ? 0.5565 0.5040 0.4507 0.0049  -0.0044 0.0426  10  GLU B OE1 
1784 O OE2 . GLU B 5   ? 0.6136 0.5636 0.5031 0.0024  -0.0059 0.0464  10  GLU B OE2 
1785 N N   . PHE B 6   ? 0.4103 0.3661 0.2880 0.0088  0.0083  0.0360  11  PHE B N   
1786 C CA  . PHE B 6   ? 0.3955 0.3516 0.2716 0.0105  0.0108  0.0331  11  PHE B CA  
1787 C C   . PHE B 6   ? 0.4003 0.3593 0.2743 0.0105  0.0132  0.0338  11  PHE B C   
1788 O O   . PHE B 6   ? 0.4068 0.3671 0.2768 0.0095  0.0131  0.0352  11  PHE B O   
1789 C CB  . PHE B 6   ? 0.4464 0.4007 0.3178 0.0111  0.0105  0.0306  11  PHE B CB  
1790 C CG  . PHE B 6   ? 0.4621 0.4171 0.3313 0.0128  0.0132  0.0278  11  PHE B CG  
1791 C CD1 . PHE B 6   ? 0.4991 0.4531 0.3718 0.0141  0.0141  0.0259  11  PHE B CD1 
1792 C CD2 . PHE B 6   ? 0.5081 0.4646 0.3720 0.0129  0.0149  0.0275  11  PHE B CD2 
1793 C CE1 . PHE B 6   ? 0.4926 0.4473 0.3637 0.0156  0.0164  0.0236  11  PHE B CE1 
1794 C CE2 . PHE B 6   ? 0.5185 0.4758 0.3811 0.0145  0.0175  0.0251  11  PHE B CE2 
1795 C CZ  . PHE B 6   ? 0.5150 0.4714 0.3813 0.0158  0.0181  0.0232  11  PHE B CZ  
1796 N N   . MET B 7   ? 0.3772 0.3373 0.2543 0.0115  0.0152  0.0331  12  MET B N   
1797 C CA  . MET B 7   ? 0.3797 0.3428 0.2563 0.0113  0.0170  0.0345  12  MET B CA  
1798 C C   . MET B 7   ? 0.3570 0.3205 0.2346 0.0129  0.0193  0.0324  12  MET B C   
1799 O O   . MET B 7   ? 0.3693 0.3313 0.2505 0.0135  0.0191  0.0312  12  MET B O   
1800 C CB  . MET B 7   ? 0.4069 0.3709 0.2883 0.0103  0.0163  0.0373  12  MET B CB  
1801 C CG  . MET B 7   ? 0.4470 0.4111 0.3282 0.0085  0.0141  0.0402  12  MET B CG  
1802 S SD  . MET B 7   ? 0.5040 0.4706 0.3789 0.0076  0.0149  0.0416  12  MET B SD  
1803 C CE  . MET B 7   ? 0.5325 0.5026 0.4106 0.0074  0.0169  0.0437  12  MET B CE  
1804 N N   . ARG B 8   ? 0.3747 0.3405 0.2495 0.0134  0.0215  0.0320  13  ARG B N   
1805 C CA  . ARG B 8   ? 0.3638 0.3306 0.2405 0.0148  0.0237  0.0306  13  ARG B CA  
1806 C C   . ARG B 8   ? 0.3563 0.3256 0.2367 0.0142  0.0246  0.0329  13  ARG B C   
1807 O O   . ARG B 8   ? 0.3651 0.3356 0.2456 0.0129  0.0239  0.0355  13  ARG B O   
1808 C CB  . ARG B 8   ? 0.4154 0.3834 0.2875 0.0158  0.0259  0.0289  13  ARG B CB  
1809 C CG  . ARG B 8   ? 0.4923 0.4577 0.3609 0.0166  0.0253  0.0261  13  ARG B CG  
1810 C CD  . ARG B 8   ? 0.5593 0.5257 0.4237 0.0178  0.0280  0.0243  13  ARG B CD  
1811 N NE  . ARG B 8   ? 0.6432 0.6069 0.5046 0.0187  0.0274  0.0214  13  ARG B NE  
1812 C CZ  . ARG B 8   ? 0.6817 0.6438 0.5457 0.0199  0.0273  0.0193  13  ARG B CZ  
1813 N NH1 . ARG B 8   ? 0.7195 0.6824 0.5889 0.0202  0.0276  0.0196  13  ARG B NH1 
1814 N NH2 . ARG B 8   ? 0.7339 0.6935 0.5948 0.0205  0.0266  0.0168  13  ARG B NH2 
1815 N N   . PHE B 9   ? 0.3475 0.3173 0.2308 0.0152  0.0259  0.0320  14  PHE B N   
1816 C CA  . PHE B 9   ? 0.3684 0.3403 0.2553 0.0147  0.0266  0.0341  14  PHE B CA  
1817 C C   . PHE B 9   ? 0.3721 0.3456 0.2601 0.0160  0.0288  0.0329  14  PHE B C   
1818 O O   . PHE B 9   ? 0.3630 0.3351 0.2499 0.0172  0.0294  0.0302  14  PHE B O   
1819 C CB  . PHE B 9   ? 0.3819 0.3518 0.2732 0.0139  0.0248  0.0350  14  PHE B CB  
1820 C CG  . PHE B 9   ? 0.4014 0.3687 0.2948 0.0149  0.0246  0.0327  14  PHE B CG  
1821 C CD1 . PHE B 9   ? 0.4128 0.3807 0.3089 0.0152  0.0255  0.0326  14  PHE B CD1 
1822 C CD2 . PHE B 9   ? 0.4358 0.4001 0.3286 0.0152  0.0234  0.0309  14  PHE B CD2 
1823 C CE1 . PHE B 9   ? 0.4644 0.4298 0.3619 0.0159  0.0253  0.0306  14  PHE B CE1 
1824 C CE2 . PHE B 9   ? 0.4932 0.4552 0.3877 0.0159  0.0234  0.0289  14  PHE B CE2 
1825 C CZ  . PHE B 9   ? 0.4771 0.4396 0.3737 0.0162  0.0243  0.0288  14  PHE B CZ  
1826 N N   . LYS B 10  ? 0.3365 0.3127 0.2269 0.0156  0.0298  0.0351  15  LYS B N   
1827 C CA  . LYS B 10  ? 0.3554 0.3332 0.2485 0.0165  0.0316  0.0346  15  LYS B CA  
1828 C C   . LYS B 10  ? 0.3486 0.3266 0.2466 0.0156  0.0305  0.0367  15  LYS B C   
1829 O O   . LYS B 10  ? 0.3707 0.3490 0.2697 0.0142  0.0293  0.0392  15  LYS B O   
1830 C CB  . LYS B 10  ? 0.3982 0.3797 0.2898 0.0170  0.0343  0.0355  15  LYS B CB  
1831 C CG  . LYS B 10  ? 0.4784 0.4595 0.3642 0.0178  0.0354  0.0337  15  LYS B CG  
1832 C CD  . LYS B 10  ? 0.5491 0.5336 0.4333 0.0184  0.0385  0.0344  15  LYS B CD  
1833 C CE  . LYS B 10  ? 0.6218 0.6054 0.4993 0.0191  0.0397  0.0324  15  LYS B CE  
1834 N NZ  . LYS B 10  ? 0.6965 0.6826 0.5730 0.0204  0.0433  0.0319  15  LYS B NZ  
1835 N N   . VAL B 11  ? 0.3392 0.3167 0.2402 0.0162  0.0307  0.0358  16  VAL B N   
1836 C CA  . VAL B 11  ? 0.3183 0.2955 0.2233 0.0152  0.0296  0.0376  16  VAL B CA  
1837 C C   . VAL B 11  ? 0.3489 0.3282 0.2572 0.0157  0.0308  0.0382  16  VAL B C   
1838 O O   . VAL B 11  ? 0.3428 0.3227 0.2507 0.0171  0.0323  0.0363  16  VAL B O   
1839 C CB  . VAL B 11  ? 0.3419 0.3147 0.2477 0.0148  0.0275  0.0363  16  VAL B CB  
1840 C CG1 . VAL B 11  ? 0.3414 0.3120 0.2463 0.0161  0.0278  0.0332  16  VAL B CG1 
1841 C CG2 . VAL B 11  ? 0.3555 0.3275 0.2650 0.0137  0.0262  0.0381  16  VAL B CG2 
1842 N N   . HIS B 12  ? 0.3252 0.3058 0.2371 0.0145  0.0301  0.0410  17  HIS B N   
1843 C CA  . HIS B 12  ? 0.3373 0.3198 0.2533 0.0147  0.0308  0.0420  17  HIS B CA  
1844 C C   . HIS B 12  ? 0.3372 0.3173 0.2561 0.0133  0.0283  0.0434  17  HIS B C   
1845 O O   . HIS B 12  ? 0.3550 0.3349 0.2743 0.0120  0.0271  0.0453  17  HIS B O   
1846 C CB  . HIS B 12  ? 0.3476 0.3348 0.2654 0.0146  0.0327  0.0447  17  HIS B CB  
1847 C CG  . HIS B 12  ? 0.3786 0.3678 0.3016 0.0146  0.0331  0.0462  17  HIS B CG  
1848 N ND1 . HIS B 12  ? 0.4157 0.4050 0.3427 0.0131  0.0313  0.0491  17  HIS B ND1 
1849 C CD2 . HIS B 12  ? 0.4080 0.3989 0.3331 0.0159  0.0348  0.0454  17  HIS B CD2 
1850 C CE1 . HIS B 12  ? 0.4106 0.4020 0.3420 0.0134  0.0320  0.0502  17  HIS B CE1 
1851 N NE2 . HIS B 12  ? 0.4268 0.4191 0.3573 0.0151  0.0341  0.0480  17  HIS B NE2 
1852 N N   . MET B 13  ? 0.3161 0.2945 0.2372 0.0134  0.0276  0.0425  18  MET B N   
1853 C CA  . MET B 13  ? 0.3022 0.2779 0.2258 0.0119  0.0251  0.0439  18  MET B CA  
1854 C C   . MET B 13  ? 0.3242 0.3020 0.2523 0.0116  0.0252  0.0456  18  MET B C   
1855 O O   . MET B 13  ? 0.3057 0.2847 0.2347 0.0129  0.0265  0.0444  18  MET B O   
1856 C CB  . MET B 13  ? 0.3151 0.2856 0.2369 0.0118  0.0236  0.0413  18  MET B CB  
1857 C CG  . MET B 13  ? 0.3255 0.2927 0.2492 0.0102  0.0211  0.0424  18  MET B CG  
1858 S SD  . MET B 13  ? 0.3646 0.3255 0.2856 0.0102  0.0197  0.0393  18  MET B SD  
1859 C CE  . MET B 13  ? 0.3422 0.3004 0.2601 0.0100  0.0194  0.0385  18  MET B CE  
1860 N N   . GLU B 14  ? 0.3173 0.2953 0.2484 0.0101  0.0236  0.0485  19  GLU B N   
1861 C CA  . GLU B 14  ? 0.3296 0.3093 0.2656 0.0095  0.0230  0.0507  19  GLU B CA  
1862 C C   . GLU B 14  ? 0.3098 0.2845 0.2459 0.0078  0.0199  0.0508  19  GLU B C   
1863 O O   . GLU B 14  ? 0.3091 0.2813 0.2434 0.0068  0.0185  0.0511  19  GLU B O   
1864 C CB  . GLU B 14  ? 0.3737 0.3582 0.3132 0.0089  0.0239  0.0543  19  GLU B CB  
1865 C CG  . GLU B 14  ? 0.4609 0.4460 0.4056 0.0074  0.0220  0.0575  19  GLU B CG  
1866 C CD  . GLU B 14  ? 0.5501 0.5389 0.4975 0.0064  0.0223  0.0612  19  GLU B CD  
1867 O OE1 . GLU B 14  ? 0.5968 0.5896 0.5434 0.0073  0.0250  0.0617  19  GLU B OE1 
1868 O OE2 . GLU B 14  ? 0.5751 0.5628 0.5254 0.0046  0.0198  0.0637  19  GLU B OE2 
1869 N N   . GLY B 15  ? 0.3161 0.2889 0.2536 0.0077  0.0187  0.0502  20  GLY B N   
1870 C CA  . GLY B 15  ? 0.3169 0.2843 0.2533 0.0060  0.0158  0.0500  20  GLY B CA  
1871 C C   . GLY B 15  ? 0.3234 0.2895 0.2627 0.0052  0.0140  0.0508  20  GLY B C   
1872 O O   . GLY B 15  ? 0.2902 0.2596 0.2328 0.0060  0.0151  0.0515  20  GLY B O   
1873 N N   . SER B 16  ? 0.3133 0.2743 0.2514 0.0034  0.0112  0.0511  21  SER B N   
1874 C CA  . SER B 16  ? 0.3488 0.3074 0.2884 0.0025  0.0091  0.0514  21  SER B CA  
1875 C C   . SER B 16  ? 0.3414 0.2930 0.2763 0.0012  0.0070  0.0496  21  SER B C   
1876 O O   . SER B 16  ? 0.3436 0.2928 0.2761 0.0006  0.0065  0.0495  21  SER B O   
1877 C CB  . SER B 16  ? 0.4221 0.3831 0.3672 0.0010  0.0074  0.0553  21  SER B CB  
1878 O OG  . SER B 16  ? 0.4303 0.3877 0.3747 -0.0009 0.0048  0.0568  21  SER B OG  
1879 N N   . VAL B 17  ? 0.3368 0.2852 0.2705 0.0009  0.0058  0.0483  22  VAL B N   
1880 C CA  . VAL B 17  ? 0.3627 0.3039 0.2914 -0.0002 0.0039  0.0465  22  VAL B CA  
1881 C C   . VAL B 17  ? 0.3917 0.3303 0.3216 -0.0018 0.0012  0.0475  22  VAL B C   
1882 O O   . VAL B 17  ? 0.3541 0.2948 0.2862 -0.0010 0.0016  0.0473  22  VAL B O   
1883 C CB  . VAL B 17  ? 0.3572 0.2964 0.2816 0.0012  0.0057  0.0428  22  VAL B CB  
1884 C CG1 . VAL B 17  ? 0.3683 0.3001 0.2877 0.0000  0.0040  0.0410  22  VAL B CG1 
1885 C CG2 . VAL B 17  ? 0.3578 0.2988 0.2806 0.0026  0.0081  0.0416  22  VAL B CG2 
1886 N N   . ASN B 18  ? 0.3521 0.2856 0.2801 -0.0040 -0.0015 0.0485  23  ASN B N   
1887 C CA  . ASN B 18  ? 0.3865 0.3179 0.3162 -0.0059 -0.0046 0.0503  23  ASN B CA  
1888 C C   . ASN B 18  ? 0.3977 0.3353 0.3346 -0.0056 -0.0047 0.0532  23  ASN B C   
1889 O O   . ASN B 18  ? 0.3987 0.3358 0.3377 -0.0063 -0.0063 0.0540  23  ASN B O   
1890 C CB  . ASN B 18  ? 0.3913 0.3170 0.3162 -0.0065 -0.0057 0.0479  23  ASN B CB  
1891 C CG  . ASN B 18  ? 0.3717 0.2898 0.2900 -0.0079 -0.0070 0.0462  23  ASN B CG  
1892 O OD1 . ASN B 18  ? 0.4443 0.3612 0.3608 -0.0078 -0.0062 0.0459  23  ASN B OD1 
1893 N ND2 . ASN B 18  ? 0.4381 0.3505 0.3524 -0.0092 -0.0088 0.0450  23  ASN B ND2 
1894 N N   . GLY B 19  ? 0.3845 0.3279 0.3256 -0.0047 -0.0029 0.0551  24  GLY B N   
1895 C CA  . GLY B 19  ? 0.3718 0.3209 0.3201 -0.0045 -0.0028 0.0581  24  GLY B CA  
1896 C C   . GLY B 19  ? 0.3920 0.3463 0.3425 -0.0019 0.0005  0.0568  24  GLY B C   
1897 O O   . GLY B 19  ? 0.3745 0.3344 0.3312 -0.0013 0.0015  0.0591  24  GLY B O   
1898 N N   . HIS B 20  ? 0.3420 0.2946 0.2879 -0.0004 0.0022  0.0532  25  HIS B N   
1899 C CA  . HIS B 20  ? 0.3730 0.3299 0.3206 0.0019  0.0052  0.0517  25  HIS B CA  
1900 C C   . HIS B 20  ? 0.3342 0.2951 0.2811 0.0035  0.0085  0.0512  25  HIS B C   
1901 O O   . HIS B 20  ? 0.3099 0.2683 0.2518 0.0038  0.0091  0.0491  25  HIS B O   
1902 C CB  . HIS B 20  ? 0.3546 0.3076 0.2976 0.0026  0.0054  0.0482  25  HIS B CB  
1903 C CG  . HIS B 20  ? 0.3886 0.3455 0.3338 0.0048  0.0079  0.0469  25  HIS B CG  
1904 N ND1 . HIS B 20  ? 0.3959 0.3558 0.3397 0.0070  0.0112  0.0449  25  HIS B ND1 
1905 C CD2 . HIS B 20  ? 0.3654 0.3232 0.3141 0.0052  0.0074  0.0471  25  HIS B CD2 
1906 C CE1 . HIS B 20  ? 0.3683 0.3308 0.3144 0.0087  0.0128  0.0439  25  HIS B CE1 
1907 N NE2 . HIS B 20  ? 0.4163 0.3777 0.3657 0.0076  0.0106  0.0452  25  HIS B NE2 
1908 N N   . GLU B 21  ? 0.3382 0.3051 0.2901 0.0047  0.0105  0.0530  26  GLU B N   
1909 C CA  . GLU B 21  ? 0.3241 0.2952 0.2756 0.0060  0.0135  0.0531  26  GLU B CA  
1910 C C   . GLU B 21  ? 0.3347 0.3076 0.2841 0.0084  0.0165  0.0501  26  GLU B C   
1911 O O   . GLU B 21  ? 0.3199 0.2935 0.2711 0.0094  0.0171  0.0491  26  GLU B O   
1912 C CB  . GLU B 21  ? 0.3749 0.3516 0.3330 0.0059  0.0143  0.0568  26  GLU B CB  
1913 C CG  . GLU B 21  ? 0.4092 0.3841 0.3698 0.0034  0.0109  0.0600  26  GLU B CG  
1914 C CD  . GLU B 21  ? 0.5350 0.5152 0.5019 0.0030  0.0116  0.0640  26  GLU B CD  
1915 O OE1 . GLU B 21  ? 0.6048 0.5903 0.5757 0.0047  0.0145  0.0647  26  GLU B OE1 
1916 O OE2 . GLU B 21  ? 0.6394 0.6183 0.6076 0.0010  0.0091  0.0666  26  GLU B OE2 
1917 N N   . PHE B 22  ? 0.2742 0.2480 0.2200 0.0093  0.0185  0.0488  27  PHE B N   
1918 C CA  . PHE B 22  ? 0.2805 0.2553 0.2234 0.0114  0.0211  0.0458  27  PHE B CA  
1919 C C   . PHE B 22  ? 0.2870 0.2641 0.2275 0.0121  0.0231  0.0457  27  PHE B C   
1920 O O   . PHE B 22  ? 0.3029 0.2805 0.2435 0.0110  0.0225  0.0477  27  PHE B O   
1921 C CB  . PHE B 22  ? 0.2906 0.2602 0.2289 0.0115  0.0199  0.0426  27  PHE B CB  
1922 C CG  . PHE B 22  ? 0.2996 0.2652 0.2339 0.0103  0.0184  0.0421  27  PHE B CG  
1923 C CD1 . PHE B 22  ? 0.2918 0.2538 0.2264 0.0082  0.0156  0.0435  27  PHE B CD1 
1924 C CD2 . PHE B 22  ? 0.3096 0.2752 0.2402 0.0111  0.0198  0.0405  27  PHE B CD2 
1925 C CE1 . PHE B 22  ? 0.3323 0.2904 0.2633 0.0072  0.0145  0.0430  27  PHE B CE1 
1926 C CE2 . PHE B 22  ? 0.3482 0.3102 0.2757 0.0101  0.0186  0.0402  27  PHE B CE2 
1927 C CZ  . PHE B 22  ? 0.3336 0.2919 0.2615 0.0082  0.0160  0.0414  27  PHE B CZ  
1928 N N   . GLU B 23  ? 0.3117 0.2905 0.2501 0.0140  0.0257  0.0435  28  GLU B N   
1929 C CA  . GLU B 23  ? 0.3353 0.3157 0.2702 0.0147  0.0275  0.0430  28  GLU B CA  
1930 C C   . GLU B 23  ? 0.3311 0.3093 0.2614 0.0160  0.0283  0.0394  28  GLU B C   
1931 O O   . GLU B 23  ? 0.3105 0.2881 0.2414 0.0171  0.0287  0.0376  28  GLU B O   
1932 C CB  . GLU B 23  ? 0.3473 0.3332 0.2845 0.0156  0.0304  0.0447  28  GLU B CB  
1933 C CG  . GLU B 23  ? 0.3994 0.3880 0.3414 0.0143  0.0298  0.0487  28  GLU B CG  
1934 C CD  . GLU B 23  ? 0.4467 0.4407 0.3905 0.0151  0.0329  0.0505  28  GLU B CD  
1935 O OE1 . GLU B 23  ? 0.5117 0.5084 0.4601 0.0141  0.0326  0.0540  28  GLU B OE1 
1936 O OE2 . GLU B 23  ? 0.4595 0.4550 0.3999 0.0166  0.0356  0.0488  28  GLU B OE2 
1937 N N   . ILE B 24  ? 0.3065 0.2835 0.2328 0.0159  0.0283  0.0386  29  ILE B N   
1938 C CA  . ILE B 24  ? 0.3294 0.3045 0.2514 0.0170  0.0290  0.0355  29  ILE B CA  
1939 C C   . ILE B 24  ? 0.3449 0.3227 0.2643 0.0176  0.0308  0.0357  29  ILE B C   
1940 O O   . ILE B 24  ? 0.3363 0.3154 0.2557 0.0166  0.0306  0.0379  29  ILE B O   
1941 C CB  . ILE B 24  ? 0.3820 0.3523 0.3016 0.0161  0.0268  0.0342  29  ILE B CB  
1942 C CG1 . ILE B 24  ? 0.3830 0.3505 0.3044 0.0156  0.0252  0.0337  29  ILE B CG1 
1943 C CG2 . ILE B 24  ? 0.3725 0.3411 0.2879 0.0172  0.0274  0.0313  29  ILE B CG2 
1944 C CD1 . ILE B 24  ? 0.4598 0.4227 0.3800 0.0141  0.0229  0.0337  29  ILE B CD1 
1945 N N   . GLU B 25  ? 0.3627 0.3408 0.2793 0.0191  0.0324  0.0333  30  GLU B N   
1946 C CA  . GLU B 25  ? 0.3604 0.3400 0.2733 0.0195  0.0339  0.0331  30  GLU B CA  
1947 C C   . GLU B 25  ? 0.3685 0.3450 0.2774 0.0202  0.0333  0.0301  30  GLU B C   
1948 O O   . GLU B 25  ? 0.3733 0.3482 0.2821 0.0212  0.0333  0.0278  30  GLU B O   
1949 C CB  . GLU B 25  ? 0.3998 0.3833 0.3131 0.0209  0.0369  0.0332  30  GLU B CB  
1950 C CG  . GLU B 25  ? 0.4742 0.4614 0.3917 0.0202  0.0378  0.0366  30  GLU B CG  
1951 C CD  . GLU B 25  ? 0.5729 0.5641 0.4909 0.0216  0.0412  0.0369  30  GLU B CD  
1952 O OE1 . GLU B 25  ? 0.6607 0.6552 0.5800 0.0210  0.0424  0.0397  30  GLU B OE1 
1953 O OE2 . GLU B 25  ? 0.6818 0.6726 0.5989 0.0232  0.0427  0.0345  30  GLU B OE2 
1954 N N   . GLY B 26  ? 0.3436 0.3195 0.2491 0.0197  0.0328  0.0302  31  GLY B N   
1955 C CA  . GLY B 26  ? 0.3578 0.3305 0.2600 0.0199  0.0318  0.0280  31  GLY B CA  
1956 C C   . GLY B 26  ? 0.3660 0.3395 0.2642 0.0199  0.0323  0.0281  31  GLY B C   
1957 O O   . GLY B 26  ? 0.3308 0.3070 0.2286 0.0193  0.0331  0.0302  31  GLY B O   
1958 N N   . GLU B 27  ? 0.3662 0.3372 0.2614 0.0203  0.0316  0.0258  32  GLU B N   
1959 C CA  . GLU B 27  ? 0.4210 0.3917 0.3121 0.0201  0.0313  0.0257  32  GLU B CA  
1960 C C   . GLU B 27  ? 0.4019 0.3690 0.2924 0.0199  0.0292  0.0243  32  GLU B C   
1961 O O   . GLU B 27  ? 0.4223 0.3874 0.3145 0.0204  0.0288  0.0228  32  GLU B O   
1962 C CB  . GLU B 27  ? 0.4801 0.4519 0.3673 0.0213  0.0332  0.0240  32  GLU B CB  
1963 C CG  . GLU B 27  ? 0.6334 0.6086 0.5214 0.0220  0.0359  0.0248  32  GLU B CG  
1964 C CD  . GLU B 27  ? 0.7411 0.7164 0.6303 0.0237  0.0374  0.0226  32  GLU B CD  
1965 O OE1 . GLU B 27  ? 0.7638 0.7363 0.6524 0.0243  0.0364  0.0202  32  GLU B OE1 
1966 O OE2 . GLU B 27  ? 0.8338 0.8119 0.7247 0.0244  0.0398  0.0233  32  GLU B OE2 
1967 N N   . GLY B 28  ? 0.4044 0.3707 0.2927 0.0191  0.0281  0.0249  33  GLY B N   
1968 C CA  . GLY B 28  ? 0.4156 0.3788 0.3037 0.0189  0.0262  0.0239  33  GLY B CA  
1969 C C   . GLY B 28  ? 0.4094 0.3723 0.2947 0.0181  0.0251  0.0247  33  GLY B C   
1970 O O   . GLY B 28  ? 0.3630 0.3280 0.2457 0.0177  0.0258  0.0259  33  GLY B O   
1971 N N   . GLU B 29  ? 0.3952 0.3554 0.2810 0.0178  0.0233  0.0242  34  GLU B N   
1972 C CA  . GLU B 29  ? 0.3957 0.3552 0.2793 0.0169  0.0217  0.0251  34  GLU B CA  
1973 C C   . GLU B 29  ? 0.3605 0.3175 0.2472 0.0164  0.0200  0.0254  34  GLU B C   
1974 O O   . GLU B 29  ? 0.3507 0.3061 0.2400 0.0169  0.0201  0.0243  34  GLU B O   
1975 C CB  . GLU B 29  ? 0.4280 0.3868 0.3070 0.0176  0.0217  0.0231  34  GLU B CB  
1976 C CG  . GLU B 29  ? 0.4727 0.4290 0.3522 0.0187  0.0215  0.0203  34  GLU B CG  
1977 C CD  . GLU B 29  ? 0.5331 0.4886 0.4079 0.0194  0.0214  0.0183  34  GLU B CD  
1978 O OE1 . GLU B 29  ? 0.5961 0.5530 0.4670 0.0193  0.0225  0.0185  34  GLU B OE1 
1979 O OE2 . GLU B 29  ? 0.5827 0.5358 0.4576 0.0198  0.0203  0.0166  34  GLU B OE2 
1980 N N   . GLY B 30  ? 0.3677 0.3244 0.2543 0.0153  0.0183  0.0270  35  GLY B N   
1981 C CA  . GLY B 30  ? 0.3759 0.3301 0.2658 0.0150  0.0168  0.0274  35  GLY B CA  
1982 C C   . GLY B 30  ? 0.3684 0.3224 0.2580 0.0138  0.0148  0.0293  35  GLY B C   
1983 O O   . GLY B 30  ? 0.3911 0.3467 0.2770 0.0132  0.0145  0.0302  35  GLY B O   
1984 N N   . ARG B 31  ? 0.3608 0.3130 0.2543 0.0134  0.0136  0.0301  36  ARG B N   
1985 C CA  . ARG B 31  ? 0.3502 0.3019 0.2447 0.0122  0.0114  0.0322  36  ARG B CA  
1986 C C   . ARG B 31  ? 0.3396 0.2913 0.2388 0.0115  0.0112  0.0344  36  ARG B C   
1987 O O   . ARG B 31  ? 0.3454 0.2951 0.2488 0.0119  0.0113  0.0341  36  ARG B O   
1988 C CB  . ARG B 31  ? 0.3913 0.3406 0.2871 0.0125  0.0101  0.0312  36  ARG B CB  
1989 C CG  . ARG B 31  ? 0.4255 0.3743 0.3176 0.0135  0.0105  0.0285  36  ARG B CG  
1990 C CD  . ARG B 31  ? 0.4790 0.4255 0.3720 0.0135  0.0086  0.0280  36  ARG B CD  
1991 N NE  . ARG B 31  ? 0.5326 0.4781 0.4228 0.0146  0.0090  0.0252  36  ARG B NE  
1992 C CZ  . ARG B 31  ? 0.6983 0.6443 0.5830 0.0148  0.0090  0.0240  36  ARG B CZ  
1993 N NH1 . ARG B 31  ? 0.7038 0.6514 0.5845 0.0139  0.0089  0.0251  36  ARG B NH1 
1994 N NH2 . ARG B 31  ? 0.7488 0.6935 0.6318 0.0158  0.0092  0.0215  36  ARG B NH2 
1995 N N   . PRO B 32  ? 0.3579 0.3117 0.2563 0.0105  0.0110  0.0366  37  PRO B N   
1996 C CA  . PRO B 32  ? 0.3830 0.3369 0.2855 0.0098  0.0110  0.0387  37  PRO B CA  
1997 C C   . PRO B 32  ? 0.4055 0.3574 0.3127 0.0093  0.0094  0.0399  37  PRO B C   
1998 O O   . PRO B 32  ? 0.4021 0.3528 0.3133 0.0093  0.0098  0.0404  37  PRO B O   
1999 C CB  . PRO B 32  ? 0.3767 0.3334 0.2770 0.0086  0.0107  0.0410  37  PRO B CB  
2000 C CG  . PRO B 32  ? 0.3996 0.3579 0.2942 0.0091  0.0116  0.0396  37  PRO B CG  
2001 C CD  . PRO B 32  ? 0.3603 0.3164 0.2537 0.0099  0.0110  0.0373  37  PRO B CD  
2002 N N   . TYR B 33  ? 0.4108 0.3620 0.3176 0.0089  0.0075  0.0404  38  TYR B N   
2003 C CA  . TYR B 33  ? 0.4186 0.3680 0.3307 0.0085  0.0061  0.0418  38  TYR B CA  
2004 C C   . TYR B 33  ? 0.4246 0.3714 0.3396 0.0096  0.0067  0.0399  38  TYR B C   
2005 O O   . TYR B 33  ? 0.4649 0.4101 0.3849 0.0095  0.0060  0.0409  38  TYR B O   
2006 C CB  . TYR B 33  ? 0.4119 0.3619 0.3235 0.0071  0.0034  0.0441  38  TYR B CB  
2007 C CG  . TYR B 33  ? 0.4182 0.3706 0.3269 0.0058  0.0027  0.0463  38  TYR B CG  
2008 C CD1 . TYR B 33  ? 0.4553 0.4095 0.3576 0.0057  0.0034  0.0456  38  TYR B CD1 
2009 C CD2 . TYR B 33  ? 0.4179 0.3709 0.3302 0.0046  0.0017  0.0492  38  TYR B CD2 
2010 C CE1 . TYR B 33  ? 0.4079 0.3644 0.3075 0.0044  0.0030  0.0477  38  TYR B CE1 
2011 C CE2 . TYR B 33  ? 0.4237 0.3790 0.3336 0.0033  0.0011  0.0514  38  TYR B CE2 
2012 C CZ  . TYR B 33  ? 0.4479 0.4050 0.3512 0.0032  0.0018  0.0507  38  TYR B CZ  
2013 O OH  . TYR B 33  ? 0.4397 0.3991 0.3405 0.0019  0.0015  0.0530  38  TYR B OH  
2014 N N   . GLU B 34  ? 0.3844 0.3308 0.2967 0.0108  0.0080  0.0372  39  GLU B N   
2015 C CA  . GLU B 34  ? 0.4065 0.3505 0.3212 0.0119  0.0089  0.0353  39  GLU B CA  
2016 C C   . GLU B 34  ? 0.3821 0.3252 0.2975 0.0127  0.0112  0.0339  39  GLU B C   
2017 O O   . GLU B 34  ? 0.3747 0.3156 0.2920 0.0135  0.0122  0.0324  39  GLU B O   
2018 C CB  . GLU B 34  ? 0.4345 0.3784 0.3457 0.0125  0.0086  0.0332  39  GLU B CB  
2019 C CG  . GLU B 34  ? 0.4878 0.4323 0.3972 0.0115  0.0061  0.0347  39  GLU B CG  
2020 C CD  . GLU B 34  ? 0.5525 0.4962 0.4589 0.0119  0.0053  0.0329  39  GLU B CD  
2021 O OE1 . GLU B 34  ? 0.5794 0.5219 0.4864 0.0131  0.0065  0.0306  39  GLU B OE1 
2022 O OE2 . GLU B 34  ? 0.5727 0.5171 0.4758 0.0110  0.0033  0.0338  39  GLU B OE2 
2023 N N   . GLY B 35  ? 0.3890 0.3337 0.3025 0.0123  0.0119  0.0343  40  GLY B N   
2024 C CA  . GLY B 35  ? 0.3596 0.3033 0.2734 0.0129  0.0138  0.0331  40  GLY B CA  
2025 C C   . GLY B 35  ? 0.3625 0.3059 0.2736 0.0139  0.0151  0.0304  40  GLY B C   
2026 O O   . GLY B 35  ? 0.3652 0.3068 0.2771 0.0144  0.0163  0.0292  40  GLY B O   
2027 N N   . THR B 36  ? 0.3558 0.3008 0.2632 0.0142  0.0149  0.0295  41  THR B N   
2028 C CA  . THR B 36  ? 0.3379 0.2826 0.2432 0.0153  0.0160  0.0271  41  THR B CA  
2029 C C   . THR B 36  ? 0.3373 0.2848 0.2390 0.0153  0.0166  0.0270  41  THR B C   
2030 O O   . THR B 36  ? 0.3626 0.3121 0.2623 0.0147  0.0159  0.0282  41  THR B O   
2031 C CB  . THR B 36  ? 0.3604 0.3039 0.2651 0.0159  0.0154  0.0256  41  THR B CB  
2032 O OG1 . THR B 36  ? 0.3732 0.3182 0.2759 0.0153  0.0139  0.0266  41  THR B OG1 
2033 C CG2 . THR B 36  ? 0.3958 0.3367 0.3046 0.0160  0.0152  0.0257  41  THR B CG2 
2034 N N   . GLN B 37  ? 0.3310 0.2786 0.2319 0.0160  0.0180  0.0255  42  GLN B N   
2035 C CA  . GLN B 37  ? 0.3848 0.3349 0.2829 0.0162  0.0188  0.0252  42  GLN B CA  
2036 C C   . GLN B 37  ? 0.3806 0.3301 0.2783 0.0172  0.0200  0.0231  42  GLN B C   
2037 O O   . GLN B 37  ? 0.3485 0.2957 0.2480 0.0174  0.0203  0.0223  42  GLN B O   
2038 C CB  . GLN B 37  ? 0.3969 0.3490 0.2957 0.0153  0.0191  0.0275  42  GLN B CB  
2039 C CG  . GLN B 37  ? 0.4146 0.3652 0.3163 0.0151  0.0195  0.0278  42  GLN B CG  
2040 C CD  . GLN B 37  ? 0.4337 0.3860 0.3365 0.0141  0.0194  0.0301  42  GLN B CD  
2041 O OE1 . GLN B 37  ? 0.5542 0.5095 0.4555 0.0141  0.0201  0.0308  42  GLN B OE1 
2042 N NE2 . GLN B 37  ? 0.4270 0.3776 0.3325 0.0134  0.0188  0.0313  42  GLN B NE2 
2043 N N   . THR B 38  ? 0.3932 0.3448 0.2883 0.0178  0.0208  0.0222  43  THR B N   
2044 C CA  . THR B 38  ? 0.3781 0.3294 0.2731 0.0188  0.0219  0.0204  43  THR B CA  
2045 C C   . THR B 38  ? 0.3818 0.3362 0.2760 0.0189  0.0231  0.0211  43  THR B C   
2046 O O   . THR B 38  ? 0.3724 0.3289 0.2648 0.0185  0.0233  0.0223  43  THR B O   
2047 C CB  . THR B 38  ? 0.4257 0.3761 0.3186 0.0197  0.0217  0.0181  43  THR B CB  
2048 O OG1 . THR B 38  ? 0.5036 0.4558 0.3934 0.0198  0.0218  0.0183  43  THR B OG1 
2049 C CG2 . THR B 38  ? 0.4520 0.3995 0.3462 0.0196  0.0205  0.0176  43  THR B CG2 
2050 N N   . ALA B 39  ? 0.3627 0.3171 0.2582 0.0193  0.0239  0.0204  44  ALA B N   
2051 C CA  . ALA B 39  ? 0.3568 0.3141 0.2524 0.0195  0.0252  0.0212  44  ALA B CA  
2052 C C   . ALA B 39  ? 0.3692 0.3264 0.2654 0.0205  0.0260  0.0195  44  ALA B C   
2053 O O   . ALA B 39  ? 0.3679 0.3226 0.2650 0.0206  0.0254  0.0183  44  ALA B O   
2054 C CB  . ALA B 39  ? 0.3518 0.3097 0.2501 0.0184  0.0249  0.0235  44  ALA B CB  
2055 N N   . LYS B 40  ? 0.3657 0.3257 0.2614 0.0211  0.0274  0.0196  45  LYS B N   
2056 C CA  . LYS B 40  ? 0.4010 0.3616 0.2978 0.0222  0.0284  0.0183  45  LYS B CA  
2057 C C   . LYS B 40  ? 0.3508 0.3142 0.2503 0.0218  0.0293  0.0204  45  LYS B C   
2058 O O   . LYS B 40  ? 0.3386 0.3048 0.2373 0.0217  0.0304  0.0217  45  LYS B O   
2059 C CB  . LYS B 40  ? 0.4529 0.4144 0.3470 0.0235  0.0296  0.0165  45  LYS B CB  
2060 C CG  . LYS B 40  ? 0.5057 0.4674 0.4015 0.0246  0.0305  0.0150  45  LYS B CG  
2061 C CD  . LYS B 40  ? 0.5678 0.5293 0.4608 0.0260  0.0314  0.0126  45  LYS B CD  
2062 C CE  . LYS B 40  ? 0.6261 0.5851 0.5159 0.0259  0.0300  0.0113  45  LYS B CE  
2063 N NZ  . LYS B 40  ? 0.6939 0.6535 0.5802 0.0253  0.0300  0.0121  45  LYS B NZ  
2064 N N   . LEU B 41  ? 0.3366 0.2989 0.2390 0.0213  0.0286  0.0209  46  LEU B N   
2065 C CA  . LEU B 41  ? 0.3457 0.3102 0.2511 0.0207  0.0289  0.0230  46  LEU B CA  
2066 C C   . LEU B 41  ? 0.3352 0.3008 0.2430 0.0216  0.0298  0.0224  46  LEU B C   
2067 O O   . LEU B 41  ? 0.3600 0.3234 0.2679 0.0222  0.0292  0.0206  46  LEU B O   
2068 C CB  . LEU B 41  ? 0.3736 0.3356 0.2807 0.0193  0.0271  0.0243  46  LEU B CB  
2069 C CG  . LEU B 41  ? 0.4114 0.3718 0.3173 0.0182  0.0261  0.0252  46  LEU B CG  
2070 C CD1 . LEU B 41  ? 0.4007 0.3642 0.3058 0.0180  0.0268  0.0269  46  LEU B CD1 
2071 C CD2 . LEU B 41  ? 0.4422 0.3994 0.3460 0.0185  0.0254  0.0233  46  LEU B CD2 
2072 N N   . LYS B 42  ? 0.3157 0.2847 0.2261 0.0217  0.0310  0.0242  47  LYS B N   
2073 C CA  . LYS B 42  ? 0.3491 0.3193 0.2627 0.0225  0.0317  0.0240  47  LYS B CA  
2074 C C   . LYS B 42  ? 0.3278 0.2995 0.2457 0.0213  0.0310  0.0270  47  LYS B C   
2075 O O   . LYS B 42  ? 0.3202 0.2942 0.2387 0.0206  0.0315  0.0292  47  LYS B O   
2076 C CB  . LYS B 42  ? 0.3904 0.3636 0.3032 0.0242  0.0344  0.0232  47  LYS B CB  
2077 C CG  . LYS B 42  ? 0.4303 0.4019 0.3384 0.0251  0.0348  0.0205  47  LYS B CG  
2078 C CD  . LYS B 42  ? 0.5033 0.4775 0.4098 0.0267  0.0376  0.0196  47  LYS B CD  
2079 C CE  . LYS B 42  ? 0.5588 0.5306 0.4609 0.0277  0.0376  0.0165  47  LYS B CE  
2080 N NZ  . LYS B 42  ? 0.6368 0.6079 0.5345 0.0269  0.0370  0.0167  47  LYS B NZ  
2081 N N   . VAL B 43  ? 0.3118 0.2818 0.2325 0.0208  0.0295  0.0272  48  VAL B N   
2082 C CA  . VAL B 43  ? 0.3077 0.2795 0.2328 0.0198  0.0291  0.0299  48  VAL B CA  
2083 C C   . VAL B 43  ? 0.3184 0.2949 0.2468 0.0212  0.0316  0.0307  48  VAL B C   
2084 O O   . VAL B 43  ? 0.3275 0.3044 0.2571 0.0225  0.0325  0.0292  48  VAL B O   
2085 C CB  . VAL B 43  ? 0.2945 0.2634 0.2217 0.0189  0.0268  0.0300  48  VAL B CB  
2086 C CG1 . VAL B 43  ? 0.3007 0.2713 0.2325 0.0177  0.0259  0.0331  48  VAL B CG1 
2087 C CG2 . VAL B 43  ? 0.3352 0.2993 0.2587 0.0178  0.0248  0.0289  48  VAL B CG2 
2088 N N   . THR B 44  ? 0.3342 0.3141 0.2640 0.0209  0.0329  0.0331  49  THR B N   
2089 C CA  . THR B 44  ? 0.3476 0.3320 0.2804 0.0223  0.0357  0.0339  49  THR B CA  
2090 C C   . THR B 44  ? 0.3151 0.3022 0.2542 0.0217  0.0356  0.0371  49  THR B C   
2091 O O   . THR B 44  ? 0.3085 0.2993 0.2512 0.0229  0.0381  0.0378  49  THR B O   
2092 C CB  . THR B 44  ? 0.3583 0.3452 0.2880 0.0226  0.0380  0.0345  49  THR B CB  
2093 O OG1 . THR B 44  ? 0.3799 0.3667 0.3095 0.0208  0.0364  0.0369  49  THR B OG1 
2094 C CG2 . THR B 44  ? 0.3904 0.3754 0.3140 0.0236  0.0386  0.0314  49  THR B CG2 
2095 N N   . LYS B 45  ? 0.2913 0.2765 0.2323 0.0198  0.0327  0.0389  50  LYS B N   
2096 C CA  . LYS B 45  ? 0.2906 0.2774 0.2379 0.0189  0.0316  0.0417  50  LYS B CA  
2097 C C   . LYS B 45  ? 0.2976 0.2798 0.2446 0.0170  0.0278  0.0420  50  LYS B C   
2098 O O   . LYS B 45  ? 0.2998 0.2787 0.2426 0.0160  0.0263  0.0411  50  LYS B O   
2099 C CB  . LYS B 45  ? 0.3316 0.3221 0.2817 0.0180  0.0324  0.0453  50  LYS B CB  
2100 C CG  . LYS B 45  ? 0.3875 0.3827 0.3384 0.0197  0.0363  0.0457  50  LYS B CG  
2101 C CD  . LYS B 45  ? 0.4342 0.4333 0.3892 0.0187  0.0368  0.0497  50  LYS B CD  
2102 C CE  . LYS B 45  ? 0.4510 0.4546 0.4058 0.0202  0.0410  0.0501  50  LYS B CE  
2103 N NZ  . LYS B 45  ? 0.5417 0.5488 0.5002 0.0190  0.0412  0.0542  50  LYS B NZ  
2104 N N   . GLY B 46  ? 0.3203 0.3024 0.2720 0.0165  0.0264  0.0431  51  GLY B N   
2105 C CA  . GLY B 46  ? 0.3209 0.2985 0.2725 0.0146  0.0228  0.0436  51  GLY B CA  
2106 C C   . GLY B 46  ? 0.3371 0.3104 0.2848 0.0150  0.0218  0.0403  51  GLY B C   
2107 O O   . GLY B 46  ? 0.3538 0.3227 0.3002 0.0133  0.0188  0.0404  51  GLY B O   
2108 N N   . GLY B 47  ? 0.3180 0.2921 0.2637 0.0170  0.0240  0.0375  52  GLY B N   
2109 C CA  . GLY B 47  ? 0.3355 0.3054 0.2776 0.0172  0.0230  0.0346  52  GLY B CA  
2110 C C   . GLY B 47  ? 0.3394 0.3089 0.2853 0.0174  0.0220  0.0346  52  GLY B C   
2111 O O   . GLY B 47  ? 0.3294 0.3027 0.2808 0.0182  0.0231  0.0362  52  GLY B O   
2112 N N   . PRO B 48  ? 0.3626 0.3277 0.3060 0.0167  0.0199  0.0330  53  PRO B N   
2113 C CA  . PRO B 48  ? 0.3733 0.3336 0.3105 0.0159  0.0187  0.0311  53  PRO B CA  
2114 C C   . PRO B 48  ? 0.3597 0.3173 0.2960 0.0135  0.0163  0.0331  53  PRO B C   
2115 O O   . PRO B 48  ? 0.3790 0.3370 0.3192 0.0122  0.0146  0.0355  53  PRO B O   
2116 C CB  . PRO B 48  ? 0.3846 0.3415 0.3209 0.0158  0.0173  0.0294  53  PRO B CB  
2117 C CG  . PRO B 48  ? 0.3795 0.3382 0.3218 0.0153  0.0161  0.0315  53  PRO B CG  
2118 C CD  . PRO B 48  ? 0.3894 0.3537 0.3364 0.0166  0.0185  0.0332  53  PRO B CD  
2119 N N   . LEU B 49  ? 0.3776 0.3324 0.3090 0.0130  0.0161  0.0320  54  LEU B N   
2120 C CA  . LEU B 49  ? 0.3539 0.3058 0.2841 0.0109  0.0141  0.0337  54  LEU B CA  
2121 C C   . LEU B 49  ? 0.3656 0.3123 0.2937 0.0093  0.0115  0.0332  54  LEU B C   
2122 O O   . LEU B 49  ? 0.4265 0.3708 0.3519 0.0099  0.0117  0.0309  54  LEU B O   
2123 C CB  . LEU B 49  ? 0.3496 0.3006 0.2759 0.0109  0.0150  0.0329  54  LEU B CB  
2124 C CG  . LEU B 49  ? 0.3528 0.3087 0.2801 0.0124  0.0176  0.0332  54  LEU B CG  
2125 C CD1 . LEU B 49  ? 0.3533 0.3077 0.2767 0.0124  0.0181  0.0323  54  LEU B CD1 
2126 C CD2 . LEU B 49  ? 0.3944 0.3543 0.3264 0.0120  0.0177  0.0362  54  LEU B CD2 
2127 N N   . PRO B 50  ? 0.3640 0.3084 0.2928 0.0072  0.0091  0.0354  55  PRO B N   
2128 C CA  . PRO B 50  ? 0.3974 0.3361 0.3235 0.0053  0.0064  0.0351  55  PRO B CA  
2129 C C   . PRO B 50  ? 0.4568 0.3902 0.3772 0.0041  0.0057  0.0341  55  PRO B C   
2130 O O   . PRO B 50  ? 0.4606 0.3893 0.3790 0.0020  0.0031  0.0350  55  PRO B O   
2131 C CB  . PRO B 50  ? 0.3953 0.3346 0.3256 0.0036  0.0039  0.0383  55  PRO B CB  
2132 C CG  . PRO B 50  ? 0.4063 0.3492 0.3390 0.0037  0.0049  0.0402  55  PRO B CG  
2133 C CD  . PRO B 50  ? 0.3938 0.3412 0.3267 0.0063  0.0085  0.0386  55  PRO B CD  
2134 N N   . PHE B 51  ? 0.4055 0.3393 0.3233 0.0054  0.0079  0.0324  56  PHE B N   
2135 C CA  . PHE B 51  ? 0.3948 0.3238 0.3078 0.0045  0.0076  0.0313  56  PHE B CA  
2136 C C   . PHE B 51  ? 0.3675 0.2972 0.2783 0.0063  0.0100  0.0289  56  PHE B C   
2137 O O   . PHE B 51  ? 0.3852 0.3192 0.2979 0.0081  0.0119  0.0283  56  PHE B O   
2138 C CB  . PHE B 51  ? 0.3941 0.3233 0.3082 0.0032  0.0067  0.0336  56  PHE B CB  
2139 C CG  . PHE B 51  ? 0.3756 0.3108 0.2932 0.0045  0.0085  0.0348  56  PHE B CG  
2140 C CD1 . PHE B 51  ? 0.3676 0.3039 0.2835 0.0058  0.0105  0.0334  56  PHE B CD1 
2141 C CD2 . PHE B 51  ? 0.3736 0.3133 0.2963 0.0044  0.0081  0.0374  56  PHE B CD2 
2142 C CE1 . PHE B 51  ? 0.3792 0.3209 0.2977 0.0069  0.0122  0.0345  56  PHE B CE1 
2143 C CE2 . PHE B 51  ? 0.3949 0.3403 0.3205 0.0057  0.0102  0.0384  56  PHE B CE2 
2144 C CZ  . PHE B 51  ? 0.3726 0.3188 0.2958 0.0069  0.0121  0.0369  56  PHE B CZ  
2145 N N   . ALA B 52  ? 0.3845 0.3096 0.2911 0.0057  0.0101  0.0276  57  ALA B N   
2146 C CA  . ALA B 52  ? 0.3564 0.2811 0.2607 0.0072  0.0121  0.0254  57  ALA B CA  
2147 C C   . ALA B 52  ? 0.3387 0.2679 0.2449 0.0085  0.0138  0.0258  57  ALA B C   
2148 O O   . ALA B 52  ? 0.3497 0.2797 0.2569 0.0078  0.0135  0.0275  57  ALA B O   
2149 C CB  . ALA B 52  ? 0.3642 0.2830 0.2643 0.0062  0.0119  0.0244  57  ALA B CB  
2150 N N   . TRP B 53  ? 0.3395 0.2715 0.2461 0.0102  0.0154  0.0244  58  TRP B N   
2151 C CA  . TRP B 53  ? 0.3684 0.3042 0.2760 0.0113  0.0169  0.0246  58  TRP B CA  
2152 C C   . TRP B 53  ? 0.3860 0.3195 0.2919 0.0109  0.0170  0.0246  58  TRP B C   
2153 O O   . TRP B 53  ? 0.3398 0.2759 0.2469 0.0109  0.0174  0.0260  58  TRP B O   
2154 C CB  . TRP B 53  ? 0.3846 0.3225 0.2920 0.0131  0.0183  0.0227  58  TRP B CB  
2155 C CG  . TRP B 53  ? 0.4167 0.3579 0.3244 0.0141  0.0196  0.0229  58  TRP B CG  
2156 C CD1 . TRP B 53  ? 0.4305 0.3706 0.3364 0.0144  0.0202  0.0220  58  TRP B CD1 
2157 C CD2 . TRP B 53  ? 0.4019 0.3480 0.3117 0.0148  0.0205  0.0241  58  TRP B CD2 
2158 N NE1 . TRP B 53  ? 0.4164 0.3603 0.3230 0.0151  0.0211  0.0227  58  TRP B NE1 
2159 C CE2 . TRP B 53  ? 0.3993 0.3469 0.3079 0.0154  0.0215  0.0239  58  TRP B CE2 
2160 C CE3 . TRP B 53  ? 0.4425 0.3920 0.3552 0.0150  0.0207  0.0253  58  TRP B CE3 
2161 C CZ2 . TRP B 53  ? 0.3853 0.3373 0.2948 0.0161  0.0226  0.0249  58  TRP B CZ2 
2162 C CZ3 . TRP B 53  ? 0.4036 0.3577 0.3176 0.0158  0.0222  0.0263  58  TRP B CZ3 
2163 C CH2 . TRP B 53  ? 0.4190 0.3741 0.3310 0.0163  0.0231  0.0260  58  TRP B CH2 
2164 N N   . ASP B 54  ? 0.3707 0.2992 0.2738 0.0104  0.0168  0.0233  59  ASP B N   
2165 C CA  . ASP B 54  ? 0.3718 0.2980 0.2736 0.0101  0.0172  0.0231  59  ASP B CA  
2166 C C   . ASP B 54  ? 0.3730 0.2995 0.2760 0.0091  0.0165  0.0253  59  ASP B C   
2167 O O   . ASP B 54  ? 0.4266 0.3533 0.3298 0.0093  0.0170  0.0256  59  ASP B O   
2168 C CB  . ASP B 54  ? 0.3894 0.3096 0.2881 0.0095  0.0171  0.0217  59  ASP B CB  
2169 C CG  . ASP B 54  ? 0.4013 0.3209 0.2988 0.0106  0.0182  0.0195  59  ASP B CG  
2170 O OD1 . ASP B 54  ? 0.4358 0.3587 0.3345 0.0120  0.0192  0.0189  59  ASP B OD1 
2171 O OD2 . ASP B 54  ? 0.4409 0.3565 0.3360 0.0101  0.0179  0.0184  59  ASP B OD2 
2172 N N   . ILE B 55  ? 0.3637 0.2904 0.2678 0.0079  0.0150  0.0269  60  ILE B N   
2173 C CA  . ILE B 55  ? 0.3952 0.3221 0.3006 0.0068  0.0142  0.0291  60  ILE B CA  
2174 C C   . ILE B 55  ? 0.3617 0.2945 0.2700 0.0076  0.0150  0.0306  60  ILE B C   
2175 O O   . ILE B 55  ? 0.3717 0.3050 0.2810 0.0070  0.0147  0.0322  60  ILE B O   
2176 C CB  . ILE B 55  ? 0.4211 0.3461 0.3270 0.0050  0.0121  0.0307  60  ILE B CB  
2177 C CG1 . ILE B 55  ? 0.4354 0.3644 0.3442 0.0051  0.0115  0.0320  60  ILE B CG1 
2178 C CG2 . ILE B 55  ? 0.4522 0.3705 0.3544 0.0039  0.0111  0.0294  60  ILE B CG2 
2179 C CD1 . ILE B 55  ? 0.4373 0.3657 0.3479 0.0033  0.0093  0.0345  60  ILE B CD1 
2180 N N   . LEU B 56  ? 0.3352 0.2722 0.2446 0.0089  0.0161  0.0302  61  LEU B N   
2181 C CA  . LEU B 56  ? 0.3585 0.3008 0.2697 0.0097  0.0172  0.0313  61  LEU B CA  
2182 C C   . LEU B 56  ? 0.3688 0.3114 0.2785 0.0108  0.0184  0.0300  61  LEU B C   
2183 O O   . LEU B 56  ? 0.3466 0.2923 0.2571 0.0110  0.0189  0.0312  61  LEU B O   
2184 C CB  . LEU B 56  ? 0.3211 0.2676 0.2341 0.0107  0.0180  0.0314  61  LEU B CB  
2185 C CG  . LEU B 56  ? 0.3409 0.2873 0.2561 0.0097  0.0167  0.0328  61  LEU B CG  
2186 C CD1 . LEU B 56  ? 0.3559 0.3067 0.2734 0.0108  0.0179  0.0330  61  LEU B CD1 
2187 C CD2 . LEU B 56  ? 0.3493 0.2960 0.2666 0.0081  0.0153  0.0356  61  LEU B CD2 
2188 N N   . SER B 57  ? 0.3530 0.2927 0.2606 0.0114  0.0188  0.0276  62  SER B N   
2189 C CA  . SER B 57  ? 0.3714 0.3116 0.2780 0.0125  0.0198  0.0264  62  SER B CA  
2190 C C   . SER B 57  ? 0.3296 0.2701 0.2367 0.0121  0.0197  0.0276  62  SER B C   
2191 O O   . SER B 57  ? 0.3504 0.2937 0.2575 0.0128  0.0203  0.0279  62  SER B O   
2192 C CB  . SER B 57  ? 0.4138 0.3504 0.3185 0.0131  0.0201  0.0240  62  SER B CB  
2193 O OG  . SER B 57  ? 0.4545 0.3863 0.3582 0.0120  0.0195  0.0238  62  SER B OG  
2194 N N   . PRO B 58  ? 0.3415 0.2788 0.2488 0.0110  0.0189  0.0284  63  PRO B N   
2195 C CA  . PRO B 58  ? 0.3566 0.2939 0.2648 0.0107  0.0188  0.0296  63  PRO B CA  
2196 C C   . PRO B 58  ? 0.3775 0.3189 0.2875 0.0102  0.0184  0.0321  63  PRO B C   
2197 O O   . PRO B 58  ? 0.3821 0.3237 0.2930 0.0099  0.0181  0.0333  63  PRO B O   
2198 C CB  . PRO B 58  ? 0.3887 0.3209 0.2966 0.0098  0.0182  0.0295  63  PRO B CB  
2199 C CG  . PRO B 58  ? 0.3990 0.3285 0.3053 0.0095  0.0179  0.0283  63  PRO B CG  
2200 C CD  . PRO B 58  ? 0.3709 0.3042 0.2776 0.0100  0.0180  0.0283  63  PRO B CD  
2201 N N   . GLN B 59  ? 0.3694 0.3140 0.2801 0.0101  0.0185  0.0331  64  GLN B N   
2202 C CA  . GLN B 59  ? 0.3791 0.3276 0.2915 0.0096  0.0183  0.0357  64  GLN B CA  
2203 C C   . GLN B 59  ? 0.4300 0.3827 0.3418 0.0105  0.0195  0.0358  64  GLN B C   
2204 O O   . GLN B 59  ? 0.4289 0.3847 0.3416 0.0101  0.0195  0.0379  64  GLN B O   
2205 C CB  . GLN B 59  ? 0.4056 0.3555 0.3198 0.0089  0.0178  0.0372  64  GLN B CB  
2206 C CG  . GLN B 59  ? 0.3842 0.3298 0.2983 0.0079  0.0165  0.0368  64  GLN B CG  
2207 C CD  . GLN B 59  ? 0.4060 0.3469 0.3196 0.0069  0.0154  0.0369  64  GLN B CD  
2208 O OE1 . GLN B 59  ? 0.3926 0.3341 0.3070 0.0066  0.0152  0.0381  64  GLN B OE1 
2209 N NE2 . GLN B 59  ? 0.3906 0.3267 0.3027 0.0062  0.0146  0.0358  64  GLN B NE2 
2210 N N   . PHE B 60  ? 0.3913 0.3439 0.3013 0.0118  0.0203  0.0335  65  PHE B N   
2211 C CA  . PHE B 60  ? 0.4661 0.4219 0.3747 0.0127  0.0213  0.0332  65  PHE B CA  
2212 C C   . PHE B 60  ? 0.5224 0.4770 0.4300 0.0126  0.0209  0.0330  65  PHE B C   
2213 O O   . PHE B 60  ? 0.5831 0.5381 0.4888 0.0135  0.0213  0.0316  65  PHE B O   
2214 C CB  . PHE B 60  ? 0.4437 0.3999 0.3509 0.0139  0.0223  0.0309  65  PHE B CB  
2215 C CG  . PHE B 60  ? 0.4203 0.3776 0.3292 0.0139  0.0226  0.0313  65  PHE B CG  
2216 C CD1 . PHE B 60  ? 0.4716 0.4329 0.3819 0.0138  0.0234  0.0332  65  PHE B CD1 
2217 C CD2 . PHE B 60  ? 0.4246 0.3789 0.3337 0.0139  0.0221  0.0300  65  PHE B CD2 
2218 C CE1 . PHE B 60  ? 0.4654 0.4278 0.3779 0.0137  0.0235  0.0339  65  PHE B CE1 
2219 C CE2 . PHE B 60  ? 0.4285 0.3838 0.3395 0.0137  0.0220  0.0306  65  PHE B CE2 
2220 C CZ  . PHE B 60  ? 0.4437 0.4032 0.3567 0.0137  0.0227  0.0326  65  PHE B CZ  
2221 N N1  . CH6 B 61  ? 0.6129 0.5649 0.5213 0.0120  0.0200  0.0334  66  CH6 B N1  
2222 C CE  . CH6 B 61  ? 0.6923 0.6419 0.5938 0.0165  0.0219  0.0243  66  CH6 B CE  
2223 S SD  . CH6 B 61  ? 0.7601 0.7077 0.6637 0.0156  0.0217  0.0252  66  CH6 B SD  
2224 C CG1 . CH6 B 61  ? 0.7788 0.7266 0.6841 0.0144  0.0208  0.0279  66  CH6 B CG1 
2225 C CB1 . CH6 B 61  ? 0.7837 0.7302 0.6905 0.0134  0.0205  0.0291  66  CH6 B CB1 
2226 C CA1 . CH6 B 61  ? 0.7330 0.6809 0.6413 0.0123  0.0197  0.0317  66  CH6 B CA1 
2227 C C1  . CH6 B 61  ? 0.7598 0.7046 0.6699 0.0113  0.0190  0.0327  66  CH6 B C1  
2228 N N2  . CH6 B 61  ? 0.7800 0.7203 0.6901 0.0114  0.0190  0.0311  66  CH6 B N2  
2229 O OH  . CH6 B 61  ? 0.7863 0.7029 0.6915 0.0119  0.0221  0.0227  66  CH6 B OH  
2230 C CD2 . CH6 B 61  ? 0.8190 0.7430 0.7291 0.0103  0.0194  0.0285  66  CH6 B CD2 
2231 C CE2 . CH6 B 61  ? 0.8133 0.7331 0.7218 0.0108  0.0205  0.0264  66  CH6 B CE2 
2232 C CZ  . CH6 B 61  ? 0.8617 0.7823 0.7686 0.0116  0.0211  0.0247  66  CH6 B CZ  
2233 C CE1 . CH6 B 61  ? 0.8363 0.7617 0.7433 0.0120  0.0207  0.0251  66  CH6 B CE1 
2234 C CD1 . CH6 B 61  ? 0.8204 0.7499 0.7288 0.0116  0.0199  0.0272  66  CH6 B CD1 
2235 C CG2 . CH6 B 61  ? 0.8264 0.7552 0.7364 0.0107  0.0192  0.0290  66  CH6 B CG2 
2236 C CB2 . CH6 B 61  ? 0.8170 0.7498 0.7286 0.0101  0.0184  0.0315  66  CH6 B CB2 
2237 C CA2 . CH6 B 61  ? 0.7781 0.7161 0.6895 0.0105  0.0184  0.0324  66  CH6 B CA2 
2238 C C2  . CH6 B 61  ? 0.7837 0.7253 0.6964 0.0097  0.0177  0.0349  66  CH6 B C2  
2239 O O2  . CH6 B 61  ? 0.7836 0.7240 0.6979 0.0086  0.0168  0.0366  66  CH6 B O2  
2240 N N3  . CH6 B 61  ? 0.6717 0.6174 0.5835 0.0102  0.0182  0.0352  66  CH6 B N3  
2241 C CA3 . CH6 B 61  ? 0.6747 0.6244 0.5874 0.0095  0.0178  0.0377  66  CH6 B CA3 
2242 C C3  . CH6 B 61  ? 0.6381 0.5921 0.5497 0.0098  0.0183  0.0385  66  CH6 B C3  
2243 O O3  . CH6 B 61  ? 0.6528 0.6104 0.5647 0.0094  0.0186  0.0403  66  CH6 B O3  
2244 N N   . SER B 62  ? 0.4735 0.4263 0.3847 0.0101  0.0180  0.0379  69  SER B N   
2245 C CA  . SER B 62  ? 0.4794 0.4348 0.3887 0.0105  0.0182  0.0381  69  SER B CA  
2246 C C   . SER B 62  ? 0.5076 0.4615 0.4182 0.0100  0.0171  0.0389  69  SER B C   
2247 O O   . SER B 62  ? 0.4738 0.4264 0.3837 0.0106  0.0169  0.0376  69  SER B O   
2248 C CB  . SER B 62  ? 0.4804 0.4359 0.3873 0.0117  0.0192  0.0355  69  SER B CB  
2249 O OG  . SER B 62  ? 0.4686 0.4205 0.3763 0.0122  0.0193  0.0337  69  SER B OG  
2250 N N   . LYS B 63  ? 0.4694 0.4235 0.3821 0.0089  0.0162  0.0413  70  LYS B N   
2251 C CA  . LYS B 63  ? 0.4618 0.4138 0.3769 0.0084  0.0150  0.0423  70  LYS B CA  
2252 C C   . LYS B 63  ? 0.4196 0.3733 0.3340 0.0081  0.0142  0.0434  70  LYS B C   
2253 O O   . LYS B 63  ? 0.4435 0.3955 0.3600 0.0078  0.0132  0.0439  70  LYS B O   
2254 C CB  . LYS B 63  ? 0.5045 0.4562 0.4223 0.0072  0.0142  0.0446  70  LYS B CB  
2255 C CG  . LYS B 63  ? 0.4938 0.4417 0.4127 0.0073  0.0145  0.0433  70  LYS B CG  
2256 C CD  . LYS B 63  ? 0.5097 0.4535 0.4301 0.0078  0.0145  0.0419  70  LYS B CD  
2257 C CE  . LYS B 63  ? 0.5694 0.5087 0.4904 0.0078  0.0149  0.0407  70  LYS B CE  
2258 N NZ  . LYS B 63  ? 0.6002 0.5385 0.5187 0.0084  0.0159  0.0385  70  LYS B NZ  
2259 N N   . ALA B 64  ? 0.3654 0.3225 0.2768 0.0081  0.0146  0.0437  71  ALA B N   
2260 C CA  . ALA B 64  ? 0.3874 0.3459 0.2971 0.0077  0.0137  0.0446  71  ALA B CA  
2261 C C   . ALA B 64  ? 0.3414 0.2975 0.2505 0.0086  0.0134  0.0424  71  ALA B C   
2262 O O   . ALA B 64  ? 0.3716 0.3278 0.2806 0.0081  0.0120  0.0434  71  ALA B O   
2263 C CB  . ALA B 64  ? 0.3704 0.3324 0.2761 0.0077  0.0146  0.0449  71  ALA B CB  
2264 N N   . TYR B 65  ? 0.3421 0.2964 0.2512 0.0097  0.0145  0.0399  72  TYR B N   
2265 C CA  . TYR B 65  ? 0.3462 0.2985 0.2546 0.0107  0.0145  0.0377  72  TYR B CA  
2266 C C   . TYR B 65  ? 0.3582 0.3069 0.2703 0.0110  0.0144  0.0370  72  TYR B C   
2267 O O   . TYR B 65  ? 0.4148 0.3613 0.3269 0.0119  0.0154  0.0348  72  TYR B O   
2268 C CB  . TYR B 65  ? 0.3308 0.2834 0.2362 0.0118  0.0159  0.0351  72  TYR B CB  
2269 C CG  . TYR B 65  ? 0.3485 0.3042 0.2500 0.0119  0.0164  0.0350  72  TYR B CG  
2270 C CD1 . TYR B 65  ? 0.3556 0.3138 0.2563 0.0117  0.0174  0.0360  72  TYR B CD1 
2271 C CD2 . TYR B 65  ? 0.3493 0.3051 0.2476 0.0123  0.0160  0.0339  72  TYR B CD2 
2272 C CE1 . TYR B 65  ? 0.3706 0.3316 0.2676 0.0119  0.0184  0.0359  72  TYR B CE1 
2273 C CE2 . TYR B 65  ? 0.3666 0.3247 0.2608 0.0126  0.0169  0.0335  72  TYR B CE2 
2274 C CZ  . TYR B 65  ? 0.3734 0.3341 0.2669 0.0124  0.0182  0.0345  72  TYR B CZ  
2275 O OH  . TYR B 65  ? 0.3774 0.3405 0.2670 0.0127  0.0194  0.0342  72  TYR B OH  
2276 N N   . VAL B 66  ? 0.3570 0.3048 0.2724 0.0101  0.0134  0.0390  73  VAL B N   
2277 C CA  . VAL B 66  ? 0.3368 0.2813 0.2559 0.0105  0.0135  0.0386  73  VAL B CA  
2278 C C   . VAL B 66  ? 0.3130 0.2574 0.2345 0.0101  0.0120  0.0400  73  VAL B C   
2279 O O   . VAL B 66  ? 0.3451 0.2913 0.2672 0.0090  0.0105  0.0425  73  VAL B O   
2280 C CB  . VAL B 66  ? 0.3313 0.2743 0.2529 0.0099  0.0137  0.0397  73  VAL B CB  
2281 C CG1 . VAL B 66  ? 0.3242 0.2634 0.2496 0.0103  0.0141  0.0392  73  VAL B CG1 
2282 C CG2 . VAL B 66  ? 0.3113 0.2542 0.2307 0.0100  0.0149  0.0386  73  VAL B CG2 
2283 N N   . LYS B 67  ? 0.3270 0.2692 0.2501 0.0108  0.0122  0.0387  74  LYS B N   
2284 C CA  . LYS B 67  ? 0.3561 0.2981 0.2822 0.0104  0.0106  0.0403  74  LYS B CA  
2285 C C   . LYS B 67  ? 0.3598 0.3003 0.2909 0.0099  0.0102  0.0422  74  LYS B C   
2286 O O   . LYS B 67  ? 0.3881 0.3260 0.3214 0.0105  0.0117  0.0412  74  LYS B O   
2287 C CB  . LYS B 67  ? 0.3866 0.3267 0.3140 0.0114  0.0110  0.0385  74  LYS B CB  
2288 C CG  . LYS B 67  ? 0.4079 0.3479 0.3387 0.0109  0.0091  0.0403  74  LYS B CG  
2289 C CD  . LYS B 67  ? 0.4498 0.3879 0.3824 0.0119  0.0096  0.0387  74  LYS B CD  
2290 C CE  . LYS B 67  ? 0.4819 0.4197 0.4194 0.0114  0.0077  0.0409  74  LYS B CE  
2291 N NZ  . LYS B 67  ? 0.5445 0.4811 0.4831 0.0122  0.0077  0.0395  74  LYS B NZ  
2292 N N   . HIS B 68  ? 0.3822 0.3243 0.3148 0.0087  0.0083  0.0449  75  HIS B N   
2293 C CA  . HIS B 68  ? 0.3792 0.3200 0.3173 0.0082  0.0077  0.0470  75  HIS B CA  
2294 C C   . HIS B 68  ? 0.4210 0.3614 0.3634 0.0079  0.0060  0.0487  75  HIS B C   
2295 O O   . HIS B 68  ? 0.4319 0.3744 0.3726 0.0070  0.0039  0.0501  75  HIS B O   
2296 C CB  . HIS B 68  ? 0.3833 0.3261 0.3207 0.0069  0.0067  0.0493  75  HIS B CB  
2297 C CG  . HIS B 68  ? 0.4281 0.3705 0.3637 0.0071  0.0083  0.0483  75  HIS B CG  
2298 N ND1 . HIS B 68  ? 0.3558 0.2996 0.2865 0.0075  0.0094  0.0466  75  HIS B ND1 
2299 C CD2 . HIS B 68  ? 0.4062 0.3465 0.3445 0.0070  0.0089  0.0487  75  HIS B CD2 
2300 C CE1 . HIS B 68  ? 0.3852 0.3279 0.3158 0.0075  0.0104  0.0462  75  HIS B CE1 
2301 N NE2 . HIS B 68  ? 0.3865 0.3271 0.3214 0.0071  0.0100  0.0474  75  HIS B NE2 
2302 N N   . PRO B 69  ? 0.4315 0.3692 0.3797 0.0084  0.0066  0.0490  76  PRO B N   
2303 C CA  . PRO B 69  ? 0.4446 0.3823 0.3985 0.0078  0.0046  0.0516  76  PRO B CA  
2304 C C   . PRO B 69  ? 0.4316 0.3716 0.3856 0.0061  0.0021  0.0548  76  PRO B C   
2305 O O   . PRO B 69  ? 0.4146 0.3556 0.3668 0.0054  0.0022  0.0555  76  PRO B O   
2306 C CB  . PRO B 69  ? 0.4433 0.3776 0.4031 0.0087  0.0064  0.0513  76  PRO B CB  
2307 C CG  . PRO B 69  ? 0.4427 0.3749 0.3993 0.0098  0.0093  0.0481  76  PRO B CG  
2308 C CD  . PRO B 69  ? 0.4100 0.3446 0.3598 0.0094  0.0091  0.0473  76  PRO B CD  
2309 N N   . ALA B 70  ? 0.4382 0.3792 0.3945 0.0051  -0.0004 0.0571  77  ALA B N   
2310 C CA  . ALA B 70  ? 0.4324 0.3756 0.3884 0.0034  -0.0029 0.0603  77  ALA B CA  
2311 C C   . ALA B 70  ? 0.4229 0.3654 0.3838 0.0029  -0.0030 0.0623  77  ALA B C   
2312 O O   . ALA B 70  ? 0.4371 0.3815 0.3965 0.0015  -0.0044 0.0644  77  ALA B O   
2313 C CB  . ALA B 70  ? 0.4595 0.4035 0.4173 0.0023  -0.0060 0.0626  77  ALA B CB  
2314 N N   . ASP B 71  ? 0.4180 0.3576 0.3845 0.0040  -0.0014 0.0615  78  ASP B N   
2315 C CA  . ASP B 71  ? 0.4441 0.3825 0.4153 0.0036  -0.0015 0.0633  78  ASP B CA  
2316 C C   . ASP B 71  ? 0.4094 0.3464 0.3782 0.0042  0.0008  0.0613  78  ASP B C   
2317 O O   . ASP B 71  ? 0.4331 0.3682 0.4059 0.0042  0.0012  0.0621  78  ASP B O   
2318 C CB  . ASP B 71  ? 0.4664 0.4024 0.4459 0.0042  -0.0014 0.0643  78  ASP B CB  
2319 C CG  . ASP B 71  ? 0.4984 0.4317 0.4793 0.0061  0.0013  0.0614  78  ASP B CG  
2320 O OD1 . ASP B 71  ? 0.5310 0.4644 0.5065 0.0069  0.0028  0.0586  78  ASP B OD1 
2321 O OD2 . ASP B 71  ? 0.5908 0.5217 0.5787 0.0068  0.0021  0.0620  78  ASP B OD2 
2322 N N   . ILE B 72  ? 0.3674 0.3053 0.3298 0.0047  0.0021  0.0590  79  ILE B N   
2323 C CA  . ILE B 72  ? 0.3821 0.3194 0.3413 0.0048  0.0037  0.0576  79  ILE B CA  
2324 C C   . ILE B 72  ? 0.3826 0.3236 0.3363 0.0037  0.0025  0.0586  79  ILE B C   
2325 O O   . ILE B 72  ? 0.3957 0.3385 0.3448 0.0040  0.0028  0.0572  79  ILE B O   
2326 C CB  . ILE B 72  ? 0.3972 0.3322 0.3535 0.0063  0.0064  0.0540  79  ILE B CB  
2327 C CG1 . ILE B 72  ? 0.4210 0.3522 0.3823 0.0075  0.0080  0.0528  79  ILE B CG1 
2328 C CG2 . ILE B 72  ? 0.3962 0.3304 0.3494 0.0062  0.0076  0.0528  79  ILE B CG2 
2329 C CD1 . ILE B 72  ? 0.4145 0.3430 0.3731 0.0089  0.0107  0.0494  79  ILE B CD1 
2330 N N   . PRO B 73  ? 0.3699 0.3123 0.3245 0.0024  0.0013  0.0611  80  PRO B N   
2331 C CA  . PRO B 73  ? 0.3737 0.3200 0.3234 0.0012  0.0003  0.0625  80  PRO B CA  
2332 C C   . PRO B 73  ? 0.3634 0.3102 0.3076 0.0021  0.0024  0.0597  80  PRO B C   
2333 O O   . PRO B 73  ? 0.3524 0.2971 0.2968 0.0028  0.0040  0.0579  80  PRO B O   
2334 C CB  . PRO B 73  ? 0.3744 0.3210 0.3267 0.0001  -0.0006 0.0650  80  PRO B CB  
2335 C CG  . PRO B 73  ? 0.3860 0.3298 0.3451 0.0001  -0.0014 0.0662  80  PRO B CG  
2336 C CD  . PRO B 73  ? 0.3844 0.3250 0.3446 0.0019  0.0005  0.0631  80  PRO B CD  
2337 N N   . ASP B 74  ? 0.3581 0.3077 0.2975 0.0019  0.0022  0.0594  81  ASP B N   
2338 C CA  . ASP B 74  ? 0.3461 0.2966 0.2805 0.0027  0.0040  0.0570  81  ASP B CA  
2339 C C   . ASP B 74  ? 0.3482 0.3016 0.2803 0.0018  0.0040  0.0586  81  ASP B C   
2340 O O   . ASP B 74  ? 0.3402 0.2969 0.2683 0.0012  0.0038  0.0594  81  ASP B O   
2341 C CB  . ASP B 74  ? 0.3859 0.3376 0.3167 0.0032  0.0039  0.0557  81  ASP B CB  
2342 C CG  . ASP B 74  ? 0.3638 0.3154 0.2905 0.0044  0.0060  0.0525  81  ASP B CG  
2343 O OD1 . ASP B 74  ? 0.4070 0.3588 0.3328 0.0047  0.0073  0.0518  81  ASP B OD1 
2344 O OD2 . ASP B 74  ? 0.3973 0.3483 0.3222 0.0053  0.0063  0.0506  81  ASP B OD2 
2345 N N   . TYR B 75  ? 0.3103 0.2624 0.2450 0.0016  0.0043  0.0590  82  TYR B N   
2346 C CA  . TYR B 75  ? 0.3147 0.2691 0.2484 0.0006  0.0042  0.0609  82  TYR B CA  
2347 C C   . TYR B 75  ? 0.3034 0.2609 0.2321 0.0008  0.0055  0.0600  82  TYR B C   
2348 O O   . TYR B 75  ? 0.3200 0.2810 0.2471 -0.0001 0.0051  0.0623  82  TYR B O   
2349 C CB  . TYR B 75  ? 0.3127 0.2642 0.2496 0.0007  0.0046  0.0604  82  TYR B CB  
2350 C CG  . TYR B 75  ? 0.2955 0.2486 0.2324 -0.0002 0.0043  0.0623  82  TYR B CG  
2351 C CD1 . TYR B 75  ? 0.3095 0.2645 0.2487 -0.0017 0.0026  0.0658  82  TYR B CD1 
2352 C CD2 . TYR B 75  ? 0.2855 0.2382 0.2205 0.0002  0.0057  0.0606  82  TYR B CD2 
2353 C CE1 . TYR B 75  ? 0.3076 0.2641 0.2473 -0.0027 0.0023  0.0677  82  TYR B CE1 
2354 C CE2 . TYR B 75  ? 0.3065 0.2605 0.2421 -0.0007 0.0052  0.0625  82  TYR B CE2 
2355 C CZ  . TYR B 75  ? 0.2959 0.2519 0.2338 -0.0021 0.0036  0.0660  82  TYR B CZ  
2356 O OH  . TYR B 75  ? 0.3193 0.2769 0.2583 -0.0032 0.0030  0.0682  82  TYR B OH  
2357 N N   . LEU B 76  ? 0.3038 0.2602 0.2305 0.0022  0.0072  0.0570  83  LEU B N   
2358 C CA  . LEU B 76  ? 0.3194 0.2784 0.2419 0.0026  0.0087  0.0559  83  LEU B CA  
2359 C C   . LEU B 76  ? 0.3285 0.2900 0.2471 0.0027  0.0087  0.0559  83  LEU B C   
2360 O O   . LEU B 76  ? 0.3238 0.2886 0.2395 0.0023  0.0094  0.0567  83  LEU B O   
2361 C CB  . LEU B 76  ? 0.3462 0.3030 0.2680 0.0039  0.0102  0.0529  83  LEU B CB  
2362 C CG  . LEU B 76  ? 0.3585 0.3129 0.2836 0.0034  0.0099  0.0534  83  LEU B CG  
2363 C CD1 . LEU B 76  ? 0.4027 0.3545 0.3267 0.0045  0.0112  0.0506  83  LEU B CD1 
2364 C CD2 . LEU B 76  ? 0.3841 0.3414 0.3097 0.0022  0.0094  0.0562  83  LEU B CD2 
2365 N N   . LYS B 77  ? 0.3455 0.3056 0.2642 0.0028  0.0077  0.0554  84  LYS B N   
2366 C CA  . LYS B 77  ? 0.3460 0.3085 0.2606 0.0024  0.0072  0.0559  84  LYS B CA  
2367 C C   . LYS B 77  ? 0.3447 0.3096 0.2591 0.0007  0.0058  0.0595  84  LYS B C   
2368 O O   . LYS B 77  ? 0.3778 0.3454 0.2877 0.0002  0.0063  0.0602  84  LYS B O   
2369 C CB  . LYS B 77  ? 0.3395 0.2999 0.2540 0.0028  0.0061  0.0548  84  LYS B CB  
2370 C CG  . LYS B 77  ? 0.3523 0.3108 0.2657 0.0044  0.0075  0.0514  84  LYS B CG  
2371 C CD  . LYS B 77  ? 0.3586 0.3155 0.2719 0.0046  0.0062  0.0506  84  LYS B CD  
2372 C CE  . LYS B 77  ? 0.3602 0.3154 0.2722 0.0062  0.0076  0.0472  84  LYS B CE  
2373 N NZ  . LYS B 77  ? 0.3465 0.2990 0.2625 0.0071  0.0086  0.0458  84  LYS B NZ  
2374 N N   . LEU B 78  ? 0.3549 0.3189 0.2739 -0.0002 0.0041  0.0618  85  LEU B N   
2375 C CA  . LEU B 78  ? 0.3648 0.3309 0.2845 -0.0020 0.0025  0.0655  85  LEU B CA  
2376 C C   . LEU B 78  ? 0.3503 0.3196 0.2681 -0.0026 0.0036  0.0669  85  LEU B C   
2377 O O   . LEU B 78  ? 0.3499 0.3216 0.2658 -0.0039 0.0028  0.0696  85  LEU B O   
2378 C CB  . LEU B 78  ? 0.3778 0.3418 0.3037 -0.0027 0.0006  0.0675  85  LEU B CB  
2379 C CG  . LEU B 78  ? 0.4335 0.3950 0.3621 -0.0026 -0.0008 0.0673  85  LEU B CG  
2380 C CD1 . LEU B 78  ? 0.4545 0.4134 0.3899 -0.0027 -0.0018 0.0684  85  LEU B CD1 
2381 C CD2 . LEU B 78  ? 0.4542 0.4174 0.3803 -0.0039 -0.0028 0.0694  85  LEU B CD2 
2382 N N   . SER B 79  ? 0.3299 0.2991 0.2479 -0.0015 0.0055  0.0652  86  SER B N   
2383 C CA  . SER B 79  ? 0.3209 0.2931 0.2382 -0.0020 0.0066  0.0667  86  SER B CA  
2384 C C   . SER B 79  ? 0.3316 0.3071 0.2434 -0.0019 0.0082  0.0665  86  SER B C   
2385 O O   . SER B 79  ? 0.3257 0.3043 0.2369 -0.0026 0.0090  0.0685  86  SER B O   
2386 C CB  . SER B 79  ? 0.3137 0.2846 0.2329 -0.0010 0.0079  0.0649  86  SER B CB  
2387 O OG  . SER B 79  ? 0.3134 0.2839 0.2297 0.0004  0.0098  0.0616  86  SER B OG  
2388 N N   . PHE B 80  ? 0.3219 0.2966 0.2300 -0.0010 0.0087  0.0642  87  PHE B N   
2389 C CA  . PHE B 80  ? 0.3541 0.3314 0.2563 -0.0009 0.0103  0.0638  87  PHE B CA  
2390 C C   . PHE B 80  ? 0.3524 0.3315 0.2517 -0.0026 0.0090  0.0667  87  PHE B C   
2391 O O   . PHE B 80  ? 0.4070 0.3848 0.3083 -0.0037 0.0065  0.0685  87  PHE B O   
2392 C CB  . PHE B 80  ? 0.3429 0.3183 0.2421 0.0006  0.0112  0.0600  87  PHE B CB  
2393 C CG  . PHE B 80  ? 0.3446 0.3192 0.2457 0.0022  0.0130  0.0575  87  PHE B CG  
2394 C CD1 . PHE B 80  ? 0.3543 0.3313 0.2536 0.0029  0.0154  0.0569  87  PHE B CD1 
2395 C CD2 . PHE B 80  ? 0.3372 0.3086 0.2420 0.0028  0.0122  0.0560  87  PHE B CD2 
2396 C CE1 . PHE B 80  ? 0.3444 0.3206 0.2457 0.0041  0.0166  0.0549  87  PHE B CE1 
2397 C CE2 . PHE B 80  ? 0.3498 0.3202 0.2559 0.0040  0.0136  0.0539  87  PHE B CE2 
2398 C CZ  . PHE B 80  ? 0.3473 0.3201 0.2517 0.0046  0.0157  0.0534  87  PHE B CZ  
2399 N N   . PRO B 81  ? 0.3719 0.3540 0.2666 -0.0028 0.0108  0.0674  88  PRO B N   
2400 C CA  . PRO B 81  ? 0.3683 0.3517 0.2601 -0.0013 0.0139  0.0650  88  PRO B CA  
2401 C C   . PRO B 81  ? 0.3624 0.3479 0.2578 -0.0008 0.0156  0.0656  88  PRO B C   
2402 O O   . PRO B 81  ? 0.3650 0.3509 0.2597 0.0006  0.0178  0.0633  88  PRO B O   
2403 C CB  . PRO B 81  ? 0.3844 0.3701 0.2697 -0.0020 0.0150  0.0661  88  PRO B CB  
2404 C CG  . PRO B 81  ? 0.3974 0.3841 0.2836 -0.0041 0.0128  0.0700  88  PRO B CG  
2405 C CD  . PRO B 81  ? 0.3871 0.3708 0.2780 -0.0045 0.0098  0.0702  88  PRO B CD  
2406 N N   . GLU B 82  ? 0.3317 0.3182 0.2313 -0.0020 0.0145  0.0687  89  GLU B N   
2407 C CA  . GLU B 82  ? 0.3477 0.3362 0.2508 -0.0019 0.0158  0.0697  89  GLU B CA  
2408 C C   . GLU B 82  ? 0.3053 0.2913 0.2115 -0.0005 0.0160  0.0669  89  GLU B C   
2409 O O   . GLU B 82  ? 0.2913 0.2786 0.1979 0.0005  0.0181  0.0657  89  GLU B O   
2410 C CB  . GLU B 82  ? 0.3542 0.3440 0.2612 -0.0037 0.0140  0.0737  89  GLU B CB  
2411 C CG  . GLU B 82  ? 0.4130 0.4056 0.3166 -0.0053 0.0138  0.0769  89  GLU B CG  
2412 C CD  . GLU B 82  ? 0.4123 0.4029 0.3142 -0.0064 0.0112  0.0775  89  GLU B CD  
2413 O OE1 . GLU B 82  ? 0.4348 0.4218 0.3376 -0.0057 0.0098  0.0753  89  GLU B OE1 
2414 O OE2 . GLU B 82  ? 0.4733 0.4658 0.3728 -0.0080 0.0105  0.0804  89  GLU B OE2 
2415 N N   . GLY B 83  ? 0.2896 0.2718 0.1978 -0.0004 0.0141  0.0657  90  GLY B N   
2416 C CA  . GLY B 83  ? 0.2881 0.2674 0.1985 0.0008  0.0143  0.0628  90  GLY B CA  
2417 C C   . GLY B 83  ? 0.2791 0.2566 0.1946 0.0002  0.0130  0.0639  90  GLY B C   
2418 O O   . GLY B 83  ? 0.2932 0.2703 0.2112 -0.0010 0.0113  0.0664  90  GLY B O   
2419 N N   . PHE B 84  ? 0.2852 0.2612 0.2018 0.0011  0.0139  0.0619  91  PHE B N   
2420 C CA  . PHE B 84  ? 0.2743 0.2470 0.1949 0.0008  0.0126  0.0619  91  PHE B CA  
2421 C C   . PHE B 84  ? 0.2682 0.2409 0.1898 0.0013  0.0135  0.0610  91  PHE B C   
2422 O O   . PHE B 84  ? 0.2857 0.2601 0.2052 0.0023  0.0153  0.0596  91  PHE B O   
2423 C CB  . PHE B 84  ? 0.2780 0.2462 0.1993 0.0013  0.0116  0.0599  91  PHE B CB  
2424 C CG  . PHE B 84  ? 0.2954 0.2618 0.2144 0.0028  0.0128  0.0563  91  PHE B CG  
2425 C CD1 . PHE B 84  ? 0.3205 0.2842 0.2402 0.0035  0.0133  0.0543  91  PHE B CD1 
2426 C CD2 . PHE B 84  ? 0.3069 0.2739 0.2229 0.0035  0.0132  0.0550  91  PHE B CD2 
2427 C CE1 . PHE B 84  ? 0.3327 0.2947 0.2503 0.0049  0.0143  0.0511  91  PHE B CE1 
2428 C CE2 . PHE B 84  ? 0.3198 0.2852 0.2337 0.0049  0.0143  0.0518  91  PHE B CE2 
2429 C CZ  . PHE B 84  ? 0.3429 0.3059 0.2578 0.0056  0.0149  0.0499  91  PHE B CZ  
2430 N N   . LYS B 85  ? 0.2691 0.2396 0.1940 0.0005  0.0122  0.0620  92  LYS B N   
2431 C CA  . LYS B 85  ? 0.2656 0.2348 0.1916 0.0008  0.0126  0.0609  92  LYS B CA  
2432 C C   . LYS B 85  ? 0.2744 0.2382 0.2012 0.0009  0.0115  0.0590  92  LYS B C   
2433 O O   . LYS B 85  ? 0.2680 0.2289 0.1959 0.0005  0.0104  0.0591  92  LYS B O   
2434 C CB  . LYS B 85  ? 0.3039 0.2755 0.2328 -0.0004 0.0119  0.0641  92  LYS B CB  
2435 C CG  . LYS B 85  ? 0.3208 0.2980 0.2492 -0.0005 0.0133  0.0664  92  LYS B CG  
2436 C CD  . LYS B 85  ? 0.3450 0.3246 0.2771 -0.0019 0.0125  0.0699  92  LYS B CD  
2437 C CE  . LYS B 85  ? 0.3928 0.3779 0.3244 -0.0022 0.0140  0.0725  92  LYS B CE  
2438 N NZ  . LYS B 85  ? 0.4312 0.4191 0.3611 -0.0008 0.0166  0.0711  92  LYS B NZ  
2439 N N   . TRP B 86  ? 0.2702 0.2323 0.1966 0.0014  0.0120  0.0572  93  TRP B N   
2440 C CA  . TRP B 86  ? 0.2686 0.2252 0.1954 0.0013  0.0110  0.0555  93  TRP B CA  
2441 C C   . TRP B 86  ? 0.2714 0.2266 0.1989 0.0009  0.0106  0.0555  93  TRP B C   
2442 O O   . TRP B 86  ? 0.2643 0.2229 0.1920 0.0010  0.0113  0.0561  93  TRP B O   
2443 C CB  . TRP B 86  ? 0.2818 0.2349 0.2065 0.0025  0.0117  0.0523  93  TRP B CB  
2444 C CG  . TRP B 86  ? 0.2964 0.2505 0.2185 0.0039  0.0133  0.0499  93  TRP B CG  
2445 C CD1 . TRP B 86  ? 0.3254 0.2819 0.2458 0.0048  0.0143  0.0491  93  TRP B CD1 
2446 C CD2 . TRP B 86  ? 0.2857 0.2380 0.2067 0.0045  0.0138  0.0477  93  TRP B CD2 
2447 N NE1 . TRP B 86  ? 0.3033 0.2596 0.2215 0.0060  0.0155  0.0466  93  TRP B NE1 
2448 C CE2 . TRP B 86  ? 0.2939 0.2479 0.2127 0.0058  0.0153  0.0458  93  TRP B CE2 
2449 C CE3 . TRP B 86  ? 0.2860 0.2355 0.2074 0.0039  0.0131  0.0474  93  TRP B CE3 
2450 C CZ2 . TRP B 86  ? 0.3042 0.2572 0.2216 0.0066  0.0161  0.0436  93  TRP B CZ2 
2451 C CZ3 . TRP B 86  ? 0.2985 0.2468 0.2182 0.0046  0.0138  0.0452  93  TRP B CZ3 
2452 C CH2 . TRP B 86  ? 0.2921 0.2423 0.2101 0.0060  0.0153  0.0435  93  TRP B CH2 
2453 N N   . GLU B 87  ? 0.2734 0.2236 0.2015 0.0001  0.0092  0.0550  94  GLU B N   
2454 C CA  . GLU B 87  ? 0.2969 0.2444 0.2253 -0.0006 0.0081  0.0550  94  GLU B CA  
2455 C C   . GLU B 87  ? 0.2750 0.2159 0.2012 -0.0003 0.0080  0.0520  94  GLU B C   
2456 O O   . GLU B 87  ? 0.2651 0.2028 0.1912 -0.0002 0.0078  0.0513  94  GLU B O   
2457 C CB  . GLU B 87  ? 0.3541 0.3017 0.2855 -0.0023 0.0062  0.0581  94  GLU B CB  
2458 C CG  . GLU B 87  ? 0.4192 0.3732 0.3528 -0.0026 0.0065  0.0613  94  GLU B CG  
2459 C CD  . GLU B 87  ? 0.5605 0.5158 0.4976 -0.0043 0.0047  0.0647  94  GLU B CD  
2460 O OE1 . GLU B 87  ? 0.5593 0.5199 0.4981 -0.0045 0.0053  0.0670  94  GLU B OE1 
2461 O OE2 . GLU B 87  ? 0.6546 0.6056 0.5926 -0.0055 0.0028  0.0653  94  GLU B OE2 
2462 N N   . ARG B 88  ? 0.2650 0.2043 0.1894 0.0000  0.0083  0.0501  95  ARG B N   
2463 C CA  . ARG B 88  ? 0.2787 0.2122 0.2003 0.0003  0.0085  0.0472  95  ARG B CA  
2464 C C   . ARG B 88  ? 0.2866 0.2165 0.2072 -0.0006 0.0071  0.0470  95  ARG B C   
2465 O O   . ARG B 88  ? 0.2875 0.2204 0.2093 -0.0011 0.0066  0.0484  95  ARG B O   
2466 C CB  . ARG B 88  ? 0.2773 0.2122 0.1969 0.0020  0.0105  0.0447  95  ARG B CB  
2467 C CG  . ARG B 88  ? 0.3022 0.2316 0.2188 0.0025  0.0110  0.0417  95  ARG B CG  
2468 C CD  . ARG B 88  ? 0.3189 0.2506 0.2342 0.0041  0.0127  0.0397  95  ARG B CD  
2469 N NE  . ARG B 88  ? 0.3460 0.2791 0.2620 0.0048  0.0135  0.0396  95  ARG B NE  
2470 C CZ  . ARG B 88  ? 0.3686 0.3043 0.2839 0.0061  0.0148  0.0385  95  ARG B CZ  
2471 N NH1 . ARG B 88  ? 0.3380 0.2752 0.2519 0.0069  0.0155  0.0372  95  ARG B NH1 
2472 N NH2 . ARG B 88  ? 0.3575 0.2938 0.2737 0.0065  0.0151  0.0387  95  ARG B NH2 
2473 N N   . VAL B 89  ? 0.2842 0.2077 0.2027 -0.0011 0.0066  0.0454  96  VAL B N   
2474 C CA  . VAL B 89  ? 0.3103 0.2290 0.2265 -0.0021 0.0054  0.0445  96  VAL B CA  
2475 C C   . VAL B 89  ? 0.2982 0.2122 0.2105 -0.0013 0.0067  0.0411  96  VAL B C   
2476 O O   . VAL B 89  ? 0.2859 0.1974 0.1975 -0.0006 0.0079  0.0397  96  VAL B O   
2477 C CB  . VAL B 89  ? 0.3302 0.2443 0.2466 -0.0038 0.0033  0.0457  96  VAL B CB  
2478 C CG1 . VAL B 89  ? 0.3585 0.2668 0.2716 -0.0050 0.0019  0.0446  96  VAL B CG1 
2479 C CG2 . VAL B 89  ? 0.3594 0.2779 0.2798 -0.0049 0.0017  0.0493  96  VAL B CG2 
2480 N N   . MET B 90  ? 0.3132 0.2260 0.2234 -0.0014 0.0065  0.0400  97  MET B N   
2481 C CA  . MET B 90  ? 0.3414 0.2497 0.2477 -0.0008 0.0076  0.0369  97  MET B CA  
2482 C C   . MET B 90  ? 0.3215 0.2240 0.2248 -0.0025 0.0057  0.0366  97  MET B C   
2483 O O   . MET B 90  ? 0.3576 0.2616 0.2617 -0.0035 0.0041  0.0380  97  MET B O   
2484 C CB  . MET B 90  ? 0.3393 0.2515 0.2456 0.0004  0.0089  0.0359  97  MET B CB  
2485 C CG  . MET B 90  ? 0.3769 0.2956 0.2860 0.0018  0.0103  0.0366  97  MET B CG  
2486 S SD  . MET B 90  ? 0.4449 0.3676 0.3536 0.0034  0.0118  0.0351  97  MET B SD  
2487 C CE  . MET B 90  ? 0.4837 0.4030 0.3901 0.0046  0.0136  0.0323  97  MET B CE  
2488 N N   . ASN B 91  ? 0.3398 0.2356 0.2397 -0.0029 0.0060  0.0350  98  ASN B N   
2489 C CA  . ASN B 91  ? 0.3469 0.2362 0.2426 -0.0045 0.0044  0.0341  98  ASN B CA  
2490 C C   . ASN B 91  ? 0.3547 0.2404 0.2461 -0.0038 0.0061  0.0311  98  ASN B C   
2491 O O   . ASN B 91  ? 0.3575 0.2398 0.2470 -0.0029 0.0081  0.0292  98  ASN B O   
2492 C CB  . ASN B 91  ? 0.3499 0.2329 0.2438 -0.0057 0.0035  0.0341  98  ASN B CB  
2493 C CG  . ASN B 91  ? 0.3704 0.2547 0.2672 -0.0073 0.0007  0.0371  98  ASN B CG  
2494 O OD1 . ASN B 91  ? 0.3902 0.2757 0.2874 -0.0086 -0.0013 0.0387  98  ASN B OD1 
2495 N ND2 . ASN B 91  ? 0.3699 0.2537 0.2688 -0.0074 0.0006  0.0381  98  ASN B ND2 
2496 N N   . PHE B 92  ? 0.3433 0.2294 0.2334 -0.0043 0.0051  0.0311  99  PHE B N   
2497 C CA  . PHE B 92  ? 0.3670 0.2504 0.2533 -0.0037 0.0064  0.0285  99  PHE B CA  
2498 C C   . PHE B 92  ? 0.3754 0.2501 0.2559 -0.0054 0.0054  0.0273  99  PHE B C   
2499 O O   . PHE B 92  ? 0.4142 0.2859 0.2938 -0.0073 0.0030  0.0286  99  PHE B O   
2500 C CB  . PHE B 92  ? 0.3475 0.2352 0.2352 -0.0035 0.0058  0.0291  99  PHE B CB  
2501 C CG  . PHE B 92  ? 0.3704 0.2656 0.2625 -0.0017 0.0073  0.0296  99  PHE B CG  
2502 C CD1 . PHE B 92  ? 0.3596 0.2605 0.2563 -0.0017 0.0066  0.0321  99  PHE B CD1 
2503 C CD2 . PHE B 92  ? 0.3391 0.2356 0.2306 0.0000  0.0095  0.0276  99  PHE B CD2 
2504 C CE1 . PHE B 92  ? 0.3669 0.2742 0.2668 0.0000  0.0081  0.0324  99  PHE B CE1 
2505 C CE2 . PHE B 92  ? 0.3719 0.2748 0.2669 0.0015  0.0108  0.0279  99  PHE B CE2 
2506 C CZ  . PHE B 92  ? 0.3651 0.2734 0.2641 0.0015  0.0101  0.0303  99  PHE B CZ  
2507 N N   . GLU B 93  ? 0.4296 0.3001 0.3060 -0.0049 0.0073  0.0247  100 GLU B N   
2508 C CA  . GLU B 93  ? 0.4262 0.2878 0.2964 -0.0063 0.0070  0.0232  100 GLU B CA  
2509 C C   . GLU B 93  ? 0.4813 0.3395 0.3480 -0.0086 0.0038  0.0240  100 GLU B C   
2510 O O   . GLU B 93  ? 0.4682 0.3191 0.3300 -0.0103 0.0027  0.0234  100 GLU B O   
2511 C CB  . GLU B 93  ? 0.4633 0.3211 0.3295 -0.0052 0.0100  0.0203  100 GLU B CB  
2512 C CG  . GLU B 93  ? 0.4709 0.3314 0.3367 -0.0046 0.0104  0.0197  100 GLU B CG  
2513 C CD  . GLU B 93  ? 0.5116 0.3675 0.3730 -0.0039 0.0131  0.0170  100 GLU B CD  
2514 O OE1 . GLU B 93  ? 0.5238 0.3827 0.3876 -0.0020 0.0157  0.0160  100 GLU B OE1 
2515 O OE2 . GLU B 93  ? 0.5663 0.4151 0.4215 -0.0055 0.0126  0.0159  100 GLU B OE2 
2516 N N   . ASP B 94  ? 0.4738 0.3369 0.3431 -0.0087 0.0025  0.0253  101 ASP B N   
2517 C CA  . ASP B 94  ? 0.4904 0.3510 0.3576 -0.0109 -0.0008 0.0265  101 ASP B CA  
2518 C C   . ASP B 94  ? 0.4448 0.3084 0.3163 -0.0122 -0.0038 0.0297  101 ASP B C   
2519 O O   . ASP B 94  ? 0.4704 0.3335 0.3420 -0.0140 -0.0068 0.0313  101 ASP B O   
2520 C CB  . ASP B 94  ? 0.4647 0.3277 0.3318 -0.0106 -0.0008 0.0261  101 ASP B CB  
2521 C CG  . ASP B 94  ? 0.4908 0.3630 0.3647 -0.0088 -0.0001 0.0273  101 ASP B CG  
2522 O OD1 . ASP B 94  ? 0.4563 0.3334 0.3347 -0.0076 0.0009  0.0283  101 ASP B OD1 
2523 O OD2 . ASP B 94  ? 0.4716 0.3463 0.3465 -0.0086 -0.0004 0.0273  101 ASP B OD2 
2524 N N   . GLY B 95  ? 0.4473 0.3144 0.3230 -0.0115 -0.0032 0.0308  102 GLY B N   
2525 C CA  . GLY B 95  ? 0.4135 0.2837 0.2937 -0.0127 -0.0059 0.0341  102 GLY B CA  
2526 C C   . GLY B 95  ? 0.4221 0.3017 0.3094 -0.0116 -0.0058 0.0364  102 GLY B C   
2527 O O   . GLY B 95  ? 0.4077 0.2902 0.2991 -0.0125 -0.0077 0.0392  102 GLY B O   
2528 N N   . GLY B 96  ? 0.3602 0.2441 0.2487 -0.0097 -0.0035 0.0352  103 GLY B N   
2529 C CA  . GLY B 96  ? 0.3575 0.2501 0.2521 -0.0081 -0.0025 0.0367  103 GLY B CA  
2530 C C   . GLY B 96  ? 0.3534 0.2489 0.2508 -0.0073 -0.0013 0.0376  103 GLY B C   
2531 O O   . GLY B 96  ? 0.3718 0.2636 0.2666 -0.0069 0.0000  0.0360  103 GLY B O   
2532 N N   . VAL B 97  ? 0.3668 0.2688 0.2695 -0.0071 -0.0016 0.0401  104 VAL B N   
2533 C CA  . VAL B 97  ? 0.3220 0.2275 0.2278 -0.0064 -0.0007 0.0415  104 VAL B CA  
2534 C C   . VAL B 97  ? 0.3403 0.2539 0.2504 -0.0048 0.0008  0.0425  104 VAL B C   
2535 O O   . VAL B 97  ? 0.3298 0.2467 0.2424 -0.0050 0.0002  0.0438  104 VAL B O   
2536 C CB  . VAL B 97  ? 0.3389 0.2434 0.2468 -0.0084 -0.0034 0.0443  104 VAL B CB  
2537 C CG1 . VAL B 97  ? 0.3104 0.2188 0.2217 -0.0078 -0.0026 0.0460  104 VAL B CG1 
2538 C CG2 . VAL B 97  ? 0.3377 0.2337 0.2409 -0.0100 -0.0051 0.0432  104 VAL B CG2 
2539 N N   . VAL B 98  ? 0.3077 0.2242 0.2186 -0.0033 0.0030  0.0419  105 VAL B N   
2540 C CA  . VAL B 98  ? 0.3050 0.2289 0.2195 -0.0019 0.0046  0.0430  105 VAL B CA  
2541 C C   . VAL B 98  ? 0.3059 0.2318 0.2224 -0.0020 0.0048  0.0447  105 VAL B C   
2542 O O   . VAL B 98  ? 0.3120 0.2344 0.2268 -0.0019 0.0051  0.0435  105 VAL B O   
2543 C CB  . VAL B 98  ? 0.3195 0.2446 0.2323 0.0000  0.0070  0.0403  105 VAL B CB  
2544 C CG1 . VAL B 98  ? 0.3255 0.2575 0.2410 0.0014  0.0087  0.0411  105 VAL B CG1 
2545 C CG2 . VAL B 98  ? 0.3480 0.2711 0.2590 0.0000  0.0066  0.0389  105 VAL B CG2 
2546 N N   . THR B 99  ? 0.3096 0.2411 0.2302 -0.0022 0.0045  0.0475  106 THR B N   
2547 C CA  . THR B 99  ? 0.3056 0.2404 0.2285 -0.0022 0.0049  0.0494  106 THR B CA  
2548 C C   . THR B 99  ? 0.2991 0.2404 0.2236 -0.0006 0.0070  0.0497  106 THR B C   
2549 O O   . THR B 99  ? 0.2955 0.2399 0.2211 -0.0001 0.0076  0.0497  106 THR B O   
2550 C CB  . THR B 99  ? 0.3529 0.2878 0.2788 -0.0040 0.0025  0.0527  106 THR B CB  
2551 O OG1 . THR B 99  ? 0.3655 0.3039 0.2942 -0.0045 0.0019  0.0546  106 THR B OG1 
2552 C CG2 . THR B 99  ? 0.3457 0.2733 0.2692 -0.0056 0.0003  0.0521  106 THR B CG2 
2553 N N   . VAL B 100 ? 0.2648 0.2080 0.1892 0.0000  0.0082  0.0497  107 VAL B N   
2554 C CA  . VAL B 100 ? 0.2898 0.2384 0.2146 0.0015  0.0103  0.0496  107 VAL B CA  
2555 C C   . VAL B 100 ? 0.2923 0.2441 0.2189 0.0011  0.0104  0.0520  107 VAL B C   
2556 O O   . VAL B 100 ? 0.2870 0.2358 0.2134 0.0005  0.0095  0.0522  107 VAL B O   
2557 C CB  . VAL B 100 ? 0.2824 0.2292 0.2040 0.0030  0.0118  0.0464  107 VAL B CB  
2558 C CG1 . VAL B 100 ? 0.3016 0.2535 0.2231 0.0044  0.0138  0.0459  107 VAL B CG1 
2559 C CG2 . VAL B 100 ? 0.2989 0.2411 0.2183 0.0030  0.0115  0.0439  107 VAL B CG2 
2560 N N   . THR B 101 ? 0.2920 0.2495 0.2200 0.0016  0.0117  0.0535  108 THR B N   
2561 C CA  . THR B 101 ? 0.2990 0.2599 0.2279 0.0014  0.0121  0.0555  108 THR B CA  
2562 C C   . THR B 101 ? 0.3065 0.2710 0.2335 0.0030  0.0144  0.0543  108 THR B C   
2563 O O   . THR B 101 ? 0.3076 0.2737 0.2339 0.0041  0.0158  0.0528  108 THR B O   
2564 C CB  . THR B 101 ? 0.3264 0.2908 0.2591 0.0001  0.0113  0.0594  108 THR B CB  
2565 O OG1 . THR B 101 ? 0.3363 0.3048 0.2704 0.0007  0.0126  0.0601  108 THR B OG1 
2566 C CG2 . THR B 101 ? 0.3461 0.3065 0.2805 -0.0014 0.0087  0.0606  108 THR B CG2 
2567 N N   . GLN B 102 ? 0.2770 0.2427 0.2030 0.0031  0.0147  0.0548  109 GLN B N   
2568 C CA  . GLN B 102 ? 0.2832 0.2514 0.2067 0.0044  0.0166  0.0535  109 GLN B CA  
2569 C C   . GLN B 102 ? 0.2935 0.2651 0.2170 0.0038  0.0168  0.0558  109 GLN B C   
2570 O O   . GLN B 102 ? 0.2824 0.2528 0.2072 0.0027  0.0153  0.0575  109 GLN B O   
2571 C CB  . GLN B 102 ? 0.3124 0.2768 0.2334 0.0052  0.0166  0.0504  109 GLN B CB  
2572 C CG  . GLN B 102 ? 0.3185 0.2845 0.2366 0.0067  0.0183  0.0483  109 GLN B CG  
2573 C CD  . GLN B 102 ? 0.3632 0.3307 0.2796 0.0067  0.0185  0.0488  109 GLN B CD  
2574 O OE1 . GLN B 102 ? 0.3432 0.3114 0.2607 0.0057  0.0175  0.0511  109 GLN B OE1 
2575 N NE2 . GLN B 102 ? 0.4620 0.4297 0.3756 0.0079  0.0196  0.0466  109 GLN B NE2 
2576 N N   . ASP B 103 ? 0.2724 0.2479 0.1941 0.0047  0.0187  0.0558  110 ASP B N   
2577 C CA  . ASP B 103 ? 0.2894 0.2678 0.2099 0.0042  0.0191  0.0576  110 ASP B CA  
2578 C C   . ASP B 103 ? 0.3006 0.2794 0.2170 0.0054  0.0204  0.0554  110 ASP B C   
2579 O O   . ASP B 103 ? 0.3163 0.2958 0.2311 0.0067  0.0220  0.0535  110 ASP B O   
2580 C CB  . ASP B 103 ? 0.3200 0.3032 0.2420 0.0038  0.0203  0.0605  110 ASP B CB  
2581 C CG  . ASP B 103 ? 0.3790 0.3651 0.2994 0.0031  0.0207  0.0627  110 ASP B CG  
2582 O OD1 . ASP B 103 ? 0.4781 0.4659 0.3947 0.0039  0.0223  0.0616  110 ASP B OD1 
2583 O OD2 . ASP B 103 ? 0.4655 0.4520 0.3882 0.0017  0.0192  0.0654  110 ASP B OD2 
2584 N N   . SER B 104 ? 0.2909 0.2690 0.2056 0.0049  0.0195  0.0559  111 SER B N   
2585 C CA  . SER B 104 ? 0.3266 0.3046 0.2373 0.0057  0.0201  0.0541  111 SER B CA  
2586 C C   . SER B 104 ? 0.3385 0.3194 0.2472 0.0049  0.0204  0.0564  111 SER B C   
2587 O O   . SER B 104 ? 0.3267 0.3078 0.2372 0.0035  0.0188  0.0589  111 SER B O   
2588 C CB  . SER B 104 ? 0.3578 0.3315 0.2686 0.0058  0.0185  0.0524  111 SER B CB  
2589 O OG  . SER B 104 ? 0.3537 0.3243 0.2660 0.0065  0.0185  0.0502  111 SER B OG  
2590 N N   . SER B 105 ? 0.3388 0.3218 0.2434 0.0057  0.0222  0.0554  112 SER B N   
2591 C CA  . SER B 105 ? 0.3482 0.3334 0.2496 0.0049  0.0224  0.0571  112 SER B CA  
2592 C C   . SER B 105 ? 0.3588 0.3431 0.2549 0.0058  0.0232  0.0546  112 SER B C   
2593 O O   . SER B 105 ? 0.3314 0.3134 0.2269 0.0070  0.0234  0.0516  112 SER B O   
2594 C CB  . SER B 105 ? 0.3561 0.3457 0.2579 0.0045  0.0244  0.0596  112 SER B CB  
2595 O OG  . SER B 105 ? 0.4015 0.3925 0.3031 0.0060  0.0269  0.0579  112 SER B OG  
2596 N N   . LEU B 106 ? 0.4041 0.3901 0.2961 0.0051  0.0236  0.0559  113 LEU B N   
2597 C CA  . LEU B 106 ? 0.4015 0.3865 0.2880 0.0057  0.0241  0.0537  113 LEU B CA  
2598 C C   . LEU B 106 ? 0.4052 0.3934 0.2872 0.0059  0.0269  0.0544  113 LEU B C   
2599 O O   . LEU B 106 ? 0.4231 0.4139 0.3049 0.0047  0.0273  0.0574  113 LEU B O   
2600 C CB  . LEU B 106 ? 0.4506 0.4338 0.3358 0.0043  0.0214  0.0550  113 LEU B CB  
2601 C CG  . LEU B 106 ? 0.4657 0.4468 0.3459 0.0045  0.0206  0.0531  113 LEU B CG  
2602 C CD1 . LEU B 106 ? 0.4870 0.4650 0.3684 0.0059  0.0202  0.0498  113 LEU B CD1 
2603 C CD2 . LEU B 106 ? 0.4822 0.4623 0.3622 0.0027  0.0177  0.0556  113 LEU B CD2 
2604 N N   . GLN B 107 ? 0.4374 0.4250 0.3156 0.0074  0.0288  0.0514  114 GLN B N   
2605 C CA  . GLN B 107 ? 0.4608 0.4511 0.3352 0.0081  0.0320  0.0513  114 GLN B CA  
2606 C C   . GLN B 107 ? 0.4802 0.4682 0.3482 0.0089  0.0326  0.0482  114 GLN B C   
2607 O O   . GLN B 107 ? 0.4952 0.4810 0.3638 0.0103  0.0325  0.0453  114 GLN B O   
2608 C CB  . GLN B 107 ? 0.5190 0.5114 0.3975 0.0094  0.0345  0.0508  114 GLN B CB  
2609 C CG  . GLN B 107 ? 0.5727 0.5674 0.4573 0.0085  0.0341  0.0539  114 GLN B CG  
2610 C CD  . GLN B 107 ? 0.6370 0.6350 0.5246 0.0096  0.0371  0.0544  114 GLN B CD  
2611 O OE1 . GLN B 107 ? 0.7043 0.7017 0.5927 0.0112  0.0385  0.0518  114 GLN B OE1 
2612 N NE2 . GLN B 107 ? 0.5996 0.6011 0.4892 0.0086  0.0381  0.0578  114 GLN B NE2 
2613 N N   . ASP B 108 ? 0.5462 0.5345 0.4080 0.0080  0.0330  0.0491  115 ASP B N   
2614 C CA  . ASP B 108 ? 0.5494 0.5350 0.4041 0.0085  0.0331  0.0463  115 ASP B CA  
2615 C C   . ASP B 108 ? 0.4963 0.4780 0.3517 0.0089  0.0303  0.0439  115 ASP B C   
2616 O O   . ASP B 108 ? 0.5148 0.4946 0.3682 0.0104  0.0311  0.0406  115 ASP B O   
2617 C CB  . ASP B 108 ? 0.6121 0.5989 0.4642 0.0104  0.0371  0.0440  115 ASP B CB  
2618 C CG  . ASP B 108 ? 0.6478 0.6386 0.4992 0.0102  0.0404  0.0465  115 ASP B CG  
2619 O OD1 . ASP B 108 ? 0.7084 0.6999 0.5558 0.0085  0.0400  0.0489  115 ASP B OD1 
2620 O OD2 . ASP B 108 ? 0.6821 0.6753 0.5373 0.0116  0.0432  0.0461  115 ASP B OD2 
2621 N N   . GLY B 109 ? 0.4555 0.4361 0.3142 0.0075  0.0270  0.0458  116 GLY B N   
2622 C CA  . GLY B 109 ? 0.4653 0.4424 0.3251 0.0074  0.0240  0.0444  116 GLY B CA  
2623 C C   . GLY B 109 ? 0.4377 0.4138 0.3031 0.0088  0.0241  0.0424  116 GLY B C   
2624 O O   . GLY B 109 ? 0.4830 0.4561 0.3493 0.0092  0.0223  0.0406  116 GLY B O   
2625 N N   . GLU B 110 ? 0.4289 0.4073 0.2978 0.0096  0.0262  0.0427  117 GLU B N   
2626 C CA  . GLU B 110 ? 0.4195 0.3968 0.2931 0.0109  0.0265  0.0408  117 GLU B CA  
2627 C C   . GLU B 110 ? 0.4002 0.3788 0.2800 0.0103  0.0260  0.0430  117 GLU B C   
2628 O O   . GLU B 110 ? 0.3829 0.3644 0.2635 0.0097  0.0270  0.0454  117 GLU B O   
2629 C CB  . GLU B 110 ? 0.4604 0.4390 0.3328 0.0126  0.0295  0.0386  117 GLU B CB  
2630 C CG  . GLU B 110 ? 0.5335 0.5102 0.4001 0.0136  0.0300  0.0357  117 GLU B CG  
2631 C CD  . GLU B 110 ? 0.5920 0.5686 0.4592 0.0156  0.0323  0.0329  117 GLU B CD  
2632 O OE1 . GLU B 110 ? 0.5976 0.5757 0.4698 0.0162  0.0333  0.0332  117 GLU B OE1 
2633 O OE2 . GLU B 110 ? 0.6142 0.5891 0.4767 0.0164  0.0328  0.0303  117 GLU B OE2 
2634 N N   . PHE B 111 ? 0.3649 0.3412 0.2488 0.0106  0.0246  0.0420  118 PHE B N   
2635 C CA  . PHE B 111 ? 0.3524 0.3293 0.2416 0.0101  0.0242  0.0438  118 PHE B CA  
2636 C C   . PHE B 111 ? 0.3602 0.3392 0.2511 0.0111  0.0265  0.0433  118 PHE B C   
2637 O O   . PHE B 111 ? 0.3906 0.3691 0.2801 0.0125  0.0279  0.0407  118 PHE B O   
2638 C CB  . PHE B 111 ? 0.3597 0.3332 0.2523 0.0102  0.0225  0.0426  118 PHE B CB  
2639 C CG  . PHE B 111 ? 0.3521 0.3236 0.2448 0.0093  0.0202  0.0435  118 PHE B CG  
2640 C CD1 . PHE B 111 ? 0.3652 0.3378 0.2592 0.0077  0.0189  0.0466  118 PHE B CD1 
2641 C CD2 . PHE B 111 ? 0.3357 0.3043 0.2275 0.0098  0.0192  0.0413  118 PHE B CD2 
2642 C CE1 . PHE B 111 ? 0.3729 0.3436 0.2676 0.0068  0.0166  0.0475  118 PHE B CE1 
2643 C CE2 . PHE B 111 ? 0.3265 0.2934 0.2191 0.0089  0.0170  0.0423  118 PHE B CE2 
2644 C CZ  . PHE B 111 ? 0.3523 0.3201 0.2466 0.0074  0.0157  0.0454  118 PHE B CZ  
2645 N N   . ILE B 112 ? 0.3482 0.3294 0.2423 0.0103  0.0268  0.0459  119 ILE B N   
2646 C CA  . ILE B 112 ? 0.3602 0.3433 0.2573 0.0110  0.0284  0.0461  119 ILE B CA  
2647 C C   . ILE B 112 ? 0.3784 0.3604 0.2805 0.0102  0.0268  0.0474  119 ILE B C   
2648 O O   . ILE B 112 ? 0.3692 0.3514 0.2731 0.0088  0.0254  0.0499  119 ILE B O   
2649 C CB  . ILE B 112 ? 0.4117 0.3991 0.3083 0.0107  0.0305  0.0485  119 ILE B CB  
2650 C CG1 . ILE B 112 ? 0.4226 0.4109 0.3134 0.0114  0.0323  0.0471  119 ILE B CG1 
2651 C CG2 . ILE B 112 ? 0.4046 0.3942 0.3053 0.0112  0.0320  0.0491  119 ILE B CG2 
2652 C CD1 . ILE B 112 ? 0.4385 0.4256 0.3278 0.0133  0.0339  0.0437  119 ILE B CD1 
2653 N N   . TYR B 113 ? 0.3507 0.3312 0.2548 0.0110  0.0270  0.0456  120 TYR B N   
2654 C CA  . TYR B 113 ? 0.3647 0.3429 0.2726 0.0104  0.0254  0.0460  120 TYR B CA  
2655 C C   . TYR B 113 ? 0.3421 0.3224 0.2531 0.0106  0.0264  0.0469  120 TYR B C   
2656 O O   . TYR B 113 ? 0.3710 0.3523 0.2813 0.0119  0.0281  0.0453  120 TYR B O   
2657 C CB  . TYR B 113 ? 0.3762 0.3501 0.2838 0.0110  0.0243  0.0431  120 TYR B CB  
2658 C CG  . TYR B 113 ? 0.3955 0.3669 0.3009 0.0109  0.0232  0.0421  120 TYR B CG  
2659 C CD1 . TYR B 113 ? 0.4410 0.4127 0.3467 0.0097  0.0220  0.0443  120 TYR B CD1 
2660 C CD2 . TYR B 113 ? 0.4707 0.4394 0.3745 0.0120  0.0231  0.0392  120 TYR B CD2 
2661 C CE1 . TYR B 113 ? 0.4512 0.4207 0.3555 0.0096  0.0208  0.0436  120 TYR B CE1 
2662 C CE2 . TYR B 113 ? 0.4776 0.4441 0.3800 0.0118  0.0220  0.0385  120 TYR B CE2 
2663 C CZ  . TYR B 113 ? 0.4639 0.4308 0.3667 0.0107  0.0208  0.0407  120 TYR B CZ  
2664 O OH  . TYR B 113 ? 0.4813 0.4461 0.3834 0.0105  0.0196  0.0402  120 TYR B OH  
2665 N N   . LYS B 114 ? 0.3238 0.3046 0.2383 0.0094  0.0253  0.0495  121 LYS B N   
2666 C CA  . LYS B 114 ? 0.3367 0.3190 0.2549 0.0092  0.0256  0.0508  121 LYS B CA  
2667 C C   . LYS B 114 ? 0.3276 0.3062 0.2483 0.0082  0.0232  0.0510  121 LYS B C   
2668 O O   . LYS B 114 ? 0.3111 0.2881 0.2325 0.0069  0.0215  0.0524  121 LYS B O   
2669 C CB  . LYS B 114 ? 0.3725 0.3593 0.2929 0.0083  0.0264  0.0545  121 LYS B CB  
2670 C CG  . LYS B 114 ? 0.4471 0.4381 0.3665 0.0093  0.0293  0.0548  121 LYS B CG  
2671 C CD  . LYS B 114 ? 0.4991 0.4906 0.4134 0.0101  0.0307  0.0533  121 LYS B CD  
2672 C CE  . LYS B 114 ? 0.5226 0.5182 0.4359 0.0113  0.0341  0.0535  121 LYS B CE  
2673 N NZ  . LYS B 114 ? 0.5751 0.5706 0.4898 0.0128  0.0355  0.0512  121 LYS B NZ  
2674 N N   . VAL B 115 ? 0.2864 0.2632 0.2081 0.0087  0.0230  0.0494  122 VAL B N   
2675 C CA  . VAL B 115 ? 0.2890 0.2615 0.2120 0.0078  0.0209  0.0491  122 VAL B CA  
2676 C C   . VAL B 115 ? 0.2922 0.2655 0.2188 0.0072  0.0203  0.0506  122 VAL B C   
2677 O O   . VAL B 115 ? 0.2801 0.2563 0.2080 0.0081  0.0218  0.0506  122 VAL B O   
2678 C CB  . VAL B 115 ? 0.2897 0.2580 0.2101 0.0087  0.0207  0.0455  122 VAL B CB  
2679 C CG1 . VAL B 115 ? 0.2892 0.2527 0.2101 0.0076  0.0186  0.0452  122 VAL B CG1 
2680 C CG2 . VAL B 115 ? 0.3056 0.2734 0.2227 0.0095  0.0214  0.0437  122 VAL B CG2 
2681 N N   . LYS B 116 ? 0.2775 0.2482 0.2060 0.0056  0.0180  0.0522  123 LYS B N   
2682 C CA  . LYS B 116 ? 0.3135 0.2839 0.2453 0.0047  0.0168  0.0537  123 LYS B CA  
2683 C C   . LYS B 116 ? 0.3116 0.2759 0.2420 0.0038  0.0146  0.0522  123 LYS B C   
2684 O O   . LYS B 116 ? 0.3093 0.2703 0.2382 0.0031  0.0134  0.0520  123 LYS B O   
2685 C CB  . LYS B 116 ? 0.3363 0.3097 0.2720 0.0033  0.0160  0.0577  123 LYS B CB  
2686 C CG  . LYS B 116 ? 0.4137 0.3932 0.3506 0.0041  0.0184  0.0595  123 LYS B CG  
2687 C CD  . LYS B 116 ? 0.4705 0.4531 0.4114 0.0026  0.0177  0.0636  123 LYS B CD  
2688 C CE  . LYS B 116 ? 0.5522 0.5406 0.4933 0.0034  0.0205  0.0651  123 LYS B CE  
2689 N NZ  . LYS B 116 ? 0.5831 0.5712 0.5200 0.0037  0.0211  0.0640  123 LYS B NZ  
2690 N N   . LEU B 117 ? 0.3136 0.2762 0.2445 0.0039  0.0140  0.0512  124 LEU B N   
2691 C CA  . LEU B 117 ? 0.3167 0.2731 0.2453 0.0031  0.0122  0.0495  124 LEU B CA  
2692 C C   . LEU B 117 ? 0.3323 0.2873 0.2632 0.0018  0.0102  0.0508  124 LEU B C   
2693 O O   . LEU B 117 ? 0.2837 0.2421 0.2175 0.0023  0.0108  0.0517  124 LEU B O   
2694 C CB  . LEU B 117 ? 0.3216 0.2762 0.2470 0.0046  0.0134  0.0460  124 LEU B CB  
2695 C CG  . LEU B 117 ? 0.3314 0.2798 0.2540 0.0041  0.0121  0.0438  124 LEU B CG  
2696 C CD1 . LEU B 117 ? 0.3300 0.2764 0.2491 0.0053  0.0134  0.0408  124 LEU B CD1 
2697 C CD2 . LEU B 117 ? 0.3157 0.2635 0.2393 0.0038  0.0113  0.0437  124 LEU B CD2 
2698 N N   . ARG B 118 ? 0.2952 0.2450 0.2249 0.0003  0.0079  0.0510  125 ARG B N   
2699 C CA  . ARG B 118 ? 0.3341 0.2814 0.2652 -0.0011 0.0055  0.0521  125 ARG B CA  
2700 C C   . ARG B 118 ? 0.3528 0.2928 0.2794 -0.0019 0.0041  0.0497  125 ARG B C   
2701 O O   . ARG B 118 ? 0.3504 0.2862 0.2747 -0.0027 0.0032  0.0493  125 ARG B O   
2702 C CB  . ARG B 118 ? 0.3748 0.3229 0.3093 -0.0029 0.0034  0.0557  125 ARG B CB  
2703 C CG  . ARG B 118 ? 0.4023 0.3472 0.3381 -0.0048 0.0005  0.0570  125 ARG B CG  
2704 C CD  . ARG B 118 ? 0.4652 0.4095 0.4037 -0.0068 -0.0020 0.0603  125 ARG B CD  
2705 N NE  . ARG B 118 ? 0.5210 0.4599 0.4558 -0.0076 -0.0030 0.0592  125 ARG B NE  
2706 C CZ  . ARG B 118 ? 0.5559 0.4948 0.4921 -0.0086 -0.0039 0.0612  125 ARG B CZ  
2707 N NH1 . ARG B 118 ? 0.6089 0.5422 0.5415 -0.0091 -0.0047 0.0597  125 ARG B NH1 
2708 N NH2 . ARG B 118 ? 0.5110 0.4554 0.4522 -0.0090 -0.0040 0.0647  125 ARG B NH2 
2709 N N   . GLY B 119 ? 0.3223 0.2606 0.2477 -0.0016 0.0039  0.0481  126 GLY B N   
2710 C CA  . GLY B 119 ? 0.3481 0.2792 0.2692 -0.0027 0.0023  0.0462  126 GLY B CA  
2711 C C   . GLY B 119 ? 0.3444 0.2730 0.2665 -0.0046 -0.0006 0.0478  126 GLY B C   
2712 O O   . GLY B 119 ? 0.3169 0.2490 0.2427 -0.0046 -0.0010 0.0493  126 GLY B O   
2713 N N   . THR B 120 ? 0.3191 0.2411 0.2378 -0.0064 -0.0027 0.0475  127 THR B N   
2714 C CA  . THR B 120 ? 0.3711 0.2898 0.2902 -0.0087 -0.0061 0.0493  127 THR B CA  
2715 C C   . THR B 120 ? 0.3741 0.2843 0.2867 -0.0098 -0.0074 0.0469  127 THR B C   
2716 O O   . THR B 120 ? 0.3824 0.2895 0.2909 -0.0090 -0.0056 0.0442  127 THR B O   
2717 C CB  . THR B 120 ? 0.3814 0.3005 0.3035 -0.0103 -0.0082 0.0526  127 THR B CB  
2718 O OG1 . THR B 120 ? 0.3843 0.3000 0.3035 -0.0104 -0.0078 0.0515  127 THR B OG1 
2719 C CG2 . THR B 120 ? 0.3914 0.3190 0.3202 -0.0094 -0.0070 0.0554  127 THR B CG2 
2720 N N   . ASN B 121 ? 0.4040 0.3108 0.3160 -0.0118 -0.0104 0.0480  128 ASN B N   
2721 C CA  . ASN B 121 ? 0.4036 0.3017 0.3092 -0.0136 -0.0123 0.0464  128 ASN B CA  
2722 C C   . ASN B 121 ? 0.3794 0.2740 0.2795 -0.0125 -0.0103 0.0427  128 ASN B C   
2723 O O   . ASN B 121 ? 0.4083 0.2959 0.3026 -0.0134 -0.0107 0.0409  128 ASN B O   
2724 C CB  . ASN B 121 ? 0.4260 0.3195 0.3290 -0.0146 -0.0131 0.0464  128 ASN B CB  
2725 C CG  . ASN B 121 ? 0.4370 0.3213 0.3343 -0.0173 -0.0163 0.0460  128 ASN B CG  
2726 O OD1 . ASN B 121 ? 0.4548 0.3378 0.3527 -0.0191 -0.0193 0.0477  128 ASN B OD1 
2727 N ND2 . ASN B 121 ? 0.4542 0.3323 0.3462 -0.0175 -0.0156 0.0439  128 ASN B ND2 
2728 N N   . PHE B 122 ? 0.3801 0.2795 0.2822 -0.0105 -0.0081 0.0417  129 PHE B N   
2729 C CA  . PHE B 122 ? 0.3619 0.2586 0.2597 -0.0095 -0.0064 0.0386  129 PHE B CA  
2730 C C   . PHE B 122 ? 0.3853 0.2780 0.2810 -0.0115 -0.0093 0.0390  129 PHE B C   
2731 O O   . PHE B 122 ? 0.4192 0.3156 0.3195 -0.0120 -0.0109 0.0413  129 PHE B O   
2732 C CB  . PHE B 122 ? 0.3828 0.2865 0.2842 -0.0070 -0.0036 0.0379  129 PHE B CB  
2733 C CG  . PHE B 122 ? 0.3597 0.2660 0.2617 -0.0052 -0.0008 0.0370  129 PHE B CG  
2734 C CD1 . PHE B 122 ? 0.3748 0.2771 0.2723 -0.0045 0.0008  0.0343  129 PHE B CD1 
2735 C CD2 . PHE B 122 ? 0.3987 0.3112 0.3057 -0.0045 -0.0001 0.0390  129 PHE B CD2 
2736 C CE1 . PHE B 122 ? 0.3639 0.2681 0.2620 -0.0031 0.0030  0.0336  129 PHE B CE1 
2737 C CE2 . PHE B 122 ? 0.3758 0.2901 0.2828 -0.0031 0.0019  0.0383  129 PHE B CE2 
2738 C CZ  . PHE B 122 ? 0.3758 0.2860 0.2786 -0.0025 0.0034  0.0356  129 PHE B CZ  
2739 N N   . PRO B 123 ? 0.4122 0.2972 0.3011 -0.0127 -0.0099 0.0371  130 PRO B N   
2740 C CA  . PRO B 123 ? 0.4848 0.3654 0.3706 -0.0145 -0.0125 0.0371  130 PRO B CA  
2741 C C   . PRO B 123 ? 0.4857 0.3709 0.3745 -0.0132 -0.0117 0.0368  130 PRO B C   
2742 O O   . PRO B 123 ? 0.4906 0.3781 0.3791 -0.0110 -0.0086 0.0347  130 PRO B O   
2743 C CB  . PRO B 123 ? 0.4607 0.3330 0.3381 -0.0152 -0.0118 0.0342  130 PRO B CB  
2744 C CG  . PRO B 123 ? 0.4773 0.3491 0.3542 -0.0144 -0.0099 0.0335  130 PRO B CG  
2745 C CD  . PRO B 123 ? 0.4331 0.3139 0.3168 -0.0118 -0.0075 0.0342  130 PRO B CD  
2746 N N   . SER B 124 ? 0.5123 0.3985 0.4042 -0.0146 -0.0146 0.0391  131 SER B N   
2747 C CA  . SER B 124 ? 0.5569 0.4468 0.4522 -0.0138 -0.0146 0.0394  131 SER B CA  
2748 C C   . SER B 124 ? 0.5184 0.4057 0.4089 -0.0129 -0.0127 0.0363  131 SER B C   
2749 O O   . SER B 124 ? 0.5500 0.4421 0.4437 -0.0109 -0.0109 0.0356  131 SER B O   
2750 C CB  . SER B 124 ? 0.5917 0.4795 0.4884 -0.0165 -0.0189 0.0420  131 SER B CB  
2751 O OG  . SER B 124 ? 0.6204 0.4995 0.5096 -0.0190 -0.0213 0.0414  131 SER B OG  
2752 N N   . ASP B 125 ? 0.5341 0.4139 0.4171 -0.0141 -0.0130 0.0345  132 ASP B N   
2753 C CA  . ASP B 125 ? 0.5529 0.4297 0.4312 -0.0135 -0.0114 0.0318  132 ASP B CA  
2754 C C   . ASP B 125 ? 0.5571 0.4330 0.4322 -0.0117 -0.0077 0.0290  132 ASP B C   
2755 O O   . ASP B 125 ? 0.5338 0.4051 0.4034 -0.0117 -0.0064 0.0267  132 ASP B O   
2756 C CB  . ASP B 125 ? 0.6067 0.4751 0.4780 -0.0164 -0.0142 0.0316  132 ASP B CB  
2757 C CG  . ASP B 125 ? 0.6421 0.5040 0.5081 -0.0182 -0.0152 0.0315  132 ASP B CG  
2758 O OD1 . ASP B 125 ? 0.7147 0.5791 0.5838 -0.0176 -0.0147 0.0324  132 ASP B OD1 
2759 O OD2 . ASP B 125 ? 0.6539 0.5079 0.5126 -0.0203 -0.0167 0.0306  132 ASP B OD2 
2760 N N   . GLY B 126 ? 0.4849 0.3649 0.3635 -0.0102 -0.0059 0.0293  133 GLY B N   
2761 C CA  . GLY B 126 ? 0.4344 0.3131 0.3103 -0.0087 -0.0028 0.0271  133 GLY B CA  
2762 C C   . GLY B 126 ? 0.4295 0.3142 0.3089 -0.0061 0.0000  0.0259  133 GLY B C   
2763 O O   . GLY B 126 ? 0.4379 0.3280 0.3219 -0.0052 -0.0002 0.0268  133 GLY B O   
2764 N N   . PRO B 127 ? 0.4445 0.3283 0.3220 -0.0047 0.0027  0.0240  134 PRO B N   
2765 C CA  . PRO B 127 ? 0.4193 0.3078 0.2994 -0.0023 0.0052  0.0227  134 PRO B CA  
2766 C C   . PRO B 127 ? 0.3801 0.2762 0.2663 -0.0009 0.0057  0.0241  134 PRO B C   
2767 O O   . PRO B 127 ? 0.4066 0.3067 0.2951 0.0007  0.0071  0.0233  134 PRO B O   
2768 C CB  . PRO B 127 ? 0.4603 0.3457 0.3372 -0.0014 0.0078  0.0207  134 PRO B CB  
2769 C CG  . PRO B 127 ? 0.4863 0.3668 0.3604 -0.0030 0.0069  0.0212  134 PRO B CG  
2770 C CD  . PRO B 127 ? 0.4820 0.3595 0.3545 -0.0053 0.0036  0.0227  134 PRO B CD  
2771 N N   . VAL B 128 ? 0.3690 0.2670 0.2578 -0.0015 0.0047  0.0261  135 VAL B N   
2772 C CA  . VAL B 128 ? 0.3800 0.2853 0.2744 0.0000  0.0055  0.0275  135 VAL B CA  
2773 C C   . VAL B 128 ? 0.3532 0.2621 0.2513 -0.0002 0.0041  0.0289  135 VAL B C   
2774 O O   . VAL B 128 ? 0.3956 0.3095 0.2967 0.0015  0.0056  0.0285  135 VAL B O   
2775 C CB  . VAL B 128 ? 0.3826 0.2892 0.2789 -0.0005 0.0051  0.0293  135 VAL B CB  
2776 C CG1 . VAL B 128 ? 0.3961 0.3102 0.2979 0.0007  0.0059  0.0309  135 VAL B CG1 
2777 C CG2 . VAL B 128 ? 0.4207 0.3246 0.3143 0.0000  0.0069  0.0277  135 VAL B CG2 
2778 N N   . MET B 129 ? 0.3560 0.2623 0.2539 -0.0022 0.0014  0.0305  136 MET B N   
2779 C CA  . MET B 129 ? 0.4106 0.3204 0.3130 -0.0025 -0.0001 0.0324  136 MET B CA  
2780 C C   . MET B 129 ? 0.4444 0.3528 0.3453 -0.0022 -0.0001 0.0309  136 MET B C   
2781 O O   . MET B 129 ? 0.4766 0.3893 0.3818 -0.0013 0.0000  0.0315  136 MET B O   
2782 C CB  . MET B 129 ? 0.4398 0.3475 0.3433 -0.0050 -0.0034 0.0352  136 MET B CB  
2783 C CG  . MET B 129 ? 0.4562 0.3655 0.3618 -0.0055 -0.0038 0.0372  136 MET B CG  
2784 S SD  . MET B 129 ? 0.4587 0.3771 0.3707 -0.0031 -0.0010 0.0382  136 MET B SD  
2785 C CE  . MET B 129 ? 0.4362 0.3592 0.3544 -0.0030 -0.0022 0.0403  136 MET B CE  
2786 N N   . GLN B 130 ? 0.4550 0.3579 0.3502 -0.0027 0.0001  0.0287  137 GLN B N   
2787 C CA  . GLN B 130 ? 0.5041 0.4057 0.3976 -0.0022 0.0004  0.0270  137 GLN B CA  
2788 C C   . GLN B 130 ? 0.4994 0.4036 0.3930 0.0001  0.0034  0.0247  137 GLN B C   
2789 O O   . GLN B 130 ? 0.4972 0.4003 0.3893 0.0006  0.0038  0.0232  137 GLN B O   
2790 C CB  . GLN B 130 ? 0.4898 0.3836 0.3768 -0.0042 -0.0009 0.0262  137 GLN B CB  
2791 C CG  . GLN B 130 ? 0.5343 0.4249 0.4207 -0.0069 -0.0044 0.0284  137 GLN B CG  
2792 C CD  . GLN B 130 ? 0.6188 0.5124 0.5099 -0.0074 -0.0066 0.0303  137 GLN B CD  
2793 O OE1 . GLN B 130 ? 0.6368 0.5318 0.5288 -0.0064 -0.0061 0.0293  137 GLN B OE1 
2794 N NE2 . GLN B 130 ? 0.6270 0.5215 0.5214 -0.0089 -0.0093 0.0331  137 GLN B NE2 
2795 N N   . LYS B 131 ? 0.4551 0.3628 0.3505 0.0016  0.0055  0.0245  138 LYS B N   
2796 C CA  . LYS B 131 ? 0.4304 0.3410 0.3263 0.0039  0.0081  0.0226  138 LYS B CA  
2797 C C   . LYS B 131 ? 0.4480 0.3537 0.3391 0.0039  0.0090  0.0203  138 LYS B C   
2798 O O   . LYS B 131 ? 0.4466 0.3534 0.3378 0.0051  0.0100  0.0189  138 LYS B O   
2799 C CB  . LYS B 131 ? 0.4442 0.3602 0.3444 0.0055  0.0086  0.0227  138 LYS B CB  
2800 C CG  . LYS B 131 ? 0.4208 0.3422 0.3261 0.0058  0.0084  0.0248  138 LYS B CG  
2801 C CD  . LYS B 131 ? 0.4797 0.4060 0.3892 0.0074  0.0091  0.0247  138 LYS B CD  
2802 C CE  . LYS B 131 ? 0.5318 0.4629 0.4464 0.0076  0.0090  0.0271  138 LYS B CE  
2803 N NZ  . LYS B 131 ? 0.5591 0.4941 0.4784 0.0086  0.0092  0.0276  138 LYS B NZ  
2804 N N   . LYS B 132 ? 0.4501 0.3505 0.3370 0.0027  0.0089  0.0200  139 LYS B N   
2805 C CA  . LYS B 132 ? 0.4749 0.3705 0.3572 0.0027  0.0102  0.0179  139 LYS B CA  
2806 C C   . LYS B 132 ? 0.4505 0.3466 0.3326 0.0042  0.0128  0.0166  139 LYS B C   
2807 O O   . LYS B 132 ? 0.4622 0.3541 0.3408 0.0041  0.0141  0.0151  139 LYS B O   
2808 C CB  . LYS B 132 ? 0.4717 0.3603 0.3490 0.0004  0.0089  0.0181  139 LYS B CB  
2809 C CG  . LYS B 132 ? 0.5393 0.4261 0.4158 -0.0014 0.0060  0.0194  139 LYS B CG  
2810 C CD  . LYS B 132 ? 0.5587 0.4379 0.4293 -0.0038 0.0045  0.0194  139 LYS B CD  
2811 C CE  . LYS B 132 ? 0.6080 0.4851 0.4777 -0.0058 0.0014  0.0207  139 LYS B CE  
2812 N NZ  . LYS B 132 ? 0.6441 0.5132 0.5071 -0.0083 -0.0001 0.0206  139 LYS B NZ  
2813 N N   . THR B 133 ? 0.4520 0.3528 0.3377 0.0053  0.0135  0.0174  140 THR B N   
2814 C CA  . THR B 133 ? 0.4191 0.3204 0.3050 0.0065  0.0156  0.0166  140 THR B CA  
2815 C C   . THR B 133 ? 0.4205 0.3258 0.3086 0.0084  0.0169  0.0155  140 THR B C   
2816 O O   . THR B 133 ? 0.4485 0.3570 0.3385 0.0089  0.0163  0.0157  140 THR B O   
2817 C CB  . THR B 133 ? 0.4493 0.3529 0.3375 0.0065  0.0155  0.0181  140 THR B CB  
2818 O OG1 . THR B 133 ? 0.4741 0.3839 0.3663 0.0073  0.0152  0.0193  140 THR B OG1 
2819 C CG2 . THR B 133 ? 0.4500 0.3505 0.3368 0.0046  0.0138  0.0194  140 THR B CG2 
2820 N N   . MET B 134 ? 0.3915 0.2962 0.2793 0.0094  0.0187  0.0144  141 MET B N   
2821 C CA  . MET B 134 ? 0.4110 0.3189 0.3005 0.0111  0.0198  0.0135  141 MET B CA  
2822 C C   . MET B 134 ? 0.4282 0.3374 0.3191 0.0120  0.0211  0.0134  141 MET B C   
2823 O O   . MET B 134 ? 0.4426 0.3512 0.3335 0.0129  0.0224  0.0123  141 MET B O   
2824 C CB  . MET B 134 ? 0.4623 0.3674 0.3498 0.0112  0.0203  0.0119  141 MET B CB  
2825 C CG  . MET B 134 ? 0.4618 0.3612 0.3458 0.0103  0.0211  0.0112  141 MET B CG  
2826 S SD  . MET B 134 ? 0.5145 0.4110 0.3963 0.0105  0.0219  0.0095  141 MET B SD  
2827 C CE  . MET B 134 ? 0.5011 0.4022 0.3864 0.0126  0.0228  0.0088  141 MET B CE  
2828 N N   . GLY B 135 ? 0.4039 0.3152 0.2964 0.0118  0.0207  0.0149  142 GLY B N   
2829 C CA  . GLY B 135 ? 0.4029 0.3164 0.2973 0.0127  0.0217  0.0152  142 GLY B CA  
2830 C C   . GLY B 135 ? 0.4155 0.3256 0.3093 0.0120  0.0222  0.0157  142 GLY B C   
2831 O O   . GLY B 135 ? 0.4514 0.3568 0.3428 0.0110  0.0221  0.0153  142 GLY B O   
2832 N N1  . 4OO B 136 ? 0.5904 0.5083 0.4914 0.0078  0.0169  0.0255  143 4OO B N1  
2833 N N2  . 4OO B 136 ? 0.7846 0.7006 0.6859 0.0071  0.0165  0.0264  143 4OO B N2  
2834 N N3  . 4OO B 136 ? 0.7822 0.6961 0.6840 0.0063  0.0161  0.0274  143 4OO B N3  
2835 C C   . 4OO B 136 ? 0.4088 0.3163 0.3056 0.0129  0.0246  0.0160  143 4OO B C   
2836 O O   . 4OO B 136 ? 0.3968 0.3068 0.2952 0.0140  0.0251  0.0156  143 4OO B O   
2837 C CA  . 4OO B 136 ? 0.4276 0.3372 0.3239 0.0121  0.0230  0.0170  143 4OO B CA  
2838 N N   . 4OO B 136 ? 0.4048 0.3173 0.3009 0.0125  0.0225  0.0165  143 4OO B N   
2839 C CB  . 4OO B 136 ? 0.4494 0.3627 0.3484 0.0121  0.0225  0.0188  143 4OO B CB  
2840 C CG  . 4OO B 136 ? 0.4743 0.3886 0.3733 0.0110  0.0211  0.0204  143 4OO B CG  
2841 C CD2 . 4OO B 136 ? 0.4573 0.3763 0.3574 0.0112  0.0204  0.0212  143 4OO B CD2 
2842 C CE2 . 4OO B 136 ? 0.4828 0.4030 0.3834 0.0102  0.0191  0.0228  143 4OO B CE2 
2843 C CZ  . 4OO B 136 ? 0.5261 0.4427 0.4260 0.0089  0.0183  0.0236  143 4OO B CZ  
2844 C CE1 . 4OO B 136 ? 0.5254 0.4371 0.4239 0.0087  0.0191  0.0226  143 4OO B CE1 
2845 C CD1 . 4OO B 136 ? 0.4663 0.3769 0.3644 0.0098  0.0206  0.0210  143 4OO B CD1 
2846 N N   . GLU B 137 ? 0.4212 0.3239 0.3167 0.0124  0.0255  0.0156  144 GLU B N   
2847 C CA  . GLU B 137 ? 0.4227 0.3237 0.3198 0.0132  0.0272  0.0151  144 GLU B CA  
2848 C C   . GLU B 137 ? 0.4255 0.3296 0.3263 0.0136  0.0269  0.0166  144 GLU B C   
2849 O O   . GLU B 137 ? 0.3846 0.2902 0.2860 0.0129  0.0257  0.0181  144 GLU B O   
2850 C CB  . GLU B 137 ? 0.4637 0.3583 0.3585 0.0126  0.0286  0.0143  144 GLU B CB  
2851 C CG  . GLU B 137 ? 0.5284 0.4188 0.4189 0.0120  0.0290  0.0128  144 GLU B CG  
2852 C CD  . GLU B 137 ? 0.5550 0.4447 0.4454 0.0130  0.0307  0.0115  144 GLU B CD  
2853 O OE1 . GLU B 137 ? 0.6108 0.5033 0.5048 0.0141  0.0314  0.0117  144 GLU B OE1 
2854 O OE2 . GLU B 137 ? 0.5699 0.4561 0.4566 0.0124  0.0311  0.0103  144 GLU B OE2 
2855 N N   . ALA B 138 ? 0.4045 0.3096 0.3080 0.0146  0.0278  0.0166  145 ALA B N   
2856 C CA  . ALA B 138 ? 0.3845 0.2920 0.2917 0.0149  0.0274  0.0181  145 ALA B CA  
2857 C C   . ALA B 138 ? 0.3928 0.2970 0.3004 0.0141  0.0277  0.0189  145 ALA B C   
2858 O O   . ALA B 138 ? 0.4067 0.3060 0.3124 0.0139  0.0290  0.0178  145 ALA B O   
2859 C CB  . ALA B 138 ? 0.4107 0.3185 0.3207 0.0159  0.0284  0.0179  145 ALA B CB  
2860 N N   . SER B 139 ? 0.4278 0.3348 0.3378 0.0138  0.0265  0.0207  146 SER B N   
2861 C CA  . SER B 139 ? 0.4102 0.3152 0.3207 0.0129  0.0261  0.0218  146 SER B CA  
2862 C C   . SER B 139 ? 0.3955 0.3024 0.3101 0.0131  0.0256  0.0236  146 SER B C   
2863 O O   . SER B 139 ? 0.3870 0.2975 0.3038 0.0136  0.0251  0.0243  146 SER B O   
2864 C CB  . SER B 139 ? 0.4683 0.3748 0.3768 0.0119  0.0245  0.0226  146 SER B CB  
2865 O OG  . SER B 139 ? 0.5513 0.4527 0.4566 0.0112  0.0249  0.0215  146 SER B OG  
2866 N N   . SER B 140 ? 0.3637 0.2678 0.2794 0.0125  0.0256  0.0244  147 SER B N   
2867 C CA  . SER B 140 ? 0.3625 0.2686 0.2824 0.0124  0.0249  0.0264  147 SER B CA  
2868 C C   . SER B 140 ? 0.3372 0.2433 0.2570 0.0112  0.0233  0.0280  147 SER B C   
2869 O O   . SER B 140 ? 0.3451 0.2469 0.2627 0.0106  0.0237  0.0272  147 SER B O   
2870 C CB  . SER B 140 ? 0.4268 0.3292 0.3497 0.0132  0.0267  0.0259  147 SER B CB  
2871 O OG  . SER B 140 ? 0.4590 0.3621 0.3863 0.0130  0.0260  0.0279  147 SER B OG  
2872 N N   . GLU B 141 ? 0.3245 0.2353 0.2462 0.0108  0.0217  0.0301  148 GLU B N   
2873 C CA  . GLU B 141 ? 0.3064 0.2180 0.2284 0.0096  0.0201  0.0320  148 GLU B CA  
2874 C C   . GLU B 141 ? 0.3018 0.2122 0.2280 0.0094  0.0199  0.0335  148 GLU B C   
2875 O O   . GLU B 141 ? 0.2923 0.2052 0.2216 0.0098  0.0196  0.0346  148 GLU B O   
2876 C CB  . GLU B 141 ? 0.3159 0.2334 0.2375 0.0092  0.0187  0.0335  148 GLU B CB  
2877 C CG  . GLU B 141 ? 0.3564 0.2747 0.2779 0.0079  0.0172  0.0353  148 GLU B CG  
2878 C CD  . GLU B 141 ? 0.4059 0.3300 0.3271 0.0075  0.0161  0.0370  148 GLU B CD  
2879 O OE1 . GLU B 141 ? 0.4319 0.3594 0.3526 0.0082  0.0165  0.0367  148 GLU B OE1 
2880 O OE2 . GLU B 141 ? 0.3899 0.3151 0.3114 0.0064  0.0150  0.0387  148 GLU B OE2 
2881 N N   . ARG B 142 ? 0.2998 0.2060 0.2261 0.0088  0.0199  0.0335  149 ARG B N   
2882 C CA  . ARG B 142 ? 0.3064 0.2115 0.2371 0.0087  0.0195  0.0352  149 ARG B CA  
2883 C C   . ARG B 142 ? 0.2793 0.1882 0.2118 0.0075  0.0172  0.0381  149 ARG B C   
2884 O O   . ARG B 142 ? 0.2933 0.2023 0.2236 0.0065  0.0162  0.0385  149 ARG B O   
2885 C CB  . ARG B 142 ? 0.3533 0.2517 0.2831 0.0086  0.0207  0.0338  149 ARG B CB  
2886 C CG  . ARG B 142 ? 0.4595 0.3537 0.3883 0.0098  0.0234  0.0312  149 ARG B CG  
2887 C CD  . ARG B 142 ? 0.5768 0.4645 0.5014 0.0093  0.0243  0.0292  149 ARG B CD  
2888 N NE  . ARG B 142 ? 0.6846 0.5732 0.6042 0.0088  0.0237  0.0283  149 ARG B NE  
2889 C CZ  . ARG B 142 ? 0.7218 0.6077 0.6375 0.0076  0.0227  0.0278  149 ARG B CZ  
2890 N NH1 . ARG B 142 ? 0.7899 0.6772 0.7019 0.0072  0.0221  0.0272  149 ARG B NH1 
2891 N NH2 . ARG B 142 ? 0.7392 0.6206 0.6544 0.0067  0.0222  0.0281  149 ARG B NH2 
2892 N N   . MET B 143 ? 0.2746 0.1870 0.2109 0.0075  0.0163  0.0401  150 MET B N   
2893 C CA  . MET B 143 ? 0.2663 0.1832 0.2039 0.0064  0.0142  0.0430  150 MET B CA  
2894 C C   . MET B 143 ? 0.2704 0.1855 0.2123 0.0058  0.0133  0.0449  150 MET B C   
2895 O O   . MET B 143 ? 0.2731 0.1858 0.2183 0.0065  0.0142  0.0446  150 MET B O   
2896 C CB  . MET B 143 ? 0.2928 0.2150 0.2311 0.0066  0.0136  0.0442  150 MET B CB  
2897 C CG  . MET B 143 ? 0.3069 0.2311 0.2418 0.0074  0.0145  0.0423  150 MET B CG  
2898 S SD  . MET B 143 ? 0.3530 0.2779 0.2830 0.0071  0.0147  0.0411  150 MET B SD  
2899 C CE  . MET B 143 ? 0.3120 0.2417 0.2425 0.0058  0.0129  0.0443  150 MET B CE  
2900 N N   . TYR B 144 ? 0.2661 0.1826 0.2084 0.0045  0.0116  0.0470  151 TYR B N   
2901 C CA  . TYR B 144 ? 0.2709 0.1865 0.2178 0.0038  0.0102  0.0494  151 TYR B CA  
2902 C C   . TYR B 144 ? 0.2671 0.1868 0.2145 0.0023  0.0081  0.0524  151 TYR B C   
2903 O O   . TYR B 144 ? 0.2782 0.1996 0.2224 0.0017  0.0077  0.0524  151 TYR B O   
2904 C CB  . TYR B 144 ? 0.2860 0.1950 0.2333 0.0039  0.0110  0.0480  151 TYR B CB  
2905 C CG  . TYR B 144 ? 0.3198 0.2265 0.2631 0.0031  0.0107  0.0471  151 TYR B CG  
2906 C CD1 . TYR B 144 ? 0.3492 0.2534 0.2880 0.0036  0.0122  0.0442  151 TYR B CD1 
2907 C CD2 . TYR B 144 ? 0.3412 0.2478 0.2853 0.0016  0.0087  0.0491  151 TYR B CD2 
2908 C CE1 . TYR B 144 ? 0.3697 0.2717 0.3049 0.0028  0.0116  0.0435  151 TYR B CE1 
2909 C CE2 . TYR B 144 ? 0.3545 0.2587 0.2950 0.0008  0.0082  0.0484  151 TYR B CE2 
2910 C CZ  . TYR B 144 ? 0.3827 0.2846 0.3187 0.0014  0.0096  0.0455  151 TYR B CZ  
2911 O OH  . TYR B 144 ? 0.4242 0.3236 0.3564 0.0005  0.0090  0.0447  151 TYR B OH  
2912 N N   . PRO B 145 ? 0.2739 0.1951 0.2255 0.0016  0.0065  0.0552  152 PRO B N   
2913 C CA  . PRO B 145 ? 0.2779 0.2029 0.2301 0.0001  0.0045  0.0582  152 PRO B CA  
2914 C C   . PRO B 145 ? 0.3039 0.2255 0.2567 -0.0007 0.0036  0.0588  152 PRO B C   
2915 O O   . PRO B 145 ? 0.2972 0.2134 0.2516 -0.0004 0.0041  0.0576  152 PRO B O   
2916 C CB  . PRO B 145 ? 0.2770 0.2042 0.2337 -0.0002 0.0031  0.0609  152 PRO B CB  
2917 C CG  . PRO B 145 ? 0.2615 0.1837 0.2216 0.0007  0.0042  0.0595  152 PRO B CG  
2918 C CD  . PRO B 145 ? 0.2773 0.1971 0.2336 0.0022  0.0066  0.0557  152 PRO B CD  
2919 N N   . GLU B 146 ? 0.3195 0.2441 0.2711 -0.0019 0.0023  0.0606  153 GLU B N   
2920 C CA  . GLU B 146 ? 0.3320 0.2537 0.2846 -0.0031 0.0009  0.0617  153 GLU B CA  
2921 C C   . GLU B 146 ? 0.3389 0.2657 0.2918 -0.0046 -0.0007 0.0649  153 GLU B C   
2922 O O   . GLU B 146 ? 0.3309 0.2615 0.2808 -0.0045 -0.0001 0.0647  153 GLU B O   
2923 C CB  . GLU B 146 ? 0.3318 0.2487 0.2808 -0.0028 0.0019  0.0587  153 GLU B CB  
2924 C CG  . GLU B 146 ? 0.3822 0.2950 0.3319 -0.0041 0.0003  0.0596  153 GLU B CG  
2925 C CD  . GLU B 146 ? 0.4025 0.3093 0.3483 -0.0038 0.0012  0.0565  153 GLU B CD  
2926 O OE1 . GLU B 146 ? 0.4360 0.3436 0.3780 -0.0033 0.0023  0.0546  153 GLU B OE1 
2927 O OE2 . GLU B 146 ? 0.4528 0.3537 0.3988 -0.0042 0.0008  0.0557  153 GLU B OE2 
2928 N N   . ASP B 147 ? 0.3875 0.3143 0.3440 -0.0059 -0.0027 0.0677  154 ASP B N   
2929 C CA  . ASP B 147 ? 0.4154 0.3467 0.3728 -0.0074 -0.0044 0.0712  154 ASP B CA  
2930 C C   . ASP B 147 ? 0.3785 0.3164 0.3345 -0.0074 -0.0039 0.0726  154 ASP B C   
2931 O O   . ASP B 147 ? 0.4172 0.3587 0.3716 -0.0080 -0.0039 0.0737  154 ASP B O   
2932 C CB  . ASP B 147 ? 0.4513 0.3814 0.4064 -0.0080 -0.0047 0.0707  154 ASP B CB  
2933 C CG  . ASP B 147 ? 0.5106 0.4343 0.4669 -0.0086 -0.0058 0.0700  154 ASP B CG  
2934 O OD1 . ASP B 147 ? 0.6003 0.5230 0.5604 -0.0095 -0.0075 0.0723  154 ASP B OD1 
2935 O OD2 . ASP B 147 ? 0.5280 0.4474 0.4811 -0.0083 -0.0052 0.0674  154 ASP B OD2 
2936 N N   . GLY B 148 ? 0.3372 0.2765 0.2939 -0.0067 -0.0034 0.0725  155 GLY B N   
2937 C CA  . GLY B 148 ? 0.3381 0.2833 0.2934 -0.0070 -0.0033 0.0742  155 GLY B CA  
2938 C C   . GLY B 148 ? 0.3411 0.2881 0.2919 -0.0058 -0.0013 0.0717  155 GLY B C   
2939 O O   . GLY B 148 ? 0.3480 0.2997 0.2968 -0.0059 -0.0009 0.0728  155 GLY B O   
2940 N N   . ALA B 149 ? 0.3441 0.2871 0.2931 -0.0047 0.0000  0.0684  156 ALA B N   
2941 C CA  . ALA B 149 ? 0.3202 0.2643 0.2651 -0.0035 0.0018  0.0657  156 ALA B CA  
2942 C C   . ALA B 149 ? 0.2966 0.2364 0.2407 -0.0020 0.0031  0.0623  156 ALA B C   
2943 O O   . ALA B 149 ? 0.2933 0.2292 0.2401 -0.0019 0.0028  0.0620  156 ALA B O   
2944 C CB  . ALA B 149 ? 0.3303 0.2744 0.2736 -0.0039 0.0020  0.0653  156 ALA B CB  
2945 N N   . LEU B 150 ? 0.2806 0.2213 0.2214 -0.0009 0.0048  0.0599  157 LEU B N   
2946 C CA  . LEU B 150 ? 0.2765 0.2133 0.2164 0.0004  0.0062  0.0567  157 LEU B CA  
2947 C C   . LEU B 150 ? 0.2875 0.2212 0.2248 0.0008  0.0072  0.0542  157 LEU B C   
2948 O O   . LEU B 150 ? 0.2933 0.2295 0.2281 0.0007  0.0074  0.0541  157 LEU B O   
2949 C CB  . LEU B 150 ? 0.2819 0.2215 0.2203 0.0013  0.0070  0.0558  157 LEU B CB  
2950 C CG  . LEU B 150 ? 0.3099 0.2461 0.2479 0.0027  0.0084  0.0529  157 LEU B CG  
2951 C CD1 . LEU B 150 ? 0.3169 0.2497 0.2590 0.0028  0.0080  0.0533  157 LEU B CD1 
2952 C CD2 . LEU B 150 ? 0.3424 0.2821 0.2783 0.0033  0.0088  0.0524  157 LEU B CD2 
2953 N N   . LYS B 151 ? 0.2693 0.1973 0.2069 0.0012  0.0076  0.0523  158 LYS B N   
2954 C CA  . LYS B 151 ? 0.2801 0.2044 0.2148 0.0014  0.0085  0.0499  158 LYS B CA  
2955 C C   . LYS B 151 ? 0.2735 0.1956 0.2062 0.0029  0.0104  0.0468  158 LYS B C   
2956 O O   . LYS B 151 ? 0.2631 0.1843 0.1977 0.0037  0.0111  0.0464  158 LYS B O   
2957 C CB  . LYS B 151 ? 0.3045 0.2231 0.2402 0.0008  0.0078  0.0498  158 LYS B CB  
2958 C CG  . LYS B 151 ? 0.3640 0.2840 0.3024 -0.0007 0.0057  0.0530  158 LYS B CG  
2959 C CD  . LYS B 151 ? 0.3752 0.2973 0.3117 -0.0016 0.0048  0.0538  158 LYS B CD  
2960 C CE  . LYS B 151 ? 0.4195 0.3433 0.3590 -0.0032 0.0026  0.0573  158 LYS B CE  
2961 N NZ  . LYS B 151 ? 0.4655 0.3857 0.4037 -0.0042 0.0015  0.0571  158 LYS B NZ  
2962 N N   . GLY B 152 ? 0.2605 0.1816 0.1896 0.0032  0.0112  0.0448  159 GLY B N   
2963 C CA  . GLY B 152 ? 0.2712 0.1896 0.1983 0.0045  0.0130  0.0418  159 GLY B CA  
2964 C C   . GLY B 152 ? 0.2842 0.1978 0.2080 0.0042  0.0134  0.0399  159 GLY B C   
2965 O O   . GLY B 152 ? 0.2818 0.1963 0.2042 0.0033  0.0123  0.0406  159 GLY B O   
2966 N N   . GLU B 153 ? 0.2880 0.1967 0.2108 0.0050  0.0149  0.0376  160 GLU B N   
2967 C CA  . GLU B 153 ? 0.3046 0.2078 0.2236 0.0047  0.0155  0.0354  160 GLU B CA  
2968 C C   . GLU B 153 ? 0.3117 0.2135 0.2284 0.0060  0.0175  0.0327  160 GLU B C   
2969 O O   . GLU B 153 ? 0.2889 0.1907 0.2075 0.0071  0.0189  0.0321  160 GLU B O   
2970 C CB  . GLU B 153 ? 0.3453 0.2425 0.2646 0.0042  0.0155  0.0351  160 GLU B CB  
2971 C CG  . GLU B 153 ? 0.3899 0.2867 0.3102 0.0027  0.0133  0.0372  160 GLU B CG  
2972 C CD  . GLU B 153 ? 0.4757 0.3666 0.3970 0.0023  0.0133  0.0370  160 GLU B CD  
2973 O OE1 . GLU B 153 ? 0.5459 0.4375 0.4695 0.0012  0.0115  0.0393  160 GLU B OE1 
2974 O OE2 . GLU B 153 ? 0.5328 0.4186 0.4530 0.0031  0.0153  0.0348  160 GLU B OE2 
2975 N N   . ILE B 154 ? 0.3127 0.2136 0.2257 0.0058  0.0176  0.0313  161 ILE B N   
2976 C CA  . ILE B 154 ? 0.3573 0.2571 0.2679 0.0068  0.0193  0.0289  161 ILE B CA  
2977 C C   . ILE B 154 ? 0.3745 0.2691 0.2806 0.0061  0.0194  0.0272  161 ILE B C   
2978 O O   . ILE B 154 ? 0.3555 0.2501 0.2601 0.0049  0.0176  0.0281  161 ILE B O   
2979 C CB  . ILE B 154 ? 0.4110 0.3160 0.3211 0.0074  0.0192  0.0288  161 ILE B CB  
2980 C CG1 . ILE B 154 ? 0.4308 0.3416 0.3429 0.0070  0.0177  0.0311  161 ILE B CG1 
2981 C CG2 . ILE B 154 ? 0.4300 0.3352 0.3402 0.0089  0.0210  0.0271  161 ILE B CG2 
2982 C CD1 . ILE B 154 ? 0.4980 0.4137 0.4097 0.0078  0.0180  0.0308  161 ILE B CD1 
2983 N N   . LYS B 155 ? 0.3948 0.2853 0.2986 0.0068  0.0213  0.0249  162 LYS B N   
2984 C CA  . LYS B 155 ? 0.4513 0.3376 0.3501 0.0062  0.0215  0.0231  162 LYS B CA  
2985 C C   . LYS B 155 ? 0.4616 0.3515 0.3599 0.0071  0.0220  0.0223  162 LYS B C   
2986 O O   . LYS B 155 ? 0.4743 0.3652 0.3742 0.0084  0.0237  0.0215  162 LYS B O   
2987 C CB  . LYS B 155 ? 0.5454 0.4246 0.4416 0.0064  0.0236  0.0210  162 LYS B CB  
2988 C CG  . LYS B 155 ? 0.6273 0.5013 0.5224 0.0053  0.0230  0.0213  162 LYS B CG  
2989 C CD  . LYS B 155 ? 0.7200 0.5914 0.6110 0.0035  0.0207  0.0216  162 LYS B CD  
2990 C CE  . LYS B 155 ? 0.7650 0.6290 0.6497 0.0028  0.0216  0.0193  162 LYS B CE  
2991 N NZ  . LYS B 155 ? 0.7820 0.6406 0.6634 0.0009  0.0196  0.0196  162 LYS B NZ  
2992 N N   . GLN B 156 ? 0.4431 0.3354 0.3401 0.0064  0.0205  0.0229  163 GLN B N   
2993 C CA  . GLN B 156 ? 0.4335 0.3295 0.3303 0.0072  0.0208  0.0221  163 GLN B CA  
2994 C C   . GLN B 156 ? 0.4246 0.3158 0.3171 0.0069  0.0214  0.0202  163 GLN B C   
2995 O O   . GLN B 156 ? 0.4024 0.2886 0.2919 0.0057  0.0209  0.0198  163 GLN B O   
2996 C CB  . GLN B 156 ? 0.4600 0.3609 0.3579 0.0067  0.0190  0.0237  163 GLN B CB  
2997 C CG  . GLN B 156 ? 0.4841 0.3903 0.3857 0.0070  0.0184  0.0257  163 GLN B CG  
2998 C CD  . GLN B 156 ? 0.5561 0.4662 0.4596 0.0084  0.0195  0.0254  163 GLN B CD  
2999 O OE1 . GLN B 156 ? 0.5879 0.4960 0.4909 0.0093  0.0210  0.0238  163 GLN B OE1 
3000 N NE2 . GLN B 156 ? 0.5438 0.4595 0.4494 0.0086  0.0189  0.0270  163 GLN B NE2 
3001 N N   . ARG B 157 ? 0.4018 0.2943 0.2939 0.0079  0.0226  0.0188  164 ARG B N   
3002 C CA  . ARG B 157 ? 0.4153 0.3035 0.3032 0.0076  0.0231  0.0170  164 ARG B CA  
3003 C C   . ARG B 157 ? 0.3729 0.2656 0.2615 0.0082  0.0226  0.0169  164 ARG B C   
3004 O O   . ARG B 157 ? 0.3978 0.2945 0.2891 0.0095  0.0234  0.0168  164 ARG B O   
3005 C CB  . ARG B 157 ? 0.4240 0.3081 0.3107 0.0084  0.0257  0.0153  164 ARG B CB  
3006 C CG  . ARG B 157 ? 0.4820 0.3626 0.3695 0.0084  0.0268  0.0154  164 ARG B CG  
3007 C CD  . ARG B 157 ? 0.5031 0.3777 0.3877 0.0087  0.0293  0.0134  164 ARG B CD  
3008 N NE  . ARG B 157 ? 0.6175 0.4864 0.4963 0.0072  0.0287  0.0125  164 ARG B NE  
3009 C CZ  . ARG B 157 ? 0.6232 0.4861 0.4975 0.0069  0.0305  0.0107  164 ARG B CZ  
3010 N NH1 . ARG B 157 ? 0.5994 0.4613 0.4748 0.0083  0.0334  0.0096  164 ARG B NH1 
3011 N NH2 . ARG B 157 ? 0.6629 0.5208 0.5316 0.0052  0.0294  0.0102  164 ARG B NH2 
3012 N N   . LEU B 158 ? 0.3832 0.2755 0.2697 0.0071  0.0210  0.0171  165 LEU B N   
3013 C CA  . LEU B 158 ? 0.3867 0.2822 0.2735 0.0076  0.0206  0.0167  165 LEU B CA  
3014 C C   . LEU B 158 ? 0.3853 0.2762 0.2683 0.0074  0.0215  0.0148  165 LEU B C   
3015 O O   . LEU B 158 ? 0.3801 0.2656 0.2593 0.0061  0.0212  0.0144  165 LEU B O   
3016 C CB  . LEU B 158 ? 0.4148 0.3125 0.3021 0.0066  0.0184  0.0181  165 LEU B CB  
3017 C CG  . LEU B 158 ? 0.4648 0.3692 0.3559 0.0072  0.0177  0.0196  165 LEU B CG  
3018 C CD1 . LEU B 158 ? 0.4905 0.3997 0.3846 0.0089  0.0189  0.0196  165 LEU B CD1 
3019 C CD2 . LEU B 158 ? 0.4176 0.3232 0.3100 0.0060  0.0158  0.0218  165 LEU B CD2 
3020 N N   . LYS B 159 ? 0.4076 0.3008 0.2916 0.0087  0.0224  0.0139  166 LYS B N   
3021 C CA  . LYS B 159 ? 0.4054 0.2953 0.2863 0.0086  0.0231  0.0124  166 LYS B CA  
3022 C C   . LYS B 159 ? 0.4239 0.3132 0.3029 0.0073  0.0212  0.0126  166 LYS B C   
3023 O O   . LYS B 159 ? 0.4333 0.3270 0.3148 0.0074  0.0197  0.0137  166 LYS B O   
3024 C CB  . LYS B 159 ? 0.4285 0.3216 0.3118 0.0102  0.0244  0.0115  166 LYS B CB  
3025 C CG  . LYS B 159 ? 0.4668 0.3599 0.3523 0.0112  0.0262  0.0114  166 LYS B CG  
3026 C CD  . LYS B 159 ? 0.5075 0.4037 0.3956 0.0128  0.0272  0.0109  166 LYS B CD  
3027 C CE  . LYS B 159 ? 0.5485 0.4507 0.4393 0.0135  0.0260  0.0115  166 LYS B CE  
3028 N NZ  . LYS B 159 ? 0.5477 0.4527 0.4412 0.0149  0.0267  0.0111  166 LYS B NZ  
3029 N N   . LEU B 160 ? 0.4113 0.2949 0.2857 0.0061  0.0212  0.0118  167 LEU B N   
3030 C CA  . LEU B 160 ? 0.3694 0.2517 0.2417 0.0048  0.0191  0.0121  167 LEU B CA  
3031 C C   . LEU B 160 ? 0.3953 0.2777 0.2668 0.0054  0.0197  0.0109  167 LEU B C   
3032 O O   . LEU B 160 ? 0.3872 0.2677 0.2576 0.0061  0.0218  0.0096  167 LEU B O   
3033 C CB  . LEU B 160 ? 0.3846 0.2600 0.2517 0.0028  0.0184  0.0120  167 LEU B CB  
3034 C CG  . LEU B 160 ? 0.3934 0.2685 0.2612 0.0018  0.0170  0.0135  167 LEU B CG  
3035 C CD1 . LEU B 160 ? 0.4085 0.2760 0.2706 0.0000  0.0167  0.0130  167 LEU B CD1 
3036 C CD2 . LEU B 160 ? 0.3871 0.2662 0.2576 0.0012  0.0143  0.0153  167 LEU B CD2 
3037 N N   . LYS B 161 ? 0.4020 0.2872 0.2749 0.0052  0.0180  0.0115  168 LYS B N   
3038 C CA  . LYS B 161 ? 0.4249 0.3108 0.2978 0.0057  0.0181  0.0107  168 LYS B CA  
3039 C C   . LYS B 161 ? 0.4592 0.3387 0.3267 0.0045  0.0187  0.0096  168 LYS B C   
3040 O O   . LYS B 161 ? 0.4564 0.3356 0.3236 0.0053  0.0201  0.0084  168 LYS B O   
3041 C CB  . LYS B 161 ? 0.4398 0.3289 0.3150 0.0053  0.0158  0.0117  168 LYS B CB  
3042 C CG  . LYS B 161 ? 0.4456 0.3414 0.3260 0.0069  0.0159  0.0123  168 LYS B CG  
3043 C CD  . LYS B 161 ? 0.4617 0.3607 0.3448 0.0066  0.0139  0.0134  168 LYS B CD  
3044 C CE  . LYS B 161 ? 0.4880 0.3931 0.3757 0.0082  0.0144  0.0140  168 LYS B CE  
3045 N NZ  . LYS B 161 ? 0.5139 0.4228 0.4050 0.0084  0.0131  0.0150  168 LYS B NZ  
3046 N N   . ASP B 162 ? 0.4638 0.3383 0.3272 0.0026  0.0177  0.0099  169 ASP B N   
3047 C CA  . ASP B 162 ? 0.4735 0.3413 0.3309 0.0013  0.0183  0.0089  169 ASP B CA  
3048 C C   . ASP B 162 ? 0.4813 0.3446 0.3356 0.0016  0.0211  0.0077  169 ASP B C   
3049 O O   . ASP B 162 ? 0.5255 0.3828 0.3742 0.0004  0.0219  0.0068  169 ASP B O   
3050 C CB  . ASP B 162 ? 0.5245 0.3884 0.3781 -0.0011 0.0154  0.0099  169 ASP B CB  
3051 C CG  . ASP B 162 ? 0.5955 0.4630 0.4519 -0.0014 0.0129  0.0109  169 ASP B CG  
3052 O OD1 . ASP B 162 ? 0.5870 0.4587 0.4468 0.0001  0.0136  0.0105  169 ASP B OD1 
3053 O OD2 . ASP B 162 ? 0.6512 0.5175 0.5068 -0.0031 0.0101  0.0123  169 ASP B OD2 
3054 N N   . GLY B 163 ? 0.4457 0.3119 0.3036 0.0031  0.0227  0.0077  170 GLY B N   
3055 C CA  . GLY B 163 ? 0.4541 0.3172 0.3109 0.0038  0.0256  0.0067  170 GLY B CA  
3056 C C   . GLY B 163 ? 0.4467 0.3082 0.3034 0.0032  0.0253  0.0073  170 GLY B C   
3057 O O   . GLY B 163 ? 0.4404 0.3007 0.2955 0.0017  0.0228  0.0083  170 GLY B O   
3058 N N   . GLY B 164 ? 0.4738 0.3347 0.3319 0.0044  0.0277  0.0068  171 GLY B N   
3059 C CA  . GLY B 164 ? 0.4775 0.3363 0.3355 0.0040  0.0277  0.0073  171 GLY B CA  
3060 C C   . GLY B 164 ? 0.4301 0.2953 0.2934 0.0045  0.0258  0.0089  171 GLY B C   
3061 O O   . GLY B 164 ? 0.4276 0.2987 0.2950 0.0056  0.0254  0.0094  171 GLY B O   
3062 N N   . HIS B 165 ? 0.4628 0.3265 0.3259 0.0036  0.0247  0.0098  172 HIS B N   
3063 C CA  . HIS B 165 ? 0.4375 0.3067 0.3058 0.0042  0.0236  0.0114  172 HIS B CA  
3064 C C   . HIS B 165 ? 0.4210 0.2892 0.2883 0.0025  0.0210  0.0129  172 HIS B C   
3065 O O   . HIS B 165 ? 0.4251 0.2873 0.2877 0.0009  0.0202  0.0125  172 HIS B O   
3066 C CB  . HIS B 165 ? 0.5073 0.3765 0.3782 0.0054  0.0258  0.0113  172 HIS B CB  
3067 C CG  . HIS B 165 ? 0.5245 0.3968 0.3986 0.0073  0.0279  0.0106  172 HIS B CG  
3068 N ND1 . HIS B 165 ? 0.6030 0.4715 0.4756 0.0079  0.0306  0.0091  172 HIS B ND1 
3069 C CD2 . HIS B 165 ? 0.5884 0.4671 0.4670 0.0085  0.0277  0.0112  172 HIS B CD2 
3070 C CE1 . HIS B 165 ? 0.5826 0.4551 0.4590 0.0095  0.0318  0.0090  172 HIS B CE1 
3071 N NE2 . HIS B 165 ? 0.5840 0.4626 0.4638 0.0098  0.0299  0.0102  172 HIS B NE2 
3072 N N   . TYR B 166 ? 0.4049 0.2792 0.2769 0.0028  0.0194  0.0146  173 TYR B N   
3073 C CA  . TYR B 166 ? 0.3796 0.2540 0.2519 0.0014  0.0169  0.0164  173 TYR B CA  
3074 C C   . TYR B 166 ? 0.3531 0.2309 0.2297 0.0022  0.0173  0.0176  173 TYR B C   
3075 O O   . TYR B 166 ? 0.3834 0.2671 0.2642 0.0036  0.0179  0.0181  173 TYR B O   
3076 C CB  . TYR B 166 ? 0.3759 0.2550 0.2503 0.0011  0.0148  0.0176  173 TYR B CB  
3077 C CG  . TYR B 166 ? 0.3754 0.2564 0.2519 -0.0002 0.0121  0.0200  173 TYR B CG  
3078 C CD1 . TYR B 166 ? 0.4122 0.2880 0.2854 -0.0022 0.0101  0.0206  173 TYR B CD1 
3079 C CD2 . TYR B 166 ? 0.4160 0.3042 0.2978 0.0006  0.0117  0.0216  173 TYR B CD2 
3080 C CE1 . TYR B 166 ? 0.4307 0.3085 0.3063 -0.0035 0.0075  0.0229  173 TYR B CE1 
3081 C CE2 . TYR B 166 ? 0.3859 0.2762 0.2700 -0.0004 0.0095  0.0239  173 TYR B CE2 
3082 C CZ  . TYR B 166 ? 0.3940 0.2794 0.2754 -0.0024 0.0074  0.0247  173 TYR B CZ  
3083 O OH  . TYR B 166 ? 0.4257 0.3139 0.3103 -0.0035 0.0051  0.0272  173 TYR B OH  
3084 N N   . ASP B 167 ? 0.3657 0.2395 0.2410 0.0012  0.0169  0.0179  174 ASP B N   
3085 C CA  . ASP B 167 ? 0.3901 0.2661 0.2693 0.0019  0.0175  0.0189  174 ASP B CA  
3086 C C   . ASP B 167 ? 0.3766 0.2554 0.2585 0.0009  0.0151  0.0214  174 ASP B C   
3087 O O   . ASP B 167 ? 0.3877 0.2650 0.2679 -0.0006 0.0128  0.0223  174 ASP B O   
3088 C CB  . ASP B 167 ? 0.4198 0.2891 0.2962 0.0018  0.0191  0.0176  174 ASP B CB  
3089 C CG  . ASP B 167 ? 0.4879 0.3547 0.3623 0.0030  0.0220  0.0153  174 ASP B CG  
3090 O OD1 . ASP B 167 ? 0.4772 0.3484 0.3538 0.0043  0.0229  0.0150  174 ASP B OD1 
3091 O OD2 . ASP B 167 ? 0.5157 0.3759 0.3863 0.0025  0.0233  0.0139  174 ASP B OD2 
3092 N N   . ALA B 168 ? 0.3556 0.2386 0.2419 0.0018  0.0156  0.0226  175 ALA B N   
3093 C CA  . ALA B 168 ? 0.3677 0.2538 0.2572 0.0010  0.0136  0.0251  175 ALA B CA  
3094 C C   . ALA B 168 ? 0.3722 0.2581 0.2641 0.0017  0.0147  0.0255  175 ALA B C   
3095 O O   . ALA B 168 ? 0.3846 0.2717 0.2779 0.0031  0.0167  0.0245  175 ALA B O   
3096 C CB  . ALA B 168 ? 0.3811 0.2749 0.2744 0.0016  0.0130  0.0267  175 ALA B CB  
3097 N N   . GLU B 169 ? 0.3464 0.2313 0.2394 0.0005  0.0131  0.0271  176 GLU B N   
3098 C CA  . GLU B 169 ? 0.3718 0.2572 0.2680 0.0009  0.0135  0.0281  176 GLU B CA  
3099 C C   . GLU B 169 ? 0.3384 0.2310 0.2390 0.0008  0.0121  0.0308  176 GLU B C   
3100 O O   . GLU B 169 ? 0.3359 0.2299 0.2365 -0.0003 0.0101  0.0323  176 GLU B O   
3101 C CB  . GLU B 169 ? 0.4046 0.2840 0.2990 -0.0005 0.0123  0.0283  176 GLU B CB  
3102 C CG  . GLU B 169 ? 0.4850 0.3562 0.3746 -0.0006 0.0137  0.0258  176 GLU B CG  
3103 C CD  . GLU B 169 ? 0.5760 0.4412 0.4629 -0.0025 0.0117  0.0262  176 GLU B CD  
3104 O OE1 . GLU B 169 ? 0.6012 0.4685 0.4907 -0.0037 0.0092  0.0287  176 GLU B OE1 
3105 O OE2 . GLU B 169 ? 0.6806 0.5383 0.5623 -0.0030 0.0125  0.0241  176 GLU B OE2 
3106 N N   . VAL B 170 ? 0.3213 0.2181 0.2254 0.0019  0.0131  0.0316  177 VAL B N   
3107 C CA  . VAL B 170 ? 0.3047 0.2085 0.2123 0.0020  0.0123  0.0339  177 VAL B CA  
3108 C C   . VAL B 170 ? 0.2917 0.1966 0.2028 0.0020  0.0121  0.0356  177 VAL B C   
3109 O O   . VAL B 170 ? 0.2818 0.1843 0.1934 0.0028  0.0134  0.0346  177 VAL B O   
3110 C CB  . VAL B 170 ? 0.3158 0.2243 0.2238 0.0035  0.0136  0.0331  177 VAL B CB  
3111 C CG1 . VAL B 170 ? 0.3242 0.2396 0.2353 0.0036  0.0130  0.0355  177 VAL B CG1 
3112 C CG2 . VAL B 170 ? 0.3296 0.2367 0.2345 0.0035  0.0138  0.0314  177 VAL B CG2 
3113 N N   . LYS B 171 ? 0.2830 0.1914 0.1964 0.0011  0.0104  0.0383  178 LYS B N   
3114 C CA  . LYS B 171 ? 0.3044 0.2148 0.2215 0.0009  0.0099  0.0404  178 LYS B CA  
3115 C C   . LYS B 171 ? 0.2937 0.2113 0.2131 0.0008  0.0093  0.0428  178 LYS B C   
3116 O O   . LYS B 171 ? 0.2869 0.2066 0.2061 0.0001  0.0084  0.0439  178 LYS B O   
3117 C CB  . LYS B 171 ? 0.3593 0.2650 0.2767 -0.0004 0.0083  0.0414  178 LYS B CB  
3118 C CG  . LYS B 171 ? 0.4047 0.3120 0.3262 -0.0006 0.0078  0.0434  178 LYS B CG  
3119 C CD  . LYS B 171 ? 0.4956 0.3969 0.4170 -0.0017 0.0066  0.0437  178 LYS B CD  
3120 C CE  . LYS B 171 ? 0.5280 0.4305 0.4537 -0.0019 0.0059  0.0459  178 LYS B CE  
3121 N NZ  . LYS B 171 ? 0.5528 0.4506 0.4789 -0.0034 0.0041  0.0468  178 LYS B NZ  
3122 N N   . THR B 172 ? 0.2731 0.1942 0.1948 0.0014  0.0098  0.0438  179 THR B N   
3123 C CA  . THR B 172 ? 0.2719 0.1996 0.1953 0.0014  0.0096  0.0460  179 THR B CA  
3124 C C   . THR B 172 ? 0.2585 0.1880 0.1852 0.0009  0.0087  0.0485  179 THR B C   
3125 O O   . THR B 172 ? 0.2580 0.1850 0.1858 0.0013  0.0090  0.0480  179 THR B O   
3126 C CB  . THR B 172 ? 0.2660 0.1967 0.1881 0.0029  0.0112  0.0444  179 THR B CB  
3127 O OG1 . THR B 172 ? 0.2719 0.2003 0.1912 0.0034  0.0120  0.0419  179 THR B OG1 
3128 C CG2 . THR B 172 ? 0.2811 0.2181 0.2039 0.0029  0.0113  0.0463  179 THR B CG2 
3129 N N   . THR B 173 ? 0.2653 0.1994 0.1937 0.0000  0.0077  0.0513  180 THR B N   
3130 C CA  . THR B 173 ? 0.2640 0.2010 0.1952 -0.0005 0.0069  0.0541  180 THR B CA  
3131 C C   . THR B 173 ? 0.2709 0.2137 0.2015 0.0000  0.0078  0.0549  180 THR B C   
3132 O O   . THR B 173 ? 0.2764 0.2227 0.2063 0.0000  0.0081  0.0556  180 THR B O   
3133 C CB  . THR B 173 ? 0.2951 0.2325 0.2287 -0.0021 0.0050  0.0570  180 THR B CB  
3134 O OG1 . THR B 173 ? 0.3107 0.2417 0.2439 -0.0027 0.0042  0.0558  180 THR B OG1 
3135 C CG2 . THR B 173 ? 0.2917 0.2317 0.2282 -0.0028 0.0041  0.0598  180 THR B CG2 
3136 N N   . TYR B 174 ? 0.2634 0.2073 0.1947 0.0004  0.0080  0.0551  181 TYR B N   
3137 C CA  . TYR B 174 ? 0.2762 0.2252 0.2066 0.0007  0.0085  0.0562  181 TYR B CA  
3138 C C   . TYR B 174 ? 0.2812 0.2332 0.2140 -0.0004 0.0073  0.0596  181 TYR B C   
3139 O O   . TYR B 174 ? 0.3002 0.2499 0.2354 -0.0009 0.0062  0.0605  181 TYR B O   
3140 C CB  . TYR B 174 ? 0.2766 0.2246 0.2057 0.0019  0.0095  0.0539  181 TYR B CB  
3141 C CG  . TYR B 174 ? 0.2926 0.2372 0.2197 0.0031  0.0107  0.0505  181 TYR B CG  
3142 C CD1 . TYR B 174 ? 0.3107 0.2499 0.2385 0.0033  0.0108  0.0489  181 TYR B CD1 
3143 C CD2 . TYR B 174 ? 0.3148 0.2614 0.2391 0.0040  0.0119  0.0489  181 TYR B CD2 
3144 C CE1 . TYR B 174 ? 0.3113 0.2475 0.2369 0.0043  0.0120  0.0459  181 TYR B CE1 
3145 C CE2 . TYR B 174 ? 0.3294 0.2730 0.2519 0.0049  0.0129  0.0460  181 TYR B CE2 
3146 C CZ  . TYR B 174 ? 0.3367 0.2751 0.2597 0.0050  0.0129  0.0445  181 TYR B CZ  
3147 O OH  . TYR B 174 ? 0.3329 0.2681 0.2538 0.0059  0.0140  0.0416  181 TYR B OH  
3148 N N   . LYS B 175 ? 0.2846 0.2416 0.2167 -0.0009 0.0075  0.0616  182 LYS B N   
3149 C CA  . LYS B 175 ? 0.2909 0.2508 0.2250 -0.0022 0.0062  0.0651  182 LYS B CA  
3150 C C   . LYS B 175 ? 0.2846 0.2494 0.2164 -0.0021 0.0070  0.0663  182 LYS B C   
3151 O O   . LYS B 175 ? 0.2737 0.2416 0.2034 -0.0017 0.0084  0.0662  182 LYS B O   
3152 C CB  . LYS B 175 ? 0.3468 0.3074 0.2831 -0.0034 0.0053  0.0675  182 LYS B CB  
3153 C CG  . LYS B 175 ? 0.3926 0.3558 0.3315 -0.0049 0.0038  0.0714  182 LYS B CG  
3154 C CD  . LYS B 175 ? 0.4462 0.4060 0.3875 -0.0053 0.0023  0.0717  182 LYS B CD  
3155 C CE  . LYS B 175 ? 0.5133 0.4747 0.4579 -0.0070 0.0003  0.0757  182 LYS B CE  
3156 N NZ  . LYS B 175 ? 0.5978 0.5570 0.5451 -0.0079 -0.0008 0.0767  182 LYS B NZ  
3157 N N   . ALA B 176 ? 0.2894 0.2544 0.2216 -0.0025 0.0061  0.0674  183 ALA B N   
3158 C CA  . ALA B 176 ? 0.2889 0.2578 0.2183 -0.0027 0.0065  0.0686  183 ALA B CA  
3159 C C   . ALA B 176 ? 0.3030 0.2760 0.2329 -0.0040 0.0065  0.0719  183 ALA B C   
3160 O O   . ALA B 176 ? 0.3002 0.2730 0.2336 -0.0051 0.0051  0.0743  183 ALA B O   
3161 C CB  . ALA B 176 ? 0.2826 0.2504 0.2130 -0.0033 0.0049  0.0696  183 ALA B CB  
3162 N N   . LYS B 177 ? 0.3174 0.2942 0.2438 -0.0039 0.0078  0.0724  184 LYS B N   
3163 C CA  . LYS B 177 ? 0.3112 0.2923 0.2377 -0.0050 0.0082  0.0757  184 LYS B CA  
3164 C C   . LYS B 177 ? 0.3399 0.3228 0.2671 -0.0067 0.0065  0.0792  184 LYS B C   
3165 O O   . LYS B 177 ? 0.3613 0.3477 0.2886 -0.0078 0.0067  0.0822  184 LYS B O   
3166 C CB  . LYS B 177 ? 0.3158 0.3003 0.2382 -0.0041 0.0108  0.0747  184 LYS B CB  
3167 C CG  . LYS B 177 ? 0.3095 0.2932 0.2322 -0.0027 0.0124  0.0721  184 LYS B CG  
3168 C CD  . LYS B 177 ? 0.3171 0.3036 0.2358 -0.0016 0.0150  0.0706  184 LYS B CD  
3169 C CE  . LYS B 177 ? 0.2918 0.2776 0.2113 -0.0003 0.0164  0.0683  184 LYS B CE  
3170 N NZ  . LYS B 177 ? 0.3084 0.2953 0.2240 0.0012  0.0188  0.0656  184 LYS B NZ  
3171 N N   . LYS B 178 ? 0.3440 0.3242 0.2717 -0.0069 0.0048  0.0789  185 LYS B N   
3172 C CA  . LYS B 178 ? 0.3604 0.3414 0.2894 -0.0085 0.0027  0.0821  185 LYS B CA  
3173 C C   . LYS B 178 ? 0.3502 0.3269 0.2831 -0.0085 0.0007  0.0816  185 LYS B C   
3174 O O   . LYS B 178 ? 0.3700 0.3433 0.3032 -0.0071 0.0012  0.0783  185 LYS B O   
3175 C CB  . LYS B 178 ? 0.3757 0.3589 0.2996 -0.0088 0.0031  0.0825  185 LYS B CB  
3176 C CG  . LYS B 178 ? 0.3817 0.3624 0.3030 -0.0075 0.0034  0.0792  185 LYS B CG  
3177 C CD  . LYS B 178 ? 0.4100 0.3925 0.3261 -0.0082 0.0033  0.0799  185 LYS B CD  
3178 C CE  . LYS B 178 ? 0.4165 0.3966 0.3298 -0.0069 0.0036  0.0766  185 LYS B CE  
3179 N NZ  . LYS B 178 ? 0.4612 0.4433 0.3686 -0.0079 0.0035  0.0778  185 LYS B NZ  
3180 N N   . PRO B 179 ? 0.3861 0.3628 0.3224 -0.0101 -0.0015 0.0847  186 PRO B N   
3181 C CA  . PRO B 179 ? 0.3989 0.3715 0.3394 -0.0099 -0.0032 0.0842  186 PRO B CA  
3182 C C   . PRO B 179 ? 0.4096 0.3807 0.3485 -0.0093 -0.0035 0.0826  186 PRO B C   
3183 O O   . PRO B 179 ? 0.4683 0.4415 0.4050 -0.0103 -0.0045 0.0844  186 PRO B O   
3184 C CB  . PRO B 179 ? 0.4197 0.3931 0.3642 -0.0118 -0.0055 0.0883  186 PRO B CB  
3185 C CG  . PRO B 179 ? 0.4153 0.3934 0.3561 -0.0131 -0.0053 0.0910  186 PRO B CG  
3186 C CD  . PRO B 179 ? 0.3886 0.3689 0.3249 -0.0120 -0.0025 0.0890  186 PRO B CD  
3187 N N   . VAL B 180 ? 0.3858 0.3534 0.3256 -0.0078 -0.0027 0.0794  187 VAL B N   
3188 C CA  . VAL B 180 ? 0.3966 0.3624 0.3361 -0.0072 -0.0032 0.0780  187 VAL B CA  
3189 C C   . VAL B 180 ? 0.4071 0.3682 0.3514 -0.0062 -0.0034 0.0763  187 VAL B C   
3190 O O   . VAL B 180 ? 0.3735 0.3325 0.3199 -0.0058 -0.0028 0.0754  187 VAL B O   
3191 C CB  . VAL B 180 ? 0.4591 0.4260 0.3930 -0.0061 -0.0015 0.0753  187 VAL B CB  
3192 C CG1 . VAL B 180 ? 0.5197 0.4907 0.4488 -0.0071 -0.0015 0.0772  187 VAL B CG1 
3193 C CG2 . VAL B 180 ? 0.4382 0.4045 0.3708 -0.0047 0.0007  0.0725  187 VAL B CG2 
3194 N N   . GLN B 181 ? 0.3966 0.3560 0.3424 -0.0059 -0.0043 0.0758  188 GLN B N   
3195 C CA  . GLN B 181 ? 0.4070 0.3622 0.3580 -0.0051 -0.0045 0.0748  188 GLN B CA  
3196 C C   . GLN B 181 ? 0.3429 0.2950 0.2933 -0.0034 -0.0022 0.0710  188 GLN B C   
3197 O O   . GLN B 181 ? 0.3313 0.2833 0.2783 -0.0022 -0.0007 0.0684  188 GLN B O   
3198 C CB  . GLN B 181 ? 0.4388 0.3933 0.3919 -0.0051 -0.0057 0.0752  188 GLN B CB  
3199 C CG  . GLN B 181 ? 0.4818 0.4323 0.4413 -0.0044 -0.0060 0.0749  188 GLN B CG  
3200 C CD  . GLN B 181 ? 0.5561 0.5061 0.5185 -0.0045 -0.0074 0.0758  188 GLN B CD  
3201 O OE1 . GLN B 181 ? 0.6031 0.5510 0.5717 -0.0046 -0.0085 0.0772  188 GLN B OE1 
3202 N NE2 . GLN B 181 ? 0.5582 0.5098 0.5163 -0.0043 -0.0074 0.0748  188 GLN B NE2 
3203 N N   . LEU B 182 ? 0.3426 0.2917 0.2962 -0.0033 -0.0020 0.0708  189 LEU B N   
3204 C CA  . LEU B 182 ? 0.3236 0.2688 0.2768 -0.0018 0.0000  0.0673  189 LEU B CA  
3205 C C   . LEU B 182 ? 0.3331 0.2748 0.2895 -0.0006 0.0005  0.0657  189 LEU B C   
3206 O O   . LEU B 182 ? 0.3716 0.3124 0.3328 -0.0010 -0.0008 0.0676  189 LEU B O   
3207 C CB  . LEU B 182 ? 0.3342 0.2769 0.2894 -0.0021 0.0000  0.0675  189 LEU B CB  
3208 C CG  . LEU B 182 ? 0.3333 0.2783 0.2852 -0.0028 0.0000  0.0681  189 LEU B CG  
3209 C CD1 . LEU B 182 ? 0.3493 0.2915 0.3042 -0.0036 -0.0008 0.0691  189 LEU B CD1 
3210 C CD2 . LEU B 182 ? 0.3465 0.2910 0.2941 -0.0017 0.0021  0.0648  189 LEU B CD2 
3211 N N   . PRO B 183 ? 0.3142 0.2536 0.2686 0.0008  0.0025  0.0623  190 PRO B N   
3212 C CA  . PRO B 183 ? 0.3128 0.2486 0.2706 0.0019  0.0034  0.0608  190 PRO B CA  
3213 C C   . PRO B 183 ? 0.3079 0.2390 0.2689 0.0023  0.0042  0.0600  190 PRO B C   
3214 O O   . PRO B 183 ? 0.3200 0.2504 0.2799 0.0016  0.0039  0.0605  190 PRO B O   
3215 C CB  . PRO B 183 ? 0.3165 0.2518 0.2702 0.0032  0.0054  0.0575  190 PRO B CB  
3216 C CG  . PRO B 183 ? 0.3199 0.2558 0.2693 0.0030  0.0061  0.0566  190 PRO B CG  
3217 C CD  . PRO B 183 ? 0.3171 0.2568 0.2664 0.0014  0.0042  0.0598  190 PRO B CD  
3218 N N   . GLY B 184 ? 0.3210 0.2485 0.2854 0.0034  0.0053  0.0588  191 GLY B N   
3219 C CA  . GLY B 184 ? 0.2975 0.2196 0.2636 0.0041  0.0070  0.0570  191 GLY B CA  
3220 C C   . GLY B 184 ? 0.2923 0.2120 0.2536 0.0052  0.0093  0.0534  191 GLY B C   
3221 O O   . GLY B 184 ? 0.3015 0.2239 0.2580 0.0052  0.0095  0.0524  191 GLY B O   
3222 N N   . ALA B 185 ? 0.2875 0.2019 0.2499 0.0062  0.0113  0.0513  192 ALA B N   
3223 C CA  . ALA B 185 ? 0.2853 0.1969 0.2433 0.0071  0.0136  0.0480  192 ALA B CA  
3224 C C   . ALA B 185 ? 0.2919 0.2046 0.2497 0.0083  0.0148  0.0466  192 ALA B C   
3225 O O   . ALA B 185 ? 0.2856 0.1987 0.2482 0.0088  0.0148  0.0476  192 ALA B O   
3226 C CB  . ALA B 185 ? 0.3017 0.2068 0.2605 0.0077  0.0153  0.0462  192 ALA B CB  
3227 N N   . TYR B 186 ? 0.2821 0.1957 0.2348 0.0086  0.0156  0.0446  193 TYR B N   
3228 C CA  . TYR B 186 ? 0.2772 0.1917 0.2293 0.0097  0.0168  0.0431  193 TYR B CA  
3229 C C   . TYR B 186 ? 0.2896 0.2034 0.2357 0.0100  0.0180  0.0405  193 TYR B C   
3230 O O   . TYR B 186 ? 0.2866 0.1997 0.2296 0.0093  0.0176  0.0403  193 TYR B O   
3231 C CB  . TYR B 186 ? 0.2744 0.1941 0.2278 0.0093  0.0149  0.0452  193 TYR B CB  
3232 C CG  . TYR B 186 ? 0.2812 0.2052 0.2302 0.0085  0.0135  0.0458  193 TYR B CG  
3233 C CD1 . TYR B 186 ? 0.2959 0.2219 0.2443 0.0072  0.0119  0.0478  193 TYR B CD1 
3234 C CD2 . TYR B 186 ? 0.2930 0.2192 0.2384 0.0090  0.0138  0.0444  193 TYR B CD2 
3235 C CE1 . TYR B 186 ? 0.3091 0.2391 0.2536 0.0065  0.0110  0.0485  193 TYR B CE1 
3236 C CE2 . TYR B 186 ? 0.2988 0.2290 0.2403 0.0083  0.0128  0.0450  193 TYR B CE2 
3237 C CZ  . TYR B 186 ? 0.3148 0.2469 0.2557 0.0072  0.0116  0.0469  193 TYR B CZ  
3238 O OH  . TYR B 186 ? 0.3357 0.2718 0.2731 0.0066  0.0110  0.0475  193 TYR B OH  
3239 N N   . ASN B 187 ? 0.2795 0.1937 0.2244 0.0110  0.0192  0.0388  194 ASN B N   
3240 C CA  . ASN B 187 ? 0.3036 0.2167 0.2434 0.0114  0.0204  0.0363  194 ASN B CA  
3241 C C   . ASN B 187 ? 0.3023 0.2199 0.2398 0.0115  0.0196  0.0362  194 ASN B C   
3242 O O   . ASN B 187 ? 0.3163 0.2366 0.2562 0.0117  0.0187  0.0374  194 ASN B O   
3243 C CB  . ASN B 187 ? 0.3429 0.2514 0.2825 0.0125  0.0230  0.0339  194 ASN B CB  
3244 C CG  . ASN B 187 ? 0.3975 0.3008 0.3384 0.0126  0.0243  0.0333  194 ASN B CG  
3245 O OD1 . ASN B 187 ? 0.4347 0.3368 0.3743 0.0117  0.0235  0.0339  194 ASN B OD1 
3246 N ND2 . ASN B 187 ? 0.4457 0.3458 0.3895 0.0136  0.0264  0.0325  194 ASN B ND2 
3247 N N   . VAL B 188 ? 0.2999 0.2181 0.2328 0.0114  0.0198  0.0349  195 VAL B N   
3248 C CA  . VAL B 188 ? 0.3092 0.2313 0.2396 0.0116  0.0193  0.0345  195 VAL B CA  
3249 C C   . VAL B 188 ? 0.3110 0.2307 0.2385 0.0124  0.0209  0.0318  195 VAL B C   
3250 O O   . VAL B 188 ? 0.3130 0.2304 0.2376 0.0122  0.0215  0.0306  195 VAL B O   
3251 C CB  . VAL B 188 ? 0.3041 0.2303 0.2322 0.0107  0.0178  0.0359  195 VAL B CB  
3252 C CG1 . VAL B 188 ? 0.3295 0.2591 0.2548 0.0112  0.0177  0.0350  195 VAL B CG1 
3253 C CG2 . VAL B 188 ? 0.3195 0.2481 0.2504 0.0098  0.0161  0.0387  195 VAL B CG2 
3254 N N   . ASN B 189 ? 0.3170 0.2372 0.2451 0.0133  0.0215  0.0308  196 ASN B N   
3255 C CA  . ASN B 189 ? 0.3264 0.2445 0.2519 0.0141  0.0230  0.0283  196 ASN B CA  
3256 C C   . ASN B 189 ? 0.3037 0.2252 0.2257 0.0141  0.0222  0.0277  196 ASN B C   
3257 O O   . ASN B 189 ? 0.3291 0.2542 0.2516 0.0141  0.0210  0.0288  196 ASN B O   
3258 C CB  . ASN B 189 ? 0.3785 0.2950 0.3065 0.0151  0.0242  0.0275  196 ASN B CB  
3259 C CG  . ASN B 189 ? 0.4302 0.3428 0.3617 0.0153  0.0256  0.0278  196 ASN B CG  
3260 O OD1 . ASN B 189 ? 0.5452 0.4545 0.4753 0.0150  0.0264  0.0273  196 ASN B OD1 
3261 N ND2 . ASN B 189 ? 0.4880 0.4009 0.4240 0.0158  0.0257  0.0286  196 ASN B ND2 
3262 N N   . ILE B 190 ? 0.3087 0.2290 0.2274 0.0141  0.0228  0.0262  197 ILE B N   
3263 C CA  . ILE B 190 ? 0.3349 0.2584 0.2507 0.0140  0.0221  0.0258  197 ILE B CA  
3264 C C   . ILE B 190 ? 0.3295 0.2513 0.2429 0.0147  0.0231  0.0236  197 ILE B C   
3265 O O   . ILE B 190 ? 0.3247 0.2427 0.2372 0.0146  0.0241  0.0225  197 ILE B O   
3266 C CB  . ILE B 190 ? 0.3709 0.2952 0.2853 0.0131  0.0214  0.0268  197 ILE B CB  
3267 C CG1 . ILE B 190 ? 0.4062 0.3324 0.3229 0.0124  0.0203  0.0292  197 ILE B CG1 
3268 C CG2 . ILE B 190 ? 0.3833 0.3106 0.2952 0.0132  0.0211  0.0263  197 ILE B CG2 
3269 C CD1 . ILE B 190 ? 0.4409 0.3660 0.3572 0.0113  0.0198  0.0302  197 ILE B CD1 
3270 N N   . LYS B 191 ? 0.3487 0.2733 0.2611 0.0152  0.0227  0.0229  198 LYS B N   
3271 C CA  . LYS B 191 ? 0.3550 0.2785 0.2651 0.0158  0.0234  0.0209  198 LYS B CA  
3272 C C   . LYS B 191 ? 0.3246 0.2517 0.2328 0.0158  0.0227  0.0209  198 LYS B C   
3273 O O   . LYS B 191 ? 0.3768 0.3072 0.2853 0.0160  0.0220  0.0216  198 LYS B O   
3274 C CB  . LYS B 191 ? 0.4194 0.3422 0.3305 0.0167  0.0239  0.0199  198 LYS B CB  
3275 C CG  . LYS B 191 ? 0.5366 0.4565 0.4460 0.0170  0.0251  0.0180  198 LYS B CG  
3276 C CD  . LYS B 191 ? 0.5916 0.5108 0.5022 0.0178  0.0256  0.0170  198 LYS B CD  
3277 C CE  . LYS B 191 ? 0.6059 0.5215 0.5149 0.0180  0.0270  0.0153  198 LYS B CE  
3278 N NZ  . LYS B 191 ? 0.6760 0.5905 0.5817 0.0174  0.0269  0.0146  198 LYS B NZ  
3279 N N   . LEU B 192 ? 0.3321 0.2583 0.2383 0.0155  0.0228  0.0201  199 LEU B N   
3280 C CA  . LEU B 192 ? 0.3468 0.2762 0.2517 0.0156  0.0223  0.0202  199 LEU B CA  
3281 C C   . LEU B 192 ? 0.3524 0.2806 0.2556 0.0161  0.0227  0.0183  199 LEU B C   
3282 O O   . LEU B 192 ? 0.3647 0.2895 0.2669 0.0156  0.0230  0.0176  199 LEU B O   
3283 C CB  . LEU B 192 ? 0.3891 0.3188 0.2940 0.0146  0.0218  0.0215  199 LEU B CB  
3284 C CG  . LEU B 192 ? 0.4590 0.3919 0.3635 0.0143  0.0214  0.0225  199 LEU B CG  
3285 C CD1 . LEU B 192 ? 0.4922 0.4232 0.3960 0.0135  0.0210  0.0225  199 LEU B CD1 
3286 C CD2 . LEU B 192 ? 0.4782 0.4147 0.3822 0.0153  0.0216  0.0218  199 LEU B CD2 
3287 N N   . ASP B 193 ? 0.3842 0.3150 0.2871 0.0169  0.0226  0.0175  200 ASP B N   
3288 C CA  . ASP B 193 ? 0.4203 0.3503 0.3219 0.0174  0.0228  0.0159  200 ASP B CA  
3289 C C   . ASP B 193 ? 0.3964 0.3298 0.2975 0.0178  0.0226  0.0158  200 ASP B C   
3290 O O   . ASP B 193 ? 0.4014 0.3381 0.3026 0.0182  0.0225  0.0164  200 ASP B O   
3291 C CB  . ASP B 193 ? 0.4671 0.3966 0.3690 0.0183  0.0230  0.0146  200 ASP B CB  
3292 C CG  . ASP B 193 ? 0.5436 0.4697 0.4465 0.0181  0.0236  0.0145  200 ASP B CG  
3293 O OD1 . ASP B 193 ? 0.5661 0.4889 0.4683 0.0177  0.0242  0.0141  200 ASP B OD1 
3294 O OD2 . ASP B 193 ? 0.6067 0.5334 0.5111 0.0185  0.0235  0.0150  200 ASP B OD2 
3295 N N   . ILE B 194 ? 0.3905 0.3230 0.2910 0.0177  0.0225  0.0151  201 ILE B N   
3296 C CA  . ILE B 194 ? 0.3986 0.3338 0.2990 0.0183  0.0225  0.0146  201 ILE B CA  
3297 C C   . ILE B 194 ? 0.4121 0.3470 0.3119 0.0194  0.0227  0.0127  201 ILE B C   
3298 O O   . ILE B 194 ? 0.4376 0.3697 0.3371 0.0193  0.0226  0.0117  201 ILE B O   
3299 C CB  . ILE B 194 ? 0.4570 0.3910 0.3575 0.0177  0.0221  0.0147  201 ILE B CB  
3300 C CG1 . ILE B 194 ? 0.5001 0.4335 0.4011 0.0164  0.0216  0.0165  201 ILE B CG1 
3301 C CG2 . ILE B 194 ? 0.4929 0.4300 0.3942 0.0184  0.0222  0.0144  201 ILE B CG2 
3302 C CD1 . ILE B 194 ? 0.5169 0.4536 0.4189 0.0164  0.0218  0.0181  201 ILE B CD1 
3303 N N   . THR B 195 ? 0.4431 0.3808 0.3427 0.0203  0.0228  0.0123  202 THR B N   
3304 C CA  . THR B 195 ? 0.4336 0.3710 0.3326 0.0212  0.0227  0.0107  202 THR B CA  
3305 C C   . THR B 195 ? 0.4446 0.3831 0.3434 0.0221  0.0229  0.0094  202 THR B C   
3306 O O   . THR B 195 ? 0.4310 0.3684 0.3295 0.0227  0.0226  0.0079  202 THR B O   
3307 C CB  . THR B 195 ? 0.4611 0.4003 0.3595 0.0216  0.0226  0.0110  202 THR B CB  
3308 O OG1 . THR B 195 ? 0.4990 0.4413 0.3968 0.0217  0.0230  0.0118  202 THR B OG1 
3309 C CG2 . THR B 195 ? 0.4816 0.4194 0.3808 0.0208  0.0223  0.0123  202 THR B CG2 
3310 N N   . SER B 196 ? 0.4146 0.3551 0.3140 0.0220  0.0232  0.0101  203 SER B N   
3311 C CA  . SER B 196 ? 0.4251 0.3663 0.3251 0.0227  0.0233  0.0090  203 SER B CA  
3312 C C   . SER B 196 ? 0.3986 0.3418 0.3001 0.0224  0.0236  0.0104  203 SER B C   
3313 O O   . SER B 196 ? 0.3871 0.3318 0.2889 0.0218  0.0238  0.0120  203 SER B O   
3314 C CB  . SER B 196 ? 0.4310 0.3738 0.3302 0.0241  0.0237  0.0075  203 SER B CB  
3315 O OG  . SER B 196 ? 0.4498 0.3952 0.3480 0.0244  0.0244  0.0082  203 SER B OG  
3316 N N   . HIS B 197 ? 0.3786 0.3220 0.2814 0.0227  0.0235  0.0100  204 HIS B N   
3317 C CA  . HIS B 197 ? 0.3663 0.3120 0.2712 0.0225  0.0237  0.0114  204 HIS B CA  
3318 C C   . HIS B 197 ? 0.3756 0.3218 0.2823 0.0232  0.0237  0.0105  204 HIS B C   
3319 O O   . HIS B 197 ? 0.3772 0.3210 0.2834 0.0234  0.0231  0.0091  204 HIS B O   
3320 C CB  . HIS B 197 ? 0.3555 0.2994 0.2611 0.0209  0.0228  0.0130  204 HIS B CB  
3321 C CG  . HIS B 197 ? 0.3639 0.3038 0.2688 0.0201  0.0216  0.0123  204 HIS B CG  
3322 N ND1 . HIS B 197 ? 0.4078 0.3468 0.3141 0.0196  0.0207  0.0126  204 HIS B ND1 
3323 C CD2 . HIS B 197 ? 0.3998 0.3362 0.3026 0.0196  0.0213  0.0115  204 HIS B CD2 
3324 C CE1 . HIS B 197 ? 0.3977 0.3328 0.3024 0.0188  0.0199  0.0119  204 HIS B CE1 
3325 N NE2 . HIS B 197 ? 0.4235 0.3570 0.3261 0.0189  0.0204  0.0112  204 HIS B NE2 
3326 N N   . ASN B 198 ? 0.3578 0.3069 0.2669 0.0236  0.0244  0.0115  205 ASN B N   
3327 C CA  . ASN B 198 ? 0.3783 0.3276 0.2900 0.0241  0.0241  0.0110  205 ASN B CA  
3328 C C   . ASN B 198 ? 0.3726 0.3197 0.2857 0.0225  0.0224  0.0124  205 ASN B C   
3329 O O   . ASN B 198 ? 0.3447 0.2902 0.2566 0.0211  0.0217  0.0135  205 ASN B O   
3330 C CB  . ASN B 198 ? 0.3899 0.3432 0.3040 0.0253  0.0258  0.0115  205 ASN B CB  
3331 C CG  . ASN B 198 ? 0.4012 0.3570 0.3176 0.0245  0.0261  0.0141  205 ASN B CG  
3332 O OD1 . ASN B 198 ? 0.3766 0.3311 0.2927 0.0229  0.0249  0.0156  205 ASN B OD1 
3333 N ND2 . ASN B 198 ? 0.3847 0.3440 0.3035 0.0256  0.0278  0.0146  205 ASN B ND2 
3334 N N   . GLU B 199 ? 0.3984 0.3448 0.3135 0.0226  0.0216  0.0120  206 GLU B N   
3335 C CA  . GLU B 199 ? 0.3923 0.3359 0.3079 0.0210  0.0197  0.0129  206 GLU B CA  
3336 C C   . GLU B 199 ? 0.4014 0.3453 0.3185 0.0195  0.0188  0.0154  206 GLU B C   
3337 O O   . GLU B 199 ? 0.3916 0.3320 0.3071 0.0178  0.0172  0.0161  206 GLU B O   
3338 C CB  . GLU B 199 ? 0.4518 0.3953 0.3701 0.0215  0.0190  0.0124  206 GLU B CB  
3339 C CG  . GLU B 199 ? 0.4752 0.4160 0.3944 0.0198  0.0168  0.0136  206 GLU B CG  
3340 C CD  . GLU B 199 ? 0.5339 0.4741 0.4551 0.0202  0.0160  0.0128  206 GLU B CD  
3341 O OE1 . GLU B 199 ? 0.5105 0.4509 0.4310 0.0217  0.0169  0.0107  206 GLU B OE1 
3342 O OE2 . GLU B 199 ? 0.5490 0.4882 0.4724 0.0190  0.0142  0.0142  206 GLU B OE2 
3343 N N   . ASP B 200 ? 0.3993 0.3471 0.3193 0.0200  0.0199  0.0169  207 ASP B N   
3344 C CA  . ASP B 200 ? 0.3728 0.3211 0.2946 0.0185  0.0189  0.0195  207 ASP B CA  
3345 C C   . ASP B 200 ? 0.4054 0.3545 0.3253 0.0182  0.0197  0.0203  207 ASP B C   
3346 O O   . ASP B 200 ? 0.4040 0.3545 0.3260 0.0172  0.0192  0.0226  207 ASP B O   
3347 C CB  . ASP B 200 ? 0.4070 0.3592 0.3342 0.0190  0.0193  0.0212  207 ASP B CB  
3348 C CG  . ASP B 200 ? 0.4379 0.3945 0.3665 0.0211  0.0221  0.0206  207 ASP B CG  
3349 O OD1 . ASP B 200 ? 0.4369 0.3937 0.3620 0.0220  0.0235  0.0190  207 ASP B OD1 
3350 O OD2 . ASP B 200 ? 0.4440 0.4038 0.3772 0.0218  0.0229  0.0218  207 ASP B OD2 
3351 N N   . TYR B 201 ? 0.3704 0.3192 0.2872 0.0190  0.0209  0.0186  208 TYR B N   
3352 C CA  . TYR B 201 ? 0.3893 0.3388 0.3043 0.0187  0.0215  0.0194  208 TYR B CA  
3353 C C   . TYR B 201 ? 0.3898 0.3437 0.3072 0.0192  0.0228  0.0211  208 TYR B C   
3354 O O   . TYR B 201 ? 0.3642 0.3187 0.2813 0.0183  0.0227  0.0228  208 TYR B O   
3355 C CB  . TYR B 201 ? 0.3872 0.3331 0.3008 0.0168  0.0199  0.0205  208 TYR B CB  
3356 C CG  . TYR B 201 ? 0.4502 0.3914 0.3604 0.0164  0.0192  0.0188  208 TYR B CG  
3357 C CD1 . TYR B 201 ? 0.4700 0.4080 0.3796 0.0157  0.0179  0.0180  208 TYR B CD1 
3358 C CD2 . TYR B 201 ? 0.4735 0.4134 0.3811 0.0164  0.0198  0.0181  208 TYR B CD2 
3359 C CE1 . TYR B 201 ? 0.4893 0.4231 0.3957 0.0153  0.0176  0.0166  208 TYR B CE1 
3360 C CE2 . TYR B 201 ? 0.5077 0.4435 0.4126 0.0160  0.0194  0.0167  208 TYR B CE2 
3361 C CZ  . TYR B 201 ? 0.4811 0.4139 0.3853 0.0155  0.0185  0.0159  208 TYR B CZ  
3362 O OH  . TYR B 201 ? 0.5423 0.4710 0.4437 0.0152  0.0185  0.0147  208 TYR B OH  
3363 N N   . THR B 202 ? 0.3568 0.3139 0.2763 0.0206  0.0243  0.0207  209 THR B N   
3364 C CA  . THR B 202 ? 0.3554 0.3169 0.2765 0.0213  0.0262  0.0221  209 THR B CA  
3365 C C   . THR B 202 ? 0.3558 0.3184 0.2735 0.0224  0.0278  0.0207  209 THR B C   
3366 O O   . THR B 202 ? 0.3441 0.3100 0.2619 0.0228  0.0294  0.0217  209 THR B O   
3367 C CB  . THR B 202 ? 0.3864 0.3510 0.3119 0.0224  0.0273  0.0226  209 THR B CB  
3368 O OG1 . THR B 202 ? 0.4036 0.3674 0.3286 0.0238  0.0278  0.0201  209 THR B OG1 
3369 C CG2 . THR B 202 ? 0.3718 0.3361 0.3012 0.0211  0.0256  0.0247  209 THR B CG2 
3370 N N   . ILE B 203 ? 0.3582 0.3183 0.2729 0.0229  0.0275  0.0183  210 ILE B N   
3371 C CA  . ILE B 203 ? 0.3375 0.2977 0.2486 0.0237  0.0284  0.0169  210 ILE B CA  
3372 C C   . ILE B 203 ? 0.3634 0.3197 0.2721 0.0228  0.0268  0.0161  210 ILE B C   
3373 O O   . ILE B 203 ? 0.3800 0.3335 0.2884 0.0228  0.0259  0.0148  210 ILE B O   
3374 C CB  . ILE B 203 ? 0.3778 0.3388 0.2879 0.0255  0.0298  0.0147  210 ILE B CB  
3375 C CG1 . ILE B 203 ? 0.4153 0.3799 0.3288 0.0264  0.0315  0.0155  210 ILE B CG1 
3376 C CG2 . ILE B 203 ? 0.3837 0.3447 0.2897 0.0260  0.0305  0.0136  210 ILE B CG2 
3377 C CD1 . ILE B 203 ? 0.4982 0.4659 0.4103 0.0272  0.0338  0.0160  210 ILE B CD1 
3378 N N   . VAL B 204 ? 0.3649 0.3209 0.2719 0.0220  0.0266  0.0171  211 VAL B N   
3379 C CA  . VAL B 204 ? 0.3640 0.3166 0.2694 0.0212  0.0253  0.0167  211 VAL B CA  
3380 C C   . VAL B 204 ? 0.3669 0.3198 0.2699 0.0214  0.0257  0.0165  211 VAL B C   
3381 O O   . VAL B 204 ? 0.3442 0.2999 0.2469 0.0214  0.0265  0.0177  211 VAL B O   
3382 C CB  . VAL B 204 ? 0.3682 0.3193 0.2747 0.0196  0.0243  0.0186  211 VAL B CB  
3383 C CG1 . VAL B 204 ? 0.4056 0.3529 0.3104 0.0189  0.0234  0.0179  211 VAL B CG1 
3384 C CG2 . VAL B 204 ? 0.3732 0.3239 0.2820 0.0191  0.0236  0.0192  211 VAL B CG2 
3385 N N   . GLU B 205 ? 0.3669 0.3172 0.2683 0.0215  0.0251  0.0150  212 GLU B N   
3386 C CA  . GLU B 205 ? 0.3801 0.3302 0.2796 0.0215  0.0249  0.0150  212 GLU B CA  
3387 C C   . GLU B 205 ? 0.3627 0.3099 0.2625 0.0205  0.0240  0.0156  212 GLU B C   
3388 O O   . GLU B 205 ? 0.3622 0.3067 0.2626 0.0202  0.0235  0.0150  212 GLU B O   
3389 C CB  . GLU B 205 ? 0.4325 0.3823 0.3301 0.0226  0.0251  0.0129  212 GLU B CB  
3390 C CG  . GLU B 205 ? 0.4960 0.4485 0.3932 0.0237  0.0263  0.0122  212 GLU B CG  
3391 C CD  . GLU B 205 ? 0.5566 0.5089 0.4512 0.0247  0.0265  0.0104  212 GLU B CD  
3392 O OE1 . GLU B 205 ? 0.5831 0.5333 0.4764 0.0245  0.0254  0.0098  212 GLU B OE1 
3393 O OE2 . GLU B 205 ? 0.6742 0.6282 0.5681 0.0258  0.0276  0.0095  212 GLU B OE2 
3394 N N   . GLN B 206 ? 0.3354 0.2833 0.2350 0.0199  0.0238  0.0171  213 GLN B N   
3395 C CA  . GLN B 206 ? 0.3307 0.2760 0.2310 0.0189  0.0231  0.0179  213 GLN B CA  
3396 C C   . GLN B 206 ? 0.3191 0.2644 0.2187 0.0190  0.0227  0.0179  213 GLN B C   
3397 O O   . GLN B 206 ? 0.3333 0.2810 0.2316 0.0193  0.0228  0.0183  213 GLN B O   
3398 C CB  . GLN B 206 ? 0.3451 0.2912 0.2467 0.0178  0.0229  0.0201  213 GLN B CB  
3399 C CG  . GLN B 206 ? 0.3831 0.3300 0.2858 0.0175  0.0230  0.0207  213 GLN B CG  
3400 C CD  . GLN B 206 ? 0.3410 0.2869 0.2450 0.0162  0.0223  0.0226  213 GLN B CD  
3401 O OE1 . GLN B 206 ? 0.3905 0.3355 0.2954 0.0157  0.0220  0.0229  213 GLN B OE1 
3402 N NE2 . GLN B 206 ? 0.3370 0.2835 0.2415 0.0156  0.0221  0.0241  213 GLN B NE2 
3403 N N   . TYR B 207 ? 0.3253 0.2677 0.2259 0.0186  0.0222  0.0180  214 TYR B N   
3404 C CA  . TYR B 207 ? 0.3137 0.2558 0.2145 0.0185  0.0217  0.0184  214 TYR B CA  
3405 C C   . TYR B 207 ? 0.3114 0.2513 0.2141 0.0177  0.0214  0.0197  214 TYR B C   
3406 O O   . TYR B 207 ? 0.3189 0.2561 0.2223 0.0175  0.0218  0.0192  214 TYR B O   
3407 C CB  . TYR B 207 ? 0.3359 0.2761 0.2364 0.0193  0.0215  0.0166  214 TYR B CB  
3408 C CG  . TYR B 207 ? 0.3406 0.2797 0.2422 0.0192  0.0208  0.0170  214 TYR B CG  
3409 C CD1 . TYR B 207 ? 0.3423 0.2833 0.2436 0.0188  0.0200  0.0183  214 TYR B CD1 
3410 C CD2 . TYR B 207 ? 0.3694 0.3057 0.2724 0.0194  0.0209  0.0161  214 TYR B CD2 
3411 C CE1 . TYR B 207 ? 0.3822 0.3220 0.2849 0.0186  0.0191  0.0189  214 TYR B CE1 
3412 C CE2 . TYR B 207 ? 0.3810 0.3163 0.2857 0.0193  0.0203  0.0167  214 TYR B CE2 
3413 C CZ  . TYR B 207 ? 0.3708 0.3080 0.2755 0.0189  0.0192  0.0181  214 TYR B CZ  
3414 O OH  . TYR B 207 ? 0.4615 0.3978 0.3684 0.0187  0.0183  0.0190  214 TYR B OH  
3415 N N   . GLU B 208 ? 0.3368 0.2781 0.2402 0.0171  0.0209  0.0215  215 GLU B N   
3416 C CA  . GLU B 208 ? 0.3709 0.3104 0.2765 0.0163  0.0206  0.0229  215 GLU B CA  
3417 C C   . GLU B 208 ? 0.3582 0.2975 0.2653 0.0162  0.0199  0.0238  215 GLU B C   
3418 O O   . GLU B 208 ? 0.3499 0.2915 0.2560 0.0162  0.0191  0.0244  215 GLU B O   
3419 C CB  . GLU B 208 ? 0.4135 0.3546 0.3195 0.0154  0.0205  0.0248  215 GLU B CB  
3420 C CG  . GLU B 208 ? 0.4950 0.4338 0.4033 0.0146  0.0201  0.0261  215 GLU B CG  
3421 C CD  . GLU B 208 ? 0.5666 0.5061 0.4757 0.0136  0.0198  0.0280  215 GLU B CD  
3422 O OE1 . GLU B 208 ? 0.6405 0.5786 0.5491 0.0133  0.0201  0.0276  215 GLU B OE1 
3423 O OE2 . GLU B 208 ? 0.7196 0.6606 0.6299 0.0129  0.0191  0.0300  215 GLU B OE2 
3424 N N   . ARG B 209 ? 0.3561 0.2925 0.2656 0.0160  0.0200  0.0240  216 ARG B N   
3425 C CA  . ARG B 209 ? 0.3522 0.2881 0.2641 0.0158  0.0194  0.0251  216 ARG B CA  
3426 C C   . ARG B 209 ? 0.3487 0.2830 0.2631 0.0151  0.0195  0.0266  216 ARG B C   
3427 O O   . ARG B 209 ? 0.3382 0.2698 0.2526 0.0151  0.0205  0.0258  216 ARG B O   
3428 C CB  . ARG B 209 ? 0.3872 0.3206 0.3006 0.0165  0.0198  0.0238  216 ARG B CB  
3429 C CG  . ARG B 209 ? 0.4325 0.3668 0.3438 0.0173  0.0196  0.0221  216 ARG B CG  
3430 C CD  . ARG B 209 ? 0.4479 0.3794 0.3609 0.0179  0.0204  0.0208  216 ARG B CD  
3431 N NE  . ARG B 209 ? 0.4428 0.3728 0.3538 0.0183  0.0215  0.0191  216 ARG B NE  
3432 C CZ  . ARG B 209 ? 0.4788 0.4063 0.3902 0.0188  0.0224  0.0177  216 ARG B CZ  
3433 N NH1 . ARG B 209 ? 0.4936 0.4198 0.4077 0.0191  0.0225  0.0179  216 ARG B NH1 
3434 N NH2 . ARG B 209 ? 0.4729 0.3993 0.3821 0.0189  0.0232  0.0164  216 ARG B NH2 
3435 N N   . ALA B 210 ? 0.3335 0.2692 0.2495 0.0144  0.0184  0.0287  217 ALA B N   
3436 C CA  . ALA B 210 ? 0.3182 0.2526 0.2370 0.0137  0.0183  0.0304  217 ALA B CA  
3437 C C   . ALA B 210 ? 0.3167 0.2515 0.2389 0.0133  0.0171  0.0323  217 ALA B C   
3438 O O   . ALA B 210 ? 0.3019 0.2394 0.2235 0.0130  0.0158  0.0334  217 ALA B O   
3439 C CB  . ALA B 210 ? 0.3170 0.2534 0.2343 0.0129  0.0179  0.0316  217 ALA B CB  
3440 N N   . GLU B 211 ? 0.3296 0.2616 0.2553 0.0134  0.0176  0.0327  218 GLU B N   
3441 C CA  . GLU B 211 ? 0.3339 0.2660 0.2636 0.0130  0.0165  0.0347  218 GLU B CA  
3442 C C   . GLU B 211 ? 0.3363 0.2660 0.2693 0.0126  0.0169  0.0358  218 GLU B C   
3443 O O   . GLU B 211 ? 0.3463 0.2726 0.2795 0.0131  0.0185  0.0344  218 GLU B O   
3444 C CB  . GLU B 211 ? 0.3693 0.2997 0.3015 0.0139  0.0171  0.0336  218 GLU B CB  
3445 C CG  . GLU B 211 ? 0.4174 0.3480 0.3543 0.0136  0.0157  0.0358  218 GLU B CG  
3446 C CD  . GLU B 211 ? 0.4954 0.4247 0.4352 0.0144  0.0162  0.0351  218 GLU B CD  
3447 O OE1 . GLU B 211 ? 0.5765 0.5047 0.5141 0.0153  0.0175  0.0329  218 GLU B OE1 
3448 O OE2 . GLU B 211 ? 0.5221 0.4515 0.4667 0.0142  0.0150  0.0370  218 GLU B OE2 
3449 N N   . GLY B 212 ? 0.3167 0.2482 0.2521 0.0117  0.0153  0.0383  219 GLY B N   
3450 C CA  . GLY B 212 ? 0.3379 0.2673 0.2773 0.0113  0.0152  0.0399  219 GLY B CA  
3451 C C   . GLY B 212 ? 0.3782 0.3051 0.3225 0.0120  0.0159  0.0399  219 GLY B C   
3452 O O   . GLY B 212 ? 0.3719 0.3002 0.3180 0.0121  0.0149  0.0406  219 GLY B O   
3453 N N   . ARG B 213 ? 0.3477 0.2707 0.2941 0.0124  0.0176  0.0392  220 ARG B N   
3454 C CA  . ARG B 213 ? 0.3682 0.2886 0.3201 0.0132  0.0186  0.0393  220 ARG B CA  
3455 C C   . ARG B 213 ? 0.3625 0.2809 0.3183 0.0127  0.0186  0.0409  220 ARG B C   
3456 O O   . ARG B 213 ? 0.3410 0.2582 0.2942 0.0122  0.0187  0.0406  220 ARG B O   
3457 C CB  . ARG B 213 ? 0.4057 0.3226 0.3564 0.0144  0.0214  0.0366  220 ARG B CB  
3458 C CG  . ARG B 213 ? 0.4659 0.3846 0.4129 0.0148  0.0214  0.0350  220 ARG B CG  
3459 C CD  . ARG B 213 ? 0.5150 0.4359 0.4657 0.0150  0.0201  0.0363  220 ARG B CD  
3460 N NE  . ARG B 213 ? 0.6302 0.5517 0.5785 0.0157  0.0205  0.0346  220 ARG B NE  
3461 C CZ  . ARG B 213 ? 0.6804 0.5994 0.6302 0.0167  0.0225  0.0331  220 ARG B CZ  
3462 N NH1 . ARG B 213 ? 0.7198 0.6354 0.6733 0.0173  0.0246  0.0330  220 ARG B NH1 
3463 N NH2 . ARG B 213 ? 0.7033 0.6233 0.6509 0.0171  0.0225  0.0318  220 ARG B NH2 
3464 N N   . HIS B 214 ? 0.3777 0.2958 0.3397 0.0129  0.0182  0.0427  221 HIS B N   
3465 C CA  . HIS B 214 ? 0.3849 0.3003 0.3513 0.0128  0.0185  0.0438  221 HIS B CA  
3466 C C   . HIS B 214 ? 0.3814 0.2916 0.3465 0.0136  0.0215  0.0413  221 HIS B C   
3467 O O   . HIS B 214 ? 0.3806 0.2887 0.3442 0.0147  0.0238  0.0391  221 HIS B O   
3468 C CB  . HIS B 214 ? 0.4272 0.3427 0.4013 0.0129  0.0178  0.0461  221 HIS B CB  
3469 C CG  . HIS B 214 ? 0.4409 0.3609 0.4165 0.0118  0.0145  0.0490  221 HIS B CG  
3470 N ND1 . HIS B 214 ? 0.5349 0.4574 0.5102 0.0118  0.0134  0.0493  221 HIS B ND1 
3471 C CD2 . HIS B 214 ? 0.4855 0.4077 0.4622 0.0104  0.0120  0.0517  221 HIS B CD2 
3472 C CE1 . HIS B 214 ? 0.4994 0.4252 0.4751 0.0105  0.0103  0.0519  221 HIS B CE1 
3473 N NE2 . HIS B 214 ? 0.5372 0.4631 0.5139 0.0096  0.0094  0.0535  221 HIS B NE2 
3474 N N   . SER B 215 ? 0.3767 0.2848 0.3421 0.0131  0.0214  0.0418  222 SER B N   
3475 C CA  . SER B 215 ? 0.3800 0.2826 0.3442 0.0137  0.0239  0.0397  222 SER B CA  
3476 C C   . SER B 215 ? 0.3802 0.2800 0.3516 0.0143  0.0249  0.0408  222 SER B C   
3477 O O   . SER B 215 ? 0.3951 0.2900 0.3668 0.0152  0.0277  0.0390  222 SER B O   
3478 C CB  . SER B 215 ? 0.4215 0.3233 0.3819 0.0125  0.0228  0.0398  222 SER B CB  
3479 O OG  . SER B 215 ? 0.5130 0.4174 0.4675 0.0120  0.0220  0.0390  222 SER B OG  
3480 N N   . THR B 216 ? 0.3464 0.2492 0.3236 0.0137  0.0227  0.0439  223 THR B N   
3481 C CA  . THR B 216 ? 0.3964 0.2973 0.3815 0.0144  0.0234  0.0453  223 THR B CA  
3482 C C   . THR B 216 ? 0.4696 0.3746 0.4601 0.0143  0.0215  0.0478  223 THR B C   
3483 O O   . THR B 216 ? 0.4694 0.3788 0.4573 0.0134  0.0190  0.0489  223 THR B O   
3484 C CB  . THR B 216 ? 0.3579 0.2578 0.3457 0.0134  0.0218  0.0473  223 THR B CB  
3485 O OG1 . THR B 216 ? 0.3642 0.2690 0.3514 0.0118  0.0181  0.0500  223 THR B OG1 
3486 C CG2 . THR B 216 ? 0.3687 0.2645 0.3516 0.0133  0.0230  0.0452  223 THR B CG2 
3487 N N   . GLY B 217 ? 0.5183 0.4217 0.5165 0.0152  0.0226  0.0489  224 GLY B N   
3488 C CA  . GLY B 217 ? 0.5408 0.4476 0.5451 0.0151  0.0208  0.0514  224 GLY B CA  
3489 C C   . GLY B 217 ? 0.6015 0.5118 0.6018 0.0149  0.0197  0.0509  224 GLY B C   
3490 O O   . GLY B 217 ? 0.5871 0.4963 0.5819 0.0156  0.0217  0.0481  224 GLY B O   
3491 N N   . ALA C 1   ? 0.9661 0.8303 0.5864 0.0028  0.0214  -0.0182 6   ALA C N   
3492 C CA  . ALA C 1   ? 0.9870 0.8448 0.5941 -0.0010 0.0167  -0.0169 6   ALA C CA  
3493 C C   . ALA C 1   ? 0.9631 0.8196 0.5755 -0.0036 0.0083  -0.0143 6   ALA C C   
3494 O O   . ALA C 1   ? 1.0111 0.8675 0.6213 -0.0069 0.0042  -0.0103 6   ALA C O   
3495 C CB  . ALA C 1   ? 0.9831 0.8322 0.5751 -0.0008 0.0181  -0.0216 6   ALA C CB  
3496 N N   . ILE C 2   ? 0.8839 0.7395 0.5036 -0.0022 0.0058  -0.0162 7   ILE C N   
3497 C CA  . ILE C 2   ? 0.8421 0.6968 0.4680 -0.0045 -0.0018 -0.0136 7   ILE C CA  
3498 C C   . ILE C 2   ? 0.7757 0.6386 0.4188 -0.0032 -0.0018 -0.0107 7   ILE C C   
3499 O O   . ILE C 2   ? 0.7720 0.6364 0.4212 -0.0053 -0.0071 -0.0070 7   ILE C O   
3500 C CB  . ILE C 2   ? 0.8599 0.7070 0.4811 -0.0049 -0.0064 -0.0168 7   ILE C CB  
3501 C CG1 . ILE C 2   ? 0.8275 0.6716 0.4447 -0.0015 -0.0014 -0.0224 7   ILE C CG1 
3502 C CG2 . ILE C 2   ? 0.8926 0.7320 0.4997 -0.0088 -0.0115 -0.0160 7   ILE C CG2 
3503 C CD1 . ILE C 2   ? 0.8336 0.6685 0.4411 -0.0024 -0.0053 -0.0259 7   ILE C CD1 
3504 N N   . ILE C 3   ? 0.7303 0.5983 0.3810 0.0002  0.0039  -0.0123 8   ILE C N   
3505 C CA  . ILE C 3   ? 0.6956 0.5716 0.3613 0.0014  0.0048  -0.0095 8   ILE C CA  
3506 C C   . ILE C 3   ? 0.6974 0.5782 0.3622 0.0019  0.0103  -0.0079 8   ILE C C   
3507 O O   . ILE C 3   ? 0.7094 0.5912 0.3715 0.0044  0.0164  -0.0105 8   ILE C O   
3508 C CB  . ILE C 3   ? 0.6538 0.5319 0.3297 0.0047  0.0065  -0.0122 8   ILE C CB  
3509 C CG1 . ILE C 3   ? 0.6486 0.5213 0.3242 0.0038  0.0007  -0.0136 8   ILE C CG1 
3510 C CG2 . ILE C 3   ? 0.6343 0.5204 0.3248 0.0059  0.0078  -0.0092 8   ILE C CG2 
3511 C CD1 . ILE C 3   ? 0.6413 0.5159 0.3279 0.0063  0.0007  -0.0153 8   ILE C CD1 
3512 N N   . LYS C 4   ? 0.6494 0.5331 0.3165 -0.0004 0.0078  -0.0034 9   LYS C N   
3513 C CA  . LYS C 4   ? 0.6726 0.5613 0.3399 -0.0005 0.0120  -0.0008 9   LYS C CA  
3514 C C   . LYS C 4   ? 0.6491 0.5452 0.3299 0.0020  0.0155  0.0000  9   LYS C C   
3515 O O   . LYS C 4   ? 0.6214 0.5188 0.3115 0.0036  0.0144  -0.0011 9   LYS C O   
3516 C CB  . LYS C 4   ? 0.6733 0.5628 0.3402 -0.0041 0.0073  0.0039  9   LYS C CB  
3517 C CG  . LYS C 4   ? 0.7486 0.6308 0.4048 -0.0073 0.0016  0.0041  9   LYS C CG  
3518 C CD  . LYS C 4   ? 0.8147 0.6909 0.4555 -0.0073 0.0043  0.0006  9   LYS C CD  
3519 C CE  . LYS C 4   ? 0.8386 0.7084 0.4676 -0.0113 -0.0011 0.0022  9   LYS C CE  
3520 N NZ  . LYS C 4   ? 0.8855 0.7477 0.4995 -0.0114 0.0000  -0.0019 9   LYS C NZ  
3521 N N   . GLU C 5   ? 0.6585 0.5594 0.3402 0.0022  0.0197  0.0020  10  GLU C N   
3522 C CA  . GLU C 5   ? 0.6786 0.5867 0.3730 0.0044  0.0229  0.0033  10  GLU C CA  
3523 C C   . GLU C 5   ? 0.6666 0.5782 0.3715 0.0029  0.0184  0.0073  10  GLU C C   
3524 O O   . GLU C 5   ? 0.6286 0.5451 0.3448 0.0046  0.0198  0.0080  10  GLU C O   
3525 C CB  . GLU C 5   ? 0.7314 0.6433 0.4233 0.0050  0.0287  0.0044  10  GLU C CB  
3526 C CG  . GLU C 5   ? 0.7942 0.7029 0.4761 0.0067  0.0339  0.0005  10  GLU C CG  
3527 C CD  . GLU C 5   ? 0.8577 0.7711 0.5396 0.0079  0.0403  0.0015  10  GLU C CD  
3528 O OE1 . GLU C 5   ? 0.8566 0.7765 0.5499 0.0089  0.0418  0.0039  10  GLU C OE1 
3529 O OE2 . GLU C 5   ? 0.8865 0.7969 0.5572 0.0079  0.0439  0.0000  10  GLU C OE2 
3530 N N   . PHE C 6   ? 0.6409 0.5498 0.3417 -0.0003 0.0132  0.0100  11  PHE C N   
3531 C CA  . PHE C 6   ? 0.6210 0.5317 0.3308 -0.0019 0.0080  0.0134  11  PHE C CA  
3532 C C   . PHE C 6   ? 0.6119 0.5166 0.3179 -0.0037 0.0020  0.0127  11  PHE C C   
3533 O O   . PHE C 6   ? 0.5830 0.4827 0.2778 -0.0057 0.0000  0.0124  11  PHE C O   
3534 C CB  . PHE C 6   ? 0.6356 0.5491 0.3450 -0.0044 0.0071  0.0181  11  PHE C CB  
3535 C CG  . PHE C 6   ? 0.6403 0.5556 0.3588 -0.0062 0.0019  0.0219  11  PHE C CG  
3536 C CD1 . PHE C 6   ? 0.6492 0.5695 0.3809 -0.0047 0.0025  0.0231  11  PHE C CD1 
3537 C CD2 . PHE C 6   ? 0.6738 0.5857 0.3875 -0.0096 -0.0035 0.0245  11  PHE C CD2 
3538 C CE1 . PHE C 6   ? 0.6210 0.5426 0.3608 -0.0063 -0.0019 0.0265  11  PHE C CE1 
3539 C CE2 . PHE C 6   ? 0.6715 0.5850 0.3940 -0.0112 -0.0082 0.0281  11  PHE C CE2 
3540 C CZ  . PHE C 6   ? 0.6373 0.5556 0.3728 -0.0094 -0.0072 0.0290  11  PHE C CZ  
3541 N N   . MET C 7   ? 0.5754 0.4807 0.2912 -0.0031 -0.0009 0.0128  12  MET C N   
3542 C CA  . MET C 7   ? 0.5771 0.4774 0.2914 -0.0047 -0.0069 0.0125  12  MET C CA  
3543 C C   . MET C 7   ? 0.5692 0.4727 0.2963 -0.0052 -0.0105 0.0157  12  MET C C   
3544 O O   . MET C 7   ? 0.5203 0.4284 0.2574 -0.0031 -0.0079 0.0157  12  MET C O   
3545 C CB  . MET C 7   ? 0.6112 0.5081 0.3241 -0.0025 -0.0060 0.0079  12  MET C CB  
3546 C CG  . MET C 7   ? 0.6338 0.5267 0.3339 -0.0018 -0.0026 0.0042  12  MET C CG  
3547 S SD  . MET C 7   ? 0.6953 0.5811 0.3809 -0.0058 -0.0076 0.0054  12  MET C SD  
3548 C CE  . MET C 7   ? 0.6654 0.5450 0.3506 -0.0062 -0.0132 0.0031  12  MET C CE  
3549 N N   . ARG C 8   ? 0.5810 0.4818 0.3073 -0.0081 -0.0164 0.0184  13  ARG C N   
3550 C CA  . ARG C 8   ? 0.5792 0.4820 0.3169 -0.0089 -0.0203 0.0214  13  ARG C CA  
3551 C C   . ARG C 8   ? 0.5556 0.4546 0.2951 -0.0086 -0.0238 0.0195  13  ARG C C   
3552 O O   . ARG C 8   ? 0.5872 0.4814 0.3179 -0.0084 -0.0240 0.0163  13  ARG C O   
3553 C CB  . ARG C 8   ? 0.6045 0.5067 0.3408 -0.0124 -0.0249 0.0260  13  ARG C CB  
3554 C CG  . ARG C 8   ? 0.6223 0.5279 0.3559 -0.0132 -0.0221 0.0283  13  ARG C CG  
3555 C CD  . ARG C 8   ? 0.6485 0.5532 0.3812 -0.0168 -0.0272 0.0330  13  ARG C CD  
3556 N NE  . ARG C 8   ? 0.6832 0.5924 0.4172 -0.0173 -0.0247 0.0358  13  ARG C NE  
3557 C CZ  . ARG C 8   ? 0.7083 0.6230 0.4536 -0.0160 -0.0229 0.0377  13  ARG C CZ  
3558 N NH1 . ARG C 8   ? 0.6775 0.5939 0.4337 -0.0142 -0.0232 0.0369  13  ARG C NH1 
3559 N NH2 . ARG C 8   ? 0.7063 0.6246 0.4519 -0.0167 -0.0208 0.0403  13  ARG C NH2 
3560 N N   . PHE C 9   ? 0.5613 0.4622 0.3121 -0.0085 -0.0264 0.0214  14  PHE C N   
3561 C CA  . PHE C 9   ? 0.5480 0.4457 0.3019 -0.0082 -0.0298 0.0199  14  PHE C CA  
3562 C C   . PHE C 9   ? 0.5308 0.4296 0.2949 -0.0097 -0.0345 0.0237  14  PHE C C   
3563 O O   . PHE C 9   ? 0.5210 0.4239 0.2919 -0.0100 -0.0339 0.0267  14  PHE C O   
3564 C CB  . PHE C 9   ? 0.5419 0.4406 0.2993 -0.0048 -0.0258 0.0158  14  PHE C CB  
3565 C CG  . PHE C 9   ? 0.5505 0.4549 0.3204 -0.0026 -0.0229 0.0165  14  PHE C CG  
3566 C CD1 . PHE C 9   ? 0.5466 0.4520 0.3269 -0.0027 -0.0258 0.0183  14  PHE C CD1 
3567 C CD2 . PHE C 9   ? 0.5318 0.4401 0.3027 -0.0004 -0.0172 0.0151  14  PHE C CD2 
3568 C CE1 . PHE C 9   ? 0.5308 0.4407 0.3216 -0.0007 -0.0230 0.0185  14  PHE C CE1 
3569 C CE2 . PHE C 9   ? 0.5527 0.4655 0.3342 0.0013  -0.0148 0.0157  14  PHE C CE2 
3570 C CZ  . PHE C 9   ? 0.5307 0.4442 0.3218 0.0011  -0.0177 0.0172  14  PHE C CZ  
3571 N N   . LYS C 10  ? 0.5260 0.4209 0.2907 -0.0107 -0.0391 0.0235  15  LYS C N   
3572 C CA  . LYS C 10  ? 0.5561 0.4518 0.3313 -0.0118 -0.0434 0.0268  15  LYS C CA  
3573 C C   . LYS C 10  ? 0.5150 0.4099 0.2968 -0.0099 -0.0438 0.0246  15  LYS C C   
3574 O O   . LYS C 10  ? 0.4986 0.3897 0.2742 -0.0093 -0.0440 0.0212  15  LYS C O   
3575 C CB  . LYS C 10  ? 0.6133 0.5049 0.3841 -0.0154 -0.0498 0.0298  15  LYS C CB  
3576 C CG  . LYS C 10  ? 0.6630 0.5566 0.4320 -0.0174 -0.0501 0.0334  15  LYS C CG  
3577 C CD  . LYS C 10  ? 0.7434 0.6320 0.5006 -0.0207 -0.0543 0.0345  15  LYS C CD  
3578 C CE  . LYS C 10  ? 0.7682 0.6590 0.5249 -0.0229 -0.0551 0.0387  15  LYS C CE  
3579 N NZ  . LYS C 10  ? 0.7872 0.6732 0.5302 -0.0259 -0.0579 0.0391  15  LYS C NZ  
3580 N N   . VAL C 11  ? 0.5015 0.3998 0.2956 -0.0092 -0.0441 0.0266  16  VAL C N   
3581 C CA  . VAL C 11  ? 0.4862 0.3843 0.2871 -0.0073 -0.0438 0.0247  16  VAL C CA  
3582 C C   . VAL C 11  ? 0.4841 0.3827 0.2955 -0.0084 -0.0478 0.0282  16  VAL C C   
3583 O O   . VAL C 11  ? 0.4860 0.3874 0.3034 -0.0093 -0.0485 0.0316  16  VAL C O   
3584 C CB  . VAL C 11  ? 0.4853 0.3874 0.2909 -0.0040 -0.0379 0.0222  16  VAL C CB  
3585 C CG1 . VAL C 11  ? 0.4699 0.3772 0.2835 -0.0036 -0.0355 0.0249  16  VAL C CG1 
3586 C CG2 . VAL C 11  ? 0.4774 0.3787 0.2888 -0.0023 -0.0380 0.0201  16  VAL C CG2 
3587 N N   . HIS C 12  ? 0.4879 0.3837 0.3015 -0.0084 -0.0507 0.0273  17  HIS C N   
3588 C CA  . HIS C 12  ? 0.4984 0.3949 0.3231 -0.0089 -0.0538 0.0301  17  HIS C CA  
3589 C C   . HIS C 12  ? 0.4716 0.3686 0.3021 -0.0064 -0.0518 0.0276  17  HIS C C   
3590 O O   . HIS C 12  ? 0.4722 0.3663 0.2966 -0.0057 -0.0517 0.0243  17  HIS C O   
3591 C CB  . HIS C 12  ? 0.5264 0.4183 0.3481 -0.0119 -0.0605 0.0322  17  HIS C CB  
3592 C CG  . HIS C 12  ? 0.5678 0.4603 0.4012 -0.0125 -0.0639 0.0355  17  HIS C CG  
3593 N ND1 . HIS C 12  ? 0.6397 0.5299 0.4764 -0.0122 -0.0662 0.0346  17  HIS C ND1 
3594 C CD2 . HIS C 12  ? 0.5894 0.4848 0.4326 -0.0134 -0.0651 0.0396  17  HIS C CD2 
3595 C CE1 . HIS C 12  ? 0.6544 0.5461 0.5025 -0.0129 -0.0688 0.0382  17  HIS C CE1 
3596 N NE2 . HIS C 12  ? 0.5875 0.4823 0.4397 -0.0135 -0.0681 0.0412  17  HIS C NE2 
3597 N N   . MET C 13  ? 0.4485 0.3490 0.2907 -0.0053 -0.0506 0.0292  18  MET C N   
3598 C CA  . MET C 13  ? 0.4476 0.3487 0.2961 -0.0032 -0.0488 0.0273  18  MET C CA  
3599 C C   . MET C 13  ? 0.4457 0.3470 0.3048 -0.0040 -0.0522 0.0304  18  MET C C   
3600 O O   . MET C 13  ? 0.4374 0.3409 0.3030 -0.0049 -0.0529 0.0339  18  MET C O   
3601 C CB  . MET C 13  ? 0.4517 0.3571 0.3048 -0.0006 -0.0430 0.0260  18  MET C CB  
3602 C CG  . MET C 13  ? 0.4342 0.3405 0.2944 0.0013  -0.0412 0.0244  18  MET C CG  
3603 S SD  . MET C 13  ? 0.4349 0.3459 0.3014 0.0040  -0.0350 0.0235  18  MET C SD  
3604 C CE  . MET C 13  ? 0.4823 0.3927 0.3377 0.0053  -0.0316 0.0192  18  MET C CE  
3605 N N   . GLU C 14  ? 0.4090 0.3080 0.2702 -0.0036 -0.0539 0.0293  19  GLU C N   
3606 C CA  . GLU C 14  ? 0.4292 0.3289 0.3017 -0.0038 -0.0561 0.0319  19  GLU C CA  
3607 C C   . GLU C 14  ? 0.4260 0.3275 0.3037 -0.0011 -0.0522 0.0296  19  GLU C C   
3608 O O   . GLU C 14  ? 0.4489 0.3488 0.3210 0.0000  -0.0508 0.0260  19  GLU C O   
3609 C CB  . GLU C 14  ? 0.5006 0.3962 0.3726 -0.0059 -0.0622 0.0333  19  GLU C CB  
3610 C CG  . GLU C 14  ? 0.5925 0.4832 0.4518 -0.0074 -0.0652 0.0313  19  GLU C CG  
3611 C CD  . GLU C 14  ? 0.6515 0.5381 0.5117 -0.0092 -0.0713 0.0326  19  GLU C CD  
3612 O OE1 . GLU C 14  ? 0.6913 0.5736 0.5426 -0.0096 -0.0729 0.0297  19  GLU C OE1 
3613 O OE2 . GLU C 14  ? 0.7136 0.6011 0.5836 -0.0103 -0.0743 0.0364  19  GLU C OE2 
3614 N N   . GLY C 15  ? 0.4147 0.3193 0.3030 -0.0002 -0.0504 0.0315  20  GLY C N   
3615 C CA  . GLY C 15  ? 0.4299 0.3361 0.3224 0.0021  -0.0464 0.0293  20  GLY C CA  
3616 C C   . GLY C 15  ? 0.4102 0.3183 0.3147 0.0026  -0.0460 0.0318  20  GLY C C   
3617 O O   . GLY C 15  ? 0.3851 0.2939 0.2958 0.0013  -0.0483 0.0355  20  GLY C O   
3618 N N   . SER C 16  ? 0.3924 0.3012 0.3000 0.0045  -0.0432 0.0297  21  SER C N   
3619 C CA  . SER C 16  ? 0.3981 0.3091 0.3162 0.0056  -0.0411 0.0314  21  SER C CA  
3620 C C   . SER C 16  ? 0.3572 0.2699 0.2748 0.0079  -0.0359 0.0284  21  SER C C   
3621 O O   . SER C 16  ? 0.3673 0.2787 0.2788 0.0087  -0.0351 0.0251  21  SER C O   
3622 C CB  . SER C 16  ? 0.4310 0.3404 0.3555 0.0048  -0.0445 0.0331  21  SER C CB  
3623 O OG  . SER C 16  ? 0.5487 0.4559 0.4685 0.0053  -0.0454 0.0303  21  SER C OG  
3624 N N   . VAL C 17  ? 0.3410 0.2562 0.2656 0.0089  -0.0325 0.0296  22  VAL C N   
3625 C CA  . VAL C 17  ? 0.3316 0.2483 0.2572 0.0109  -0.0278 0.0273  22  VAL C CA  
3626 C C   . VAL C 17  ? 0.3436 0.2614 0.2792 0.0116  -0.0262 0.0292  22  VAL C C   
3627 O O   . VAL C 17  ? 0.3452 0.2643 0.2867 0.0112  -0.0259 0.0319  22  VAL C O   
3628 C CB  . VAL C 17  ? 0.3221 0.2408 0.2441 0.0116  -0.0243 0.0263  22  VAL C CB  
3629 C CG1 . VAL C 17  ? 0.3406 0.2606 0.2644 0.0135  -0.0196 0.0244  22  VAL C CG1 
3630 C CG2 . VAL C 17  ? 0.3479 0.2656 0.2598 0.0111  -0.0252 0.0243  22  VAL C CG2 
3631 N N   . ASN C 18  ? 0.3365 0.2538 0.2743 0.0126  -0.0251 0.0278  23  ASN C N   
3632 C CA  . ASN C 18  ? 0.3523 0.2703 0.2991 0.0132  -0.0236 0.0294  23  ASN C CA  
3633 C C   . ASN C 18  ? 0.3894 0.3072 0.3435 0.0118  -0.0270 0.0333  23  ASN C C   
3634 O O   . ASN C 18  ? 0.3765 0.2956 0.3391 0.0121  -0.0254 0.0358  23  ASN C O   
3635 C CB  . ASN C 18  ? 0.3421 0.2620 0.2912 0.0146  -0.0185 0.0289  23  ASN C CB  
3636 C CG  . ASN C 18  ? 0.3517 0.2715 0.2974 0.0161  -0.0154 0.0257  23  ASN C CG  
3637 O OD1 . ASN C 18  ? 0.3653 0.2839 0.3050 0.0162  -0.0166 0.0233  23  ASN C OD1 
3638 N ND2 . ASN C 18  ? 0.3632 0.2839 0.3128 0.0172  -0.0115 0.0257  23  ASN C ND2 
3639 N N   . GLY C 19  ? 0.3768 0.2928 0.3277 0.0103  -0.0318 0.0339  24  GLY C N   
3640 C CA  . GLY C 19  ? 0.4114 0.3269 0.3687 0.0087  -0.0358 0.0378  24  GLY C CA  
3641 C C   . GLY C 19  ? 0.4187 0.3350 0.3765 0.0074  -0.0372 0.0402  24  GLY C C   
3642 O O   . GLY C 19  ? 0.4198 0.3354 0.3819 0.0058  -0.0411 0.0434  24  GLY C O   
3643 N N   . HIS C 20  ? 0.3859 0.3035 0.3391 0.0080  -0.0342 0.0389  25  HIS C N   
3644 C CA  . HIS C 20  ? 0.3898 0.3083 0.3437 0.0068  -0.0352 0.0413  25  HIS C CA  
3645 C C   . HIS C 20  ? 0.3781 0.2947 0.3226 0.0051  -0.0391 0.0408  25  HIS C C   
3646 O O   . HIS C 20  ? 0.3659 0.2822 0.3015 0.0056  -0.0377 0.0377  25  HIS C O   
3647 C CB  . HIS C 20  ? 0.3981 0.3186 0.3515 0.0081  -0.0305 0.0404  25  HIS C CB  
3648 C CG  . HIS C 20  ? 0.4380 0.3596 0.3944 0.0070  -0.0314 0.0434  25  HIS C CG  
3649 N ND1 . HIS C 20  ? 0.4529 0.3743 0.4024 0.0057  -0.0336 0.0436  25  HIS C ND1 
3650 C CD2 . HIS C 20  ? 0.4036 0.3264 0.3695 0.0070  -0.0307 0.0465  25  HIS C CD2 
3651 C CE1 . HIS C 20  ? 0.4110 0.3334 0.3654 0.0048  -0.0342 0.0467  25  HIS C CE1 
3652 N NE2 . HIS C 20  ? 0.4491 0.3724 0.4136 0.0056  -0.0326 0.0485  25  HIS C NE2 
3653 N N   . GLU C 21  ? 0.3861 0.3015 0.3329 0.0031  -0.0440 0.0439  26  GLU C N   
3654 C CA  . GLU C 21  ? 0.3891 0.3022 0.3271 0.0012  -0.0482 0.0436  26  GLU C CA  
3655 C C   . GLU C 21  ? 0.4075 0.3217 0.3423 0.0002  -0.0481 0.0449  26  GLU C C   
3656 O O   . GLU C 21  ? 0.4194 0.3356 0.3616 0.0002  -0.0472 0.0477  26  GLU C O   
3657 C CB  . GLU C 21  ? 0.4377 0.3484 0.3792 -0.0007 -0.0540 0.0464  26  GLU C CB  
3658 C CG  . GLU C 21  ? 0.4772 0.3863 0.4195 0.0000  -0.0547 0.0446  26  GLU C CG  
3659 C CD  . GLU C 21  ? 0.5529 0.4599 0.5000 -0.0019 -0.0603 0.0476  26  GLU C CD  
3660 O OE1 . GLU C 21  ? 0.6015 0.5075 0.5492 -0.0041 -0.0646 0.0507  26  GLU C OE1 
3661 O OE2 . GLU C 21  ? 0.5945 0.5006 0.5447 -0.0012 -0.0607 0.0469  26  GLU C OE2 
3662 N N   . PHE C 22  ? 0.3779 0.2906 0.3017 -0.0005 -0.0492 0.0430  27  PHE C N   
3663 C CA  . PHE C 22  ? 0.3772 0.2908 0.2965 -0.0014 -0.0490 0.0440  27  PHE C CA  
3664 C C   . PHE C 22  ? 0.3830 0.2939 0.2903 -0.0029 -0.0517 0.0425  27  PHE C C   
3665 O O   . PHE C 22  ? 0.4160 0.3245 0.3176 -0.0028 -0.0528 0.0399  27  PHE C O   
3666 C CB  . PHE C 22  ? 0.3814 0.2979 0.3003 0.0006  -0.0432 0.0419  27  PHE C CB  
3667 C CG  . PHE C 22  ? 0.3987 0.3146 0.3096 0.0022  -0.0402 0.0375  27  PHE C CG  
3668 C CD1 . PHE C 22  ? 0.4045 0.3206 0.3188 0.0040  -0.0379 0.0354  27  PHE C CD1 
3669 C CD2 . PHE C 22  ? 0.4187 0.3341 0.3193 0.0018  -0.0398 0.0355  27  PHE C CD2 
3670 C CE1 . PHE C 22  ? 0.4164 0.3320 0.3240 0.0054  -0.0355 0.0315  27  PHE C CE1 
3671 C CE2 . PHE C 22  ? 0.4512 0.3661 0.3452 0.0034  -0.0370 0.0315  27  PHE C CE2 
3672 C CZ  . PHE C 22  ? 0.4127 0.3277 0.3104 0.0051  -0.0350 0.0296  27  PHE C CZ  
3673 N N   . GLU C 23  ? 0.4047 0.3160 0.3082 -0.0044 -0.0528 0.0442  28  GLU C N   
3674 C CA  . GLU C 23  ? 0.4092 0.3182 0.3003 -0.0058 -0.0544 0.0427  28  GLU C CA  
3675 C C   . GLU C 23  ? 0.4281 0.3395 0.3149 -0.0054 -0.0511 0.0423  28  GLU C C   
3676 O O   . GLU C 23  ? 0.3951 0.3092 0.2885 -0.0053 -0.0498 0.0447  28  GLU C O   
3677 C CB  . GLU C 23  ? 0.4597 0.3658 0.3489 -0.0089 -0.0607 0.0458  28  GLU C CB  
3678 C CG  . GLU C 23  ? 0.4740 0.3770 0.3650 -0.0094 -0.0645 0.0457  28  GLU C CG  
3679 C CD  . GLU C 23  ? 0.5384 0.4377 0.4256 -0.0126 -0.0710 0.0483  28  GLU C CD  
3680 O OE1 . GLU C 23  ? 0.5586 0.4558 0.4500 -0.0133 -0.0746 0.0493  28  GLU C OE1 
3681 O OE2 . GLU C 23  ? 0.5503 0.4488 0.4307 -0.0144 -0.0727 0.0494  28  GLU C OE2 
3682 N N   . ILE C 24  ? 0.4057 0.3160 0.2814 -0.0052 -0.0496 0.0394  29  ILE C N   
3683 C CA  . ILE C 24  ? 0.4107 0.3231 0.2814 -0.0051 -0.0467 0.0391  29  ILE C CA  
3684 C C   . ILE C 24  ? 0.4301 0.3396 0.2892 -0.0072 -0.0494 0.0388  29  ILE C C   
3685 O O   . ILE C 24  ? 0.4443 0.3505 0.2972 -0.0074 -0.0511 0.0367  29  ILE C O   
3686 C CB  . ILE C 24  ? 0.4171 0.3314 0.2859 -0.0024 -0.0411 0.0353  29  ILE C CB  
3687 C CG1 . ILE C 24  ? 0.4315 0.3487 0.3114 -0.0006 -0.0383 0.0360  29  ILE C CG1 
3688 C CG2 . ILE C 24  ? 0.4156 0.3316 0.2777 -0.0022 -0.0381 0.0345  29  ILE C CG2 
3689 C CD1 . ILE C 24  ? 0.4386 0.3572 0.3181 0.0019  -0.0335 0.0324  29  ILE C CD1 
3690 N N   . GLU C 25  ? 0.4463 0.3569 0.3027 -0.0086 -0.0496 0.0410  30  GLU C N   
3691 C CA  . GLU C 25  ? 0.4753 0.3836 0.3197 -0.0103 -0.0510 0.0405  30  GLU C CA  
3692 C C   . GLU C 25  ? 0.4658 0.3772 0.3065 -0.0092 -0.0463 0.0395  30  GLU C C   
3693 O O   . GLU C 25  ? 0.4456 0.3605 0.2931 -0.0088 -0.0444 0.0414  30  GLU C O   
3694 C CB  . GLU C 25  ? 0.5458 0.4523 0.3898 -0.0136 -0.0566 0.0447  30  GLU C CB  
3695 C CG  . GLU C 25  ? 0.5963 0.5005 0.4469 -0.0149 -0.0616 0.0469  30  GLU C CG  
3696 C CD  . GLU C 25  ? 0.6788 0.5812 0.5294 -0.0183 -0.0675 0.0514  30  GLU C CD  
3697 O OE1 . GLU C 25  ? 0.7300 0.6302 0.5856 -0.0196 -0.0721 0.0534  30  GLU C OE1 
3698 O OE2 . GLU C 25  ? 0.7806 0.6836 0.6265 -0.0198 -0.0678 0.0531  30  GLU C OE2 
3699 N N   . GLY C 26  ? 0.4591 0.3690 0.2889 -0.0089 -0.0444 0.0366  31  GLY C N   
3700 C CA  . GLY C 26  ? 0.4736 0.3864 0.3000 -0.0083 -0.0403 0.0362  31  GLY C CA  
3701 C C   . GLY C 26  ? 0.4793 0.3899 0.2930 -0.0094 -0.0401 0.0351  31  GLY C C   
3702 O O   . GLY C 26  ? 0.4889 0.3952 0.2950 -0.0107 -0.0431 0.0340  31  GLY C O   
3703 N N   . GLU C 27  ? 0.4813 0.3949 0.2927 -0.0090 -0.0366 0.0353  32  GLU C N   
3704 C CA  . GLU C 27  ? 0.5244 0.4366 0.3236 -0.0097 -0.0352 0.0340  32  GLU C CA  
3705 C C   . GLU C 27  ? 0.5031 0.4188 0.3018 -0.0073 -0.0291 0.0318  32  GLU C C   
3706 O O   . GLU C 27  ? 0.5322 0.4518 0.3394 -0.0060 -0.0268 0.0327  32  GLU C O   
3707 C CB  . GLU C 27  ? 0.5972 0.5095 0.3936 -0.0127 -0.0380 0.0380  32  GLU C CB  
3708 C CG  . GLU C 27  ? 0.6905 0.5987 0.4852 -0.0156 -0.0443 0.0404  32  GLU C CG  
3709 C CD  . GLU C 27  ? 0.7621 0.6722 0.5652 -0.0175 -0.0477 0.0453  32  GLU C CD  
3710 O OE1 . GLU C 27  ? 0.7666 0.6775 0.5660 -0.0194 -0.0485 0.0480  32  GLU C OE1 
3711 O OE2 . GLU C 27  ? 0.8499 0.7608 0.6636 -0.0169 -0.0493 0.0464  32  GLU C OE2 
3712 N N   . GLY C 28  ? 0.4938 0.4079 0.2827 -0.0066 -0.0265 0.0288  33  GLY C N   
3713 C CA  . GLY C 28  ? 0.4990 0.4166 0.2874 -0.0044 -0.0207 0.0270  33  GLY C CA  
3714 C C   . GLY C 28  ? 0.5315 0.4476 0.3079 -0.0049 -0.0186 0.0256  33  GLY C C   
3715 O O   . GLY C 28  ? 0.5373 0.4493 0.3053 -0.0069 -0.0215 0.0257  33  GLY C O   
3716 N N   . GLU C 29  ? 0.5779 0.4973 0.3539 -0.0032 -0.0135 0.0245  34  GLU C N   
3717 C CA  . GLU C 29  ? 0.5759 0.4943 0.3412 -0.0031 -0.0104 0.0229  34  GLU C CA  
3718 C C   . GLU C 29  ? 0.5764 0.4978 0.3437 -0.0001 -0.0047 0.0201  34  GLU C C   
3719 O O   . GLU C 29  ? 0.5381 0.4628 0.3151 0.0016  -0.0032 0.0200  34  GLU C O   
3720 C CB  . GLU C 29  ? 0.6337 0.5539 0.3961 -0.0053 -0.0106 0.0265  34  GLU C CB  
3721 C CG  . GLU C 29  ? 0.6436 0.5697 0.4146 -0.0043 -0.0077 0.0286  34  GLU C CG  
3722 C CD  . GLU C 29  ? 0.6773 0.6049 0.4472 -0.0069 -0.0093 0.0328  34  GLU C CD  
3723 O OE1 . GLU C 29  ? 0.7467 0.6728 0.5186 -0.0091 -0.0142 0.0356  34  GLU C OE1 
3724 O OE2 . GLU C 29  ? 0.7457 0.6761 0.5129 -0.0067 -0.0057 0.0335  34  GLU C OE2 
3725 N N   . GLY C 30  ? 0.5426 0.4627 0.3009 0.0005  -0.0014 0.0178  35  GLY C N   
3726 C CA  . GLY C 30  ? 0.5347 0.4576 0.2945 0.0033  0.0041  0.0153  35  GLY C CA  
3727 C C   . GLY C 30  ? 0.5669 0.4880 0.3159 0.0038  0.0078  0.0129  35  GLY C C   
3728 O O   . GLY C 30  ? 0.5655 0.4830 0.3046 0.0019  0.0062  0.0132  35  GLY C O   
3729 N N   . ARG C 31  ? 0.5711 0.4945 0.3221 0.0066  0.0127  0.0105  36  ARG C N   
3730 C CA  . ARG C 31  ? 0.5981 0.5203 0.3402 0.0076  0.0172  0.0081  36  ARG C CA  
3731 C C   . ARG C 31  ? 0.5801 0.5001 0.3221 0.0101  0.0190  0.0037  36  ARG C C   
3732 O O   . ARG C 31  ? 0.6021 0.5253 0.3513 0.0125  0.0221  0.0025  36  ARG C O   
3733 C CB  . ARG C 31  ? 0.6440 0.5718 0.3892 0.0084  0.0218  0.0099  36  ARG C CB  
3734 C CG  . ARG C 31  ? 0.6470 0.5772 0.3941 0.0058  0.0194  0.0146  36  ARG C CG  
3735 C CD  . ARG C 31  ? 0.6842 0.6188 0.4311 0.0060  0.0237  0.0166  36  ARG C CD  
3736 N NE  . ARG C 31  ? 0.6902 0.6223 0.4254 0.0058  0.0267  0.0150  36  ARG C NE  
3737 C CZ  . ARG C 31  ? 0.6863 0.6162 0.4123 0.0033  0.0253  0.0168  36  ARG C CZ  
3738 N NH1 . ARG C 31  ? 0.6988 0.6260 0.4141 0.0035  0.0286  0.0147  36  ARG C NH1 
3739 N NH2 . ARG C 31  ? 0.6782 0.6081 0.4054 0.0005  0.0207  0.0205  36  ARG C NH2 
3740 N N   . PRO C 32  ? 0.5697 0.4838 0.3037 0.0095  0.0166  0.0013  37  PRO C N   
3741 C CA  . PRO C 32  ? 0.5755 0.4869 0.3105 0.0116  0.0169  -0.0025 37  PRO C CA  
3742 C C   . PRO C 32  ? 0.5595 0.4727 0.2949 0.0146  0.0229  -0.0055 37  PRO C C   
3743 O O   . PRO C 32  ? 0.5690 0.4829 0.3110 0.0167  0.0237  -0.0075 37  PRO C O   
3744 C CB  . PRO C 32  ? 0.5809 0.4853 0.3048 0.0100  0.0136  -0.0043 37  PRO C CB  
3745 C CG  . PRO C 32  ? 0.5855 0.4895 0.3067 0.0067  0.0096  -0.0004 37  PRO C CG  
3746 C CD  . PRO C 32  ? 0.5746 0.4841 0.2985 0.0066  0.0129  0.0023  37  PRO C CD  
3747 N N   . TYR C 33  ? 0.5764 0.4907 0.3058 0.0148  0.0272  -0.0053 38  TYR C N   
3748 C CA  . TYR C 33  ? 0.5821 0.4982 0.3119 0.0177  0.0331  -0.0079 38  TYR C CA  
3749 C C   . TYR C 33  ? 0.6004 0.5232 0.3416 0.0193  0.0361  -0.0061 38  TYR C C   
3750 O O   . TYR C 33  ? 0.6250 0.5498 0.3691 0.0218  0.0406  -0.0080 38  TYR C O   
3751 C CB  . TYR C 33  ? 0.5926 0.5068 0.3111 0.0173  0.0367  -0.0086 38  TYR C CB  
3752 C CG  . TYR C 33  ? 0.5834 0.4904 0.2905 0.0160  0.0338  -0.0109 38  TYR C CG  
3753 C CD1 . TYR C 33  ? 0.5868 0.4894 0.2896 0.0178  0.0352  -0.0153 38  TYR C CD1 
3754 C CD2 . TYR C 33  ? 0.5994 0.5037 0.3002 0.0127  0.0295  -0.0085 38  TYR C CD2 
3755 C CE1 . TYR C 33  ? 0.6133 0.5088 0.3051 0.0164  0.0324  -0.0175 38  TYR C CE1 
3756 C CE2 . TYR C 33  ? 0.6051 0.5023 0.2952 0.0113  0.0264  -0.0105 38  TYR C CE2 
3757 C CZ  . TYR C 33  ? 0.6183 0.5111 0.3038 0.0131  0.0279  -0.0150 38  TYR C CZ  
3758 O OH  . TYR C 33  ? 0.6409 0.5263 0.3151 0.0115  0.0247  -0.0170 38  TYR C OH  
3759 N N   . GLU C 34  ? 0.5726 0.4987 0.3204 0.0177  0.0334  -0.0024 39  GLU C N   
3760 C CA  . GLU C 34  ? 0.5740 0.5062 0.3322 0.0188  0.0356  -0.0003 39  GLU C CA  
3761 C C   . GLU C 34  ? 0.5487 0.4819 0.3167 0.0192  0.0325  0.0000  39  GLU C C   
3762 O O   . GLU C 34  ? 0.5426 0.4802 0.3195 0.0201  0.0340  0.0013  39  GLU C O   
3763 C CB  . GLU C 34  ? 0.6061 0.5416 0.3645 0.0168  0.0355  0.0037  39  GLU C CB  
3764 C CG  . GLU C 34  ? 0.6518 0.5872 0.4011 0.0166  0.0394  0.0038  39  GLU C CG  
3765 C CD  . GLU C 34  ? 0.6744 0.6117 0.4214 0.0140  0.0383  0.0079  39  GLU C CD  
3766 O OE1 . GLU C 34  ? 0.6671 0.6068 0.4210 0.0126  0.0351  0.0110  39  GLU C OE1 
3767 O OE2 . GLU C 34  ? 0.7606 0.6969 0.4986 0.0133  0.0407  0.0081  39  GLU C OE2 
3768 N N   . GLY C 35  ? 0.5006 0.4296 0.2670 0.0184  0.0282  -0.0012 40  GLY C N   
3769 C CA  . GLY C 35  ? 0.5165 0.4458 0.2915 0.0189  0.0255  -0.0014 40  GLY C CA  
3770 C C   . GLY C 35  ? 0.4968 0.4288 0.2791 0.0174  0.0226  0.0022  40  GLY C C   
3771 O O   . GLY C 35  ? 0.4770 0.4108 0.2681 0.0182  0.0219  0.0024  40  GLY C O   
3772 N N   . THR C 36  ? 0.4991 0.4313 0.2779 0.0151  0.0210  0.0051  41  THR C N   
3773 C CA  . THR C 36  ? 0.5243 0.4594 0.3104 0.0137  0.0186  0.0087  41  THR C CA  
3774 C C   . THR C 36  ? 0.4860 0.4179 0.2692 0.0112  0.0134  0.0105  41  THR C C   
3775 O O   . THR C 36  ? 0.5236 0.4520 0.2974 0.0098  0.0122  0.0100  41  THR C O   
3776 C CB  . THR C 36  ? 0.5538 0.4935 0.3415 0.0134  0.0215  0.0114  41  THR C CB  
3777 O OG1 . THR C 36  ? 0.5627 0.5011 0.3408 0.0122  0.0225  0.0118  41  THR C OG1 
3778 C CG2 . THR C 36  ? 0.5713 0.5144 0.3639 0.0159  0.0261  0.0101  41  THR C CG2 
3779 N N   . GLN C 37  ? 0.4557 0.3884 0.2467 0.0105  0.0103  0.0124  42  GLN C N   
3780 C CA  . GLN C 37  ? 0.4838 0.4139 0.2733 0.0080  0.0053  0.0145  42  GLN C CA  
3781 C C   . GLN C 37  ? 0.4893 0.4216 0.2881 0.0072  0.0031  0.0175  42  GLN C C   
3782 O O   . GLN C 37  ? 0.5026 0.4375 0.3095 0.0088  0.0046  0.0173  42  GLN C O   
3783 C CB  . GLN C 37  ? 0.4886 0.4136 0.2742 0.0078  0.0022  0.0122  42  GLN C CB  
3784 C CG  . GLN C 37  ? 0.5061 0.4311 0.2991 0.0096  0.0021  0.0103  42  GLN C CG  
3785 C CD  . GLN C 37  ? 0.5734 0.4937 0.3633 0.0096  -0.0008 0.0079  42  GLN C CD  
3786 O OE1 . GLN C 37  ? 0.6163 0.5336 0.4043 0.0075  -0.0052 0.0093  42  GLN C OE1 
3787 N NE2 . GLN C 37  ? 0.5704 0.4899 0.3604 0.0118  0.0015  0.0046  42  GLN C NE2 
3788 N N   . THR C 38  ? 0.4770 0.4079 0.2746 0.0048  -0.0007 0.0202  43  THR C N   
3789 C CA  . THR C 38  ? 0.5003 0.4329 0.3072 0.0040  -0.0032 0.0231  43  THR C CA  
3790 C C   . THR C 38  ? 0.4622 0.3912 0.2686 0.0023  -0.0083 0.0241  43  THR C C   
3791 O O   . THR C 38  ? 0.5205 0.4461 0.3185 0.0009  -0.0103 0.0236  43  THR C O   
3792 C CB  . THR C 38  ? 0.5298 0.4657 0.3385 0.0028  -0.0028 0.0267  43  THR C CB  
3793 O OG1 . THR C 38  ? 0.5264 0.4605 0.3267 0.0005  -0.0046 0.0282  43  THR C OG1 
3794 C CG2 . THR C 38  ? 0.5344 0.4742 0.3447 0.0045  0.0021  0.0260  43  THR C CG2 
3795 N N   . ALA C 39  ? 0.4912 0.4209 0.3066 0.0022  -0.0103 0.0256  44  ALA C N   
3796 C CA  . ALA C 39  ? 0.4796 0.4064 0.2963 0.0004  -0.0153 0.0273  44  ALA C CA  
3797 C C   . ALA C 39  ? 0.4899 0.4189 0.3167 -0.0001 -0.0170 0.0306  44  ALA C C   
3798 O O   . ALA C 39  ? 0.4549 0.3868 0.2883 0.0012  -0.0144 0.0307  44  ALA C O   
3799 C CB  . ALA C 39  ? 0.5121 0.4359 0.3285 0.0014  -0.0165 0.0245  44  ALA C CB  
3800 N N   . LYS C 40  ? 0.4875 0.4145 0.3146 -0.0024 -0.0216 0.0333  45  LYS C N   
3801 C CA  . LYS C 40  ? 0.4834 0.4116 0.3197 -0.0034 -0.0239 0.0368  45  LYS C CA  
3802 C C   . LYS C 40  ? 0.4358 0.3611 0.2755 -0.0039 -0.0279 0.0370  45  LYS C C   
3803 O O   . LYS C 40  ? 0.4671 0.3891 0.3013 -0.0057 -0.0315 0.0374  45  LYS C O   
3804 C CB  . LYS C 40  ? 0.5465 0.4754 0.3806 -0.0058 -0.0260 0.0405  45  LYS C CB  
3805 C CG  . LYS C 40  ? 0.5858 0.5182 0.4186 -0.0053 -0.0222 0.0409  45  LYS C CG  
3806 C CD  . LYS C 40  ? 0.6486 0.5810 0.4737 -0.0075 -0.0232 0.0430  45  LYS C CD  
3807 C CE  . LYS C 40  ? 0.6794 0.6152 0.5025 -0.0063 -0.0184 0.0423  45  LYS C CE  
3808 N NZ  . LYS C 40  ? 0.7199 0.6566 0.5378 -0.0083 -0.0188 0.0450  45  LYS C NZ  
3809 N N   . LEU C 41  ? 0.4343 0.3605 0.2828 -0.0024 -0.0271 0.0366  46  LEU C N   
3810 C CA  . LEU C 41  ? 0.4262 0.3499 0.2788 -0.0028 -0.0305 0.0369  46  LEU C CA  
3811 C C   . LEU C 41  ? 0.4384 0.3633 0.3014 -0.0037 -0.0328 0.0407  46  LEU C C   
3812 O O   . LEU C 41  ? 0.4245 0.3523 0.2931 -0.0030 -0.0304 0.0419  46  LEU C O   
3813 C CB  . LEU C 41  ? 0.4108 0.3345 0.2664 -0.0004 -0.0279 0.0336  46  LEU C CB  
3814 C CG  . LEU C 41  ? 0.4138 0.3365 0.2617 0.0011  -0.0252 0.0295  46  LEU C CG  
3815 C CD1 . LEU C 41  ? 0.4363 0.3555 0.2737 -0.0005 -0.0279 0.0288  46  LEU C CD1 
3816 C CD2 . LEU C 41  ? 0.4118 0.3376 0.2583 0.0026  -0.0204 0.0281  46  LEU C CD2 
3817 N N   . LYS C 42  ? 0.4360 0.3585 0.3016 -0.0052 -0.0372 0.0425  47  LYS C N   
3818 C CA  . LYS C 42  ? 0.4469 0.3702 0.3231 -0.0060 -0.0396 0.0461  47  LYS C CA  
3819 C C   . LYS C 42  ? 0.4427 0.3640 0.3242 -0.0057 -0.0418 0.0459  47  LYS C C   
3820 O O   . LYS C 42  ? 0.4350 0.3532 0.3113 -0.0066 -0.0448 0.0450  47  LYS C O   
3821 C CB  . LYS C 42  ? 0.4823 0.4045 0.3571 -0.0090 -0.0443 0.0500  47  LYS C CB  
3822 C CG  . LYS C 42  ? 0.5273 0.4512 0.3974 -0.0099 -0.0430 0.0512  47  LYS C CG  
3823 C CD  . LYS C 42  ? 0.5642 0.4872 0.4352 -0.0129 -0.0480 0.0556  47  LYS C CD  
3824 C CE  . LYS C 42  ? 0.6342 0.5599 0.5052 -0.0136 -0.0466 0.0578  47  LYS C CE  
3825 N NZ  . LYS C 42  ? 0.6640 0.5904 0.5250 -0.0129 -0.0431 0.0551  47  LYS C NZ  
3826 N N   . VAL C 43  ? 0.4249 0.3479 0.3167 -0.0043 -0.0401 0.0466  48  VAL C N   
3827 C CA  . VAL C 43  ? 0.4147 0.3363 0.3134 -0.0041 -0.0421 0.0471  48  VAL C CA  
3828 C C   . VAL C 43  ? 0.4481 0.3684 0.3504 -0.0066 -0.0475 0.0514  48  VAL C C   
3829 O O   . VAL C 43  ? 0.4283 0.3504 0.3368 -0.0073 -0.0478 0.0545  48  VAL C O   
3830 C CB  . VAL C 43  ? 0.3926 0.3165 0.3011 -0.0019 -0.0384 0.0469  48  VAL C CB  
3831 C CG1 . VAL C 43  ? 0.3946 0.3173 0.3104 -0.0016 -0.0401 0.0475  48  VAL C CG1 
3832 C CG2 . VAL C 43  ? 0.3953 0.3203 0.2994 0.0002  -0.0335 0.0430  48  VAL C CG2 
3833 N N   . THR C 44  ? 0.4193 0.3365 0.3174 -0.0082 -0.0517 0.0515  49  THR C N   
3834 C CA  . THR C 44  ? 0.4573 0.3730 0.3586 -0.0109 -0.0573 0.0557  49  THR C CA  
3835 C C   . THR C 44  ? 0.4742 0.3894 0.3862 -0.0109 -0.0597 0.0577  49  THR C C   
3836 O O   . THR C 44  ? 0.5408 0.4558 0.4593 -0.0127 -0.0635 0.0618  49  THR C O   
3837 C CB  . THR C 44  ? 0.4598 0.3720 0.3494 -0.0132 -0.0612 0.0552  49  THR C CB  
3838 O OG1 . THR C 44  ? 0.4336 0.3435 0.3177 -0.0121 -0.0606 0.0514  49  THR C OG1 
3839 C CG2 . THR C 44  ? 0.4793 0.3924 0.3600 -0.0135 -0.0591 0.0543  49  THR C CG2 
3840 N N   . LYS C 45  ? 0.4784 0.3933 0.3925 -0.0091 -0.0578 0.0552  50  LYS C N   
3841 C CA  . LYS C 45  ? 0.4561 0.3711 0.3815 -0.0086 -0.0588 0.0569  50  LYS C CA  
3842 C C   . LYS C 45  ? 0.4574 0.3745 0.3876 -0.0055 -0.0532 0.0543  50  LYS C C   
3843 O O   . LYS C 45  ? 0.4550 0.3722 0.3783 -0.0041 -0.0500 0.0506  50  LYS C O   
3844 C CB  . LYS C 45  ? 0.5052 0.4168 0.4281 -0.0098 -0.0632 0.0567  50  LYS C CB  
3845 C CG  . LYS C 45  ? 0.5503 0.4592 0.4671 -0.0130 -0.0691 0.0591  50  LYS C CG  
3846 C CD  . LYS C 45  ? 0.6113 0.5168 0.5291 -0.0145 -0.0744 0.0602  50  LYS C CD  
3847 C CE  . LYS C 45  ? 0.6552 0.5582 0.5706 -0.0180 -0.0809 0.0640  50  LYS C CE  
3848 N NZ  . LYS C 45  ? 0.7081 0.6083 0.6276 -0.0194 -0.0861 0.0657  50  LYS C NZ  
3849 N N   . GLY C 46  ? 0.4867 0.4053 0.4286 -0.0046 -0.0522 0.0564  51  GLY C N   
3850 C CA  . GLY C 46  ? 0.4599 0.3800 0.4066 -0.0020 -0.0472 0.0541  51  GLY C CA  
3851 C C   . GLY C 46  ? 0.4473 0.3698 0.3940 -0.0003 -0.0420 0.0528  51  GLY C C   
3852 O O   . GLY C 46  ? 0.4264 0.3498 0.3750 0.0018  -0.0377 0.0504  51  GLY C O   
3853 N N   . GLY C 47  ? 0.4322 0.3557 0.3767 -0.0013 -0.0424 0.0543  52  GLY C N   
3854 C CA  . GLY C 47  ? 0.4357 0.3614 0.3806 0.0000  -0.0377 0.0532  52  GLY C CA  
3855 C C   . GLY C 47  ? 0.4451 0.3723 0.4018 0.0008  -0.0360 0.0557  52  GLY C C   
3856 O O   . GLY C 47  ? 0.4704 0.3972 0.4345 -0.0002 -0.0390 0.0591  52  GLY C O   
3857 N N   . PRO C 48  ? 0.4223 0.3508 0.3809 0.0027  -0.0312 0.0541  53  PRO C N   
3858 C CA  . PRO C 48  ? 0.4243 0.3533 0.3753 0.0041  -0.0275 0.0503  53  PRO C CA  
3859 C C   . PRO C 48  ? 0.3927 0.3207 0.3424 0.0056  -0.0258 0.0473  53  PRO C C   
3860 O O   . PRO C 48  ? 0.3842 0.3117 0.3409 0.0061  -0.0260 0.0481  53  PRO C O   
3861 C CB  . PRO C 48  ? 0.4468 0.3773 0.4024 0.0053  -0.0235 0.0504  53  PRO C CB  
3862 C CG  . PRO C 48  ? 0.4391 0.3694 0.4059 0.0056  -0.0236 0.0531  53  PRO C CG  
3863 C CD  . PRO C 48  ? 0.4405 0.3701 0.4095 0.0035  -0.0289 0.0562  53  PRO C CD  
3864 N N   . LEU C 49  ? 0.3917 0.3197 0.3327 0.0063  -0.0242 0.0439  54  LEU C N   
3865 C CA  . LEU C 49  ? 0.3687 0.2956 0.3075 0.0075  -0.0229 0.0409  54  LEU C CA  
3866 C C   . LEU C 49  ? 0.3436 0.2713 0.2867 0.0095  -0.0183 0.0395  54  LEU C C   
3867 O O   . LEU C 49  ? 0.3550 0.2839 0.2962 0.0103  -0.0153 0.0384  54  LEU C O   
3868 C CB  . LEU C 49  ? 0.3929 0.3194 0.3213 0.0075  -0.0229 0.0380  54  LEU C CB  
3869 C CG  . LEU C 49  ? 0.4090 0.3341 0.3317 0.0055  -0.0274 0.0392  54  LEU C CG  
3870 C CD1 . LEU C 49  ? 0.4514 0.3760 0.3638 0.0058  -0.0265 0.0360  54  LEU C CD1 
3871 C CD2 . LEU C 49  ? 0.4064 0.3296 0.3330 0.0043  -0.0316 0.0410  54  LEU C CD2 
3872 N N   . PRO C 50  ? 0.3581 0.2851 0.3066 0.0103  -0.0178 0.0393  55  PRO C N   
3873 C CA  . PRO C 50  ? 0.3703 0.2977 0.3225 0.0121  -0.0133 0.0380  55  PRO C CA  
3874 C C   . PRO C 50  ? 0.3876 0.3147 0.3337 0.0133  -0.0110 0.0342  55  PRO C C   
3875 O O   . PRO C 50  ? 0.4122 0.3388 0.3612 0.0145  -0.0089 0.0331  55  PRO C O   
3876 C CB  . PRO C 50  ? 0.3895 0.3163 0.3507 0.0123  -0.0139 0.0399  55  PRO C CB  
3877 C CG  . PRO C 50  ? 0.3905 0.3162 0.3492 0.0112  -0.0181 0.0400  55  PRO C CG  
3878 C CD  . PRO C 50  ? 0.3682 0.2938 0.3200 0.0097  -0.0211 0.0405  55  PRO C CD  
3879 N N   . PHE C 51  ? 0.3898 0.3172 0.3277 0.0131  -0.0112 0.0324  56  PHE C N   
3880 C CA  . PHE C 51  ? 0.3711 0.2983 0.3032 0.0143  -0.0091 0.0290  56  PHE C CA  
3881 C C   . PHE C 51  ? 0.4037 0.3319 0.3285 0.0141  -0.0085 0.0278  56  PHE C C   
3882 O O   . PHE C 51  ? 0.3877 0.3165 0.3111 0.0128  -0.0103 0.0297  56  PHE C O   
3883 C CB  . PHE C 51  ? 0.3545 0.2802 0.2847 0.0143  -0.0113 0.0277  56  PHE C CB  
3884 C CG  . PHE C 51  ? 0.3439 0.2687 0.2698 0.0127  -0.0155 0.0285  56  PHE C CG  
3885 C CD1 . PHE C 51  ? 0.3565 0.2812 0.2740 0.0124  -0.0159 0.0268  56  PHE C CD1 
3886 C CD2 . PHE C 51  ? 0.3389 0.2628 0.2695 0.0115  -0.0190 0.0310  56  PHE C CD2 
3887 C CE1 . PHE C 51  ? 0.3453 0.2688 0.2582 0.0109  -0.0196 0.0276  56  PHE C CE1 
3888 C CE2 . PHE C 51  ? 0.3429 0.2655 0.2691 0.0099  -0.0230 0.0319  56  PHE C CE2 
3889 C CZ  . PHE C 51  ? 0.3589 0.2812 0.2762 0.0096  -0.0233 0.0301  56  PHE C CZ  
3890 N N   . ALA C 52  ? 0.3894 0.3178 0.3098 0.0152  -0.0061 0.0250  57  ALA C N   
3891 C CA  . ALA C 52  ? 0.3996 0.3292 0.3136 0.0152  -0.0049 0.0238  57  ALA C CA  
3892 C C   . ALA C 52  ? 0.4078 0.3370 0.3156 0.0141  -0.0077 0.0238  57  ALA C C   
3893 O O   . ALA C 52  ? 0.4206 0.3484 0.3255 0.0141  -0.0093 0.0225  57  ALA C O   
3894 C CB  . ALA C 52  ? 0.4062 0.3359 0.3172 0.0166  -0.0022 0.0209  57  ALA C CB  
3895 N N   . TRP C 53  ? 0.3722 0.3027 0.2773 0.0132  -0.0079 0.0251  58  TRP C N   
3896 C CA  . TRP C 53  ? 0.3592 0.2892 0.2569 0.0122  -0.0101 0.0249  58  TRP C CA  
3897 C C   . TRP C 53  ? 0.3618 0.2915 0.2527 0.0132  -0.0087 0.0216  58  TRP C C   
3898 O O   . TRP C 53  ? 0.3874 0.3156 0.2724 0.0126  -0.0106 0.0206  58  TRP C O   
3899 C CB  . TRP C 53  ? 0.3590 0.2907 0.2550 0.0112  -0.0098 0.0267  58  TRP C CB  
3900 C CG  . TRP C 53  ? 0.3476 0.2788 0.2355 0.0101  -0.0116 0.0265  58  TRP C CG  
3901 C CD1 . TRP C 53  ? 0.3750 0.3070 0.2560 0.0106  -0.0096 0.0245  58  TRP C CD1 
3902 C CD2 . TRP C 53  ? 0.3689 0.2985 0.2546 0.0083  -0.0155 0.0282  58  TRP C CD2 
3903 N NE1 . TRP C 53  ? 0.3670 0.2978 0.2413 0.0093  -0.0119 0.0249  58  TRP C NE1 
3904 C CE2 . TRP C 53  ? 0.3668 0.2960 0.2437 0.0078  -0.0157 0.0271  58  TRP C CE2 
3905 C CE3 . TRP C 53  ? 0.3947 0.3231 0.2852 0.0070  -0.0190 0.0307  58  TRP C CE3 
3906 C CZ2 . TRP C 53  ? 0.4006 0.3279 0.2726 0.0059  -0.0192 0.0282  58  TRP C CZ2 
3907 C CZ3 . TRP C 53  ? 0.4359 0.3625 0.3220 0.0052  -0.0227 0.0320  58  TRP C CZ3 
3908 C CH2 . TRP C 53  ? 0.4001 0.3261 0.2767 0.0046  -0.0229 0.0307  58  TRP C CH2 
3909 N N   . ASP C 54  ? 0.3478 0.2785 0.2394 0.0147  -0.0054 0.0197  59  ASP C N   
3910 C CA  . ASP C 54  ? 0.3803 0.3110 0.2660 0.0157  -0.0038 0.0168  59  ASP C CA  
3911 C C   . ASP C 54  ? 0.3770 0.3054 0.2601 0.0159  -0.0056 0.0149  59  ASP C C   
3912 O O   . ASP C 54  ? 0.4196 0.3472 0.2963 0.0162  -0.0055 0.0129  59  ASP C O   
3913 C CB  . ASP C 54  ? 0.3739 0.3060 0.2619 0.0171  -0.0003 0.0154  59  ASP C CB  
3914 C CG  . ASP C 54  ? 0.4093 0.3435 0.2979 0.0169  0.0015  0.0168  59  ASP C CG  
3915 O OD1 . ASP C 54  ? 0.3897 0.3249 0.2743 0.0161  0.0010  0.0177  59  ASP C OD1 
3916 O OD2 . ASP C 54  ? 0.4375 0.3722 0.3305 0.0175  0.0033  0.0170  59  ASP C OD2 
3917 N N   . ILE C 55  ? 0.3684 0.2953 0.2561 0.0157  -0.0075 0.0157  60  ILE C N   
3918 C CA  . ILE C 55  ? 0.4024 0.3270 0.2875 0.0160  -0.0092 0.0137  60  ILE C CA  
3919 C C   . ILE C 55  ? 0.3640 0.2869 0.2433 0.0146  -0.0123 0.0141  60  ILE C C   
3920 O O   . ILE C 55  ? 0.3988 0.3197 0.2737 0.0148  -0.0134 0.0121  60  ILE C O   
3921 C CB  . ILE C 55  ? 0.4112 0.3347 0.3026 0.0162  -0.0102 0.0141  60  ILE C CB  
3922 C CG1 . ILE C 55  ? 0.4031 0.3262 0.2994 0.0148  -0.0130 0.0173  60  ILE C CG1 
3923 C CG2 . ILE C 55  ? 0.4117 0.3365 0.3073 0.0176  -0.0068 0.0133  60  ILE C CG2 
3924 C CD1 . ILE C 55  ? 0.4431 0.3650 0.3455 0.0150  -0.0143 0.0179  60  ILE C CD1 
3925 N N   . LEU C 56  ? 0.3508 0.2742 0.2298 0.0131  -0.0138 0.0167  61  LEU C N   
3926 C CA  . LEU C 56  ? 0.3701 0.2915 0.2429 0.0114  -0.0172 0.0172  61  LEU C CA  
3927 C C   . LEU C 56  ? 0.3929 0.3149 0.2576 0.0114  -0.0154 0.0160  61  LEU C C   
3928 O O   . LEU C 56  ? 0.3854 0.3053 0.2428 0.0105  -0.0172 0.0153  61  LEU C O   
3929 C CB  . LEU C 56  ? 0.3676 0.2892 0.2445 0.0096  -0.0200 0.0211  61  LEU C CB  
3930 C CG  . LEU C 56  ? 0.3755 0.2971 0.2618 0.0095  -0.0213 0.0230  61  LEU C CG  
3931 C CD1 . LEU C 56  ? 0.3867 0.3086 0.2769 0.0077  -0.0240 0.0268  61  LEU C CD1 
3932 C CD2 . LEU C 56  ? 0.3870 0.3060 0.2736 0.0097  -0.0235 0.0218  61  LEU C CD2 
3933 N N   . SER C 57  ? 0.3967 0.3216 0.2627 0.0124  -0.0119 0.0159  62  SER C N   
3934 C CA  . SER C 57  ? 0.4043 0.3305 0.2642 0.0122  -0.0101 0.0156  62  SER C CA  
3935 C C   . SER C 57  ? 0.4123 0.3368 0.2638 0.0128  -0.0094 0.0126  62  SER C C   
3936 O O   . SER C 57  ? 0.3949 0.3188 0.2397 0.0117  -0.0101 0.0130  62  SER C O   
3937 C CB  . SER C 57  ? 0.4074 0.3369 0.2708 0.0132  -0.0065 0.0161  62  SER C CB  
3938 O OG  . SER C 57  ? 0.5125 0.4426 0.3767 0.0151  -0.0036 0.0135  62  SER C OG  
3939 N N   . PRO C 58  ? 0.4048 0.3283 0.2562 0.0144  -0.0082 0.0097  63  PRO C N   
3940 C CA  . PRO C 58  ? 0.4315 0.3532 0.2751 0.0150  -0.0074 0.0068  63  PRO C CA  
3941 C C   . PRO C 58  ? 0.4481 0.3658 0.2865 0.0138  -0.0111 0.0063  63  PRO C C   
3942 O O   . PRO C 58  ? 0.4598 0.3753 0.2914 0.0144  -0.0106 0.0037  63  PRO C O   
3943 C CB  . PRO C 58  ? 0.4512 0.3732 0.2976 0.0171  -0.0051 0.0042  63  PRO C CB  
3944 C CG  . PRO C 58  ? 0.4368 0.3603 0.2919 0.0173  -0.0051 0.0057  63  PRO C CG  
3945 C CD  . PRO C 58  ? 0.4251 0.3491 0.2835 0.0156  -0.0074 0.0091  63  PRO C CD  
3946 N N   . GLN C 59  ? 0.4197 0.3361 0.2610 0.0122  -0.0149 0.0087  64  GLN C N   
3947 C CA  . GLN C 59  ? 0.4447 0.3569 0.2808 0.0109  -0.0188 0.0081  64  GLN C CA  
3948 C C   . GLN C 59  ? 0.4604 0.3713 0.2890 0.0091  -0.0203 0.0093  64  GLN C C   
3949 O O   . GLN C 59  ? 0.4756 0.3826 0.2978 0.0079  -0.0233 0.0085  64  GLN C O   
3950 C CB  . GLN C 59  ? 0.4445 0.3554 0.2872 0.0099  -0.0227 0.0101  64  GLN C CB  
3951 C CG  . GLN C 59  ? 0.4027 0.3156 0.2546 0.0114  -0.0211 0.0101  64  GLN C CG  
3952 C CD  . GLN C 59  ? 0.4148 0.3275 0.2660 0.0135  -0.0183 0.0067  64  GLN C CD  
3953 O OE1 . GLN C 59  ? 0.4221 0.3328 0.2665 0.0141  -0.0179 0.0039  64  GLN C OE1 
3954 N NE2 . GLN C 59  ? 0.4169 0.3318 0.2756 0.0147  -0.0163 0.0069  64  GLN C NE2 
3955 N N   . PHE C 60  ? 0.4598 0.3737 0.2891 0.0086  -0.0187 0.0114  65  PHE C N   
3956 C CA  . PHE C 60  ? 0.5127 0.4256 0.3351 0.0066  -0.0203 0.0130  65  PHE C CA  
3957 C C   . PHE C 60  ? 0.5886 0.5008 0.4012 0.0072  -0.0174 0.0104  65  PHE C C   
3958 O O   . PHE C 60  ? 0.6693 0.5825 0.4773 0.0062  -0.0166 0.0117  65  PHE C O   
3959 C CB  . PHE C 60  ? 0.4778 0.3941 0.3057 0.0056  -0.0203 0.0167  65  PHE C CB  
3960 C CG  . PHE C 60  ? 0.4793 0.3957 0.3162 0.0049  -0.0232 0.0193  65  PHE C CG  
3961 C CD1 . PHE C 60  ? 0.4898 0.4031 0.3261 0.0029  -0.0281 0.0209  65  PHE C CD1 
3962 C CD2 . PHE C 60  ? 0.4631 0.3825 0.3091 0.0062  -0.0210 0.0198  65  PHE C CD2 
3963 C CE1 . PHE C 60  ? 0.4899 0.4035 0.3351 0.0023  -0.0306 0.0233  65  PHE C CE1 
3964 C CE2 . PHE C 60  ? 0.4519 0.3713 0.3062 0.0057  -0.0233 0.0220  65  PHE C CE2 
3965 C CZ  . PHE C 60  ? 0.4697 0.3864 0.3241 0.0038  -0.0280 0.0238  65  PHE C CZ  
3966 N N1  . CH6 C 61  ? 0.6605 0.5746 0.4747 0.0095  -0.0134 0.0081  66  CH6 C N1  
3967 C CE  . CH6 C 61  ? 0.7120 0.6365 0.5298 0.0072  -0.0089 0.0164  66  CH6 C CE  
3968 S SD  . CH6 C 61  ? 0.6987 0.6262 0.5208 0.0101  -0.0040 0.0137  66  CH6 C SD  
3969 C CG1 . CH6 C 61  ? 0.7320 0.6554 0.5482 0.0113  -0.0041 0.0096  66  CH6 C CG1 
3970 C CB1 . CH6 C 61  ? 0.7246 0.6462 0.5463 0.0117  -0.0065 0.0088  66  CH6 C CB1 
3971 C CA1 . CH6 C 61  ? 0.7045 0.6216 0.5191 0.0116  -0.0084 0.0062  66  CH6 C CA1 
3972 C C1  . CH6 C 61  ? 0.6650 0.5814 0.4811 0.0138  -0.0064 0.0029  66  CH6 C C1  
3973 N N2  . CH6 C 61  ? 0.6262 0.5460 0.4472 0.0158  -0.0026 0.0019  66  CH6 C N2  
3974 O OH  . CH6 C 61  ? 0.6183 0.5518 0.4679 0.0230  0.0109  0.0004  66  CH6 C OH  
3975 C CD2 . CH6 C 61  ? 0.6336 0.5581 0.4686 0.0225  0.0061  -0.0041 66  CH6 C CD2 
3976 C CE2 . CH6 C 61  ? 0.6712 0.5991 0.5123 0.0233  0.0085  -0.0032 66  CH6 C CE2 
3977 C CZ  . CH6 C 61  ? 0.6688 0.5993 0.5129 0.0223  0.0087  -0.0003 66  CH6 C CZ  
3978 C CE1 . CH6 C 61  ? 0.6740 0.6039 0.5154 0.0205  0.0066  0.0016  66  CH6 C CE1 
3979 C CD1 . CH6 C 61  ? 0.6483 0.5749 0.4836 0.0196  0.0041  0.0009  66  CH6 C CD1 
3980 C CG2 . CH6 C 61  ? 0.6424 0.5662 0.4744 0.0206  0.0038  -0.0019 66  CH6 C CG2 
3981 C CB2 . CH6 C 61  ? 0.6528 0.5725 0.4778 0.0196  0.0011  -0.0030 66  CH6 C CB2 
3982 C CA2 . CH6 C 61  ? 0.6259 0.5438 0.4464 0.0174  -0.0019 -0.0010 66  CH6 C CA2 
3983 C C2  . CH6 C 61  ? 0.6445 0.5579 0.4598 0.0163  -0.0055 -0.0019 66  CH6 C C2  
3984 O O2  . CH6 C 61  ? 0.6326 0.5431 0.4461 0.0172  -0.0061 -0.0046 66  CH6 C O2  
3985 N N3  . CH6 C 61  ? 0.6167 0.5292 0.4290 0.0141  -0.0082 0.0004  66  CH6 C N3  
3986 C CA3 . CH6 C 61  ? 0.6342 0.5419 0.4412 0.0124  -0.0126 0.0003  66  CH6 C CA3 
3987 C C3  . CH6 C 61  ? 0.6370 0.5421 0.4333 0.0111  -0.0131 -0.0001 66  CH6 C C3  
3988 O O3  . CH6 C 61  ? 0.6760 0.5776 0.4685 0.0090  -0.0175 0.0010  66  CH6 C O3  
3989 N N   . SER C 62  ? 0.6308 0.5383 0.4241 0.0115  -0.0096 0.0000  69  SER C N   
3990 C CA  . SER C 62  ? 0.5976 0.5031 0.3809 0.0100  -0.0099 0.0002  69  SER C CA  
3991 C C   . SER C 62  ? 0.6255 0.5308 0.4030 0.0120  -0.0052 -0.0031 69  SER C C   
3992 O O   . SER C 62  ? 0.5714 0.4798 0.3477 0.0126  -0.0014 -0.0026 69  SER C O   
3993 C CB  . SER C 62  ? 0.6370 0.5461 0.4227 0.0086  -0.0098 0.0040  69  SER C CB  
3994 O OG  . SER C 62  ? 0.6305 0.5378 0.4070 0.0068  -0.0103 0.0048  69  SER C OG  
3995 N N   . LYS C 63  ? 0.6262 0.5279 0.4005 0.0131  -0.0055 -0.0064 70  LYS C N   
3996 C CA  . LYS C 63  ? 0.6283 0.5301 0.3994 0.0155  -0.0008 -0.0099 70  LYS C CA  
3997 C C   . LYS C 63  ? 0.5797 0.4793 0.3397 0.0152  0.0013  -0.0112 70  LYS C C   
3998 O O   . LYS C 63  ? 0.5597 0.4597 0.3169 0.0171  0.0056  -0.0138 70  LYS C O   
3999 C CB  . LYS C 63  ? 0.6947 0.5932 0.4665 0.0169  -0.0018 -0.0132 70  LYS C CB  
4000 C CG  . LYS C 63  ? 0.7152 0.6160 0.4981 0.0176  -0.0032 -0.0122 70  LYS C CG  
4001 C CD  . LYS C 63  ? 0.7061 0.6125 0.4969 0.0191  0.0006  -0.0112 70  LYS C CD  
4002 C CE  . LYS C 63  ? 0.7275 0.6349 0.5264 0.0208  0.0007  -0.0123 70  LYS C CE  
4003 N NZ  . LYS C 63  ? 0.7172 0.6295 0.5236 0.0222  0.0042  -0.0115 70  LYS C NZ  
4004 N N   . ALA C 64  ? 0.5640 0.4615 0.3177 0.0126  -0.0014 -0.0092 71  ALA C N   
4005 C CA  . ALA C 64  ? 0.5919 0.4875 0.3345 0.0121  0.0008  -0.0101 71  ALA C CA  
4006 C C   . ALA C 64  ? 0.5799 0.4809 0.3245 0.0130  0.0058  -0.0087 71  ALA C C   
4007 O O   . ALA C 64  ? 0.5562 0.4565 0.2931 0.0134  0.0093  -0.0100 71  ALA C O   
4008 C CB  . ALA C 64  ? 0.6480 0.5401 0.3837 0.0089  -0.0037 -0.0079 71  ALA C CB  
4009 N N   . TYR C 65  ? 0.5376 0.4439 0.2927 0.0133  0.0061  -0.0060 72  TYR C N   
4010 C CA  . TYR C 65  ? 0.5274 0.4387 0.2847 0.0138  0.0102  -0.0043 72  TYR C CA  
4011 C C   . TYR C 65  ? 0.5160 0.4310 0.2809 0.0167  0.0143  -0.0059 72  TYR C C   
4012 O O   . TYR C 65  ? 0.5984 0.5180 0.3717 0.0170  0.0151  -0.0037 72  TYR C O   
4013 C CB  . TYR C 65  ? 0.5212 0.4359 0.2845 0.0120  0.0078  0.0000  72  TYR C CB  
4014 C CG  . TYR C 65  ? 0.5303 0.4421 0.2882 0.0089  0.0034  0.0024  72  TYR C CG  
4015 C CD1 . TYR C 65  ? 0.5230 0.4308 0.2805 0.0076  -0.0016 0.0023  72  TYR C CD1 
4016 C CD2 . TYR C 65  ? 0.5358 0.4492 0.2898 0.0072  0.0039  0.0051  72  TYR C CD2 
4017 C CE1 . TYR C 65  ? 0.5396 0.4448 0.2926 0.0046  -0.0060 0.0049  72  TYR C CE1 
4018 C CE2 . TYR C 65  ? 0.5396 0.4505 0.2890 0.0043  -0.0003 0.0076  72  TYR C CE2 
4019 C CZ  . TYR C 65  ? 0.5439 0.4507 0.2929 0.0030  -0.0054 0.0075  72  TYR C CZ  
4020 O OH  . TYR C 65  ? 0.5090 0.4133 0.2541 0.0000  -0.0101 0.0102  72  TYR C OH  
4021 N N   . VAL C 66  ? 0.5118 0.4245 0.2742 0.0187  0.0163  -0.0096 73  VAL C N   
4022 C CA  . VAL C 66  ? 0.5022 0.4182 0.2708 0.0214  0.0206  -0.0112 73  VAL C CA  
4023 C C   . VAL C 66  ? 0.5503 0.4664 0.3122 0.0227  0.0256  -0.0130 73  VAL C C   
4024 O O   . VAL C 66  ? 0.5221 0.4336 0.2740 0.0224  0.0259  -0.0153 73  VAL C O   
4025 C CB  . VAL C 66  ? 0.4939 0.4075 0.2656 0.0230  0.0195  -0.0142 73  VAL C CB  
4026 C CG1 . VAL C 66  ? 0.4816 0.3986 0.2600 0.0256  0.0236  -0.0155 73  VAL C CG1 
4027 C CG2 . VAL C 66  ? 0.4803 0.3929 0.2575 0.0216  0.0144  -0.0127 73  VAL C CG2 
4028 N N   . LYS C 67  ? 0.5308 0.4521 0.2979 0.0238  0.0296  -0.0117 74  LYS C N   
4029 C CA  . LYS C 67  ? 0.5472 0.4695 0.3100 0.0254  0.0349  -0.0131 74  LYS C CA  
4030 C C   . LYS C 67  ? 0.5540 0.4745 0.3174 0.0280  0.0374  -0.0171 74  LYS C C   
4031 O O   . LYS C 67  ? 0.5447 0.4679 0.3171 0.0296  0.0382  -0.0173 74  LYS C O   
4032 C CB  . LYS C 67  ? 0.5684 0.4970 0.3381 0.0259  0.0382  -0.0104 74  LYS C CB  
4033 C CG  . LYS C 67  ? 0.5885 0.5188 0.3546 0.0274  0.0439  -0.0112 74  LYS C CG  
4034 C CD  . LYS C 67  ? 0.6131 0.5494 0.3848 0.0271  0.0464  -0.0077 74  LYS C CD  
4035 C CE  . LYS C 67  ? 0.6085 0.5473 0.3808 0.0294  0.0524  -0.0088 74  LYS C CE  
4036 N NZ  . LYS C 67  ? 0.6242 0.5689 0.4024 0.0292  0.0547  -0.0053 74  LYS C NZ  
4037 N N   . HIS C 68  ? 0.5474 0.4634 0.3013 0.0285  0.0389  -0.0201 75  HIS C N   
4038 C CA  . HIS C 68  ? 0.5689 0.4833 0.3230 0.0312  0.0419  -0.0238 75  HIS C CA  
4039 C C   . HIS C 68  ? 0.5525 0.4684 0.3034 0.0330  0.0482  -0.0250 75  HIS C C   
4040 O O   . HIS C 68  ? 0.5642 0.4793 0.3071 0.0320  0.0500  -0.0243 75  HIS C O   
4041 C CB  . HIS C 68  ? 0.5772 0.4846 0.3234 0.0308  0.0391  -0.0270 75  HIS C CB  
4042 C CG  . HIS C 68  ? 0.5631 0.4690 0.3141 0.0298  0.0335  -0.0266 75  HIS C CG  
4043 N ND1 . HIS C 68  ? 0.5734 0.4793 0.3249 0.0272  0.0289  -0.0236 75  HIS C ND1 
4044 C CD2 . HIS C 68  ? 0.5650 0.4694 0.3210 0.0311  0.0319  -0.0286 75  HIS C CD2 
4045 C CE1 . HIS C 68  ? 0.5548 0.4593 0.3113 0.0269  0.0249  -0.0238 75  HIS C CE1 
4046 N NE2 . HIS C 68  ? 0.5809 0.4845 0.3401 0.0292  0.0266  -0.0268 75  HIS C NE2 
4047 N N   . PRO C 69  ? 0.5889 0.5068 0.3461 0.0357  0.0517  -0.0267 76  PRO C N   
4048 C CA  . PRO C 69  ? 0.5974 0.5156 0.3507 0.0376  0.0577  -0.0285 76  PRO C CA  
4049 C C   . PRO C 69  ? 0.6056 0.5168 0.3470 0.0376  0.0576  -0.0322 76  PRO C C   
4050 O O   . PRO C 69  ? 0.5967 0.5032 0.3351 0.0367  0.0531  -0.0337 76  PRO C O   
4051 C CB  . PRO C 69  ? 0.5868 0.5078 0.3500 0.0404  0.0602  -0.0297 76  PRO C CB  
4052 C CG  . PRO C 69  ? 0.6033 0.5268 0.3761 0.0396  0.0559  -0.0277 76  PRO C CG  
4053 C CD  . PRO C 69  ? 0.5589 0.4789 0.3268 0.0370  0.0504  -0.0269 76  PRO C CD  
4054 N N   . ALA C 70  ? 0.6345 0.5448 0.3687 0.0385  0.0626  -0.0334 77  ALA C N   
4055 C CA  . ALA C 70  ? 0.6802 0.5837 0.4015 0.0383  0.0631  -0.0365 77  ALA C CA  
4056 C C   . ALA C 70  ? 0.6843 0.5831 0.4050 0.0403  0.0631  -0.0409 77  ALA C C   
4057 O O   . ALA C 70  ? 0.7025 0.5947 0.4132 0.0395  0.0611  -0.0436 77  ALA C O   
4058 C CB  . ALA C 70  ? 0.6702 0.5746 0.3851 0.0390  0.0693  -0.0367 77  ALA C CB  
4059 N N   . ASP C 71  ? 0.6731 0.5752 0.4041 0.0428  0.0651  -0.0417 78  ASP C N   
4060 C CA  . ASP C 71  ? 0.7024 0.6001 0.4336 0.0447  0.0649  -0.0458 78  ASP C CA  
4061 C C   . ASP C 71  ? 0.6654 0.5626 0.4036 0.0440  0.0590  -0.0455 78  ASP C C   
4062 O O   . ASP C 71  ? 0.6749 0.5706 0.4176 0.0458  0.0587  -0.0480 78  ASP C O   
4063 C CB  . ASP C 71  ? 0.7301 0.6306 0.4672 0.0481  0.0711  -0.0474 78  ASP C CB  
4064 C CG  . ASP C 71  ? 0.7253 0.6333 0.4760 0.0489  0.0720  -0.0443 78  ASP C CG  
4065 O OD1 . ASP C 71  ? 0.7818 0.6934 0.5365 0.0468  0.0688  -0.0407 78  ASP C OD1 
4066 O OD2 . ASP C 71  ? 0.7695 0.6797 0.5272 0.0515  0.0756  -0.0455 78  ASP C OD2 
4067 N N   . ILE C 72  ? 0.6389 0.5375 0.3785 0.0414  0.0543  -0.0423 79  ILE C N   
4068 C CA  . ILE C 72  ? 0.6144 0.5115 0.3586 0.0403  0.0483  -0.0420 79  ILE C CA  
4069 C C   . ILE C 72  ? 0.6303 0.5223 0.3645 0.0376  0.0439  -0.0419 79  ILE C C   
4070 O O   . ILE C 72  ? 0.5675 0.4615 0.3005 0.0354  0.0422  -0.0386 79  ILE C O   
4071 C CB  . ILE C 72  ? 0.6037 0.5070 0.3592 0.0395  0.0462  -0.0381 79  ILE C CB  
4072 C CG1 . ILE C 72  ? 0.5886 0.4970 0.3543 0.0420  0.0502  -0.0379 79  ILE C CG1 
4073 C CG2 . ILE C 72  ? 0.5880 0.4890 0.3468 0.0382  0.0402  -0.0378 79  ILE C CG2 
4074 C CD1 . ILE C 72  ? 0.5860 0.4999 0.3625 0.0412  0.0483  -0.0344 79  ILE C CD1 
4075 N N   . PRO C 73  ? 0.6432 0.5283 0.3700 0.0376  0.0420  -0.0453 80  PRO C N   
4076 C CA  . PRO C 73  ? 0.6407 0.5207 0.3574 0.0347  0.0376  -0.0449 80  PRO C CA  
4077 C C   . PRO C 73  ? 0.6377 0.5204 0.3600 0.0322  0.0323  -0.0408 80  PRO C C   
4078 O O   . PRO C 73  ? 0.5975 0.4831 0.3303 0.0326  0.0301  -0.0398 80  PRO C O   
4079 C CB  . PRO C 73  ? 0.6806 0.5536 0.3926 0.0352  0.0350  -0.0488 80  PRO C CB  
4080 C CG  . PRO C 73  ? 0.6637 0.5373 0.3799 0.0387  0.0399  -0.0520 80  PRO C CG  
4081 C CD  . PRO C 73  ? 0.6713 0.5529 0.3980 0.0401  0.0438  -0.0495 80  PRO C CD  
4082 N N   . ASP C 74  ? 0.5762 0.4582 0.2919 0.0296  0.0305  -0.0385 81  ASP C N   
4083 C CA  . ASP C 74  ? 0.6040 0.4886 0.3245 0.0271  0.0258  -0.0344 81  ASP C CA  
4084 C C   . ASP C 74  ? 0.5702 0.4486 0.2855 0.0250  0.0197  -0.0350 81  ASP C C   
4085 O O   . ASP C 74  ? 0.5936 0.4691 0.3012 0.0224  0.0169  -0.0335 81  ASP C O   
4086 C CB  . ASP C 74  ? 0.6178 0.5055 0.3352 0.0254  0.0272  -0.0310 81  ASP C CB  
4087 C CG  . ASP C 74  ? 0.6534 0.5456 0.3793 0.0235  0.0236  -0.0266 81  ASP C CG  
4088 O OD1 . ASP C 74  ? 0.5841 0.4746 0.3138 0.0225  0.0186  -0.0261 81  ASP C OD1 
4089 O OD2 . ASP C 74  ? 0.6842 0.5814 0.4131 0.0231  0.0257  -0.0237 81  ASP C OD2 
4090 N N   . TYR C 75  ? 0.5653 0.4419 0.2856 0.0261  0.0176  -0.0368 82  TYR C N   
4091 C CA  . TYR C 75  ? 0.5665 0.4371 0.2831 0.0245  0.0119  -0.0379 82  TYR C CA  
4092 C C   . TYR C 75  ? 0.5720 0.4419 0.2874 0.0212  0.0063  -0.0343 82  TYR C C   
4093 O O   . TYR C 75  ? 0.5710 0.4351 0.2778 0.0192  0.0026  -0.0350 82  TYR C O   
4094 C CB  . TYR C 75  ? 0.5609 0.4325 0.2875 0.0262  0.0105  -0.0390 82  TYR C CB  
4095 C CG  . TYR C 75  ? 0.5407 0.4070 0.2665 0.0248  0.0045  -0.0397 82  TYR C CG  
4096 C CD1 . TYR C 75  ? 0.5465 0.4059 0.2639 0.0251  0.0035  -0.0434 82  TYR C CD1 
4097 C CD2 . TYR C 75  ? 0.5473 0.4158 0.2815 0.0233  0.0000  -0.0366 82  TYR C CD2 
4098 C CE1 . TYR C 75  ? 0.5341 0.3890 0.2513 0.0238  -0.0019 -0.0439 82  TYR C CE1 
4099 C CE2 . TYR C 75  ? 0.5543 0.4185 0.2889 0.0223  -0.0052 -0.0371 82  TYR C CE2 
4100 C CZ  . TYR C 75  ? 0.5432 0.4004 0.2690 0.0224  -0.0064 -0.0407 82  TYR C CZ  
4101 O OH  . TYR C 75  ? 0.5308 0.3833 0.2565 0.0211  -0.0119 -0.0411 82  TYR C OH  
4102 N N   . LEU C 76  ? 0.5566 0.4324 0.2814 0.0205  0.0056  -0.0305 83  LEU C N   
4103 C CA  . LEU C 76  ? 0.5366 0.4120 0.2616 0.0174  0.0004  -0.0269 83  LEU C CA  
4104 C C   . LEU C 76  ? 0.5496 0.4240 0.2649 0.0153  0.0007  -0.0252 83  LEU C C   
4105 O O   . LEU C 76  ? 0.5848 0.4557 0.2949 0.0125  -0.0039 -0.0236 83  LEU C O   
4106 C CB  . LEU C 76  ? 0.5149 0.3963 0.2533 0.0175  -0.0007 -0.0235 83  LEU C CB  
4107 C CG  . LEU C 76  ? 0.5074 0.3890 0.2542 0.0192  -0.0015 -0.0252 83  LEU C CG  
4108 C CD1 . LEU C 76  ? 0.5013 0.3888 0.2605 0.0195  -0.0016 -0.0222 83  LEU C CD1 
4109 C CD2 . LEU C 76  ? 0.5117 0.3876 0.2559 0.0180  -0.0069 -0.0261 83  LEU C CD2 
4110 N N   . LYS C 77  ? 0.5589 0.4361 0.2714 0.0166  0.0063  -0.0256 84  LYS C N   
4111 C CA  . LYS C 77  ? 0.6069 0.4823 0.3088 0.0148  0.0071  -0.0248 84  LYS C CA  
4112 C C   . LYS C 77  ? 0.6279 0.4953 0.3165 0.0142  0.0062  -0.0282 84  LYS C C   
4113 O O   . LYS C 77  ? 0.6490 0.5124 0.3280 0.0115  0.0034  -0.0271 84  LYS C O   
4114 C CB  . LYS C 77  ? 0.6211 0.5014 0.3236 0.0165  0.0137  -0.0245 84  LYS C CB  
4115 C CG  . LYS C 77  ? 0.5851 0.4721 0.2957 0.0156  0.0139  -0.0201 84  LYS C CG  
4116 C CD  . LYS C 77  ? 0.5807 0.4714 0.2886 0.0164  0.0196  -0.0193 84  LYS C CD  
4117 C CE  . LYS C 77  ? 0.5731 0.4710 0.2913 0.0162  0.0204  -0.0154 84  LYS C CE  
4118 N NZ  . LYS C 77  ? 0.5499 0.4514 0.2803 0.0184  0.0210  -0.0159 84  LYS C NZ  
4119 N N   . LEU C 78  ? 0.6540 0.5185 0.3415 0.0165  0.0082  -0.0324 85  LEU C N   
4120 C CA  . LEU C 78  ? 0.6495 0.5057 0.3238 0.0160  0.0073  -0.0360 85  LEU C CA  
4121 C C   . LEU C 78  ? 0.6574 0.5082 0.3287 0.0132  -0.0002 -0.0352 85  LEU C C   
4122 O O   . LEU C 78  ? 0.6942 0.5383 0.3530 0.0111  -0.0025 -0.0362 85  LEU C O   
4123 C CB  . LEU C 78  ? 0.6613 0.5158 0.3364 0.0193  0.0110  -0.0406 85  LEU C CB  
4124 C CG  . LEU C 78  ? 0.6588 0.5172 0.3346 0.0222  0.0188  -0.0420 85  LEU C CG  
4125 C CD1 . LEU C 78  ? 0.6528 0.5116 0.3350 0.0254  0.0214  -0.0454 85  LEU C CD1 
4126 C CD2 . LEU C 78  ? 0.6520 0.5061 0.3135 0.0218  0.0222  -0.0440 85  LEU C CD2 
4127 N N   . SER C 79  ? 0.6141 0.4677 0.2967 0.0128  -0.0042 -0.0330 86  SER C N   
4128 C CA  . SER C 79  ? 0.6018 0.4508 0.2836 0.0103  -0.0114 -0.0319 86  SER C CA  
4129 C C   . SER C 79  ? 0.6030 0.4489 0.2767 0.0065  -0.0158 -0.0289 86  SER C C   
4130 O O   . SER C 79  ? 0.6074 0.4479 0.2771 0.0044  -0.0215 -0.0288 86  SER C O   
4131 C CB  . SER C 79  ? 0.5936 0.4471 0.2899 0.0105  -0.0144 -0.0293 86  SER C CB  
4132 O OG  . SER C 79  ? 0.5563 0.4145 0.2577 0.0087  -0.0158 -0.0248 86  SER C OG  
4133 N N   . PHE C 80  ? 0.6362 0.4857 0.3079 0.0056  -0.0134 -0.0263 87  PHE C N   
4134 C CA  . PHE C 80  ? 0.6528 0.5004 0.3190 0.0019  -0.0180 -0.0228 87  PHE C CA  
4135 C C   . PHE C 80  ? 0.6850 0.5251 0.3342 0.0003  -0.0182 -0.0250 87  PHE C C   
4136 O O   . PHE C 80  ? 0.7060 0.5447 0.3487 0.0024  -0.0128 -0.0286 87  PHE C O   
4137 C CB  . PHE C 80  ? 0.6494 0.5043 0.3220 0.0015  -0.0159 -0.0188 87  PHE C CB  
4138 C CG  . PHE C 80  ? 0.6544 0.5155 0.3428 0.0023  -0.0171 -0.0161 87  PHE C CG  
4139 C CD1 . PHE C 80  ? 0.6533 0.5140 0.3472 0.0000  -0.0234 -0.0128 87  PHE C CD1 
4140 C CD2 . PHE C 80  ? 0.6450 0.5121 0.3425 0.0054  -0.0120 -0.0169 87  PHE C CD2 
4141 C CE1 . PHE C 80  ? 0.6454 0.5114 0.3531 0.0007  -0.0243 -0.0104 87  PHE C CE1 
4142 C CE2 . PHE C 80  ? 0.6475 0.5198 0.3588 0.0060  -0.0131 -0.0145 87  PHE C CE2 
4143 C CZ  . PHE C 80  ? 0.6299 0.5016 0.3461 0.0037  -0.0191 -0.0114 87  PHE C CZ  
4144 N N   . PRO C 81  ? 0.7450 0.5804 0.3871 -0.0033 -0.0240 -0.0229 88  PRO C N   
4145 C CA  . PRO C 81  ? 0.7440 0.5822 0.3932 -0.0060 -0.0294 -0.0177 88  PRO C CA  
4146 C C   . PRO C 81  ? 0.7364 0.5733 0.3939 -0.0068 -0.0355 -0.0166 88  PRO C C   
4147 O O   . PRO C 81  ? 0.7304 0.5712 0.3976 -0.0082 -0.0390 -0.0124 88  PRO C O   
4148 C CB  . PRO C 81  ? 0.7885 0.6215 0.4241 -0.0097 -0.0324 -0.0162 88  PRO C CB  
4149 C CG  . PRO C 81  ? 0.7853 0.6099 0.4071 -0.0094 -0.0319 -0.0210 88  PRO C CG  
4150 C CD  . PRO C 81  ? 0.7943 0.6217 0.4192 -0.0051 -0.0246 -0.0251 88  PRO C CD  
4151 N N   . GLU C 82  ? 0.7416 0.5733 0.3961 -0.0057 -0.0366 -0.0204 89  GLU C N   
4152 C CA  . GLU C 82  ? 0.7107 0.5416 0.3743 -0.0059 -0.0417 -0.0199 89  GLU C CA  
4153 C C   . GLU C 82  ? 0.6736 0.5127 0.3539 -0.0040 -0.0400 -0.0176 89  GLU C C   
4154 O O   . GLU C 82  ? 0.6668 0.5076 0.3561 -0.0054 -0.0446 -0.0143 89  GLU C O   
4155 C CB  . GLU C 82  ? 0.7371 0.5624 0.3966 -0.0042 -0.0415 -0.0248 89  GLU C CB  
4156 C CG  . GLU C 82  ? 0.8150 0.6308 0.4580 -0.0062 -0.0440 -0.0274 89  GLU C CG  
4157 C CD  . GLU C 82  ? 0.8840 0.6978 0.5152 -0.0046 -0.0375 -0.0310 89  GLU C CD  
4158 O OE1 . GLU C 82  ? 0.8788 0.6989 0.5135 -0.0027 -0.0315 -0.0306 89  GLU C OE1 
4159 O OE2 . GLU C 82  ? 0.9669 0.7726 0.5851 -0.0053 -0.0385 -0.0344 89  GLU C OE2 
4160 N N   . GLY C 83  ? 0.6230 0.4670 0.3073 -0.0008 -0.0334 -0.0195 90  GLY C N   
4161 C CA  . GLY C 83  ? 0.5816 0.4330 0.2811 0.0011  -0.0314 -0.0179 90  GLY C CA  
4162 C C   . GLY C 83  ? 0.5495 0.4008 0.2564 0.0034  -0.0314 -0.0203 90  GLY C C   
4163 O O   . GLY C 83  ? 0.5598 0.4062 0.2608 0.0046  -0.0309 -0.0243 90  GLY C O   
4164 N N   . PHE C 84  ? 0.5367 0.3937 0.2571 0.0041  -0.0318 -0.0178 91  PHE C N   
4165 C CA  . PHE C 84  ? 0.5277 0.3860 0.2567 0.0063  -0.0311 -0.0195 91  PHE C CA  
4166 C C   . PHE C 84  ? 0.4984 0.3600 0.2397 0.0055  -0.0347 -0.0158 91  PHE C C   
4167 O O   . PHE C 84  ? 0.4892 0.3527 0.2328 0.0035  -0.0369 -0.0121 91  PHE C O   
4168 C CB  . PHE C 84  ? 0.5391 0.4023 0.2722 0.0096  -0.0243 -0.0214 91  PHE C CB  
4169 C CG  . PHE C 84  ? 0.5375 0.4076 0.2775 0.0098  -0.0215 -0.0183 91  PHE C CG  
4170 C CD1 . PHE C 84  ? 0.5546 0.4261 0.2887 0.0093  -0.0188 -0.0174 91  PHE C CD1 
4171 C CD2 . PHE C 84  ? 0.5460 0.4213 0.2988 0.0107  -0.0214 -0.0163 91  PHE C CD2 
4172 C CE1 . PHE C 84  ? 0.5703 0.4480 0.3106 0.0094  -0.0163 -0.0146 91  PHE C CE1 
4173 C CE2 . PHE C 84  ? 0.5633 0.4445 0.3221 0.0109  -0.0189 -0.0134 91  PHE C CE2 
4174 C CZ  . PHE C 84  ? 0.5631 0.4456 0.3159 0.0102  -0.0165 -0.0125 91  PHE C CZ  
4175 N N   . LYS C 85  ? 0.4945 0.3566 0.2433 0.0071  -0.0350 -0.0170 92  LYS C N   
4176 C CA  . LYS C 85  ? 0.5265 0.3919 0.2875 0.0067  -0.0376 -0.0140 92  LYS C CA  
4177 C C   . LYS C 85  ? 0.4885 0.3591 0.2583 0.0097  -0.0328 -0.0151 92  LYS C C   
4178 O O   . LYS C 85  ? 0.5000 0.3699 0.2668 0.0119  -0.0293 -0.0187 92  LYS C O   
4179 C CB  . LYS C 85  ? 0.5605 0.4210 0.3221 0.0057  -0.0429 -0.0145 92  LYS C CB  
4180 C CG  . LYS C 85  ? 0.6037 0.4584 0.3576 0.0025  -0.0489 -0.0132 92  LYS C CG  
4181 C CD  . LYS C 85  ? 0.6055 0.4563 0.3627 0.0019  -0.0538 -0.0135 92  LYS C CD  
4182 C CE  . LYS C 85  ? 0.6661 0.5098 0.4150 -0.0010 -0.0601 -0.0131 92  LYS C CE  
4183 N NZ  . LYS C 85  ? 0.6877 0.5325 0.4387 -0.0040 -0.0640 -0.0083 92  LYS C NZ  
4184 N N   . TRP C 86  ? 0.4632 0.3386 0.2440 0.0098  -0.0328 -0.0121 93  TRP C N   
4185 C CA  . TRP C 86  ? 0.4470 0.3261 0.2359 0.0124  -0.0293 -0.0134 93  TRP C CA  
4186 C C   . TRP C 86  ? 0.4182 0.2993 0.2184 0.0122  -0.0318 -0.0110 93  TRP C C   
4187 O O   . TRP C 86  ? 0.4074 0.2879 0.2104 0.0101  -0.0359 -0.0079 93  TRP C O   
4188 C CB  . TRP C 86  ? 0.4651 0.3493 0.2556 0.0139  -0.0238 -0.0133 93  TRP C CB  
4189 C CG  . TRP C 86  ? 0.4387 0.3268 0.2322 0.0127  -0.0235 -0.0097 93  TRP C CG  
4190 C CD1 . TRP C 86  ? 0.4458 0.3340 0.2325 0.0116  -0.0226 -0.0088 93  TRP C CD1 
4191 C CD2 . TRP C 86  ? 0.4289 0.3216 0.2328 0.0127  -0.0232 -0.0067 93  TRP C CD2 
4192 N NE1 . TRP C 86  ? 0.4528 0.3451 0.2450 0.0107  -0.0224 -0.0053 93  TRP C NE1 
4193 C CE2 . TRP C 86  ? 0.4290 0.3240 0.2318 0.0115  -0.0226 -0.0040 93  TRP C CE2 
4194 C CE3 . TRP C 86  ? 0.4292 0.3237 0.2429 0.0135  -0.0237 -0.0058 93  TRP C CE3 
4195 C CZ2 . TRP C 86  ? 0.4129 0.3121 0.2242 0.0111  -0.0224 -0.0008 93  TRP C CZ2 
4196 C CZ3 . TRP C 86  ? 0.4197 0.3183 0.2413 0.0132  -0.0231 -0.0028 93  TRP C CZ3 
4197 C CH2 . TRP C 86  ? 0.4226 0.3233 0.2430 0.0121  -0.0225 -0.0003 93  TRP C CH2 
4198 N N   . GLU C 87  ? 0.4360 0.3184 0.2418 0.0142  -0.0298 -0.0127 94  GLU C N   
4199 C CA  . GLU C 87  ? 0.4358 0.3195 0.2512 0.0143  -0.0316 -0.0111 94  GLU C CA  
4200 C C   . GLU C 87  ? 0.4089 0.2975 0.2311 0.0164  -0.0270 -0.0115 94  GLU C C   
4201 O O   . GLU C 87  ? 0.4355 0.3242 0.2551 0.0183  -0.0237 -0.0144 94  GLU C O   
4202 C CB  . GLU C 87  ? 0.4871 0.3666 0.3018 0.0144  -0.0346 -0.0131 94  GLU C CB  
4203 C CG  . GLU C 87  ? 0.5523 0.4262 0.3586 0.0124  -0.0390 -0.0134 94  GLU C CG  
4204 C CD  . GLU C 87  ? 0.6215 0.4911 0.4287 0.0120  -0.0430 -0.0145 94  GLU C CD  
4205 O OE1 . GLU C 87  ? 0.6709 0.5424 0.4860 0.0134  -0.0421 -0.0148 94  GLU C OE1 
4206 O OE2 . GLU C 87  ? 0.7196 0.5839 0.5194 0.0103  -0.0470 -0.0150 94  GLU C OE2 
4207 N N   . ARG C 88  ? 0.3904 0.2828 0.2210 0.0162  -0.0266 -0.0086 95  ARG C N   
4208 C CA  . ARG C 88  ? 0.3722 0.2690 0.2087 0.0180  -0.0223 -0.0087 95  ARG C CA  
4209 C C   . ARG C 88  ? 0.3544 0.2529 0.2007 0.0182  -0.0230 -0.0069 95  ARG C C   
4210 O O   . ARG C 88  ? 0.3599 0.2580 0.2101 0.0167  -0.0263 -0.0042 95  ARG C O   
4211 C CB  . ARG C 88  ? 0.3507 0.2511 0.1870 0.0176  -0.0199 -0.0066 95  ARG C CB  
4212 C CG  . ARG C 88  ? 0.3674 0.2724 0.2100 0.0190  -0.0159 -0.0061 95  ARG C CG  
4213 C CD  . ARG C 88  ? 0.3787 0.2863 0.2194 0.0183  -0.0141 -0.0042 95  ARG C CD  
4214 N NE  . ARG C 88  ? 0.3933 0.3000 0.2254 0.0188  -0.0122 -0.0064 95  ARG C NE  
4215 C CZ  . ARG C 88  ? 0.4433 0.3515 0.2714 0.0181  -0.0109 -0.0052 95  ARG C CZ  
4216 N NH1 . ARG C 88  ? 0.4367 0.3472 0.2685 0.0169  -0.0115 -0.0020 95  ARG C NH1 
4217 N NH2 . ARG C 88  ? 0.4452 0.3523 0.2655 0.0186  -0.0089 -0.0073 95  ARG C NH2 
4218 N N   . VAL C 89  ? 0.3363 0.2365 0.1864 0.0200  -0.0203 -0.0084 96  VAL C N   
4219 C CA  . VAL C 89  ? 0.3507 0.2532 0.2096 0.0204  -0.0197 -0.0068 96  VAL C CA  
4220 C C   . VAL C 89  ? 0.3561 0.2626 0.2180 0.0215  -0.0155 -0.0066 96  VAL C C   
4221 O O   . VAL C 89  ? 0.3606 0.2678 0.2194 0.0229  -0.0125 -0.0088 96  VAL C O   
4222 C CB  . VAL C 89  ? 0.3487 0.2493 0.2099 0.0213  -0.0206 -0.0087 96  VAL C CB  
4223 C CG1 . VAL C 89  ? 0.3654 0.2682 0.2353 0.0218  -0.0197 -0.0072 96  VAL C CG1 
4224 C CG2 . VAL C 89  ? 0.3939 0.2901 0.2515 0.0201  -0.0251 -0.0092 96  VAL C CG2 
4225 N N   . MET C 90  ? 0.3333 0.2421 0.2017 0.0210  -0.0152 -0.0038 97  MET C N   
4226 C CA  . MET C 90  ? 0.3536 0.2658 0.2256 0.0219  -0.0115 -0.0034 97  MET C CA  
4227 C C   . MET C 90  ? 0.3240 0.2368 0.2034 0.0223  -0.0113 -0.0024 97  MET C C   
4228 O O   . MET C 90  ? 0.3382 0.2509 0.2221 0.0212  -0.0133 -0.0001 97  MET C O   
4229 C CB  . MET C 90  ? 0.3422 0.2566 0.2148 0.0210  -0.0108 -0.0008 97  MET C CB  
4230 C CG  . MET C 90  ? 0.3970 0.3105 0.2627 0.0201  -0.0118 -0.0008 97  MET C CG  
4231 S SD  . MET C 90  ? 0.4923 0.4083 0.3596 0.0188  -0.0115 0.0024  97  MET C SD  
4232 C CE  . MET C 90  ? 0.4533 0.3726 0.3199 0.0202  -0.0067 0.0013  97  MET C CE  
4233 N N   . ASN C 91  ? 0.3111 0.2247 0.1920 0.0236  -0.0090 -0.0041 98  ASN C N   
4234 C CA  . ASN C 91  ? 0.3077 0.2222 0.1951 0.0240  -0.0081 -0.0032 98  ASN C CA  
4235 C C   . ASN C 91  ? 0.3169 0.2342 0.2067 0.0245  -0.0047 -0.0025 98  ASN C C   
4236 O O   . ASN C 91  ? 0.3050 0.2233 0.1927 0.0254  -0.0024 -0.0040 98  ASN C O   
4237 C CB  . ASN C 91  ? 0.3007 0.2138 0.1883 0.0250  -0.0082 -0.0055 98  ASN C CB  
4238 C CG  . ASN C 91  ? 0.3196 0.2298 0.2074 0.0244  -0.0119 -0.0056 98  ASN C CG  
4239 O OD1 . ASN C 91  ? 0.3158 0.2257 0.2076 0.0233  -0.0138 -0.0033 98  ASN C OD1 
4240 N ND2 . ASN C 91  ? 0.3280 0.2358 0.2113 0.0249  -0.0131 -0.0081 98  ASN C ND2 
4241 N N   . PHE C 92  ? 0.3377 0.2559 0.2323 0.0238  -0.0045 0.0000  99  PHE C N   
4242 C CA  . PHE C 92  ? 0.3295 0.2499 0.2265 0.0241  -0.0015 0.0007  99  PHE C CA  
4243 C C   . PHE C 92  ? 0.3509 0.2712 0.2515 0.0248  0.0000  0.0003  99  PHE C C   
4244 O O   . PHE C 92  ? 0.3449 0.2638 0.2482 0.0247  -0.0014 0.0003  99  PHE C O   
4245 C CB  . PHE C 92  ? 0.3365 0.2577 0.2366 0.0231  -0.0018 0.0035  99  PHE C CB  
4246 C CG  . PHE C 92  ? 0.3217 0.2432 0.2178 0.0223  -0.0031 0.0042  99  PHE C CG  
4247 C CD1 . PHE C 92  ? 0.3443 0.2641 0.2383 0.0214  -0.0063 0.0045  99  PHE C CD1 
4248 C CD2 . PHE C 92  ? 0.3646 0.2880 0.2587 0.0223  -0.0011 0.0046  99  PHE C CD2 
4249 C CE1 . PHE C 92  ? 0.3375 0.2573 0.2273 0.0205  -0.0076 0.0051  99  PHE C CE1 
4250 C CE2 . PHE C 92  ? 0.3463 0.2700 0.2365 0.0214  -0.0023 0.0054  99  PHE C CE2 
4251 C CZ  . PHE C 92  ? 0.3701 0.2919 0.2577 0.0205  -0.0055 0.0056  99  PHE C CZ  
4252 N N   . GLU C 93  ? 0.3096 0.2314 0.2103 0.0252  0.0026  0.0001  100 GLU C N   
4253 C CA  . GLU C 93  ? 0.3524 0.2740 0.2556 0.0258  0.0043  -0.0004 100 GLU C CA  
4254 C C   . GLU C 93  ? 0.3262 0.2471 0.2345 0.0254  0.0042  0.0010  100 GLU C C   
4255 O O   . GLU C 93  ? 0.3624 0.2823 0.2725 0.0257  0.0045  0.0004  100 GLU C O   
4256 C CB  . GLU C 93  ? 0.3545 0.2776 0.2565 0.0261  0.0069  -0.0007 100 GLU C CB  
4257 C CG  . GLU C 93  ? 0.3827 0.3067 0.2865 0.0255  0.0082  0.0012  100 GLU C CG  
4258 C CD  . GLU C 93  ? 0.4336 0.3588 0.3366 0.0257  0.0106  0.0010  100 GLU C CD  
4259 O OE1 . GLU C 93  ? 0.3976 0.3242 0.2976 0.0260  0.0112  0.0004  100 GLU C OE1 
4260 O OE2 . GLU C 93  ? 0.5366 0.4611 0.4422 0.0256  0.0118  0.0016  100 GLU C OE2 
4261 N N   . ASP C 94  ? 0.3363 0.2574 0.2471 0.0247  0.0039  0.0031  101 ASP C N   
4262 C CA  . ASP C 94  ? 0.3340 0.2544 0.2501 0.0244  0.0042  0.0048  101 ASP C CA  
4263 C C   . ASP C 94  ? 0.3525 0.2718 0.2715 0.0239  0.0014  0.0057  101 ASP C C   
4264 O O   . ASP C 94  ? 0.3771 0.2962 0.3011 0.0236  0.0015  0.0076  101 ASP C O   
4265 C CB  . ASP C 94  ? 0.3204 0.2417 0.2389 0.0240  0.0059  0.0067  101 ASP C CB  
4266 C CG  . ASP C 94  ? 0.3664 0.2884 0.2847 0.0233  0.0043  0.0081  101 ASP C CG  
4267 O OD1 . ASP C 94  ? 0.3436 0.2654 0.2586 0.0231  0.0020  0.0074  101 ASP C OD1 
4268 O OD2 . ASP C 94  ? 0.3725 0.2950 0.2938 0.0229  0.0053  0.0100  101 ASP C OD2 
4269 N N   . GLY C 95  ? 0.3592 0.2777 0.2750 0.0239  -0.0010 0.0044  102 GLY C N   
4270 C CA  . GLY C 95  ? 0.3539 0.2710 0.2718 0.0234  -0.0042 0.0052  102 GLY C CA  
4271 C C   . GLY C 95  ? 0.3371 0.2540 0.2540 0.0224  -0.0068 0.0065  102 GLY C C   
4272 O O   . GLY C 95  ? 0.3237 0.2392 0.2413 0.0218  -0.0100 0.0070  102 GLY C O   
4273 N N   . GLY C 96  ? 0.3350 0.2532 0.2503 0.0221  -0.0058 0.0073  103 GLY C N   
4274 C CA  . GLY C 96  ? 0.3017 0.2197 0.2154 0.0211  -0.0082 0.0085  103 GLY C CA  
4275 C C   . GLY C 96  ? 0.3371 0.2536 0.2445 0.0210  -0.0105 0.0065  103 GLY C C   
4276 O O   . GLY C 96  ? 0.3214 0.2378 0.2246 0.0219  -0.0092 0.0040  103 GLY C O   
4277 N N   . VAL C 97  ? 0.3081 0.2232 0.2149 0.0198  -0.0140 0.0077  104 VAL C N   
4278 C CA  . VAL C 97  ? 0.3208 0.2338 0.2213 0.0195  -0.0165 0.0060  104 VAL C CA  
4279 C C   . VAL C 97  ? 0.3365 0.2490 0.2341 0.0181  -0.0189 0.0075  104 VAL C C   
4280 O O   . VAL C 97  ? 0.3425 0.2550 0.2443 0.0169  -0.0210 0.0103  104 VAL C O   
4281 C CB  . VAL C 97  ? 0.3163 0.2268 0.2187 0.0193  -0.0195 0.0057  104 VAL C CB  
4282 C CG1 . VAL C 97  ? 0.3292 0.2370 0.2248 0.0187  -0.0225 0.0041  104 VAL C CG1 
4283 C CG2 . VAL C 97  ? 0.3116 0.2225 0.2163 0.0206  -0.0173 0.0041  104 VAL C CG2 
4284 N N   . VAL C 98  ? 0.3259 0.2377 0.2157 0.0181  -0.0189 0.0057  105 VAL C N   
4285 C CA  . VAL C 98  ? 0.3272 0.2379 0.2129 0.0167  -0.0215 0.0068  105 VAL C CA  
4286 C C   . VAL C 98  ? 0.3494 0.2570 0.2276 0.0164  -0.0236 0.0044  105 VAL C C   
4287 O O   . VAL C 98  ? 0.3544 0.2618 0.2280 0.0177  -0.0214 0.0015  105 VAL C O   
4288 C CB  . VAL C 98  ? 0.3423 0.2553 0.2253 0.0165  -0.0192 0.0074  105 VAL C CB  
4289 C CG1 . VAL C 98  ? 0.3622 0.2736 0.2398 0.0149  -0.0222 0.0084  105 VAL C CG1 
4290 C CG2 . VAL C 98  ? 0.3321 0.2476 0.2226 0.0164  -0.0177 0.0101  105 VAL C CG2 
4291 N N   . THR C 99  ? 0.3260 0.2309 0.2032 0.0149  -0.0279 0.0056  106 THR C N   
4292 C CA  . THR C 99  ? 0.3623 0.2636 0.2312 0.0145  -0.0302 0.0034  106 THR C CA  
4293 C C   . THR C 99  ? 0.3823 0.2825 0.2463 0.0126  -0.0325 0.0049  106 THR C C   
4294 O O   . THR C 99  ? 0.3683 0.2695 0.2367 0.0112  -0.0344 0.0083  106 THR C O   
4295 C CB  . THR C 99  ? 0.4037 0.3017 0.2738 0.0141  -0.0338 0.0028  106 THR C CB  
4296 O OG1 . THR C 99  ? 0.4139 0.3113 0.2891 0.0123  -0.0375 0.0062  106 THR C OG1 
4297 C CG2 . THR C 99  ? 0.3999 0.2989 0.2750 0.0157  -0.0317 0.0015  106 THR C CG2 
4298 N N   . VAL C 100 ? 0.3636 0.2616 0.2183 0.0126  -0.0325 0.0026  107 VAL C N   
4299 C CA  . VAL C 100 ? 0.3828 0.2800 0.2314 0.0110  -0.0338 0.0038  107 VAL C CA  
4300 C C   . VAL C 100 ? 0.3929 0.2854 0.2318 0.0103  -0.0362 0.0014  107 VAL C C   
4301 O O   . VAL C 100 ? 0.4232 0.3143 0.2582 0.0118  -0.0345 -0.0019 107 VAL C O   
4302 C CB  . VAL C 100 ? 0.3891 0.2893 0.2347 0.0119  -0.0295 0.0032  107 VAL C CB  
4303 C CG1 . VAL C 100 ? 0.4119 0.3118 0.2526 0.0100  -0.0310 0.0051  107 VAL C CG1 
4304 C CG2 . VAL C 100 ? 0.4089 0.3135 0.2629 0.0132  -0.0261 0.0043  107 VAL C CG2 
4305 N N   . THR C 101 ? 0.3978 0.2878 0.2327 0.0080  -0.0401 0.0033  108 THR C N   
4306 C CA  . THR C 101 ? 0.4330 0.3182 0.2570 0.0070  -0.0423 0.0012  108 THR C CA  
4307 C C   . THR C 101 ? 0.4443 0.3294 0.2619 0.0053  -0.0428 0.0028  108 THR C C   
4308 O O   . THR C 101 ? 0.4249 0.3123 0.2471 0.0039  -0.0440 0.0065  108 THR C O   
4309 C CB  . THR C 101 ? 0.4531 0.3335 0.2768 0.0055  -0.0479 0.0015  108 THR C CB  
4310 O OG1 . THR C 101 ? 0.4647 0.3452 0.2929 0.0032  -0.0521 0.0057  108 THR C OG1 
4311 C CG2 . THR C 101 ? 0.4538 0.3345 0.2845 0.0071  -0.0476 0.0003  108 THR C CG2 
4312 N N   . GLN C 102 ? 0.4392 0.3214 0.2459 0.0054  -0.0418 0.0001  109 GLN C N   
4313 C CA  . GLN C 102 ? 0.4450 0.3275 0.2449 0.0041  -0.0412 0.0012  109 GLN C CA  
4314 C C   . GLN C 102 ? 0.4621 0.3389 0.2495 0.0029  -0.0431 -0.0010 109 GLN C C   
4315 O O   . GLN C 102 ? 0.4642 0.3382 0.2469 0.0043  -0.0419 -0.0046 109 GLN C O   
4316 C CB  . GLN C 102 ? 0.4522 0.3390 0.2518 0.0061  -0.0352 0.0000  109 GLN C CB  
4317 C CG  . GLN C 102 ? 0.4539 0.3430 0.2518 0.0048  -0.0345 0.0026  109 GLN C CG  
4318 C CD  . GLN C 102 ? 0.4783 0.3652 0.2641 0.0042  -0.0331 0.0010  109 GLN C CD  
4319 O OE1 . GLN C 102 ? 0.5268 0.4096 0.3048 0.0046  -0.0331 -0.0021 109 GLN C OE1 
4320 N NE2 . GLN C 102 ? 0.4670 0.3565 0.2513 0.0033  -0.0317 0.0032  109 GLN C NE2 
4321 N N   . ASP C 103 ? 0.4857 0.3609 0.2680 0.0004  -0.0459 0.0012  110 ASP C N   
4322 C CA  . ASP C 103 ? 0.5257 0.3955 0.2945 -0.0009 -0.0473 -0.0004 110 ASP C CA  
4323 C C   . ASP C 103 ? 0.5190 0.3908 0.2820 -0.0016 -0.0448 0.0005  110 ASP C C   
4324 O O   . ASP C 103 ? 0.5286 0.4037 0.2964 -0.0029 -0.0456 0.0043  110 ASP C O   
4325 C CB  . ASP C 103 ? 0.5710 0.4357 0.3372 -0.0039 -0.0543 0.0014  110 ASP C CB  
4326 C CG  . ASP C 103 ? 0.5886 0.4470 0.3400 -0.0054 -0.0559 -0.0007 110 ASP C CG  
4327 O OD1 . ASP C 103 ? 0.6569 0.5154 0.4015 -0.0066 -0.0549 0.0001  110 ASP C OD1 
4328 O OD2 . ASP C 103 ? 0.5836 0.4368 0.3302 -0.0054 -0.0581 -0.0033 110 ASP C OD2 
4329 N N   . SER C 104 ? 0.5024 0.3719 0.2548 -0.0007 -0.0415 -0.0027 111 SER C N   
4330 C CA  . SER C 104 ? 0.5102 0.3815 0.2564 -0.0010 -0.0383 -0.0022 111 SER C CA  
4331 C C   . SER C 104 ? 0.5258 0.3905 0.2574 -0.0028 -0.0402 -0.0039 111 SER C C   
4332 O O   . SER C 104 ? 0.5465 0.4071 0.2720 -0.0018 -0.0394 -0.0077 111 SER C O   
4333 C CB  . SER C 104 ? 0.4995 0.3745 0.2466 0.0021  -0.0314 -0.0050 111 SER C CB  
4334 O OG  . SER C 104 ? 0.4660 0.3469 0.2259 0.0037  -0.0293 -0.0036 111 SER C OG  
4335 N N   . SER C 105 ? 0.5373 0.4014 0.2640 -0.0055 -0.0423 -0.0010 112 SER C N   
4336 C CA  . SER C 105 ? 0.5775 0.4354 0.2894 -0.0076 -0.0440 -0.0022 112 SER C CA  
4337 C C   . SER C 105 ? 0.5816 0.4417 0.2879 -0.0086 -0.0415 -0.0003 112 SER C C   
4338 O O   . SER C 105 ? 0.5679 0.4343 0.2825 -0.0081 -0.0392 0.0023  112 SER C O   
4339 C CB  . SER C 105 ? 0.6046 0.4572 0.3144 -0.0108 -0.0516 -0.0001 112 SER C CB  
4340 O OG  . SER C 105 ? 0.6306 0.4864 0.3479 -0.0129 -0.0550 0.0048  112 SER C OG  
4341 N N   . LEU C 106 ? 0.6151 0.4700 0.3074 -0.0102 -0.0417 -0.0017 113 LEU C N   
4342 C CA  . LEU C 106 ? 0.6605 0.5170 0.3465 -0.0116 -0.0398 0.0002  113 LEU C CA  
4343 C C   . LEU C 106 ? 0.7030 0.5534 0.3790 -0.0157 -0.0459 0.0025  113 LEU C C   
4344 O O   . LEU C 106 ? 0.7484 0.5918 0.4135 -0.0168 -0.0481 0.0000  113 LEU C O   
4345 C CB  . LEU C 106 ? 0.6688 0.5251 0.3460 -0.0094 -0.0330 -0.0035 113 LEU C CB  
4346 C CG  . LEU C 106 ? 0.7183 0.5756 0.3872 -0.0107 -0.0303 -0.0019 113 LEU C CG  
4347 C CD1 . LEU C 106 ? 0.7015 0.5670 0.3809 -0.0098 -0.0271 0.0012  113 LEU C CD1 
4348 C CD2 . LEU C 106 ? 0.7520 0.6064 0.4094 -0.0090 -0.0247 -0.0062 113 LEU C CD2 
4349 N N   . GLN C 107 ? 0.7110 0.5642 0.3913 -0.0181 -0.0488 0.0072  114 GLN C N   
4350 C CA  . GLN C 107 ? 0.8116 0.6598 0.4831 -0.0222 -0.0547 0.0100  114 GLN C CA  
4351 C C   . GLN C 107 ? 0.7774 0.6295 0.4484 -0.0238 -0.0536 0.0138  114 GLN C C   
4352 O O   . GLN C 107 ? 0.6675 0.5265 0.3499 -0.0227 -0.0514 0.0163  114 GLN C O   
4353 C CB  . GLN C 107 ? 0.8745 0.7204 0.5528 -0.0244 -0.0623 0.0127  114 GLN C CB  
4354 C CG  . GLN C 107 ? 0.9150 0.7543 0.5889 -0.0242 -0.0653 0.0093  114 GLN C CG  
4355 C CD  . GLN C 107 ? 0.9170 0.7477 0.5734 -0.0268 -0.0679 0.0074  114 GLN C CD  
4356 O OE1 . GLN C 107 ? 0.9331 0.7598 0.5806 -0.0251 -0.0649 0.0027  114 GLN C OE1 
4357 N NE2 . GLN C 107 ? 0.9054 0.7331 0.5568 -0.0308 -0.0736 0.0112  114 GLN C NE2 
4358 N N   . ASP C 108 ? 0.7438 0.5911 0.4011 -0.0266 -0.0552 0.0144  115 ASP C N   
4359 C CA  . ASP C 108 ? 0.7572 0.6072 0.4121 -0.0287 -0.0548 0.0181  115 ASP C CA  
4360 C C   . ASP C 108 ? 0.7396 0.5968 0.3997 -0.0257 -0.0473 0.0175  115 ASP C C   
4361 O O   . ASP C 108 ? 0.7070 0.5697 0.3748 -0.0262 -0.0469 0.0214  115 ASP C O   
4362 C CB  . ASP C 108 ? 0.7856 0.6376 0.4501 -0.0314 -0.0611 0.0238  115 ASP C CB  
4363 C CG  . ASP C 108 ? 0.8484 0.6933 0.5046 -0.0357 -0.0688 0.0258  115 ASP C CG  
4364 O OD1 . ASP C 108 ? 0.8431 0.6809 0.4872 -0.0364 -0.0702 0.0226  115 ASP C OD1 
4365 O OD2 . ASP C 108 ? 0.8164 0.6628 0.4787 -0.0383 -0.0737 0.0308  115 ASP C OD2 
4366 N N   . GLY C 109 ? 0.7309 0.5879 0.3871 -0.0225 -0.0414 0.0129  116 GLY C N   
4367 C CA  . GLY C 109 ? 0.7234 0.5868 0.3835 -0.0197 -0.0340 0.0121  116 GLY C CA  
4368 C C   . GLY C 109 ? 0.6876 0.5581 0.3644 -0.0173 -0.0324 0.0134  116 GLY C C   
4369 O O   . GLY C 109 ? 0.6866 0.5629 0.3681 -0.0155 -0.0273 0.0139  116 GLY C O   
4370 N N   . GLU C 110 ? 0.7007 0.5709 0.3865 -0.0172 -0.0365 0.0139  117 GLU C N   
4371 C CA  . GLU C 110 ? 0.6664 0.5430 0.3680 -0.0149 -0.0350 0.0149  117 GLU C CA  
4372 C C   . GLU C 110 ? 0.6604 0.5356 0.3672 -0.0128 -0.0354 0.0119  117 GLU C C   
4373 O O   . GLU C 110 ? 0.6447 0.5139 0.3453 -0.0139 -0.0391 0.0102  117 GLU C O   
4374 C CB  . GLU C 110 ? 0.6802 0.5592 0.3907 -0.0172 -0.0398 0.0201  117 GLU C CB  
4375 C CG  . GLU C 110 ? 0.7123 0.5944 0.4211 -0.0189 -0.0388 0.0236  117 GLU C CG  
4376 C CD  . GLU C 110 ? 0.7610 0.6475 0.4823 -0.0200 -0.0418 0.0283  117 GLU C CD  
4377 O OE1 . GLU C 110 ? 0.8068 0.6945 0.5389 -0.0190 -0.0437 0.0286  117 GLU C OE1 
4378 O OE2 . GLU C 110 ? 0.7658 0.6544 0.4863 -0.0218 -0.0421 0.0317  117 GLU C OE2 
4379 N N   . PHE C 111 ? 0.6084 0.4889 0.3265 -0.0100 -0.0320 0.0113  118 PHE C N   
4380 C CA  . PHE C 111 ? 0.6025 0.4820 0.3267 -0.0081 -0.0328 0.0089  118 PHE C CA  
4381 C C   . PHE C 111 ? 0.5819 0.4622 0.3162 -0.0097 -0.0382 0.0124  118 PHE C C   
4382 O O   . PHE C 111 ? 0.6053 0.4895 0.3467 -0.0106 -0.0390 0.0162  118 PHE C O   
4383 C CB  . PHE C 111 ? 0.5937 0.4781 0.3254 -0.0044 -0.0269 0.0066  118 PHE C CB  
4384 C CG  . PHE C 111 ? 0.5814 0.4654 0.3047 -0.0025 -0.0211 0.0029  118 PHE C CG  
4385 C CD1 . PHE C 111 ? 0.5811 0.4596 0.2953 -0.0018 -0.0208 -0.0010 118 PHE C CD1 
4386 C CD2 . PHE C 111 ? 0.5822 0.4715 0.3077 -0.0011 -0.0159 0.0036  118 PHE C CD2 
4387 C CE1 . PHE C 111 ? 0.5595 0.4377 0.2667 0.0000  -0.0153 -0.0043 118 PHE C CE1 
4388 C CE2 . PHE C 111 ? 0.5719 0.4612 0.2910 0.0007  -0.0104 0.0005  118 PHE C CE2 
4389 C CZ  . PHE C 111 ? 0.5990 0.4826 0.3088 0.0014  -0.0100 -0.0035 118 PHE C CZ  
4390 N N   . ILE C 112 ? 0.5540 0.4302 0.2888 -0.0100 -0.0420 0.0111  119 ILE C N   
4391 C CA  . ILE C 112 ? 0.5593 0.4359 0.3041 -0.0112 -0.0470 0.0141  119 ILE C CA  
4392 C C   . ILE C 112 ? 0.5370 0.4148 0.2902 -0.0084 -0.0456 0.0117  119 ILE C C   
4393 O O   . ILE C 112 ? 0.5229 0.3969 0.2714 -0.0074 -0.0455 0.0080  119 ILE C O   
4394 C CB  . ILE C 112 ? 0.5603 0.4307 0.2985 -0.0145 -0.0537 0.0155  119 ILE C CB  
4395 C CG1 . ILE C 112 ? 0.6135 0.4824 0.3421 -0.0173 -0.0550 0.0178  119 ILE C CG1 
4396 C CG2 . ILE C 112 ? 0.5509 0.4217 0.3001 -0.0156 -0.0589 0.0187  119 ILE C CG2 
4397 C CD1 . ILE C 112 ? 0.6119 0.4864 0.3479 -0.0180 -0.0543 0.0220  119 ILE C CD1 
4398 N N   . TYR C 113 ? 0.5206 0.4037 0.2865 -0.0073 -0.0445 0.0138  120 TYR C N   
4399 C CA  . TYR C 113 ? 0.5088 0.3932 0.2831 -0.0049 -0.0432 0.0120  120 TYR C CA  
4400 C C   . TYR C 113 ? 0.5130 0.3976 0.2975 -0.0061 -0.0480 0.0151  120 TYR C C   
4401 O O   . TYR C 113 ? 0.5188 0.4058 0.3090 -0.0076 -0.0498 0.0190  120 TYR C O   
4402 C CB  . TYR C 113 ? 0.4773 0.3679 0.2590 -0.0024 -0.0376 0.0118  120 TYR C CB  
4403 C CG  . TYR C 113 ? 0.5082 0.4001 0.2828 -0.0010 -0.0323 0.0094  120 TYR C CG  
4404 C CD1 . TYR C 113 ? 0.5011 0.3890 0.2648 -0.0006 -0.0311 0.0059  120 TYR C CD1 
4405 C CD2 . TYR C 113 ? 0.5539 0.4513 0.3337 0.0001  -0.0281 0.0106  120 TYR C CD2 
4406 C CE1 . TYR C 113 ? 0.5229 0.4123 0.2812 0.0010  -0.0258 0.0036  120 TYR C CE1 
4407 C CE2 . TYR C 113 ? 0.5624 0.4613 0.3365 0.0016  -0.0231 0.0085  120 TYR C CE2 
4408 C CZ  . TYR C 113 ? 0.5450 0.4401 0.3087 0.0020  -0.0218 0.0051  120 TYR C CZ  
4409 O OH  . TYR C 113 ? 0.5159 0.4128 0.2748 0.0036  -0.0165 0.0031  120 TYR C OH  
4410 N N   . LYS C 114 ? 0.5031 0.3855 0.2905 -0.0052 -0.0494 0.0133  121 LYS C N   
4411 C CA  . LYS C 114 ? 0.5012 0.3837 0.2985 -0.0060 -0.0534 0.0158  121 LYS C CA  
4412 C C   . LYS C 114 ? 0.4680 0.3528 0.2732 -0.0032 -0.0504 0.0137  121 LYS C C   
4413 O O   . LYS C 114 ? 0.4567 0.3391 0.2577 -0.0017 -0.0492 0.0100  121 LYS C O   
4414 C CB  . LYS C 114 ? 0.5379 0.4143 0.3299 -0.0084 -0.0596 0.0162  121 LYS C CB  
4415 C CG  . LYS C 114 ? 0.5913 0.4654 0.3768 -0.0116 -0.0634 0.0190  121 LYS C CG  
4416 C CD  . LYS C 114 ? 0.6594 0.5268 0.4378 -0.0139 -0.0692 0.0186  121 LYS C CD  
4417 C CE  . LYS C 114 ? 0.7134 0.5780 0.4849 -0.0174 -0.0736 0.0217  121 LYS C CE  
4418 N NZ  . LYS C 114 ? 0.7690 0.6270 0.5358 -0.0199 -0.0803 0.0221  121 LYS C NZ  
4419 N N   . VAL C 115 ? 0.4524 0.3416 0.2691 -0.0024 -0.0493 0.0161  122 VAL C N   
4420 C CA  . VAL C 115 ? 0.4443 0.3361 0.2687 0.0001  -0.0461 0.0144  122 VAL C CA  
4421 C C   . VAL C 115 ? 0.4275 0.3197 0.2626 -0.0003 -0.0492 0.0171  122 VAL C C   
4422 O O   . VAL C 115 ? 0.4466 0.3397 0.2867 -0.0022 -0.0520 0.0210  122 VAL C O   
4423 C CB  . VAL C 115 ? 0.4450 0.3420 0.2735 0.0018  -0.0408 0.0146  122 VAL C CB  
4424 C CG1 . VAL C 115 ? 0.4329 0.3321 0.2672 0.0045  -0.0370 0.0123  122 VAL C CG1 
4425 C CG2 . VAL C 115 ? 0.4655 0.3628 0.2847 0.0017  -0.0382 0.0134  122 VAL C CG2 
4426 N N   . LYS C 116 ? 0.4108 0.3025 0.2497 0.0011  -0.0487 0.0151  123 LYS C N   
4427 C CA  . LYS C 116 ? 0.4316 0.3243 0.2814 0.0012  -0.0504 0.0172  123 LYS C CA  
4428 C C   . LYS C 116 ? 0.4045 0.3005 0.2601 0.0039  -0.0455 0.0153  123 LYS C C   
4429 O O   . LYS C 116 ? 0.4087 0.3040 0.2594 0.0055  -0.0429 0.0117  123 LYS C O   
4430 C CB  . LYS C 116 ? 0.4475 0.3355 0.2957 0.0000  -0.0553 0.0168  123 LYS C CB  
4431 C CG  . LYS C 116 ? 0.5119 0.3961 0.3544 -0.0029 -0.0608 0.0188  123 LYS C CG  
4432 C CD  . LYS C 116 ? 0.6041 0.4830 0.4425 -0.0037 -0.0650 0.0172  123 LYS C CD  
4433 C CE  . LYS C 116 ? 0.6549 0.5296 0.4886 -0.0070 -0.0712 0.0196  123 LYS C CE  
4434 N NZ  . LYS C 116 ? 0.7172 0.5859 0.5418 -0.0076 -0.0741 0.0167  123 LYS C NZ  
4435 N N   . LEU C 117 ? 0.3658 0.2651 0.2316 0.0044  -0.0442 0.0177  124 LEU C N   
4436 C CA  . LEU C 117 ? 0.3802 0.2826 0.2511 0.0068  -0.0396 0.0162  124 LEU C CA  
4437 C C   . LEU C 117 ? 0.3636 0.2672 0.2454 0.0071  -0.0402 0.0182  124 LEU C C   
4438 O O   . LEU C 117 ? 0.3681 0.2721 0.2561 0.0057  -0.0427 0.0219  124 LEU C O   
4439 C CB  . LEU C 117 ? 0.3588 0.2647 0.2301 0.0074  -0.0357 0.0168  124 LEU C CB  
4440 C CG  . LEU C 117 ? 0.3553 0.2646 0.2323 0.0096  -0.0310 0.0159  124 LEU C CG  
4441 C CD1 . LEU C 117 ? 0.3591 0.2705 0.2310 0.0101  -0.0275 0.0149  124 LEU C CD1 
4442 C CD2 . LEU C 117 ? 0.3608 0.2722 0.2485 0.0095  -0.0309 0.0190  124 LEU C CD2 
4443 N N   . ARG C 118 ? 0.3792 0.2829 0.2631 0.0088  -0.0381 0.0160  125 ARG C N   
4444 C CA  . ARG C 118 ? 0.3616 0.2667 0.2555 0.0094  -0.0377 0.0176  125 ARG C CA  
4445 C C   . ARG C 118 ? 0.3416 0.2494 0.2383 0.0115  -0.0327 0.0159  125 ARG C C   
4446 O O   . ARG C 118 ? 0.3513 0.2584 0.2445 0.0129  -0.0310 0.0128  125 ARG C O   
4447 C CB  . ARG C 118 ? 0.4179 0.3198 0.3128 0.0088  -0.0416 0.0173  125 ARG C CB  
4448 C CG  . ARG C 118 ? 0.4311 0.3344 0.3368 0.0092  -0.0415 0.0194  125 ARG C CG  
4449 C CD  . ARG C 118 ? 0.4714 0.3723 0.3787 0.0093  -0.0438 0.0185  125 ARG C CD  
4450 N NE  . ARG C 118 ? 0.5274 0.4247 0.4312 0.0073  -0.0493 0.0193  125 ARG C NE  
4451 C CZ  . ARG C 118 ? 0.5068 0.4005 0.4033 0.0071  -0.0516 0.0167  125 ARG C CZ  
4452 N NH1 . ARG C 118 ? 0.5465 0.4367 0.4403 0.0050  -0.0569 0.0179  125 ARG C NH1 
4453 N NH2 . ARG C 118 ? 0.5304 0.4237 0.4223 0.0088  -0.0488 0.0130  125 ARG C NH2 
4454 N N   . GLY C 119 ? 0.3162 0.2267 0.2200 0.0119  -0.0305 0.0181  126 GLY C N   
4455 C CA  . GLY C 119 ? 0.3288 0.2417 0.2360 0.0136  -0.0260 0.0170  126 GLY C CA  
4456 C C   . GLY C 119 ? 0.3235 0.2367 0.2397 0.0139  -0.0260 0.0187  126 GLY C C   
4457 O O   . GLY C 119 ? 0.3329 0.2465 0.2553 0.0129  -0.0278 0.0219  126 GLY C O   
4458 N N   . THR C 120 ? 0.3127 0.2259 0.2300 0.0152  -0.0240 0.0168  127 THR C N   
4459 C CA  . THR C 120 ? 0.3050 0.2186 0.2307 0.0156  -0.0234 0.0182  127 THR C CA  
4460 C C   . THR C 120 ? 0.3044 0.2193 0.2313 0.0172  -0.0191 0.0166  127 THR C C   
4461 O O   . THR C 120 ? 0.3057 0.2209 0.2270 0.0181  -0.0171 0.0140  127 THR C O   
4462 C CB  . THR C 120 ? 0.3328 0.2439 0.2585 0.0150  -0.0272 0.0178  127 THR C CB  
4463 O OG1 . THR C 120 ? 0.3192 0.2289 0.2376 0.0158  -0.0269 0.0143  127 THR C OG1 
4464 C CG2 . THR C 120 ? 0.3412 0.2506 0.2658 0.0132  -0.0319 0.0197  127 THR C CG2 
4465 N N   . ASN C 121 ? 0.2762 0.1918 0.2104 0.0176  -0.0178 0.0181  128 ASN C N   
4466 C CA  . ASN C 121 ? 0.3535 0.2698 0.2894 0.0189  -0.0142 0.0168  128 ASN C CA  
4467 C C   . ASN C 121 ? 0.3054 0.2232 0.2389 0.0197  -0.0103 0.0158  128 ASN C C   
4468 O O   . ASN C 121 ? 0.3170 0.2351 0.2491 0.0206  -0.0077 0.0140  128 ASN C O   
4469 C CB  . ASN C 121 ? 0.3424 0.2573 0.2746 0.0194  -0.0149 0.0142  128 ASN C CB  
4470 C CG  . ASN C 121 ? 0.3723 0.2874 0.3083 0.0203  -0.0125 0.0138  128 ASN C CG  
4471 O OD1 . ASN C 121 ? 0.3995 0.3148 0.3422 0.0202  -0.0121 0.0159  128 ASN C OD1 
4472 N ND2 . ASN C 121 ? 0.3842 0.2991 0.3161 0.0212  -0.0108 0.0111  128 ASN C ND2 
4473 N N   . PHE C 122 ? 0.3076 0.2265 0.2413 0.0191  -0.0101 0.0174  129 PHE C N   
4474 C CA  . PHE C 122 ? 0.3058 0.2260 0.2387 0.0197  -0.0065 0.0170  129 PHE C CA  
4475 C C   . PHE C 122 ? 0.3047 0.2254 0.2443 0.0202  -0.0036 0.0185  129 PHE C C   
4476 O O   . PHE C 122 ? 0.3320 0.2527 0.2779 0.0197  -0.0047 0.0210  129 PHE C O   
4477 C CB  . PHE C 122 ? 0.3119 0.2331 0.2426 0.0189  -0.0074 0.0181  129 PHE C CB  
4478 C CG  . PHE C 122 ? 0.3178 0.2386 0.2406 0.0187  -0.0087 0.0162  129 PHE C CG  
4479 C CD1 . PHE C 122 ? 0.3063 0.2278 0.2243 0.0196  -0.0062 0.0138  129 PHE C CD1 
4480 C CD2 . PHE C 122 ? 0.3128 0.2325 0.2329 0.0176  -0.0124 0.0168  129 PHE C CD2 
4481 C CE1 . PHE C 122 ? 0.3040 0.2253 0.2149 0.0196  -0.0070 0.0120  129 PHE C CE1 
4482 C CE2 . PHE C 122 ? 0.3283 0.2475 0.2407 0.0175  -0.0133 0.0148  129 PHE C CE2 
4483 C CZ  . PHE C 122 ? 0.3201 0.2402 0.2280 0.0186  -0.0104 0.0124  129 PHE C CZ  
4484 N N   . PRO C 123 ? 0.3375 0.2584 0.2761 0.0212  -0.0002 0.0169  130 PRO C N   
4485 C CA  . PRO C 123 ? 0.3353 0.2561 0.2794 0.0216  0.0027  0.0180  130 PRO C CA  
4486 C C   . PRO C 123 ? 0.3595 0.2811 0.3071 0.0213  0.0035  0.0203  130 PRO C C   
4487 O O   . PRO C 123 ? 0.3197 0.2420 0.2638 0.0209  0.0031  0.0201  130 PRO C O   
4488 C CB  . PRO C 123 ? 0.3451 0.2657 0.2853 0.0224  0.0058  0.0158  130 PRO C CB  
4489 C CG  . PRO C 123 ? 0.3731 0.2936 0.3075 0.0226  0.0041  0.0135  130 PRO C CG  
4490 C CD  . PRO C 123 ? 0.3299 0.2508 0.2622 0.0218  0.0009  0.0141  130 PRO C CD  
4491 N N   . SER C 124 ? 0.3600 0.2813 0.3146 0.0213  0.0047  0.0223  131 SER C N   
4492 C CA  . SER C 124 ? 0.3802 0.3021 0.3392 0.0210  0.0052  0.0247  131 SER C CA  
4493 C C   . SER C 124 ? 0.3883 0.3105 0.3441 0.0214  0.0080  0.0237  131 SER C C   
4494 O O   . SER C 124 ? 0.4032 0.3261 0.3595 0.0209  0.0076  0.0249  131 SER C O   
4495 C CB  . SER C 124 ? 0.4080 0.3296 0.3754 0.0213  0.0069  0.0269  131 SER C CB  
4496 O OG  . SER C 124 ? 0.5013 0.4219 0.4686 0.0221  0.0097  0.0254  131 SER C OG  
4497 N N   . ASP C 125 ? 0.3579 0.2793 0.3105 0.0221  0.0108  0.0216  132 ASP C N   
4498 C CA  . ASP C 125 ? 0.3750 0.2963 0.3246 0.0224  0.0135  0.0207  132 ASP C CA  
4499 C C   . ASP C 125 ? 0.3596 0.2815 0.3019 0.0224  0.0131  0.0185  132 ASP C C   
4500 O O   . ASP C 125 ? 0.3536 0.2751 0.2930 0.0227  0.0154  0.0173  132 ASP C O   
4501 C CB  . ASP C 125 ? 0.3937 0.3134 0.3454 0.0231  0.0172  0.0202  132 ASP C CB  
4502 C CG  . ASP C 125 ? 0.4628 0.3817 0.4116 0.0235  0.0175  0.0183  132 ASP C CG  
4503 O OD1 . ASP C 125 ? 0.4294 0.3490 0.3759 0.0233  0.0149  0.0175  132 ASP C OD1 
4504 O OD2 . ASP C 125 ? 0.5196 0.4370 0.4685 0.0239  0.0205  0.0176  132 ASP C OD2 
4505 N N   . GLY C 126 ? 0.3312 0.2538 0.2703 0.0221  0.0101  0.0178  133 GLY C N   
4506 C CA  . GLY C 126 ? 0.3411 0.2643 0.2736 0.0221  0.0097  0.0158  133 GLY C CA  
4507 C C   . GLY C 126 ? 0.3378 0.2624 0.2679 0.0216  0.0089  0.0164  133 GLY C C   
4508 O O   . GLY C 126 ? 0.3221 0.2469 0.2556 0.0211  0.0085  0.0186  133 GLY C O   
4509 N N   . PRO C 127 ? 0.3327 0.2580 0.2570 0.0217  0.0089  0.0147  134 PRO C N   
4510 C CA  . PRO C 127 ? 0.3247 0.2514 0.2461 0.0212  0.0086  0.0152  134 PRO C CA  
4511 C C   . PRO C 127 ? 0.3358 0.2631 0.2570 0.0203  0.0057  0.0167  134 PRO C C   
4512 O O   . PRO C 127 ? 0.3499 0.2781 0.2708 0.0197  0.0055  0.0181  134 PRO C O   
4513 C CB  . PRO C 127 ? 0.3629 0.2902 0.2786 0.0217  0.0092  0.0130  134 PRO C CB  
4514 C CG  . PRO C 127 ? 0.3623 0.2884 0.2780 0.0224  0.0096  0.0113  134 PRO C CG  
4515 C CD  . PRO C 127 ? 0.3330 0.2579 0.2541 0.0224  0.0099  0.0124  134 PRO C CD  
4516 N N   . VAL C 128 ? 0.3052 0.2317 0.2264 0.0201  0.0033  0.0166  135 VAL C N   
4517 C CA  . VAL C 128 ? 0.3017 0.2283 0.2224 0.0191  0.0003  0.0181  135 VAL C CA  
4518 C C   . VAL C 128 ? 0.3140 0.2405 0.2416 0.0184  -0.0005 0.0211  135 VAL C C   
4519 O O   . VAL C 128 ? 0.3642 0.2915 0.2922 0.0176  -0.0014 0.0229  135 VAL C O   
4520 C CB  . VAL C 128 ? 0.3123 0.2377 0.2302 0.0189  -0.0022 0.0169  135 VAL C CB  
4521 C CG1 . VAL C 128 ? 0.3248 0.2498 0.2430 0.0176  -0.0058 0.0189  135 VAL C CG1 
4522 C CG2 . VAL C 128 ? 0.3129 0.2385 0.2239 0.0195  -0.0015 0.0142  135 VAL C CG2 
4523 N N   . MET C 129 ? 0.3223 0.2479 0.2555 0.0189  0.0003  0.0216  136 MET C N   
4524 C CA  . MET C 129 ? 0.3316 0.2572 0.2718 0.0184  -0.0003 0.0245  136 MET C CA  
4525 C C   . MET C 129 ? 0.3379 0.2639 0.2812 0.0187  0.0025  0.0255  136 MET C C   
4526 O O   . MET C 129 ? 0.3344 0.2606 0.2834 0.0182  0.0021  0.0279  136 MET C O   
4527 C CB  . MET C 129 ? 0.3352 0.2597 0.2808 0.0187  -0.0006 0.0250  136 MET C CB  
4528 C CG  . MET C 129 ? 0.3546 0.2783 0.2980 0.0183  -0.0038 0.0242  136 MET C CG  
4529 S SD  . MET C 129 ? 0.4035 0.3271 0.3437 0.0167  -0.0084 0.0256  136 MET C SD  
4530 C CE  . MET C 129 ? 0.4102 0.3339 0.3594 0.0157  -0.0104 0.0297  136 MET C CE  
4531 N N   . GLN C 130 ? 0.3332 0.2593 0.2732 0.0194  0.0053  0.0236  137 GLN C N   
4532 C CA  . GLN C 130 ? 0.3115 0.2378 0.2532 0.0196  0.0080  0.0242  137 GLN C CA  
4533 C C   . GLN C 130 ? 0.3319 0.2594 0.2690 0.0191  0.0077  0.0241  137 GLN C C   
4534 O O   . GLN C 130 ? 0.3202 0.2477 0.2574 0.0193  0.0098  0.0242  137 GLN C O   
4535 C CB  . GLN C 130 ? 0.3075 0.2324 0.2494 0.0207  0.0114  0.0225  137 GLN C CB  
4536 C CG  . GLN C 130 ? 0.3069 0.2307 0.2542 0.0211  0.0122  0.0231  137 GLN C CG  
4537 C CD  . GLN C 130 ? 0.3357 0.2593 0.2901 0.0209  0.0123  0.0258  137 GLN C CD  
4538 O OE1 . GLN C 130 ? 0.3616 0.2853 0.3171 0.0208  0.0137  0.0266  137 GLN C OE1 
4539 N NE2 . GLN C 130 ? 0.3513 0.2747 0.3111 0.0208  0.0110  0.0273  137 GLN C NE2 
4540 N N   . LYS C 131 ? 0.3251 0.2535 0.2579 0.0185  0.0051  0.0240  138 LYS C N   
4541 C CA  . LYS C 131 ? 0.3248 0.2546 0.2533 0.0179  0.0046  0.0242  138 LYS C CA  
4542 C C   . LYS C 131 ? 0.3406 0.2708 0.2658 0.0185  0.0075  0.0225  138 LYS C C   
4543 O O   . LYS C 131 ? 0.3196 0.2505 0.2451 0.0182  0.0084  0.0235  138 LYS C O   
4544 C CB  . LYS C 131 ? 0.3327 0.2631 0.2649 0.0169  0.0033  0.0271  138 LYS C CB  
4545 C CG  . LYS C 131 ? 0.3693 0.2994 0.3041 0.0159  0.0000  0.0291  138 LYS C CG  
4546 C CD  . LYS C 131 ? 0.4245 0.3552 0.3632 0.0148  -0.0015 0.0321  138 LYS C CD  
4547 C CE  . LYS C 131 ? 0.4539 0.3842 0.3956 0.0137  -0.0052 0.0343  138 LYS C CE  
4548 N NZ  . LYS C 131 ? 0.5486 0.4794 0.4955 0.0127  -0.0065 0.0376  138 LYS C NZ  
4549 N N   . LYS C 132 ? 0.3238 0.2535 0.2462 0.0194  0.0088  0.0201  139 LYS C N   
4550 C CA  . LYS C 132 ? 0.3351 0.2651 0.2546 0.0199  0.0112  0.0185  139 LYS C CA  
4551 C C   . LYS C 132 ? 0.3439 0.2754 0.2576 0.0199  0.0107  0.0174  139 LYS C C   
4552 O O   . LYS C 132 ? 0.3509 0.2829 0.2624 0.0202  0.0124  0.0163  139 LYS C O   
4553 C CB  . LYS C 132 ? 0.3600 0.2884 0.2803 0.0208  0.0129  0.0168  139 LYS C CB  
4554 C CG  . LYS C 132 ? 0.3748 0.3017 0.3005 0.0210  0.0141  0.0178  139 LYS C CG  
4555 C CD  . LYS C 132 ? 0.3880 0.3132 0.3136 0.0217  0.0158  0.0161  139 LYS C CD  
4556 C CE  . LYS C 132 ? 0.4072 0.3308 0.3382 0.0219  0.0171  0.0171  139 LYS C CE  
4557 N NZ  . LYS C 132 ? 0.4372 0.3590 0.3670 0.0225  0.0196  0.0155  139 LYS C NZ  
4558 N N   . THR C 133 ? 0.3673 0.2995 0.2784 0.0194  0.0085  0.0176  140 THR C N   
4559 C CA  . THR C 133 ? 0.3561 0.2895 0.2616 0.0195  0.0084  0.0162  140 THR C CA  
4560 C C   . THR C 133 ? 0.3693 0.3043 0.2730 0.0187  0.0082  0.0178  140 THR C C   
4561 O O   . THR C 133 ? 0.3736 0.3086 0.2801 0.0178  0.0071  0.0200  140 THR C O   
4562 C CB  . THR C 133 ? 0.3686 0.3013 0.2709 0.0195  0.0064  0.0151  140 THR C CB  
4563 O OG1 . THR C 133 ? 0.4058 0.3381 0.3087 0.0185  0.0037  0.0169  140 THR C OG1 
4564 C CG2 . THR C 133 ? 0.3557 0.2867 0.2599 0.0203  0.0065  0.0136  140 THR C CG2 
4565 N N   . MET C 134 ? 0.3643 0.3007 0.2637 0.0189  0.0093  0.0168  141 MET C N   
4566 C CA  . MET C 134 ? 0.4062 0.3444 0.3036 0.0182  0.0093  0.0182  141 MET C CA  
4567 C C   . MET C 134 ? 0.4231 0.3625 0.3148 0.0184  0.0096  0.0170  141 MET C C   
4568 O O   . MET C 134 ? 0.4755 0.4167 0.3655 0.0185  0.0112  0.0171  141 MET C O   
4569 C CB  . MET C 134 ? 0.4603 0.3992 0.3603 0.0181  0.0111  0.0192  141 MET C CB  
4570 C CG  . MET C 134 ? 0.4731 0.4119 0.3729 0.0191  0.0133  0.0175  141 MET C CG  
4571 S SD  . MET C 134 ? 0.5302 0.4699 0.4319 0.0186  0.0148  0.0190  141 MET C SD  
4572 C CE  . MET C 134 ? 0.5545 0.4951 0.4535 0.0195  0.0166  0.0170  141 MET C CE  
4573 N N   . GLY C 135 ? 0.3816 0.3200 0.2705 0.0185  0.0082  0.0158  142 GLY C N   
4574 C CA  . GLY C 135 ? 0.3793 0.3185 0.2622 0.0187  0.0085  0.0146  142 GLY C CA  
4575 C C   . GLY C 135 ? 0.3973 0.3360 0.2780 0.0200  0.0097  0.0118  142 GLY C C   
4576 O O   . GLY C 135 ? 0.4019 0.3401 0.2854 0.0208  0.0108  0.0107  142 GLY C O   
4577 N N1  . 4OO C 136 ? 0.5205 0.4477 0.3929 0.0194  -0.0013 0.0067  143 4OO C N1  
4578 N N2  . 4OO C 136 ? 0.6741 0.6001 0.5481 0.0203  -0.0012 0.0051  143 4OO C N2  
4579 N N3  . 4OO C 136 ? 0.8196 0.7445 0.6955 0.0213  -0.0012 0.0034  143 4OO C N3  
4580 C C   . 4OO C 136 ? 0.4298 0.3704 0.3018 0.0223  0.0138  0.0072  143 4OO C C   
4581 O O   . 4OO C 136 ? 0.4468 0.3891 0.3163 0.0218  0.0146  0.0084  143 4OO C O   
4582 C CA  . 4OO C 136 ? 0.3950 0.3334 0.2683 0.0216  0.0111  0.0078  143 4OO C CA  
4583 N N   . 4OO C 136 ? 0.3807 0.3195 0.2560 0.0202  0.0097  0.0105  143 4OO C N   
4584 C CB  . 4OO C 136 ? 0.4236 0.3606 0.2912 0.0215  0.0099  0.0064  143 4OO C CB  
4585 C CG  . 4OO C 136 ? 0.4759 0.4101 0.3443 0.0211  0.0071  0.0063  143 4OO C CG  
4586 C CD2 . 4OO C 136 ? 0.4249 0.3584 0.2926 0.0196  0.0046  0.0082  143 4OO C CD2 
4587 C CE2 . 4OO C 136 ? 0.4499 0.3809 0.3188 0.0191  0.0018  0.0082  143 4OO C CE2 
4588 C CZ  . 4OO C 136 ? 0.4550 0.3845 0.3257 0.0200  0.0016  0.0064  143 4OO C CZ  
4589 C CE1 . 4OO C 136 ? 0.4741 0.4044 0.3452 0.0215  0.0041  0.0043  143 4OO C CE1 
4590 C CD1 . 4OO C 136 ? 0.4518 0.3845 0.3219 0.0221  0.0069  0.0043  143 4OO C CD1 
4591 N N   . GLU C 137 ? 0.4044 0.3449 0.2776 0.0236  0.0152  0.0054  144 GLU C N   
4592 C CA  . GLU C 137 ? 0.4239 0.3665 0.2961 0.0244  0.0177  0.0047  144 GLU C CA  
4593 C C   . GLU C 137 ? 0.4235 0.3658 0.2901 0.0249  0.0180  0.0033  144 GLU C C   
4594 O O   . GLU C 137 ? 0.4268 0.3668 0.2908 0.0247  0.0163  0.0022  144 GLU C O   
4595 C CB  . GLU C 137 ? 0.4328 0.3751 0.3081 0.0255  0.0187  0.0032  144 GLU C CB  
4596 C CG  . GLU C 137 ? 0.5051 0.4474 0.3853 0.0252  0.0188  0.0044  144 GLU C CG  
4597 C CD  . GLU C 137 ? 0.5630 0.5077 0.4446 0.0248  0.0203  0.0061  144 GLU C CD  
4598 O OE1 . GLU C 137 ? 0.5970 0.5436 0.4762 0.0248  0.0214  0.0065  144 GLU C OE1 
4599 O OE2 . GLU C 137 ? 0.5969 0.5413 0.4820 0.0244  0.0204  0.0070  144 GLU C OE2 
4600 N N   . ALA C 138 ? 0.4641 0.4085 0.3287 0.0253  0.0203  0.0034  145 ALA C N   
4601 C CA  . ALA C 138 ? 0.4237 0.3677 0.2828 0.0260  0.0214  0.0015  145 ALA C CA  
4602 C C   . ALA C 138 ? 0.4166 0.3584 0.2757 0.0272  0.0210  -0.0011 145 ALA C C   
4603 O O   . ALA C 138 ? 0.3975 0.3394 0.2610 0.0279  0.0213  -0.0016 145 ALA C O   
4604 C CB  . ALA C 138 ? 0.4502 0.3971 0.3095 0.0269  0.0245  0.0017  145 ALA C CB  
4605 N N   . SER C 139 ? 0.3996 0.3392 0.2536 0.0275  0.0204  -0.0029 146 SER C N   
4606 C CA  . SER C 139 ? 0.4311 0.3682 0.2850 0.0286  0.0197  -0.0055 146 SER C CA  
4607 C C   . SER C 139 ? 0.4131 0.3490 0.2613 0.0295  0.0211  -0.0078 146 SER C C   
4608 O O   . SER C 139 ? 0.4296 0.3662 0.2733 0.0292  0.0222  -0.0073 146 SER C O   
4609 C CB  . SER C 139 ? 0.4808 0.4151 0.3352 0.0277  0.0164  -0.0054 146 SER C CB  
4610 O OG  . SER C 139 ? 0.5294 0.4619 0.3782 0.0267  0.0147  -0.0053 146 SER C OG  
4611 N N   . SER C 140 ? 0.3977 0.3318 0.2462 0.0308  0.0211  -0.0103 147 SER C N   
4612 C CA  . SER C 140 ? 0.3993 0.3318 0.2423 0.0320  0.0227  -0.0129 147 SER C CA  
4613 C C   . SER C 140 ? 0.3830 0.3113 0.2234 0.0320  0.0200  -0.0149 147 SER C C   
4614 O O   . SER C 140 ? 0.3887 0.3162 0.2336 0.0322  0.0184  -0.0154 147 SER C O   
4615 C CB  . SER C 140 ? 0.4561 0.3905 0.3031 0.0338  0.0256  -0.0141 147 SER C CB  
4616 O OG  . SER C 140 ? 0.5152 0.4479 0.3580 0.0352  0.0273  -0.0168 147 SER C OG  
4617 N N   . GLU C 141 ? 0.3791 0.3047 0.2124 0.0315  0.0192  -0.0161 148 GLU C N   
4618 C CA  . GLU C 141 ? 0.4006 0.3219 0.2310 0.0314  0.0165  -0.0181 148 GLU C CA  
4619 C C   . GLU C 141 ? 0.3993 0.3188 0.2266 0.0333  0.0186  -0.0215 148 GLU C C   
4620 O O   . GLU C 141 ? 0.4186 0.3382 0.2408 0.0339  0.0212  -0.0224 148 GLU C O   
4621 C CB  . GLU C 141 ? 0.4153 0.3340 0.2396 0.0297  0.0138  -0.0173 148 GLU C CB  
4622 C CG  . GLU C 141 ? 0.4458 0.3600 0.2681 0.0291  0.0101  -0.0187 148 GLU C CG  
4623 C CD  . GLU C 141 ? 0.5057 0.4174 0.3229 0.0269  0.0066  -0.0173 148 GLU C CD  
4624 O OE1 . GLU C 141 ? 0.5263 0.4392 0.3395 0.0260  0.0076  -0.0159 148 GLU C OE1 
4625 O OE2 . GLU C 141 ? 0.5124 0.4209 0.3294 0.0260  0.0029  -0.0175 148 GLU C OE2 
4626 N N   . ARG C 142 ? 0.3802 0.2980 0.2107 0.0343  0.0177  -0.0232 149 ARG C N   
4627 C CA  . ARG C 142 ? 0.4294 0.3453 0.2575 0.0362  0.0197  -0.0265 149 ARG C CA  
4628 C C   . ARG C 142 ? 0.4111 0.3219 0.2320 0.0357  0.0172  -0.0285 149 ARG C C   
4629 O O   . ARG C 142 ? 0.4069 0.3156 0.2294 0.0347  0.0135  -0.0281 149 ARG C O   
4630 C CB  . ARG C 142 ? 0.4651 0.3818 0.3002 0.0374  0.0196  -0.0272 149 ARG C CB  
4631 C CG  . ARG C 142 ? 0.5414 0.4627 0.3832 0.0381  0.0223  -0.0256 149 ARG C CG  
4632 C CD  . ARG C 142 ? 0.6149 0.5380 0.4624 0.0368  0.0202  -0.0228 149 ARG C CD  
4633 N NE  . ARG C 142 ? 0.6829 0.6040 0.5341 0.0367  0.0176  -0.0234 149 ARG C NE  
4634 C CZ  . ARG C 142 ? 0.7161 0.6370 0.5703 0.0354  0.0149  -0.0216 149 ARG C CZ  
4635 N NH1 . ARG C 142 ? 0.7007 0.6232 0.5548 0.0340  0.0144  -0.0192 149 ARG C NH1 
4636 N NH2 . ARG C 142 ? 0.7784 0.6977 0.6360 0.0354  0.0128  -0.0221 149 ARG C NH2 
4637 N N   . MET C 143 ? 0.3986 0.3074 0.2120 0.0363  0.0192  -0.0305 150 MET C N   
4638 C CA  . MET C 143 ? 0.4379 0.3413 0.2428 0.0355  0.0169  -0.0324 150 MET C CA  
4639 C C   . MET C 143 ? 0.4591 0.3591 0.2619 0.0374  0.0179  -0.0361 150 MET C C   
4640 O O   . MET C 143 ? 0.4549 0.3567 0.2597 0.0394  0.0218  -0.0375 150 MET C O   
4641 C CB  . MET C 143 ? 0.4676 0.3703 0.2639 0.0347  0.0184  -0.0322 150 MET C CB  
4642 C CG  . MET C 143 ? 0.4762 0.3830 0.2745 0.0332  0.0186  -0.0285 150 MET C CG  
4643 S SD  . MET C 143 ? 0.5366 0.4433 0.3393 0.0308  0.0133  -0.0254 150 MET C SD  
4644 C CE  . MET C 143 ? 0.4897 0.3899 0.2830 0.0294  0.0095  -0.0270 150 MET C CE  
4645 N N   . TYR C 144 ? 0.4502 0.3452 0.2492 0.0367  0.0143  -0.0377 151 TYR C N   
4646 C CA  . TYR C 144 ? 0.4486 0.3395 0.2445 0.0384  0.0152  -0.0416 151 TYR C CA  
4647 C C   . TYR C 144 ? 0.4680 0.3526 0.2570 0.0371  0.0110  -0.0431 151 TYR C C   
4648 O O   . TYR C 144 ? 0.4525 0.3363 0.2420 0.0351  0.0069  -0.0411 151 TYR C O   
4649 C CB  . TYR C 144 ? 0.4349 0.3271 0.2393 0.0400  0.0153  -0.0423 151 TYR C CB  
4650 C CG  . TYR C 144 ? 0.4377 0.3296 0.2477 0.0387  0.0109  -0.0407 151 TYR C CG  
4651 C CD1 . TYR C 144 ? 0.4727 0.3691 0.2896 0.0378  0.0103  -0.0374 151 TYR C CD1 
4652 C CD2 . TYR C 144 ? 0.4595 0.3466 0.2678 0.0384  0.0072  -0.0424 151 TYR C CD2 
4653 C CE1 . TYR C 144 ? 0.4544 0.3506 0.2767 0.0367  0.0067  -0.0358 151 TYR C CE1 
4654 C CE2 . TYR C 144 ? 0.4536 0.3408 0.2678 0.0372  0.0033  -0.0406 151 TYR C CE2 
4655 C CZ  . TYR C 144 ? 0.4527 0.3444 0.2734 0.0363  0.0032  -0.0373 151 TYR C CZ  
4656 O OH  . TYR C 144 ? 0.4976 0.3898 0.3244 0.0353  0.0000  -0.0354 151 TYR C OH  
4657 N N   . PRO C 145 ? 0.4588 0.3389 0.2414 0.0383  0.0121  -0.0467 152 PRO C N   
4658 C CA  . PRO C 145 ? 0.4918 0.3653 0.2669 0.0370  0.0080  -0.0483 152 PRO C CA  
4659 C C   . PRO C 145 ? 0.5129 0.3837 0.2923 0.0374  0.0048  -0.0496 152 PRO C C   
4660 O O   . PRO C 145 ? 0.5115 0.3841 0.2971 0.0393  0.0068  -0.0508 152 PRO C O   
4661 C CB  . PRO C 145 ? 0.4996 0.3693 0.2650 0.0382  0.0114  -0.0518 152 PRO C CB  
4662 C CG  . PRO C 145 ? 0.4787 0.3520 0.2502 0.0410  0.0163  -0.0530 152 PRO C CG  
4663 C CD  . PRO C 145 ? 0.4894 0.3696 0.2696 0.0407  0.0174  -0.0493 152 PRO C CD  
4664 N N   . GLU C 146 ? 0.5251 0.3920 0.3022 0.0354  -0.0004 -0.0490 153 GLU C N   
4665 C CA  . GLU C 146 ? 0.5375 0.4015 0.3185 0.0355  -0.0039 -0.0502 153 GLU C CA  
4666 C C   . GLU C 146 ? 0.5828 0.4411 0.3573 0.0332  -0.0092 -0.0501 153 GLU C C   
4667 O O   . GLU C 146 ? 0.5248 0.3841 0.2979 0.0310  -0.0114 -0.0472 153 GLU C O   
4668 C CB  . GLU C 146 ? 0.5217 0.3905 0.3141 0.0353  -0.0053 -0.0473 153 GLU C CB  
4669 C CG  . GLU C 146 ? 0.5509 0.4173 0.3484 0.0356  -0.0086 -0.0481 153 GLU C CG  
4670 C CD  . GLU C 146 ? 0.5424 0.4142 0.3509 0.0358  -0.0084 -0.0454 153 GLU C CD  
4671 O OE1 . GLU C 146 ? 0.5915 0.4669 0.4030 0.0345  -0.0088 -0.0422 153 GLU C OE1 
4672 O OE2 . GLU C 146 ? 0.5495 0.4217 0.3637 0.0372  -0.0079 -0.0465 153 GLU C OE2 
4673 N N   . ASP C 147 ? 0.6179 0.4705 0.3889 0.0336  -0.0114 -0.0531 154 ASP C N   
4674 C CA  . ASP C 147 ? 0.6581 0.5046 0.4235 0.0314  -0.0171 -0.0532 154 ASP C CA  
4675 C C   . ASP C 147 ? 0.6350 0.4794 0.3908 0.0294  -0.0179 -0.0522 154 ASP C C   
4676 O O   . ASP C 147 ? 0.6377 0.4806 0.3927 0.0268  -0.0227 -0.0499 154 ASP C O   
4677 C CB  . ASP C 147 ? 0.6732 0.5215 0.4473 0.0298  -0.0218 -0.0498 154 ASP C CB  
4678 C CG  . ASP C 147 ? 0.7174 0.5676 0.5011 0.0313  -0.0218 -0.0503 154 ASP C CG  
4679 O OD1 . ASP C 147 ? 0.8267 0.6742 0.6089 0.0332  -0.0202 -0.0537 154 ASP C OD1 
4680 O OD2 . ASP C 147 ? 0.7125 0.5665 0.5049 0.0305  -0.0236 -0.0471 154 ASP C OD2 
4681 N N   . GLY C 148 ? 0.5913 0.4363 0.3407 0.0303  -0.0132 -0.0537 155 GLY C N   
4682 C CA  . GLY C 148 ? 0.5758 0.4179 0.3148 0.0284  -0.0140 -0.0532 155 GLY C CA  
4683 C C   . GLY C 148 ? 0.5555 0.4026 0.2968 0.0266  -0.0142 -0.0489 155 GLY C C   
4684 O O   . GLY C 148 ? 0.5747 0.4193 0.3079 0.0245  -0.0158 -0.0480 155 GLY C O   
4685 N N   . ALA C 149 ? 0.5070 0.3610 0.2591 0.0274  -0.0124 -0.0464 156 ALA C N   
4686 C CA  . ALA C 149 ? 0.5215 0.3804 0.2772 0.0259  -0.0125 -0.0424 156 ALA C CA  
4687 C C   . ALA C 149 ? 0.4773 0.3426 0.2391 0.0281  -0.0068 -0.0421 156 ALA C C   
4688 O O   . ALA C 149 ? 0.5140 0.3799 0.2786 0.0306  -0.0037 -0.0446 156 ALA C O   
4689 C CB  . ALA C 149 ? 0.5231 0.3836 0.2876 0.0244  -0.0172 -0.0392 156 ALA C CB  
4690 N N   . LEU C 150 ? 0.4937 0.3638 0.2585 0.0272  -0.0060 -0.0387 157 LEU C N   
4691 C CA  . LEU C 150 ? 0.4685 0.3448 0.2395 0.0287  -0.0013 -0.0377 157 LEU C CA  
4692 C C   . LEU C 150 ? 0.4637 0.3444 0.2459 0.0282  -0.0032 -0.0346 157 LEU C C   
4693 O O   . LEU C 150 ? 0.4548 0.3355 0.2382 0.0261  -0.0068 -0.0318 157 LEU C O   
4694 C CB  . LEU C 150 ? 0.4804 0.3585 0.2459 0.0279  0.0010  -0.0362 157 LEU C CB  
4695 C CG  . LEU C 150 ? 0.4842 0.3688 0.2552 0.0293  0.0060  -0.0350 157 LEU C CG  
4696 C CD1 . LEU C 150 ? 0.4904 0.3752 0.2620 0.0322  0.0105  -0.0382 157 LEU C CD1 
4697 C CD2 . LEU C 150 ? 0.4961 0.3818 0.2608 0.0280  0.0074  -0.0333 157 LEU C CD2 
4698 N N   . LYS C 151 ? 0.4335 0.3174 0.2234 0.0302  -0.0008 -0.0351 158 LYS C N   
4699 C CA  . LYS C 151 ? 0.4350 0.3229 0.2349 0.0298  -0.0020 -0.0323 158 LYS C CA  
4700 C C   . LYS C 151 ? 0.4427 0.3363 0.2469 0.0306  0.0020  -0.0306 158 LYS C C   
4701 O O   . LYS C 151 ? 0.4711 0.3661 0.2740 0.0323  0.0061  -0.0323 158 LYS C O   
4702 C CB  . LYS C 151 ? 0.4758 0.3631 0.2816 0.0312  -0.0025 -0.0339 158 LYS C CB  
4703 C CG  . LYS C 151 ? 0.4913 0.3726 0.2922 0.0311  -0.0055 -0.0365 158 LYS C CG  
4704 C CD  . LYS C 151 ? 0.5271 0.4063 0.3298 0.0290  -0.0108 -0.0345 158 LYS C CD  
4705 C CE  . LYS C 151 ? 0.5325 0.4055 0.3305 0.0287  -0.0143 -0.0369 158 LYS C CE  
4706 N NZ  . LYS C 151 ? 0.5480 0.4210 0.3533 0.0295  -0.0157 -0.0374 158 LYS C NZ  
4707 N N   . GLY C 152 ? 0.4330 0.3299 0.2425 0.0293  0.0008  -0.0272 159 GLY C N   
4708 C CA  . GLY C 152 ? 0.4013 0.3036 0.2168 0.0300  0.0040  -0.0254 159 GLY C CA  
4709 C C   . GLY C 152 ? 0.3974 0.3023 0.2221 0.0299  0.0029  -0.0235 159 GLY C C   
4710 O O   . GLY C 152 ? 0.3994 0.3028 0.2264 0.0286  -0.0006 -0.0222 159 GLY C O   
4711 N N   . GLU C 153 ? 0.3866 0.2949 0.2166 0.0313  0.0060  -0.0235 160 GLU C N   
4712 C CA  . GLU C 153 ? 0.4005 0.3112 0.2390 0.0313  0.0054  -0.0218 160 GLU C CA  
4713 C C   . GLU C 153 ? 0.3993 0.3145 0.2414 0.0313  0.0081  -0.0196 160 GLU C C   
4714 O O   . GLU C 153 ? 0.3861 0.3032 0.2265 0.0323  0.0113  -0.0203 160 GLU C O   
4715 C CB  . GLU C 153 ? 0.4394 0.3494 0.2815 0.0329  0.0060  -0.0239 160 GLU C CB  
4716 C CG  . GLU C 153 ? 0.5204 0.4258 0.3585 0.0332  0.0038  -0.0265 160 GLU C CG  
4717 C CD  . GLU C 153 ? 0.5798 0.4847 0.4217 0.0349  0.0046  -0.0286 160 GLU C CD  
4718 O OE1 . GLU C 153 ? 0.6102 0.5113 0.4500 0.0352  0.0027  -0.0306 160 GLU C OE1 
4719 O OE2 . GLU C 153 ? 0.6370 0.5452 0.4838 0.0359  0.0072  -0.0281 160 GLU C OE2 
4720 N N   . ILE C 154 ? 0.3753 0.2923 0.2228 0.0303  0.0068  -0.0170 161 ILE C N   
4721 C CA  . ILE C 154 ? 0.3919 0.3128 0.2429 0.0300  0.0090  -0.0148 161 ILE C CA  
4722 C C   . ILE C 154 ? 0.4227 0.3448 0.2808 0.0299  0.0084  -0.0134 161 ILE C C   
4723 O O   . ILE C 154 ? 0.4065 0.3268 0.2668 0.0292  0.0057  -0.0129 161 ILE C O   
4724 C CB  . ILE C 154 ? 0.4370 0.3587 0.2857 0.0284  0.0081  -0.0124 161 ILE C CB  
4725 C CG1 . ILE C 154 ? 0.4671 0.3866 0.3079 0.0280  0.0076  -0.0134 161 ILE C CG1 
4726 C CG2 . ILE C 154 ? 0.4391 0.3648 0.2907 0.0284  0.0108  -0.0105 161 ILE C CG2 
4727 C CD1 . ILE C 154 ? 0.4974 0.4167 0.3362 0.0260  0.0053  -0.0109 161 ILE C CD1 
4728 N N   . LYS C 155 ? 0.4008 0.3259 0.2626 0.0305  0.0109  -0.0127 162 LYS C N   
4729 C CA  . LYS C 155 ? 0.4575 0.3838 0.3253 0.0302  0.0108  -0.0111 162 LYS C CA  
4730 C C   . LYS C 155 ? 0.4779 0.4064 0.3464 0.0291  0.0114  -0.0086 162 LYS C C   
4731 O O   . LYS C 155 ? 0.4817 0.4125 0.3492 0.0294  0.0137  -0.0082 162 LYS C O   
4732 C CB  . LYS C 155 ? 0.5132 0.4410 0.3839 0.0314  0.0131  -0.0120 162 LYS C CB  
4733 C CG  . LYS C 155 ? 0.6474 0.5737 0.5216 0.0318  0.0120  -0.0130 162 LYS C CG  
4734 C CD  . LYS C 155 ? 0.6554 0.5796 0.5272 0.0330  0.0117  -0.0157 162 LYS C CD  
4735 C CE  . LYS C 155 ? 0.6943 0.6179 0.5705 0.0336  0.0113  -0.0164 162 LYS C CE  
4736 N NZ  . LYS C 155 ? 0.7460 0.6688 0.6256 0.0325  0.0094  -0.0148 162 LYS C NZ  
4737 N N   . GLN C 156 ? 0.4361 0.3639 0.3061 0.0278  0.0094  -0.0068 163 GLN C N   
4738 C CA  . GLN C 156 ? 0.4202 0.3497 0.2904 0.0267  0.0095  -0.0043 163 GLN C CA  
4739 C C   . GLN C 156 ? 0.3835 0.3143 0.2593 0.0265  0.0104  -0.0028 163 GLN C C   
4740 O O   . GLN C 156 ? 0.3711 0.3009 0.2504 0.0267  0.0098  -0.0031 163 GLN C O   
4741 C CB  . GLN C 156 ? 0.4666 0.3944 0.3356 0.0253  0.0067  -0.0029 163 GLN C CB  
4742 C CG  . GLN C 156 ? 0.4819 0.4079 0.3447 0.0249  0.0052  -0.0039 163 GLN C CG  
4743 C CD  . GLN C 156 ? 0.5339 0.4614 0.3922 0.0245  0.0065  -0.0033 163 GLN C CD  
4744 O OE1 . GLN C 156 ? 0.6454 0.5714 0.4988 0.0235  0.0048  -0.0029 163 GLN C OE1 
4745 N NE2 . GLN C 156 ? 0.4903 0.4205 0.3498 0.0252  0.0094  -0.0030 163 GLN C NE2 
4746 N N   . ARG C 157 ? 0.3946 0.3275 0.2709 0.0261  0.0118  -0.0011 164 ARG C N   
4747 C CA  . ARG C 157 ? 0.3831 0.3170 0.2642 0.0257  0.0126  0.0003  164 ARG C CA  
4748 C C   . ARG C 157 ? 0.3756 0.3103 0.2571 0.0245  0.0120  0.0028  164 ARG C C   
4749 O O   . ARG C 157 ? 0.3962 0.3323 0.2748 0.0242  0.0125  0.0034  164 ARG C O   
4750 C CB  . ARG C 157 ? 0.4292 0.3648 0.3112 0.0265  0.0150  0.0000  164 ARG C CB  
4751 C CG  . ARG C 157 ? 0.4844 0.4192 0.3672 0.0276  0.0155  -0.0021 164 ARG C CG  
4752 C CD  . ARG C 157 ? 0.5652 0.5010 0.4512 0.0278  0.0170  -0.0016 164 ARG C CD  
4753 N NE  . ARG C 157 ? 0.6767 0.6148 0.5614 0.0280  0.0188  -0.0012 164 ARG C NE  
4754 C CZ  . ARG C 157 ? 0.7387 0.6782 0.6255 0.0276  0.0199  0.0001  164 ARG C CZ  
4755 N NH1 . ARG C 157 ? 0.7447 0.6832 0.6343 0.0269  0.0196  0.0011  164 ARG C NH1 
4756 N NH2 . ARG C 157 ? 0.7604 0.7022 0.6462 0.0278  0.0214  0.0005  164 ARG C NH2 
4757 N N   . LEU C 158 ? 0.3623 0.2960 0.2475 0.0239  0.0109  0.0041  165 LEU C N   
4758 C CA  . LEU C 158 ? 0.3717 0.3061 0.2586 0.0228  0.0104  0.0066  165 LEU C CA  
4759 C C   . LEU C 158 ? 0.3524 0.2877 0.2425 0.0229  0.0123  0.0074  165 LEU C C   
4760 O O   . LEU C 158 ? 0.3571 0.2915 0.2498 0.0234  0.0130  0.0066  165 LEU C O   
4761 C CB  . LEU C 158 ? 0.3853 0.3179 0.2750 0.0222  0.0082  0.0076  165 LEU C CB  
4762 C CG  . LEU C 158 ? 0.4417 0.3737 0.3297 0.0211  0.0057  0.0089  165 LEU C CG  
4763 C CD1 . LEU C 158 ? 0.4687 0.4018 0.3513 0.0207  0.0057  0.0087  165 LEU C CD1 
4764 C CD2 . LEU C 158 ? 0.4320 0.3619 0.3216 0.0208  0.0031  0.0089  165 LEU C CD2 
4765 N N   . LYS C 159 ? 0.3520 0.2890 0.2419 0.0223  0.0130  0.0089  166 LYS C N   
4766 C CA  . LYS C 159 ? 0.3620 0.2994 0.2549 0.0222  0.0146  0.0099  166 LYS C CA  
4767 C C   . LYS C 159 ? 0.3452 0.2812 0.2423 0.0216  0.0139  0.0112  166 LYS C C   
4768 O O   . LYS C 159 ? 0.3473 0.2828 0.2452 0.0210  0.0124  0.0125  166 LYS C O   
4769 C CB  . LYS C 159 ? 0.4114 0.3510 0.3030 0.0216  0.0153  0.0113  166 LYS C CB  
4770 C CG  . LYS C 159 ? 0.4833 0.4246 0.3712 0.0222  0.0163  0.0102  166 LYS C CG  
4771 C CD  . LYS C 159 ? 0.5734 0.5170 0.4602 0.0215  0.0170  0.0120  166 LYS C CD  
4772 C CE  . LYS C 159 ? 0.6201 0.5641 0.5032 0.0209  0.0158  0.0126  166 LYS C CE  
4773 N NZ  . LYS C 159 ? 0.6234 0.5699 0.5039 0.0206  0.0169  0.0136  166 LYS C NZ  
4774 N N   . LEU C 160 ? 0.3093 0.2443 0.2091 0.0219  0.0153  0.0111  167 LEU C N   
4775 C CA  . LEU C 160 ? 0.3132 0.2466 0.2170 0.0215  0.0152  0.0123  167 LEU C CA  
4776 C C   . LEU C 160 ? 0.3398 0.2736 0.2449 0.0209  0.0163  0.0138  167 LEU C C   
4777 O O   . LEU C 160 ? 0.3586 0.2933 0.2620 0.0210  0.0174  0.0135  167 LEU C O   
4778 C CB  . LEU C 160 ? 0.3183 0.2498 0.2237 0.0221  0.0162  0.0111  167 LEU C CB  
4779 C CG  . LEU C 160 ? 0.3253 0.2561 0.2302 0.0226  0.0151  0.0097  167 LEU C CG  
4780 C CD1 . LEU C 160 ? 0.3538 0.2831 0.2596 0.0231  0.0161  0.0083  167 LEU C CD1 
4781 C CD2 . LEU C 160 ? 0.3310 0.2613 0.2385 0.0221  0.0134  0.0111  167 LEU C CD2 
4782 N N   . LYS C 161 ? 0.3627 0.2959 0.2711 0.0204  0.0158  0.0155  168 LYS C N   
4783 C CA  . LYS C 161 ? 0.3812 0.3144 0.2912 0.0199  0.0167  0.0171  168 LYS C CA  
4784 C C   . LYS C 161 ? 0.4087 0.3404 0.3192 0.0201  0.0186  0.0163  168 LYS C C   
4785 O O   . LYS C 161 ? 0.4166 0.3486 0.3266 0.0197  0.0193  0.0170  168 LYS C O   
4786 C CB  . LYS C 161 ? 0.4129 0.3454 0.3270 0.0194  0.0158  0.0190  168 LYS C CB  
4787 C CG  . LYS C 161 ? 0.4284 0.3623 0.3418 0.0187  0.0136  0.0203  168 LYS C CG  
4788 C CD  . LYS C 161 ? 0.4891 0.4225 0.4074 0.0182  0.0125  0.0225  168 LYS C CD  
4789 C CE  . LYS C 161 ? 0.5060 0.4404 0.4231 0.0174  0.0098  0.0236  168 LYS C CE  
4790 N NZ  . LYS C 161 ? 0.5725 0.5065 0.4944 0.0167  0.0083  0.0260  168 LYS C NZ  
4791 N N   . ASP C 162 ? 0.4416 0.3714 0.3528 0.0206  0.0193  0.0150  169 ASP C N   
4792 C CA  . ASP C 162 ? 0.5111 0.4388 0.4221 0.0207  0.0211  0.0142  169 ASP C CA  
4793 C C   . ASP C 162 ? 0.5295 0.4580 0.4372 0.0209  0.0214  0.0129  169 ASP C C   
4794 O O   . ASP C 162 ? 0.5236 0.4504 0.4307 0.0208  0.0225  0.0124  169 ASP C O   
4795 C CB  . ASP C 162 ? 0.6011 0.5264 0.5143 0.0211  0.0218  0.0136  169 ASP C CB  
4796 C CG  . ASP C 162 ? 0.7004 0.6239 0.6172 0.0209  0.0227  0.0149  169 ASP C CG  
4797 O OD1 . ASP C 162 ? 0.7888 0.7113 0.7054 0.0206  0.0238  0.0153  169 ASP C OD1 
4798 O OD2 . ASP C 162 ? 0.8097 0.7329 0.7298 0.0211  0.0224  0.0156  169 ASP C OD2 
4799 N N   . GLY C 163 ? 0.5045 0.4355 0.4101 0.0211  0.0204  0.0126  170 GLY C N   
4800 C CA  . GLY C 163 ? 0.5772 0.5091 0.4804 0.0215  0.0207  0.0113  170 GLY C CA  
4801 C C   . GLY C 163 ? 0.5217 0.4531 0.4245 0.0222  0.0202  0.0097  170 GLY C C   
4802 O O   . GLY C 163 ? 0.6144 0.5441 0.5190 0.0223  0.0199  0.0096  170 GLY C O   
4803 N N   . GLY C 164 ? 0.5270 0.4598 0.4277 0.0227  0.0200  0.0086  171 GLY C N   
4804 C CA  . GLY C 164 ? 0.4655 0.3977 0.3656 0.0234  0.0195  0.0070  171 GLY C CA  
4805 C C   . GLY C 164 ? 0.4359 0.3693 0.3348 0.0236  0.0182  0.0069  171 GLY C C   
4806 O O   . GLY C 164 ? 0.3587 0.2935 0.2568 0.0232  0.0179  0.0080  171 GLY C O   
4807 N N   . HIS C 165 ? 0.3723 0.3048 0.2709 0.0241  0.0173  0.0056  172 HIS C N   
4808 C CA  . HIS C 165 ? 0.3555 0.2887 0.2520 0.0244  0.0160  0.0049  172 HIS C CA  
4809 C C   . HIS C 165 ? 0.3377 0.2689 0.2357 0.0246  0.0147  0.0044  172 HIS C C   
4810 O O   . HIS C 165 ? 0.3927 0.3225 0.2927 0.0248  0.0152  0.0038  172 HIS C O   
4811 C CB  . HIS C 165 ? 0.3967 0.3310 0.2905 0.0252  0.0166  0.0033  172 HIS C CB  
4812 C CG  . HIS C 165 ? 0.4654 0.3987 0.3602 0.0258  0.0171  0.0019  172 HIS C CG  
4813 N ND1 . HIS C 165 ? 0.4873 0.4194 0.3820 0.0264  0.0162  0.0003  172 HIS C ND1 
4814 C CD2 . HIS C 165 ? 0.5227 0.4559 0.4186 0.0258  0.0183  0.0019  172 HIS C CD2 
4815 C CE1 . HIS C 165 ? 0.5146 0.4460 0.4104 0.0268  0.0168  -0.0004 172 HIS C CE1 
4816 N NE2 . HIS C 165 ? 0.5207 0.4527 0.4172 0.0263  0.0180  0.0005  172 HIS C NE2 
4817 N N   . TYR C 166 ? 0.3153 0.2464 0.2121 0.0244  0.0131  0.0045  173 TYR C N   
4818 C CA  . TYR C 166 ? 0.3074 0.2369 0.2056 0.0244  0.0114  0.0041  173 TYR C CA  
4819 C C   . TYR C 166 ? 0.3193 0.2488 0.2137 0.0248  0.0100  0.0026  173 TYR C C   
4820 O O   . TYR C 166 ? 0.3416 0.2719 0.2330 0.0245  0.0096  0.0029  173 TYR C O   
4821 C CB  . TYR C 166 ? 0.3248 0.2539 0.2256 0.0236  0.0102  0.0062  173 TYR C CB  
4822 C CG  . TYR C 166 ? 0.2998 0.2274 0.2022 0.0234  0.0080  0.0064  173 TYR C CG  
4823 C CD1 . TYR C 166 ? 0.3179 0.2442 0.2232 0.0237  0.0080  0.0059  173 TYR C CD1 
4824 C CD2 . TYR C 166 ? 0.2985 0.2261 0.1999 0.0226  0.0059  0.0074  173 TYR C CD2 
4825 C CE1 . TYR C 166 ? 0.3055 0.2305 0.2130 0.0234  0.0058  0.0064  173 TYR C CE1 
4826 C CE2 . TYR C 166 ? 0.3088 0.2350 0.2124 0.0222  0.0035  0.0081  173 TYR C CE2 
4827 C CZ  . TYR C 166 ? 0.2939 0.2188 0.2006 0.0226  0.0035  0.0076  173 TYR C CZ  
4828 O OH  . TYR C 166 ? 0.3387 0.2623 0.2481 0.0222  0.0011  0.0084  173 TYR C OH  
4829 N N   . ASP C 167 ? 0.3308 0.2591 0.2250 0.0255  0.0096  0.0009  174 ASP C N   
4830 C CA  . ASP C 167 ? 0.3548 0.2828 0.2451 0.0261  0.0089  -0.0009 174 ASP C CA  
4831 C C   . ASP C 167 ? 0.3420 0.2680 0.2316 0.0258  0.0063  -0.0013 174 ASP C C   
4832 O O   . ASP C 167 ? 0.3341 0.2589 0.2271 0.0255  0.0052  -0.0005 174 ASP C O   
4833 C CB  . ASP C 167 ? 0.3777 0.3056 0.2683 0.0271  0.0102  -0.0026 174 ASP C CB  
4834 C CG  . ASP C 167 ? 0.4233 0.3530 0.3143 0.0273  0.0125  -0.0023 174 ASP C CG  
4835 O OD1 . ASP C 167 ? 0.4307 0.3618 0.3216 0.0267  0.0132  -0.0008 174 ASP C OD1 
4836 O OD2 . ASP C 167 ? 0.5018 0.4315 0.3935 0.0279  0.0133  -0.0035 174 ASP C OD2 
4837 N N   . ALA C 168 ? 0.3562 0.2818 0.2412 0.0260  0.0055  -0.0026 175 ALA C N   
4838 C CA  . ALA C 168 ? 0.3605 0.2836 0.2437 0.0258  0.0027  -0.0035 175 ALA C CA  
4839 C C   . ALA C 168 ? 0.3692 0.2916 0.2480 0.0268  0.0032  -0.0061 175 ALA C C   
4840 O O   . ALA C 168 ? 0.3669 0.2907 0.2430 0.0274  0.0053  -0.0069 175 ALA C O   
4841 C CB  . ALA C 168 ? 0.3426 0.2652 0.2235 0.0246  0.0006  -0.0021 175 ALA C CB  
4842 N N   . GLU C 169 ? 0.3535 0.2735 0.2315 0.0270  0.0011  -0.0075 176 GLU C N   
4843 C CA  . GLU C 169 ? 0.3755 0.2940 0.2488 0.0279  0.0011  -0.0100 176 GLU C CA  
4844 C C   . GLU C 169 ? 0.3699 0.2862 0.2389 0.0269  -0.0014 -0.0099 176 GLU C C   
4845 O O   . GLU C 169 ? 0.3647 0.2795 0.2359 0.0258  -0.0043 -0.0086 176 GLU C O   
4846 C CB  . GLU C 169 ? 0.4159 0.3327 0.2912 0.0286  0.0002  -0.0116 176 GLU C CB  
4847 C CG  . GLU C 169 ? 0.4911 0.4093 0.3705 0.0295  0.0023  -0.0120 176 GLU C CG  
4848 C CD  . GLU C 169 ? 0.6425 0.5585 0.5237 0.0300  0.0008  -0.0135 176 GLU C CD  
4849 O OE1 . GLU C 169 ? 0.6124 0.5260 0.4927 0.0295  -0.0019 -0.0138 176 GLU C OE1 
4850 O OE2 . GLU C 169 ? 0.7348 0.6516 0.6185 0.0309  0.0022  -0.0142 176 GLU C OE2 
4851 N N   . VAL C 170 ? 0.3473 0.2632 0.2101 0.0271  -0.0008 -0.0112 177 VAL C N   
4852 C CA  . VAL C 170 ? 0.3415 0.2551 0.1993 0.0259  -0.0032 -0.0111 177 VAL C CA  
4853 C C   . VAL C 170 ? 0.3602 0.2710 0.2118 0.0267  -0.0035 -0.0140 177 VAL C C   
4854 O O   . VAL C 170 ? 0.3603 0.2719 0.2095 0.0280  -0.0006 -0.0159 177 VAL C O   
4855 C CB  . VAL C 170 ? 0.3662 0.2817 0.2214 0.0251  -0.0022 -0.0093 177 VAL C CB  
4856 C CG1 . VAL C 170 ? 0.3701 0.2829 0.2190 0.0237  -0.0049 -0.0091 177 VAL C CG1 
4857 C CG2 . VAL C 170 ? 0.3617 0.2797 0.2230 0.0244  -0.0020 -0.0064 177 VAL C CG2 
4858 N N   . LYS C 171 ? 0.3634 0.2706 0.2120 0.0258  -0.0069 -0.0144 178 LYS C N   
4859 C CA  . LYS C 171 ? 0.3776 0.2814 0.2194 0.0263  -0.0074 -0.0174 178 LYS C CA  
4860 C C   . LYS C 171 ? 0.3866 0.2873 0.2223 0.0246  -0.0105 -0.0169 178 LYS C C   
4861 O O   . LYS C 171 ? 0.3576 0.2572 0.1960 0.0231  -0.0140 -0.0148 178 LYS C O   
4862 C CB  . LYS C 171 ? 0.3843 0.2857 0.2281 0.0273  -0.0086 -0.0195 178 LYS C CB  
4863 C CG  . LYS C 171 ? 0.4538 0.3512 0.2899 0.0278  -0.0089 -0.0227 178 LYS C CG  
4864 C CD  . LYS C 171 ? 0.4937 0.3897 0.3325 0.0293  -0.0089 -0.0250 178 LYS C CD  
4865 C CE  . LYS C 171 ? 0.5446 0.4369 0.3765 0.0303  -0.0086 -0.0285 178 LYS C CE  
4866 N NZ  . LYS C 171 ? 0.6009 0.4915 0.4365 0.0314  -0.0095 -0.0302 178 LYS C NZ  
4867 N N   . THR C 172 ? 0.3808 0.2797 0.2084 0.0248  -0.0094 -0.0187 179 THR C N   
4868 C CA  . THR C 172 ? 0.3918 0.2877 0.2130 0.0231  -0.0122 -0.0182 179 THR C CA  
4869 C C   . THR C 172 ? 0.4140 0.3053 0.2266 0.0236  -0.0126 -0.0216 179 THR C C   
4870 O O   . THR C 172 ? 0.4196 0.3111 0.2295 0.0254  -0.0091 -0.0242 179 THR C O   
4871 C CB  . THR C 172 ? 0.3828 0.2813 0.2013 0.0222  -0.0106 -0.0161 179 THR C CB  
4872 O OG1 . THR C 172 ? 0.3799 0.2829 0.2063 0.0221  -0.0095 -0.0133 179 THR C OG1 
4873 C CG2 . THR C 172 ? 0.4272 0.3228 0.2402 0.0200  -0.0140 -0.0149 179 THR C CG2 
4874 N N   . THR C 173 ? 0.3978 0.2847 0.2065 0.0220  -0.0168 -0.0216 180 THR C N   
4875 C CA  . THR C 173 ? 0.4267 0.3084 0.2260 0.0221  -0.0176 -0.0247 180 THR C CA  
4876 C C   . THR C 173 ? 0.4426 0.3223 0.2331 0.0202  -0.0188 -0.0237 180 THR C C   
4877 O O   . THR C 173 ? 0.4327 0.3120 0.2240 0.0179  -0.0224 -0.0208 180 THR C O   
4878 C CB  . THR C 173 ? 0.4357 0.3131 0.2359 0.0217  -0.0217 -0.0258 180 THR C CB  
4879 O OG1 . THR C 173 ? 0.4802 0.3594 0.2877 0.0236  -0.0202 -0.0269 180 THR C OG1 
4880 C CG2 . THR C 173 ? 0.4781 0.3494 0.2682 0.0215  -0.0231 -0.0290 180 THR C CG2 
4881 N N   . TYR C 174 ? 0.4557 0.3343 0.2380 0.0209  -0.0156 -0.0260 181 TYR C N   
4882 C CA  . TYR C 174 ? 0.4646 0.3413 0.2380 0.0191  -0.0163 -0.0251 181 TYR C CA  
4883 C C   . TYR C 174 ? 0.4915 0.3615 0.2541 0.0191  -0.0174 -0.0287 181 TYR C C   
4884 O O   . TYR C 174 ? 0.5327 0.4016 0.2926 0.0212  -0.0139 -0.0320 181 TYR C O   
4885 C CB  . TYR C 174 ? 0.4797 0.3603 0.2512 0.0199  -0.0114 -0.0247 181 TYR C CB  
4886 C CG  . TYR C 174 ? 0.4767 0.3638 0.2582 0.0206  -0.0091 -0.0221 181 TYR C CG  
4887 C CD1 . TYR C 174 ? 0.4523 0.3424 0.2408 0.0229  -0.0060 -0.0234 181 TYR C CD1 
4888 C CD2 . TYR C 174 ? 0.4687 0.3587 0.2526 0.0189  -0.0102 -0.0185 181 TYR C CD2 
4889 C CE1 . TYR C 174 ? 0.4668 0.3624 0.2637 0.0234  -0.0041 -0.0210 181 TYR C CE1 
4890 C CE2 . TYR C 174 ? 0.4762 0.3716 0.2688 0.0195  -0.0082 -0.0163 181 TYR C CE2 
4891 C CZ  . TYR C 174 ? 0.4578 0.3559 0.2565 0.0217  -0.0051 -0.0176 181 TYR C CZ  
4892 O OH  . TYR C 174 ? 0.4937 0.3969 0.3011 0.0221  -0.0035 -0.0152 181 TYR C OH  
4893 N N   . LYS C 175 ? 0.4809 0.3462 0.2378 0.0166  -0.0222 -0.0278 182 LYS C N   
4894 C CA  . LYS C 175 ? 0.5064 0.3646 0.2530 0.0163  -0.0239 -0.0311 182 LYS C CA  
4895 C C   . LYS C 175 ? 0.5296 0.3845 0.2653 0.0139  -0.0255 -0.0303 182 LYS C C   
4896 O O   . LYS C 175 ? 0.5374 0.3923 0.2738 0.0113  -0.0296 -0.0269 182 LYS C O   
4897 C CB  . LYS C 175 ? 0.5050 0.3595 0.2547 0.0154  -0.0292 -0.0312 182 LYS C CB  
4898 C CG  . LYS C 175 ? 0.5587 0.4054 0.2983 0.0150  -0.0316 -0.0346 182 LYS C CG  
4899 C CD  . LYS C 175 ? 0.6045 0.4497 0.3470 0.0174  -0.0303 -0.0380 182 LYS C CD  
4900 C CE  . LYS C 175 ? 0.6141 0.4510 0.3466 0.0167  -0.0334 -0.0413 182 LYS C CE  
4901 N NZ  . LYS C 175 ? 0.6786 0.5123 0.3986 0.0163  -0.0310 -0.0431 182 LYS C NZ  
4902 N N   . ALA C 176 ? 0.5651 0.4168 0.2904 0.0148  -0.0222 -0.0335 183 ALA C N   
4903 C CA  . ALA C 176 ? 0.5635 0.4111 0.2767 0.0126  -0.0233 -0.0333 183 ALA C CA  
4904 C C   . ALA C 176 ? 0.5802 0.4202 0.2866 0.0103  -0.0296 -0.0339 183 ALA C C   
4905 O O   . ALA C 176 ? 0.6035 0.4401 0.3110 0.0111  -0.0314 -0.0363 183 ALA C O   
4906 C CB  . ALA C 176 ? 0.5874 0.4335 0.2913 0.0143  -0.0176 -0.0367 183 ALA C CB  
4907 N N   . LYS C 177 ? 0.5782 0.4159 0.2786 0.0072  -0.0333 -0.0314 184 LYS C N   
4908 C CA  . LYS C 177 ? 0.6413 0.4721 0.3360 0.0045  -0.0400 -0.0311 184 LYS C CA  
4909 C C   . LYS C 177 ? 0.7084 0.5314 0.3900 0.0049  -0.0393 -0.0359 184 LYS C C   
4910 O O   . LYS C 177 ? 0.7678 0.5851 0.4472 0.0042  -0.0437 -0.0374 184 LYS C O   
4911 C CB  . LYS C 177 ? 0.6305 0.4610 0.3219 0.0010  -0.0439 -0.0270 184 LYS C CB  
4912 C CG  . LYS C 177 ? 0.6341 0.4705 0.3390 0.0002  -0.0465 -0.0222 184 LYS C CG  
4913 C CD  . LYS C 177 ? 0.6391 0.4771 0.3418 -0.0024 -0.0483 -0.0182 184 LYS C CD  
4914 C CE  . LYS C 177 ? 0.6250 0.4692 0.3417 -0.0029 -0.0500 -0.0137 184 LYS C CE  
4915 N NZ  . LYS C 177 ? 0.6011 0.4465 0.3160 -0.0057 -0.0522 -0.0096 184 LYS C NZ  
4916 N N   . LYS C 178 ? 0.7568 0.5796 0.4299 0.0061  -0.0339 -0.0381 185 LYS C N   
4917 C CA  . LYS C 178 ? 0.7934 0.6093 0.4545 0.0073  -0.0316 -0.0432 185 LYS C CA  
4918 C C   . LYS C 178 ? 0.8056 0.6254 0.4715 0.0113  -0.0245 -0.0463 185 LYS C C   
4919 O O   . LYS C 178 ? 0.7910 0.6183 0.4644 0.0128  -0.0202 -0.0446 185 LYS C O   
4920 C CB  . LYS C 178 ? 0.8477 0.6592 0.4939 0.0052  -0.0311 -0.0435 185 LYS C CB  
4921 C CG  . LYS C 178 ? 0.9077 0.7240 0.5515 0.0066  -0.0242 -0.0433 185 LYS C CG  
4922 C CD  . LYS C 178 ? 0.8947 0.7177 0.5448 0.0049  -0.0247 -0.0381 185 LYS C CD  
4923 C CE  . LYS C 178 ? 0.9252 0.7493 0.5667 0.0048  -0.0199 -0.0379 185 LYS C CE  
4924 N NZ  . LYS C 178 ? 0.9122 0.7403 0.5558 0.0084  -0.0119 -0.0406 185 LYS C NZ  
4925 N N   . PRO C 179 ? 0.7664 0.5812 0.4282 0.0132  -0.0233 -0.0509 186 PRO C N   
4926 C CA  . PRO C 179 ? 0.7320 0.5506 0.3996 0.0170  -0.0169 -0.0536 186 PRO C CA  
4927 C C   . PRO C 179 ? 0.7414 0.5627 0.4036 0.0185  -0.0099 -0.0545 186 PRO C C   
4928 O O   . PRO C 179 ? 0.7052 0.5212 0.3543 0.0178  -0.0086 -0.0565 186 PRO C O   
4929 C CB  . PRO C 179 ? 0.7702 0.5816 0.4326 0.0182  -0.0179 -0.0583 186 PRO C CB  
4930 C CG  . PRO C 179 ? 0.7806 0.5836 0.4284 0.0154  -0.0217 -0.0592 186 PRO C CG  
4931 C CD  . PRO C 179 ? 0.7991 0.6041 0.4490 0.0119  -0.0269 -0.0541 186 PRO C CD  
4932 N N   . VAL C 180 ? 0.6552 0.4846 0.3274 0.0203  -0.0056 -0.0527 187 VAL C N   
4933 C CA  . VAL C 180 ? 0.6511 0.4835 0.3199 0.0219  0.0011  -0.0534 187 VAL C CA  
4934 C C   . VAL C 180 ? 0.6388 0.4770 0.3189 0.0254  0.0059  -0.0545 187 VAL C C   
4935 O O   . VAL C 180 ? 0.6099 0.4494 0.2994 0.0262  0.0035  -0.0544 187 VAL C O   
4936 C CB  . VAL C 180 ? 0.6711 0.5081 0.3398 0.0198  0.0011  -0.0490 187 VAL C CB  
4937 C CG1 . VAL C 180 ? 0.7157 0.5467 0.3723 0.0163  -0.0032 -0.0482 187 VAL C CG1 
4938 C CG2 . VAL C 180 ? 0.6492 0.4930 0.3316 0.0191  -0.0015 -0.0448 187 VAL C CG2 
4939 N N   . GLN C 181 ? 0.6326 0.4741 0.3116 0.0275  0.0126  -0.0555 188 GLN C N   
4940 C CA  . GLN C 181 ? 0.6344 0.4799 0.3221 0.0310  0.0176  -0.0573 188 GLN C CA  
4941 C C   . GLN C 181 ? 0.5763 0.4297 0.2787 0.0314  0.0170  -0.0537 188 GLN C C   
4942 O O   . GLN C 181 ? 0.5627 0.4210 0.2677 0.0302  0.0175  -0.0502 188 GLN C O   
4943 C CB  . GLN C 181 ? 0.6752 0.5223 0.3581 0.0329  0.0249  -0.0587 188 GLN C CB  
4944 C CG  . GLN C 181 ? 0.7358 0.5847 0.4244 0.0366  0.0303  -0.0617 188 GLN C CG  
4945 C CD  . GLN C 181 ? 0.7867 0.6389 0.4733 0.0385  0.0377  -0.0621 188 GLN C CD  
4946 O OE1 . GLN C 181 ? 0.7828 0.6365 0.4737 0.0415  0.0426  -0.0643 188 GLN C OE1 
4947 N NE2 . GLN C 181 ? 0.7530 0.6066 0.4337 0.0366  0.0386  -0.0597 188 GLN C NE2 
4948 N N   . LEU C 182 ? 0.5692 0.4233 0.2803 0.0330  0.0160  -0.0549 189 LEU C N   
4949 C CA  . LEU C 182 ? 0.5298 0.3908 0.2549 0.0337  0.0158  -0.0522 189 LEU C CA  
4950 C C   . LEU C 182 ? 0.5114 0.3778 0.2418 0.0364  0.0223  -0.0526 189 LEU C C   
4951 O O   . LEU C 182 ? 0.5513 0.4157 0.2775 0.0384  0.0264  -0.0558 189 LEU C O   
4952 C CB  . LEU C 182 ? 0.5268 0.3858 0.2580 0.0343  0.0123  -0.0535 189 LEU C CB  
4953 C CG  . LEU C 182 ? 0.5411 0.3964 0.2712 0.0316  0.0052  -0.0520 189 LEU C CG  
4954 C CD1 . LEU C 182 ? 0.5367 0.3884 0.2701 0.0324  0.0022  -0.0543 189 LEU C CD1 
4955 C CD2 . LEU C 182 ? 0.5342 0.3956 0.2734 0.0301  0.0031  -0.0473 189 LEU C CD2 
4956 N N   . PRO C 183 ? 0.5056 0.3791 0.2457 0.0365  0.0232  -0.0493 190 PRO C N   
4957 C CA  . PRO C 183 ? 0.4775 0.3561 0.2236 0.0389  0.0289  -0.0493 190 PRO C CA  
4958 C C   . PRO C 183 ? 0.4816 0.3608 0.2361 0.0410  0.0290  -0.0510 190 PRO C C   
4959 O O   . PRO C 183 ? 0.4815 0.3574 0.2372 0.0403  0.0245  -0.0518 190 PRO C O   
4960 C CB  . PRO C 183 ? 0.4838 0.3688 0.2363 0.0376  0.0286  -0.0449 190 PRO C CB  
4961 C CG  . PRO C 183 ? 0.4764 0.3605 0.2321 0.0355  0.0225  -0.0429 190 PRO C CG  
4962 C CD  . PRO C 183 ? 0.4891 0.3656 0.2351 0.0343  0.0190  -0.0453 190 PRO C CD  
4963 N N   . GLY C 184 ? 0.4964 0.3796 0.2569 0.0434  0.0337  -0.0515 191 GLY C N   
4964 C CA  . GLY C 184 ? 0.4894 0.3749 0.2603 0.0449  0.0334  -0.0517 191 GLY C CA  
4965 C C   . GLY C 184 ? 0.4920 0.3832 0.2719 0.0437  0.0317  -0.0477 191 GLY C C   
4966 O O   . GLY C 184 ? 0.4947 0.3869 0.2728 0.0415  0.0294  -0.0450 191 GLY C O   
4967 N N   . ALA C 185 ? 0.4408 0.3356 0.2305 0.0451  0.0327  -0.0472 192 ALA C N   
4968 C CA  . ALA C 185 ? 0.4318 0.3319 0.2302 0.0442  0.0314  -0.0436 192 ALA C CA  
4969 C C   . ALA C 185 ? 0.4537 0.3587 0.2530 0.0442  0.0350  -0.0413 192 ALA C C   
4970 O O   . ALA C 185 ? 0.4496 0.3560 0.2484 0.0459  0.0397  -0.0423 192 ALA C O   
4971 C CB  . ALA C 185 ? 0.4256 0.3275 0.2334 0.0456  0.0313  -0.0439 192 ALA C CB  
4972 N N   . TYR C 186 ? 0.4413 0.3492 0.2431 0.0422  0.0329  -0.0378 193 TYR C N   
4973 C CA  . TYR C 186 ? 0.4513 0.3641 0.2550 0.0418  0.0355  -0.0350 193 TYR C CA  
4974 C C   . TYR C 186 ? 0.4558 0.3712 0.2645 0.0398  0.0322  -0.0315 193 TYR C C   
4975 O O   . TYR C 186 ? 0.4107 0.3241 0.2215 0.0390  0.0283  -0.0315 193 TYR C O   
4976 C CB  . TYR C 186 ? 0.4723 0.3837 0.2666 0.0412  0.0376  -0.0353 193 TYR C CB  
4977 C CG  . TYR C 186 ? 0.4983 0.4069 0.2858 0.0387  0.0337  -0.0342 193 TYR C CG  
4978 C CD1 . TYR C 186 ? 0.4992 0.4021 0.2811 0.0379  0.0302  -0.0362 193 TYR C CD1 
4979 C CD2 . TYR C 186 ? 0.4814 0.3929 0.2683 0.0369  0.0335  -0.0309 193 TYR C CD2 
4980 C CE1 . TYR C 186 ? 0.5112 0.4115 0.2874 0.0354  0.0263  -0.0348 193 TYR C CE1 
4981 C CE2 . TYR C 186 ? 0.5177 0.4267 0.2990 0.0346  0.0299  -0.0297 193 TYR C CE2 
4982 C CZ  . TYR C 186 ? 0.5086 0.4119 0.2844 0.0338  0.0262  -0.0316 193 TYR C CZ  
4983 O OH  . TYR C 186 ? 0.5317 0.4326 0.3022 0.0312  0.0224  -0.0299 193 TYR C OH  
4984 N N   . ASN C 187 ? 0.4360 0.3560 0.2475 0.0392  0.0339  -0.0287 194 ASN C N   
4985 C CA  . ASN C 187 ? 0.4438 0.3666 0.2610 0.0376  0.0315  -0.0254 194 ASN C CA  
4986 C C   . ASN C 187 ? 0.4201 0.3441 0.2334 0.0359  0.0312  -0.0230 194 ASN C C   
4987 O O   . ASN C 187 ? 0.4224 0.3470 0.2306 0.0361  0.0341  -0.0231 194 ASN C O   
4988 C CB  . ASN C 187 ? 0.4930 0.4205 0.3190 0.0386  0.0336  -0.0238 194 ASN C CB  
4989 C CG  . ASN C 187 ? 0.5602 0.4872 0.3907 0.0403  0.0343  -0.0259 194 ASN C CG  
4990 O OD1 . ASN C 187 ? 0.6101 0.5348 0.4425 0.0401  0.0313  -0.0267 194 ASN C OD1 
4991 N ND2 . ASN C 187 ? 0.6363 0.5652 0.4683 0.0422  0.0382  -0.0268 194 ASN C ND2 
4992 N N   . VAL C 188 ? 0.4115 0.3359 0.2273 0.0340  0.0277  -0.0206 195 VAL C N   
4993 C CA  . VAL C 188 ? 0.4130 0.3386 0.2257 0.0321  0.0270  -0.0179 195 VAL C CA  
4994 C C   . VAL C 188 ? 0.4149 0.3445 0.2355 0.0314  0.0265  -0.0148 195 VAL C C   
4995 O O   . VAL C 188 ? 0.4140 0.3434 0.2396 0.0310  0.0239  -0.0141 195 VAL C O   
4996 C CB  . VAL C 188 ? 0.4138 0.3354 0.2208 0.0302  0.0230  -0.0178 195 VAL C CB  
4997 C CG1 . VAL C 188 ? 0.4157 0.3387 0.2201 0.0282  0.0221  -0.0148 195 VAL C CG1 
4998 C CG2 . VAL C 188 ? 0.4158 0.3327 0.2143 0.0308  0.0232  -0.0210 195 VAL C CG2 
4999 N N   . ASN C 189 ? 0.4465 0.3798 0.2679 0.0313  0.0292  -0.0129 196 ASN C N   
5000 C CA  . ASN C 189 ? 0.4211 0.3580 0.2492 0.0306  0.0288  -0.0099 196 ASN C CA  
5001 C C   . ASN C 189 ? 0.4200 0.3565 0.2458 0.0283  0.0261  -0.0074 196 ASN C C   
5002 O O   . ASN C 189 ? 0.4124 0.3487 0.2324 0.0275  0.0267  -0.0067 196 ASN C O   
5003 C CB  . ASN C 189 ? 0.4616 0.4025 0.2920 0.0314  0.0327  -0.0088 196 ASN C CB  
5004 C CG  . ASN C 189 ? 0.5564 0.4980 0.3903 0.0336  0.0352  -0.0108 196 ASN C CG  
5005 O OD1 . ASN C 189 ? 0.6020 0.5425 0.4400 0.0342  0.0338  -0.0120 196 ASN C OD1 
5006 N ND2 . ASN C 189 ? 0.5920 0.5356 0.4246 0.0347  0.0391  -0.0112 196 ASN C ND2 
5007 N N   . ILE C 190 ? 0.3998 0.3364 0.2307 0.0274  0.0233  -0.0058 197 ILE C N   
5008 C CA  . ILE C 190 ? 0.3965 0.3326 0.2261 0.0253  0.0205  -0.0034 197 ILE C CA  
5009 C C   . ILE C 190 ? 0.4028 0.3418 0.2393 0.0246  0.0201  -0.0006 197 ILE C C   
5010 O O   . ILE C 190 ? 0.4077 0.3474 0.2502 0.0254  0.0202  -0.0008 197 ILE C O   
5011 C CB  . ILE C 190 ? 0.4276 0.3598 0.2562 0.0245  0.0166  -0.0042 197 ILE C CB  
5012 C CG1 . ILE C 190 ? 0.4569 0.3855 0.2782 0.0250  0.0165  -0.0070 197 ILE C CG1 
5013 C CG2 . ILE C 190 ? 0.4371 0.3688 0.2655 0.0224  0.0134  -0.0015 197 ILE C CG2 
5014 C CD1 . ILE C 190 ? 0.4970 0.4219 0.3187 0.0249  0.0131  -0.0084 197 ILE C CD1 
5015 N N   . LYS C 191 ? 0.4070 0.3472 0.2424 0.0231  0.0195  0.0019  198 LYS C N   
5016 C CA  . LYS C 191 ? 0.4286 0.3709 0.2705 0.0223  0.0186  0.0046  198 LYS C CA  
5017 C C   . LYS C 191 ? 0.4035 0.3449 0.2440 0.0202  0.0156  0.0069  198 LYS C C   
5018 O O   . LYS C 191 ? 0.3948 0.3363 0.2300 0.0192  0.0156  0.0080  198 LYS C O   
5019 C CB  . LYS C 191 ? 0.4681 0.4142 0.3127 0.0228  0.0217  0.0058  198 LYS C CB  
5020 C CG  . LYS C 191 ? 0.5141 0.4622 0.3648 0.0219  0.0210  0.0085  198 LYS C CG  
5021 C CD  . LYS C 191 ? 0.5518 0.5032 0.4056 0.0226  0.0239  0.0093  198 LYS C CD  
5022 C CE  . LYS C 191 ? 0.5971 0.5497 0.4574 0.0221  0.0232  0.0113  198 LYS C CE  
5023 N NZ  . LYS C 191 ? 0.6262 0.5792 0.4869 0.0203  0.0215  0.0141  198 LYS C NZ  
5024 N N   . LEU C 192 ? 0.3918 0.3322 0.2370 0.0197  0.0131  0.0079  199 LEU C N   
5025 C CA  . LEU C 192 ? 0.4268 0.3659 0.2717 0.0178  0.0098  0.0101  199 LEU C CA  
5026 C C   . LEU C 192 ? 0.4259 0.3671 0.2773 0.0172  0.0097  0.0127  199 LEU C C   
5027 O O   . LEU C 192 ? 0.4072 0.3488 0.2643 0.0180  0.0102  0.0123  199 LEU C O   
5028 C CB  . LEU C 192 ? 0.4700 0.4058 0.3152 0.0176  0.0069  0.0090  199 LEU C CB  
5029 C CG  . LEU C 192 ? 0.5418 0.4757 0.3869 0.0157  0.0030  0.0112  199 LEU C CG  
5030 C CD1 . LEU C 192 ? 0.5854 0.5163 0.4315 0.0159  0.0006  0.0097  199 LEU C CD1 
5031 C CD2 . LEU C 192 ? 0.5709 0.5067 0.4224 0.0147  0.0022  0.0143  199 LEU C CD2 
5032 N N   . ASP C 193 ? 0.4325 0.3748 0.2828 0.0157  0.0090  0.0154  200 ASP C N   
5033 C CA  . ASP C 193 ? 0.4426 0.3869 0.2989 0.0150  0.0089  0.0180  200 ASP C CA  
5034 C C   . ASP C 193 ? 0.4368 0.3798 0.2942 0.0132  0.0055  0.0204  200 ASP C C   
5035 O O   . ASP C 193 ? 0.4456 0.3876 0.2978 0.0120  0.0038  0.0211  200 ASP C O   
5036 C CB  . ASP C 193 ? 0.4827 0.4301 0.3377 0.0148  0.0112  0.0194  200 ASP C CB  
5037 C CG  . ASP C 193 ? 0.5268 0.4758 0.3814 0.0165  0.0146  0.0175  200 ASP C CG  
5038 O OD1 . ASP C 193 ? 0.5101 0.4592 0.3692 0.0176  0.0155  0.0163  200 ASP C OD1 
5039 O OD2 . ASP C 193 ? 0.5597 0.5101 0.4097 0.0166  0.0165  0.0174  200 ASP C OD2 
5040 N N   . ILE C 194 ? 0.4190 0.3619 0.2832 0.0131  0.0044  0.0217  201 ILE C N   
5041 C CA  . ILE C 194 ? 0.4405 0.3829 0.3072 0.0114  0.0015  0.0246  201 ILE C CA  
5042 C C   . ILE C 194 ? 0.4383 0.3832 0.3054 0.0106  0.0026  0.0270  201 ILE C C   
5043 O O   . ILE C 194 ? 0.4606 0.4073 0.3314 0.0114  0.0048  0.0271  201 ILE C O   
5044 C CB  . ILE C 194 ? 0.4647 0.4062 0.3392 0.0116  0.0006  0.0254  201 ILE C CB  
5045 C CG1 . ILE C 194 ? 0.4480 0.3872 0.3230 0.0126  0.0000  0.0231  201 ILE C CG1 
5046 C CG2 . ILE C 194 ? 0.4510 0.3921 0.3283 0.0099  -0.0022 0.0286  201 ILE C CG2 
5047 C CD1 . ILE C 194 ? 0.4831 0.4201 0.3541 0.0115  -0.0031 0.0232  201 ILE C CD1 
5048 N N   . THR C 195 ? 0.4314 0.3764 0.2945 0.0090  0.0009  0.0289  202 THR C N   
5049 C CA  . THR C 195 ? 0.4504 0.3979 0.3134 0.0081  0.0018  0.0313  202 THR C CA  
5050 C C   . THR C 195 ? 0.4529 0.4007 0.3211 0.0066  -0.0004 0.0346  202 THR C C   
5051 O O   . THR C 195 ? 0.4599 0.4097 0.3298 0.0061  0.0003  0.0365  202 THR C O   
5052 C CB  . THR C 195 ? 0.4760 0.4240 0.3310 0.0072  0.0021  0.0315  202 THR C CB  
5053 O OG1 . THR C 195 ? 0.4896 0.4351 0.3406 0.0057  -0.0011 0.0322  202 THR C OG1 
5054 C CG2 . THR C 195 ? 0.4905 0.4390 0.3410 0.0088  0.0052  0.0286  202 THR C CG2 
5055 N N   . SER C 196 ? 0.4384 0.3840 0.3092 0.0059  -0.0034 0.0354  203 SER C N   
5056 C CA  . SER C 196 ? 0.4714 0.4171 0.3491 0.0049  -0.0054 0.0384  203 SER C CA  
5057 C C   . SER C 196 ? 0.4782 0.4214 0.3593 0.0046  -0.0082 0.0386  203 SER C C   
5058 O O   . SER C 196 ? 0.4909 0.4323 0.3683 0.0046  -0.0094 0.0370  203 SER C O   
5059 C CB  . SER C 196 ? 0.5022 0.4489 0.3781 0.0028  -0.0072 0.0417  203 SER C CB  
5060 O OG  . SER C 196 ? 0.5154 0.4605 0.3856 0.0013  -0.0099 0.0422  203 SER C OG  
5061 N N   . HIS C 197 ? 0.4722 0.4154 0.3609 0.0043  -0.0091 0.0406  204 HIS C N   
5062 C CA  . HIS C 197 ? 0.4633 0.4045 0.3565 0.0039  -0.0118 0.0415  204 HIS C CA  
5063 C C   . HIS C 197 ? 0.4581 0.3997 0.3594 0.0033  -0.0127 0.0445  204 HIS C C   
5064 O O   . HIS C 197 ? 0.4610 0.4041 0.3651 0.0037  -0.0107 0.0451  204 HIS C O   
5065 C CB  . HIS C 197 ? 0.4606 0.4007 0.3562 0.0057  -0.0102 0.0387  204 HIS C CB  
5066 C CG  . HIS C 197 ? 0.4944 0.4355 0.3942 0.0073  -0.0068 0.0376  204 HIS C CG  
5067 N ND1 . HIS C 197 ? 0.5173 0.4583 0.4249 0.0075  -0.0065 0.0392  204 HIS C ND1 
5068 C CD2 . HIS C 197 ? 0.4977 0.4397 0.3950 0.0086  -0.0036 0.0353  204 HIS C CD2 
5069 C CE1 . HIS C 197 ? 0.5215 0.4630 0.4306 0.0088  -0.0033 0.0377  204 HIS C CE1 
5070 N NE2 . HIS C 197 ? 0.5105 0.4527 0.4136 0.0095  -0.0017 0.0354  204 HIS C NE2 
5071 N N   . ASN C 198 ? 0.4299 0.3701 0.3355 0.0024  -0.0158 0.0464  205 ASN C N   
5072 C CA  . ASN C 198 ? 0.4439 0.3842 0.3585 0.0021  -0.0165 0.0490  205 ASN C CA  
5073 C C   . ASN C 198 ? 0.4517 0.3911 0.3728 0.0040  -0.0142 0.0475  205 ASN C C   
5074 O O   . ASN C 198 ? 0.4613 0.4002 0.3801 0.0054  -0.0124 0.0445  205 ASN C O   
5075 C CB  . ASN C 198 ? 0.4577 0.3972 0.3742 0.0000  -0.0210 0.0524  205 ASN C CB  
5076 C CG  . ASN C 198 ? 0.4442 0.3815 0.3609 -0.0002 -0.0235 0.0520  205 ASN C CG  
5077 O OD1 . ASN C 198 ? 0.4254 0.3619 0.3413 0.0012  -0.0219 0.0491  205 ASN C OD1 
5078 N ND2 . ASN C 198 ? 0.4646 0.4010 0.3825 -0.0022 -0.0279 0.0550  205 ASN C ND2 
5079 N N   . GLU C 199 ? 0.5130 0.4524 0.4423 0.0041  -0.0141 0.0495  206 GLU C N   
5080 C CA  . GLU C 199 ? 0.5377 0.4764 0.4725 0.0059  -0.0111 0.0480  206 GLU C CA  
5081 C C   . GLU C 199 ? 0.5254 0.4626 0.4614 0.0066  -0.0115 0.0465  206 GLU C C   
5082 O O   . GLU C 199 ? 0.5420 0.4787 0.4777 0.0082  -0.0088 0.0439  206 GLU C O   
5083 C CB  . GLU C 199 ? 0.6187 0.5573 0.5621 0.0058  -0.0107 0.0505  206 GLU C CB  
5084 C CG  . GLU C 199 ? 0.7059 0.6433 0.6549 0.0077  -0.0076 0.0489  206 GLU C CG  
5085 C CD  . GLU C 199 ? 0.7415 0.6786 0.6968 0.0080  -0.0060 0.0504  206 GLU C CD  
5086 O OE1 . GLU C 199 ? 0.7664 0.7040 0.7254 0.0067  -0.0082 0.0535  206 GLU C OE1 
5087 O OE2 . GLU C 199 ? 0.7653 0.7015 0.7221 0.0094  -0.0026 0.0485  206 GLU C OE2 
5088 N N   . ASP C 200 ? 0.4814 0.4178 0.4185 0.0054  -0.0151 0.0483  207 ASP C N   
5089 C CA  . ASP C 200 ? 0.4770 0.4120 0.4157 0.0060  -0.0157 0.0471  207 ASP C CA  
5090 C C   . ASP C 200 ? 0.4546 0.3889 0.3849 0.0057  -0.0172 0.0450  207 ASP C C   
5091 O O   . ASP C 200 ? 0.4395 0.3724 0.3707 0.0059  -0.0184 0.0443  207 ASP C O   
5092 C CB  . ASP C 200 ? 0.4833 0.4176 0.4303 0.0052  -0.0184 0.0502  207 ASP C CB  
5093 C CG  . ASP C 200 ? 0.5110 0.4451 0.4562 0.0029  -0.0231 0.0531  207 ASP C CG  
5094 O OD1 . ASP C 200 ? 0.5167 0.4512 0.4538 0.0018  -0.0242 0.0528  207 ASP C OD1 
5095 O OD2 . ASP C 200 ? 0.4982 0.4317 0.4505 0.0021  -0.0257 0.0558  207 ASP C OD2 
5096 N N   . TYR C 201 ? 0.4374 0.3726 0.3598 0.0054  -0.0165 0.0437  208 TYR C N   
5097 C CA  . TYR C 201 ? 0.4379 0.3723 0.3518 0.0054  -0.0171 0.0413  208 TYR C CA  
5098 C C   . TYR C 201 ? 0.4527 0.3854 0.3648 0.0038  -0.0215 0.0426  208 TYR C C   
5099 O O   . TYR C 201 ? 0.4586 0.3897 0.3662 0.0040  -0.0223 0.0406  208 TYR C O   
5100 C CB  . TYR C 201 ? 0.4509 0.3848 0.3641 0.0073  -0.0144 0.0379  208 TYR C CB  
5101 C CG  . TYR C 201 ? 0.4410 0.3764 0.3515 0.0087  -0.0105 0.0357  208 TYR C CG  
5102 C CD1 . TYR C 201 ? 0.4536 0.3896 0.3695 0.0097  -0.0078 0.0359  208 TYR C CD1 
5103 C CD2 . TYR C 201 ? 0.4794 0.4151 0.3818 0.0089  -0.0095 0.0335  208 TYR C CD2 
5104 C CE1 . TYR C 201 ? 0.4614 0.3985 0.3748 0.0107  -0.0046 0.0341  208 TYR C CE1 
5105 C CE2 . TYR C 201 ? 0.4776 0.4146 0.3780 0.0101  -0.0061 0.0317  208 TYR C CE2 
5106 C CZ  . TYR C 201 ? 0.5039 0.4416 0.4099 0.0109  -0.0039 0.0321  208 TYR C CZ  
5107 O OH  . TYR C 201 ? 0.6172 0.5560 0.5215 0.0119  -0.0008 0.0305  208 TYR C OH  
5108 N N   . THR C 202 ? 0.4224 0.3551 0.3380 0.0021  -0.0245 0.0461  209 THR C N   
5109 C CA  . THR C 202 ? 0.4217 0.3526 0.3345 0.0001  -0.0291 0.0478  209 THR C CA  
5110 C C   . THR C 202 ? 0.4090 0.3398 0.3123 -0.0014 -0.0304 0.0479  209 THR C C   
5111 O O   . THR C 202 ? 0.4549 0.3837 0.3534 -0.0031 -0.0341 0.0486  209 THR C O   
5112 C CB  . THR C 202 ? 0.4300 0.3606 0.3516 -0.0011 -0.0323 0.0517  209 THR C CB  
5113 O OG1 . THR C 202 ? 0.4464 0.3787 0.3708 -0.0017 -0.0317 0.0541  209 THR C OG1 
5114 C CG2 . THR C 202 ? 0.4691 0.3994 0.3999 0.0003  -0.0311 0.0515  209 THR C CG2 
5115 N N   . ILE C 203 ? 0.4259 0.3588 0.3266 -0.0009 -0.0276 0.0475  210 ILE C N   
5116 C CA  . ILE C 203 ? 0.4243 0.3575 0.3152 -0.0018 -0.0274 0.0468  210 ILE C CA  
5117 C C   . ILE C 203 ? 0.4194 0.3542 0.3067 0.0001  -0.0227 0.0436  210 ILE C C   
5118 O O   . ILE C 203 ? 0.4215 0.3581 0.3137 0.0013  -0.0198 0.0434  210 ILE C O   
5119 C CB  . ILE C 203 ? 0.4719 0.4063 0.3628 -0.0037 -0.0289 0.0503  210 ILE C CB  
5120 C CG1 . ILE C 203 ? 0.4975 0.4307 0.3938 -0.0057 -0.0336 0.0540  210 ILE C CG1 
5121 C CG2 . ILE C 203 ? 0.4487 0.3831 0.3288 -0.0049 -0.0291 0.0498  210 ILE C CG2 
5122 C CD1 . ILE C 203 ? 0.5378 0.4721 0.4342 -0.0077 -0.0355 0.0576  210 ILE C CD1 
5123 N N   . VAL C 204 ? 0.4125 0.3462 0.2915 0.0005  -0.0219 0.0408  211 VAL C N   
5124 C CA  . VAL C 204 ? 0.4184 0.3535 0.2947 0.0025  -0.0177 0.0376  211 VAL C CA  
5125 C C   . VAL C 204 ? 0.4224 0.3574 0.2887 0.0019  -0.0172 0.0365  211 VAL C C   
5126 O O   . VAL C 204 ? 0.4521 0.3846 0.3126 0.0006  -0.0200 0.0365  211 VAL C O   
5127 C CB  . VAL C 204 ? 0.4066 0.3402 0.2840 0.0042  -0.0167 0.0346  211 VAL C CB  
5128 C CG1 . VAL C 204 ? 0.4221 0.3571 0.2963 0.0061  -0.0126 0.0316  211 VAL C CG1 
5129 C CG2 . VAL C 204 ? 0.3776 0.3111 0.2646 0.0048  -0.0170 0.0356  211 VAL C CG2 
5130 N N   . GLU C 205 ? 0.4286 0.3659 0.2929 0.0029  -0.0136 0.0357  212 GLU C N   
5131 C CA  . GLU C 205 ? 0.4615 0.3991 0.3165 0.0028  -0.0120 0.0341  212 GLU C CA  
5132 C C   . GLU C 205 ? 0.4510 0.3894 0.3047 0.0052  -0.0081 0.0305  212 GLU C C   
5133 O O   . GLU C 205 ? 0.4315 0.3716 0.2910 0.0065  -0.0058 0.0301  212 GLU C O   
5134 C CB  . GLU C 205 ? 0.4686 0.4086 0.3219 0.0017  -0.0111 0.0365  212 GLU C CB  
5135 C CG  . GLU C 205 ? 0.5068 0.4459 0.3603 -0.0006 -0.0151 0.0400  212 GLU C CG  
5136 C CD  . GLU C 205 ? 0.5822 0.5234 0.4324 -0.0020 -0.0146 0.0424  212 GLU C CD  
5137 O OE1 . GLU C 205 ? 0.6475 0.5904 0.4933 -0.0012 -0.0113 0.0411  212 GLU C OE1 
5138 O OE2 . GLU C 205 ? 0.6518 0.5927 0.5040 -0.0040 -0.0177 0.0457  212 GLU C OE2 
5139 N N   . GLN C 206 ? 0.4491 0.3860 0.2949 0.0055  -0.0074 0.0281  213 GLN C N   
5140 C CA  . GLN C 206 ? 0.4314 0.3687 0.2759 0.0077  -0.0041 0.0246  213 GLN C CA  
5141 C C   . GLN C 206 ? 0.4401 0.3780 0.2763 0.0079  -0.0017 0.0234  213 GLN C C   
5142 O O   . GLN C 206 ? 0.4488 0.3855 0.2787 0.0062  -0.0033 0.0246  213 GLN C O   
5143 C CB  . GLN C 206 ? 0.4485 0.3827 0.2920 0.0085  -0.0055 0.0221  213 GLN C CB  
5144 C CG  . GLN C 206 ? 0.4673 0.3996 0.3160 0.0076  -0.0091 0.0235  213 GLN C CG  
5145 C CD  . GLN C 206 ? 0.4601 0.3903 0.3102 0.0088  -0.0095 0.0210  213 GLN C CD  
5146 O OE1 . GLN C 206 ? 0.5022 0.4324 0.3594 0.0091  -0.0103 0.0216  213 GLN C OE1 
5147 N NE2 . GLN C 206 ? 0.4401 0.3685 0.2836 0.0095  -0.0088 0.0181  213 GLN C NE2 
5148 N N   . TYR C 207 ? 0.4232 0.3628 0.2596 0.0098  0.0020  0.0213  214 TYR C N   
5149 C CA  . TYR C 207 ? 0.4391 0.3796 0.2688 0.0104  0.0049  0.0199  214 TYR C CA  
5150 C C   . TYR C 207 ? 0.4405 0.3800 0.2693 0.0125  0.0070  0.0162  214 TYR C C   
5151 O O   . TYR C 207 ? 0.4353 0.3754 0.2704 0.0138  0.0077  0.0154  214 TYR C O   
5152 C CB  . TYR C 207 ? 0.4423 0.3867 0.2745 0.0106  0.0078  0.0216  214 TYR C CB  
5153 C CG  . TYR C 207 ? 0.4766 0.4223 0.3033 0.0116  0.0115  0.0201  214 TYR C CG  
5154 C CD1 . TYR C 207 ? 0.5025 0.4480 0.3216 0.0104  0.0118  0.0209  214 TYR C CD1 
5155 C CD2 . TYR C 207 ? 0.4916 0.4387 0.3208 0.0137  0.0147  0.0179  214 TYR C CD2 
5156 C CE1 . TYR C 207 ? 0.4990 0.4457 0.3132 0.0114  0.0156  0.0195  214 TYR C CE1 
5157 C CE2 . TYR C 207 ? 0.5231 0.4716 0.3480 0.0148  0.0183  0.0166  214 TYR C CE2 
5158 C CZ  . TYR C 207 ? 0.5265 0.4748 0.3440 0.0137  0.0189  0.0173  214 TYR C CZ  
5159 O OH  . TYR C 207 ? 0.5968 0.5465 0.4107 0.0150  0.0229  0.0160  214 TYR C OH  
5160 N N   . GLU C 208 ? 0.4224 0.3600 0.2434 0.0129  0.0080  0.0140  215 GLU C N   
5161 C CA  . GLU C 208 ? 0.4739 0.4105 0.2942 0.0150  0.0101  0.0104  215 GLU C CA  
5162 C C   . GLU C 208 ? 0.4622 0.3994 0.2762 0.0159  0.0136  0.0088  215 GLU C C   
5163 O O   . GLU C 208 ? 0.4518 0.3880 0.2586 0.0146  0.0135  0.0095  215 GLU C O   
5164 C CB  . GLU C 208 ? 0.5130 0.4453 0.3307 0.0148  0.0071  0.0085  215 GLU C CB  
5165 C CG  . GLU C 208 ? 0.5708 0.5024 0.3899 0.0171  0.0091  0.0051  215 GLU C CG  
5166 C CD  . GLU C 208 ? 0.6623 0.5897 0.4792 0.0170  0.0062  0.0030  215 GLU C CD  
5167 O OE1 . GLU C 208 ? 0.7200 0.6465 0.5419 0.0164  0.0032  0.0041  215 GLU C OE1 
5168 O OE2 . GLU C 208 ? 0.6854 0.6103 0.4958 0.0178  0.0072  0.0003  215 GLU C OE2 
5169 N N   . ARG C 209 ? 0.4563 0.3952 0.2732 0.0180  0.0169  0.0069  216 ARG C N   
5170 C CA  . ARG C 209 ? 0.4863 0.4258 0.2984 0.0193  0.0207  0.0050  216 ARG C CA  
5171 C C   . ARG C 209 ? 0.4673 0.4045 0.2794 0.0212  0.0214  0.0014  216 ARG C C   
5172 O O   . ARG C 209 ? 0.4263 0.3642 0.2452 0.0221  0.0210  0.0009  216 ARG C O   
5173 C CB  . ARG C 209 ? 0.5728 0.5169 0.3893 0.0201  0.0242  0.0064  216 ARG C CB  
5174 C CG  . ARG C 209 ? 0.6687 0.6137 0.4812 0.0217  0.0285  0.0045  216 ARG C CG  
5175 C CD  . ARG C 209 ? 0.7471 0.6967 0.5654 0.0226  0.0318  0.0059  216 ARG C CD  
5176 N NE  . ARG C 209 ? 0.8700 0.8219 0.6851 0.0215  0.0333  0.0084  216 ARG C NE  
5177 C CZ  . ARG C 209 ? 0.8931 0.8470 0.7108 0.0198  0.0318  0.0118  216 ARG C CZ  
5178 N NH1 . ARG C 209 ? 0.9118 0.8659 0.7359 0.0191  0.0289  0.0131  216 ARG C NH1 
5179 N NH2 . ARG C 209 ? 0.8761 0.8318 0.6901 0.0188  0.0333  0.0138  216 ARG C NH2 
5180 N N   . ALA C 210 ? 0.4226 0.3570 0.2270 0.0217  0.0224  -0.0009 217 ALA C N   
5181 C CA  . ALA C 210 ? 0.4702 0.4022 0.2742 0.0234  0.0229  -0.0044 217 ALA C CA  
5182 C C   . ALA C 210 ? 0.4704 0.4022 0.2686 0.0248  0.0270  -0.0066 217 ALA C C   
5183 O O   . ALA C 210 ? 0.4853 0.4160 0.2761 0.0239  0.0276  -0.0063 217 ALA C O   
5184 C CB  . ALA C 210 ? 0.4479 0.3750 0.2477 0.0224  0.0189  -0.0057 217 ALA C CB  
5185 N N   . GLU C 211 ? 0.4976 0.4303 0.2994 0.0271  0.0297  -0.0088 218 GLU C N   
5186 C CA  . GLU C 211 ? 0.5066 0.4392 0.3038 0.0287  0.0340  -0.0110 218 GLU C CA  
5187 C C   . GLU C 211 ? 0.4976 0.4280 0.2960 0.0307  0.0347  -0.0144 218 GLU C C   
5188 O O   . GLU C 211 ? 0.4876 0.4196 0.2939 0.0316  0.0343  -0.0144 218 GLU C O   
5189 C CB  . GLU C 211 ? 0.5534 0.4913 0.3554 0.0295  0.0380  -0.0091 218 GLU C CB  
5190 C CG  . GLU C 211 ? 0.6161 0.5544 0.4126 0.0308  0.0426  -0.0104 218 GLU C CG  
5191 C CD  . GLU C 211 ? 0.6502 0.5939 0.4525 0.0317  0.0465  -0.0085 218 GLU C CD  
5192 O OE1 . GLU C 211 ? 0.7279 0.6749 0.5361 0.0307  0.0455  -0.0054 218 GLU C OE1 
5193 O OE2 . GLU C 211 ? 0.7775 0.7217 0.5781 0.0335  0.0508  -0.0101 218 GLU C OE2 
5194 N N   . GLY C 212 ? 0.4698 0.3963 0.2605 0.0314  0.0357  -0.0173 219 GLY C N   
5195 C CA  . GLY C 212 ? 0.4989 0.4231 0.2904 0.0335  0.0367  -0.0208 219 GLY C CA  
5196 C C   . GLY C 212 ? 0.5303 0.4580 0.3255 0.0358  0.0420  -0.0215 219 GLY C C   
5197 O O   . GLY C 212 ? 0.5128 0.4425 0.3050 0.0360  0.0455  -0.0207 219 GLY C O   
5198 N N   . ARG C 213 ? 0.4987 0.4269 0.3005 0.0375  0.0424  -0.0230 220 ARG C N   
5199 C CA  . ARG C 213 ? 0.5376 0.4688 0.3440 0.0397  0.0468  -0.0236 220 ARG C CA  
5200 C C   . ARG C 213 ? 0.5032 0.4314 0.3101 0.0417  0.0474  -0.0272 220 ARG C C   
5201 O O   . ARG C 213 ? 0.4635 0.3889 0.2714 0.0414  0.0439  -0.0284 220 ARG C O   
5202 C CB  . ARG C 213 ? 0.5715 0.5077 0.3879 0.0396  0.0467  -0.0207 220 ARG C CB  
5203 C CG  . ARG C 213 ? 0.6267 0.5664 0.4436 0.0378  0.0467  -0.0170 220 ARG C CG  
5204 C CD  . ARG C 213 ? 0.7171 0.6606 0.5344 0.0387  0.0515  -0.0159 220 ARG C CD  
5205 N NE  . ARG C 213 ? 0.8251 0.7733 0.6505 0.0381  0.0514  -0.0125 220 ARG C NE  
5206 C CZ  . ARG C 213 ? 0.9243 0.8757 0.7576 0.0394  0.0532  -0.0120 220 ARG C CZ  
5207 N NH1 . ARG C 213 ? 0.9481 0.8990 0.7833 0.0416  0.0556  -0.0144 220 ARG C NH1 
5208 N NH2 . ARG C 213 ? 0.9611 0.9161 0.8008 0.0385  0.0525  -0.0089 220 ARG C NH2 
5209 N N   . HIS C 214 ? 0.5302 0.4591 0.3368 0.0438  0.0520  -0.0288 221 HIS C N   
5210 C CA  . HIS C 214 ? 0.5071 0.4340 0.3162 0.0459  0.0528  -0.0320 221 HIS C CA  
5211 C C   . HIS C 214 ? 0.4826 0.4114 0.3014 0.0463  0.0507  -0.0312 221 HIS C C   
5212 O O   . HIS C 214 ? 0.4740 0.4071 0.2999 0.0457  0.0506  -0.0283 221 HIS C O   
5213 C CB  . HIS C 214 ? 0.5327 0.4605 0.3409 0.0482  0.0585  -0.0335 221 HIS C CB  
5214 C CG  . HIS C 214 ? 0.5423 0.4666 0.3394 0.0482  0.0606  -0.0354 221 HIS C CG  
5215 N ND1 . HIS C 214 ? 0.5545 0.4729 0.3446 0.0488  0.0600  -0.0391 221 HIS C ND1 
5216 C CD2 . HIS C 214 ? 0.5605 0.4859 0.3517 0.0473  0.0630  -0.0340 221 HIS C CD2 
5217 C CE1 . HIS C 214 ? 0.5785 0.4943 0.3586 0.0485  0.0622  -0.0401 221 HIS C CE1 
5218 N NE2 . HIS C 214 ? 0.5912 0.5113 0.3717 0.0475  0.0640  -0.0370 221 HIS C NE2 
5219 N N   . SER C 215 ? 0.4599 0.3849 0.2787 0.0471  0.0489  -0.0339 222 SER C N   
5220 C CA  . SER C 215 ? 0.4490 0.3748 0.2761 0.0477  0.0472  -0.0339 222 SER C CA  
5221 C C   . SER C 215 ? 0.4256 0.3516 0.2565 0.0503  0.0504  -0.0361 222 SER C C   
5222 O O   . SER C 215 ? 0.4303 0.3582 0.2691 0.0509  0.0498  -0.0355 222 SER C O   
5223 C CB  . SER C 215 ? 0.4762 0.3975 0.3010 0.0468  0.0426  -0.0354 222 SER C CB  
5224 O OG  . SER C 215 ? 0.5467 0.4687 0.3718 0.0446  0.0391  -0.0329 222 SER C OG  
5225 N N   . THR C 216 ? 0.4276 0.3509 0.2524 0.0518  0.0534  -0.0389 223 THR C N   
5226 C CA  . THR C 216 ? 0.4356 0.3593 0.2642 0.0544  0.0573  -0.0409 223 THR C CA  
5227 C C   . THR C 216 ? 0.4793 0.4043 0.3035 0.0554  0.0625  -0.0411 223 THR C C   
5228 O O   . THR C 216 ? 0.4883 0.4129 0.3053 0.0540  0.0627  -0.0403 223 THR C O   
5229 C CB  . THR C 216 ? 0.4202 0.3383 0.2454 0.0556  0.0561  -0.0448 223 THR C CB  
5230 O OG1 . THR C 216 ? 0.4236 0.3371 0.2377 0.0550  0.0561  -0.0469 223 THR C OG1 
5231 C CG2 . THR C 216 ? 0.4138 0.3302 0.2423 0.0546  0.0510  -0.0448 223 THR C CG2 
5232 N N   . GLY C 217 ? 0.5212 0.4476 0.3496 0.0579  0.0668  -0.0423 224 GLY C N   
5233 C CA  . GLY C 217 ? 0.5706 0.4982 0.3955 0.0592  0.0724  -0.0427 224 GLY C CA  
5234 C C   . GLY C 217 ? 0.5982 0.5313 0.4257 0.0580  0.0738  -0.0387 224 GLY C C   
5235 O O   . GLY C 217 ? 0.7111 0.6479 0.5463 0.0569  0.0713  -0.0357 224 GLY C O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   6   6   ALA ALA A . n 
A 1 2   ILE 2   7   7   ILE ILE A . n 
A 1 3   ILE 3   8   8   ILE ILE A . n 
A 1 4   LYS 4   9   9   LYS LYS A . n 
A 1 5   GLU 5   10  10  GLU GLU A . n 
A 1 6   PHE 6   11  11  PHE PHE A . n 
A 1 7   MET 7   12  12  MET MET A . n 
A 1 8   ARG 8   13  13  ARG ARG A . n 
A 1 9   PHE 9   14  14  PHE PHE A . n 
A 1 10  LYS 10  15  15  LYS LYS A . n 
A 1 11  VAL 11  16  16  VAL VAL A . n 
A 1 12  HIS 12  17  17  HIS HIS A . n 
A 1 13  MET 13  18  18  MET MET A . n 
A 1 14  GLU 14  19  19  GLU GLU A . n 
A 1 15  GLY 15  20  20  GLY GLY A . n 
A 1 16  SER 16  21  21  SER SER A . n 
A 1 17  VAL 17  22  22  VAL VAL A . n 
A 1 18  ASN 18  23  23  ASN ASN A . n 
A 1 19  GLY 19  24  24  GLY GLY A . n 
A 1 20  HIS 20  25  25  HIS HIS A . n 
A 1 21  GLU 21  26  26  GLU GLU A . n 
A 1 22  PHE 22  27  27  PHE PHE A . n 
A 1 23  GLU 23  28  28  GLU GLU A . n 
A 1 24  ILE 24  29  29  ILE ILE A . n 
A 1 25  GLU 25  30  30  GLU GLU A . n 
A 1 26  GLY 26  31  31  GLY GLY A . n 
A 1 27  GLU 27  32  32  GLU GLU A . n 
A 1 28  GLY 28  33  33  GLY GLY A . n 
A 1 29  GLU 29  34  34  GLU GLU A . n 
A 1 30  GLY 30  35  35  GLY GLY A . n 
A 1 31  ARG 31  36  36  ARG ARG A . n 
A 1 32  PRO 32  37  37  PRO PRO A . n 
A 1 33  TYR 33  38  38  TYR TYR A . n 
A 1 34  GLU 34  39  39  GLU GLU A . n 
A 1 35  GLY 35  40  40  GLY GLY A . n 
A 1 36  THR 36  41  41  THR THR A . n 
A 1 37  GLN 37  42  42  GLN GLN A . n 
A 1 38  THR 38  43  43  THR THR A . n 
A 1 39  ALA 39  44  44  ALA ALA A . n 
A 1 40  LYS 40  45  45  LYS LYS A . n 
A 1 41  LEU 41  46  46  LEU LEU A . n 
A 1 42  LYS 42  47  47  LYS LYS A . n 
A 1 43  VAL 43  48  48  VAL VAL A . n 
A 1 44  THR 44  49  49  THR THR A . n 
A 1 45  LYS 45  50  50  LYS LYS A . n 
A 1 46  GLY 46  51  51  GLY GLY A . n 
A 1 47  GLY 47  52  52  GLY GLY A . n 
A 1 48  PRO 48  53  53  PRO PRO A . n 
A 1 49  LEU 49  54  54  LEU LEU A . n 
A 1 50  PRO 50  55  55  PRO PRO A . n 
A 1 51  PHE 51  56  56  PHE PHE A . n 
A 1 52  ALA 52  57  57  ALA ALA A . n 
A 1 53  TRP 53  58  58  TRP TRP A . n 
A 1 54  ASP 54  59  59  ASP ASP A . n 
A 1 55  ILE 55  60  60  ILE ILE A . n 
A 1 56  LEU 56  61  61  LEU LEU A . n 
A 1 57  SER 57  62  62  SER SER A . n 
A 1 58  PRO 58  63  63  PRO PRO A . n 
A 1 59  GLN 59  64  64  GLN GLN A . n 
A 1 60  PHE 60  65  65  PHE PHE A . n 
A 1 61  CH6 61  66  66  CH6 CH6 A . n 
A 1 62  SER 62  69  69  SER SER A . n 
A 1 63  LYS 63  70  70  LYS LYS A . n 
A 1 64  ALA 64  71  71  ALA ALA A . n 
A 1 65  TYR 65  72  72  TYR TYR A . n 
A 1 66  VAL 66  73  73  VAL VAL A . n 
A 1 67  LYS 67  74  74  LYS LYS A . n 
A 1 68  HIS 68  75  75  HIS HIS A . n 
A 1 69  PRO 69  76  76  PRO PRO A . n 
A 1 70  ALA 70  77  77  ALA ALA A . n 
A 1 71  ASP 71  78  78  ASP ASP A . n 
A 1 72  ILE 72  79  79  ILE ILE A . n 
A 1 73  PRO 73  80  80  PRO PRO A . n 
A 1 74  ASP 74  81  81  ASP ASP A . n 
A 1 75  TYR 75  82  82  TYR TYR A . n 
A 1 76  LEU 76  83  83  LEU LEU A . n 
A 1 77  LYS 77  84  84  LYS LYS A . n 
A 1 78  LEU 78  85  85  LEU LEU A . n 
A 1 79  SER 79  86  86  SER SER A . n 
A 1 80  PHE 80  87  87  PHE PHE A . n 
A 1 81  PRO 81  88  88  PRO PRO A . n 
A 1 82  GLU 82  89  89  GLU GLU A . n 
A 1 83  GLY 83  90  90  GLY GLY A . n 
A 1 84  PHE 84  91  91  PHE PHE A . n 
A 1 85  LYS 85  92  92  LYS LYS A . n 
A 1 86  TRP 86  93  93  TRP TRP A . n 
A 1 87  GLU 87  94  94  GLU GLU A . n 
A 1 88  ARG 88  95  95  ARG ARG A . n 
A 1 89  VAL 89  96  96  VAL VAL A . n 
A 1 90  MET 90  97  97  MET MET A . n 
A 1 91  ASN 91  98  98  ASN ASN A . n 
A 1 92  PHE 92  99  99  PHE PHE A . n 
A 1 93  GLU 93  100 100 GLU GLU A . n 
A 1 94  ASP 94  101 101 ASP ASP A . n 
A 1 95  GLY 95  102 102 GLY GLY A . n 
A 1 96  GLY 96  103 103 GLY GLY A . n 
A 1 97  VAL 97  104 104 VAL VAL A . n 
A 1 98  VAL 98  105 105 VAL VAL A . n 
A 1 99  THR 99  106 106 THR THR A . n 
A 1 100 VAL 100 107 107 VAL VAL A . n 
A 1 101 THR 101 108 108 THR THR A . n 
A 1 102 GLN 102 109 109 GLN GLN A . n 
A 1 103 ASP 103 110 110 ASP ASP A . n 
A 1 104 SER 104 111 111 SER SER A . n 
A 1 105 SER 105 112 112 SER SER A . n 
A 1 106 LEU 106 113 113 LEU LEU A . n 
A 1 107 GLN 107 114 114 GLN GLN A . n 
A 1 108 ASP 108 115 115 ASP ASP A . n 
A 1 109 GLY 109 116 116 GLY GLY A . n 
A 1 110 GLU 110 117 117 GLU GLU A . n 
A 1 111 PHE 111 118 118 PHE PHE A . n 
A 1 112 ILE 112 119 119 ILE ILE A . n 
A 1 113 TYR 113 120 120 TYR TYR A . n 
A 1 114 LYS 114 121 121 LYS LYS A . n 
A 1 115 VAL 115 122 122 VAL VAL A . n 
A 1 116 LYS 116 123 123 LYS LYS A . n 
A 1 117 LEU 117 124 124 LEU LEU A . n 
A 1 118 ARG 118 125 125 ARG ARG A . n 
A 1 119 GLY 119 126 126 GLY GLY A . n 
A 1 120 THR 120 127 127 THR THR A . n 
A 1 121 ASN 121 128 128 ASN ASN A . n 
A 1 122 PHE 122 129 129 PHE PHE A . n 
A 1 123 PRO 123 130 130 PRO PRO A . n 
A 1 124 SER 124 131 131 SER SER A . n 
A 1 125 ASP 125 132 132 ASP ASP A . n 
A 1 126 GLY 126 133 133 GLY GLY A . n 
A 1 127 PRO 127 134 134 PRO PRO A . n 
A 1 128 VAL 128 135 135 VAL VAL A . n 
A 1 129 MET 129 136 136 MET MET A . n 
A 1 130 GLN 130 137 137 GLN GLN A . n 
A 1 131 LYS 131 138 138 LYS LYS A . n 
A 1 132 LYS 132 139 139 LYS LYS A . n 
A 1 133 THR 133 140 140 THR THR A . n 
A 1 134 MET 134 141 141 MET MET A . n 
A 1 135 GLY 135 142 142 GLY GLY A . n 
A 1 136 4OO 136 143 143 4OO AZ4 A . n 
A 1 137 GLU 137 144 144 GLU GLU A . n 
A 1 138 ALA 138 145 145 ALA ALA A . n 
A 1 139 SER 139 146 146 SER SER A . n 
A 1 140 SER 140 147 147 SER SER A . n 
A 1 141 GLU 141 148 148 GLU GLU A . n 
A 1 142 ARG 142 149 149 ARG ARG A . n 
A 1 143 MET 143 150 150 MET MET A . n 
A 1 144 TYR 144 151 151 TYR TYR A . n 
A 1 145 PRO 145 152 152 PRO PRO A . n 
A 1 146 GLU 146 153 153 GLU GLU A . n 
A 1 147 ASP 147 154 154 ASP ASP A . n 
A 1 148 GLY 148 155 155 GLY GLY A . n 
A 1 149 ALA 149 156 156 ALA ALA A . n 
A 1 150 LEU 150 157 157 LEU LEU A . n 
A 1 151 LYS 151 158 158 LYS LYS A . n 
A 1 152 GLY 152 159 159 GLY GLY A . n 
A 1 153 GLU 153 160 160 GLU GLU A . n 
A 1 154 ILE 154 161 161 ILE ILE A . n 
A 1 155 LYS 155 162 162 LYS LYS A . n 
A 1 156 GLN 156 163 163 GLN GLN A . n 
A 1 157 ARG 157 164 164 ARG ARG A . n 
A 1 158 LEU 158 165 165 LEU LEU A . n 
A 1 159 LYS 159 166 166 LYS LYS A . n 
A 1 160 LEU 160 167 167 LEU LEU A . n 
A 1 161 LYS 161 168 168 LYS LYS A . n 
A 1 162 ASP 162 169 169 ASP ASP A . n 
A 1 163 GLY 163 170 170 GLY GLY A . n 
A 1 164 GLY 164 171 171 GLY GLY A . n 
A 1 165 HIS 165 172 172 HIS HIS A . n 
A 1 166 TYR 166 173 173 TYR TYR A . n 
A 1 167 ASP 167 174 174 ASP ASP A . n 
A 1 168 ALA 168 175 175 ALA ALA A . n 
A 1 169 GLU 169 176 176 GLU GLU A . n 
A 1 170 VAL 170 177 177 VAL VAL A . n 
A 1 171 LYS 171 178 178 LYS LYS A . n 
A 1 172 THR 172 179 179 THR THR A . n 
A 1 173 THR 173 180 180 THR THR A . n 
A 1 174 TYR 174 181 181 TYR TYR A . n 
A 1 175 LYS 175 182 182 LYS LYS A . n 
A 1 176 ALA 176 183 183 ALA ALA A . n 
A 1 177 LYS 177 184 184 LYS LYS A . n 
A 1 178 LYS 178 185 185 LYS LYS A . n 
A 1 179 PRO 179 186 186 PRO PRO A . n 
A 1 180 VAL 180 187 187 VAL VAL A . n 
A 1 181 GLN 181 188 188 GLN GLN A . n 
A 1 182 LEU 182 189 189 LEU LEU A . n 
A 1 183 PRO 183 190 190 PRO PRO A . n 
A 1 184 GLY 184 191 191 GLY GLY A . n 
A 1 185 ALA 185 192 192 ALA ALA A . n 
A 1 186 TYR 186 193 193 TYR TYR A . n 
A 1 187 ASN 187 194 194 ASN ASN A . n 
A 1 188 VAL 188 195 195 VAL VAL A . n 
A 1 189 ASN 189 196 196 ASN ASN A . n 
A 1 190 ILE 190 197 197 ILE ILE A . n 
A 1 191 LYS 191 198 198 LYS LYS A . n 
A 1 192 LEU 192 199 199 LEU LEU A . n 
A 1 193 ASP 193 200 200 ASP ASP A . n 
A 1 194 ILE 194 201 201 ILE ILE A . n 
A 1 195 THR 195 202 202 THR THR A . n 
A 1 196 SER 196 203 203 SER SER A . n 
A 1 197 HIS 197 204 204 HIS HIS A . n 
A 1 198 ASN 198 205 205 ASN ASN A . n 
A 1 199 GLU 199 206 206 GLU GLU A . n 
A 1 200 ASP 200 207 207 ASP ASP A . n 
A 1 201 TYR 201 208 208 TYR TYR A . n 
A 1 202 THR 202 209 209 THR THR A . n 
A 1 203 ILE 203 210 210 ILE ILE A . n 
A 1 204 VAL 204 211 211 VAL VAL A . n 
A 1 205 GLU 205 212 212 GLU GLU A . n 
A 1 206 GLN 206 213 213 GLN GLN A . n 
A 1 207 TYR 207 214 214 TYR TYR A . n 
A 1 208 GLU 208 215 215 GLU GLU A . n 
A 1 209 ARG 209 216 216 ARG ARG A . n 
A 1 210 ALA 210 217 217 ALA ALA A . n 
A 1 211 GLU 211 218 218 GLU GLU A . n 
A 1 212 GLY 212 219 219 GLY GLY A . n 
A 1 213 ARG 213 220 220 ARG ARG A . n 
A 1 214 HIS 214 221 221 HIS HIS A . n 
A 1 215 SER 215 222 222 SER SER A . n 
A 1 216 THR 216 223 223 THR THR A . n 
A 1 217 GLY 217 224 224 GLY GLY A . n 
B 1 1   ALA 1   6   6   ALA ALA B . n 
B 1 2   ILE 2   7   7   ILE ILE B . n 
B 1 3   ILE 3   8   8   ILE ILE B . n 
B 1 4   LYS 4   9   9   LYS LYS B . n 
B 1 5   GLU 5   10  10  GLU GLU B . n 
B 1 6   PHE 6   11  11  PHE PHE B . n 
B 1 7   MET 7   12  12  MET MET B . n 
B 1 8   ARG 8   13  13  ARG ARG B . n 
B 1 9   PHE 9   14  14  PHE PHE B . n 
B 1 10  LYS 10  15  15  LYS LYS B . n 
B 1 11  VAL 11  16  16  VAL VAL B . n 
B 1 12  HIS 12  17  17  HIS HIS B . n 
B 1 13  MET 13  18  18  MET MET B . n 
B 1 14  GLU 14  19  19  GLU GLU B . n 
B 1 15  GLY 15  20  20  GLY GLY B . n 
B 1 16  SER 16  21  21  SER SER B . n 
B 1 17  VAL 17  22  22  VAL VAL B . n 
B 1 18  ASN 18  23  23  ASN ASN B . n 
B 1 19  GLY 19  24  24  GLY GLY B . n 
B 1 20  HIS 20  25  25  HIS HIS B . n 
B 1 21  GLU 21  26  26  GLU GLU B . n 
B 1 22  PHE 22  27  27  PHE PHE B . n 
B 1 23  GLU 23  28  28  GLU GLU B . n 
B 1 24  ILE 24  29  29  ILE ILE B . n 
B 1 25  GLU 25  30  30  GLU GLU B . n 
B 1 26  GLY 26  31  31  GLY GLY B . n 
B 1 27  GLU 27  32  32  GLU GLU B . n 
B 1 28  GLY 28  33  33  GLY GLY B . n 
B 1 29  GLU 29  34  34  GLU GLU B . n 
B 1 30  GLY 30  35  35  GLY GLY B . n 
B 1 31  ARG 31  36  36  ARG ARG B . n 
B 1 32  PRO 32  37  37  PRO PRO B . n 
B 1 33  TYR 33  38  38  TYR TYR B . n 
B 1 34  GLU 34  39  39  GLU GLU B . n 
B 1 35  GLY 35  40  40  GLY GLY B . n 
B 1 36  THR 36  41  41  THR THR B . n 
B 1 37  GLN 37  42  42  GLN GLN B . n 
B 1 38  THR 38  43  43  THR THR B . n 
B 1 39  ALA 39  44  44  ALA ALA B . n 
B 1 40  LYS 40  45  45  LYS LYS B . n 
B 1 41  LEU 41  46  46  LEU LEU B . n 
B 1 42  LYS 42  47  47  LYS LYS B . n 
B 1 43  VAL 43  48  48  VAL VAL B . n 
B 1 44  THR 44  49  49  THR THR B . n 
B 1 45  LYS 45  50  50  LYS LYS B . n 
B 1 46  GLY 46  51  51  GLY GLY B . n 
B 1 47  GLY 47  52  52  GLY GLY B . n 
B 1 48  PRO 48  53  53  PRO PRO B . n 
B 1 49  LEU 49  54  54  LEU LEU B . n 
B 1 50  PRO 50  55  55  PRO PRO B . n 
B 1 51  PHE 51  56  56  PHE PHE B . n 
B 1 52  ALA 52  57  57  ALA ALA B . n 
B 1 53  TRP 53  58  58  TRP TRP B . n 
B 1 54  ASP 54  59  59  ASP ASP B . n 
B 1 55  ILE 55  60  60  ILE ILE B . n 
B 1 56  LEU 56  61  61  LEU LEU B . n 
B 1 57  SER 57  62  62  SER SER B . n 
B 1 58  PRO 58  63  63  PRO PRO B . n 
B 1 59  GLN 59  64  64  GLN GLN B . n 
B 1 60  PHE 60  65  65  PHE PHE B . n 
B 1 61  CH6 61  66  66  CH6 CH6 B . n 
B 1 62  SER 62  69  69  SER SER B . n 
B 1 63  LYS 63  70  70  LYS LYS B . n 
B 1 64  ALA 64  71  71  ALA ALA B . n 
B 1 65  TYR 65  72  72  TYR TYR B . n 
B 1 66  VAL 66  73  73  VAL VAL B . n 
B 1 67  LYS 67  74  74  LYS LYS B . n 
B 1 68  HIS 68  75  75  HIS HIS B . n 
B 1 69  PRO 69  76  76  PRO PRO B . n 
B 1 70  ALA 70  77  77  ALA ALA B . n 
B 1 71  ASP 71  78  78  ASP ASP B . n 
B 1 72  ILE 72  79  79  ILE ILE B . n 
B 1 73  PRO 73  80  80  PRO PRO B . n 
B 1 74  ASP 74  81  81  ASP ASP B . n 
B 1 75  TYR 75  82  82  TYR TYR B . n 
B 1 76  LEU 76  83  83  LEU LEU B . n 
B 1 77  LYS 77  84  84  LYS LYS B . n 
B 1 78  LEU 78  85  85  LEU LEU B . n 
B 1 79  SER 79  86  86  SER SER B . n 
B 1 80  PHE 80  87  87  PHE PHE B . n 
B 1 81  PRO 81  88  88  PRO PRO B . n 
B 1 82  GLU 82  89  89  GLU GLU B . n 
B 1 83  GLY 83  90  90  GLY GLY B . n 
B 1 84  PHE 84  91  91  PHE PHE B . n 
B 1 85  LYS 85  92  92  LYS LYS B . n 
B 1 86  TRP 86  93  93  TRP TRP B . n 
B 1 87  GLU 87  94  94  GLU GLU B . n 
B 1 88  ARG 88  95  95  ARG ARG B . n 
B 1 89  VAL 89  96  96  VAL VAL B . n 
B 1 90  MET 90  97  97  MET MET B . n 
B 1 91  ASN 91  98  98  ASN ASN B . n 
B 1 92  PHE 92  99  99  PHE PHE B . n 
B 1 93  GLU 93  100 100 GLU GLU B . n 
B 1 94  ASP 94  101 101 ASP ASP B . n 
B 1 95  GLY 95  102 102 GLY GLY B . n 
B 1 96  GLY 96  103 103 GLY GLY B . n 
B 1 97  VAL 97  104 104 VAL VAL B . n 
B 1 98  VAL 98  105 105 VAL VAL B . n 
B 1 99  THR 99  106 106 THR THR B . n 
B 1 100 VAL 100 107 107 VAL VAL B . n 
B 1 101 THR 101 108 108 THR THR B . n 
B 1 102 GLN 102 109 109 GLN GLN B . n 
B 1 103 ASP 103 110 110 ASP ASP B . n 
B 1 104 SER 104 111 111 SER SER B . n 
B 1 105 SER 105 112 112 SER SER B . n 
B 1 106 LEU 106 113 113 LEU LEU B . n 
B 1 107 GLN 107 114 114 GLN GLN B . n 
B 1 108 ASP 108 115 115 ASP ASP B . n 
B 1 109 GLY 109 116 116 GLY GLY B . n 
B 1 110 GLU 110 117 117 GLU GLU B . n 
B 1 111 PHE 111 118 118 PHE PHE B . n 
B 1 112 ILE 112 119 119 ILE ILE B . n 
B 1 113 TYR 113 120 120 TYR TYR B . n 
B 1 114 LYS 114 121 121 LYS LYS B . n 
B 1 115 VAL 115 122 122 VAL VAL B . n 
B 1 116 LYS 116 123 123 LYS LYS B . n 
B 1 117 LEU 117 124 124 LEU LEU B . n 
B 1 118 ARG 118 125 125 ARG ARG B . n 
B 1 119 GLY 119 126 126 GLY GLY B . n 
B 1 120 THR 120 127 127 THR THR B . n 
B 1 121 ASN 121 128 128 ASN ASN B . n 
B 1 122 PHE 122 129 129 PHE PHE B . n 
B 1 123 PRO 123 130 130 PRO PRO B . n 
B 1 124 SER 124 131 131 SER SER B . n 
B 1 125 ASP 125 132 132 ASP ASP B . n 
B 1 126 GLY 126 133 133 GLY GLY B . n 
B 1 127 PRO 127 134 134 PRO PRO B . n 
B 1 128 VAL 128 135 135 VAL VAL B . n 
B 1 129 MET 129 136 136 MET MET B . n 
B 1 130 GLN 130 137 137 GLN GLN B . n 
B 1 131 LYS 131 138 138 LYS LYS B . n 
B 1 132 LYS 132 139 139 LYS LYS B . n 
B 1 133 THR 133 140 140 THR THR B . n 
B 1 134 MET 134 141 141 MET MET B . n 
B 1 135 GLY 135 142 142 GLY GLY B . n 
B 1 136 4OO 136 143 143 4OO AZ4 B . n 
B 1 137 GLU 137 144 144 GLU GLU B . n 
B 1 138 ALA 138 145 145 ALA ALA B . n 
B 1 139 SER 139 146 146 SER SER B . n 
B 1 140 SER 140 147 147 SER SER B . n 
B 1 141 GLU 141 148 148 GLU GLU B . n 
B 1 142 ARG 142 149 149 ARG ARG B . n 
B 1 143 MET 143 150 150 MET MET B . n 
B 1 144 TYR 144 151 151 TYR TYR B . n 
B 1 145 PRO 145 152 152 PRO PRO B . n 
B 1 146 GLU 146 153 153 GLU GLU B . n 
B 1 147 ASP 147 154 154 ASP ASP B . n 
B 1 148 GLY 148 155 155 GLY GLY B . n 
B 1 149 ALA 149 156 156 ALA ALA B . n 
B 1 150 LEU 150 157 157 LEU LEU B . n 
B 1 151 LYS 151 158 158 LYS LYS B . n 
B 1 152 GLY 152 159 159 GLY GLY B . n 
B 1 153 GLU 153 160 160 GLU GLU B . n 
B 1 154 ILE 154 161 161 ILE ILE B . n 
B 1 155 LYS 155 162 162 LYS LYS B . n 
B 1 156 GLN 156 163 163 GLN GLN B . n 
B 1 157 ARG 157 164 164 ARG ARG B . n 
B 1 158 LEU 158 165 165 LEU LEU B . n 
B 1 159 LYS 159 166 166 LYS LYS B . n 
B 1 160 LEU 160 167 167 LEU LEU B . n 
B 1 161 LYS 161 168 168 LYS LYS B . n 
B 1 162 ASP 162 169 169 ASP ASP B . n 
B 1 163 GLY 163 170 170 GLY GLY B . n 
B 1 164 GLY 164 171 171 GLY GLY B . n 
B 1 165 HIS 165 172 172 HIS HIS B . n 
B 1 166 TYR 166 173 173 TYR TYR B . n 
B 1 167 ASP 167 174 174 ASP ASP B . n 
B 1 168 ALA 168 175 175 ALA ALA B . n 
B 1 169 GLU 169 176 176 GLU GLU B . n 
B 1 170 VAL 170 177 177 VAL VAL B . n 
B 1 171 LYS 171 178 178 LYS LYS B . n 
B 1 172 THR 172 179 179 THR THR B . n 
B 1 173 THR 173 180 180 THR THR B . n 
B 1 174 TYR 174 181 181 TYR TYR B . n 
B 1 175 LYS 175 182 182 LYS LYS B . n 
B 1 176 ALA 176 183 183 ALA ALA B . n 
B 1 177 LYS 177 184 184 LYS LYS B . n 
B 1 178 LYS 178 185 185 LYS LYS B . n 
B 1 179 PRO 179 186 186 PRO PRO B . n 
B 1 180 VAL 180 187 187 VAL VAL B . n 
B 1 181 GLN 181 188 188 GLN GLN B . n 
B 1 182 LEU 182 189 189 LEU LEU B . n 
B 1 183 PRO 183 190 190 PRO PRO B . n 
B 1 184 GLY 184 191 191 GLY GLY B . n 
B 1 185 ALA 185 192 192 ALA ALA B . n 
B 1 186 TYR 186 193 193 TYR TYR B . n 
B 1 187 ASN 187 194 194 ASN ASN B . n 
B 1 188 VAL 188 195 195 VAL VAL B . n 
B 1 189 ASN 189 196 196 ASN ASN B . n 
B 1 190 ILE 190 197 197 ILE ILE B . n 
B 1 191 LYS 191 198 198 LYS LYS B . n 
B 1 192 LEU 192 199 199 LEU LEU B . n 
B 1 193 ASP 193 200 200 ASP ASP B . n 
B 1 194 ILE 194 201 201 ILE ILE B . n 
B 1 195 THR 195 202 202 THR THR B . n 
B 1 196 SER 196 203 203 SER SER B . n 
B 1 197 HIS 197 204 204 HIS HIS B . n 
B 1 198 ASN 198 205 205 ASN ASN B . n 
B 1 199 GLU 199 206 206 GLU GLU B . n 
B 1 200 ASP 200 207 207 ASP ASP B . n 
B 1 201 TYR 201 208 208 TYR TYR B . n 
B 1 202 THR 202 209 209 THR THR B . n 
B 1 203 ILE 203 210 210 ILE ILE B . n 
B 1 204 VAL 204 211 211 VAL VAL B . n 
B 1 205 GLU 205 212 212 GLU GLU B . n 
B 1 206 GLN 206 213 213 GLN GLN B . n 
B 1 207 TYR 207 214 214 TYR TYR B . n 
B 1 208 GLU 208 215 215 GLU GLU B . n 
B 1 209 ARG 209 216 216 ARG ARG B . n 
B 1 210 ALA 210 217 217 ALA ALA B . n 
B 1 211 GLU 211 218 218 GLU GLU B . n 
B 1 212 GLY 212 219 219 GLY GLY B . n 
B 1 213 ARG 213 220 220 ARG ARG B . n 
B 1 214 HIS 214 221 221 HIS HIS B . n 
B 1 215 SER 215 222 222 SER SER B . n 
B 1 216 THR 216 223 223 THR THR B . n 
B 1 217 GLY 217 224 224 GLY GLY B . n 
C 1 1   ALA 1   6   6   ALA ALA C . n 
C 1 2   ILE 2   7   7   ILE ILE C . n 
C 1 3   ILE 3   8   8   ILE ILE C . n 
C 1 4   LYS 4   9   9   LYS LYS C . n 
C 1 5   GLU 5   10  10  GLU GLU C . n 
C 1 6   PHE 6   11  11  PHE PHE C . n 
C 1 7   MET 7   12  12  MET MET C . n 
C 1 8   ARG 8   13  13  ARG ARG C . n 
C 1 9   PHE 9   14  14  PHE PHE C . n 
C 1 10  LYS 10  15  15  LYS LYS C . n 
C 1 11  VAL 11  16  16  VAL VAL C . n 
C 1 12  HIS 12  17  17  HIS HIS C . n 
C 1 13  MET 13  18  18  MET MET C . n 
C 1 14  GLU 14  19  19  GLU GLU C . n 
C 1 15  GLY 15  20  20  GLY GLY C . n 
C 1 16  SER 16  21  21  SER SER C . n 
C 1 17  VAL 17  22  22  VAL VAL C . n 
C 1 18  ASN 18  23  23  ASN ASN C . n 
C 1 19  GLY 19  24  24  GLY GLY C . n 
C 1 20  HIS 20  25  25  HIS HIS C . n 
C 1 21  GLU 21  26  26  GLU GLU C . n 
C 1 22  PHE 22  27  27  PHE PHE C . n 
C 1 23  GLU 23  28  28  GLU GLU C . n 
C 1 24  ILE 24  29  29  ILE ILE C . n 
C 1 25  GLU 25  30  30  GLU GLU C . n 
C 1 26  GLY 26  31  31  GLY GLY C . n 
C 1 27  GLU 27  32  32  GLU GLU C . n 
C 1 28  GLY 28  33  33  GLY GLY C . n 
C 1 29  GLU 29  34  34  GLU GLU C . n 
C 1 30  GLY 30  35  35  GLY GLY C . n 
C 1 31  ARG 31  36  36  ARG ARG C . n 
C 1 32  PRO 32  37  37  PRO PRO C . n 
C 1 33  TYR 33  38  38  TYR TYR C . n 
C 1 34  GLU 34  39  39  GLU GLU C . n 
C 1 35  GLY 35  40  40  GLY GLY C . n 
C 1 36  THR 36  41  41  THR THR C . n 
C 1 37  GLN 37  42  42  GLN GLN C . n 
C 1 38  THR 38  43  43  THR THR C . n 
C 1 39  ALA 39  44  44  ALA ALA C . n 
C 1 40  LYS 40  45  45  LYS LYS C . n 
C 1 41  LEU 41  46  46  LEU LEU C . n 
C 1 42  LYS 42  47  47  LYS LYS C . n 
C 1 43  VAL 43  48  48  VAL VAL C . n 
C 1 44  THR 44  49  49  THR THR C . n 
C 1 45  LYS 45  50  50  LYS LYS C . n 
C 1 46  GLY 46  51  51  GLY GLY C . n 
C 1 47  GLY 47  52  52  GLY GLY C . n 
C 1 48  PRO 48  53  53  PRO PRO C . n 
C 1 49  LEU 49  54  54  LEU LEU C . n 
C 1 50  PRO 50  55  55  PRO PRO C . n 
C 1 51  PHE 51  56  56  PHE PHE C . n 
C 1 52  ALA 52  57  57  ALA ALA C . n 
C 1 53  TRP 53  58  58  TRP TRP C . n 
C 1 54  ASP 54  59  59  ASP ASP C . n 
C 1 55  ILE 55  60  60  ILE ILE C . n 
C 1 56  LEU 56  61  61  LEU LEU C . n 
C 1 57  SER 57  62  62  SER SER C . n 
C 1 58  PRO 58  63  63  PRO PRO C . n 
C 1 59  GLN 59  64  64  GLN GLN C . n 
C 1 60  PHE 60  65  65  PHE PHE C . n 
C 1 61  CH6 61  66  66  CH6 CH6 C . n 
C 1 62  SER 62  69  69  SER SER C . n 
C 1 63  LYS 63  70  70  LYS LYS C . n 
C 1 64  ALA 64  71  71  ALA ALA C . n 
C 1 65  TYR 65  72  72  TYR TYR C . n 
C 1 66  VAL 66  73  73  VAL VAL C . n 
C 1 67  LYS 67  74  74  LYS LYS C . n 
C 1 68  HIS 68  75  75  HIS HIS C . n 
C 1 69  PRO 69  76  76  PRO PRO C . n 
C 1 70  ALA 70  77  77  ALA ALA C . n 
C 1 71  ASP 71  78  78  ASP ASP C . n 
C 1 72  ILE 72  79  79  ILE ILE C . n 
C 1 73  PRO 73  80  80  PRO PRO C . n 
C 1 74  ASP 74  81  81  ASP ASP C . n 
C 1 75  TYR 75  82  82  TYR TYR C . n 
C 1 76  LEU 76  83  83  LEU LEU C . n 
C 1 77  LYS 77  84  84  LYS LYS C . n 
C 1 78  LEU 78  85  85  LEU LEU C . n 
C 1 79  SER 79  86  86  SER SER C . n 
C 1 80  PHE 80  87  87  PHE PHE C . n 
C 1 81  PRO 81  88  88  PRO PRO C . n 
C 1 82  GLU 82  89  89  GLU GLU C . n 
C 1 83  GLY 83  90  90  GLY GLY C . n 
C 1 84  PHE 84  91  91  PHE PHE C . n 
C 1 85  LYS 85  92  92  LYS LYS C . n 
C 1 86  TRP 86  93  93  TRP TRP C . n 
C 1 87  GLU 87  94  94  GLU GLU C . n 
C 1 88  ARG 88  95  95  ARG ARG C . n 
C 1 89  VAL 89  96  96  VAL VAL C . n 
C 1 90  MET 90  97  97  MET MET C . n 
C 1 91  ASN 91  98  98  ASN ASN C . n 
C 1 92  PHE 92  99  99  PHE PHE C . n 
C 1 93  GLU 93  100 100 GLU GLU C . n 
C 1 94  ASP 94  101 101 ASP ASP C . n 
C 1 95  GLY 95  102 102 GLY GLY C . n 
C 1 96  GLY 96  103 103 GLY GLY C . n 
C 1 97  VAL 97  104 104 VAL VAL C . n 
C 1 98  VAL 98  105 105 VAL VAL C . n 
C 1 99  THR 99  106 106 THR THR C . n 
C 1 100 VAL 100 107 107 VAL VAL C . n 
C 1 101 THR 101 108 108 THR THR C . n 
C 1 102 GLN 102 109 109 GLN GLN C . n 
C 1 103 ASP 103 110 110 ASP ASP C . n 
C 1 104 SER 104 111 111 SER SER C . n 
C 1 105 SER 105 112 112 SER SER C . n 
C 1 106 LEU 106 113 113 LEU LEU C . n 
C 1 107 GLN 107 114 114 GLN GLN C . n 
C 1 108 ASP 108 115 115 ASP ASP C . n 
C 1 109 GLY 109 116 116 GLY GLY C . n 
C 1 110 GLU 110 117 117 GLU GLU C . n 
C 1 111 PHE 111 118 118 PHE PHE C . n 
C 1 112 ILE 112 119 119 ILE ILE C . n 
C 1 113 TYR 113 120 120 TYR TYR C . n 
C 1 114 LYS 114 121 121 LYS LYS C . n 
C 1 115 VAL 115 122 122 VAL VAL C . n 
C 1 116 LYS 116 123 123 LYS LYS C . n 
C 1 117 LEU 117 124 124 LEU LEU C . n 
C 1 118 ARG 118 125 125 ARG ARG C . n 
C 1 119 GLY 119 126 126 GLY GLY C . n 
C 1 120 THR 120 127 127 THR THR C . n 
C 1 121 ASN 121 128 128 ASN ASN C . n 
C 1 122 PHE 122 129 129 PHE PHE C . n 
C 1 123 PRO 123 130 130 PRO PRO C . n 
C 1 124 SER 124 131 131 SER SER C . n 
C 1 125 ASP 125 132 132 ASP ASP C . n 
C 1 126 GLY 126 133 133 GLY GLY C . n 
C 1 127 PRO 127 134 134 PRO PRO C . n 
C 1 128 VAL 128 135 135 VAL VAL C . n 
C 1 129 MET 129 136 136 MET MET C . n 
C 1 130 GLN 130 137 137 GLN GLN C . n 
C 1 131 LYS 131 138 138 LYS LYS C . n 
C 1 132 LYS 132 139 139 LYS LYS C . n 
C 1 133 THR 133 140 140 THR THR C . n 
C 1 134 MET 134 141 141 MET MET C . n 
C 1 135 GLY 135 142 142 GLY GLY C . n 
C 1 136 4OO 136 143 143 4OO AZ4 C . n 
C 1 137 GLU 137 144 144 GLU GLU C . n 
C 1 138 ALA 138 145 145 ALA ALA C . n 
C 1 139 SER 139 146 146 SER SER C . n 
C 1 140 SER 140 147 147 SER SER C . n 
C 1 141 GLU 141 148 148 GLU GLU C . n 
C 1 142 ARG 142 149 149 ARG ARG C . n 
C 1 143 MET 143 150 150 MET MET C . n 
C 1 144 TYR 144 151 151 TYR TYR C . n 
C 1 145 PRO 145 152 152 PRO PRO C . n 
C 1 146 GLU 146 153 153 GLU GLU C . n 
C 1 147 ASP 147 154 154 ASP ASP C . n 
C 1 148 GLY 148 155 155 GLY GLY C . n 
C 1 149 ALA 149 156 156 ALA ALA C . n 
C 1 150 LEU 150 157 157 LEU LEU C . n 
C 1 151 LYS 151 158 158 LYS LYS C . n 
C 1 152 GLY 152 159 159 GLY GLY C . n 
C 1 153 GLU 153 160 160 GLU GLU C . n 
C 1 154 ILE 154 161 161 ILE ILE C . n 
C 1 155 LYS 155 162 162 LYS LYS C . n 
C 1 156 GLN 156 163 163 GLN GLN C . n 
C 1 157 ARG 157 164 164 ARG ARG C . n 
C 1 158 LEU 158 165 165 LEU LEU C . n 
C 1 159 LYS 159 166 166 LYS LYS C . n 
C 1 160 LEU 160 167 167 LEU LEU C . n 
C 1 161 LYS 161 168 168 LYS LYS C . n 
C 1 162 ASP 162 169 169 ASP ASP C . n 
C 1 163 GLY 163 170 170 GLY GLY C . n 
C 1 164 GLY 164 171 171 GLY GLY C . n 
C 1 165 HIS 165 172 172 HIS HIS C . n 
C 1 166 TYR 166 173 173 TYR TYR C . n 
C 1 167 ASP 167 174 174 ASP ASP C . n 
C 1 168 ALA 168 175 175 ALA ALA C . n 
C 1 169 GLU 169 176 176 GLU GLU C . n 
C 1 170 VAL 170 177 177 VAL VAL C . n 
C 1 171 LYS 171 178 178 LYS LYS C . n 
C 1 172 THR 172 179 179 THR THR C . n 
C 1 173 THR 173 180 180 THR THR C . n 
C 1 174 TYR 174 181 181 TYR TYR C . n 
C 1 175 LYS 175 182 182 LYS LYS C . n 
C 1 176 ALA 176 183 183 ALA ALA C . n 
C 1 177 LYS 177 184 184 LYS LYS C . n 
C 1 178 LYS 178 185 185 LYS LYS C . n 
C 1 179 PRO 179 186 186 PRO PRO C . n 
C 1 180 VAL 180 187 187 VAL VAL C . n 
C 1 181 GLN 181 188 188 GLN GLN C . n 
C 1 182 LEU 182 189 189 LEU LEU C . n 
C 1 183 PRO 183 190 190 PRO PRO C . n 
C 1 184 GLY 184 191 191 GLY GLY C . n 
C 1 185 ALA 185 192 192 ALA ALA C . n 
C 1 186 TYR 186 193 193 TYR TYR C . n 
C 1 187 ASN 187 194 194 ASN ASN C . n 
C 1 188 VAL 188 195 195 VAL VAL C . n 
C 1 189 ASN 189 196 196 ASN ASN C . n 
C 1 190 ILE 190 197 197 ILE ILE C . n 
C 1 191 LYS 191 198 198 LYS LYS C . n 
C 1 192 LEU 192 199 199 LEU LEU C . n 
C 1 193 ASP 193 200 200 ASP ASP C . n 
C 1 194 ILE 194 201 201 ILE ILE C . n 
C 1 195 THR 195 202 202 THR THR C . n 
C 1 196 SER 196 203 203 SER SER C . n 
C 1 197 HIS 197 204 204 HIS HIS C . n 
C 1 198 ASN 198 205 205 ASN ASN C . n 
C 1 199 GLU 199 206 206 GLU GLU C . n 
C 1 200 ASP 200 207 207 ASP ASP C . n 
C 1 201 TYR 201 208 208 TYR TYR C . n 
C 1 202 THR 202 209 209 THR THR C . n 
C 1 203 ILE 203 210 210 ILE ILE C . n 
C 1 204 VAL 204 211 211 VAL VAL C . n 
C 1 205 GLU 205 212 212 GLU GLU C . n 
C 1 206 GLN 206 213 213 GLN GLN C . n 
C 1 207 TYR 207 214 214 TYR TYR C . n 
C 1 208 GLU 208 215 215 GLU GLU C . n 
C 1 209 ARG 209 216 216 ARG ARG C . n 
C 1 210 ALA 210 217 217 ALA ALA C . n 
C 1 211 GLU 211 218 218 GLU GLU C . n 
C 1 212 GLY 212 219 219 GLY GLY C . n 
C 1 213 ARG 213 220 220 ARG ARG C . n 
C 1 214 HIS 214 221 221 HIS HIS C . n 
C 1 215 SER 215 222 222 SER SER C . n 
C 1 216 THR 216 223 223 THR THR C . n 
C 1 217 GLY 217 224 224 GLY GLY C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 SO4 1   301 301 SO4 SO4 A . 
E 2 SO4 1   302 302 SO4 SO4 A . 
F 2 SO4 1   301 303 SO4 SO4 B . 
G 2 SO4 1   302 304 SO4 SO4 B . 
H 2 SO4 1   301 305 SO4 SO4 C . 
I 2 SO4 1   302 306 SO4 SO4 C . 
J 3 EDO 1   303 311 EDO EDO C . 
K 4 HOH 1   401 638 HOH HOH A . 
K 4 HOH 2   402 726 HOH HOH A . 
K 4 HOH 3   403 648 HOH HOH A . 
K 4 HOH 4   404 607 HOH HOH A . 
K 4 HOH 5   405 643 HOH HOH A . 
K 4 HOH 6   406 686 HOH HOH A . 
K 4 HOH 7   407 772 HOH HOH A . 
K 4 HOH 8   408 786 HOH HOH A . 
K 4 HOH 9   409 724 HOH HOH A . 
K 4 HOH 10  410 522 HOH HOH A . 
K 4 HOH 11  411 516 HOH HOH A . 
K 4 HOH 12  412 493 HOH HOH A . 
K 4 HOH 13  413 660 HOH HOH A . 
K 4 HOH 14  414 489 HOH HOH A . 
K 4 HOH 15  415 646 HOH HOH A . 
K 4 HOH 16  416 634 HOH HOH A . 
K 4 HOH 17  417 490 HOH HOH A . 
K 4 HOH 18  418 524 HOH HOH A . 
K 4 HOH 19  419 475 HOH HOH A . 
K 4 HOH 20  420 586 HOH HOH A . 
K 4 HOH 21  421 663 HOH HOH A . 
K 4 HOH 22  422 595 HOH HOH A . 
K 4 HOH 23  423 702 HOH HOH A . 
K 4 HOH 24  424 644 HOH HOH A . 
K 4 HOH 25  425 561 HOH HOH A . 
K 4 HOH 26  426 598 HOH HOH A . 
K 4 HOH 27  427 757 HOH HOH A . 
K 4 HOH 28  428 579 HOH HOH A . 
K 4 HOH 29  429 612 HOH HOH A . 
K 4 HOH 30  430 545 HOH HOH A . 
K 4 HOH 31  431 407 HOH HOH A . 
K 4 HOH 32  432 556 HOH HOH A . 
K 4 HOH 33  433 696 HOH HOH A . 
K 4 HOH 34  434 746 HOH HOH A . 
K 4 HOH 35  435 465 HOH HOH A . 
K 4 HOH 36  436 622 HOH HOH A . 
K 4 HOH 37  437 485 HOH HOH A . 
K 4 HOH 38  438 438 HOH HOH A . 
K 4 HOH 39  439 446 HOH HOH A . 
K 4 HOH 40  440 785 HOH HOH A . 
K 4 HOH 41  441 530 HOH HOH A . 
K 4 HOH 42  442 423 HOH HOH A . 
K 4 HOH 43  443 771 HOH HOH A . 
K 4 HOH 44  444 656 HOH HOH A . 
K 4 HOH 45  445 436 HOH HOH A . 
K 4 HOH 46  446 683 HOH HOH A . 
K 4 HOH 47  447 613 HOH HOH A . 
K 4 HOH 48  448 498 HOH HOH A . 
K 4 HOH 49  449 424 HOH HOH A . 
K 4 HOH 50  450 482 HOH HOH A . 
K 4 HOH 51  451 628 HOH HOH A . 
K 4 HOH 52  452 515 HOH HOH A . 
K 4 HOH 53  453 453 HOH HOH A . 
K 4 HOH 54  454 477 HOH HOH A . 
K 4 HOH 55  455 523 HOH HOH A . 
K 4 HOH 56  456 501 HOH HOH A . 
K 4 HOH 57  457 464 HOH HOH A . 
K 4 HOH 58  458 508 HOH HOH A . 
K 4 HOH 59  459 742 HOH HOH A . 
K 4 HOH 60  460 402 HOH HOH A . 
K 4 HOH 61  461 534 HOH HOH A . 
K 4 HOH 62  462 594 HOH HOH A . 
K 4 HOH 63  463 426 HOH HOH A . 
K 4 HOH 64  464 428 HOH HOH A . 
K 4 HOH 65  465 642 HOH HOH A . 
K 4 HOH 66  466 441 HOH HOH A . 
K 4 HOH 67  467 451 HOH HOH A . 
K 4 HOH 68  468 703 HOH HOH A . 
K 4 HOH 69  469 709 HOH HOH A . 
K 4 HOH 70  470 514 HOH HOH A . 
K 4 HOH 71  471 725 HOH HOH A . 
K 4 HOH 72  472 409 HOH HOH A . 
K 4 HOH 73  473 659 HOH HOH A . 
K 4 HOH 74  474 624 HOH HOH A . 
K 4 HOH 75  475 744 HOH HOH A . 
K 4 HOH 76  476 509 HOH HOH A . 
K 4 HOH 77  477 518 HOH HOH A . 
K 4 HOH 78  478 430 HOH HOH A . 
K 4 HOH 79  479 414 HOH HOH A . 
K 4 HOH 80  480 473 HOH HOH A . 
K 4 HOH 81  481 420 HOH HOH A . 
K 4 HOH 82  482 740 HOH HOH A . 
K 4 HOH 83  483 698 HOH HOH A . 
K 4 HOH 84  484 404 HOH HOH A . 
K 4 HOH 85  485 567 HOH HOH A . 
K 4 HOH 86  486 617 HOH HOH A . 
K 4 HOH 87  487 777 HOH HOH A . 
K 4 HOH 88  488 571 HOH HOH A . 
K 4 HOH 89  489 578 HOH HOH A . 
K 4 HOH 90  490 535 HOH HOH A . 
K 4 HOH 91  491 406 HOH HOH A . 
K 4 HOH 92  492 548 HOH HOH A . 
K 4 HOH 93  493 564 HOH HOH A . 
K 4 HOH 94  494 690 HOH HOH A . 
K 4 HOH 95  495 657 HOH HOH A . 
K 4 HOH 96  496 727 HOH HOH A . 
K 4 HOH 97  497 774 HOH HOH A . 
K 4 HOH 98  498 444 HOH HOH A . 
K 4 HOH 99  499 411 HOH HOH A . 
K 4 HOH 100 500 507 HOH HOH A . 
K 4 HOH 101 501 745 HOH HOH A . 
K 4 HOH 102 502 563 HOH HOH A . 
K 4 HOH 103 503 421 HOH HOH A . 
K 4 HOH 104 504 664 HOH HOH A . 
K 4 HOH 105 505 470 HOH HOH A . 
K 4 HOH 106 506 706 HOH HOH A . 
K 4 HOH 107 507 661 HOH HOH A . 
K 4 HOH 108 508 667 HOH HOH A . 
K 4 HOH 109 509 445 HOH HOH A . 
K 4 HOH 110 510 469 HOH HOH A . 
K 4 HOH 111 511 540 HOH HOH A . 
K 4 HOH 112 512 486 HOH HOH A . 
K 4 HOH 113 513 781 HOH HOH A . 
K 4 HOH 114 514 691 HOH HOH A . 
K 4 HOH 115 515 422 HOH HOH A . 
K 4 HOH 116 516 533 HOH HOH A . 
K 4 HOH 117 517 467 HOH HOH A . 
K 4 HOH 118 518 476 HOH HOH A . 
K 4 HOH 119 519 784 HOH HOH A . 
K 4 HOH 120 520 554 HOH HOH A . 
K 4 HOH 121 521 626 HOH HOH A . 
K 4 HOH 122 522 710 HOH HOH A . 
K 4 HOH 123 523 519 HOH HOH A . 
K 4 HOH 124 524 767 HOH HOH A . 
K 4 HOH 125 525 456 HOH HOH A . 
K 4 HOH 126 526 483 HOH HOH A . 
K 4 HOH 127 527 692 HOH HOH A . 
K 4 HOH 128 528 670 HOH HOH A . 
K 4 HOH 129 529 654 HOH HOH A . 
K 4 HOH 130 530 776 HOH HOH A . 
K 4 HOH 131 531 672 HOH HOH A . 
K 4 HOH 132 532 419 HOH HOH A . 
K 4 HOH 133 533 452 HOH HOH A . 
K 4 HOH 134 534 549 HOH HOH A . 
K 4 HOH 135 535 429 HOH HOH A . 
K 4 HOH 136 536 542 HOH HOH A . 
K 4 HOH 137 537 705 HOH HOH A . 
K 4 HOH 138 538 503 HOH HOH A . 
K 4 HOH 139 539 517 HOH HOH A . 
K 4 HOH 140 540 550 HOH HOH A . 
K 4 HOH 141 541 401 HOH HOH A . 
K 4 HOH 142 542 614 HOH HOH A . 
K 4 HOH 143 543 766 HOH HOH A . 
K 4 HOH 144 544 455 HOH HOH A . 
K 4 HOH 145 545 765 HOH HOH A . 
K 4 HOH 146 546 759 HOH HOH A . 
K 4 HOH 147 547 641 HOH HOH A . 
K 4 HOH 148 548 505 HOH HOH A . 
K 4 HOH 149 549 704 HOH HOH A . 
K 4 HOH 150 550 547 HOH HOH A . 
K 4 HOH 151 551 627 HOH HOH A . 
K 4 HOH 152 552 796 HOH HOH A . 
K 4 HOH 153 553 749 HOH HOH A . 
K 4 HOH 154 554 737 HOH HOH A . 
K 4 HOH 155 555 581 HOH HOH A . 
K 4 HOH 156 556 747 HOH HOH A . 
K 4 HOH 157 557 495 HOH HOH A . 
K 4 HOH 158 558 649 HOH HOH A . 
K 4 HOH 159 559 589 HOH HOH A . 
K 4 HOH 160 560 580 HOH HOH A . 
K 4 HOH 161 561 532 HOH HOH A . 
K 4 HOH 162 562 789 HOH HOH A . 
K 4 HOH 163 563 721 HOH HOH A . 
K 4 HOH 164 564 754 HOH HOH A . 
K 4 HOH 165 565 722 HOH HOH A . 
K 4 HOH 166 566 730 HOH HOH A . 
K 4 HOH 167 567 751 HOH HOH A . 
K 4 HOH 168 568 791 HOH HOH A . 
K 4 HOH 169 569 792 HOH HOH A . 
K 4 HOH 170 570 700 HOH HOH A . 
K 4 HOH 171 571 666 HOH HOH A . 
K 4 HOH 172 572 697 HOH HOH A . 
L 4 HOH 1   401 570 HOH HOH B . 
L 4 HOH 2   402 573 HOH HOH B . 
L 4 HOH 3   403 491 HOH HOH B . 
L 4 HOH 4   404 741 HOH HOH B . 
L 4 HOH 5   405 798 HOH HOH B . 
L 4 HOH 6   406 479 HOH HOH B . 
L 4 HOH 7   407 529 HOH HOH B . 
L 4 HOH 8   408 608 HOH HOH B . 
L 4 HOH 9   409 673 HOH HOH B . 
L 4 HOH 10  410 671 HOH HOH B . 
L 4 HOH 11  411 537 HOH HOH B . 
L 4 HOH 12  412 728 HOH HOH B . 
L 4 HOH 13  413 761 HOH HOH B . 
L 4 HOH 14  414 442 HOH HOH B . 
L 4 HOH 15  415 433 HOH HOH B . 
L 4 HOH 16  416 527 HOH HOH B . 
L 4 HOH 17  417 609 HOH HOH B . 
L 4 HOH 18  418 565 HOH HOH B . 
L 4 HOH 19  419 763 HOH HOH B . 
L 4 HOH 20  420 733 HOH HOH B . 
L 4 HOH 21  421 431 HOH HOH B . 
L 4 HOH 22  422 782 HOH HOH B . 
L 4 HOH 23  423 738 HOH HOH B . 
L 4 HOH 24  424 440 HOH HOH B . 
L 4 HOH 25  425 794 HOH HOH B . 
L 4 HOH 26  426 437 HOH HOH B . 
L 4 HOH 27  427 472 HOH HOH B . 
L 4 HOH 28  428 629 HOH HOH B . 
L 4 HOH 29  429 623 HOH HOH B . 
L 4 HOH 30  430 539 HOH HOH B . 
L 4 HOH 31  431 685 HOH HOH B . 
L 4 HOH 32  432 775 HOH HOH B . 
L 4 HOH 33  433 620 HOH HOH B . 
L 4 HOH 34  434 459 HOH HOH B . 
L 4 HOH 35  435 665 HOH HOH B . 
L 4 HOH 36  436 712 HOH HOH B . 
L 4 HOH 37  437 457 HOH HOH B . 
L 4 HOH 38  438 718 HOH HOH B . 
L 4 HOH 39  439 606 HOH HOH B . 
L 4 HOH 40  440 458 HOH HOH B . 
L 4 HOH 41  441 799 HOH HOH B . 
L 4 HOH 42  442 732 HOH HOH B . 
L 4 HOH 43  443 588 HOH HOH B . 
L 4 HOH 44  444 576 HOH HOH B . 
L 4 HOH 45  445 480 HOH HOH B . 
L 4 HOH 46  446 713 HOH HOH B . 
L 4 HOH 47  447 569 HOH HOH B . 
L 4 HOH 48  448 572 HOH HOH B . 
L 4 HOH 49  449 454 HOH HOH B . 
L 4 HOH 50  450 621 HOH HOH B . 
L 4 HOH 51  451 640 HOH HOH B . 
L 4 HOH 52  452 405 HOH HOH B . 
L 4 HOH 53  453 427 HOH HOH B . 
L 4 HOH 54  454 574 HOH HOH B . 
L 4 HOH 55  455 597 HOH HOH B . 
L 4 HOH 56  456 684 HOH HOH B . 
L 4 HOH 57  457 460 HOH HOH B . 
L 4 HOH 58  458 739 HOH HOH B . 
L 4 HOH 59  459 633 HOH HOH B . 
L 4 HOH 60  460 689 HOH HOH B . 
L 4 HOH 61  461 511 HOH HOH B . 
L 4 HOH 62  462 468 HOH HOH B . 
L 4 HOH 63  463 682 HOH HOH B . 
L 4 HOH 64  464 403 HOH HOH B . 
L 4 HOH 65  465 447 HOH HOH B . 
L 4 HOH 66  466 645 HOH HOH B . 
L 4 HOH 67  467 497 HOH HOH B . 
L 4 HOH 68  468 770 HOH HOH B . 
L 4 HOH 69  469 768 HOH HOH B . 
L 4 HOH 70  470 769 HOH HOH B . 
L 4 HOH 71  471 596 HOH HOH B . 
L 4 HOH 72  472 585 HOH HOH B . 
L 4 HOH 73  473 762 HOH HOH B . 
L 4 HOH 74  474 435 HOH HOH B . 
L 4 HOH 75  475 650 HOH HOH B . 
L 4 HOH 76  476 631 HOH HOH B . 
L 4 HOH 77  477 668 HOH HOH B . 
L 4 HOH 78  478 559 HOH HOH B . 
L 4 HOH 79  479 466 HOH HOH B . 
L 4 HOH 80  480 412 HOH HOH B . 
L 4 HOH 81  481 602 HOH HOH B . 
L 4 HOH 82  482 471 HOH HOH B . 
L 4 HOH 83  483 555 HOH HOH B . 
L 4 HOH 84  484 557 HOH HOH B . 
L 4 HOH 85  485 619 HOH HOH B . 
L 4 HOH 86  486 583 HOH HOH B . 
L 4 HOH 87  487 592 HOH HOH B . 
L 4 HOH 88  488 462 HOH HOH B . 
L 4 HOH 89  489 764 HOH HOH B . 
L 4 HOH 90  490 582 HOH HOH B . 
L 4 HOH 91  491 510 HOH HOH B . 
L 4 HOH 92  492 600 HOH HOH B . 
L 4 HOH 93  493 779 HOH HOH B . 
L 4 HOH 94  494 675 HOH HOH B . 
L 4 HOH 95  495 536 HOH HOH B . 
L 4 HOH 96  496 560 HOH HOH B . 
L 4 HOH 97  497 584 HOH HOH B . 
L 4 HOH 98  498 587 HOH HOH B . 
L 4 HOH 99  499 800 HOH HOH B . 
L 4 HOH 100 500 500 HOH HOH B . 
L 4 HOH 101 501 520 HOH HOH B . 
L 4 HOH 102 502 410 HOH HOH B . 
L 4 HOH 103 503 562 HOH HOH B . 
L 4 HOH 104 504 528 HOH HOH B . 
L 4 HOH 105 505 669 HOH HOH B . 
L 4 HOH 106 506 577 HOH HOH B . 
L 4 HOH 107 507 651 HOH HOH B . 
L 4 HOH 108 508 474 HOH HOH B . 
L 4 HOH 109 509 504 HOH HOH B . 
L 4 HOH 110 510 478 HOH HOH B . 
L 4 HOH 111 511 553 HOH HOH B . 
L 4 HOH 112 512 687 HOH HOH B . 
L 4 HOH 113 513 525 HOH HOH B . 
L 4 HOH 114 514 795 HOH HOH B . 
L 4 HOH 115 515 694 HOH HOH B . 
L 4 HOH 116 516 681 HOH HOH B . 
L 4 HOH 117 517 450 HOH HOH B . 
L 4 HOH 118 518 662 HOH HOH B . 
L 4 HOH 119 519 778 HOH HOH B . 
L 4 HOH 120 520 484 HOH HOH B . 
L 4 HOH 121 521 531 HOH HOH B . 
L 4 HOH 122 522 743 HOH HOH B . 
L 4 HOH 123 523 753 HOH HOH B . 
L 4 HOH 124 524 756 HOH HOH B . 
L 4 HOH 125 525 496 HOH HOH B . 
L 4 HOH 126 526 752 HOH HOH B . 
L 4 HOH 127 527 618 HOH HOH B . 
L 4 HOH 128 528 674 HOH HOH B . 
L 4 HOH 129 529 717 HOH HOH B . 
L 4 HOH 130 530 790 HOH HOH B . 
L 4 HOH 131 531 678 HOH HOH B . 
M 4 HOH 1   401 797 HOH HOH C . 
M 4 HOH 2   402 566 HOH HOH C . 
M 4 HOH 3   403 543 HOH HOH C . 
M 4 HOH 4   404 731 HOH HOH C . 
M 4 HOH 5   405 544 HOH HOH C . 
M 4 HOH 6   406 637 HOH HOH C . 
M 4 HOH 7   407 708 HOH HOH C . 
M 4 HOH 8   408 575 HOH HOH C . 
M 4 HOH 9   409 758 HOH HOH C . 
M 4 HOH 10  410 677 HOH HOH C . 
M 4 HOH 11  411 729 HOH HOH C . 
M 4 HOH 12  412 611 HOH HOH C . 
M 4 HOH 13  413 787 HOH HOH C . 
M 4 HOH 14  414 481 HOH HOH C . 
M 4 HOH 15  415 719 HOH HOH C . 
M 4 HOH 16  416 590 HOH HOH C . 
M 4 HOH 17  417 463 HOH HOH C . 
M 4 HOH 18  418 487 HOH HOH C . 
M 4 HOH 19  419 408 HOH HOH C . 
M 4 HOH 20  420 625 HOH HOH C . 
M 4 HOH 21  421 676 HOH HOH C . 
M 4 HOH 22  422 415 HOH HOH C . 
M 4 HOH 23  423 443 HOH HOH C . 
M 4 HOH 24  424 699 HOH HOH C . 
M 4 HOH 25  425 605 HOH HOH C . 
M 4 HOH 26  426 432 HOH HOH C . 
M 4 HOH 27  427 591 HOH HOH C . 
M 4 HOH 28  428 630 HOH HOH C . 
M 4 HOH 29  429 434 HOH HOH C . 
M 4 HOH 30  430 541 HOH HOH C . 
M 4 HOH 31  431 695 HOH HOH C . 
M 4 HOH 32  432 652 HOH HOH C . 
M 4 HOH 33  433 512 HOH HOH C . 
M 4 HOH 34  434 488 HOH HOH C . 
M 4 HOH 35  435 715 HOH HOH C . 
M 4 HOH 36  436 568 HOH HOH C . 
M 4 HOH 37  437 413 HOH HOH C . 
M 4 HOH 38  438 793 HOH HOH C . 
M 4 HOH 39  439 716 HOH HOH C . 
M 4 HOH 40  440 701 HOH HOH C . 
M 4 HOH 41  441 552 HOH HOH C . 
M 4 HOH 42  442 788 HOH HOH C . 
M 4 HOH 43  443 735 HOH HOH C . 
M 4 HOH 44  444 448 HOH HOH C . 
M 4 HOH 45  445 734 HOH HOH C . 
M 4 HOH 46  446 610 HOH HOH C . 
M 4 HOH 47  447 439 HOH HOH C . 
M 4 HOH 48  448 526 HOH HOH C . 
M 4 HOH 49  449 635 HOH HOH C . 
M 4 HOH 50  450 707 HOH HOH C . 
M 4 HOH 51  451 773 HOH HOH C . 
M 4 HOH 52  452 655 HOH HOH C . 
M 4 HOH 53  453 653 HOH HOH C . 
M 4 HOH 54  454 521 HOH HOH C . 
M 4 HOH 55  455 502 HOH HOH C . 
M 4 HOH 56  456 494 HOH HOH C . 
M 4 HOH 57  457 425 HOH HOH C . 
M 4 HOH 58  458 546 HOH HOH C . 
M 4 HOH 59  459 680 HOH HOH C . 
M 4 HOH 60  460 417 HOH HOH C . 
M 4 HOH 61  461 711 HOH HOH C . 
M 4 HOH 62  462 418 HOH HOH C . 
M 4 HOH 63  463 416 HOH HOH C . 
M 4 HOH 64  464 604 HOH HOH C . 
M 4 HOH 65  465 714 HOH HOH C . 
M 4 HOH 66  466 748 HOH HOH C . 
M 4 HOH 67  467 693 HOH HOH C . 
M 4 HOH 68  468 599 HOH HOH C . 
M 4 HOH 69  469 658 HOH HOH C . 
M 4 HOH 70  470 639 HOH HOH C . 
M 4 HOH 71  471 780 HOH HOH C . 
M 4 HOH 72  472 492 HOH HOH C . 
M 4 HOH 73  473 601 HOH HOH C . 
M 4 HOH 74  474 593 HOH HOH C . 
M 4 HOH 75  475 506 HOH HOH C . 
M 4 HOH 76  476 461 HOH HOH C . 
M 4 HOH 77  477 760 HOH HOH C . 
M 4 HOH 78  478 551 HOH HOH C . 
M 4 HOH 79  479 723 HOH HOH C . 
M 4 HOH 80  480 449 HOH HOH C . 
M 4 HOH 81  481 736 HOH HOH C . 
M 4 HOH 82  482 632 HOH HOH C . 
M 4 HOH 83  483 558 HOH HOH C . 
M 4 HOH 84  484 616 HOH HOH C . 
M 4 HOH 85  485 513 HOH HOH C . 
M 4 HOH 86  486 783 HOH HOH C . 
M 4 HOH 87  487 615 HOH HOH C . 
M 4 HOH 88  488 647 HOH HOH C . 
M 4 HOH 89  489 538 HOH HOH C . 
M 4 HOH 90  490 679 HOH HOH C . 
M 4 HOH 91  491 499 HOH HOH C . 
M 4 HOH 92  492 688 HOH HOH C . 
M 4 HOH 93  493 755 HOH HOH C . 
M 4 HOH 94  494 750 HOH HOH C . 
M 4 HOH 95  495 603 HOH HOH C . 
M 4 HOH 96  496 636 HOH HOH C . 
M 4 HOH 97  497 720 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
3 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,E,K   
2 1 B,F,G,L   
3 1 C,H,I,J,M 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-09-16 
2 'Structure model' 1 1 2018-02-07 
3 'Structure model' 1 2 2019-10-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 3 'Structure model' citation              
3 3 'Structure model' pdbx_database_related 
4 3 'Structure model' struct_ref_seq_dif    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'       
2 2 'Structure model' '_citation.page_first'           
3 2 'Structure model' '_citation.pdbx_database_id_DOI' 
4 2 'Structure model' '_citation.title'                
5 3 'Structure model' '_citation.page_last'            
6 3 'Structure model' '_struct_ref_seq_dif.details'    
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         9.0184 
_pdbx_refine_tls.origin_y         -6.6180 
_pdbx_refine_tls.origin_z         -33.0201 
_pdbx_refine_tls.T[1][1]          0.1084 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          0.0230 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          0.0202 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          0.0429 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          0.0081 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          0.0072 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          0.1733 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          0.0747 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          0.0516 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          0.3625 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          -0.1267 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          0.0836 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          0.0066 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          0.0699 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          0.0131 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          -0.0284 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          0.0015 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          0.0283 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tl