data_4ZSQ
# 
_entry.id   4ZSQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ZSQ         
WWPDB D_1000209823 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4ZSM PDB . 
unspecified 4ZSP PDB . 
unspecified 4ZSR PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4ZSQ 
_pdbx_database_status.recvd_initial_deposition_date   2015-05-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Timm, D.E.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Preparation and biological evaluation of conformationally constrained BACE1 inhibitors.' 
_citation.journal_abbrev            Bioorg.Med.Chem. 
_citation.journal_volume            23 
_citation.page_first                3260 
_citation.page_last                 3268 
_citation.year                      2015 
_citation.journal_id_ASTM           BMECEP 
_citation.country                   UK 
_citation.journal_id_ISSN           1464-3391 
_citation.journal_id_CSD            1200 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26001341 
_citation.pdbx_database_id_DOI      10.1016/j.bmc.2015.04.062 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Winneroski, L.L.'  1  
primary 'Schiffler, M.A.'   2  
primary 'Erickson, J.A.'    3  
primary 'May, P.C.'         4  
primary 'Monk, S.A.'        5  
primary 'Timm, D.E.'        6  
primary 'Audia, J.E.'       7  
primary 'Beck, J.P.'        8  
primary 'Boggs, L.N.'       9  
primary 'Borders, A.R.'     10 
primary 'Boyer, R.D.'       11 
primary 'Brier, R.A.'       12 
primary 'Hudziak, K.J.'     13 
primary 'Klimkowski, V.J.'  14 
primary 'Garcia Losada, P.' 15 
primary 'Mathes, B.M.'      16 
primary 'Stout, S.L.'       17 
primary 'Watson, B.M.'      18 
primary 'Mergott, D.J.'     19 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4ZSQ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     86.031 
_cell.length_a_esd                 ? 
_cell.length_b                     92.629 
_cell.length_b_esd                 ? 
_cell.length_c                     132.031 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4ZSQ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Beta-secretase 1'                                                                                         
48970.117 2   3.4.23.46 ? 'UNP residues 14-454' ? 
2 non-polymer syn 'N-[(4S,4aS,6S,8aR)-10-aminohexahydro-3H-4,8a-(epithiomethenoazeno)isochromen-6(1H)-yl]-3-chlorobenzamide' 
365.878   2   ?         ? ?                     ? 
3 non-polymer syn GLYCEROL                                                                                                   
92.094    2   ?         ? ?                     ? 
4 water       nat water                                                                                                      
18.015    482 ?         ? ?                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Aspartyl protease 2,Asp 2,Beta-site amyloid precursor protein cleaving enzyme 1,Beta-site APP cleaving enzyme 1,Memapsin-2,Membrane-associated aspartic protease 2
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILV
DTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFIN
GSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYT
PIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQ
AGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKR
IGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDEST
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILV
DTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFIN
GSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYT
PIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQ
AGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKR
IGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDEST
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   GLY n 
1 4   VAL n 
1 5   LEU n 
1 6   PRO n 
1 7   ALA n 
1 8   HIS n 
1 9   GLY n 
1 10  THR n 
1 11  GLN n 
1 12  HIS n 
1 13  GLY n 
1 14  ILE n 
1 15  ARG n 
1 16  LEU n 
1 17  PRO n 
1 18  LEU n 
1 19  ARG n 
1 20  SER n 
1 21  GLY n 
1 22  LEU n 
1 23  GLY n 
1 24  GLY n 
1 25  ALA n 
1 26  PRO n 
1 27  LEU n 
1 28  GLY n 
1 29  LEU n 
1 30  ARG n 
1 31  LEU n 
1 32  PRO n 
1 33  ARG n 
1 34  GLU n 
1 35  THR n 
1 36  ASP n 
1 37  GLU n 
1 38  GLU n 
1 39  PRO n 
1 40  GLU n 
1 41  GLU n 
1 42  PRO n 
1 43  GLY n 
1 44  ARG n 
1 45  ARG n 
1 46  GLY n 
1 47  SER n 
1 48  PHE n 
1 49  VAL n 
1 50  GLU n 
1 51  MET n 
1 52  VAL n 
1 53  ASP n 
1 54  ASN n 
1 55  LEU n 
1 56  ARG n 
1 57  GLY n 
1 58  LYS n 
1 59  SER n 
1 60  GLY n 
1 61  GLN n 
1 62  GLY n 
1 63  TYR n 
1 64  TYR n 
1 65  VAL n 
1 66  GLU n 
1 67  MET n 
1 68  THR n 
1 69  VAL n 
1 70  GLY n 
1 71  SER n 
1 72  PRO n 
1 73  PRO n 
1 74  GLN n 
1 75  THR n 
1 76  LEU n 
1 77  ASN n 
1 78  ILE n 
1 79  LEU n 
1 80  VAL n 
1 81  ASP n 
1 82  THR n 
1 83  GLY n 
1 84  SER n 
1 85  SER n 
1 86  ASN n 
1 87  PHE n 
1 88  ALA n 
1 89  VAL n 
1 90  GLY n 
1 91  ALA n 
1 92  ALA n 
1 93  PRO n 
1 94  HIS n 
1 95  PRO n 
1 96  PHE n 
1 97  LEU n 
1 98  HIS n 
1 99  ARG n 
1 100 TYR n 
1 101 TYR n 
1 102 GLN n 
1 103 ARG n 
1 104 GLN n 
1 105 LEU n 
1 106 SER n 
1 107 SER n 
1 108 THR n 
1 109 TYR n 
1 110 ARG n 
1 111 ASP n 
1 112 LEU n 
1 113 ARG n 
1 114 LYS n 
1 115 GLY n 
1 116 VAL n 
1 117 TYR n 
1 118 VAL n 
1 119 PRO n 
1 120 TYR n 
1 121 THR n 
1 122 GLN n 
1 123 GLY n 
1 124 LYS n 
1 125 TRP n 
1 126 GLU n 
1 127 GLY n 
1 128 GLU n 
1 129 LEU n 
1 130 GLY n 
1 131 THR n 
1 132 ASP n 
1 133 LEU n 
1 134 VAL n 
1 135 SER n 
1 136 ILE n 
1 137 PRO n 
1 138 HIS n 
1 139 GLY n 
1 140 PRO n 
1 141 ASN n 
1 142 VAL n 
1 143 THR n 
1 144 VAL n 
1 145 ARG n 
1 146 ALA n 
1 147 ASN n 
1 148 ILE n 
1 149 ALA n 
1 150 ALA n 
1 151 ILE n 
1 152 THR n 
1 153 GLU n 
1 154 SER n 
1 155 ASP n 
1 156 LYS n 
1 157 PHE n 
1 158 PHE n 
1 159 ILE n 
1 160 ASN n 
1 161 GLY n 
1 162 SER n 
1 163 ASN n 
1 164 TRP n 
1 165 GLU n 
1 166 GLY n 
1 167 ILE n 
1 168 LEU n 
1 169 GLY n 
1 170 LEU n 
1 171 ALA n 
1 172 TYR n 
1 173 ALA n 
1 174 GLU n 
1 175 ILE n 
1 176 ALA n 
1 177 ARG n 
1 178 PRO n 
1 179 ASP n 
1 180 ASP n 
1 181 SER n 
1 182 LEU n 
1 183 GLU n 
1 184 PRO n 
1 185 PHE n 
1 186 PHE n 
1 187 ASP n 
1 188 SER n 
1 189 LEU n 
1 190 VAL n 
1 191 LYS n 
1 192 GLN n 
1 193 THR n 
1 194 HIS n 
1 195 VAL n 
1 196 PRO n 
1 197 ASN n 
1 198 LEU n 
1 199 PHE n 
1 200 SER n 
1 201 LEU n 
1 202 GLN n 
1 203 LEU n 
1 204 CYS n 
1 205 GLY n 
1 206 ALA n 
1 207 GLY n 
1 208 PHE n 
1 209 PRO n 
1 210 LEU n 
1 211 ASN n 
1 212 GLN n 
1 213 SER n 
1 214 GLU n 
1 215 VAL n 
1 216 LEU n 
1 217 ALA n 
1 218 SER n 
1 219 VAL n 
1 220 GLY n 
1 221 GLY n 
1 222 SER n 
1 223 MET n 
1 224 ILE n 
1 225 ILE n 
1 226 GLY n 
1 227 GLY n 
1 228 ILE n 
1 229 ASP n 
1 230 HIS n 
1 231 SER n 
1 232 LEU n 
1 233 TYR n 
1 234 THR n 
1 235 GLY n 
1 236 SER n 
1 237 LEU n 
1 238 TRP n 
1 239 TYR n 
1 240 THR n 
1 241 PRO n 
1 242 ILE n 
1 243 ARG n 
1 244 ARG n 
1 245 GLU n 
1 246 TRP n 
1 247 TYR n 
1 248 TYR n 
1 249 GLU n 
1 250 VAL n 
1 251 ILE n 
1 252 ILE n 
1 253 VAL n 
1 254 ARG n 
1 255 VAL n 
1 256 GLU n 
1 257 ILE n 
1 258 ASN n 
1 259 GLY n 
1 260 GLN n 
1 261 ASP n 
1 262 LEU n 
1 263 LYS n 
1 264 MET n 
1 265 ASP n 
1 266 CYS n 
1 267 LYS n 
1 268 GLU n 
1 269 TYR n 
1 270 ASN n 
1 271 TYR n 
1 272 ASP n 
1 273 LYS n 
1 274 SER n 
1 275 ILE n 
1 276 VAL n 
1 277 ASP n 
1 278 SER n 
1 279 GLY n 
1 280 THR n 
1 281 THR n 
1 282 ASN n 
1 283 LEU n 
1 284 ARG n 
1 285 LEU n 
1 286 PRO n 
1 287 LYS n 
1 288 LYS n 
1 289 VAL n 
1 290 PHE n 
1 291 GLU n 
1 292 ALA n 
1 293 ALA n 
1 294 VAL n 
1 295 LYS n 
1 296 SER n 
1 297 ILE n 
1 298 LYS n 
1 299 ALA n 
1 300 ALA n 
1 301 SER n 
1 302 SER n 
1 303 THR n 
1 304 GLU n 
1 305 LYS n 
1 306 PHE n 
1 307 PRO n 
1 308 ASP n 
1 309 GLY n 
1 310 PHE n 
1 311 TRP n 
1 312 LEU n 
1 313 GLY n 
1 314 GLU n 
1 315 GLN n 
1 316 LEU n 
1 317 VAL n 
1 318 CYS n 
1 319 TRP n 
1 320 GLN n 
1 321 ALA n 
1 322 GLY n 
1 323 THR n 
1 324 THR n 
1 325 PRO n 
1 326 TRP n 
1 327 ASN n 
1 328 ILE n 
1 329 PHE n 
1 330 PRO n 
1 331 VAL n 
1 332 ILE n 
1 333 SER n 
1 334 LEU n 
1 335 TYR n 
1 336 LEU n 
1 337 MET n 
1 338 GLY n 
1 339 GLU n 
1 340 VAL n 
1 341 THR n 
1 342 ASN n 
1 343 GLN n 
1 344 SER n 
1 345 PHE n 
1 346 ARG n 
1 347 ILE n 
1 348 THR n 
1 349 ILE n 
1 350 LEU n 
1 351 PRO n 
1 352 GLN n 
1 353 GLN n 
1 354 TYR n 
1 355 LEU n 
1 356 ARG n 
1 357 PRO n 
1 358 VAL n 
1 359 GLU n 
1 360 ASP n 
1 361 VAL n 
1 362 ALA n 
1 363 THR n 
1 364 SER n 
1 365 GLN n 
1 366 ASP n 
1 367 ASP n 
1 368 CYS n 
1 369 TYR n 
1 370 LYS n 
1 371 PHE n 
1 372 ALA n 
1 373 ILE n 
1 374 SER n 
1 375 GLN n 
1 376 SER n 
1 377 SER n 
1 378 THR n 
1 379 GLY n 
1 380 THR n 
1 381 VAL n 
1 382 MET n 
1 383 GLY n 
1 384 ALA n 
1 385 VAL n 
1 386 ILE n 
1 387 MET n 
1 388 GLU n 
1 389 GLY n 
1 390 PHE n 
1 391 TYR n 
1 392 VAL n 
1 393 VAL n 
1 394 PHE n 
1 395 ASP n 
1 396 ARG n 
1 397 ALA n 
1 398 ARG n 
1 399 LYS n 
1 400 ARG n 
1 401 ILE n 
1 402 GLY n 
1 403 PHE n 
1 404 ALA n 
1 405 VAL n 
1 406 SER n 
1 407 ALA n 
1 408 CYS n 
1 409 HIS n 
1 410 VAL n 
1 411 HIS n 
1 412 ASP n 
1 413 GLU n 
1 414 PHE n 
1 415 ARG n 
1 416 THR n 
1 417 ALA n 
1 418 ALA n 
1 419 VAL n 
1 420 GLU n 
1 421 GLY n 
1 422 PRO n 
1 423 PHE n 
1 424 VAL n 
1 425 THR n 
1 426 LEU n 
1 427 ASP n 
1 428 MET n 
1 429 GLU n 
1 430 ASP n 
1 431 CYS n 
1 432 GLY n 
1 433 TYR n 
1 434 ASN n 
1 435 ILE n 
1 436 PRO n 
1 437 GLN n 
1 438 THR n 
1 439 ASP n 
1 440 GLU n 
1 441 SER n 
1 442 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   442 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BACE1, BACE, KIAA1149' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BACE1_HUMAN 
_struct_ref.pdbx_db_accession          P56817 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVD
TGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFING
SNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTP
IRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQA
GTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRI
GFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDEST
;
_struct_ref.pdbx_align_begin           14 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ZSQ A 2 ? 442 ? P56817 14 ? 454 ? -47 393 
2 1 4ZSQ B 2 ? 442 ? P56817 14 ? 454 ? -47 393 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ZSQ MET A 1 ? UNP P56817 ? ? 'initiating methionine' -48 1 
2 4ZSQ MET B 1 ? UNP P56817 ? ? 'initiating methionine' -48 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4RX non-polymer         . 
'N-[(4S,4aS,6S,8aR)-10-aminohexahydro-3H-4,8a-(epithiomethenoazeno)isochromen-6(1H)-yl]-3-chlorobenzamide' ? 'C17 H20 Cl N3 O2 S' 
365.878 
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'         75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'           92.094  
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER ?                               'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'      149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'        117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4ZSQ 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.69 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.20 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG8000, sodium cacodylate, ammonium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 210r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-10-31 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97856 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 31-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97856 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   31-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4ZSQ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.3 
_reflns.d_resolution_low                 132.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       47661 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.3 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            -6.30 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            8.24 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            -1.94 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               54.488 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.965 
_refine.correlation_coeff_Fo_to_Fc_free          0.938 
_refine.details                                  'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4ZSQ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.30 
_refine.ls_d_res_low                             75.83 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     46470 
_refine.ls_number_reflns_R_free                  1042 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.82 
_refine.ls_percent_reflns_R_free                 2.2 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.20309 
_refine.ls_R_factor_R_free                       0.25798 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.20191 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.271 
_refine.pdbx_overall_ESU_R_Free                  0.226 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             9.610 
_refine.overall_SU_ML                            0.208 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        6104 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             482 
_refine_hist.number_atoms_total               6646 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        75.83 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  0.019  6342 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.403  1.957  8634 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.583  5.000  780  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 35.059 23.979 289  ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 14.089 15.000 997  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 19.259 15.000 34   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.094  0.200  941  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.021  4900 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 2.922  5.344  3114 ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 4.440  8.005  3890 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 3.442  5.505  3228 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 7.336  45.039 9744 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             70 
_refine_ls_shell.number_reflns_R_work             3400 
_refine_ls_shell.percent_reflns_obs               99.86 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.330 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.370 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     4ZSQ 
_struct.title                        'BACE crystal structure with tricyclic aminothiazine inhibitor' 
_struct.pdbx_descriptor              'Beta-secretase 1 (E.C.3.4.23.46)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4ZSQ 
_struct_keywords.text            'aspartyl, protease, beta-secretase, Hydrolase-Hydrolase Inhibitor complex' 
_struct_keywords.pdbx_keywords   'Hydrolase/Hydrolase Inhibitor' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PHE A 48  ? VAL A 52  ? PHE A -1  VAL A 3   5 ? 5  
HELX_P HELX_P2  AA2 GLN A 102 ? SER A 106 ? GLN A 53  SER A 57  5 ? 5  
HELX_P HELX_P3  AA3 TYR A 172 ? ALA A 176 ? TYR A 123 ALA A 127 5 ? 5  
HELX_P HELX_P4  AA4 PRO A 184 ? THR A 193 ? PRO A 135 THR A 144 1 ? 10 
HELX_P HELX_P5  AA5 ASN A 211 ? SER A 218 ? ASN A 162 SER A 169 1 ? 8  
HELX_P HELX_P6  AA6 ASP A 229 ? SER A 231 ? ASP A 180 SER A 182 5 ? 3  
HELX_P HELX_P7  AA7 LYS A 287 ? SER A 301 ? LYS A 238 SER A 252 1 ? 15 
HELX_P HELX_P8  AA8 PRO A 307 ? LEU A 312 ? PRO A 258 LEU A 263 1 ? 6  
HELX_P HELX_P9  AA9 PRO A 325 ? PHE A 329 ? PRO A 276 PHE A 280 5 ? 5  
HELX_P HELX_P10 AB1 LEU A 350 ? TYR A 354 ? LEU A 301 TYR A 305 1 ? 5  
HELX_P HELX_P11 AB2 GLY A 383 ? GLU A 388 ? GLY A 334 GLU A 339 1 ? 6  
HELX_P HELX_P12 AB3 MET A 428 ? GLY A 432 ? MET A 379 GLY A 383 5 ? 5  
HELX_P HELX_P13 AB4 GLN B 102 ? SER B 106 ? GLN B 53  SER B 57  5 ? 5  
HELX_P HELX_P14 AB5 TYR B 172 ? ALA B 176 ? TYR B 123 ALA B 127 5 ? 5  
HELX_P HELX_P15 AB6 PRO B 184 ? THR B 193 ? PRO B 135 THR B 144 1 ? 10 
HELX_P HELX_P16 AB7 ASN B 211 ? SER B 218 ? ASN B 162 SER B 169 1 ? 8  
HELX_P HELX_P17 AB8 ASP B 229 ? SER B 231 ? ASP B 180 SER B 182 5 ? 3  
HELX_P HELX_P18 AB9 ASP B 265 ? TYR B 271 ? ASP B 216 TYR B 222 5 ? 7  
HELX_P HELX_P19 AC1 LYS B 287 ? SER B 301 ? LYS B 238 SER B 252 1 ? 15 
HELX_P HELX_P20 AC2 PRO B 307 ? LEU B 312 ? PRO B 258 LEU B 263 1 ? 6  
HELX_P HELX_P21 AC3 PRO B 325 ? PHE B 329 ? PRO B 276 PHE B 280 5 ? 5  
HELX_P HELX_P22 AC4 LEU B 350 ? TYR B 354 ? LEU B 301 TYR B 305 1 ? 5  
HELX_P HELX_P23 AC5 GLY B 383 ? GLU B 388 ? GLY B 334 GLU B 339 1 ? 6  
HELX_P HELX_P24 AC6 ASP B 427 ? GLY B 432 ? ASP B 378 GLY B 383 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 204 SG ? ? ? 1_555 A CYS 408 SG ? ? A CYS 155 A CYS 359 1_555 ? ? ? ? ? ? ? 2.075 ? 
disulf2 disulf ? ? A CYS 266 SG ? ? ? 1_555 A CYS 431 SG ? ? A CYS 217 A CYS 382 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf3 disulf ? ? A CYS 318 SG ? ? ? 1_555 A CYS 368 SG ? ? A CYS 269 A CYS 319 1_555 ? ? ? ? ? ? ? 2.060 ? 
disulf4 disulf ? ? B CYS 204 SG ? ? ? 1_555 B CYS 408 SG ? ? B CYS 155 B CYS 359 1_555 ? ? ? ? ? ? ? 2.081 ? 
disulf5 disulf ? ? B CYS 266 SG ? ? ? 1_555 B CYS 431 SG ? ? B CYS 217 B CYS 382 1_555 ? ? ? ? ? ? ? 2.063 ? 
disulf6 disulf ? ? B CYS 318 SG ? ? ? 1_555 B CYS 368 SG ? ? B CYS 269 B CYS 319 1_555 ? ? ? ? ? ? ? 2.061 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 71  A . ? SER 22  A PRO 72  A ? PRO 23  A 1 -7.71 
2 ARG 177 A . ? ARG 128 A PRO 178 A ? PRO 129 A 1 2.54  
3 TYR 271 A . ? TYR 222 A ASP 272 A ? ASP 223 A 1 0.91  
4 GLY 421 A . ? GLY 372 A PRO 422 A ? PRO 373 A 1 1.09  
5 SER 71  B . ? SER 22  B PRO 72  B ? PRO 23  B 1 -9.54 
6 ARG 177 B . ? ARG 128 B PRO 178 B ? PRO 129 B 1 0.90  
7 TYR 271 B . ? TYR 222 B ASP 272 B ? ASP 223 B 1 1.91  
8 GLY 421 B . ? GLY 372 B PRO 422 B ? PRO 373 B 1 2.88  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 4 ? 
AA3 ? 5 ? 
AA4 ? 5 ? 
AA5 ? 4 ? 
AA6 ? 3 ? 
AA7 ? 8 ? 
AA8 ? 4 ? 
AA9 ? 5 ? 
AB1 ? 5 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? parallel      
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? parallel      
AA7 4 5 ? anti-parallel 
AA7 5 6 ? parallel      
AA7 6 7 ? anti-parallel 
AA7 7 8 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB2 1 2 ? parallel      
AB3 1 2 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 55  ? LYS A 58  ? LEU A 6   LYS A 9   
AA1 2 GLY A 62  ? VAL A 69  ? GLY A 13  VAL A 20  
AA1 3 GLN A 74  ? ASP A 81  ? GLN A 25  ASP A 32  
AA1 4 GLY A 166 ? GLY A 169 ? GLY A 117 GLY A 120 
AA1 5 PHE A 87  ? GLY A 90  ? PHE A 38  GLY A 41  
AA1 6 THR A 143 ? ASP A 155 ? THR A 94  ASP A 106 
AA1 7 GLY A 123 ? SER A 135 ? GLY A 74  SER A 86  
AA1 8 ARG A 110 ? TYR A 120 ? ARG A 61  TYR A 71  
AA2 1 LEU A 55  ? LYS A 58  ? LEU A 6   LYS A 9   
AA2 2 GLY A 62  ? VAL A 69  ? GLY A 13  VAL A 20  
AA2 3 GLY A 123 ? SER A 135 ? GLY A 74  SER A 86  
AA2 4 ARG A 110 ? TYR A 120 ? ARG A 61  TYR A 71  
AA3 1 GLY A 221 ? ILE A 225 ? GLY A 172 ILE A 176 
AA3 2 PHE A 199 ? LEU A 203 ? PHE A 150 LEU A 154 
AA3 3 PHE A 390 ? ASP A 395 ? PHE A 341 ASP A 346 
AA3 4 ARG A 400 ? SER A 406 ? ARG A 351 SER A 357 
AA3 5 TYR A 233 ? PRO A 241 ? TYR A 184 PRO A 192 
AA4 1 GLN A 260 ? ASP A 261 ? GLN A 211 ASP A 212 
AA4 2 ILE A 252 ? ILE A 257 ? ILE A 203 ILE A 208 
AA4 3 ILE A 332 ? MET A 337 ? ILE A 283 MET A 288 
AA4 4 GLN A 343 ? ILE A 349 ? GLN A 294 ILE A 300 
AA4 5 ALA A 418 ? VAL A 424 ? ALA A 369 VAL A 375 
AA5 1 SER A 274 ? VAL A 276 ? SER A 225 VAL A 227 
AA5 2 THR A 380 ? MET A 382 ? THR A 331 MET A 333 
AA5 3 LEU A 283 ? PRO A 286 ? LEU A 234 PRO A 237 
AA5 4 ILE A 373 ? SER A 376 ? ILE A 324 SER A 327 
AA6 1 VAL A 317 ? TRP A 319 ? VAL A 268 TRP A 270 
AA6 2 ASP A 367 ? PHE A 371 ? ASP A 318 PHE A 322 
AA6 3 LEU A 355 ? VAL A 358 ? LEU A 306 VAL A 309 
AA7 1 LEU B 55  ? LYS B 58  ? LEU B 6   LYS B 9   
AA7 2 GLY B 62  ? VAL B 69  ? GLY B 13  VAL B 20  
AA7 3 GLN B 74  ? ASP B 81  ? GLN B 25  ASP B 32  
AA7 4 GLY B 166 ? GLY B 169 ? GLY B 117 GLY B 120 
AA7 5 PHE B 87  ? GLY B 90  ? PHE B 38  GLY B 41  
AA7 6 THR B 143 ? ASP B 155 ? THR B 94  ASP B 106 
AA7 7 GLY B 123 ? SER B 135 ? GLY B 74  SER B 86  
AA7 8 ARG B 110 ? TYR B 120 ? ARG B 61  TYR B 71  
AA8 1 LEU B 55  ? LYS B 58  ? LEU B 6   LYS B 9   
AA8 2 GLY B 62  ? VAL B 69  ? GLY B 13  VAL B 20  
AA8 3 GLY B 123 ? SER B 135 ? GLY B 74  SER B 86  
AA8 4 ARG B 110 ? TYR B 120 ? ARG B 61  TYR B 71  
AA9 1 GLY B 221 ? ILE B 225 ? GLY B 172 ILE B 176 
AA9 2 PHE B 199 ? LEU B 203 ? PHE B 150 LEU B 154 
AA9 3 PHE B 390 ? ASP B 395 ? PHE B 341 ASP B 346 
AA9 4 ARG B 400 ? SER B 406 ? ARG B 351 SER B 357 
AA9 5 TYR B 233 ? PRO B 241 ? TYR B 184 PRO B 192 
AB1 1 GLN B 260 ? ASP B 261 ? GLN B 211 ASP B 212 
AB1 2 ILE B 252 ? ILE B 257 ? ILE B 203 ILE B 208 
AB1 3 ILE B 332 ? MET B 337 ? ILE B 283 MET B 288 
AB1 4 GLN B 343 ? ILE B 349 ? GLN B 294 ILE B 300 
AB1 5 ALA B 418 ? VAL B 424 ? ALA B 369 VAL B 375 
AB2 1 SER B 274 ? VAL B 276 ? SER B 225 VAL B 227 
AB2 2 THR B 380 ? MET B 382 ? THR B 331 MET B 333 
AB3 1 LEU B 283 ? PRO B 286 ? LEU B 234 PRO B 237 
AB3 2 ILE B 373 ? SER B 376 ? ILE B 324 SER B 327 
AB4 1 VAL B 317 ? TRP B 319 ? VAL B 268 TRP B 270 
AB4 2 ASP B 367 ? PHE B 371 ? ASP B 318 PHE B 322 
AB4 3 LEU B 355 ? VAL B 358 ? LEU B 306 VAL B 309 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 56  ? N ARG A 7   O TYR A 64  ? O TYR A 15  
AA1 2 3 N MET A 67  ? N MET A 18  O LEU A 76  ? O LEU A 27  
AA1 3 4 N LEU A 79  ? N LEU A 30  O LEU A 168 ? O LEU A 119 
AA1 4 5 O ILE A 167 ? O ILE A 118 N ALA A 88  ? N ALA A 39  
AA1 5 6 N PHE A 87  ? N PHE A 38  O ALA A 149 ? O ALA A 100 
AA1 6 7 O ILE A 148 ? O ILE A 99  N GLY A 130 ? N GLY A 81  
AA1 7 8 O TRP A 125 ? O TRP A 76  N VAL A 118 ? N VAL A 69  
AA2 1 2 N ARG A 56  ? N ARG A 7   O TYR A 64  ? O TYR A 15  
AA2 2 3 N THR A 68  ? N THR A 19  O SER A 135 ? O SER A 86  
AA2 3 4 O TRP A 125 ? O TRP A 76  N VAL A 118 ? N VAL A 69  
AA3 1 2 O SER A 222 ? O SER A 173 N GLN A 202 ? N GLN A 153 
AA3 2 3 N PHE A 199 ? N PHE A 150 O PHE A 394 ? O PHE A 345 
AA3 3 4 N VAL A 393 ? N VAL A 344 O GLY A 402 ? O GLY A 353 
AA3 4 5 O ILE A 401 ? O ILE A 352 N THR A 240 ? N THR A 191 
AA4 1 2 O GLN A 260 ? O GLN A 211 N ILE A 257 ? N ILE A 208 
AA4 2 3 N ARG A 254 ? N ARG A 205 O TYR A 335 ? O TYR A 286 
AA4 3 4 N ILE A 332 ? N ILE A 283 O ILE A 349 ? O ILE A 300 
AA4 4 5 N ARG A 346 ? N ARG A 297 O GLU A 420 ? O GLU A 371 
AA5 1 2 N ILE A 275 ? N ILE A 226 O MET A 382 ? O MET A 333 
AA5 2 3 O VAL A 381 ? O VAL A 332 N ARG A 284 ? N ARG A 235 
AA5 3 4 N LEU A 285 ? N LEU A 236 O SER A 374 ? O SER A 325 
AA6 1 2 N TRP A 319 ? N TRP A 270 O ASP A 367 ? O ASP A 318 
AA6 2 3 O LYS A 370 ? O LYS A 321 N ARG A 356 ? N ARG A 307 
AA7 1 2 N ARG B 56  ? N ARG B 7   O TYR B 64  ? O TYR B 15  
AA7 2 3 N MET B 67  ? N MET B 18  O LEU B 76  ? O LEU B 27  
AA7 3 4 N LEU B 79  ? N LEU B 30  O LEU B 168 ? O LEU B 119 
AA7 4 5 O ILE B 167 ? O ILE B 118 N ALA B 88  ? N ALA B 39  
AA7 5 6 N VAL B 89  ? N VAL B 40  O ILE B 151 ? O ILE B 102 
AA7 6 7 O ALA B 150 ? O ALA B 101 N GLU B 128 ? N GLU B 79  
AA7 7 8 O THR B 131 ? O THR B 82  N ARG B 110 ? N ARG B 61  
AA8 1 2 N ARG B 56  ? N ARG B 7   O TYR B 64  ? O TYR B 15  
AA8 2 3 N THR B 68  ? N THR B 19  O SER B 135 ? O SER B 86  
AA8 3 4 O THR B 131 ? O THR B 82  N ARG B 110 ? N ARG B 61  
AA9 1 2 O SER B 222 ? O SER B 173 N GLN B 202 ? N GLN B 153 
AA9 2 3 N PHE B 199 ? N PHE B 150 O PHE B 394 ? O PHE B 345 
AA9 3 4 N TYR B 391 ? N TYR B 342 O ALA B 404 ? O ALA B 355 
AA9 4 5 O ILE B 401 ? O ILE B 352 N THR B 240 ? N THR B 191 
AB1 1 2 O GLN B 260 ? O GLN B 211 N ILE B 257 ? N ILE B 208 
AB1 2 3 N ARG B 254 ? N ARG B 205 O TYR B 335 ? O TYR B 286 
AB1 3 4 N ILE B 332 ? N ILE B 283 O ILE B 349 ? O ILE B 300 
AB1 4 5 N ARG B 346 ? N ARG B 297 O GLU B 420 ? O GLU B 371 
AB2 1 2 N ILE B 275 ? N ILE B 226 O MET B 382 ? O MET B 333 
AB3 1 2 N LEU B 285 ? N LEU B 236 O SER B 374 ? O SER B 325 
AB4 1 2 N VAL B 317 ? N VAL B 268 O TYR B 369 ? O TYR B 320 
AB4 2 3 O LYS B 370 ? O LYS B 321 N ARG B 356 ? N ARG B 307 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 4RX 401 ? 13 'binding site for residue 4RX A 401' 
AC2 Software B 4RX 401 ? 10 'binding site for residue 4RX B 401' 
AC3 Software B GOL 402 ? 8  'binding site for residue GOL B 402' 
AC4 Software B GOL 403 ? 7  'binding site for residue GOL B 403' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 SER A 59  ? SER A 10  . ? 1_555 ? 
2  AC1 13 GLY A 60  ? GLY A 11  . ? 1_555 ? 
3  AC1 13 GLN A 61  ? GLN A 12  . ? 1_555 ? 
4  AC1 13 GLY A 62  ? GLY A 13  . ? 1_555 ? 
5  AC1 13 ASP A 81  ? ASP A 32  . ? 1_555 ? 
6  AC1 13 GLY A 83  ? GLY A 34  . ? 1_555 ? 
7  AC1 13 TYR A 120 ? TYR A 71  . ? 1_555 ? 
8  AC1 13 ILE A 159 ? ILE A 110 . ? 1_555 ? 
9  AC1 13 TRP A 164 ? TRP A 115 . ? 1_555 ? 
10 AC1 13 ASP A 277 ? ASP A 228 . ? 1_555 ? 
11 AC1 13 SER A 278 ? SER A 229 . ? 1_555 ? 
12 AC1 13 GLY A 279 ? GLY A 230 . ? 1_555 ? 
13 AC1 13 THR A 281 ? THR A 232 . ? 1_555 ? 
14 AC2 10 GLY B 60  ? GLY B 11  . ? 1_555 ? 
15 AC2 10 GLN B 61  ? GLN B 12  . ? 1_555 ? 
16 AC2 10 GLY B 62  ? GLY B 13  . ? 1_555 ? 
17 AC2 10 ASP B 81  ? ASP B 32  . ? 1_555 ? 
18 AC2 10 GLY B 83  ? GLY B 34  . ? 1_555 ? 
19 AC2 10 TYR B 120 ? TYR B 71  . ? 1_555 ? 
20 AC2 10 ASP B 277 ? ASP B 228 . ? 1_555 ? 
21 AC2 10 SER B 278 ? SER B 229 . ? 1_555 ? 
22 AC2 10 GLY B 279 ? GLY B 230 . ? 1_555 ? 
23 AC2 10 THR B 281 ? THR B 232 . ? 1_555 ? 
24 AC3 8  ASP A 367 ? ASP A 318 . ? 1_555 ? 
25 AC3 8  HOH G .   ? HOH A 509 . ? 1_555 ? 
26 AC3 8  SER B 107 ? SER B 58  . ? 1_555 ? 
27 AC3 8  THR B 108 ? THR B 59  . ? 1_555 ? 
28 AC3 8  ARG B 110 ? ARG B 61  . ? 1_555 ? 
29 AC3 8  ARG B 145 ? ARG B 96  . ? 1_555 ? 
30 AC3 8  HOH H .   ? HOH B 554 . ? 1_555 ? 
31 AC3 8  HOH H .   ? HOH B 603 . ? 1_555 ? 
32 AC4 7  SER A 107 ? SER A 58  . ? 1_455 ? 
33 AC4 7  THR A 108 ? THR A 59  . ? 1_455 ? 
34 AC4 7  TYR A 109 ? TYR A 60  . ? 1_455 ? 
35 AC4 7  ARG A 110 ? ARG A 61  . ? 1_455 ? 
36 AC4 7  ARG A 145 ? ARG A 96  . ? 1_455 ? 
37 AC4 7  ASP B 367 ? ASP B 318 . ? 1_555 ? 
38 AC4 7  HOH H .   ? HOH B 543 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4ZSQ 
_atom_sites.fract_transf_matrix[1][1]   0.011624 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010796 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007574 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 46  ? 11.216  17.985  1.579   1.00 94.77  ? -3  GLY A N   1 
ATOM   2    C  CA  . GLY A 1 46  ? 9.732   18.225  1.572   1.00 102.72 ? -3  GLY A CA  1 
ATOM   3    C  C   . GLY A 1 46  ? 9.035   17.380  0.516   1.00 108.07 ? -3  GLY A C   1 
ATOM   4    O  O   . GLY A 1 46  ? 8.378   16.371  0.848   1.00 105.67 ? -3  GLY A O   1 
ATOM   5    N  N   . SER A 1 47  ? 9.186   17.790  -0.761  1.00 111.80 ? -2  SER A N   1 
ATOM   6    C  CA  . SER A 1 47  ? 8.550   17.093  -1.897  1.00 111.37 ? -2  SER A CA  1 
ATOM   7    C  C   . SER A 1 47  ? 9.415   17.079  -3.179  1.00 114.30 ? -2  SER A C   1 
ATOM   8    O  O   . SER A 1 47  ? 9.914   18.135  -3.622  1.00 121.18 ? -2  SER A O   1 
ATOM   9    C  CB  . SER A 1 47  ? 7.168   17.703  -2.202  1.00 103.33 ? -2  SER A CB  1 
ATOM   10   O  OG  . SER A 1 47  ? 6.535   17.005  -3.268  1.00 102.46 ? -2  SER A OG  1 
ATOM   11   N  N   . PHE A 1 48  ? 9.582   15.883  -3.764  1.00 102.22 ? -1  PHE A N   1 
ATOM   12   C  CA  . PHE A 1 48  ? 10.288  15.698  -5.045  1.00 83.51  ? -1  PHE A CA  1 
ATOM   13   C  C   . PHE A 1 48  ? 9.280   15.133  -6.038  1.00 80.84  ? -1  PHE A C   1 
ATOM   14   O  O   . PHE A 1 48  ? 9.376   13.969  -6.428  1.00 84.42  ? -1  PHE A O   1 
ATOM   15   C  CB  . PHE A 1 48  ? 11.450  14.705  -4.898  1.00 74.39  ? -1  PHE A CB  1 
ATOM   16   C  CG  . PHE A 1 48  ? 12.544  15.150  -3.954  1.00 73.73  ? -1  PHE A CG  1 
ATOM   17   C  CD1 . PHE A 1 48  ? 12.343  15.177  -2.550  1.00 72.26  ? -1  PHE A CD1 1 
ATOM   18   C  CD2 . PHE A 1 48  ? 13.796  15.501  -4.463  1.00 69.89  ? -1  PHE A CD2 1 
ATOM   19   C  CE1 . PHE A 1 48  ? 13.361  15.582  -1.688  1.00 74.11  ? -1  PHE A CE1 1 
ATOM   20   C  CE2 . PHE A 1 48  ? 14.817  15.896  -3.609  1.00 67.59  ? -1  PHE A CE2 1 
ATOM   21   C  CZ  . PHE A 1 48  ? 14.600  15.939  -2.221  1.00 70.96  ? -1  PHE A CZ  1 
ATOM   22   N  N   . VAL A 1 49  ? 8.309   15.958  -6.430  1.00 75.77  ? 0   VAL A N   1 
ATOM   23   C  CA  . VAL A 1 49  ? 7.162   15.497  -7.217  1.00 74.68  ? 0   VAL A CA  1 
ATOM   24   C  C   . VAL A 1 49  ? 7.538   14.781  -8.525  1.00 74.86  ? 0   VAL A C   1 
ATOM   25   O  O   . VAL A 1 49  ? 6.972   13.728  -8.848  1.00 77.54  ? 0   VAL A O   1 
ATOM   26   C  CB  . VAL A 1 49  ? 6.116   16.625  -7.448  1.00 79.07  ? 0   VAL A CB  1 
ATOM   27   C  CG1 . VAL A 1 49  ? 6.731   17.821  -8.174  1.00 79.82  ? 0   VAL A CG1 1 
ATOM   28   C  CG2 . VAL A 1 49  ? 4.892   16.101  -8.200  1.00 79.19  ? 0   VAL A CG2 1 
ATOM   29   N  N   . GLU A 1 50  ? 8.502   15.334  -9.260  1.00 73.37  ? 1   GLU A N   1 
ATOM   30   C  CA  . GLU A 1 50  ? 8.902   14.772  -10.559 1.00 71.76  ? 1   GLU A CA  1 
ATOM   31   C  C   . GLU A 1 50  ? 9.391   13.303  -10.477 1.00 67.09  ? 1   GLU A C   1 
ATOM   32   O  O   . GLU A 1 50  ? 9.418   12.594  -11.485 1.00 66.36  ? 1   GLU A O   1 
ATOM   33   C  CB  . GLU A 1 50  ? 9.920   15.694  -11.264 1.00 73.56  ? 1   GLU A CB  1 
ATOM   34   C  CG  . GLU A 1 50  ? 11.384  15.552  -10.828 1.00 84.45  ? 1   GLU A CG  1 
ATOM   35   C  CD  . GLU A 1 50  ? 11.785  16.334  -9.563  1.00 84.61  ? 1   GLU A CD  1 
ATOM   36   O  OE1 . GLU A 1 50  ? 10.929  16.638  -8.683  1.00 81.14  ? 1   GLU A OE1 1 
ATOM   37   O  OE2 . GLU A 1 50  ? 13.002  16.614  -9.433  1.00 83.87  ? 1   GLU A OE2 1 
ATOM   38   N  N   . MET A 1 51  ? 9.732   12.853  -9.268  1.00 62.18  ? 2   MET A N   1 
ATOM   39   C  CA  . MET A 1 51  ? 10.214  11.488  -9.036  1.00 60.69  ? 2   MET A CA  1 
ATOM   40   C  C   . MET A 1 51  ? 9.181   10.497  -8.489  1.00 61.64  ? 2   MET A C   1 
ATOM   41   O  O   . MET A 1 51  ? 9.347   9.286   -8.645  1.00 62.18  ? 2   MET A O   1 
ATOM   42   C  CB  . MET A 1 51  ? 11.450  11.509  -8.142  1.00 60.25  ? 2   MET A CB  1 
ATOM   43   C  CG  . MET A 1 51  ? 12.667  11.959  -8.906  1.00 60.02  ? 2   MET A CG  1 
ATOM   44   S  SD  . MET A 1 51  ? 14.140  12.098  -7.909  1.00 63.37  ? 2   MET A SD  1 
ATOM   45   C  CE  . MET A 1 51  ? 14.284  13.872  -7.643  1.00 62.02  ? 2   MET A CE  1 
ATOM   46   N  N   . VAL A 1 52  ? 8.126   10.992  -7.849  1.00 58.69  ? 3   VAL A N   1 
ATOM   47   C  CA  . VAL A 1 52  ? 7.071   10.117  -7.353  1.00 53.27  ? 3   VAL A CA  1 
ATOM   48   C  C   . VAL A 1 52  ? 6.482   9.339   -8.528  1.00 56.14  ? 3   VAL A C   1 
ATOM   49   O  O   . VAL A 1 52  ? 6.263   9.912   -9.603  1.00 54.33  ? 3   VAL A O   1 
ATOM   50   C  CB  . VAL A 1 52  ? 5.982   10.921  -6.607  1.00 52.89  ? 3   VAL A CB  1 
ATOM   51   C  CG1 . VAL A 1 52  ? 4.652   10.182  -6.593  1.00 51.07  ? 3   VAL A CG1 1 
ATOM   52   C  CG2 . VAL A 1 52  ? 6.431   11.222  -5.195  1.00 49.13  ? 3   VAL A CG2 1 
ATOM   53   N  N   . ASP A 1 53  ? 6.261   8.034   -8.327  1.00 55.92  ? 4   ASP A N   1 
ATOM   54   C  CA  . ASP A 1 53  ? 5.603   7.166   -9.327  1.00 59.25  ? 4   ASP A CA  1 
ATOM   55   C  C   . ASP A 1 53  ? 6.507   6.714   -10.473 1.00 56.33  ? 4   ASP A C   1 
ATOM   56   O  O   . ASP A 1 53  ? 6.003   6.264   -11.507 1.00 58.56  ? 4   ASP A O   1 
ATOM   57   C  CB  . ASP A 1 53  ? 4.319   7.808   -9.918  1.00 62.39  ? 4   ASP A CB  1 
ATOM   58   C  CG  . ASP A 1 53  ? 3.166   7.911   -8.903  1.00 65.75  ? 4   ASP A CG  1 
ATOM   59   O  OD1 . ASP A 1 53  ? 3.275   7.348   -7.785  1.00 61.31  ? 4   ASP A OD1 1 
ATOM   60   O  OD2 . ASP A 1 53  ? 2.150   8.570   -9.237  1.00 67.90  ? 4   ASP A OD2 1 
ATOM   61   N  N   . ASN A 1 54  ? 7.825   6.814   -10.287 1.00 49.94  ? 5   ASN A N   1 
ATOM   62   C  CA  . ASN A 1 54  ? 8.776   6.491   -11.354 1.00 45.81  ? 5   ASN A CA  1 
ATOM   63   C  C   . ASN A 1 54  ? 9.128   5.004   -11.455 1.00 46.94  ? 5   ASN A C   1 
ATOM   64   O  O   . ASN A 1 54  ? 9.912   4.617   -12.328 1.00 48.03  ? 5   ASN A O   1 
ATOM   65   C  CB  . ASN A 1 54  ? 10.042  7.362   -11.285 1.00 44.25  ? 5   ASN A CB  1 
ATOM   66   C  CG  . ASN A 1 54  ? 10.868  7.147   -10.010 1.00 45.56  ? 5   ASN A CG  1 
ATOM   67   O  OD1 . ASN A 1 54  ? 10.522  6.352   -9.139  1.00 51.71  ? 5   ASN A OD1 1 
ATOM   68   N  ND2 . ASN A 1 54  ? 11.966  7.873   -9.902  1.00 42.33  ? 5   ASN A ND2 1 
ATOM   69   N  N   . LEU A 1 55  ? 8.537   4.167   -10.598 1.00 42.11  ? 6   LEU A N   1 
ATOM   70   C  CA  . LEU A 1 55  ? 8.841   2.727   -10.653 1.00 42.25  ? 6   LEU A CA  1 
ATOM   71   C  C   . LEU A 1 55  ? 7.694   1.829   -11.163 1.00 44.76  ? 6   LEU A C   1 
ATOM   72   O  O   . LEU A 1 55  ? 6.510   2.176   -11.054 1.00 47.24  ? 6   LEU A O   1 
ATOM   73   C  CB  . LEU A 1 55  ? 9.327   2.225   -9.293  1.00 38.76  ? 6   LEU A CB  1 
ATOM   74   C  CG  . LEU A 1 55  ? 10.498  2.874   -8.585  1.00 38.37  ? 6   LEU A CG  1 
ATOM   75   C  CD1 . LEU A 1 55  ? 10.726  2.099   -7.308  1.00 41.74  ? 6   LEU A CD1 1 
ATOM   76   C  CD2 . LEU A 1 55  ? 11.756  2.811   -9.423  1.00 42.39  ? 6   LEU A CD2 1 
ATOM   77   N  N   . ARG A 1 56  ? 8.049   0.660   -11.694 1.00 45.03  ? 7   ARG A N   1 
ATOM   78   C  CA  . ARG A 1 56  ? 7.068   -0.327  -12.130 1.00 46.25  ? 7   ARG A CA  1 
ATOM   79   C  C   . ARG A 1 56  ? 7.578   -1.703  -11.852 1.00 46.95  ? 7   ARG A C   1 
ATOM   80   O  O   . ARG A 1 56  ? 8.763   -1.887  -11.586 1.00 49.58  ? 7   ARG A O   1 
ATOM   81   C  CB  . ARG A 1 56  ? 6.785   -0.203  -13.621 1.00 49.64  ? 7   ARG A CB  1 
ATOM   82   C  CG  . ARG A 1 56  ? 6.010   1.045   -13.971 1.00 55.83  ? 7   ARG A CG  1 
ATOM   83   C  CD  . ARG A 1 56  ? 5.819   1.180   -15.460 1.00 59.79  ? 7   ARG A CD  1 
ATOM   84   N  NE  . ARG A 1 56  ? 5.195   2.467   -15.703 1.00 76.51  ? 7   ARG A NE  1 
ATOM   85   C  CZ  . ARG A 1 56  ? 4.810   2.897   -16.897 1.00 88.80  ? 7   ARG A CZ  1 
ATOM   86   N  NH1 . ARG A 1 56  ? 4.984   2.127   -17.973 1.00 91.10  ? 7   ARG A NH1 1 
ATOM   87   N  NH2 . ARG A 1 56  ? 4.247   4.099   -17.011 1.00 87.40  ? 7   ARG A NH2 1 
ATOM   88   N  N   . GLY A 1 57  ? 6.683   -2.677  -11.935 1.00 47.99  ? 8   GLY A N   1 
ATOM   89   C  CA  . GLY A 1 57  ? 7.032   -4.054  -11.648 1.00 48.74  ? 8   GLY A CA  1 
ATOM   90   C  C   . GLY A 1 57  ? 6.314   -4.559  -10.418 1.00 52.76  ? 8   GLY A C   1 
ATOM   91   O  O   . GLY A 1 57  ? 5.342   -3.941  -9.944  1.00 48.02  ? 8   GLY A O   1 
ATOM   92   N  N   . LYS A 1 58  ? 6.808   -5.686  -9.905  1.00 55.75  ? 9   LYS A N   1 
ATOM   93   C  CA  . LYS A 1 58  ? 6.245   -6.347  -8.730  1.00 53.58  ? 9   LYS A CA  1 
ATOM   94   C  C   . LYS A 1 58  ? 7.292   -7.286  -8.126  1.00 50.12  ? 9   LYS A C   1 
ATOM   95   O  O   . LYS A 1 58  ? 8.264   -7.634  -8.787  1.00 50.50  ? 9   LYS A O   1 
ATOM   96   C  CB  . LYS A 1 58  ? 4.988   -7.111  -9.133  1.00 54.22  ? 9   LYS A CB  1 
ATOM   97   C  CG  . LYS A 1 58  ? 5.262   -8.311  -10.020 1.00 58.78  ? 9   LYS A CG  1 
ATOM   98   C  CD  . LYS A 1 58  ? 4.049   -8.692  -10.851 1.00 60.72  ? 9   LYS A CD  1 
ATOM   99   C  CE  . LYS A 1 58  ? 4.401   -9.780  -11.851 1.00 56.92  ? 9   LYS A CE  1 
ATOM   100  N  NZ  . LYS A 1 58  ? 3.190   -10.206 -12.592 1.00 60.14  ? 9   LYS A NZ  1 
ATOM   101  N  N   . SER A 1 59  ? 7.103   -7.698  -6.876  1.00 51.08  ? 10  SER A N   1 
ATOM   102  C  CA  . SER A 1 59  ? 8.126   -8.477  -6.167  1.00 50.06  ? 10  SER A CA  1 
ATOM   103  C  C   . SER A 1 59  ? 8.647   -9.693  -6.944  1.00 49.62  ? 10  SER A C   1 
ATOM   104  O  O   . SER A 1 59  ? 9.820   -10.044 -6.822  1.00 48.59  ? 10  SER A O   1 
ATOM   105  C  CB  . SER A 1 59  ? 7.633   -8.900  -4.776  1.00 49.09  ? 10  SER A CB  1 
ATOM   106  O  OG  . SER A 1 59  ? 6.534   -9.780  -4.867  1.00 51.26  ? 10  SER A OG  1 
ATOM   107  N  N   . GLY A 1 60  ? 7.786   -10.320 -7.746  1.00 48.60  ? 11  GLY A N   1 
ATOM   108  C  CA  . GLY A 1 60  ? 8.157   -11.536 -8.468  1.00 47.45  ? 11  GLY A CA  1 
ATOM   109  C  C   . GLY A 1 60  ? 9.025   -11.335 -9.713  1.00 51.66  ? 11  GLY A C   1 
ATOM   110  O  O   . GLY A 1 60  ? 9.639   -12.288 -10.215 1.00 47.06  ? 11  GLY A O   1 
ATOM   111  N  N   . GLN A 1 61  ? 9.082   -10.108 -10.221 1.00 50.20  ? 12  GLN A N   1 
ATOM   112  C  CA  . GLN A 1 61  ? 9.841   -9.828  -11.448 1.00 54.70  ? 12  GLN A CA  1 
ATOM   113  C  C   . GLN A 1 61  ? 10.819  -8.683  -11.250 1.00 54.27  ? 12  GLN A C   1 
ATOM   114  O  O   . GLN A 1 61  ? 11.677  -8.440  -12.092 1.00 58.72  ? 12  GLN A O   1 
ATOM   115  C  CB  . GLN A 1 61  ? 8.904   -9.500  -12.612 1.00 55.54  ? 12  GLN A CB  1 
ATOM   116  C  CG  . GLN A 1 61  ? 8.137   -10.704 -13.141 1.00 66.42  ? 12  GLN A CG  1 
ATOM   117  C  CD  . GLN A 1 61  ? 7.175   -10.335 -14.271 1.00 77.28  ? 12  GLN A CD  1 
ATOM   118  O  OE1 . GLN A 1 61  ? 6.656   -9.205  -14.353 1.00 76.48  ? 12  GLN A OE1 1 
ATOM   119  N  NE2 . GLN A 1 61  ? 6.915   -11.302 -15.142 1.00 81.05  ? 12  GLN A NE2 1 
ATOM   120  N  N   . GLY A 1 62  ? 10.669  -7.979  -10.133 1.00 48.79  ? 13  GLY A N   1 
ATOM   121  C  CA  . GLY A 1 62  ? 11.554  -6.894  -9.769  1.00 43.29  ? 13  GLY A CA  1 
ATOM   122  C  C   . GLY A 1 62  ? 10.940  -5.564  -10.116 1.00 45.14  ? 13  GLY A C   1 
ATOM   123  O  O   . GLY A 1 62  ? 10.084  -5.482  -10.998 1.00 50.41  ? 13  GLY A O   1 
ATOM   124  N  N   . TYR A 1 63  ? 11.360  -4.521  -9.412  1.00 44.66  ? 14  TYR A N   1 
ATOM   125  C  CA  . TYR A 1 63  ? 10.862  -3.187  -9.690  1.00 44.58  ? 14  TYR A CA  1 
ATOM   126  C  C   . TYR A 1 63  ? 11.900  -2.428  -10.479 1.00 43.38  ? 14  TYR A C   1 
ATOM   127  O  O   . TYR A 1 63  ? 13.073  -2.461  -10.129 1.00 49.47  ? 14  TYR A O   1 
ATOM   128  C  CB  . TYR A 1 63  ? 10.549  -2.460  -8.395  1.00 44.50  ? 14  TYR A CB  1 
ATOM   129  C  CG  . TYR A 1 63  ? 9.339   -2.993  -7.654  1.00 45.87  ? 14  TYR A CG  1 
ATOM   130  C  CD1 . TYR A 1 63  ? 9.455   -4.067  -6.769  1.00 47.58  ? 14  TYR A CD1 1 
ATOM   131  C  CD2 . TYR A 1 63  ? 8.081   -2.402  -7.810  1.00 45.87  ? 14  TYR A CD2 1 
ATOM   132  C  CE1 . TYR A 1 63  ? 8.351   -4.539  -6.063  1.00 47.49  ? 14  TYR A CE1 1 
ATOM   133  C  CE2 . TYR A 1 63  ? 6.966   -2.872  -7.114  1.00 44.91  ? 14  TYR A CE2 1 
ATOM   134  C  CZ  . TYR A 1 63  ? 7.102   -3.942  -6.246  1.00 47.74  ? 14  TYR A CZ  1 
ATOM   135  O  OH  . TYR A 1 63  ? 6.001   -4.420  -5.551  1.00 46.51  ? 14  TYR A OH  1 
ATOM   136  N  N   . TYR A 1 64  ? 11.483  -1.732  -11.533 1.00 44.40  ? 15  TYR A N   1 
ATOM   137  C  CA  . TYR A 1 64  ? 12.433  -1.054  -12.403 1.00 43.66  ? 15  TYR A CA  1 
ATOM   138  C  C   . TYR A 1 64  ? 12.164  0.434   -12.626 1.00 45.15  ? 15  TYR A C   1 
ATOM   139  O  O   . TYR A 1 64  ? 11.089  0.952   -12.311 1.00 44.52  ? 15  TYR A O   1 
ATOM   140  C  CB  . TYR A 1 64  ? 12.528  -1.788  -13.726 1.00 44.66  ? 15  TYR A CB  1 
ATOM   141  C  CG  . TYR A 1 64  ? 11.238  -1.825  -14.480 1.00 46.27  ? 15  TYR A CG  1 
ATOM   142  C  CD1 . TYR A 1 64  ? 10.860  -0.759  -15.273 1.00 47.18  ? 15  TYR A CD1 1 
ATOM   143  C  CD2 . TYR A 1 64  ? 10.392  -2.939  -14.412 1.00 47.91  ? 15  TYR A CD2 1 
ATOM   144  C  CE1 . TYR A 1 64  ? 9.670   -0.781  -15.985 1.00 51.72  ? 15  TYR A CE1 1 
ATOM   145  C  CE2 . TYR A 1 64  ? 9.199   -2.977  -15.123 1.00 48.21  ? 15  TYR A CE2 1 
ATOM   146  C  CZ  . TYR A 1 64  ? 8.847   -1.891  -15.910 1.00 50.18  ? 15  TYR A CZ  1 
ATOM   147  O  OH  . TYR A 1 64  ? 7.683   -1.895  -16.633 1.00 53.15  ? 15  TYR A OH  1 
ATOM   148  N  N   . VAL A 1 65  ? 13.176  1.118   -13.152 1.00 48.01  ? 16  VAL A N   1 
ATOM   149  C  CA  . VAL A 1 65  ? 13.149  2.573   -13.401 1.00 46.31  ? 16  VAL A CA  1 
ATOM   150  C  C   . VAL A 1 65  ? 13.539  2.802   -14.872 1.00 51.14  ? 16  VAL A C   1 
ATOM   151  O  O   . VAL A 1 65  ? 14.313  2.023   -15.453 1.00 55.16  ? 16  VAL A O   1 
ATOM   152  C  CB  . VAL A 1 65  ? 14.082  3.355   -12.411 1.00 44.02  ? 16  VAL A CB  1 
ATOM   153  C  CG1 . VAL A 1 65  ? 15.559  3.018   -12.624 1.00 37.17  ? 16  VAL A CG1 1 
ATOM   154  C  CG2 . VAL A 1 65  ? 13.839  4.863   -12.483 1.00 43.24  ? 16  VAL A CG2 1 
ATOM   155  N  N   . GLU A 1 66  ? 12.985  3.834   -15.494 1.00 51.21  ? 17  GLU A N   1 
ATOM   156  C  CA  . GLU A 1 66  ? 13.379  4.134   -16.855 1.00 55.01  ? 17  GLU A CA  1 
ATOM   157  C  C   . GLU A 1 66  ? 14.698  4.898   -16.821 1.00 54.22  ? 17  GLU A C   1 
ATOM   158  O  O   . GLU A 1 66  ? 14.849  5.852   -16.047 1.00 52.34  ? 17  GLU A O   1 
ATOM   159  C  CB  . GLU A 1 66  ? 12.299  4.931   -17.576 1.00 57.84  ? 17  GLU A CB  1 
ATOM   160  C  CG  . GLU A 1 66  ? 12.692  5.403   -18.969 1.00 64.36  ? 17  GLU A CG  1 
ATOM   161  C  CD  . GLU A 1 66  ? 11.514  6.014   -19.719 1.00 70.79  ? 17  GLU A CD  1 
ATOM   162  O  OE1 . GLU A 1 66  ? 10.629  5.235   -20.150 1.00 66.54  ? 17  GLU A OE1 1 
ATOM   163  O  OE2 . GLU A 1 66  ? 11.473  7.262   -19.880 1.00 69.45  ? 17  GLU A OE2 1 
ATOM   164  N  N   . MET A 1 67  ? 15.650  4.448   -17.641 1.00 49.99  ? 18  MET A N   1 
ATOM   165  C  CA  . MET A 1 67  ? 16.917  5.163   -17.838 1.00 52.77  ? 18  MET A CA  1 
ATOM   166  C  C   . MET A 1 67  ? 17.200  5.357   -19.331 1.00 50.37  ? 18  MET A C   1 
ATOM   167  O  O   . MET A 1 67  ? 16.659  4.628   -20.160 1.00 52.82  ? 18  MET A O   1 
ATOM   168  C  CB  . MET A 1 67  ? 18.092  4.452   -17.127 1.00 49.52  ? 18  MET A CB  1 
ATOM   169  C  CG  . MET A 1 67  ? 17.892  4.246   -15.625 1.00 46.66  ? 18  MET A CG  1 
ATOM   170  S  SD  . MET A 1 67  ? 19.247  3.397   -14.771 1.00 50.21  ? 18  MET A SD  1 
ATOM   171  C  CE  . MET A 1 67  ? 20.411  4.752   -14.707 1.00 47.82  ? 18  MET A CE  1 
ATOM   172  N  N   . THR A 1 68  ? 18.010  6.361   -19.667 1.00 51.32  ? 19  THR A N   1 
ATOM   173  C  CA  . THR A 1 68  ? 18.550  6.519   -21.038 1.00 52.20  ? 19  THR A CA  1 
ATOM   174  C  C   . THR A 1 68  ? 20.081  6.367   -21.020 1.00 52.51  ? 19  THR A C   1 
ATOM   175  O  O   . THR A 1 68  ? 20.755  6.854   -20.106 1.00 51.24  ? 19  THR A O   1 
ATOM   176  C  CB  . THR A 1 68  ? 18.146  7.863   -21.713 1.00 53.97  ? 19  THR A CB  1 
ATOM   177  O  OG1 . THR A 1 68  ? 18.725  8.972   -21.005 1.00 55.98  ? 19  THR A OG1 1 
ATOM   178  C  CG2 . THR A 1 68  ? 16.597  8.039   -21.774 1.00 49.80  ? 19  THR A CG2 1 
ATOM   179  N  N   . VAL A 1 69  ? 20.629  5.651   -21.995 1.00 49.92  ? 20  VAL A N   1 
ATOM   180  C  CA  . VAL A 1 69  ? 22.087  5.572   -22.138 1.00 49.81  ? 20  VAL A CA  1 
ATOM   181  C  C   . VAL A 1 69  ? 22.493  5.935   -23.552 1.00 48.56  ? 20  VAL A C   1 
ATOM   182  O  O   . VAL A 1 69  ? 21.787  5.586   -24.482 1.00 52.21  ? 20  VAL A O   1 
ATOM   183  C  CB  . VAL A 1 69  ? 22.648  4.184   -21.766 1.00 49.76  ? 20  VAL A CB  1 
ATOM   184  C  CG1 . VAL A 1 69  ? 22.309  3.853   -20.327 1.00 48.83  ? 20  VAL A CG1 1 
ATOM   185  C  CG2 . VAL A 1 69  ? 22.129  3.103   -22.697 1.00 48.33  ? 20  VAL A CG2 1 
ATOM   186  N  N   . GLY A 1 70  ? 23.601  6.657   -23.711 1.00 49.22  ? 21  GLY A N   1 
ATOM   187  C  CA  . GLY A 1 70  ? 24.167  6.956   -25.038 1.00 48.92  ? 21  GLY A CA  1 
ATOM   188  C  C   . GLY A 1 70  ? 23.727  8.266   -25.666 1.00 53.04  ? 21  GLY A C   1 
ATOM   189  O  O   . GLY A 1 70  ? 22.852  8.949   -25.136 1.00 59.62  ? 21  GLY A O   1 
ATOM   190  N  N   . SER A 1 71  ? 24.342  8.612   -26.800 1.00 55.46  ? 22  SER A N   1 
ATOM   191  C  CA  . SER A 1 71  ? 23.952  9.779   -27.610 1.00 57.04  ? 22  SER A CA  1 
ATOM   192  C  C   . SER A 1 71  ? 23.678  9.375   -29.075 1.00 58.76  ? 22  SER A C   1 
ATOM   193  O  O   . SER A 1 71  ? 24.563  8.825   -29.733 1.00 62.11  ? 22  SER A O   1 
ATOM   194  C  CB  . SER A 1 71  ? 25.049  10.839  -27.565 1.00 52.35  ? 22  SER A CB  1 
ATOM   195  O  OG  . SER A 1 71  ? 25.423  11.098  -26.230 1.00 53.19  ? 22  SER A OG  1 
ATOM   196  N  N   . PRO A 1 72  ? 22.443  9.599   -29.585 1.00 57.96  ? 23  PRO A N   1 
ATOM   197  C  CA  . PRO A 1 72  ? 21.206  10.051  -28.922 1.00 55.45  ? 23  PRO A CA  1 
ATOM   198  C  C   . PRO A 1 72  ? 20.732  9.079   -27.827 1.00 52.90  ? 23  PRO A C   1 
ATOM   199  O  O   . PRO A 1 72  ? 21.169  7.914   -27.800 1.00 54.67  ? 23  PRO A O   1 
ATOM   200  C  CB  . PRO A 1 72  ? 20.178  10.094  -30.073 1.00 51.52  ? 23  PRO A CB  1 
ATOM   201  C  CG  . PRO A 1 72  ? 20.747  9.226   -31.141 1.00 51.50  ? 23  PRO A CG  1 
ATOM   202  C  CD  . PRO A 1 72  ? 22.234  9.387   -31.030 1.00 54.59  ? 23  PRO A CD  1 
ATOM   203  N  N   . PRO A 1 73  ? 19.837  9.544   -26.935 1.00 50.11  ? 24  PRO A N   1 
ATOM   204  C  CA  . PRO A 1 73  ? 19.430  8.715   -25.800 1.00 48.96  ? 24  PRO A CA  1 
ATOM   205  C  C   . PRO A 1 73  ? 18.747  7.431   -26.232 1.00 47.21  ? 24  PRO A C   1 
ATOM   206  O  O   . PRO A 1 73  ? 17.831  7.478   -27.044 1.00 56.94  ? 24  PRO A O   1 
ATOM   207  C  CB  . PRO A 1 73  ? 18.451  9.615   -25.038 1.00 50.64  ? 24  PRO A CB  1 
ATOM   208  C  CG  . PRO A 1 73  ? 18.803  11.000  -25.434 1.00 50.34  ? 24  PRO A CG  1 
ATOM   209  C  CD  . PRO A 1 73  ? 19.264  10.900  -26.865 1.00 50.63  ? 24  PRO A CD  1 
ATOM   210  N  N   . GLN A 1 74  ? 19.229  6.295   -25.732 1.00 44.37  ? 25  GLN A N   1 
ATOM   211  C  CA  . GLN A 1 74  ? 18.542  5.000   -25.885 1.00 43.35  ? 25  GLN A CA  1 
ATOM   212  C  C   . GLN A 1 74  ? 17.838  4.694   -24.582 1.00 44.94  ? 25  GLN A C   1 
ATOM   213  O  O   . GLN A 1 74  ? 18.472  4.662   -23.514 1.00 44.93  ? 25  GLN A O   1 
ATOM   214  C  CB  . GLN A 1 74  ? 19.527  3.877   -26.206 1.00 40.63  ? 25  GLN A CB  1 
ATOM   215  C  CG  . GLN A 1 74  ? 20.203  4.081   -27.543 1.00 44.89  ? 25  GLN A CG  1 
ATOM   216  C  CD  . GLN A 1 74  ? 21.301  3.087   -27.831 1.00 47.54  ? 25  GLN A CD  1 
ATOM   217  O  OE1 . GLN A 1 74  ? 21.164  1.882   -27.591 1.00 46.35  ? 25  GLN A OE1 1 
ATOM   218  N  NE2 . GLN A 1 74  ? 22.397  3.587   -28.388 1.00 49.39  ? 25  GLN A NE2 1 
ATOM   219  N  N   . THR A 1 75  ? 16.526  4.489   -24.675 1.00 48.13  ? 26  THR A N   1 
ATOM   220  C  CA  . THR A 1 75  ? 15.679  4.222   -23.516 1.00 48.42  ? 26  THR A CA  1 
ATOM   221  C  C   . THR A 1 75  ? 15.714  2.738   -23.152 1.00 51.74  ? 26  THR A C   1 
ATOM   222  O  O   . THR A 1 75  ? 15.519  1.886   -24.026 1.00 55.31  ? 26  THR A O   1 
ATOM   223  C  CB  . THR A 1 75  ? 14.238  4.681   -23.795 1.00 47.54  ? 26  THR A CB  1 
ATOM   224  O  OG1 . THR A 1 75  ? 14.176  6.098   -23.648 1.00 46.63  ? 26  THR A OG1 1 
ATOM   225  C  CG2 . THR A 1 75  ? 13.259  4.077   -22.813 1.00 50.35  ? 26  THR A CG2 1 
ATOM   226  N  N   . LEU A 1 76  ? 15.997  2.449   -21.875 1.00 47.44  ? 27  LEU A N   1 
ATOM   227  C  CA  . LEU A 1 76  ? 15.930  1.097   -21.314 1.00 45.74  ? 27  LEU A CA  1 
ATOM   228  C  C   . LEU A 1 76  ? 15.230  1.120   -19.944 1.00 48.53  ? 27  LEU A C   1 
ATOM   229  O  O   . LEU A 1 76  ? 15.298  2.108   -19.204 1.00 51.99  ? 27  LEU A O   1 
ATOM   230  C  CB  . LEU A 1 76  ? 17.333  0.492   -21.154 1.00 43.57  ? 27  LEU A CB  1 
ATOM   231  C  CG  . LEU A 1 76  ? 18.236  0.282   -22.387 1.00 45.26  ? 27  LEU A CG  1 
ATOM   232  C  CD1 . LEU A 1 76  ? 19.696  0.037   -21.996 1.00 44.16  ? 27  LEU A CD1 1 
ATOM   233  C  CD2 . LEU A 1 76  ? 17.741  -0.850  -23.271 1.00 42.22  ? 27  LEU A CD2 1 
ATOM   234  N  N   . ASN A 1 77  ? 14.544  0.027   -19.622 1.00 47.41  ? 28  ASN A N   1 
ATOM   235  C  CA  . ASN A 1 77  ? 14.083  -0.244  -18.261 1.00 48.02  ? 28  ASN A CA  1 
ATOM   236  C  C   . ASN A 1 77  ? 15.123  -1.014  -17.460 1.00 46.75  ? 28  ASN A C   1 
ATOM   237  O  O   . ASN A 1 77  ? 15.624  -2.047  -17.931 1.00 48.92  ? 28  ASN A O   1 
ATOM   238  C  CB  . ASN A 1 77  ? 12.829  -1.102  -18.300 1.00 47.27  ? 28  ASN A CB  1 
ATOM   239  C  CG  . ASN A 1 77  ? 11.625  -0.346  -18.757 1.00 46.61  ? 28  ASN A CG  1 
ATOM   240  O  OD1 . ASN A 1 77  ? 11.536  0.882   -18.640 1.00 46.86  ? 28  ASN A OD1 1 
ATOM   241  N  ND2 . ASN A 1 77  ? 10.669  -1.084  -19.268 1.00 49.36  ? 28  ASN A ND2 1 
ATOM   242  N  N   . ILE A 1 78  ? 15.375  -0.560  -16.233 1.00 42.46  ? 29  ILE A N   1 
ATOM   243  C  CA  . ILE A 1 78  ? 16.512  -1.008  -15.439 1.00 42.29  ? 29  ILE A CA  1 
ATOM   244  C  C   . ILE A 1 78  ? 16.085  -1.395  -14.013 1.00 44.14  ? 29  ILE A C   1 
ATOM   245  O  O   . ILE A 1 78  ? 15.637  -0.552  -13.245 1.00 42.65  ? 29  ILE A O   1 
ATOM   246  C  CB  . ILE A 1 78  ? 17.603  0.106   -15.375 1.00 44.32  ? 29  ILE A CB  1 
ATOM   247  C  CG1 . ILE A 1 78  ? 18.062  0.538   -16.776 1.00 41.72  ? 29  ILE A CG1 1 
ATOM   248  C  CG2 . ILE A 1 78  ? 18.782  -0.294  -14.487 1.00 39.54  ? 29  ILE A CG2 1 
ATOM   249  C  CD1 . ILE A 1 78  ? 18.648  -0.594  -17.602 1.00 46.13  ? 29  ILE A CD1 1 
ATOM   250  N  N   . LEU A 1 79  ? 16.231  -2.677  -13.680 1.00 43.09  ? 30  LEU A N   1 
ATOM   251  C  CA  . LEU A 1 79  ? 16.059  -3.174  -12.325 1.00 44.46  ? 30  LEU A CA  1 
ATOM   252  C  C   . LEU A 1 79  ? 16.769  -2.300  -11.262 1.00 48.38  ? 30  LEU A C   1 
ATOM   253  O  O   . LEU A 1 79  ? 17.955  -1.958  -11.388 1.00 48.16  ? 30  LEU A O   1 
ATOM   254  C  CB  . LEU A 1 79  ? 16.563  -4.628  -12.220 1.00 44.55  ? 30  LEU A CB  1 
ATOM   255  C  CG  . LEU A 1 79  ? 16.384  -5.348  -10.878 1.00 44.98  ? 30  LEU A CG  1 
ATOM   256  C  CD1 . LEU A 1 79  ? 14.915  -5.629  -10.643 1.00 41.61  ? 30  LEU A CD1 1 
ATOM   257  C  CD2 . LEU A 1 79  ? 17.185  -6.643  -10.814 1.00 46.45  ? 30  LEU A CD2 1 
ATOM   258  N  N   . VAL A 1 80  ? 16.019  -1.948  -10.224 1.00 45.11  ? 31  VAL A N   1 
ATOM   259  C  CA  . VAL A 1 80  ? 16.535  -1.245  -9.080  1.00 43.93  ? 31  VAL A CA  1 
ATOM   260  C  C   . VAL A 1 80  ? 17.052  -2.300  -8.093  1.00 44.03  ? 31  VAL A C   1 
ATOM   261  O  O   . VAL A 1 80  ? 16.271  -3.088  -7.564  1.00 43.79  ? 31  VAL A O   1 
ATOM   262  C  CB  . VAL A 1 80  ? 15.428  -0.357  -8.487  1.00 47.02  ? 31  VAL A CB  1 
ATOM   263  C  CG1 . VAL A 1 80  ? 15.732  0.013   -7.042  1.00 47.16  ? 31  VAL A CG1 1 
ATOM   264  C  CG2 . VAL A 1 80  ? 15.248  0.873   -9.368  1.00 44.61  ? 31  VAL A CG2 1 
ATOM   265  N  N   . ASP A 1 81  ? 18.371  -2.335  -7.867  1.00 43.18  ? 32  ASP A N   1 
ATOM   266  C  CA  . ASP A 1 81  ? 18.955  -3.436  -7.101  1.00 42.50  ? 32  ASP A CA  1 
ATOM   267  C  C   . ASP A 1 81  ? 19.974  -3.027  -5.990  1.00 42.86  ? 32  ASP A C   1 
ATOM   268  O  O   . ASP A 1 81  ? 21.151  -2.783  -6.268  1.00 45.10  ? 32  ASP A O   1 
ATOM   269  C  CB  . ASP A 1 81  ? 19.509  -4.487  -8.079  1.00 43.15  ? 32  ASP A CB  1 
ATOM   270  C  CG  . ASP A 1 81  ? 20.275  -5.594  -7.386  1.00 47.33  ? 32  ASP A CG  1 
ATOM   271  O  OD1 . ASP A 1 81  ? 20.093  -5.797  -6.162  1.00 44.01  ? 32  ASP A OD1 1 
ATOM   272  O  OD2 . ASP A 1 81  ? 21.077  -6.259  -8.080  1.00 49.01  ? 32  ASP A OD2 1 
ATOM   273  N  N   . THR A 1 82  ? 19.518  -2.977  -4.735  1.00 41.34  ? 33  THR A N   1 
ATOM   274  C  CA  . THR A 1 82  ? 20.388  -2.550  -3.638  1.00 42.03  ? 33  THR A CA  1 
ATOM   275  C  C   . THR A 1 82  ? 21.339  -3.647  -3.146  1.00 46.71  ? 33  THR A C   1 
ATOM   276  O  O   . THR A 1 82  ? 22.167  -3.387  -2.262  1.00 53.00  ? 33  THR A O   1 
ATOM   277  C  CB  . THR A 1 82  ? 19.607  -1.940  -2.433  1.00 43.14  ? 33  THR A CB  1 
ATOM   278  O  OG1 . THR A 1 82  ? 18.710  -2.902  -1.878  1.00 41.49  ? 33  THR A OG1 1 
ATOM   279  C  CG2 . THR A 1 82  ? 18.818  -0.669  -2.825  1.00 42.90  ? 33  THR A CG2 1 
ATOM   280  N  N   . GLY A 1 83  ? 21.235  -4.854  -3.719  1.00 48.47  ? 34  GLY A N   1 
ATOM   281  C  CA  . GLY A 1 83  ? 22.093  -5.988  -3.352  1.00 44.76  ? 34  GLY A CA  1 
ATOM   282  C  C   . GLY A 1 83  ? 23.197  -6.301  -4.357  1.00 49.44  ? 34  GLY A C   1 
ATOM   283  O  O   . GLY A 1 83  ? 23.716  -7.430  -4.374  1.00 49.33  ? 34  GLY A O   1 
ATOM   284  N  N   . SER A 1 84  ? 23.549  -5.317  -5.197  1.00 46.40  ? 35  SER A N   1 
ATOM   285  C  CA  . SER A 1 84  ? 24.708  -5.406  -6.112  1.00 46.06  ? 35  SER A CA  1 
ATOM   286  C  C   . SER A 1 84  ? 25.177  -4.006  -6.486  1.00 49.50  ? 35  SER A C   1 
ATOM   287  O  O   . SER A 1 84  ? 24.530  -3.033  -6.120  1.00 50.91  ? 35  SER A O   1 
ATOM   288  C  CB  . SER A 1 84  ? 24.382  -6.223  -7.362  1.00 45.42  ? 35  SER A CB  1 
ATOM   289  O  OG  . SER A 1 84  ? 23.512  -5.535  -8.254  1.00 44.12  ? 35  SER A OG  1 
ATOM   290  N  N   . SER A 1 85  ? 26.291  -3.903  -7.215  1.00 51.16  ? 36  SER A N   1 
ATOM   291  C  CA  . SER A 1 85  ? 26.975  -2.609  -7.411  1.00 47.71  ? 36  SER A CA  1 
ATOM   292  C  C   . SER A 1 85  ? 27.384  -2.282  -8.860  1.00 48.28  ? 36  SER A C   1 
ATOM   293  O  O   . SER A 1 85  ? 28.081  -1.271  -9.098  1.00 44.67  ? 36  SER A O   1 
ATOM   294  C  CB  . SER A 1 85  ? 28.210  -2.511  -6.500  1.00 45.91  ? 36  SER A CB  1 
ATOM   295  O  OG  . SER A 1 85  ? 27.876  -2.807  -5.158  1.00 42.43  ? 36  SER A OG  1 
ATOM   296  N  N   . ASN A 1 86  ? 26.952  -3.127  -9.804  1.00 49.28  ? 37  ASN A N   1 
ATOM   297  C  CA  . ASN A 1 86  ? 27.217  -2.944  -11.242 1.00 48.94  ? 37  ASN A CA  1 
ATOM   298  C  C   . ASN A 1 86  ? 26.001  -2.429  -12.006 1.00 50.03  ? 37  ASN A C   1 
ATOM   299  O  O   . ASN A 1 86  ? 24.883  -2.971  -11.866 1.00 49.09  ? 37  ASN A O   1 
ATOM   300  C  CB  . ASN A 1 86  ? 27.660  -4.270  -11.871 1.00 46.95  ? 37  ASN A CB  1 
ATOM   301  C  CG  . ASN A 1 86  ? 29.092  -4.642  -11.527 1.00 48.15  ? 37  ASN A CG  1 
ATOM   302  O  OD1 . ASN A 1 86  ? 29.392  -5.116  -10.423 1.00 44.77  ? 37  ASN A OD1 1 
ATOM   303  N  ND2 . ASN A 1 86  ? 29.985  -4.473  -12.500 1.00 50.91  ? 37  ASN A ND2 1 
ATOM   304  N  N   . PHE A 1 87  ? 26.215  -1.366  -12.783 1.00 47.46  ? 38  PHE A N   1 
ATOM   305  C  CA  . PHE A 1 87  ? 25.252  -0.915  -13.796 1.00 45.92  ? 38  PHE A CA  1 
ATOM   306  C  C   . PHE A 1 87  ? 25.507  -1.746  -15.055 1.00 49.24  ? 38  PHE A C   1 
ATOM   307  O  O   . PHE A 1 87  ? 26.552  -1.623  -15.696 1.00 52.35  ? 38  PHE A O   1 
ATOM   308  C  CB  . PHE A 1 87  ? 25.399  0.602   -14.061 1.00 45.66  ? 38  PHE A CB  1 
ATOM   309  C  CG  . PHE A 1 87  ? 24.430  1.164   -15.092 1.00 46.89  ? 38  PHE A CG  1 
ATOM   310  C  CD1 . PHE A 1 87  ? 23.129  0.686   -15.204 1.00 47.10  ? 38  PHE A CD1 1 
ATOM   311  C  CD2 . PHE A 1 87  ? 24.819  2.204   -15.928 1.00 46.93  ? 38  PHE A CD2 1 
ATOM   312  C  CE1 . PHE A 1 87  ? 22.258  1.218   -16.141 1.00 47.45  ? 38  PHE A CE1 1 
ATOM   313  C  CE2 . PHE A 1 87  ? 23.952  2.741   -16.865 1.00 46.50  ? 38  PHE A CE2 1 
ATOM   314  C  CZ  . PHE A 1 87  ? 22.670  2.243   -16.979 1.00 45.93  ? 38  PHE A CZ  1 
ATOM   315  N  N   . ALA A 1 88  ? 24.571  -2.623  -15.384 1.00 47.82  ? 39  ALA A N   1 
ATOM   316  C  CA  . ALA A 1 88  ? 24.778  -3.607  -16.439 1.00 46.52  ? 39  ALA A CA  1 
ATOM   317  C  C   . ALA A 1 88  ? 23.525  -3.736  -17.295 1.00 49.72  ? 39  ALA A C   1 
ATOM   318  O  O   . ALA A 1 88  ? 22.434  -3.913  -16.755 1.00 53.79  ? 39  ALA A O   1 
ATOM   319  C  CB  . ALA A 1 88  ? 25.141  -4.947  -15.831 1.00 43.14  ? 39  ALA A CB  1 
ATOM   320  N  N   . VAL A 1 89  ? 23.669  -3.648  -18.617 1.00 46.91  ? 40  VAL A N   1 
ATOM   321  C  CA  . VAL A 1 89  ? 22.503  -3.578  -19.506 1.00 47.29  ? 40  VAL A CA  1 
ATOM   322  C  C   . VAL A 1 89  ? 22.653  -4.478  -20.719 1.00 49.49  ? 40  VAL A C   1 
ATOM   323  O  O   . VAL A 1 89  ? 23.715  -4.495  -21.332 1.00 54.34  ? 40  VAL A O   1 
ATOM   324  C  CB  . VAL A 1 89  ? 22.230  -2.126  -19.986 1.00 46.90  ? 40  VAL A CB  1 
ATOM   325  C  CG1 . VAL A 1 89  ? 22.179  -1.175  -18.802 1.00 41.62  ? 40  VAL A CG1 1 
ATOM   326  C  CG2 . VAL A 1 89  ? 23.281  -1.661  -20.992 1.00 42.22  ? 40  VAL A CG2 1 
ATOM   327  N  N   . GLY A 1 90  ? 21.596  -5.211  -21.072 1.00 52.21  ? 41  GLY A N   1 
ATOM   328  C  CA  . GLY A 1 90  ? 21.596  -6.087  -22.264 1.00 51.91  ? 41  GLY A CA  1 
ATOM   329  C  C   . GLY A 1 90  ? 22.114  -5.324  -23.466 1.00 50.97  ? 41  GLY A C   1 
ATOM   330  O  O   . GLY A 1 90  ? 21.673  -4.206  -23.709 1.00 54.38  ? 41  GLY A O   1 
ATOM   331  N  N   . ALA A 1 91  ? 23.082  -5.891  -24.192 1.00 54.04  ? 42  ALA A N   1 
ATOM   332  C  CA  . ALA A 1 91  ? 23.777  -5.146  -25.264 1.00 55.71  ? 42  ALA A CA  1 
ATOM   333  C  C   . ALA A 1 91  ? 23.790  -5.862  -26.602 1.00 57.18  ? 42  ALA A C   1 
ATOM   334  O  O   . ALA A 1 91  ? 24.410  -5.394  -27.548 1.00 60.92  ? 42  ALA A O   1 
ATOM   335  C  CB  . ALA A 1 91  ? 25.199  -4.770  -24.851 1.00 51.80  ? 42  ALA A CB  1 
ATOM   336  N  N   . ALA A 1 92  ? 23.109  -6.997  -26.666 1.00 60.21  ? 43  ALA A N   1 
ATOM   337  C  CA  . ALA A 1 92  ? 22.987  -7.773  -27.881 1.00 66.03  ? 43  ALA A CA  1 
ATOM   338  C  C   . ALA A 1 92  ? 21.652  -8.534  -27.810 1.00 75.37  ? 43  ALA A C   1 
ATOM   339  O  O   . ALA A 1 92  ? 21.133  -8.728  -26.703 1.00 79.14  ? 43  ALA A O   1 
ATOM   340  C  CB  . ALA A 1 92  ? 24.164  -8.724  -28.002 1.00 62.75  ? 43  ALA A CB  1 
ATOM   341  N  N   . PRO A 1 93  ? 21.087  -8.953  -28.975 1.00 78.10  ? 44  PRO A N   1 
ATOM   342  C  CA  . PRO A 1 93  ? 19.755  -9.587  -29.015 1.00 71.58  ? 44  PRO A CA  1 
ATOM   343  C  C   . PRO A 1 93  ? 19.625  -10.851 -28.167 1.00 67.25  ? 44  PRO A C   1 
ATOM   344  O  O   . PRO A 1 93  ? 20.577  -11.614 -28.011 1.00 69.67  ? 44  PRO A O   1 
ATOM   345  C  CB  . PRO A 1 93  ? 19.567  -9.931  -30.497 1.00 74.00  ? 44  PRO A CB  1 
ATOM   346  C  CG  . PRO A 1 93  ? 20.952  -9.997  -31.053 1.00 77.68  ? 44  PRO A CG  1 
ATOM   347  C  CD  . PRO A 1 93  ? 21.699  -8.923  -30.320 1.00 78.85  ? 44  PRO A CD  1 
ATOM   348  N  N   . HIS A 1 94  ? 18.436  -11.041 -27.612 1.00 63.30  ? 45  HIS A N   1 
ATOM   349  C  CA  . HIS A 1 94  ? 18.135  -12.151 -26.726 1.00 58.48  ? 45  HIS A CA  1 
ATOM   350  C  C   . HIS A 1 94  ? 16.648  -12.441 -26.851 1.00 60.07  ? 45  HIS A C   1 
ATOM   351  O  O   . HIS A 1 94  ? 15.859  -11.514 -27.043 1.00 63.63  ? 45  HIS A O   1 
ATOM   352  C  CB  . HIS A 1 94  ? 18.455  -11.769 -25.284 1.00 60.23  ? 45  HIS A CB  1 
ATOM   353  C  CG  . HIS A 1 94  ? 18.303  -12.900 -24.333 1.00 58.03  ? 45  HIS A CG  1 
ATOM   354  N  ND1 . HIS A 1 94  ? 17.099  -13.213 -23.738 1.00 60.87  ? 45  HIS A ND1 1 
ATOM   355  C  CD2 . HIS A 1 94  ? 19.190  -13.830 -23.909 1.00 61.26  ? 45  HIS A CD2 1 
ATOM   356  C  CE1 . HIS A 1 94  ? 17.256  -14.279 -22.971 1.00 65.66  ? 45  HIS A CE1 1 
ATOM   357  N  NE2 . HIS A 1 94  ? 18.518  -14.668 -23.051 1.00 64.78  ? 45  HIS A NE2 1 
ATOM   358  N  N   . PRO A 1 95  ? 16.244  -13.720 -26.752 1.00 61.35  ? 46  PRO A N   1 
ATOM   359  C  CA  . PRO A 1 95  ? 14.798  -13.957 -26.910 1.00 65.42  ? 46  PRO A CA  1 
ATOM   360  C  C   . PRO A 1 95  ? 13.883  -13.111 -25.976 1.00 69.02  ? 46  PRO A C   1 
ATOM   361  O  O   . PRO A 1 95  ? 12.757  -12.785 -26.372 1.00 67.02  ? 46  PRO A O   1 
ATOM   362  C  CB  . PRO A 1 95  ? 14.647  -15.463 -26.632 1.00 59.79  ? 46  PRO A CB  1 
ATOM   363  C  CG  . PRO A 1 95  ? 15.987  -16.033 -26.953 1.00 59.14  ? 46  PRO A CG  1 
ATOM   364  C  CD  . PRO A 1 95  ? 17.003  -14.978 -26.603 1.00 58.17  ? 46  PRO A CD  1 
ATOM   365  N  N   . PHE A 1 96  ? 14.349  -12.733 -24.781 1.00 63.55  ? 47  PHE A N   1 
ATOM   366  C  CA  . PHE A 1 96  ? 13.457  -12.031 -23.834 1.00 66.04  ? 47  PHE A CA  1 
ATOM   367  C  C   . PHE A 1 96  ? 13.696  -10.517 -23.702 1.00 68.26  ? 47  PHE A C   1 
ATOM   368  O  O   . PHE A 1 96  ? 13.156  -9.874  -22.789 1.00 67.51  ? 47  PHE A O   1 
ATOM   369  C  CB  . PHE A 1 96  ? 13.412  -12.727 -22.450 1.00 62.79  ? 47  PHE A CB  1 
ATOM   370  C  CG  . PHE A 1 96  ? 13.129  -14.220 -22.510 1.00 63.72  ? 47  PHE A CG  1 
ATOM   371  C  CD1 . PHE A 1 96  ? 12.174  -14.744 -23.395 1.00 65.58  ? 47  PHE A CD1 1 
ATOM   372  C  CD2 . PHE A 1 96  ? 13.812  -15.105 -21.664 1.00 62.55  ? 47  PHE A CD2 1 
ATOM   373  C  CE1 . PHE A 1 96  ? 11.930  -16.114 -23.447 1.00 66.11  ? 47  PHE A CE1 1 
ATOM   374  C  CE2 . PHE A 1 96  ? 13.562  -16.472 -21.700 1.00 64.90  ? 47  PHE A CE2 1 
ATOM   375  C  CZ  . PHE A 1 96  ? 12.624  -16.978 -22.600 1.00 66.18  ? 47  PHE A CZ  1 
ATOM   376  N  N   . LEU A 1 97  ? 14.482  -9.946  -24.618 1.00 65.31  ? 48  LEU A N   1 
ATOM   377  C  CA  . LEU A 1 97  ? 14.731  -8.503  -24.624 1.00 64.29  ? 48  LEU A CA  1 
ATOM   378  C  C   . LEU A 1 97  ? 14.041  -7.836  -25.812 1.00 65.39  ? 48  LEU A C   1 
ATOM   379  O  O   . LEU A 1 97  ? 14.313  -8.185  -26.958 1.00 70.15  ? 48  LEU A O   1 
ATOM   380  C  CB  . LEU A 1 97  ? 16.236  -8.205  -24.662 1.00 61.50  ? 48  LEU A CB  1 
ATOM   381  C  CG  . LEU A 1 97  ? 17.112  -8.463  -23.439 1.00 61.47  ? 48  LEU A CG  1 
ATOM   382  C  CD1 . LEU A 1 97  ? 18.554  -8.080  -23.737 1.00 56.53  ? 48  LEU A CD1 1 
ATOM   383  C  CD2 . LEU A 1 97  ? 16.590  -7.688  -22.239 1.00 62.19  ? 48  LEU A CD2 1 
ATOM   384  N  N   . HIS A 1 98  ? 13.155  -6.879  -25.544 1.00 70.23  ? 49  HIS A N   1 
ATOM   385  C  CA  . HIS A 1 98  ? 12.428  -6.195  -26.622 1.00 73.68  ? 49  HIS A CA  1 
ATOM   386  C  C   . HIS A 1 98  ? 13.297  -5.115  -27.226 1.00 69.00  ? 49  HIS A C   1 
ATOM   387  O  O   . HIS A 1 98  ? 13.012  -4.627  -28.321 1.00 72.24  ? 49  HIS A O   1 
ATOM   388  C  CB  . HIS A 1 98  ? 11.082  -5.612  -26.151 1.00 82.54  ? 49  HIS A CB  1 
ATOM   389  C  CG  . HIS A 1 98  ? 10.120  -6.653  -25.635 1.00 102.13 ? 49  HIS A CG  1 
ATOM   390  N  ND1 . HIS A 1 98  ? 9.572   -7.667  -26.455 1.00 100.90 ? 49  HIS A ND1 1 
ATOM   391  C  CD2 . HIS A 1 98  ? 9.613   -6.840  -24.379 1.00 104.29 ? 49  HIS A CD2 1 
ATOM   392  C  CE1 . HIS A 1 98  ? 8.772   -8.430  -25.725 1.00 104.92 ? 49  HIS A CE1 1 
ATOM   393  N  NE2 . HIS A 1 98  ? 8.780   -7.950  -24.461 1.00 106.97 ? 49  HIS A NE2 1 
ATOM   394  N  N   . ARG A 1 99  ? 14.355  -4.758  -26.491 1.00 63.13  ? 50  ARG A N   1 
ATOM   395  C  CA  . ARG A 1 99  ? 15.364  -3.764  -26.900 1.00 56.63  ? 50  ARG A CA  1 
ATOM   396  C  C   . ARG A 1 99  ? 16.668  -3.888  -26.079 1.00 55.85  ? 50  ARG A C   1 
ATOM   397  O  O   . ARG A 1 99  ? 16.716  -4.594  -25.059 1.00 55.73  ? 50  ARG A O   1 
ATOM   398  C  CB  . ARG A 1 99  ? 14.801  -2.342  -26.822 1.00 59.78  ? 50  ARG A CB  1 
ATOM   399  C  CG  . ARG A 1 99  ? 14.140  -2.036  -25.498 1.00 58.84  ? 50  ARG A CG  1 
ATOM   400  C  CD  . ARG A 1 99  ? 13.781  -0.576  -25.344 1.00 55.10  ? 50  ARG A CD  1 
ATOM   401  N  NE  . ARG A 1 99  ? 13.214  -0.427  -24.012 1.00 57.43  ? 50  ARG A NE  1 
ATOM   402  C  CZ  . ARG A 1 99  ? 12.499  0.607   -23.596 1.00 58.01  ? 50  ARG A CZ  1 
ATOM   403  N  NH1 . ARG A 1 99  ? 12.241  1.615   -24.411 1.00 59.08  ? 50  ARG A NH1 1 
ATOM   404  N  NH2 . ARG A 1 99  ? 12.042  0.628   -22.352 1.00 61.03  ? 50  ARG A NH2 1 
ATOM   405  N  N   . TYR A 1 100 ? 17.724  -3.220  -26.537 1.00 51.46  ? 51  TYR A N   1 
ATOM   406  C  CA  . TYR A 1 100 ? 19.035  -3.343  -25.904 1.00 53.95  ? 51  TYR A CA  1 
ATOM   407  C  C   . TYR A 1 100 ? 19.988  -2.216  -26.252 1.00 52.24  ? 51  TYR A C   1 
ATOM   408  O  O   . TYR A 1 100 ? 19.757  -1.480  -27.205 1.00 52.36  ? 51  TYR A O   1 
ATOM   409  C  CB  . TYR A 1 100 ? 19.685  -4.700  -26.210 1.00 58.38  ? 51  TYR A CB  1 
ATOM   410  C  CG  . TYR A 1 100 ? 19.835  -5.061  -27.678 1.00 67.14  ? 51  TYR A CG  1 
ATOM   411  C  CD1 . TYR A 1 100 ? 21.015  -4.758  -28.382 1.00 67.93  ? 51  TYR A CD1 1 
ATOM   412  C  CD2 . TYR A 1 100 ? 18.816  -5.746  -28.356 1.00 69.49  ? 51  TYR A CD2 1 
ATOM   413  C  CE1 . TYR A 1 100 ? 21.167  -5.103  -29.715 1.00 64.95  ? 51  TYR A CE1 1 
ATOM   414  C  CE2 . TYR A 1 100 ? 18.955  -6.091  -29.692 1.00 71.52  ? 51  TYR A CE2 1 
ATOM   415  C  CZ  . TYR A 1 100 ? 20.131  -5.771  -30.360 1.00 71.13  ? 51  TYR A CZ  1 
ATOM   416  O  OH  . TYR A 1 100 ? 20.266  -6.126  -31.675 1.00 73.09  ? 51  TYR A OH  1 
ATOM   417  N  N   . TYR A 1 101 ? 21.051  -2.089  -25.459 1.00 48.71  ? 52  TYR A N   1 
ATOM   418  C  CA  . TYR A 1 101 ? 22.088  -1.078  -25.679 1.00 51.08  ? 52  TYR A CA  1 
ATOM   419  C  C   . TYR A 1 101 ? 22.832  -1.346  -26.996 1.00 49.85  ? 52  TYR A C   1 
ATOM   420  O  O   . TYR A 1 101 ? 23.415  -2.428  -27.186 1.00 48.32  ? 52  TYR A O   1 
ATOM   421  C  CB  . TYR A 1 101 ? 23.057  -1.095  -24.487 1.00 50.66  ? 52  TYR A CB  1 
ATOM   422  C  CG  . TYR A 1 101 ? 24.178  -0.056  -24.456 1.00 48.41  ? 52  TYR A CG  1 
ATOM   423  C  CD1 . TYR A 1 101 ? 24.054  1.173   -25.107 1.00 46.00  ? 52  TYR A CD1 1 
ATOM   424  C  CD2 . TYR A 1 101 ? 25.350  -0.301  -23.714 1.00 46.48  ? 52  TYR A CD2 1 
ATOM   425  C  CE1 . TYR A 1 101 ? 25.068  2.121   -25.046 1.00 48.66  ? 52  TYR A CE1 1 
ATOM   426  C  CE2 . TYR A 1 101 ? 26.379  0.635   -23.647 1.00 44.78  ? 52  TYR A CE2 1 
ATOM   427  C  CZ  . TYR A 1 101 ? 26.240  1.846   -24.316 1.00 48.77  ? 52  TYR A CZ  1 
ATOM   428  O  OH  . TYR A 1 101 ? 27.249  2.793   -24.253 1.00 41.47  ? 52  TYR A OH  1 
ATOM   429  N  N   . GLN A 1 102 ? 22.803  -0.381  -27.909 1.00 47.91  ? 53  GLN A N   1 
ATOM   430  C  CA  . GLN A 1 102 ? 23.607  -0.487  -29.152 1.00 49.91  ? 53  GLN A CA  1 
ATOM   431  C  C   . GLN A 1 102 ? 24.758  0.519   -29.175 1.00 46.53  ? 53  GLN A C   1 
ATOM   432  O  O   . GLN A 1 102 ? 24.555  1.707   -29.485 1.00 45.66  ? 53  GLN A O   1 
ATOM   433  C  CB  . GLN A 1 102 ? 22.724  -0.297  -30.381 1.00 51.75  ? 53  GLN A CB  1 
ATOM   434  C  CG  . GLN A 1 102 ? 21.570  -1.277  -30.465 1.00 52.66  ? 53  GLN A CG  1 
ATOM   435  C  CD  . GLN A 1 102 ? 20.827  -1.182  -31.781 1.00 54.38  ? 53  GLN A CD  1 
ATOM   436  O  OE1 . GLN A 1 102 ? 19.764  -0.585  -31.860 1.00 54.61  ? 53  GLN A OE1 1 
ATOM   437  N  NE2 . GLN A 1 102 ? 21.398  -1.762  -32.823 1.00 55.80  ? 53  GLN A NE2 1 
ATOM   438  N  N   . ARG A 1 103 ? 25.954  0.051   -28.829 1.00 45.41  ? 54  ARG A N   1 
ATOM   439  C  CA  . ARG A 1 103 ? 27.108  0.946   -28.611 1.00 49.38  ? 54  ARG A CA  1 
ATOM   440  C  C   . ARG A 1 103 ? 27.584  1.703   -29.860 1.00 52.64  ? 54  ARG A C   1 
ATOM   441  O  O   . ARG A 1 103 ? 27.900  2.902   -29.778 1.00 51.71  ? 54  ARG A O   1 
ATOM   442  C  CB  . ARG A 1 103 ? 28.259  0.205   -27.945 1.00 46.81  ? 54  ARG A CB  1 
ATOM   443  C  CG  . ARG A 1 103 ? 27.861  -0.430  -26.626 1.00 46.74  ? 54  ARG A CG  1 
ATOM   444  C  CD  . ARG A 1 103 ? 28.866  -1.486  -26.207 1.00 47.36  ? 54  ARG A CD  1 
ATOM   445  N  NE  . ARG A 1 103 ? 28.625  -2.805  -26.795 1.00 43.95  ? 54  ARG A NE  1 
ATOM   446  C  CZ  . ARG A 1 103 ? 29.433  -3.851  -26.601 1.00 46.12  ? 54  ARG A CZ  1 
ATOM   447  N  NH1 . ARG A 1 103 ? 30.526  -3.710  -25.843 1.00 43.06  ? 54  ARG A NH1 1 
ATOM   448  N  NH2 . ARG A 1 103 ? 29.155  -5.039  -27.150 1.00 43.30  ? 54  ARG A NH2 1 
ATOM   449  N  N   . GLN A 1 104 ? 27.600  1.013   -31.005 1.00 55.33  ? 55  GLN A N   1 
ATOM   450  C  CA  . GLN A 1 104 ? 27.949  1.613   -32.313 1.00 57.07  ? 55  GLN A CA  1 
ATOM   451  C  C   . GLN A 1 104 ? 27.047  2.806   -32.749 1.00 56.80  ? 55  GLN A C   1 
ATOM   452  O  O   . GLN A 1 104 ? 27.456  3.634   -33.590 1.00 49.78  ? 55  GLN A O   1 
ATOM   453  C  CB  . GLN A 1 104 ? 28.017  0.529   -33.407 1.00 59.86  ? 55  GLN A CB  1 
ATOM   454  C  CG  . GLN A 1 104 ? 26.668  0.019   -33.913 1.00 72.78  ? 55  GLN A CG  1 
ATOM   455  C  CD  . GLN A 1 104 ? 26.034  -1.090  -33.063 1.00 81.14  ? 55  GLN A CD  1 
ATOM   456  O  OE1 . GLN A 1 104 ? 26.537  -1.474  -31.995 1.00 81.05  ? 55  GLN A OE1 1 
ATOM   457  N  NE2 . GLN A 1 104 ? 24.905  -1.608  -33.547 1.00 82.67  ? 55  GLN A NE2 1 
ATOM   458  N  N   . LEU A 1 105 ? 25.845  2.895   -32.161 1.00 51.82  ? 56  LEU A N   1 
ATOM   459  C  CA  . LEU A 1 105 ? 24.930  4.013   -32.410 1.00 46.64  ? 56  LEU A CA  1 
ATOM   460  C  C   . LEU A 1 105 ? 25.099  5.172   -31.412 1.00 49.15  ? 56  LEU A C   1 
ATOM   461  O  O   . LEU A 1 105 ? 24.431  6.213   -31.522 1.00 47.83  ? 56  LEU A O   1 
ATOM   462  C  CB  . LEU A 1 105 ? 23.479  3.538   -32.442 1.00 44.71  ? 56  LEU A CB  1 
ATOM   463  C  CG  . LEU A 1 105 ? 23.137  2.393   -33.396 1.00 46.97  ? 56  LEU A CG  1 
ATOM   464  C  CD1 . LEU A 1 105 ? 21.633  2.201   -33.382 1.00 46.43  ? 56  LEU A CD1 1 
ATOM   465  C  CD2 . LEU A 1 105 ? 23.667  2.636   -34.814 1.00 44.88  ? 56  LEU A CD2 1 
ATOM   466  N  N   . SER A 1 106 ? 26.018  5.003   -30.462 1.00 48.60  ? 57  SER A N   1 
ATOM   467  C  CA  . SER A 1 106 ? 26.259  6.021   -29.464 1.00 44.54  ? 57  SER A CA  1 
ATOM   468  C  C   . SER A 1 106 ? 27.601  6.696   -29.746 1.00 45.84  ? 57  SER A C   1 
ATOM   469  O  O   . SER A 1 106 ? 28.671  6.085   -29.605 1.00 45.75  ? 57  SER A O   1 
ATOM   470  C  CB  . SER A 1 106 ? 26.197  5.401   -28.066 1.00 42.16  ? 57  SER A CB  1 
ATOM   471  O  OG  . SER A 1 106 ? 26.648  6.297   -27.068 1.00 46.02  ? 57  SER A OG  1 
ATOM   472  N  N   . SER A 1 107 ? 27.549  7.967   -30.138 1.00 43.70  ? 58  SER A N   1 
ATOM   473  C  CA  . SER A 1 107 ? 28.768  8.738   -30.382 1.00 45.56  ? 58  SER A CA  1 
ATOM   474  C  C   . SER A 1 107 ? 29.619  8.996   -29.103 1.00 47.38  ? 58  SER A C   1 
ATOM   475  O  O   . SER A 1 107 ? 30.817  9.276   -29.197 1.00 48.83  ? 58  SER A O   1 
ATOM   476  C  CB  . SER A 1 107 ? 28.419  10.059  -31.055 1.00 43.59  ? 58  SER A CB  1 
ATOM   477  O  OG  . SER A 1 107 ? 27.668  10.852  -30.162 1.00 46.14  ? 58  SER A OG  1 
ATOM   478  N  N   . THR A 1 108 ? 29.001  8.903   -27.924 1.00 47.11  ? 59  THR A N   1 
ATOM   479  C  CA  . THR A 1 108 ? 29.691  9.144   -26.655 1.00 45.34  ? 59  THR A CA  1 
ATOM   480  C  C   . THR A 1 108 ? 30.149  7.861   -25.973 1.00 46.51  ? 59  THR A C   1 
ATOM   481  O  O   . THR A 1 108 ? 30.695  7.902   -24.872 1.00 48.96  ? 59  THR A O   1 
ATOM   482  C  CB  . THR A 1 108 ? 28.815  9.957   -25.685 1.00 49.32  ? 59  THR A CB  1 
ATOM   483  O  OG1 . THR A 1 108 ? 27.504  9.386   -25.643 1.00 51.84  ? 59  THR A OG1 1 
ATOM   484  C  CG2 . THR A 1 108 ? 28.714  11.413  -26.134 1.00 48.05  ? 59  THR A CG2 1 
ATOM   485  N  N   . TYR A 1 109 ? 29.943  6.722   -26.628 1.00 48.24  ? 60  TYR A N   1 
ATOM   486  C  CA  . TYR A 1 109 ? 30.405  5.453   -26.089 1.00 47.64  ? 60  TYR A CA  1 
ATOM   487  C  C   . TYR A 1 109 ? 31.932  5.454   -25.905 1.00 50.30  ? 60  TYR A C   1 
ATOM   488  O  O   . TYR A 1 109 ? 32.661  6.001   -26.725 1.00 50.51  ? 60  TYR A O   1 
ATOM   489  C  CB  . TYR A 1 109 ? 29.954  4.311   -26.999 1.00 46.18  ? 60  TYR A CB  1 
ATOM   490  C  CG  . TYR A 1 109 ? 30.629  2.983   -26.740 1.00 50.39  ? 60  TYR A CG  1 
ATOM   491  C  CD1 . TYR A 1 109 ? 30.390  2.275   -25.568 1.00 50.32  ? 60  TYR A CD1 1 
ATOM   492  C  CD2 . TYR A 1 109 ? 31.509  2.429   -27.682 1.00 55.09  ? 60  TYR A CD2 1 
ATOM   493  C  CE1 . TYR A 1 109 ? 31.002  1.058   -25.330 1.00 51.83  ? 60  TYR A CE1 1 
ATOM   494  C  CE2 . TYR A 1 109 ? 32.125  1.201   -27.460 1.00 51.41  ? 60  TYR A CE2 1 
ATOM   495  C  CZ  . TYR A 1 109 ? 31.866  0.526   -26.276 1.00 53.90  ? 60  TYR A CZ  1 
ATOM   496  O  OH  . TYR A 1 109 ? 32.463  -0.688  -26.023 1.00 57.40  ? 60  TYR A OH  1 
ATOM   497  N  N   . ARG A 1 110 ? 32.410  4.874   -24.809 1.00 49.97  ? 61  ARG A N   1 
ATOM   498  C  CA  . ARG A 1 110 ? 33.842  4.682   -24.630 1.00 50.61  ? 61  ARG A CA  1 
ATOM   499  C  C   . ARG A 1 110 ? 34.074  3.236   -24.247 1.00 55.53  ? 61  ARG A C   1 
ATOM   500  O  O   . ARG A 1 110 ? 33.464  2.720   -23.304 1.00 59.73  ? 61  ARG A O   1 
ATOM   501  C  CB  . ARG A 1 110 ? 34.408  5.608   -23.559 1.00 47.60  ? 61  ARG A CB  1 
ATOM   502  C  CG  . ARG A 1 110 ? 34.494  7.079   -23.956 1.00 48.12  ? 61  ARG A CG  1 
ATOM   503  C  CD  . ARG A 1 110 ? 34.965  7.910   -22.779 1.00 43.58  ? 61  ARG A CD  1 
ATOM   504  N  NE  . ARG A 1 110 ? 34.974  9.337   -23.068 1.00 43.38  ? 61  ARG A NE  1 
ATOM   505  C  CZ  . ARG A 1 110 ? 35.261  10.288  -22.173 1.00 45.66  ? 61  ARG A CZ  1 
ATOM   506  N  NH1 . ARG A 1 110 ? 35.567  9.979   -20.901 1.00 43.82  ? 61  ARG A NH1 1 
ATOM   507  N  NH2 . ARG A 1 110 ? 35.242  11.565  -22.551 1.00 42.59  ? 61  ARG A NH2 1 
ATOM   508  N  N   . ASP A 1 111 ? 34.941  2.581   -25.008 1.00 53.54  ? 62  ASP A N   1 
ATOM   509  C  CA  . ASP A 1 111 ? 35.322  1.207   -24.757 1.00 50.60  ? 62  ASP A CA  1 
ATOM   510  C  C   . ASP A 1 111 ? 36.424  1.136   -23.677 1.00 52.53  ? 62  ASP A C   1 
ATOM   511  O  O   . ASP A 1 111 ? 37.498  1.735   -23.825 1.00 53.26  ? 62  ASP A O   1 
ATOM   512  C  CB  . ASP A 1 111 ? 35.785  0.574   -26.073 1.00 50.60  ? 62  ASP A CB  1 
ATOM   513  C  CG  . ASP A 1 111 ? 35.928  -0.925  -25.981 1.00 50.17  ? 62  ASP A CG  1 
ATOM   514  O  OD1 . ASP A 1 111 ? 35.838  -1.476  -24.869 1.00 53.68  ? 62  ASP A OD1 1 
ATOM   515  O  OD2 . ASP A 1 111 ? 36.135  -1.561  -27.023 1.00 52.46  ? 62  ASP A OD2 1 
ATOM   516  N  N   . LEU A 1 112 ? 36.140  0.433   -22.582 1.00 53.18  ? 63  LEU A N   1 
ATOM   517  C  CA  . LEU A 1 112 ? 37.134  0.239   -21.530 1.00 52.04  ? 63  LEU A CA  1 
ATOM   518  C  C   . LEU A 1 112 ? 38.043  -0.949  -21.831 1.00 54.69  ? 63  LEU A C   1 
ATOM   519  O  O   . LEU A 1 112 ? 39.000  -1.192  -21.087 1.00 55.74  ? 63  LEU A O   1 
ATOM   520  C  CB  . LEU A 1 112 ? 36.496  0.137   -20.123 1.00 48.95  ? 63  LEU A CB  1 
ATOM   521  C  CG  . LEU A 1 112 ? 36.172  1.495   -19.492 1.00 48.71  ? 63  LEU A CG  1 
ATOM   522  C  CD1 . LEU A 1 112 ? 35.142  1.381   -18.376 1.00 49.41  ? 63  LEU A CD1 1 
ATOM   523  C  CD2 . LEU A 1 112 ? 37.426  2.211   -19.015 1.00 50.77  ? 63  LEU A CD2 1 
ATOM   524  N  N   . ARG A 1 113 ? 37.764  -1.666  -22.922 1.00 54.55  ? 64  ARG A N   1 
ATOM   525  C  CA  . ARG A 1 113 ? 38.623  -2.767  -23.369 1.00 60.20  ? 64  ARG A CA  1 
ATOM   526  C  C   . ARG A 1 113 ? 38.899  -3.814  -22.270 1.00 62.44  ? 64  ARG A C   1 
ATOM   527  O  O   . ARG A 1 113 ? 39.958  -4.449  -22.278 1.00 69.74  ? 64  ARG A O   1 
ATOM   528  C  CB  . ARG A 1 113 ? 39.970  -2.226  -23.893 1.00 60.05  ? 64  ARG A CB  1 
ATOM   529  C  CG  . ARG A 1 113 ? 39.988  -1.648  -25.303 1.00 66.06  ? 64  ARG A CG  1 
ATOM   530  C  CD  . ARG A 1 113 ? 41.414  -1.394  -25.815 1.00 67.86  ? 64  ARG A CD  1 
ATOM   531  N  NE  . ARG A 1 113 ? 42.348  -2.495  -25.518 1.00 71.82  ? 64  ARG A NE  1 
ATOM   532  C  CZ  . ARG A 1 113 ? 43.365  -2.432  -24.639 1.00 71.66  ? 64  ARG A CZ  1 
ATOM   533  N  NH1 . ARG A 1 113 ? 43.624  -1.310  -23.966 1.00 71.59  ? 64  ARG A NH1 1 
ATOM   534  N  NH2 . ARG A 1 113 ? 44.134  -3.499  -24.428 1.00 62.17  ? 64  ARG A NH2 1 
ATOM   535  N  N   . LYS A 1 114 ? 37.965  -3.983  -21.332 1.00 63.02  ? 65  LYS A N   1 
ATOM   536  C  CA  . LYS A 1 114 ? 38.071  -4.995  -20.266 1.00 62.07  ? 65  LYS A CA  1 
ATOM   537  C  C   . LYS A 1 114 ? 36.808  -5.860  -20.208 1.00 62.62  ? 65  LYS A C   1 
ATOM   538  O  O   . LYS A 1 114 ? 35.694  -5.346  -20.290 1.00 64.47  ? 65  LYS A O   1 
ATOM   539  C  CB  . LYS A 1 114 ? 38.336  -4.316  -18.913 1.00 61.55  ? 65  LYS A CB  1 
ATOM   540  C  CG  . LYS A 1 114 ? 38.693  -5.252  -17.761 1.00 67.28  ? 65  LYS A CG  1 
ATOM   541  C  CD  . LYS A 1 114 ? 39.405  -4.532  -16.600 1.00 75.35  ? 65  LYS A CD  1 
ATOM   542  C  CE  . LYS A 1 114 ? 38.701  -3.243  -16.150 1.00 77.29  ? 65  LYS A CE  1 
ATOM   543  N  NZ  . LYS A 1 114 ? 39.121  -2.734  -14.810 1.00 70.10  ? 65  LYS A NZ  1 
ATOM   544  N  N   . GLY A 1 115 ? 36.989  -7.173  -20.087 1.00 64.99  ? 66  GLY A N   1 
ATOM   545  C  CA  . GLY A 1 115 ? 35.874  -8.109  -19.935 1.00 59.07  ? 66  GLY A CA  1 
ATOM   546  C  C   . GLY A 1 115 ? 35.464  -8.261  -18.480 1.00 62.46  ? 66  GLY A C   1 
ATOM   547  O  O   . GLY A 1 115 ? 36.248  -7.964  -17.573 1.00 67.42  ? 66  GLY A O   1 
ATOM   548  N  N   . VAL A 1 116 ? 34.228  -8.708  -18.255 1.00 62.54  ? 67  VAL A N   1 
ATOM   549  C  CA  . VAL A 1 116 ? 33.695  -8.932  -16.902 1.00 62.35  ? 67  VAL A CA  1 
ATOM   550  C  C   . VAL A 1 116 ? 32.766  -10.160 -16.887 1.00 67.17  ? 67  VAL A C   1 
ATOM   551  O  O   . VAL A 1 116 ? 31.866  -10.284 -17.720 1.00 74.13  ? 67  VAL A O   1 
ATOM   552  C  CB  . VAL A 1 116 ? 33.045  -7.640  -16.308 1.00 62.18  ? 67  VAL A CB  1 
ATOM   553  C  CG1 . VAL A 1 116 ? 31.883  -7.129  -17.154 1.00 61.55  ? 67  VAL A CG1 1 
ATOM   554  C  CG2 . VAL A 1 116 ? 32.616  -7.831  -14.860 1.00 62.03  ? 67  VAL A CG2 1 
ATOM   555  N  N   . TYR A 1 117 ? 33.016  -11.077 -15.959 1.00 69.36  ? 68  TYR A N   1 
ATOM   556  C  CA  . TYR A 1 117 ? 32.267  -12.324 -15.876 1.00 73.05  ? 68  TYR A CA  1 
ATOM   557  C  C   . TYR A 1 117 ? 31.641  -12.469 -14.479 1.00 76.09  ? 68  TYR A C   1 
ATOM   558  O  O   . TYR A 1 117 ? 32.363  -12.534 -13.484 1.00 85.25  ? 68  TYR A O   1 
ATOM   559  C  CB  . TYR A 1 117 ? 33.188  -13.500 -16.227 1.00 73.83  ? 68  TYR A CB  1 
ATOM   560  C  CG  . TYR A 1 117 ? 32.575  -14.871 -16.020 1.00 83.27  ? 68  TYR A CG  1 
ATOM   561  C  CD1 . TYR A 1 117 ? 31.504  -15.312 -16.811 1.00 84.14  ? 68  TYR A CD1 1 
ATOM   562  C  CD2 . TYR A 1 117 ? 33.070  -15.734 -15.039 1.00 85.14  ? 68  TYR A CD2 1 
ATOM   563  C  CE1 . TYR A 1 117 ? 30.939  -16.565 -16.620 1.00 86.61  ? 68  TYR A CE1 1 
ATOM   564  C  CE2 . TYR A 1 117 ? 32.511  -16.988 -14.843 1.00 85.78  ? 68  TYR A CE2 1 
ATOM   565  C  CZ  . TYR A 1 117 ? 31.448  -17.394 -15.634 1.00 88.33  ? 68  TYR A CZ  1 
ATOM   566  O  OH  . TYR A 1 117 ? 30.889  -18.631 -15.443 1.00 91.24  ? 68  TYR A OH  1 
ATOM   567  N  N   . VAL A 1 118 ? 30.305  -12.522 -14.419 1.00 71.87  ? 69  VAL A N   1 
ATOM   568  C  CA  . VAL A 1 118 ? 29.547  -12.373 -13.163 1.00 69.67  ? 69  VAL A CA  1 
ATOM   569  C  C   . VAL A 1 118 ? 28.595  -13.548 -12.864 1.00 70.69  ? 69  VAL A C   1 
ATOM   570  O  O   . VAL A 1 118 ? 27.391  -13.438 -13.085 1.00 71.98  ? 69  VAL A O   1 
ATOM   571  C  CB  . VAL A 1 118 ? 28.750  -11.033 -13.161 1.00 72.64  ? 69  VAL A CB  1 
ATOM   572  C  CG1 . VAL A 1 118 ? 28.011  -10.803 -11.847 1.00 68.82  ? 69  VAL A CG1 1 
ATOM   573  C  CG2 . VAL A 1 118 ? 29.672  -9.856  -13.437 1.00 77.39  ? 69  VAL A CG2 1 
ATOM   574  N  N   . PRO A 1 119 ? 29.122  -14.673 -12.333 1.00 72.94  ? 70  PRO A N   1 
ATOM   575  C  CA  . PRO A 1 119 ? 28.230  -15.796 -12.068 1.00 74.38  ? 70  PRO A CA  1 
ATOM   576  C  C   . PRO A 1 119 ? 27.737  -15.806 -10.627 1.00 74.56  ? 70  PRO A C   1 
ATOM   577  O  O   . PRO A 1 119 ? 28.526  -15.582 -9.715  1.00 78.15  ? 70  PRO A O   1 
ATOM   578  C  CB  . PRO A 1 119 ? 29.143  -17.005 -12.294 1.00 75.15  ? 70  PRO A CB  1 
ATOM   579  C  CG  . PRO A 1 119 ? 30.498  -16.523 -11.858 1.00 74.66  ? 70  PRO A CG  1 
ATOM   580  C  CD  . PRO A 1 119 ? 30.518  -15.008 -11.974 1.00 72.94  ? 70  PRO A CD  1 
ATOM   581  N  N   . TYR A 1 120 ? 26.449  -16.057 -10.425 1.00 72.67  ? 71  TYR A N   1 
ATOM   582  C  CA  . TYR A 1 120 ? 25.935  -16.339 -9.084  1.00 74.86  ? 71  TYR A CA  1 
ATOM   583  C  C   . TYR A 1 120 ? 25.240  -17.703 -9.099  1.00 77.58  ? 71  TYR A C   1 
ATOM   584  O  O   . TYR A 1 120 ? 25.337  -18.427 -10.097 1.00 78.76  ? 71  TYR A O   1 
ATOM   585  C  CB  . TYR A 1 120 ? 25.054  -15.184 -8.548  1.00 79.28  ? 71  TYR A CB  1 
ATOM   586  C  CG  . TYR A 1 120 ? 23.938  -14.690 -9.469  1.00 80.18  ? 71  TYR A CG  1 
ATOM   587  C  CD1 . TYR A 1 120 ? 24.183  -13.715 -10.474 1.00 75.30  ? 71  TYR A CD1 1 
ATOM   588  C  CD2 . TYR A 1 120 ? 22.616  -15.177 -9.310  1.00 78.26  ? 71  TYR A CD2 1 
ATOM   589  C  CE1 . TYR A 1 120 ? 23.146  -13.270 -11.304 1.00 74.70  ? 71  TYR A CE1 1 
ATOM   590  C  CE2 . TYR A 1 120 ? 21.576  -14.744 -10.133 1.00 75.69  ? 71  TYR A CE2 1 
ATOM   591  C  CZ  . TYR A 1 120 ? 21.835  -13.793 -11.128 1.00 78.67  ? 71  TYR A CZ  1 
ATOM   592  O  OH  . TYR A 1 120 ? 20.781  -13.381 -11.928 1.00 71.04  ? 71  TYR A OH  1 
ATOM   593  N  N   . THR A 1 121 ? 24.571  -18.086 -8.014  1.00 77.70  ? 72  THR A N   1 
ATOM   594  C  CA  . THR A 1 121 ? 24.024  -19.443 -7.949  1.00 79.38  ? 72  THR A CA  1 
ATOM   595  C  C   . THR A 1 121 ? 22.867  -19.667 -8.931  1.00 79.38  ? 72  THR A C   1 
ATOM   596  O  O   . THR A 1 121 ? 22.882  -20.645 -9.673  1.00 87.77  ? 72  THR A O   1 
ATOM   597  C  CB  . THR A 1 121 ? 23.642  -19.888 -6.514  1.00 80.62  ? 72  THR A CB  1 
ATOM   598  O  OG1 . THR A 1 121 ? 22.309  -19.466 -6.201  1.00 89.27  ? 72  THR A OG1 1 
ATOM   599  C  CG2 . THR A 1 121 ? 24.634  -19.362 -5.469  1.00 78.55  ? 72  THR A CG2 1 
ATOM   600  N  N   . GLN A 1 122 ? 21.891  -18.759 -8.956  1.00 84.65  ? 73  GLN A N   1 
ATOM   601  C  CA  . GLN A 1 122 ? 20.666  -18.946 -9.757  1.00 90.77  ? 73  GLN A CA  1 
ATOM   602  C  C   . GLN A 1 122 ? 20.694  -18.279 -11.141 1.00 84.14  ? 73  GLN A C   1 
ATOM   603  O  O   . GLN A 1 122 ? 19.648  -17.918 -11.689 1.00 83.23  ? 73  GLN A O   1 
ATOM   604  C  CB  . GLN A 1 122 ? 19.409  -18.517 -8.959  1.00 101.97 ? 73  GLN A CB  1 
ATOM   605  C  CG  . GLN A 1 122 ? 19.017  -19.423 -7.775  1.00 116.47 ? 73  GLN A CG  1 
ATOM   606  C  CD  . GLN A 1 122 ? 18.551  -20.852 -8.190  1.00 125.44 ? 73  GLN A CD  1 
ATOM   607  O  OE1 . GLN A 1 122 ? 17.878  -21.030 -9.212  1.00 134.54 ? 73  GLN A OE1 1 
ATOM   608  N  NE2 . GLN A 1 122 ? 18.901  -21.879 -7.383  1.00 122.18 ? 73  GLN A NE2 1 
ATOM   609  N  N   . GLY A 1 123 ? 21.886  -18.134 -11.711 1.00 79.68  ? 74  GLY A N   1 
ATOM   610  C  CA  . GLY A 1 123 ? 22.047  -17.478 -13.013 1.00 78.82  ? 74  GLY A CA  1 
ATOM   611  C  C   . GLY A 1 123 ? 23.367  -16.737 -13.163 1.00 79.74  ? 74  GLY A C   1 
ATOM   612  O  O   . GLY A 1 123 ? 24.149  -16.646 -12.213 1.00 82.41  ? 74  GLY A O   1 
ATOM   613  N  N   . LYS A 1 124 ? 23.626  -16.207 -14.355 1.00 78.94  ? 75  LYS A N   1 
ATOM   614  C  CA  . LYS A 1 124 ? 24.888  -15.501 -14.618 1.00 79.77  ? 75  LYS A CA  1 
ATOM   615  C  C   . LYS A 1 124 ? 24.850  -14.603 -15.849 1.00 76.97  ? 75  LYS A C   1 
ATOM   616  O  O   . LYS A 1 124 ? 24.129  -14.870 -16.810 1.00 75.41  ? 75  LYS A O   1 
ATOM   617  C  CB  . LYS A 1 124 ? 26.048  -16.496 -14.746 1.00 80.85  ? 75  LYS A CB  1 
ATOM   618  C  CG  . LYS A 1 124 ? 26.080  -17.262 -16.057 1.00 87.30  ? 75  LYS A CG  1 
ATOM   619  C  CD  . LYS A 1 124 ? 26.473  -18.715 -15.835 1.00 90.44  ? 75  LYS A CD  1 
ATOM   620  C  CE  . LYS A 1 124 ? 27.000  -19.347 -17.122 1.00 89.90  ? 75  LYS A CE  1 
ATOM   621  N  NZ  . LYS A 1 124 ? 27.468  -20.736 -16.865 1.00 86.77  ? 75  LYS A NZ  1 
ATOM   622  N  N   . TRP A 1 125 ? 25.642  -13.537 -15.808 1.00 75.82  ? 76  TRP A N   1 
ATOM   623  C  CA  . TRP A 1 125 ? 25.849  -12.707 -16.984 1.00 72.23  ? 76  TRP A CA  1 
ATOM   624  C  C   . TRP A 1 125 ? 27.336  -12.435 -17.261 1.00 76.15  ? 76  TRP A C   1 
ATOM   625  O  O   . TRP A 1 125 ? 28.176  -12.500 -16.359 1.00 76.79  ? 76  TRP A O   1 
ATOM   626  C  CB  . TRP A 1 125 ? 25.016  -11.431 -16.902 1.00 64.58  ? 76  TRP A CB  1 
ATOM   627  C  CG  . TRP A 1 125 ? 25.345  -10.518 -15.785 1.00 61.02  ? 76  TRP A CG  1 
ATOM   628  C  CD1 . TRP A 1 125 ? 24.765  -10.489 -14.555 1.00 61.26  ? 76  TRP A CD1 1 
ATOM   629  C  CD2 . TRP A 1 125 ? 26.311  -9.457  -15.802 1.00 60.30  ? 76  TRP A CD2 1 
ATOM   630  N  NE1 . TRP A 1 125 ? 25.317  -9.482  -13.790 1.00 62.42  ? 76  TRP A NE1 1 
ATOM   631  C  CE2 . TRP A 1 125 ? 26.265  -8.832  -14.538 1.00 59.12  ? 76  TRP A CE2 1 
ATOM   632  C  CE3 . TRP A 1 125 ? 27.217  -8.979  -16.762 1.00 58.14  ? 76  TRP A CE3 1 
ATOM   633  C  CZ2 . TRP A 1 125 ? 27.089  -7.748  -14.209 1.00 62.59  ? 76  TRP A CZ2 1 
ATOM   634  C  CZ3 . TRP A 1 125 ? 28.030  -7.894  -16.438 1.00 58.14  ? 76  TRP A CZ3 1 
ATOM   635  C  CH2 . TRP A 1 125 ? 27.965  -7.296  -15.175 1.00 60.35  ? 76  TRP A CH2 1 
ATOM   636  N  N   . GLU A 1 126 ? 27.633  -12.135 -18.523 1.00 75.43  ? 77  GLU A N   1 
ATOM   637  C  CA  . GLU A 1 126 ? 28.989  -11.985 -19.042 1.00 72.39  ? 77  GLU A CA  1 
ATOM   638  C  C   . GLU A 1 126 ? 28.989  -10.797 -20.010 1.00 67.62  ? 77  GLU A C   1 
ATOM   639  O  O   . GLU A 1 126 ? 28.061  -10.646 -20.806 1.00 69.92  ? 77  GLU A O   1 
ATOM   640  C  CB  . GLU A 1 126 ? 29.362  -13.270 -19.784 1.00 80.49  ? 77  GLU A CB  1 
ATOM   641  C  CG  . GLU A 1 126 ? 30.838  -13.434 -20.117 1.00 96.24  ? 77  GLU A CG  1 
ATOM   642  C  CD  . GLU A 1 126 ? 31.208  -14.881 -20.447 1.00 105.26 ? 77  GLU A CD  1 
ATOM   643  O  OE1 . GLU A 1 126 ? 32.355  -15.302 -20.139 1.00 107.01 ? 77  GLU A OE1 1 
ATOM   644  O  OE2 . GLU A 1 126 ? 30.350  -15.607 -20.998 1.00 109.01 ? 77  GLU A OE2 1 
ATOM   645  N  N   . GLY A 1 127 ? 29.994  -9.934  -19.951 1.00 60.24  ? 78  GLY A N   1 
ATOM   646  C  CA  . GLY A 1 127 ? 29.950  -8.755  -20.809 1.00 59.02  ? 78  GLY A CA  1 
ATOM   647  C  C   . GLY A 1 127 ? 31.185  -7.885  -20.913 1.00 60.96  ? 78  GLY A C   1 
ATOM   648  O  O   . GLY A 1 127 ? 32.233  -8.210  -20.352 1.00 60.94  ? 78  GLY A O   1 
ATOM   649  N  N   . GLU A 1 128 ? 31.039  -6.759  -21.620 1.00 55.38  ? 79  GLU A N   1 
ATOM   650  C  CA  . GLU A 1 128 ? 32.152  -5.859  -21.942 1.00 53.40  ? 79  GLU A CA  1 
ATOM   651  C  C   . GLU A 1 128 ? 32.002  -4.480  -21.305 1.00 51.27  ? 79  GLU A C   1 
ATOM   652  O  O   . GLU A 1 128 ? 30.981  -3.810  -21.475 1.00 53.81  ? 79  GLU A O   1 
ATOM   653  C  CB  . GLU A 1 128 ? 32.301  -5.738  -23.460 1.00 56.34  ? 79  GLU A CB  1 
ATOM   654  C  CG  . GLU A 1 128 ? 32.619  -7.079  -24.119 1.00 60.14  ? 79  GLU A CG  1 
ATOM   655  C  CD  . GLU A 1 128 ? 32.381  -7.125  -25.617 1.00 61.20  ? 79  GLU A CD  1 
ATOM   656  O  OE1 . GLU A 1 128 ? 32.638  -8.195  -26.200 1.00 65.62  ? 79  GLU A OE1 1 
ATOM   657  O  OE2 . GLU A 1 128 ? 31.931  -6.121  -26.213 1.00 61.01  ? 79  GLU A OE2 1 
ATOM   658  N  N   . LEU A 1 129 ? 33.022  -4.072  -20.561 1.00 45.18  ? 80  LEU A N   1 
ATOM   659  C  CA  . LEU A 1 129 ? 32.993  -2.813  -19.844 1.00 43.45  ? 80  LEU A CA  1 
ATOM   660  C  C   . LEU A 1 129 ? 33.205  -1.616  -20.779 1.00 41.62  ? 80  LEU A C   1 
ATOM   661  O  O   . LEU A 1 129 ? 33.913  -1.736  -21.786 1.00 42.43  ? 80  LEU A O   1 
ATOM   662  C  CB  . LEU A 1 129 ? 34.045  -2.806  -18.722 1.00 44.77  ? 80  LEU A CB  1 
ATOM   663  C  CG  . LEU A 1 129 ? 33.804  -3.656  -17.483 1.00 47.66  ? 80  LEU A CG  1 
ATOM   664  C  CD1 . LEU A 1 129 ? 35.040  -3.600  -16.610 1.00 48.41  ? 80  LEU A CD1 1 
ATOM   665  C  CD2 . LEU A 1 129 ? 32.576  -3.185  -16.707 1.00 48.08  ? 80  LEU A CD2 1 
ATOM   666  N  N   . GLY A 1 130 ? 32.614  -0.475  -20.405 1.00 37.64  ? 81  GLY A N   1 
ATOM   667  C  CA  . GLY A 1 130 ? 32.692  0.786   -21.146 1.00 38.81  ? 81  GLY A CA  1 
ATOM   668  C  C   . GLY A 1 130 ? 32.080  1.910   -20.318 1.00 42.60  ? 81  GLY A C   1 
ATOM   669  O  O   . GLY A 1 130 ? 31.563  1.657   -19.235 1.00 46.00  ? 81  GLY A O   1 
ATOM   670  N  N   . THR A 1 131 ? 32.171  3.152   -20.795 1.00 42.95  ? 82  THR A N   1 
ATOM   671  C  CA  . THR A 1 131 ? 31.439  4.286   -20.200 1.00 44.50  ? 82  THR A CA  1 
ATOM   672  C  C   . THR A 1 131 ? 30.571  5.000   -21.249 1.00 47.55  ? 82  THR A C   1 
ATOM   673  O  O   . THR A 1 131 ? 30.810  4.867   -22.445 1.00 49.69  ? 82  THR A O   1 
ATOM   674  C  CB  . THR A 1 131 ? 32.358  5.345   -19.552 1.00 44.33  ? 82  THR A CB  1 
ATOM   675  O  OG1 . THR A 1 131 ? 33.041  6.077   -20.567 1.00 43.55  ? 82  THR A OG1 1 
ATOM   676  C  CG2 . THR A 1 131 ? 33.362  4.728   -18.590 1.00 45.88  ? 82  THR A CG2 1 
ATOM   677  N  N   . ASP A 1 132 ? 29.572  5.752   -20.793 1.00 47.02  ? 83  ASP A N   1 
ATOM   678  C  CA  . ASP A 1 132 ? 28.722  6.541   -21.682 1.00 46.96  ? 83  ASP A CA  1 
ATOM   679  C  C   . ASP A 1 132 ? 27.986  7.558   -20.846 1.00 48.19  ? 83  ASP A C   1 
ATOM   680  O  O   . ASP A 1 132 ? 28.125  7.570   -19.617 1.00 51.69  ? 83  ASP A O   1 
ATOM   681  C  CB  . ASP A 1 132 ? 27.682  5.644   -22.369 1.00 47.61  ? 83  ASP A CB  1 
ATOM   682  C  CG  . ASP A 1 132 ? 27.395  6.049   -23.809 1.00 43.82  ? 83  ASP A CG  1 
ATOM   683  O  OD1 . ASP A 1 132 ? 27.449  7.249   -24.151 1.00 44.37  ? 83  ASP A OD1 1 
ATOM   684  O  OD2 . ASP A 1 132 ? 27.115  5.142   -24.608 1.00 43.83  ? 83  ASP A OD2 1 
ATOM   685  N  N   . LEU A 1 133 ? 27.189  8.388   -21.516 1.00 45.80  ? 84  LEU A N   1 
ATOM   686  C  CA  . LEU A 1 133 ? 26.317  9.335   -20.849 1.00 49.42  ? 84  LEU A CA  1 
ATOM   687  C  C   . LEU A 1 133 ? 24.977  8.660   -20.468 1.00 52.61  ? 84  LEU A C   1 
ATOM   688  O  O   . LEU A 1 133 ? 24.427  7.856   -21.231 1.00 50.02  ? 84  LEU A O   1 
ATOM   689  C  CB  . LEU A 1 133 ? 26.114  10.593  -21.716 1.00 47.74  ? 84  LEU A CB  1 
ATOM   690  C  CG  . LEU A 1 133 ? 27.346  11.368  -22.215 1.00 44.95  ? 84  LEU A CG  1 
ATOM   691  C  CD1 . LEU A 1 133 ? 26.930  12.593  -23.034 1.00 43.38  ? 84  LEU A CD1 1 
ATOM   692  C  CD2 . LEU A 1 133 ? 28.260  11.778  -21.070 1.00 44.94  ? 84  LEU A CD2 1 
ATOM   693  N  N   . VAL A 1 134 ? 24.476  8.990   -19.274 1.00 52.37  ? 85  VAL A N   1 
ATOM   694  C  CA  . VAL A 1 134 ? 23.371  8.266   -18.638 1.00 51.27  ? 85  VAL A CA  1 
ATOM   695  C  C   . VAL A 1 134 ? 22.475  9.275   -17.917 1.00 51.44  ? 85  VAL A C   1 
ATOM   696  O  O   . VAL A 1 134 ? 22.979  10.116  -17.163 1.00 50.89  ? 85  VAL A O   1 
ATOM   697  C  CB  . VAL A 1 134 ? 23.908  7.244   -17.605 1.00 51.50  ? 85  VAL A CB  1 
ATOM   698  C  CG1 . VAL A 1 134 ? 22.780  6.528   -16.887 1.00 50.79  ? 85  VAL A CG1 1 
ATOM   699  C  CG2 . VAL A 1 134 ? 24.842  6.241   -18.261 1.00 47.40  ? 85  VAL A CG2 1 
ATOM   700  N  N   . SER A 1 135 ? 21.160  9.187   -18.171 1.00 53.97  ? 86  SER A N   1 
ATOM   701  C  CA  . SER A 1 135 ? 20.115  9.991   -17.494 1.00 53.27  ? 86  SER A CA  1 
ATOM   702  C  C   . SER A 1 135 ? 19.034  9.110   -16.906 1.00 51.54  ? 86  SER A C   1 
ATOM   703  O  O   . SER A 1 135 ? 18.831  7.965   -17.334 1.00 47.85  ? 86  SER A O   1 
ATOM   704  C  CB  . SER A 1 135 ? 19.424  10.946  -18.469 1.00 52.29  ? 86  SER A CB  1 
ATOM   705  O  OG  . SER A 1 135 ? 20.375  11.713  -19.171 1.00 57.18  ? 86  SER A OG  1 
ATOM   706  N  N   . ILE A 1 136 ? 18.331  9.670   -15.931 1.00 52.21  ? 87  ILE A N   1 
ATOM   707  C  CA  . ILE A 1 136 ? 17.108  9.087   -15.399 1.00 51.20  ? 87  ILE A CA  1 
ATOM   708  C  C   . ILE A 1 136 ? 15.997  10.103  -15.695 1.00 52.33  ? 87  ILE A C   1 
ATOM   709  O  O   . ILE A 1 136 ? 15.883  11.100  -14.984 1.00 56.57  ? 87  ILE A O   1 
ATOM   710  C  CB  . ILE A 1 136 ? 17.235  8.830   -13.877 1.00 52.54  ? 87  ILE A CB  1 
ATOM   711  C  CG1 . ILE A 1 136 ? 18.414  7.884   -13.593 1.00 57.48  ? 87  ILE A CG1 1 
ATOM   712  C  CG2 . ILE A 1 136 ? 15.922  8.314   -13.292 1.00 47.99  ? 87  ILE A CG2 1 
ATOM   713  C  CD1 . ILE A 1 136 ? 18.918  7.892   -12.160 1.00 56.49  ? 87  ILE A CD1 1 
ATOM   714  N  N   . PRO A 1 137 ? 15.193  9.876   -16.760 1.00 51.46  ? 88  PRO A N   1 
ATOM   715  C  CA  . PRO A 1 137 ? 14.129  10.800  -17.165 1.00 52.63  ? 88  PRO A CA  1 
ATOM   716  C  C   . PRO A 1 137 ? 13.192  11.233  -16.036 1.00 56.81  ? 88  PRO A C   1 
ATOM   717  O  O   . PRO A 1 137 ? 12.836  12.410  -15.975 1.00 62.44  ? 88  PRO A O   1 
ATOM   718  C  CB  . PRO A 1 137 ? 13.355  10.005  -18.214 1.00 50.92  ? 88  PRO A CB  1 
ATOM   719  C  CG  . PRO A 1 137 ? 14.399  9.157   -18.833 1.00 51.84  ? 88  PRO A CG  1 
ATOM   720  C  CD  . PRO A 1 137 ? 15.300  8.747   -17.700 1.00 52.39  ? 88  PRO A CD  1 
ATOM   721  N  N   . HIS A 1 138 ? 12.786  10.322  -15.155 1.00 54.80  ? 89  HIS A N   1 
ATOM   722  C  CA  . HIS A 1 138 ? 11.982  10.746  -14.008 1.00 55.29  ? 89  HIS A CA  1 
ATOM   723  C  C   . HIS A 1 138 ? 12.808  10.730  -12.739 1.00 56.57  ? 89  HIS A C   1 
ATOM   724  O  O   . HIS A 1 138 ? 12.491  10.040  -11.766 1.00 62.15  ? 89  HIS A O   1 
ATOM   725  C  CB  . HIS A 1 138 ? 10.699  9.940   -13.912 1.00 54.68  ? 89  HIS A CB  1 
ATOM   726  C  CG  . HIS A 1 138 ? 9.927   9.939   -15.187 1.00 61.22  ? 89  HIS A CG  1 
ATOM   727  N  ND1 . HIS A 1 138 ? 9.175   11.020  -15.597 1.00 60.15  ? 89  HIS A ND1 1 
ATOM   728  C  CD2 . HIS A 1 138 ? 9.843   9.017   -16.178 1.00 62.00  ? 89  HIS A CD2 1 
ATOM   729  C  CE1 . HIS A 1 138 ? 8.641   10.756  -16.776 1.00 62.14  ? 89  HIS A CE1 1 
ATOM   730  N  NE2 . HIS A 1 138 ? 9.029   9.546   -17.149 1.00 64.81  ? 89  HIS A NE2 1 
ATOM   731  N  N   . GLY A 1 139 ? 13.883  11.507  -12.780 1.00 51.31  ? 90  GLY A N   1 
ATOM   732  C  CA  . GLY A 1 139 ? 14.816  11.648  -11.677 1.00 49.26  ? 90  GLY A CA  1 
ATOM   733  C  C   . GLY A 1 139 ? 15.319  13.075  -11.701 1.00 52.03  ? 90  GLY A C   1 
ATOM   734  O  O   . GLY A 1 139 ? 14.646  13.951  -12.249 1.00 51.03  ? 90  GLY A O   1 
ATOM   735  N  N   . PRO A 1 140 ? 16.511  13.328  -11.134 1.00 53.44  ? 91  PRO A N   1 
ATOM   736  C  CA  . PRO A 1 140 ? 17.010  14.718  -11.122 1.00 57.68  ? 91  PRO A CA  1 
ATOM   737  C  C   . PRO A 1 140 ? 17.415  15.172  -12.539 1.00 65.87  ? 91  PRO A C   1 
ATOM   738  O  O   . PRO A 1 140 ? 17.640  14.325  -13.423 1.00 62.03  ? 91  PRO A O   1 
ATOM   739  C  CB  . PRO A 1 140 ? 18.216  14.654  -10.184 1.00 55.76  ? 91  PRO A CB  1 
ATOM   740  C  CG  . PRO A 1 140 ? 18.683  13.221  -10.258 1.00 56.73  ? 91  PRO A CG  1 
ATOM   741  C  CD  . PRO A 1 140 ? 17.525  12.354  -10.684 1.00 52.51  ? 91  PRO A CD  1 
ATOM   742  N  N   . ASN A 1 141 ? 17.480  16.483  -12.772 1.00 68.35  ? 92  ASN A N   1 
ATOM   743  C  CA  . ASN A 1 141 ? 17.749  16.947  -14.124 1.00 71.09  ? 92  ASN A CA  1 
ATOM   744  C  C   . ASN A 1 141 ? 19.249  17.026  -14.405 1.00 71.28  ? 92  ASN A C   1 
ATOM   745  O  O   . ASN A 1 141 ? 19.817  18.118  -14.544 1.00 72.60  ? 92  ASN A O   1 
ATOM   746  C  CB  . ASN A 1 141 ? 17.013  18.254  -14.446 1.00 75.17  ? 92  ASN A CB  1 
ATOM   747  C  CG  . ASN A 1 141 ? 16.770  18.422  -15.938 1.00 81.86  ? 92  ASN A CG  1 
ATOM   748  O  OD1 . ASN A 1 141 ? 16.820  17.454  -16.699 1.00 85.23  ? 92  ASN A OD1 1 
ATOM   749  N  ND2 . ASN A 1 141 ? 16.514  19.651  -16.365 1.00 82.81  ? 92  ASN A ND2 1 
ATOM   750  N  N   . VAL A 1 142 ? 19.877  15.851  -14.469 1.00 64.03  ? 93  VAL A N   1 
ATOM   751  C  CA  . VAL A 1 142 ? 21.324  15.720  -14.698 1.00 63.57  ? 93  VAL A CA  1 
ATOM   752  C  C   . VAL A 1 142 ? 21.656  14.558  -15.663 1.00 64.00  ? 93  VAL A C   1 
ATOM   753  O  O   . VAL A 1 142 ? 20.916  13.561  -15.735 1.00 61.76  ? 93  VAL A O   1 
ATOM   754  C  CB  . VAL A 1 142 ? 22.109  15.501  -13.374 1.00 60.18  ? 93  VAL A CB  1 
ATOM   755  C  CG1 . VAL A 1 142 ? 21.834  16.608  -12.366 1.00 58.05  ? 93  VAL A CG1 1 
ATOM   756  C  CG2 . VAL A 1 142 ? 21.810  14.124  -12.769 1.00 56.51  ? 93  VAL A CG2 1 
ATOM   757  N  N   . THR A 1 143 ? 22.778  14.696  -16.377 1.00 62.03  ? 94  THR A N   1 
ATOM   758  C  CA  . THR A 1 143 ? 23.362  13.625  -17.190 1.00 58.94  ? 94  THR A CA  1 
ATOM   759  C  C   . THR A 1 143 ? 24.763  13.367  -16.678 1.00 61.62  ? 94  THR A C   1 
ATOM   760  O  O   . THR A 1 143 ? 25.533  14.316  -16.520 1.00 65.36  ? 94  THR A O   1 
ATOM   761  C  CB  . THR A 1 143 ? 23.476  14.055  -18.643 1.00 56.56  ? 94  THR A CB  1 
ATOM   762  O  OG1 . THR A 1 143 ? 22.184  14.450  -19.100 1.00 60.77  ? 94  THR A OG1 1 
ATOM   763  C  CG2 . THR A 1 143 ? 23.980  12.914  -19.497 1.00 60.75  ? 94  THR A CG2 1 
ATOM   764  N  N   . VAL A 1 144 ? 25.100  12.110  -16.390 1.00 55.98  ? 95  VAL A N   1 
ATOM   765  C  CA  . VAL A 1 144 ? 26.456  11.813  -15.904 1.00 57.26  ? 95  VAL A CA  1 
ATOM   766  C  C   . VAL A 1 144 ? 27.190  10.799  -16.778 1.00 54.20  ? 95  VAL A C   1 
ATOM   767  O  O   . VAL A 1 144 ? 26.557  10.036  -17.500 1.00 54.85  ? 95  VAL A O   1 
ATOM   768  C  CB  . VAL A 1 144 ? 26.485  11.375  -14.414 1.00 60.15  ? 95  VAL A CB  1 
ATOM   769  C  CG1 . VAL A 1 144 ? 25.888  12.457  -13.524 1.00 63.43  ? 95  VAL A CG1 1 
ATOM   770  C  CG2 . VAL A 1 144 ? 25.776  10.044  -14.201 1.00 57.75  ? 95  VAL A CG2 1 
ATOM   771  N  N   . ARG A 1 145 ? 28.521  10.801  -16.723 1.00 50.29  ? 96  ARG A N   1 
ATOM   772  C  CA  . ARG A 1 145 ? 29.265  9.747   -17.375 1.00 48.82  ? 96  ARG A CA  1 
ATOM   773  C  C   . ARG A 1 145 ? 29.452  8.619   -16.374 1.00 48.07  ? 96  ARG A C   1 
ATOM   774  O  O   . ARG A 1 145 ? 29.935  8.853   -15.257 1.00 48.89  ? 96  ARG A O   1 
ATOM   775  C  CB  . ARG A 1 145 ? 30.605  10.214  -17.963 1.00 49.26  ? 96  ARG A CB  1 
ATOM   776  C  CG  . ARG A 1 145 ? 31.266  9.083   -18.739 1.00 49.39  ? 96  ARG A CG  1 
ATOM   777  C  CD  . ARG A 1 145 ? 32.438  9.512   -19.590 1.00 52.53  ? 96  ARG A CD  1 
ATOM   778  N  NE  . ARG A 1 145 ? 32.071  10.255  -20.800 1.00 54.30  ? 96  ARG A NE  1 
ATOM   779  C  CZ  . ARG A 1 145 ? 31.767  9.721   -21.987 1.00 52.43  ? 96  ARG A CZ  1 
ATOM   780  N  NH1 . ARG A 1 145 ? 31.709  8.403   -22.164 1.00 47.47  ? 96  ARG A NH1 1 
ATOM   781  N  NH2 . ARG A 1 145 ? 31.494  10.522  -23.005 1.00 54.16  ? 96  ARG A NH2 1 
ATOM   782  N  N   . ALA A 1 146 ? 29.075  7.405   -16.773 1.00 41.04  ? 97  ALA A N   1 
ATOM   783  C  CA  . ALA A 1 146 ? 29.049  6.299   -15.834 1.00 41.72  ? 97  ALA A CA  1 
ATOM   784  C  C   . ALA A 1 146 ? 29.463  4.974   -16.460 1.00 39.93  ? 97  ALA A C   1 
ATOM   785  O  O   . ALA A 1 146 ? 29.283  4.771   -17.631 1.00 37.26  ? 97  ALA A O   1 
ATOM   786  C  CB  . ALA A 1 146 ? 27.657  6.199   -15.206 1.00 41.42  ? 97  ALA A CB  1 
ATOM   787  N  N   . ASN A 1 147 ? 30.034  4.078   -15.667 1.00 44.97  ? 98  ASN A N   1 
ATOM   788  C  CA  . ASN A 1 147 ? 30.431  2.774   -16.156 1.00 43.35  ? 98  ASN A CA  1 
ATOM   789  C  C   . ASN A 1 147 ? 29.223  1.944   -16.533 1.00 43.46  ? 98  ASN A C   1 
ATOM   790  O  O   . ASN A 1 147 ? 28.269  1.820   -15.764 1.00 48.99  ? 98  ASN A O   1 
ATOM   791  C  CB  . ASN A 1 147 ? 31.279  2.055   -15.115 1.00 43.93  ? 98  ASN A CB  1 
ATOM   792  C  CG  . ASN A 1 147 ? 32.601  2.759   -14.846 1.00 47.06  ? 98  ASN A CG  1 
ATOM   793  O  OD1 . ASN A 1 147 ? 33.408  2.937   -15.752 1.00 50.64  ? 98  ASN A OD1 1 
ATOM   794  N  ND2 . ASN A 1 147 ? 32.832  3.150   -13.593 1.00 45.02  ? 98  ASN A ND2 1 
ATOM   795  N  N   . ILE A 1 148 ? 29.251  1.401   -17.738 1.00 41.87  ? 99  ILE A N   1 
ATOM   796  C  CA  . ILE A 1 148 ? 28.207  0.496   -18.193 1.00 43.41  ? 99  ILE A CA  1 
ATOM   797  C  C   . ILE A 1 148 ? 28.847  -0.829  -18.539 1.00 43.63  ? 99  ILE A C   1 
ATOM   798  O  O   . ILE A 1 148 ? 29.757  -0.871  -19.363 1.00 47.65  ? 99  ILE A O   1 
ATOM   799  C  CB  . ILE A 1 148 ? 27.475  1.051   -19.450 1.00 44.12  ? 99  ILE A CB  1 
ATOM   800  C  CG1 . ILE A 1 148 ? 27.104  2.530   -19.225 1.00 44.32  ? 99  ILE A CG1 1 
ATOM   801  C  CG2 . ILE A 1 148 ? 26.270  0.184   -19.794 1.00 40.82  ? 99  ILE A CG2 1 
ATOM   802  C  CD1 . ILE A 1 148 ? 26.021  3.087   -20.109 1.00 44.54  ? 99  ILE A CD1 1 
ATOM   803  N  N   . ALA A 1 149 ? 28.386  -1.910  -17.927 1.00 42.60  ? 100 ALA A N   1 
ATOM   804  C  CA  . ALA A 1 149 ? 28.760  -3.235  -18.399 1.00 42.63  ? 100 ALA A CA  1 
ATOM   805  C  C   . ALA A 1 149 ? 27.792  -3.640  -19.514 1.00 47.51  ? 100 ALA A C   1 
ATOM   806  O  O   . ALA A 1 149 ? 26.599  -3.789  -19.269 1.00 50.81  ? 100 ALA A O   1 
ATOM   807  C  CB  . ALA A 1 149 ? 28.739  -4.237  -17.261 1.00 41.02  ? 100 ALA A CB  1 
ATOM   808  N  N   . ALA A 1 150 ? 28.291  -3.790  -20.740 1.00 49.43  ? 101 ALA A N   1 
ATOM   809  C  CA  . ALA A 1 150 ? 27.441  -4.177  -21.885 1.00 51.13  ? 101 ALA A CA  1 
ATOM   810  C  C   . ALA A 1 150 ? 27.331  -5.694  -21.961 1.00 53.08  ? 101 ALA A C   1 
ATOM   811  O  O   . ALA A 1 150 ? 28.288  -6.352  -22.359 1.00 55.71  ? 101 ALA A O   1 
ATOM   812  C  CB  . ALA A 1 150 ? 28.008  -3.624  -23.190 1.00 45.23  ? 101 ALA A CB  1 
ATOM   813  N  N   . ILE A 1 151 ? 26.169  -6.241  -21.591 1.00 56.44  ? 102 ILE A N   1 
ATOM   814  C  CA  . ILE A 1 151 ? 25.979  -7.703  -21.417 1.00 55.92  ? 102 ILE A CA  1 
ATOM   815  C  C   . ILE A 1 151 ? 25.865  -8.446  -22.755 1.00 54.40  ? 102 ILE A C   1 
ATOM   816  O  O   . ILE A 1 151 ? 24.956  -8.174  -23.540 1.00 54.60  ? 102 ILE A O   1 
ATOM   817  C  CB  . ILE A 1 151 ? 24.748  -8.022  -20.524 1.00 56.76  ? 102 ILE A CB  1 
ATOM   818  C  CG1 . ILE A 1 151 ? 24.846  -7.319  -19.167 1.00 57.99  ? 102 ILE A CG1 1 
ATOM   819  C  CG2 . ILE A 1 151 ? 24.637  -9.519  -20.275 1.00 59.57  ? 102 ILE A CG2 1 
ATOM   820  C  CD1 . ILE A 1 151 ? 23.519  -7.181  -18.457 1.00 58.03  ? 102 ILE A CD1 1 
ATOM   821  N  N   . THR A 1 152 ? 26.778  -9.383  -23.014 1.00 53.71  ? 103 THR A N   1 
ATOM   822  C  CA  . THR A 1 152 ? 26.839  -10.043 -24.334 1.00 56.17  ? 103 THR A CA  1 
ATOM   823  C  C   . THR A 1 152 ? 26.372  -11.494 -24.307 1.00 58.34  ? 103 THR A C   1 
ATOM   824  O  O   . THR A 1 152 ? 26.099  -12.081 -25.349 1.00 64.76  ? 103 THR A O   1 
ATOM   825  C  CB  . THR A 1 152 ? 28.248  -9.951  -24.999 1.00 53.69  ? 103 THR A CB  1 
ATOM   826  O  OG1 . THR A 1 152 ? 29.260  -10.237 -24.032 1.00 56.82  ? 103 THR A OG1 1 
ATOM   827  C  CG2 . THR A 1 152 ? 28.514  -8.573  -25.559 1.00 49.98  ? 103 THR A CG2 1 
ATOM   828  N  N   . GLU A 1 153 ? 26.289  -12.070 -23.115 1.00 61.17  ? 104 GLU A N   1 
ATOM   829  C  CA  . GLU A 1 153 ? 25.828  -13.442 -22.934 1.00 67.73  ? 104 GLU A CA  1 
ATOM   830  C  C   . GLU A 1 153 ? 25.336  -13.639 -21.512 1.00 66.56  ? 104 GLU A C   1 
ATOM   831  O  O   . GLU A 1 153 ? 25.915  -13.090 -20.573 1.00 66.23  ? 104 GLU A O   1 
ATOM   832  C  CB  . GLU A 1 153 ? 26.948  -14.440 -23.224 1.00 78.01  ? 104 GLU A CB  1 
ATOM   833  C  CG  . GLU A 1 153 ? 26.981  -14.942 -24.659 1.00 86.14  ? 104 GLU A CG  1 
ATOM   834  C  CD  . GLU A 1 153 ? 27.951  -16.085 -24.827 1.00 92.69  ? 104 GLU A CD  1 
ATOM   835  O  OE1 . GLU A 1 153 ? 29.172  -15.830 -24.850 1.00 95.63  ? 104 GLU A OE1 1 
ATOM   836  O  OE2 . GLU A 1 153 ? 27.489  -17.238 -24.926 1.00 97.92  ? 104 GLU A OE2 1 
ATOM   837  N  N   . SER A 1 154 ? 24.274  -14.430 -21.355 1.00 70.87  ? 105 SER A N   1 
ATOM   838  C  CA  . SER A 1 154 ? 23.630  -14.626 -20.048 1.00 72.28  ? 105 SER A CA  1 
ATOM   839  C  C   . SER A 1 154 ? 22.952  -15.981 -19.918 1.00 72.85  ? 105 SER A C   1 
ATOM   840  O  O   . SER A 1 154 ? 22.862  -16.737 -20.882 1.00 74.23  ? 105 SER A O   1 
ATOM   841  C  CB  . SER A 1 154 ? 22.619  -13.502 -19.766 1.00 70.06  ? 105 SER A CB  1 
ATOM   842  O  OG  . SER A 1 154 ? 21.577  -13.486 -20.732 1.00 75.88  ? 105 SER A OG  1 
ATOM   843  N  N   . ASP A 1 155 ? 22.480  -16.274 -18.709 1.00 80.58  ? 106 ASP A N   1 
ATOM   844  C  CA  . ASP A 1 155 ? 21.746  -17.502 -18.424 1.00 86.54  ? 106 ASP A CA  1 
ATOM   845  C  C   . ASP A 1 155 ? 20.817  -17.292 -17.231 1.00 83.37  ? 106 ASP A C   1 
ATOM   846  O  O   . ASP A 1 155 ? 21.262  -16.883 -16.161 1.00 88.67  ? 106 ASP A O   1 
ATOM   847  C  CB  . ASP A 1 155 ? 22.716  -18.663 -18.165 1.00 89.02  ? 106 ASP A CB  1 
ATOM   848  C  CG  . ASP A 1 155 ? 22.016  -20.009 -18.121 1.00 95.74  ? 106 ASP A CG  1 
ATOM   849  O  OD1 . ASP A 1 155 ? 20.898  -20.137 -18.667 1.00 102.37 ? 106 ASP A OD1 1 
ATOM   850  O  OD2 . ASP A 1 155 ? 22.584  -20.949 -17.538 1.00 98.53  ? 106 ASP A OD2 1 
ATOM   851  N  N   . LYS A 1 156 ? 19.528  -17.569 -17.428 1.00 80.30  ? 107 LYS A N   1 
ATOM   852  C  CA  . LYS A 1 156 ? 18.481  -17.362 -16.404 1.00 79.70  ? 107 LYS A CA  1 
ATOM   853  C  C   . LYS A 1 156 ? 18.477  -15.955 -15.783 1.00 78.65  ? 107 LYS A C   1 
ATOM   854  O  O   . LYS A 1 156 ? 18.058  -15.780 -14.637 1.00 85.48  ? 107 LYS A O   1 
ATOM   855  C  CB  . LYS A 1 156 ? 18.536  -18.431 -15.296 1.00 81.79  ? 107 LYS A CB  1 
ATOM   856  C  CG  . LYS A 1 156 ? 18.414  -19.875 -15.773 1.00 88.78  ? 107 LYS A CG  1 
ATOM   857  C  CD  . LYS A 1 156 ? 17.940  -20.779 -14.638 1.00 92.51  ? 107 LYS A CD  1 
ATOM   858  C  CE  . LYS A 1 156 ? 18.388  -22.220 -14.832 1.00 90.13  ? 107 LYS A CE  1 
ATOM   859  N  NZ  . LYS A 1 156 ? 19.851  -22.367 -14.585 1.00 88.80  ? 107 LYS A NZ  1 
ATOM   860  N  N   . PHE A 1 157 ? 18.919  -14.964 -16.555 1.00 71.96  ? 108 PHE A N   1 
ATOM   861  C  CA  . PHE A 1 157 ? 19.032  -13.583 -16.091 1.00 67.84  ? 108 PHE A CA  1 
ATOM   862  C  C   . PHE A 1 157 ? 17.906  -12.710 -16.652 1.00 69.92  ? 108 PHE A C   1 
ATOM   863  O  O   . PHE A 1 157 ? 17.200  -12.042 -15.896 1.00 79.11  ? 108 PHE A O   1 
ATOM   864  C  CB  . PHE A 1 157 ? 20.423  -13.030 -16.443 1.00 66.34  ? 108 PHE A CB  1 
ATOM   865  C  CG  . PHE A 1 157 ? 20.660  -11.597 -16.020 1.00 61.76  ? 108 PHE A CG  1 
ATOM   866  C  CD1 . PHE A 1 157 ? 20.943  -11.281 -14.690 1.00 62.58  ? 108 PHE A CD1 1 
ATOM   867  C  CD2 . PHE A 1 157 ? 20.652  -10.568 -16.960 1.00 57.06  ? 108 PHE A CD2 1 
ATOM   868  C  CE1 . PHE A 1 157 ? 21.181  -9.965  -14.305 1.00 59.35  ? 108 PHE A CE1 1 
ATOM   869  C  CE2 . PHE A 1 157 ? 20.884  -9.251  -16.577 1.00 53.88  ? 108 PHE A CE2 1 
ATOM   870  C  CZ  . PHE A 1 157 ? 21.146  -8.951  -15.248 1.00 55.87  ? 108 PHE A CZ  1 
ATOM   871  N  N   . PHE A 1 158 ? 17.730  -12.703 -17.967 1.00 70.09  ? 109 PHE A N   1 
ATOM   872  C  CA  . PHE A 1 158 ? 16.589  -12.011 -18.550 1.00 73.49  ? 109 PHE A CA  1 
ATOM   873  C  C   . PHE A 1 158 ? 15.387  -12.969 -18.608 1.00 80.21  ? 109 PHE A C   1 
ATOM   874  O  O   . PHE A 1 158 ? 15.287  -13.804 -19.511 1.00 86.30  ? 109 PHE A O   1 
ATOM   875  C  CB  . PHE A 1 158 ? 16.922  -11.466 -19.942 1.00 68.64  ? 109 PHE A CB  1 
ATOM   876  C  CG  . PHE A 1 158 ? 18.051  -10.469 -19.970 1.00 67.74  ? 109 PHE A CG  1 
ATOM   877  C  CD1 . PHE A 1 158 ? 17.930  -9.233  -19.342 1.00 69.24  ? 109 PHE A CD1 1 
ATOM   878  C  CD2 . PHE A 1 158 ? 19.227  -10.745 -20.672 1.00 65.34  ? 109 PHE A CD2 1 
ATOM   879  C  CE1 . PHE A 1 158 ? 18.963  -8.298  -19.397 1.00 68.67  ? 109 PHE A CE1 1 
ATOM   880  C  CE2 . PHE A 1 158 ? 20.262  -9.823  -20.726 1.00 61.98  ? 109 PHE A CE2 1 
ATOM   881  C  CZ  . PHE A 1 158 ? 20.132  -8.598  -20.090 1.00 65.54  ? 109 PHE A CZ  1 
ATOM   882  N  N   . ILE A 1 159 ? 14.492  -12.854 -17.627 1.00 83.23  ? 110 ILE A N   1 
ATOM   883  C  CA  . ILE A 1 159 ? 13.305  -13.716 -17.508 1.00 79.06  ? 110 ILE A CA  1 
ATOM   884  C  C   . ILE A 1 159 ? 12.233  -13.269 -18.491 1.00 74.51  ? 110 ILE A C   1 
ATOM   885  O  O   . ILE A 1 159 ? 12.081  -12.071 -18.743 1.00 67.11  ? 110 ILE A O   1 
ATOM   886  C  CB  . ILE A 1 159 ? 12.708  -13.667 -16.082 1.00 85.27  ? 110 ILE A CB  1 
ATOM   887  C  CG1 . ILE A 1 159 ? 13.821  -13.667 -15.016 1.00 86.94  ? 110 ILE A CG1 1 
ATOM   888  C  CG2 . ILE A 1 159 ? 11.746  -14.831 -15.864 1.00 80.30  ? 110 ILE A CG2 1 
ATOM   889  C  CD1 . ILE A 1 159 ? 13.583  -12.696 -13.871 1.00 89.16  ? 110 ILE A CD1 1 
ATOM   890  N  N   . ASN A 1 160 ? 11.488  -14.235 -19.030 1.00 77.37  ? 111 ASN A N   1 
ATOM   891  C  CA  . ASN A 1 160 ? 10.508  -13.984 -20.092 1.00 74.29  ? 111 ASN A CA  1 
ATOM   892  C  C   . ASN A 1 160 ? 9.432   -12.980 -19.711 1.00 74.93  ? 111 ASN A C   1 
ATOM   893  O  O   . ASN A 1 160 ? 8.662   -13.214 -18.785 1.00 71.81  ? 111 ASN A O   1 
ATOM   894  C  CB  . ASN A 1 160 ? 9.863   -15.295 -20.554 1.00 78.78  ? 111 ASN A CB  1 
ATOM   895  C  CG  . ASN A 1 160 ? 8.999   -15.120 -21.801 1.00 83.36  ? 111 ASN A CG  1 
ATOM   896  O  OD1 . ASN A 1 160 ? 9.148   -14.155 -22.559 1.00 88.16  ? 111 ASN A OD1 1 
ATOM   897  N  ND2 . ASN A 1 160 ? 8.093   -16.063 -22.019 1.00 84.48  ? 111 ASN A ND2 1 
ATOM   898  N  N   . GLY A 1 161 ? 9.395   -11.863 -20.441 1.00 81.91  ? 112 GLY A N   1 
ATOM   899  C  CA  . GLY A 1 161 ? 8.400   -10.806 -20.230 1.00 78.48  ? 112 GLY A CA  1 
ATOM   900  C  C   . GLY A 1 161 ? 8.428   -10.161 -18.857 1.00 78.94  ? 112 GLY A C   1 
ATOM   901  O  O   . GLY A 1 161 ? 7.373   -9.881  -18.289 1.00 78.92  ? 112 GLY A O   1 
ATOM   902  N  N   . SER A 1 162 ? 9.635   -9.932  -18.328 1.00 82.68  ? 113 SER A N   1 
ATOM   903  C  CA  . SER A 1 162 ? 9.848   -9.246  -17.037 1.00 76.85  ? 113 SER A CA  1 
ATOM   904  C  C   . SER A 1 162 ? 9.861   -7.717  -17.206 1.00 72.33  ? 113 SER A C   1 
ATOM   905  O  O   . SER A 1 162 ? 9.670   -6.972  -16.239 1.00 63.34  ? 113 SER A O   1 
ATOM   906  C  CB  . SER A 1 162 ? 11.161  -9.699  -16.386 1.00 78.17  ? 113 SER A CB  1 
ATOM   907  O  OG  . SER A 1 162 ? 12.274  -8.947  -16.870 1.00 78.21  ? 113 SER A OG  1 
ATOM   908  N  N   . ASN A 1 163 ? 10.109  -7.265  -18.436 1.00 64.56  ? 114 ASN A N   1 
ATOM   909  C  CA  . ASN A 1 163 ? 10.011  -5.848  -18.794 1.00 64.72  ? 114 ASN A CA  1 
ATOM   910  C  C   . ASN A 1 163 ? 11.217  -4.968  -18.490 1.00 62.00  ? 114 ASN A C   1 
ATOM   911  O  O   . ASN A 1 163 ? 11.213  -3.791  -18.879 1.00 59.94  ? 114 ASN A O   1 
ATOM   912  C  CB  . ASN A 1 163 ? 8.742   -5.208  -18.217 1.00 75.06  ? 114 ASN A CB  1 
ATOM   913  C  CG  . ASN A 1 163 ? 7.473   -5.887  -18.710 1.00 84.25  ? 114 ASN A CG  1 
ATOM   914  O  OD1 . ASN A 1 163 ? 7.290   -6.089  -19.924 1.00 88.46  ? 114 ASN A OD1 1 
ATOM   915  N  ND2 . ASN A 1 163 ? 6.584   -6.245  -17.770 1.00 77.61  ? 114 ASN A ND2 1 
ATOM   916  N  N   . TRP A 1 164 ? 12.236  -5.511  -17.811 1.00 55.89  ? 115 TRP A N   1 
ATOM   917  C  CA  . TRP A 1 164 ? 13.513  -4.781  -17.677 1.00 51.76  ? 115 TRP A CA  1 
ATOM   918  C  C   . TRP A 1 164 ? 14.663  -5.362  -18.525 1.00 50.87  ? 115 TRP A C   1 
ATOM   919  O  O   . TRP A 1 164 ? 14.694  -6.569  -18.841 1.00 47.32  ? 115 TRP A O   1 
ATOM   920  C  CB  . TRP A 1 164 ? 13.919  -4.557  -16.207 1.00 48.54  ? 115 TRP A CB  1 
ATOM   921  C  CG  . TRP A 1 164 ? 13.954  -5.794  -15.326 1.00 44.94  ? 115 TRP A CG  1 
ATOM   922  C  CD1 . TRP A 1 164 ? 12.986  -6.207  -14.450 1.00 46.05  ? 115 TRP A CD1 1 
ATOM   923  C  CD2 . TRP A 1 164 ? 15.021  -6.735  -15.211 1.00 44.07  ? 115 TRP A CD2 1 
ATOM   924  N  NE1 . TRP A 1 164 ? 13.375  -7.357  -13.824 1.00 42.92  ? 115 TRP A NE1 1 
ATOM   925  C  CE2 . TRP A 1 164 ? 14.622  -7.702  -14.268 1.00 43.84  ? 115 TRP A CE2 1 
ATOM   926  C  CE3 . TRP A 1 164 ? 16.277  -6.860  -15.825 1.00 46.13  ? 115 TRP A CE3 1 
ATOM   927  C  CZ2 . TRP A 1 164 ? 15.429  -8.777  -13.919 1.00 45.78  ? 115 TRP A CZ2 1 
ATOM   928  C  CZ3 . TRP A 1 164 ? 17.082  -7.934  -15.475 1.00 45.66  ? 115 TRP A CZ3 1 
ATOM   929  C  CH2 . TRP A 1 164 ? 16.647  -8.884  -14.538 1.00 45.96  ? 115 TRP A CH2 1 
ATOM   930  N  N   . GLU A 1 165 ? 15.596  -4.488  -18.895 1.00 48.90  ? 116 GLU A N   1 
ATOM   931  C  CA  . GLU A 1 165 ? 16.659  -4.846  -19.847 1.00 51.06  ? 116 GLU A CA  1 
ATOM   932  C  C   . GLU A 1 165 ? 18.049  -4.623  -19.273 1.00 50.29  ? 116 GLU A C   1 
ATOM   933  O  O   . GLU A 1 165 ? 19.041  -4.652  -19.997 1.00 49.14  ? 116 GLU A O   1 
ATOM   934  C  CB  . GLU A 1 165 ? 16.507  -4.072  -21.161 1.00 50.78  ? 116 GLU A CB  1 
ATOM   935  C  CG  . GLU A 1 165 ? 15.199  -4.319  -21.909 1.00 54.89  ? 116 GLU A CG  1 
ATOM   936  C  CD  . GLU A 1 165 ? 14.244  -3.128  -21.892 1.00 58.54  ? 116 GLU A CD  1 
ATOM   937  O  OE1 . GLU A 1 165 ? 13.137  -3.263  -22.450 1.00 64.71  ? 116 GLU A OE1 1 
ATOM   938  O  OE2 . GLU A 1 165 ? 14.585  -2.049  -21.351 1.00 59.44  ? 116 GLU A OE2 1 
ATOM   939  N  N   . GLY A 1 166 ? 18.112  -4.419  -17.965 1.00 47.96  ? 117 GLY A N   1 
ATOM   940  C  CA  . GLY A 1 166 ? 19.361  -4.108  -17.311 1.00 49.53  ? 117 GLY A CA  1 
ATOM   941  C  C   . GLY A 1 166 ? 19.153  -3.951  -15.822 1.00 49.70  ? 117 GLY A C   1 
ATOM   942  O  O   . GLY A 1 166 ? 18.019  -4.004  -15.346 1.00 50.31  ? 117 GLY A O   1 
ATOM   943  N  N   . ILE A 1 167 ? 20.256  -3.790  -15.094 1.00 47.41  ? 118 ILE A N   1 
ATOM   944  C  CA  . ILE A 1 167 ? 20.236  -3.747  -13.645 1.00 48.19  ? 118 ILE A CA  1 
ATOM   945  C  C   . ILE A 1 167 ? 21.077  -2.582  -13.149 1.00 47.00  ? 118 ILE A C   1 
ATOM   946  O  O   . ILE A 1 167 ? 22.128  -2.301  -13.697 1.00 46.62  ? 118 ILE A O   1 
ATOM   947  C  CB  . ILE A 1 167 ? 20.681  -5.083  -12.982 1.00 53.29  ? 118 ILE A CB  1 
ATOM   948  C  CG1 . ILE A 1 167 ? 22.101  -5.476  -13.372 1.00 55.79  ? 118 ILE A CG1 1 
ATOM   949  C  CG2 . ILE A 1 167 ? 19.724  -6.225  -13.324 1.00 54.09  ? 118 ILE A CG2 1 
ATOM   950  C  CD1 . ILE A 1 167 ? 22.683  -6.513  -12.426 1.00 65.13  ? 118 ILE A CD1 1 
ATOM   951  N  N   . LEU A 1 168 ? 20.569  -1.891  -12.133 1.00 43.41  ? 119 LEU A N   1 
ATOM   952  C  CA  . LEU A 1 168 ? 21.233  -0.769  -11.524 1.00 44.04  ? 119 LEU A CA  1 
ATOM   953  C  C   . LEU A 1 168 ? 21.605  -1.178  -10.094 1.00 45.83  ? 119 LEU A C   1 
ATOM   954  O  O   . LEU A 1 168 ? 20.753  -1.160  -9.182  1.00 47.58  ? 119 LEU A O   1 
ATOM   955  C  CB  . LEU A 1 168 ? 20.313  0.455   -11.524 1.00 42.76  ? 119 LEU A CB  1 
ATOM   956  C  CG  . LEU A 1 168 ? 20.908  1.742   -10.945 1.00 42.90  ? 119 LEU A CG  1 
ATOM   957  C  CD1 . LEU A 1 168 ? 22.087  2.221   -11.775 1.00 42.91  ? 119 LEU A CD1 1 
ATOM   958  C  CD2 . LEU A 1 168 ? 19.851  2.828   -10.854 1.00 44.52  ? 119 LEU A CD2 1 
ATOM   959  N  N   . GLY A 1 169 ? 22.867  -1.577  -9.920  1.00 46.67  ? 120 GLY A N   1 
ATOM   960  C  CA  . GLY A 1 169 ? 23.402  -1.985  -8.616  1.00 44.74  ? 120 GLY A CA  1 
ATOM   961  C  C   . GLY A 1 169 ? 23.683  -0.747  -7.784  1.00 45.65  ? 120 GLY A C   1 
ATOM   962  O  O   . GLY A 1 169 ? 24.551  0.075   -8.132  1.00 41.78  ? 120 GLY A O   1 
ATOM   963  N  N   . LEU A 1 170 ? 22.938  -0.597  -6.691  1.00 41.51  ? 121 LEU A N   1 
ATOM   964  C  CA  . LEU A 1 170 ? 23.023  0.626   -5.899  1.00 41.93  ? 121 LEU A CA  1 
ATOM   965  C  C   . LEU A 1 170 ? 23.879  0.477   -4.629  1.00 40.55  ? 121 LEU A C   1 
ATOM   966  O  O   . LEU A 1 170 ? 24.033  1.439   -3.876  1.00 39.44  ? 121 LEU A O   1 
ATOM   967  C  CB  . LEU A 1 170 ? 21.611  1.188   -5.592  1.00 43.14  ? 121 LEU A CB  1 
ATOM   968  C  CG  . LEU A 1 170 ? 20.832  1.785   -6.778  1.00 44.28  ? 121 LEU A CG  1 
ATOM   969  C  CD1 . LEU A 1 170 ? 19.349  1.928   -6.478  1.00 45.98  ? 121 LEU A CD1 1 
ATOM   970  C  CD2 . LEU A 1 170 ? 21.394  3.120   -7.258  1.00 45.11  ? 121 LEU A CD2 1 
ATOM   971  N  N   . ALA A 1 171 ? 24.436  -0.720  -4.402  1.00 38.38  ? 122 ALA A N   1 
ATOM   972  C  CA  . ALA A 1 171 ? 25.404  -0.945  -3.292  1.00 43.86  ? 122 ALA A CA  1 
ATOM   973  C  C   . ALA A 1 171 ? 26.849  -0.460  -3.616  1.00 46.31  ? 122 ALA A C   1 
ATOM   974  O  O   . ALA A 1 171 ? 27.153  -0.077  -4.757  1.00 44.78  ? 122 ALA A O   1 
ATOM   975  C  CB  . ALA A 1 171 ? 25.396  -2.415  -2.829  1.00 40.62  ? 122 ALA A CB  1 
ATOM   976  N  N   . TYR A 1 172 ? 27.733  -0.518  -2.619  1.00 45.27  ? 123 TYR A N   1 
ATOM   977  C  CA  . TYR A 1 172 ? 29.029  0.135   -2.677  1.00 45.43  ? 123 TYR A CA  1 
ATOM   978  C  C   . TYR A 1 172 ? 30.106  -0.567  -3.529  1.00 47.12  ? 123 TYR A C   1 
ATOM   979  O  O   . TYR A 1 172 ? 30.023  -1.784  -3.802  1.00 42.42  ? 123 TYR A O   1 
ATOM   980  C  CB  . TYR A 1 172 ? 29.527  0.317   -1.256  1.00 45.54  ? 123 TYR A CB  1 
ATOM   981  C  CG  . TYR A 1 172 ? 28.610  1.138   -0.381  1.00 43.78  ? 123 TYR A CG  1 
ATOM   982  C  CD1 . TYR A 1 172 ? 28.723  2.533   -0.338  1.00 48.12  ? 123 TYR A CD1 1 
ATOM   983  C  CD2 . TYR A 1 172 ? 27.644  0.528   0.425   1.00 41.64  ? 123 TYR A CD2 1 
ATOM   984  C  CE1 . TYR A 1 172 ? 27.893  3.306   0.487   1.00 46.85  ? 123 TYR A CE1 1 
ATOM   985  C  CE2 . TYR A 1 172 ? 26.821  1.277   1.256   1.00 41.17  ? 123 TYR A CE2 1 
ATOM   986  C  CZ  . TYR A 1 172 ? 26.944  2.669   1.280   1.00 47.65  ? 123 TYR A CZ  1 
ATOM   987  O  OH  . TYR A 1 172 ? 26.132  3.438   2.079   1.00 47.91  ? 123 TYR A OH  1 
ATOM   988  N  N   . ALA A 1 173 ? 31.128  0.209   -3.925  1.00 47.44  ? 124 ALA A N   1 
ATOM   989  C  CA  . ALA A 1 173 ? 32.228  -0.292  -4.799  1.00 48.22  ? 124 ALA A CA  1 
ATOM   990  C  C   . ALA A 1 173 ? 32.842  -1.645  -4.386  1.00 47.83  ? 124 ALA A C   1 
ATOM   991  O  O   . ALA A 1 173 ? 33.212  -2.442  -5.231  1.00 52.51  ? 124 ALA A O   1 
ATOM   992  C  CB  . ALA A 1 173 ? 33.309  0.768   -4.966  1.00 39.70  ? 124 ALA A CB  1 
ATOM   993  N  N   . GLU A 1 174 ? 32.914  -1.917  -3.085  1.00 53.81  ? 125 GLU A N   1 
ATOM   994  C  CA  . GLU A 1 174 ? 33.580  -3.120  -2.581  1.00 56.07  ? 125 GLU A CA  1 
ATOM   995  C  C   . GLU A 1 174 ? 33.086  -4.454  -3.159  1.00 57.13  ? 125 GLU A C   1 
ATOM   996  O  O   . GLU A 1 174 ? 33.818  -5.439  -3.126  1.00 56.94  ? 125 GLU A O   1 
ATOM   997  C  CB  . GLU A 1 174 ? 33.544  -3.170  -1.061  1.00 59.64  ? 125 GLU A CB  1 
ATOM   998  C  CG  . GLU A 1 174 ? 34.691  -3.979  -0.500  1.00 66.68  ? 125 GLU A CG  1 
ATOM   999  C  CD  . GLU A 1 174 ? 34.381  -4.550  0.853   1.00 76.48  ? 125 GLU A CD  1 
ATOM   1000 O  OE1 . GLU A 1 174 ? 34.266  -3.768  1.832   1.00 83.58  ? 125 GLU A OE1 1 
ATOM   1001 O  OE2 . GLU A 1 174 ? 34.265  -5.792  0.930   1.00 79.08  ? 125 GLU A OE2 1 
ATOM   1002 N  N   . ILE A 1 175 ? 31.857  -4.490  -3.675  1.00 56.55  ? 126 ILE A N   1 
ATOM   1003 C  CA  . ILE A 1 175 ? 31.313  -5.720  -4.289  1.00 51.57  ? 126 ILE A CA  1 
ATOM   1004 C  C   . ILE A 1 175 ? 31.041  -5.533  -5.793  1.00 51.66  ? 126 ILE A C   1 
ATOM   1005 O  O   . ILE A 1 175 ? 30.405  -6.393  -6.424  1.00 46.56  ? 126 ILE A O   1 
ATOM   1006 C  CB  . ILE A 1 175 ? 30.037  -6.264  -3.568  1.00 49.99  ? 126 ILE A CB  1 
ATOM   1007 C  CG1 . ILE A 1 175 ? 28.902  -5.228  -3.608  1.00 52.82  ? 126 ILE A CG1 1 
ATOM   1008 C  CG2 . ILE A 1 175 ? 30.344  -6.702  -2.138  1.00 49.08  ? 126 ILE A CG2 1 
ATOM   1009 C  CD1 . ILE A 1 175 ? 27.517  -5.782  -3.311  1.00 53.31  ? 126 ILE A CD1 1 
ATOM   1010 N  N   . ALA A 1 176 ? 31.513  -4.415  -6.363  1.00 47.70  ? 127 ALA A N   1 
ATOM   1011 C  CA  . ALA A 1 176 ? 31.451  -4.220  -7.817  1.00 47.15  ? 127 ALA A CA  1 
ATOM   1012 C  C   . ALA A 1 176 ? 32.344  -5.263  -8.507  1.00 47.34  ? 127 ALA A C   1 
ATOM   1013 O  O   . ALA A 1 176 ? 33.365  -5.660  -7.951  1.00 52.78  ? 127 ALA A O   1 
ATOM   1014 C  CB  . ALA A 1 176 ? 31.877  -2.805  -8.202  1.00 42.35  ? 127 ALA A CB  1 
ATOM   1015 N  N   . ARG A 1 177 ? 31.949  -5.723  -9.693  1.00 50.29  ? 128 ARG A N   1 
ATOM   1016 C  CA  . ARG A 1 177 ? 32.760  -6.655  -10.486 1.00 53.72  ? 128 ARG A CA  1 
ATOM   1017 C  C   . ARG A 1 177 ? 33.339  -5.899  -11.674 1.00 54.35  ? 128 ARG A C   1 
ATOM   1018 O  O   . ARG A 1 177 ? 32.647  -5.056  -12.242 1.00 53.69  ? 128 ARG A O   1 
ATOM   1019 C  CB  . ARG A 1 177 ? 31.922  -7.819  -11.015 1.00 55.68  ? 128 ARG A CB  1 
ATOM   1020 C  CG  . ARG A 1 177 ? 30.912  -8.390  -10.047 1.00 63.99  ? 128 ARG A CG  1 
ATOM   1021 C  CD  . ARG A 1 177 ? 31.560  -9.390  -9.114  1.00 76.78  ? 128 ARG A CD  1 
ATOM   1022 N  NE  . ARG A 1 177 ? 31.867  -10.641 -9.798  1.00 91.82  ? 128 ARG A NE  1 
ATOM   1023 C  CZ  . ARG A 1 177 ? 32.476  -11.678 -9.227  1.00 105.07 ? 128 ARG A CZ  1 
ATOM   1024 N  NH1 . ARG A 1 177 ? 32.846  -11.617 -7.950  1.00 105.55 ? 128 ARG A NH1 1 
ATOM   1025 N  NH2 . ARG A 1 177 ? 32.712  -12.782 -9.932  1.00 108.76 ? 128 ARG A NH2 1 
ATOM   1026 N  N   . PRO A 1 178 ? 34.592  -6.201  -12.076 1.00 54.72  ? 129 PRO A N   1 
ATOM   1027 C  CA  . PRO A 1 178 ? 35.523  -7.231  -11.555 1.00 55.54  ? 129 PRO A CA  1 
ATOM   1028 C  C   . PRO A 1 178 ? 36.227  -6.918  -10.221 1.00 55.17  ? 129 PRO A C   1 
ATOM   1029 O  O   . PRO A 1 178 ? 36.675  -7.851  -9.554  1.00 53.33  ? 129 PRO A O   1 
ATOM   1030 C  CB  . PRO A 1 178 ? 36.567  -7.384  -12.671 1.00 55.74  ? 129 PRO A CB  1 
ATOM   1031 C  CG  . PRO A 1 178 ? 36.435  -6.173  -13.529 1.00 55.51  ? 129 PRO A CG  1 
ATOM   1032 C  CD  . PRO A 1 178 ? 35.155  -5.455  -13.218 1.00 52.15  ? 129 PRO A CD  1 
ATOM   1033 N  N   . ASP A 1 179 ? 36.315  -5.641  -9.839  1.00 50.14  ? 130 ASP A N   1 
ATOM   1034 C  CA  . ASP A 1 179 ? 36.955  -5.224  -8.578  1.00 53.98  ? 130 ASP A CA  1 
ATOM   1035 C  C   . ASP A 1 179 ? 36.408  -3.861  -8.151  1.00 54.31  ? 130 ASP A C   1 
ATOM   1036 O  O   . ASP A 1 179 ? 35.598  -3.275  -8.863  1.00 56.14  ? 130 ASP A O   1 
ATOM   1037 C  CB  . ASP A 1 179 ? 38.463  -5.130  -8.752  1.00 53.16  ? 130 ASP A CB  1 
ATOM   1038 C  CG  . ASP A 1 179 ? 38.841  -4.348  -9.991  1.00 63.24  ? 130 ASP A CG  1 
ATOM   1039 O  OD1 . ASP A 1 179 ? 38.707  -3.098  -9.989  1.00 54.23  ? 130 ASP A OD1 1 
ATOM   1040 O  OD2 . ASP A 1 179 ? 39.244  -5.000  -10.981 1.00 70.76  ? 130 ASP A OD2 1 
ATOM   1041 N  N   . ASP A 1 180 ? 36.861  -3.350  -7.011  1.00 49.96  ? 131 ASP A N   1 
ATOM   1042 C  CA  . ASP A 1 180 ? 36.298  -2.116  -6.461  1.00 48.88  ? 131 ASP A CA  1 
ATOM   1043 C  C   . ASP A 1 180 ? 36.743  -0.846  -7.190  1.00 49.87  ? 131 ASP A C   1 
ATOM   1044 O  O   . ASP A 1 180 ? 36.270  0.257   -6.889  1.00 49.39  ? 131 ASP A O   1 
ATOM   1045 C  CB  . ASP A 1 180 ? 36.523  -2.000  -4.936  1.00 49.69  ? 131 ASP A CB  1 
ATOM   1046 C  CG  . ASP A 1 180 ? 37.999  -2.017  -4.535  1.00 52.35  ? 131 ASP A CG  1 
ATOM   1047 O  OD1 . ASP A 1 180 ? 38.908  -1.966  -5.414  1.00 50.26  ? 131 ASP A OD1 1 
ATOM   1048 O  OD2 . ASP A 1 180 ? 38.242  -2.060  -3.311  1.00 52.91  ? 131 ASP A OD2 1 
ATOM   1049 N  N   . SER A 1 181 ? 37.633  -0.996  -8.164  1.00 50.10  ? 132 SER A N   1 
ATOM   1050 C  CA  . SER A 1 181 ? 38.067  0.160   -8.933  1.00 49.19  ? 132 SER A CA  1 
ATOM   1051 C  C   . SER A 1 181 ? 36.955  0.618   -9.876  1.00 48.94  ? 132 SER A C   1 
ATOM   1052 O  O   . SER A 1 181 ? 36.914  1.789   -10.260 1.00 51.53  ? 132 SER A O   1 
ATOM   1053 C  CB  . SER A 1 181 ? 39.363  -0.125  -9.695  1.00 50.80  ? 132 SER A CB  1 
ATOM   1054 O  OG  . SER A 1 181 ? 39.140  -1.100  -10.712 1.00 53.93  ? 132 SER A OG  1 
ATOM   1055 N  N   . LEU A 1 182 ? 36.039  -0.292  -10.220 1.00 48.16  ? 133 LEU A N   1 
ATOM   1056 C  CA  . LEU A 1 182 ? 34.900  0.052   -11.066 1.00 47.37  ? 133 LEU A CA  1 
ATOM   1057 C  C   . LEU A 1 182 ? 33.800  0.845   -10.328 1.00 50.55  ? 133 LEU A C   1 
ATOM   1058 O  O   . LEU A 1 182 ? 32.958  0.270   -9.636  1.00 56.10  ? 133 LEU A O   1 
ATOM   1059 C  CB  . LEU A 1 182 ? 34.317  -1.191  -11.704 1.00 46.92  ? 133 LEU A CB  1 
ATOM   1060 C  CG  . LEU A 1 182 ? 33.398  -0.820  -12.880 1.00 48.12  ? 133 LEU A CG  1 
ATOM   1061 C  CD1 . LEU A 1 182 ? 34.215  -0.454  -14.116 1.00 44.86  ? 133 LEU A CD1 1 
ATOM   1062 C  CD2 . LEU A 1 182 ? 32.443  -1.959  -13.191 1.00 45.82  ? 133 LEU A CD2 1 
ATOM   1063 N  N   . GLU A 1 183 ? 33.813  2.165   -10.495 1.00 46.67  ? 134 GLU A N   1 
ATOM   1064 C  CA  . GLU A 1 183 ? 32.937  3.059   -9.759  1.00 48.60  ? 134 GLU A CA  1 
ATOM   1065 C  C   . GLU A 1 183 ? 31.473  2.797   -10.090 1.00 53.14  ? 134 GLU A C   1 
ATOM   1066 O  O   . GLU A 1 183 ? 31.093  2.893   -11.269 1.00 51.80  ? 134 GLU A O   1 
ATOM   1067 C  CB  . GLU A 1 183 ? 33.273  4.514   -10.078 1.00 47.21  ? 134 GLU A CB  1 
ATOM   1068 C  CG  . GLU A 1 183 ? 32.789  5.480   -9.011  1.00 51.56  ? 134 GLU A CG  1 
ATOM   1069 C  CD  . GLU A 1 183 ? 33.041  6.932   -9.369  1.00 51.38  ? 134 GLU A CD  1 
ATOM   1070 O  OE1 . GLU A 1 183 ? 33.811  7.593   -8.638  1.00 55.92  ? 134 GLU A OE1 1 
ATOM   1071 O  OE2 . GLU A 1 183 ? 32.475  7.413   -10.374 1.00 46.93  ? 134 GLU A OE2 1 
ATOM   1072 N  N   . PRO A 1 184 ? 30.654  2.460   -9.053  1.00 51.70  ? 135 PRO A N   1 
ATOM   1073 C  CA  . PRO A 1 184 ? 29.203  2.219   -9.180  1.00 47.82  ? 135 PRO A CA  1 
ATOM   1074 C  C   . PRO A 1 184 ? 28.466  3.491   -9.581  1.00 47.97  ? 135 PRO A C   1 
ATOM   1075 O  O   . PRO A 1 184 ? 28.918  4.598   -9.244  1.00 48.39  ? 135 PRO A O   1 
ATOM   1076 C  CB  . PRO A 1 184 ? 28.781  1.798   -7.768  1.00 49.23  ? 135 PRO A CB  1 
ATOM   1077 C  CG  . PRO A 1 184 ? 30.036  1.317   -7.123  1.00 51.51  ? 135 PRO A CG  1 
ATOM   1078 C  CD  . PRO A 1 184 ? 31.116  2.209   -7.675  1.00 49.74  ? 135 PRO A CD  1 
ATOM   1079 N  N   . PHE A 1 185 ? 27.352  3.329   -10.300 1.00 43.70  ? 136 PHE A N   1 
ATOM   1080 C  CA  . PHE A 1 185 ? 26.603  4.452   -10.833 1.00 43.14  ? 136 PHE A CA  1 
ATOM   1081 C  C   . PHE A 1 185 ? 26.302  5.574   -9.820  1.00 45.27  ? 136 PHE A C   1 
ATOM   1082 O  O   . PHE A 1 185 ? 26.534  6.748   -10.129 1.00 44.15  ? 136 PHE A O   1 
ATOM   1083 C  CB  . PHE A 1 185 ? 25.309  3.968   -11.511 1.00 44.95  ? 136 PHE A CB  1 
ATOM   1084 C  CG  . PHE A 1 185 ? 24.410  5.093   -11.928 1.00 45.50  ? 136 PHE A CG  1 
ATOM   1085 C  CD1 . PHE A 1 185 ? 24.568  5.697   -13.165 1.00 46.94  ? 136 PHE A CD1 1 
ATOM   1086 C  CD2 . PHE A 1 185 ? 23.432  5.594   -11.061 1.00 46.63  ? 136 PHE A CD2 1 
ATOM   1087 C  CE1 . PHE A 1 185 ? 23.765  6.765   -13.540 1.00 46.90  ? 136 PHE A CE1 1 
ATOM   1088 C  CE2 . PHE A 1 185 ? 22.625  6.671   -11.431 1.00 44.62  ? 136 PHE A CE2 1 
ATOM   1089 C  CZ  . PHE A 1 185 ? 22.791  7.251   -12.672 1.00 45.39  ? 136 PHE A CZ  1 
ATOM   1090 N  N   . PHE A 1 186 ? 25.781  5.222   -8.631  1.00 46.64  ? 137 PHE A N   1 
ATOM   1091 C  CA  . PHE A 1 186 ? 25.419  6.217   -7.612  1.00 45.74  ? 137 PHE A CA  1 
ATOM   1092 C  C   . PHE A 1 186 ? 26.636  7.065   -7.142  1.00 48.70  ? 137 PHE A C   1 
ATOM   1093 O  O   . PHE A 1 186 ? 26.519  8.281   -6.903  1.00 48.40  ? 137 PHE A O   1 
ATOM   1094 C  CB  . PHE A 1 186 ? 24.613  5.599   -6.440  1.00 44.78  ? 137 PHE A CB  1 
ATOM   1095 C  CG  . PHE A 1 186 ? 23.717  6.588   -5.751  1.00 44.57  ? 137 PHE A CG  1 
ATOM   1096 C  CD1 . PHE A 1 186 ? 22.455  6.896   -6.269  1.00 46.40  ? 137 PHE A CD1 1 
ATOM   1097 C  CD2 . PHE A 1 186 ? 24.149  7.272   -4.620  1.00 46.92  ? 137 PHE A CD2 1 
ATOM   1098 C  CE1 . PHE A 1 186 ? 21.637  7.851   -5.657  1.00 45.32  ? 137 PHE A CE1 1 
ATOM   1099 C  CE2 . PHE A 1 186 ? 23.327  8.222   -3.991  1.00 49.37  ? 137 PHE A CE2 1 
ATOM   1100 C  CZ  . PHE A 1 186 ? 22.072  8.513   -4.515  1.00 48.38  ? 137 PHE A CZ  1 
ATOM   1101 N  N   . ASP A 1 187 ? 27.809  6.444   -7.056  1.00 52.86  ? 138 ASP A N   1 
ATOM   1102 C  CA  . ASP A 1 187 ? 29.061  7.188   -6.783  1.00 54.49  ? 138 ASP A CA  1 
ATOM   1103 C  C   . ASP A 1 187 ? 29.364  8.217   -7.877  1.00 53.57  ? 138 ASP A C   1 
ATOM   1104 O  O   . ASP A 1 187 ? 29.673  9.378   -7.574  1.00 51.12  ? 138 ASP A O   1 
ATOM   1105 C  CB  . ASP A 1 187 ? 30.242  6.238   -6.577  1.00 52.29  ? 138 ASP A CB  1 
ATOM   1106 C  CG  . ASP A 1 187 ? 30.051  5.340   -5.369  1.00 57.01  ? 138 ASP A CG  1 
ATOM   1107 O  OD1 . ASP A 1 187 ? 29.455  4.248   -5.490  1.00 55.66  ? 138 ASP A OD1 1 
ATOM   1108 O  OD2 . ASP A 1 187 ? 30.493  5.733   -4.276  1.00 64.63  ? 138 ASP A OD2 1 
ATOM   1109 N  N   . SER A 1 188 ? 29.245  7.804   -9.140  1.00 49.81  ? 139 SER A N   1 
ATOM   1110 C  CA  . SER A 1 188 ? 29.452  8.718   -10.268 1.00 44.83  ? 139 SER A CA  1 
ATOM   1111 C  C   . SER A 1 188 ? 28.511  9.900   -10.179 1.00 47.69  ? 139 SER A C   1 
ATOM   1112 O  O   . SER A 1 188 ? 28.934  11.043  -10.328 1.00 51.06  ? 139 SER A O   1 
ATOM   1113 C  CB  . SER A 1 188 ? 29.256  7.997   -11.597 1.00 41.81  ? 139 SER A CB  1 
ATOM   1114 O  OG  . SER A 1 188 ? 30.201  6.960   -11.715 1.00 42.68  ? 139 SER A OG  1 
ATOM   1115 N  N   . LEU A 1 189 ? 27.235  9.610   -9.931  1.00 49.64  ? 140 LEU A N   1 
ATOM   1116 C  CA  . LEU A 1 189 ? 26.201  10.624  -9.825  1.00 50.81  ? 140 LEU A CA  1 
ATOM   1117 C  C   . LEU A 1 189 ? 26.525  11.651  -8.756  1.00 51.78  ? 140 LEU A C   1 
ATOM   1118 O  O   . LEU A 1 189 ? 26.413  12.847  -8.998  1.00 55.01  ? 140 LEU A O   1 
ATOM   1119 C  CB  . LEU A 1 189 ? 24.859  9.974   -9.515  1.00 54.39  ? 140 LEU A CB  1 
ATOM   1120 C  CG  . LEU A 1 189 ? 23.651  10.911  -9.463  1.00 58.27  ? 140 LEU A CG  1 
ATOM   1121 C  CD1 . LEU A 1 189 ? 23.259  11.414  -10.850 1.00 56.41  ? 140 LEU A CD1 1 
ATOM   1122 C  CD2 . LEU A 1 189 ? 22.489  10.199  -8.801  1.00 57.79  ? 140 LEU A CD2 1 
ATOM   1123 N  N   . VAL A 1 190 ? 26.928  11.176  -7.580  1.00 53.17  ? 141 VAL A N   1 
ATOM   1124 C  CA  . VAL A 1 190 ? 27.224  12.045  -6.433  1.00 53.56  ? 141 VAL A CA  1 
ATOM   1125 C  C   . VAL A 1 190 ? 28.510  12.876  -6.632  1.00 56.01  ? 141 VAL A C   1 
ATOM   1126 O  O   . VAL A 1 190 ? 28.545  14.052  -6.255  1.00 62.00  ? 141 VAL A O   1 
ATOM   1127 C  CB  . VAL A 1 190 ? 27.192  11.245  -5.096  1.00 53.19  ? 141 VAL A CB  1 
ATOM   1128 C  CG1 . VAL A 1 190 ? 27.933  11.961  -3.987  1.00 50.21  ? 141 VAL A CG1 1 
ATOM   1129 C  CG2 . VAL A 1 190 ? 25.752  10.981  -4.670  1.00 50.78  ? 141 VAL A CG2 1 
ATOM   1130 N  N   . LYS A 1 191 ? 29.539  12.277  -7.239  1.00 56.70  ? 142 LYS A N   1 
ATOM   1131 C  CA  . LYS A 1 191 ? 30.775  12.990  -7.621  1.00 57.75  ? 142 LYS A CA  1 
ATOM   1132 C  C   . LYS A 1 191 ? 30.561  14.060  -8.677  1.00 57.94  ? 142 LYS A C   1 
ATOM   1133 O  O   . LYS A 1 191 ? 31.144  15.141  -8.605  1.00 61.17  ? 142 LYS A O   1 
ATOM   1134 C  CB  . LYS A 1 191 ? 31.840  12.021  -8.132  1.00 60.35  ? 142 LYS A CB  1 
ATOM   1135 C  CG  . LYS A 1 191 ? 33.057  11.906  -7.236  1.00 66.47  ? 142 LYS A CG  1 
ATOM   1136 C  CD  . LYS A 1 191 ? 33.953  10.760  -7.684  1.00 75.36  ? 142 LYS A CD  1 
ATOM   1137 C  CE  . LYS A 1 191 ? 35.306  10.811  -6.991  1.00 82.14  ? 142 LYS A CE  1 
ATOM   1138 N  NZ  . LYS A 1 191 ? 35.192  10.728  -5.506  1.00 79.69  ? 142 LYS A NZ  1 
ATOM   1139 N  N   . GLN A 1 192 ? 29.718  13.756  -9.653  1.00 59.94  ? 143 GLN A N   1 
ATOM   1140 C  CA  . GLN A 1 192 ? 29.539  14.619  -10.821 1.00 58.11  ? 143 GLN A CA  1 
ATOM   1141 C  C   . GLN A 1 192 ? 28.442  15.698  -10.746 1.00 59.14  ? 143 GLN A C   1 
ATOM   1142 O  O   . GLN A 1 192 ? 28.379  16.575  -11.608 1.00 60.84  ? 143 GLN A O   1 
ATOM   1143 C  CB  . GLN A 1 192 ? 29.372  13.753  -12.070 1.00 54.90  ? 143 GLN A CB  1 
ATOM   1144 C  CG  . GLN A 1 192 ? 30.638  12.982  -12.394 1.00 51.85  ? 143 GLN A CG  1 
ATOM   1145 C  CD  . GLN A 1 192 ? 30.451  12.012  -13.526 1.00 54.41  ? 143 GLN A CD  1 
ATOM   1146 O  OE1 . GLN A 1 192 ? 29.913  12.358  -14.578 1.00 55.38  ? 143 GLN A OE1 1 
ATOM   1147 N  NE2 . GLN A 1 192 ? 30.898  10.779  -13.318 1.00 53.99  ? 143 GLN A NE2 1 
ATOM   1148 N  N   . THR A 1 193 ? 27.583  15.638  -9.734  1.00 58.86  ? 144 THR A N   1 
ATOM   1149 C  CA  . THR A 1 193 ? 26.478  16.597  -9.611  1.00 60.13  ? 144 THR A CA  1 
ATOM   1150 C  C   . THR A 1 193 ? 26.344  17.114  -8.177  1.00 60.95  ? 144 THR A C   1 
ATOM   1151 O  O   . THR A 1 193 ? 27.166  16.806  -7.306  1.00 59.65  ? 144 THR A O   1 
ATOM   1152 C  CB  . THR A 1 193 ? 25.118  15.989  -10.039 1.00 59.54  ? 144 THR A CB  1 
ATOM   1153 O  OG1 . THR A 1 193 ? 24.654  15.093  -9.023  1.00 64.30  ? 144 THR A OG1 1 
ATOM   1154 C  CG2 . THR A 1 193 ? 25.230  15.233  -11.336 1.00 53.92  ? 144 THR A CG2 1 
ATOM   1155 N  N   . HIS A 1 194 ? 25.290  17.890  -7.937  1.00 66.50  ? 145 HIS A N   1 
ATOM   1156 C  CA  . HIS A 1 194 ? 24.988  18.374  -6.590  1.00 71.76  ? 145 HIS A CA  1 
ATOM   1157 C  C   . HIS A 1 194 ? 23.879  17.560  -5.897  1.00 67.94  ? 145 HIS A C   1 
ATOM   1158 O  O   . HIS A 1 194 ? 23.198  18.065  -4.994  1.00 66.81  ? 145 HIS A O   1 
ATOM   1159 C  CB  . HIS A 1 194 ? 24.651  19.879  -6.612  1.00 80.73  ? 145 HIS A CB  1 
ATOM   1160 C  CG  . HIS A 1 194 ? 25.845  20.765  -6.819  1.00 84.35  ? 145 HIS A CG  1 
ATOM   1161 N  ND1 . HIS A 1 194 ? 25.986  21.585  -7.922  1.00 79.63  ? 145 HIS A ND1 1 
ATOM   1162 C  CD2 . HIS A 1 194 ? 26.957  20.951  -6.067  1.00 84.73  ? 145 HIS A CD2 1 
ATOM   1163 C  CE1 . HIS A 1 194 ? 27.131  22.239  -7.841  1.00 83.68  ? 145 HIS A CE1 1 
ATOM   1164 N  NE2 . HIS A 1 194 ? 27.739  21.872  -6.725  1.00 86.18  ? 145 HIS A NE2 1 
ATOM   1165 N  N   . VAL A 1 195 ? 23.721  16.299  -6.307  1.00 59.97  ? 146 VAL A N   1 
ATOM   1166 C  CA  . VAL A 1 195 ? 22.696  15.428  -5.756  1.00 55.92  ? 146 VAL A CA  1 
ATOM   1167 C  C   . VAL A 1 195 ? 23.219  14.854  -4.444  1.00 59.78  ? 146 VAL A C   1 
ATOM   1168 O  O   . VAL A 1 195 ? 24.302  14.254  -4.423  1.00 65.47  ? 146 VAL A O   1 
ATOM   1169 C  CB  . VAL A 1 195 ? 22.327  14.298  -6.735  1.00 58.07  ? 146 VAL A CB  1 
ATOM   1170 C  CG1 . VAL A 1 195 ? 21.392  13.301  -6.081  1.00 53.72  ? 146 VAL A CG1 1 
ATOM   1171 C  CG2 . VAL A 1 195 ? 21.685  14.867  -7.994  1.00 56.93  ? 146 VAL A CG2 1 
ATOM   1172 N  N   . PRO A 1 196 ? 22.465  15.044  -3.339  1.00 51.89  ? 147 PRO A N   1 
ATOM   1173 C  CA  . PRO A 1 196 ? 22.945  14.571  -2.045  1.00 52.73  ? 147 PRO A CA  1 
ATOM   1174 C  C   . PRO A 1 196 ? 23.147  13.045  -2.009  1.00 54.27  ? 147 PRO A C   1 
ATOM   1175 O  O   . PRO A 1 196 ? 22.516  12.303  -2.769  1.00 51.16  ? 147 PRO A O   1 
ATOM   1176 C  CB  . PRO A 1 196 ? 21.845  15.012  -1.073  1.00 54.01  ? 147 PRO A CB  1 
ATOM   1177 C  CG  . PRO A 1 196 ? 21.098  16.085  -1.792  1.00 52.50  ? 147 PRO A CG  1 
ATOM   1178 C  CD  . PRO A 1 196 ? 21.154  15.709  -3.235  1.00 50.78  ? 147 PRO A CD  1 
ATOM   1179 N  N   . ASN A 1 197 ? 24.039  12.589  -1.137  1.00 54.29  ? 148 ASN A N   1 
ATOM   1180 C  CA  . ASN A 1 197 ? 24.390  11.183  -1.094  1.00 51.17  ? 148 ASN A CA  1 
ATOM   1181 C  C   . ASN A 1 197 ? 23.357  10.411  -0.257  1.00 53.01  ? 148 ASN A C   1 
ATOM   1182 O  O   . ASN A 1 197 ? 23.585  10.053  0.906   1.00 55.08  ? 148 ASN A O   1 
ATOM   1183 C  CB  . ASN A 1 197 ? 25.814  11.014  -0.578  1.00 46.52  ? 148 ASN A CB  1 
ATOM   1184 C  CG  . ASN A 1 197 ? 26.341  9.619   -0.781  1.00 52.69  ? 148 ASN A CG  1 
ATOM   1185 O  OD1 . ASN A 1 197 ? 25.861  8.877   -1.654  1.00 53.64  ? 148 ASN A OD1 1 
ATOM   1186 N  ND2 . ASN A 1 197 ? 27.332  9.236   0.034   1.00 49.90  ? 148 ASN A ND2 1 
ATOM   1187 N  N   . LEU A 1 198 ? 22.210  10.160  -0.882  1.00 52.16  ? 149 LEU A N   1 
ATOM   1188 C  CA  . LEU A 1 198 ? 21.055  9.592   -0.216  1.00 47.10  ? 149 LEU A CA  1 
ATOM   1189 C  C   . LEU A 1 198 ? 20.035  9.233   -1.291  1.00 50.49  ? 149 LEU A C   1 
ATOM   1190 O  O   . LEU A 1 198 ? 19.779  10.039  -2.186  1.00 48.94  ? 149 LEU A O   1 
ATOM   1191 C  CB  . LEU A 1 198 ? 20.476  10.646  0.737   1.00 47.57  ? 149 LEU A CB  1 
ATOM   1192 C  CG  . LEU A 1 198 ? 19.231  10.359  1.549   1.00 46.04  ? 149 LEU A CG  1 
ATOM   1193 C  CD1 . LEU A 1 198 ? 19.361  10.978  2.915   1.00 46.57  ? 149 LEU A CD1 1 
ATOM   1194 C  CD2 . LEU A 1 198 ? 18.034  10.919  0.833   1.00 48.10  ? 149 LEU A CD2 1 
ATOM   1195 N  N   . PHE A 1 199 ? 19.473  8.026   -1.224  1.00 48.36  ? 150 PHE A N   1 
ATOM   1196 C  CA  . PHE A 1 199 ? 18.261  7.707   -1.982  1.00 45.53  ? 150 PHE A CA  1 
ATOM   1197 C  C   . PHE A 1 199 ? 17.243  6.956   -1.102  1.00 46.46  ? 150 PHE A C   1 
ATOM   1198 O  O   . PHE A 1 199 ? 17.595  6.421   -0.042  1.00 47.01  ? 150 PHE A O   1 
ATOM   1199 C  CB  . PHE A 1 199 ? 18.572  6.972   -3.314  1.00 44.09  ? 150 PHE A CB  1 
ATOM   1200 C  CG  . PHE A 1 199 ? 19.034  5.545   -3.140  1.00 45.47  ? 150 PHE A CG  1 
ATOM   1201 C  CD1 . PHE A 1 199 ? 20.368  5.261   -2.874  1.00 45.65  ? 150 PHE A CD1 1 
ATOM   1202 C  CD2 . PHE A 1 199 ? 18.135  4.488   -3.221  1.00 42.83  ? 150 PHE A CD2 1 
ATOM   1203 C  CE1 . PHE A 1 199 ? 20.788  3.949   -2.687  1.00 45.09  ? 150 PHE A CE1 1 
ATOM   1204 C  CE2 . PHE A 1 199 ? 18.553  3.182   -3.044  1.00 40.71  ? 150 PHE A CE2 1 
ATOM   1205 C  CZ  . PHE A 1 199 ? 19.876  2.912   -2.779  1.00 42.23  ? 150 PHE A CZ  1 
ATOM   1206 N  N   . SER A 1 200 ? 15.986  6.923   -1.549  1.00 45.60  ? 151 SER A N   1 
ATOM   1207 C  CA  . SER A 1 200 ? 14.912  6.274   -0.813  1.00 42.60  ? 151 SER A CA  1 
ATOM   1208 C  C   . SER A 1 200 ? 13.928  5.561   -1.741  1.00 45.78  ? 151 SER A C   1 
ATOM   1209 O  O   . SER A 1 200 ? 13.630  6.024   -2.847  1.00 45.47  ? 151 SER A O   1 
ATOM   1210 C  CB  . SER A 1 200 ? 14.194  7.274   0.086   1.00 46.29  ? 151 SER A CB  1 
ATOM   1211 O  OG  . SER A 1 200 ? 13.749  8.407   -0.635  1.00 44.19  ? 151 SER A OG  1 
ATOM   1212 N  N   . LEU A 1 201 ? 13.448  4.408   -1.274  1.00 46.34  ? 152 LEU A N   1 
ATOM   1213 C  CA  . LEU A 1 201 ? 12.649  3.492   -2.066  1.00 43.85  ? 152 LEU A CA  1 
ATOM   1214 C  C   . LEU A 1 201 ? 11.307  3.262   -1.413  1.00 45.40  ? 152 LEU A C   1 
ATOM   1215 O  O   . LEU A 1 201 ? 11.223  2.976   -0.205  1.00 42.93  ? 152 LEU A O   1 
ATOM   1216 C  CB  . LEU A 1 201 ? 13.373  2.149   -2.231  1.00 43.35  ? 152 LEU A CB  1 
ATOM   1217 C  CG  . LEU A 1 201 ? 14.511  2.170   -3.262  1.00 44.62  ? 152 LEU A CG  1 
ATOM   1218 C  CD1 . LEU A 1 201 ? 15.279  0.860   -3.215  1.00 42.10  ? 152 LEU A CD1 1 
ATOM   1219 C  CD2 . LEU A 1 201 ? 13.978  2.423   -4.662  1.00 42.15  ? 152 LEU A CD2 1 
ATOM   1220 N  N   . GLN A 1 202 ? 10.257  3.418   -2.220  1.00 46.83  ? 153 GLN A N   1 
ATOM   1221 C  CA  . GLN A 1 202 ? 8.911   2.990   -1.853  1.00 47.04  ? 153 GLN A CA  1 
ATOM   1222 C  C   . GLN A 1 202 ? 8.477   1.962   -2.883  1.00 46.05  ? 153 GLN A C   1 
ATOM   1223 O  O   . GLN A 1 202 ? 8.071   2.319   -3.975  1.00 47.93  ? 153 GLN A O   1 
ATOM   1224 C  CB  . GLN A 1 202 ? 7.928   4.163   -1.840  1.00 47.57  ? 153 GLN A CB  1 
ATOM   1225 C  CG  . GLN A 1 202 ? 6.572   3.779   -1.264  1.00 52.17  ? 153 GLN A CG  1 
ATOM   1226 C  CD  . GLN A 1 202 ? 5.443   4.717   -1.684  1.00 54.33  ? 153 GLN A CD  1 
ATOM   1227 O  OE1 . GLN A 1 202 ? 5.272   5.028   -2.874  1.00 48.38  ? 153 GLN A OE1 1 
ATOM   1228 N  NE2 . GLN A 1 202 ? 4.648   5.164   -0.695  1.00 52.69  ? 153 GLN A NE2 1 
ATOM   1229 N  N   . LEU A 1 203 ? 8.600   0.684   -2.562  1.00 43.42  ? 154 LEU A N   1 
ATOM   1230 C  CA  . LEU A 1 203 ? 8.137   -0.331  -3.487  1.00 40.53  ? 154 LEU A CA  1 
ATOM   1231 C  C   . LEU A 1 203 ? 6.688   -0.685  -3.126  1.00 43.00  ? 154 LEU A C   1 
ATOM   1232 O  O   . LEU A 1 203 ? 6.385   -0.982  -1.967  1.00 50.02  ? 154 LEU A O   1 
ATOM   1233 C  CB  . LEU A 1 203 ? 9.045   -1.551  -3.427  1.00 41.44  ? 154 LEU A CB  1 
ATOM   1234 C  CG  . LEU A 1 203 ? 10.562  -1.330  -3.537  1.00 42.25  ? 154 LEU A CG  1 
ATOM   1235 C  CD1 . LEU A 1 203 ? 11.293  -2.658  -3.448  1.00 39.19  ? 154 LEU A CD1 1 
ATOM   1236 C  CD2 . LEU A 1 203 ? 10.920  -0.585  -4.814  1.00 40.70  ? 154 LEU A CD2 1 
ATOM   1237 N  N   . CYS A 1 204 ? 5.790   -0.634  -4.107  1.00 42.16  ? 155 CYS A N   1 
ATOM   1238 C  CA  . CYS A 1 204 ? 4.360   -0.857  -3.866  1.00 42.71  ? 155 CYS A CA  1 
ATOM   1239 C  C   . CYS A 1 204 ? 3.846   -2.200  -4.419  1.00 44.92  ? 155 CYS A C   1 
ATOM   1240 O  O   . CYS A 1 204 ? 3.686   -2.368  -5.621  1.00 48.22  ? 155 CYS A O   1 
ATOM   1241 C  CB  . CYS A 1 204 ? 3.544   0.322   -4.413  1.00 42.63  ? 155 CYS A CB  1 
ATOM   1242 S  SG  . CYS A 1 204 ? 3.921   1.914   -3.607  1.00 53.93  ? 155 CYS A SG  1 
ATOM   1243 N  N   . GLY A 1 205 ? 3.608   -3.167  -3.540  1.00 45.97  ? 156 GLY A N   1 
ATOM   1244 C  CA  . GLY A 1 205 ? 3.006   -4.429  -3.960  1.00 46.03  ? 156 GLY A CA  1 
ATOM   1245 C  C   . GLY A 1 205 ? 1.506   -4.214  -4.042  1.00 52.63  ? 156 GLY A C   1 
ATOM   1246 O  O   . GLY A 1 205 ? 0.936   -3.477  -3.212  1.00 52.51  ? 156 GLY A O   1 
ATOM   1247 N  N   . ALA A 1 206 ? 0.863   -4.836  -5.034  1.00 47.79  ? 157 ALA A N   1 
ATOM   1248 C  CA  . ALA A 1 206 ? -0.531  -4.542  -5.314  1.00 43.39  ? 157 ALA A CA  1 
ATOM   1249 C  C   . ALA A 1 206 ? -1.479  -5.244  -4.343  1.00 44.87  ? 157 ALA A C   1 
ATOM   1250 O  O   . ALA A 1 206 ? -2.517  -4.705  -3.994  1.00 45.22  ? 157 ALA A O   1 
ATOM   1251 C  CB  . ALA A 1 206 ? -0.870  -4.877  -6.755  1.00 39.98  ? 157 ALA A CB  1 
ATOM   1252 N  N   . GLY A 1 207 ? -1.107  -6.441  -3.908  1.00 47.14  ? 158 GLY A N   1 
ATOM   1253 C  CA  . GLY A 1 207 ? -1.916  -7.216  -2.982  1.00 45.85  ? 158 GLY A CA  1 
ATOM   1254 C  C   . GLY A 1 207 ? -2.667  -8.326  -3.681  1.00 46.85  ? 158 GLY A C   1 
ATOM   1255 O  O   . GLY A 1 207 ? -3.422  -9.074  -3.044  1.00 49.50  ? 158 GLY A O   1 
ATOM   1256 N  N   . PHE A 1 208 ? -2.450  -8.423  -4.989  1.00 45.29  ? 159 PHE A N   1 
ATOM   1257 C  CA  . PHE A 1 208 ? -3.185  -9.320  -5.897  1.00 48.58  ? 159 PHE A CA  1 
ATOM   1258 C  C   . PHE A 1 208 ? -2.367  -9.468  -7.188  1.00 51.36  ? 159 PHE A C   1 
ATOM   1259 O  O   . PHE A 1 208 ? -1.423  -8.695  -7.414  1.00 52.03  ? 159 PHE A O   1 
ATOM   1260 C  CB  . PHE A 1 208 ? -4.606  -8.789  -6.191  1.00 45.77  ? 159 PHE A CB  1 
ATOM   1261 C  CG  . PHE A 1 208 ? -4.649  -7.350  -6.644  1.00 43.99  ? 159 PHE A CG  1 
ATOM   1262 C  CD1 . PHE A 1 208 ? -4.486  -7.025  -7.988  1.00 44.60  ? 159 PHE A CD1 1 
ATOM   1263 C  CD2 . PHE A 1 208 ? -4.879  -6.314  -5.727  1.00 44.55  ? 159 PHE A CD2 1 
ATOM   1264 C  CE1 . PHE A 1 208 ? -4.526  -5.692  -8.415  1.00 45.96  ? 159 PHE A CE1 1 
ATOM   1265 C  CE2 . PHE A 1 208 ? -4.926  -4.979  -6.147  1.00 44.73  ? 159 PHE A CE2 1 
ATOM   1266 C  CZ  . PHE A 1 208 ? -4.747  -4.671  -7.492  1.00 43.83  ? 159 PHE A CZ  1 
ATOM   1267 N  N   . PRO A 1 209 ? -2.705  -10.456 -8.038  1.00 54.22  ? 160 PRO A N   1 
ATOM   1268 C  CA  . PRO A 1 209 ? -1.872  -10.595 -9.240  1.00 56.54  ? 160 PRO A CA  1 
ATOM   1269 C  C   . PRO A 1 209 ? -2.094  -9.482  -10.256 1.00 58.25  ? 160 PRO A C   1 
ATOM   1270 O  O   . PRO A 1 209 ? -3.167  -8.872  -10.308 1.00 60.19  ? 160 PRO A O   1 
ATOM   1271 C  CB  . PRO A 1 209 ? -2.297  -11.946 -9.821  1.00 53.97  ? 160 PRO A CB  1 
ATOM   1272 C  CG  . PRO A 1 209 ? -2.974  -12.657 -8.683  1.00 56.26  ? 160 PRO A CG  1 
ATOM   1273 C  CD  . PRO A 1 209 ? -3.663  -11.568 -7.917  1.00 54.37  ? 160 PRO A CD  1 
ATOM   1274 N  N   . LEU A 1 210 ? -1.048  -9.202  -11.020 1.00 60.04  ? 161 LEU A N   1 
ATOM   1275 C  CA  . LEU A 1 210 ? -1.110  -8.257  -12.108 1.00 60.98  ? 161 LEU A CA  1 
ATOM   1276 C  C   . LEU A 1 210 ? -0.731  -9.015  -13.374 1.00 65.33  ? 161 LEU A C   1 
ATOM   1277 O  O   . LEU A 1 210 ? 0.316   -9.677  -13.381 1.00 61.95  ? 161 LEU A O   1 
ATOM   1278 C  CB  . LEU A 1 210 ? -0.131  -7.108  -11.855 1.00 59.39  ? 161 LEU A CB  1 
ATOM   1279 C  CG  . LEU A 1 210 ? -0.454  -6.054  -10.783 1.00 60.56  ? 161 LEU A CG  1 
ATOM   1280 C  CD1 . LEU A 1 210 ? 0.694   -5.059  -10.684 1.00 57.62  ? 161 LEU A CD1 1 
ATOM   1281 C  CD2 . LEU A 1 210 ? -1.769  -5.319  -11.044 1.00 57.95  ? 161 LEU A CD2 1 
ATOM   1282 N  N   . ASN A 1 211 ? -1.576  -8.950  -14.421 1.00 67.69  ? 162 ASN A N   1 
ATOM   1283 C  CA  . ASN A 1 211 ? -1.224  -9.516  -15.747 1.00 72.04  ? 162 ASN A CA  1 
ATOM   1284 C  C   . ASN A 1 211 ? -0.220  -8.588  -16.435 1.00 77.44  ? 162 ASN A C   1 
ATOM   1285 O  O   . ASN A 1 211 ? 0.034   -7.495  -15.910 1.00 76.26  ? 162 ASN A O   1 
ATOM   1286 C  CB  . ASN A 1 211 ? -2.469  -9.783  -16.622 1.00 68.31  ? 162 ASN A CB  1 
ATOM   1287 C  CG  . ASN A 1 211 ? -3.248  -8.522  -16.962 1.00 69.06  ? 162 ASN A CG  1 
ATOM   1288 O  OD1 . ASN A 1 211 ? -2.678  -7.462  -17.192 1.00 74.72  ? 162 ASN A OD1 1 
ATOM   1289 N  ND2 . ASN A 1 211 ? -4.565  -8.642  -17.019 1.00 66.63  ? 162 ASN A ND2 1 
ATOM   1290 N  N   . GLN A 1 212 ? 0.346   -8.975  -17.587 1.00 84.13  ? 163 GLN A N   1 
ATOM   1291 C  CA  . GLN A 1 212 ? 1.422   -8.138  -18.177 1.00 87.81  ? 163 GLN A CA  1 
ATOM   1292 C  C   . GLN A 1 212 ? 0.990   -6.735  -18.667 1.00 83.03  ? 163 GLN A C   1 
ATOM   1293 O  O   . GLN A 1 212 ? 1.747   -5.753  -18.571 1.00 75.98  ? 163 GLN A O   1 
ATOM   1294 C  CB  . GLN A 1 212 ? 2.255   -8.862  -19.236 1.00 88.55  ? 163 GLN A CB  1 
ATOM   1295 C  CG  . GLN A 1 212 ? 3.703   -8.386  -19.178 1.00 89.51  ? 163 GLN A CG  1 
ATOM   1296 C  CD  . GLN A 1 212 ? 4.454   -8.597  -20.469 1.00 99.40  ? 163 GLN A CD  1 
ATOM   1297 O  OE1 . GLN A 1 212 ? 4.842   -9.717  -20.799 1.00 102.28 ? 163 GLN A OE1 1 
ATOM   1298 N  NE2 . GLN A 1 212 ? 4.682   -7.512  -21.202 1.00 100.37 ? 163 GLN A NE2 1 
ATOM   1299 N  N   . SER A 1 213 ? -0.230  -6.645  -19.176 1.00 76.56  ? 164 SER A N   1 
ATOM   1300 C  CA  . SER A 1 213 ? -0.780  -5.351  -19.532 1.00 73.95  ? 164 SER A CA  1 
ATOM   1301 C  C   . SER A 1 213 ? -0.876  -4.479  -18.266 1.00 70.43  ? 164 SER A C   1 
ATOM   1302 O  O   . SER A 1 213 ? -0.490  -3.304  -18.281 1.00 67.87  ? 164 SER A O   1 
ATOM   1303 C  CB  . SER A 1 213 ? -2.139  -5.547  -20.225 1.00 73.65  ? 164 SER A CB  1 
ATOM   1304 O  OG  . SER A 1 213 ? -2.861  -4.329  -20.306 1.00 69.56  ? 164 SER A OG  1 
ATOM   1305 N  N   . GLU A 1 214 ? -1.377  -5.084  -17.180 1.00 70.63  ? 165 GLU A N   1 
ATOM   1306 C  CA  . GLU A 1 214 ? -1.596  -4.408  -15.891 1.00 69.88  ? 165 GLU A CA  1 
ATOM   1307 C  C   . GLU A 1 214 ? -0.276  -3.986  -15.259 1.00 62.84  ? 165 GLU A C   1 
ATOM   1308 O  O   . GLU A 1 214 ? -0.157  -2.864  -14.757 1.00 59.97  ? 165 GLU A O   1 
ATOM   1309 C  CB  . GLU A 1 214 ? -2.373  -5.304  -14.903 1.00 74.14  ? 165 GLU A CB  1 
ATOM   1310 C  CG  . GLU A 1 214 ? -3.882  -5.034  -14.809 1.00 73.46  ? 165 GLU A CG  1 
ATOM   1311 C  CD  . GLU A 1 214 ? -4.632  -6.132  -14.058 1.00 75.64  ? 165 GLU A CD  1 
ATOM   1312 O  OE1 . GLU A 1 214 ? -5.617  -5.799  -13.361 1.00 78.33  ? 165 GLU A OE1 1 
ATOM   1313 O  OE2 . GLU A 1 214 ? -4.247  -7.326  -14.165 1.00 70.47  ? 165 GLU A OE2 1 
ATOM   1314 N  N   . VAL A 1 215 ? 0.718   -4.871  -15.294 1.00 55.80  ? 166 VAL A N   1 
ATOM   1315 C  CA  . VAL A 1 215 ? 2.019   -4.535  -14.715 1.00 57.38  ? 166 VAL A CA  1 
ATOM   1316 C  C   . VAL A 1 215 ? 2.654   -3.341  -15.449 1.00 56.96  ? 166 VAL A C   1 
ATOM   1317 O  O   . VAL A 1 215 ? 3.325   -2.533  -14.822 1.00 56.49  ? 166 VAL A O   1 
ATOM   1318 C  CB  . VAL A 1 215 ? 2.974   -5.759  -14.591 1.00 55.97  ? 166 VAL A CB  1 
ATOM   1319 C  CG1 . VAL A 1 215 ? 3.695   -6.046  -15.900 1.00 61.00  ? 166 VAL A CG1 1 
ATOM   1320 C  CG2 . VAL A 1 215 ? 3.995   -5.539  -13.486 1.00 56.99  ? 166 VAL A CG2 1 
ATOM   1321 N  N   . LEU A 1 216 ? 2.398   -3.214  -16.756 1.00 57.49  ? 167 LEU A N   1 
ATOM   1322 C  CA  . LEU A 1 216 ? 2.948   -2.116  -17.550 1.00 55.50  ? 167 LEU A CA  1 
ATOM   1323 C  C   . LEU A 1 216 ? 2.217   -0.810  -17.269 1.00 56.96  ? 167 LEU A C   1 
ATOM   1324 O  O   . LEU A 1 216 ? 2.813   0.269   -17.307 1.00 56.71  ? 167 LEU A O   1 
ATOM   1325 C  CB  . LEU A 1 216 ? 2.888   -2.431  -19.048 1.00 55.38  ? 167 LEU A CB  1 
ATOM   1326 C  CG  . LEU A 1 216 ? 3.771   -3.517  -19.687 1.00 59.57  ? 167 LEU A CG  1 
ATOM   1327 C  CD1 . LEU A 1 216 ? 3.445   -3.664  -21.180 1.00 54.73  ? 167 LEU A CD1 1 
ATOM   1328 C  CD2 . LEU A 1 216 ? 5.258   -3.259  -19.481 1.00 53.60  ? 167 LEU A CD2 1 
ATOM   1329 N  N   . ALA A 1 217 ? 0.923   -0.912  -16.981 1.00 59.82  ? 168 ALA A N   1 
ATOM   1330 C  CA  . ALA A 1 217 ? 0.094   0.280   -16.806 1.00 61.78  ? 168 ALA A CA  1 
ATOM   1331 C  C   . ALA A 1 217 ? 0.108   0.814   -15.372 1.00 58.85  ? 168 ALA A C   1 
ATOM   1332 O  O   . ALA A 1 217 ? -0.091  2.006   -15.155 1.00 64.08  ? 168 ALA A O   1 
ATOM   1333 C  CB  . ALA A 1 217 ? -1.334  0.014   -17.289 1.00 62.14  ? 168 ALA A CB  1 
ATOM   1334 N  N   . SER A 1 218 ? 0.349   -0.063  -14.402 1.00 57.36  ? 169 SER A N   1 
ATOM   1335 C  CA  . SER A 1 218 ? 0.334   0.317   -12.987 1.00 57.80  ? 169 SER A CA  1 
ATOM   1336 C  C   . SER A 1 218 ? 1.585   1.092   -12.530 1.00 60.21  ? 169 SER A C   1 
ATOM   1337 O  O   . SER A 1 218 ? 2.696   0.873   -13.031 1.00 61.00  ? 169 SER A O   1 
ATOM   1338 C  CB  . SER A 1 218 ? 0.143   -0.932  -12.128 1.00 57.00  ? 169 SER A CB  1 
ATOM   1339 O  OG  . SER A 1 218 ? 0.124   -0.634  -10.740 1.00 71.71  ? 169 SER A OG  1 
ATOM   1340 N  N   . VAL A 1 219 ? 1.391   2.005   -11.578 1.00 59.81  ? 170 VAL A N   1 
ATOM   1341 C  CA  . VAL A 1 219 ? 2.511   2.620   -10.846 1.00 58.07  ? 170 VAL A CA  1 
ATOM   1342 C  C   . VAL A 1 219 ? 3.008   1.649   -9.758  1.00 55.26  ? 170 VAL A C   1 
ATOM   1343 O  O   . VAL A 1 219 ? 2.197   1.090   -9.014  1.00 56.48  ? 170 VAL A O   1 
ATOM   1344 C  CB  . VAL A 1 219 ? 2.115   3.970   -10.214 1.00 57.55  ? 170 VAL A CB  1 
ATOM   1345 C  CG1 . VAL A 1 219 ? 3.177   4.426   -9.210  1.00 59.07  ? 170 VAL A CG1 1 
ATOM   1346 C  CG2 . VAL A 1 219 ? 1.896   5.007   -11.305 1.00 53.97  ? 170 VAL A CG2 1 
ATOM   1347 N  N   . GLY A 1 220 ? 4.326   1.454   -9.665  1.00 46.73  ? 171 GLY A N   1 
ATOM   1348 C  CA  . GLY A 1 220 ? 4.871   0.413   -8.814  1.00 46.17  ? 171 GLY A CA  1 
ATOM   1349 C  C   . GLY A 1 220 ? 5.651   0.951   -7.639  1.00 47.62  ? 171 GLY A C   1 
ATOM   1350 O  O   . GLY A 1 220 ? 6.124   0.186   -6.809  1.00 47.78  ? 171 GLY A O   1 
ATOM   1351 N  N   . GLY A 1 221 ? 5.817   2.267   -7.590  1.00 45.84  ? 172 GLY A N   1 
ATOM   1352 C  CA  . GLY A 1 221 ? 6.463   2.896   -6.467  1.00 45.07  ? 172 GLY A CA  1 
ATOM   1353 C  C   . GLY A 1 221 ? 7.234   4.161   -6.802  1.00 46.06  ? 172 GLY A C   1 
ATOM   1354 O  O   . GLY A 1 221 ? 6.999   4.796   -7.825  1.00 49.24  ? 172 GLY A O   1 
ATOM   1355 N  N   . SER A 1 222 ? 8.143   4.536   -5.911  1.00 40.79  ? 173 SER A N   1 
ATOM   1356 C  CA  . SER A 1 222 ? 8.963   5.686   -6.112  1.00 42.97  ? 173 SER A CA  1 
ATOM   1357 C  C   . SER A 1 222 ? 10.368  5.392   -5.623  1.00 46.69  ? 173 SER A C   1 
ATOM   1358 O  O   . SER A 1 222 ? 10.557  4.836   -4.522  1.00 50.72  ? 173 SER A O   1 
ATOM   1359 C  CB  . SER A 1 222 ? 8.391   6.891   -5.352  1.00 43.85  ? 173 SER A CB  1 
ATOM   1360 O  OG  . SER A 1 222 ? 7.120   7.265   -5.865  1.00 44.40  ? 173 SER A OG  1 
ATOM   1361 N  N   . MET A 1 223 ? 11.336  5.736   -6.472  1.00 44.32  ? 174 MET A N   1 
ATOM   1362 C  CA  . MET A 1 223 ? 12.716  5.940   -6.083  1.00 46.12  ? 174 MET A CA  1 
ATOM   1363 C  C   . MET A 1 223 ? 12.986  7.459   -6.068  1.00 48.48  ? 174 MET A C   1 
ATOM   1364 O  O   . MET A 1 223 ? 13.001  8.110   -7.125  1.00 49.00  ? 174 MET A O   1 
ATOM   1365 C  CB  . MET A 1 223 ? 13.676  5.242   -7.060  1.00 45.75  ? 174 MET A CB  1 
ATOM   1366 C  CG  . MET A 1 223 ? 15.128  5.298   -6.607  1.00 46.43  ? 174 MET A CG  1 
ATOM   1367 S  SD  . MET A 1 223 ? 16.368  4.451   -7.602  1.00 53.67  ? 174 MET A SD  1 
ATOM   1368 C  CE  . MET A 1 223 ? 15.829  4.770   -9.270  1.00 52.91  ? 174 MET A CE  1 
ATOM   1369 N  N   . ILE A 1 224 ? 13.188  8.010   -4.875  1.00 47.61  ? 175 ILE A N   1 
ATOM   1370 C  CA  . ILE A 1 224 ? 13.556  9.416   -4.714  1.00 47.01  ? 175 ILE A CA  1 
ATOM   1371 C  C   . ILE A 1 224 ? 15.095  9.532   -4.626  1.00 49.18  ? 175 ILE A C   1 
ATOM   1372 O  O   . ILE A 1 224 ? 15.705  9.181   -3.593  1.00 47.19  ? 175 ILE A O   1 
ATOM   1373 C  CB  . ILE A 1 224 ? 12.874  10.037  -3.457  1.00 47.84  ? 175 ILE A CB  1 
ATOM   1374 C  CG1 . ILE A 1 224 ? 11.390  9.631   -3.357  1.00 47.89  ? 175 ILE A CG1 1 
ATOM   1375 C  CG2 . ILE A 1 224 ? 13.059  11.558  -3.420  1.00 44.57  ? 175 ILE A CG2 1 
ATOM   1376 C  CD1 . ILE A 1 224 ? 10.495  10.087  -4.510  1.00 48.05  ? 175 ILE A CD1 1 
ATOM   1377 N  N   . ILE A 1 225 ? 15.713  9.986   -5.721  1.00 47.95  ? 176 ILE A N   1 
ATOM   1378 C  CA  . ILE A 1 225 ? 17.155  10.206  -5.803  1.00 47.48  ? 176 ILE A CA  1 
ATOM   1379 C  C   . ILE A 1 225 ? 17.479  11.558  -5.172  1.00 52.85  ? 176 ILE A C   1 
ATOM   1380 O  O   . ILE A 1 225 ? 17.055  12.610  -5.674  1.00 50.35  ? 176 ILE A O   1 
ATOM   1381 C  CB  . ILE A 1 225 ? 17.646  10.264  -7.266  1.00 50.43  ? 176 ILE A CB  1 
ATOM   1382 C  CG1 . ILE A 1 225 ? 17.087  9.119   -8.113  1.00 50.09  ? 176 ILE A CG1 1 
ATOM   1383 C  CG2 . ILE A 1 225 ? 19.163  10.301  -7.320  1.00 49.12  ? 176 ILE A CG2 1 
ATOM   1384 C  CD1 . ILE A 1 225 ? 17.633  7.768   -7.720  1.00 51.91  ? 176 ILE A CD1 1 
ATOM   1385 N  N   . GLY A 1 226 ? 18.217  11.530  -4.066  1.00 56.01  ? 177 GLY A N   1 
ATOM   1386 C  CA  . GLY A 1 226 ? 18.723  12.755  -3.441  1.00 56.14  ? 177 GLY A CA  1 
ATOM   1387 C  C   . GLY A 1 226 ? 17.867  13.303  -2.319  1.00 59.38  ? 177 GLY A C   1 
ATOM   1388 O  O   . GLY A 1 226 ? 18.113  14.413  -1.843  1.00 62.67  ? 177 GLY A O   1 
ATOM   1389 N  N   . GLY A 1 227 ? 16.872  12.532  -1.886  1.00 55.53  ? 178 GLY A N   1 
ATOM   1390 C  CA  . GLY A 1 227 ? 15.935  13.027  -0.889  1.00 55.69  ? 178 GLY A CA  1 
ATOM   1391 C  C   . GLY A 1 227 ? 14.924  12.049  -0.316  1.00 56.04  ? 178 GLY A C   1 
ATOM   1392 O  O   . GLY A 1 227 ? 14.899  10.857  -0.659  1.00 54.59  ? 178 GLY A O   1 
ATOM   1393 N  N   . ILE A 1 228 ? 14.098  12.586  0.578   1.00 55.37  ? 179 ILE A N   1 
ATOM   1394 C  CA  . ILE A 1 228 ? 13.059  11.863  1.307   1.00 52.20  ? 179 ILE A CA  1 
ATOM   1395 C  C   . ILE A 1 228 ? 11.756  12.580  0.936   1.00 55.42  ? 179 ILE A C   1 
ATOM   1396 O  O   . ILE A 1 228 ? 11.677  13.800  1.074   1.00 59.33  ? 179 ILE A O   1 
ATOM   1397 C  CB  . ILE A 1 228 ? 13.317  11.954  2.840   1.00 49.44  ? 179 ILE A CB  1 
ATOM   1398 C  CG1 . ILE A 1 228 ? 14.580  11.178  3.239   1.00 51.00  ? 179 ILE A CG1 1 
ATOM   1399 C  CG2 . ILE A 1 228 ? 12.125  11.478  3.669   1.00 49.71  ? 179 ILE A CG2 1 
ATOM   1400 C  CD1 . ILE A 1 228 ? 15.061  11.451  4.660   1.00 49.27  ? 179 ILE A CD1 1 
ATOM   1401 N  N   . ASP A 1 229 ? 10.760  11.854  0.422   1.00 53.16  ? 180 ASP A N   1 
ATOM   1402 C  CA  . ASP A 1 229 ? 9.434   12.443  0.194   1.00 53.93  ? 180 ASP A CA  1 
ATOM   1403 C  C   . ASP A 1 229 ? 8.466   12.051  1.327   1.00 56.51  ? 180 ASP A C   1 
ATOM   1404 O  O   . ASP A 1 229 ? 8.278   10.870  1.609   1.00 57.01  ? 180 ASP A O   1 
ATOM   1405 C  CB  . ASP A 1 229 ? 8.877   12.018  -1.158  1.00 57.12  ? 180 ASP A CB  1 
ATOM   1406 C  CG  . ASP A 1 229 ? 7.603   12.763  -1.530  1.00 61.77  ? 180 ASP A CG  1 
ATOM   1407 O  OD1 . ASP A 1 229 ? 6.677   12.818  -0.697  1.00 63.48  ? 180 ASP A OD1 1 
ATOM   1408 O  OD2 . ASP A 1 229 ? 7.519   13.283  -2.665  1.00 66.66  ? 180 ASP A OD2 1 
ATOM   1409 N  N   . HIS A 1 230 ? 7.846   13.039  1.970   1.00 59.23  ? 181 HIS A N   1 
ATOM   1410 C  CA  . HIS A 1 230 ? 7.055   12.796  3.177   1.00 57.16  ? 181 HIS A CA  1 
ATOM   1411 C  C   . HIS A 1 230 ? 5.671   12.212  2.924   1.00 53.58  ? 181 HIS A C   1 
ATOM   1412 O  O   . HIS A 1 230 ? 5.051   11.695  3.849   1.00 51.51  ? 181 HIS A O   1 
ATOM   1413 C  CB  . HIS A 1 230 ? 6.999   14.042  4.072   1.00 64.68  ? 181 HIS A CB  1 
ATOM   1414 C  CG  . HIS A 1 230 ? 8.330   14.411  4.670   1.00 82.23  ? 181 HIS A CG  1 
ATOM   1415 N  ND1 . HIS A 1 230 ? 9.082   13.531  5.425   1.00 84.23  ? 181 HIS A ND1 1 
ATOM   1416 C  CD2 . HIS A 1 230 ? 9.045   15.563  4.620   1.00 87.84  ? 181 HIS A CD2 1 
ATOM   1417 C  CE1 . HIS A 1 230 ? 10.201  14.122  5.811   1.00 82.76  ? 181 HIS A CE1 1 
ATOM   1418 N  NE2 . HIS A 1 230 ? 10.201  15.357  5.339   1.00 86.67  ? 181 HIS A NE2 1 
ATOM   1419 N  N   . SER A 1 231 ? 5.212   12.232  1.675   1.00 47.55  ? 182 SER A N   1 
ATOM   1420 C  CA  . SER A 1 231 ? 3.924   11.620  1.339   1.00 49.45  ? 182 SER A CA  1 
ATOM   1421 C  C   . SER A 1 231 ? 3.991   10.093  1.071   1.00 50.39  ? 182 SER A C   1 
ATOM   1422 O  O   . SER A 1 231 ? 2.970   9.461   0.774   1.00 55.24  ? 182 SER A O   1 
ATOM   1423 C  CB  . SER A 1 231 ? 3.313   12.312  0.131   1.00 44.53  ? 182 SER A CB  1 
ATOM   1424 O  OG  . SER A 1 231 ? 3.946   11.835  -1.033  1.00 47.23  ? 182 SER A OG  1 
ATOM   1425 N  N   . LEU A 1 232 ? 5.178   9.509   1.172   1.00 50.16  ? 183 LEU A N   1 
ATOM   1426 C  CA  . LEU A 1 232 ? 5.367   8.085   0.884   1.00 46.95  ? 183 LEU A CA  1 
ATOM   1427 C  C   . LEU A 1 232 ? 5.305   7.236   2.141   1.00 49.08  ? 183 LEU A C   1 
ATOM   1428 O  O   . LEU A 1 232 ? 5.243   6.015   2.055   1.00 53.36  ? 183 LEU A O   1 
ATOM   1429 C  CB  . LEU A 1 232 ? 6.686   7.856   0.153   1.00 42.47  ? 183 LEU A CB  1 
ATOM   1430 C  CG  . LEU A 1 232 ? 6.849   8.606   -1.169  1.00 41.59  ? 183 LEU A CG  1 
ATOM   1431 C  CD1 . LEU A 1 232 ? 8.158   8.230   -1.831  1.00 43.70  ? 183 LEU A CD1 1 
ATOM   1432 C  CD2 . LEU A 1 232 ? 5.679   8.358   -2.110  1.00 39.62  ? 183 LEU A CD2 1 
ATOM   1433 N  N   . TYR A 1 233 ? 5.292   7.887   3.303   1.00 49.16  ? 184 TYR A N   1 
ATOM   1434 C  CA  . TYR A 1 233 ? 5.150   7.184   4.575   1.00 50.78  ? 184 TYR A CA  1 
ATOM   1435 C  C   . TYR A 1 233 ? 4.224   7.850   5.610   1.00 50.10  ? 184 TYR A C   1 
ATOM   1436 O  O   . TYR A 1 233 ? 3.754   8.972   5.426   1.00 49.43  ? 184 TYR A O   1 
ATOM   1437 C  CB  . TYR A 1 233 ? 6.532   6.937   5.184   1.00 50.47  ? 184 TYR A CB  1 
ATOM   1438 C  CG  . TYR A 1 233 ? 7.230   8.172   5.713   1.00 49.55  ? 184 TYR A CG  1 
ATOM   1439 C  CD1 . TYR A 1 233 ? 7.883   9.061   4.847   1.00 49.40  ? 184 TYR A CD1 1 
ATOM   1440 C  CD2 . TYR A 1 233 ? 7.259   8.444   7.084   1.00 45.48  ? 184 TYR A CD2 1 
ATOM   1441 C  CE1 . TYR A 1 233 ? 8.538   10.184  5.335   1.00 50.84  ? 184 TYR A CE1 1 
ATOM   1442 C  CE2 . TYR A 1 233 ? 7.910   9.561   7.580   1.00 49.41  ? 184 TYR A CE2 1 
ATOM   1443 C  CZ  . TYR A 1 233 ? 8.548   10.426  6.703   1.00 54.46  ? 184 TYR A CZ  1 
ATOM   1444 O  OH  . TYR A 1 233 ? 9.203   11.528  7.200   1.00 59.10  ? 184 TYR A OH  1 
ATOM   1445 N  N   . THR A 1 234 ? 3.970   7.129   6.699   1.00 51.58  ? 185 THR A N   1 
ATOM   1446 C  CA  . THR A 1 234 ? 3.258   7.644   7.871   1.00 51.44  ? 185 THR A CA  1 
ATOM   1447 C  C   . THR A 1 234 ? 4.060   7.264   9.123   1.00 52.60  ? 185 THR A C   1 
ATOM   1448 O  O   . THR A 1 234 ? 4.882   6.341   9.077   1.00 48.40  ? 185 THR A O   1 
ATOM   1449 C  CB  . THR A 1 234 ? 1.849   7.031   7.982   1.00 52.89  ? 185 THR A CB  1 
ATOM   1450 O  OG1 . THR A 1 234 ? 1.943   5.590   8.013   1.00 52.60  ? 185 THR A OG1 1 
ATOM   1451 C  CG2 . THR A 1 234 ? 0.957   7.482   6.821   1.00 46.41  ? 185 THR A CG2 1 
ATOM   1452 N  N   . GLY A 1 235 ? 3.824   7.960   10.237  1.00 53.97  ? 186 GLY A N   1 
ATOM   1453 C  CA  . GLY A 1 235 ? 4.589   7.721   11.475  1.00 50.05  ? 186 GLY A CA  1 
ATOM   1454 C  C   . GLY A 1 235 ? 6.004   8.240   11.297  1.00 47.71  ? 186 GLY A C   1 
ATOM   1455 O  O   . GLY A 1 235 ? 6.279   8.937   10.335  1.00 45.61  ? 186 GLY A O   1 
ATOM   1456 N  N   . SER A 1 236 ? 6.903   7.898   12.215  1.00 48.84  ? 187 SER A N   1 
ATOM   1457 C  CA  . SER A 1 236 ? 8.288   8.366   12.169  1.00 48.97  ? 187 SER A CA  1 
ATOM   1458 C  C   . SER A 1 236 ? 9.204   7.409   11.400  1.00 51.01  ? 187 SER A C   1 
ATOM   1459 O  O   . SER A 1 236 ? 8.974   6.184   11.383  1.00 46.18  ? 187 SER A O   1 
ATOM   1460 C  CB  . SER A 1 236 ? 8.857   8.509   13.591  1.00 53.50  ? 187 SER A CB  1 
ATOM   1461 O  OG  . SER A 1 236 ? 8.086   9.368   14.407  1.00 55.31  ? 187 SER A OG  1 
ATOM   1462 N  N   . LEU A 1 237 ? 10.247  7.977   10.788  1.00 49.01  ? 188 LEU A N   1 
ATOM   1463 C  CA  . LEU A 1 237 ? 11.411  7.217   10.316  1.00 49.38  ? 188 LEU A CA  1 
ATOM   1464 C  C   . LEU A 1 237 ? 12.293  6.802   11.496  1.00 49.45  ? 188 LEU A C   1 
ATOM   1465 O  O   . LEU A 1 237 ? 12.684  7.648   12.291  1.00 49.51  ? 188 LEU A O   1 
ATOM   1466 C  CB  . LEU A 1 237 ? 12.246  8.064   9.343   1.00 48.12  ? 188 LEU A CB  1 
ATOM   1467 C  CG  . LEU A 1 237 ? 11.794  8.099   7.880   1.00 51.46  ? 188 LEU A CG  1 
ATOM   1468 C  CD1 . LEU A 1 237 ? 12.366  9.315   7.179   1.00 51.84  ? 188 LEU A CD1 1 
ATOM   1469 C  CD2 . LEU A 1 237 ? 12.181  6.820   7.139   1.00 50.59  ? 188 LEU A CD2 1 
ATOM   1470 N  N   . TRP A 1 238 ? 12.597  5.507   11.611  1.00 49.41  ? 189 TRP A N   1 
ATOM   1471 C  CA  . TRP A 1 238 ? 13.601  5.015   12.556  1.00 47.83  ? 189 TRP A CA  1 
ATOM   1472 C  C   . TRP A 1 238 ? 14.837  4.521   11.791  1.00 53.16  ? 189 TRP A C   1 
ATOM   1473 O  O   . TRP A 1 238 ? 14.714  3.910   10.723  1.00 49.98  ? 189 TRP A O   1 
ATOM   1474 C  CB  . TRP A 1 238 ? 13.045  3.887   13.413  1.00 48.43  ? 189 TRP A CB  1 
ATOM   1475 C  CG  . TRP A 1 238 ? 12.171  4.350   14.527  1.00 45.03  ? 189 TRP A CG  1 
ATOM   1476 C  CD1 . TRP A 1 238 ? 10.847  4.665   14.451  1.00 43.85  ? 189 TRP A CD1 1 
ATOM   1477 C  CD2 . TRP A 1 238 ? 12.556  4.549   15.887  1.00 44.36  ? 189 TRP A CD2 1 
ATOM   1478 N  NE1 . TRP A 1 238 ? 10.376  5.049   15.688  1.00 43.89  ? 189 TRP A NE1 1 
ATOM   1479 C  CE2 . TRP A 1 238 ? 11.406  4.989   16.587  1.00 45.08  ? 189 TRP A CE2 1 
ATOM   1480 C  CE3 . TRP A 1 238 ? 13.760  4.396   16.588  1.00 45.61  ? 189 TRP A CE3 1 
ATOM   1481 C  CZ2 . TRP A 1 238 ? 11.422  5.271   17.964  1.00 47.74  ? 189 TRP A CZ2 1 
ATOM   1482 C  CZ3 . TRP A 1 238 ? 13.781  4.681   17.956  1.00 45.52  ? 189 TRP A CZ3 1 
ATOM   1483 C  CH2 . TRP A 1 238 ? 12.617  5.111   18.631  1.00 46.43  ? 189 TRP A CH2 1 
ATOM   1484 N  N   . TYR A 1 239 ? 16.024  4.784   12.345  1.00 51.38  ? 190 TYR A N   1 
ATOM   1485 C  CA  . TYR A 1 239 ? 17.265  4.518   11.624  1.00 51.39  ? 190 TYR A CA  1 
ATOM   1486 C  C   . TYR A 1 239 ? 18.142  3.446   12.239  1.00 51.96  ? 190 TYR A C   1 
ATOM   1487 O  O   . TYR A 1 239 ? 18.337  3.384   13.458  1.00 58.15  ? 190 TYR A O   1 
ATOM   1488 C  CB  . TYR A 1 239 ? 18.077  5.787   11.469  1.00 49.33  ? 190 TYR A CB  1 
ATOM   1489 C  CG  . TYR A 1 239 ? 17.521  6.741   10.452  1.00 50.61  ? 190 TYR A CG  1 
ATOM   1490 C  CD1 . TYR A 1 239 ? 17.768  6.566   9.080   1.00 50.54  ? 190 TYR A CD1 1 
ATOM   1491 C  CD2 . TYR A 1 239 ? 16.770  7.833   10.847  1.00 49.18  ? 190 TYR A CD2 1 
ATOM   1492 C  CE1 . TYR A 1 239 ? 17.257  7.454   8.144   1.00 48.29  ? 190 TYR A CE1 1 
ATOM   1493 C  CE2 . TYR A 1 239 ? 16.266  8.726   9.922   1.00 48.29  ? 190 TYR A CE2 1 
ATOM   1494 C  CZ  . TYR A 1 239 ? 16.514  8.536   8.585   1.00 47.32  ? 190 TYR A CZ  1 
ATOM   1495 O  OH  . TYR A 1 239 ? 16.004  9.436   7.699   1.00 47.10  ? 190 TYR A OH  1 
ATOM   1496 N  N   . THR A 1 240 ? 18.675  2.607   11.369  1.00 46.48  ? 191 THR A N   1 
ATOM   1497 C  CA  . THR A 1 240 ? 19.599  1.581   11.773  1.00 49.12  ? 191 THR A CA  1 
ATOM   1498 C  C   . THR A 1 240 ? 20.957  1.849   11.073  1.00 49.87  ? 191 THR A C   1 
ATOM   1499 O  O   . THR A 1 240 ? 20.981  2.338   9.936   1.00 51.72  ? 191 THR A O   1 
ATOM   1500 C  CB  . THR A 1 240 ? 19.015  0.188   11.476  1.00 47.37  ? 191 THR A CB  1 
ATOM   1501 O  OG1 . THR A 1 240 ? 19.781  -0.801  12.163  1.00 51.98  ? 191 THR A OG1 1 
ATOM   1502 C  CG2 . THR A 1 240 ? 19.011  -0.107  9.981   1.00 47.16  ? 191 THR A CG2 1 
ATOM   1503 N  N   . PRO A 1 241 ? 22.084  1.598   11.767  1.00 45.59  ? 192 PRO A N   1 
ATOM   1504 C  CA  . PRO A 1 241 ? 23.394  1.894   11.159  1.00 44.53  ? 192 PRO A CA  1 
ATOM   1505 C  C   . PRO A 1 241 ? 23.731  0.908   10.067  1.00 48.11  ? 192 PRO A C   1 
ATOM   1506 O  O   . PRO A 1 241 ? 23.532  -0.306  10.255  1.00 46.89  ? 192 PRO A O   1 
ATOM   1507 C  CB  . PRO A 1 241 ? 24.399  1.672   12.302  1.00 42.90  ? 192 PRO A CB  1 
ATOM   1508 C  CG  . PRO A 1 241 ? 23.603  1.558   13.550  1.00 45.38  ? 192 PRO A CG  1 
ATOM   1509 C  CD  . PRO A 1 241 ? 22.178  1.235   13.190  1.00 45.35  ? 192 PRO A CD  1 
ATOM   1510 N  N   . ILE A 1 242 ? 24.261  1.401   8.947   1.00 50.78  ? 193 ILE A N   1 
ATOM   1511 C  CA  . ILE A 1 242 ? 24.914  0.514   7.976   1.00 50.90  ? 193 ILE A CA  1 
ATOM   1512 C  C   . ILE A 1 242 ? 26.217  0.037   8.620   1.00 53.03  ? 193 ILE A C   1 
ATOM   1513 O  O   . ILE A 1 242 ? 27.079  0.850   8.943   1.00 55.92  ? 193 ILE A O   1 
ATOM   1514 C  CB  . ILE A 1 242 ? 25.227  1.227   6.651   1.00 50.64  ? 193 ILE A CB  1 
ATOM   1515 C  CG1 . ILE A 1 242 ? 23.921  1.651   5.951   1.00 48.33  ? 193 ILE A CG1 1 
ATOM   1516 C  CG2 . ILE A 1 242 ? 26.075  0.315   5.762   1.00 48.83  ? 193 ILE A CG2 1 
ATOM   1517 C  CD1 . ILE A 1 242 ? 24.123  2.571   4.763   1.00 44.02  ? 193 ILE A CD1 1 
ATOM   1518 N  N   . ARG A 1 243 ? 26.344  -1.267  8.845   1.00 50.09  ? 194 ARG A N   1 
ATOM   1519 C  CA  . ARG A 1 243 ? 27.481  -1.797  9.586   1.00 51.02  ? 194 ARG A CA  1 
ATOM   1520 C  C   . ARG A 1 243 ? 28.787  -1.565  8.828   1.00 56.78  ? 194 ARG A C   1 
ATOM   1521 O  O   . ARG A 1 243 ? 29.826  -1.273  9.427   1.00 55.85  ? 194 ARG A O   1 
ATOM   1522 C  CB  . ARG A 1 243 ? 27.299  -3.293  9.847   1.00 46.87  ? 194 ARG A CB  1 
ATOM   1523 C  CG  . ARG A 1 243 ? 28.279  -3.870  10.855  1.00 44.58  ? 194 ARG A CG  1 
ATOM   1524 C  CD  . ARG A 1 243 ? 28.178  -5.376  10.856  1.00 45.15  ? 194 ARG A CD  1 
ATOM   1525 N  NE  . ARG A 1 243 ? 29.128  -5.994  11.765  1.00 51.42  ? 194 ARG A NE  1 
ATOM   1526 C  CZ  . ARG A 1 243 ? 29.457  -7.287  11.726  1.00 55.52  ? 194 ARG A CZ  1 
ATOM   1527 N  NH1 . ARG A 1 243 ? 28.909  -8.086  10.806  1.00 53.13  ? 194 ARG A NH1 1 
ATOM   1528 N  NH2 . ARG A 1 243 ? 30.323  -7.787  12.611  1.00 49.34  ? 194 ARG A NH2 1 
ATOM   1529 N  N   . ARG A 1 244 ? 28.708  -1.697  7.506   1.00 59.01  ? 195 ARG A N   1 
ATOM   1530 C  CA  . ARG A 1 244 ? 29.878  -1.728  6.625   1.00 63.48  ? 195 ARG A CA  1 
ATOM   1531 C  C   . ARG A 1 244 ? 29.410  -1.431  5.209   1.00 61.12  ? 195 ARG A C   1 
ATOM   1532 O  O   . ARG A 1 244 ? 28.453  -2.030  4.710   1.00 61.36  ? 195 ARG A O   1 
ATOM   1533 C  CB  . ARG A 1 244 ? 30.557  -3.109  6.681   1.00 62.93  ? 195 ARG A CB  1 
ATOM   1534 C  CG  . ARG A 1 244 ? 31.864  -3.247  5.901   1.00 62.54  ? 195 ARG A CG  1 
ATOM   1535 C  CD  . ARG A 1 244 ? 32.454  -4.652  6.077   1.00 59.99  ? 195 ARG A CD  1 
ATOM   1536 N  NE  . ARG A 1 244 ? 33.195  -5.108  4.896   1.00 60.13  ? 195 ARG A NE  1 
ATOM   1537 C  CZ  . ARG A 1 244 ? 33.449  -6.386  4.590   1.00 63.55  ? 195 ARG A CZ  1 
ATOM   1538 N  NH1 . ARG A 1 244 ? 33.019  -7.389  5.365   1.00 59.82  ? 195 ARG A NH1 1 
ATOM   1539 N  NH2 . ARG A 1 244 ? 34.127  -6.673  3.482   1.00 61.77  ? 195 ARG A NH2 1 
ATOM   1540 N  N   . GLU A 1 245 ? 30.084  -0.491  4.568   1.00 57.79  ? 196 GLU A N   1 
ATOM   1541 C  CA  . GLU A 1 245 ? 29.723  -0.084  3.221   1.00 54.02  ? 196 GLU A CA  1 
ATOM   1542 C  C   . GLU A 1 245 ? 30.247  -1.071  2.191   1.00 52.42  ? 196 GLU A C   1 
ATOM   1543 O  O   . GLU A 1 245 ? 31.292  -0.859  1.595   1.00 56.47  ? 196 GLU A O   1 
ATOM   1544 C  CB  . GLU A 1 245 ? 30.233  1.320   2.934   1.00 54.19  ? 196 GLU A CB  1 
ATOM   1545 C  CG  . GLU A 1 245 ? 29.520  2.377   3.756   1.00 58.24  ? 196 GLU A CG  1 
ATOM   1546 C  CD  . GLU A 1 245 ? 30.413  3.547   4.093   1.00 61.62  ? 196 GLU A CD  1 
ATOM   1547 O  OE1 . GLU A 1 245 ? 31.464  3.337   4.744   1.00 67.02  ? 196 GLU A OE1 1 
ATOM   1548 O  OE2 . GLU A 1 245 ? 30.062  4.678   3.714   1.00 55.95  ? 196 GLU A OE2 1 
ATOM   1549 N  N   . TRP A 1 246 ? 29.506  -2.162  2.007   1.00 51.30  ? 197 TRP A N   1 
ATOM   1550 C  CA  . TRP A 1 246 ? 29.743  -3.100  0.927   1.00 47.84  ? 197 TRP A CA  1 
ATOM   1551 C  C   . TRP A 1 246 ? 28.371  -3.464  0.321   1.00 48.45  ? 197 TRP A C   1 
ATOM   1552 O  O   . TRP A 1 246 ? 27.914  -2.784  -0.598  1.00 43.54  ? 197 TRP A O   1 
ATOM   1553 C  CB  . TRP A 1 246 ? 30.625  -4.273  1.381   1.00 45.97  ? 197 TRP A CB  1 
ATOM   1554 C  CG  . TRP A 1 246 ? 30.092  -5.185  2.476   1.00 45.60  ? 197 TRP A CG  1 
ATOM   1555 C  CD1 . TRP A 1 246 ? 29.372  -4.831  3.589   1.00 45.09  ? 197 TRP A CD1 1 
ATOM   1556 C  CD2 . TRP A 1 246 ? 30.305  -6.606  2.573   1.00 44.77  ? 197 TRP A CD2 1 
ATOM   1557 N  NE1 . TRP A 1 246 ? 29.103  -5.947  4.348   1.00 45.03  ? 197 TRP A NE1 1 
ATOM   1558 C  CE2 . TRP A 1 246 ? 29.653  -7.049  3.742   1.00 44.42  ? 197 TRP A CE2 1 
ATOM   1559 C  CE3 . TRP A 1 246 ? 30.969  -7.546  1.768   1.00 46.62  ? 197 TRP A CE3 1 
ATOM   1560 C  CZ2 . TRP A 1 246 ? 29.649  -8.396  4.136   1.00 46.50  ? 197 TRP A CZ2 1 
ATOM   1561 C  CZ3 . TRP A 1 246 ? 30.962  -8.890  2.156   1.00 47.00  ? 197 TRP A CZ3 1 
ATOM   1562 C  CH2 . TRP A 1 246 ? 30.308  -9.299  3.333   1.00 47.27  ? 197 TRP A CH2 1 
ATOM   1563 N  N   . TYR A 1 247 ? 27.696  -4.484  0.847   1.00 49.88  ? 198 TYR A N   1 
ATOM   1564 C  CA  . TYR A 1 247 ? 26.228  -4.537  0.743   1.00 47.66  ? 198 TYR A CA  1 
ATOM   1565 C  C   . TYR A 1 247 ? 25.637  -3.478  1.690   1.00 47.04  ? 198 TYR A C   1 
ATOM   1566 O  O   . TYR A 1 247 ? 26.349  -2.884  2.505   1.00 45.81  ? 198 TYR A O   1 
ATOM   1567 C  CB  . TYR A 1 247 ? 25.716  -5.897  1.190   1.00 47.79  ? 198 TYR A CB  1 
ATOM   1568 C  CG  . TYR A 1 247 ? 26.220  -7.068  0.396   1.00 51.50  ? 198 TYR A CG  1 
ATOM   1569 C  CD1 . TYR A 1 247 ? 27.392  -7.727  0.768   1.00 53.44  ? 198 TYR A CD1 1 
ATOM   1570 C  CD2 . TYR A 1 247 ? 25.511  -7.542  -0.710  1.00 50.18  ? 198 TYR A CD2 1 
ATOM   1571 C  CE1 . TYR A 1 247 ? 27.855  -8.819  0.057   1.00 53.80  ? 198 TYR A CE1 1 
ATOM   1572 C  CE2 . TYR A 1 247 ? 25.968  -8.632  -1.428  1.00 52.46  ? 198 TYR A CE2 1 
ATOM   1573 C  CZ  . TYR A 1 247 ? 27.144  -9.261  -1.038  1.00 54.44  ? 198 TYR A CZ  1 
ATOM   1574 O  OH  . TYR A 1 247 ? 27.625  -10.344 -1.725  1.00 54.24  ? 198 TYR A OH  1 
ATOM   1575 N  N   . TYR A 1 248 ? 24.334  -3.262  1.642   1.00 45.65  ? 199 TYR A N   1 
ATOM   1576 C  CA  . TYR A 1 248 ? 23.734  -2.446  2.684   1.00 46.79  ? 199 TYR A CA  1 
ATOM   1577 C  C   . TYR A 1 248 ? 23.545  -3.273  3.936   1.00 47.51  ? 199 TYR A C   1 
ATOM   1578 O  O   . TYR A 1 248 ? 22.465  -3.808  4.152   1.00 56.57  ? 199 TYR A O   1 
ATOM   1579 C  CB  . TYR A 1 248 ? 22.417  -1.845  2.205   1.00 43.39  ? 199 TYR A CB  1 
ATOM   1580 C  CG  . TYR A 1 248 ? 22.657  -0.712  1.240   1.00 43.80  ? 199 TYR A CG  1 
ATOM   1581 C  CD1 . TYR A 1 248 ? 22.995  0.574   1.712   1.00 43.50  ? 199 TYR A CD1 1 
ATOM   1582 C  CD2 . TYR A 1 248 ? 22.584  -0.918  -0.144  1.00 38.62  ? 199 TYR A CD2 1 
ATOM   1583 C  CE1 . TYR A 1 248 ? 23.228  1.620   0.828   1.00 43.00  ? 199 TYR A CE1 1 
ATOM   1584 C  CE2 . TYR A 1 248 ? 22.817  0.126   -1.031  1.00 39.00  ? 199 TYR A CE2 1 
ATOM   1585 C  CZ  . TYR A 1 248 ? 23.137  1.382   -0.545  1.00 40.39  ? 199 TYR A CZ  1 
ATOM   1586 O  OH  . TYR A 1 248 ? 23.382  2.413   -1.404  1.00 40.06  ? 199 TYR A OH  1 
ATOM   1587 N  N   . GLU A 1 249 ? 24.590  -3.387  4.756   1.00 44.84  ? 200 GLU A N   1 
ATOM   1588 C  CA  . GLU A 1 249 ? 24.578  -4.369  5.850   1.00 45.80  ? 200 GLU A CA  1 
ATOM   1589 C  C   . GLU A 1 249 ? 24.015  -3.785  7.139   1.00 44.82  ? 200 GLU A C   1 
ATOM   1590 O  O   . GLU A 1 249 ? 24.414  -2.689  7.533   1.00 48.97  ? 200 GLU A O   1 
ATOM   1591 C  CB  . GLU A 1 249 ? 25.966  -4.984  6.076   1.00 46.08  ? 200 GLU A CB  1 
ATOM   1592 C  CG  . GLU A 1 249 ? 25.992  -6.173  7.038   1.00 50.30  ? 200 GLU A CG  1 
ATOM   1593 C  CD  . GLU A 1 249 ? 27.387  -6.491  7.585   1.00 55.25  ? 200 GLU A CD  1 
ATOM   1594 O  OE1 . GLU A 1 249 ? 28.358  -5.851  7.154   1.00 59.48  ? 200 GLU A OE1 1 
ATOM   1595 O  OE2 . GLU A 1 249 ? 27.529  -7.388  8.449   1.00 56.07  ? 200 GLU A OE2 1 
ATOM   1596 N  N   . VAL A 1 250 ? 23.079  -4.507  7.769   1.00 43.80  ? 201 VAL A N   1 
ATOM   1597 C  CA  . VAL A 1 250 ? 22.458  -4.092  9.038   1.00 42.16  ? 201 VAL A CA  1 
ATOM   1598 C  C   . VAL A 1 250 ? 22.572  -5.207  10.082  1.00 47.75  ? 201 VAL A C   1 
ATOM   1599 O  O   . VAL A 1 250 ? 23.001  -6.328  9.755   1.00 47.78  ? 201 VAL A O   1 
ATOM   1600 C  CB  . VAL A 1 250 ? 20.961  -3.808  8.867   1.00 42.37  ? 201 VAL A CB  1 
ATOM   1601 C  CG1 . VAL A 1 250 ? 20.714  -2.608  7.962   1.00 40.54  ? 201 VAL A CG1 1 
ATOM   1602 C  CG2 . VAL A 1 250 ? 20.243  -5.056  8.355   1.00 39.81  ? 201 VAL A CG2 1 
ATOM   1603 N  N   . ILE A 1 251 ? 22.159  -4.913  11.323  1.00 45.06  ? 202 ILE A N   1 
ATOM   1604 C  CA  . ILE A 1 251 ? 22.195  -5.909  12.395  1.00 43.77  ? 202 ILE A CA  1 
ATOM   1605 C  C   . ILE A 1 251 ? 20.803  -6.117  13.022  1.00 46.28  ? 202 ILE A C   1 
ATOM   1606 O  O   . ILE A 1 251 ? 20.183  -5.156  13.510  1.00 39.19  ? 202 ILE A O   1 
ATOM   1607 C  CB  . ILE A 1 251 ? 23.270  -5.548  13.468  1.00 44.39  ? 202 ILE A CB  1 
ATOM   1608 C  CG1 . ILE A 1 251 ? 24.675  -5.756  12.897  1.00 46.83  ? 202 ILE A CG1 1 
ATOM   1609 C  CG2 . ILE A 1 251 ? 23.117  -6.383  14.737  1.00 40.70  ? 202 ILE A CG2 1 
ATOM   1610 C  CD1 . ILE A 1 251 ? 25.792  -5.215  13.772  1.00 53.60  ? 202 ILE A CD1 1 
ATOM   1611 N  N   . ILE A 1 252 ? 20.336  -7.375  12.995  1.00 42.48  ? 203 ILE A N   1 
ATOM   1612 C  CA  . ILE A 1 252 ? 19.094  -7.798  13.646  1.00 41.47  ? 203 ILE A CA  1 
ATOM   1613 C  C   . ILE A 1 252 ? 19.389  -8.354  15.036  1.00 45.69  ? 203 ILE A C   1 
ATOM   1614 O  O   . ILE A 1 252 ? 20.208  -9.263  15.187  1.00 51.41  ? 203 ILE A O   1 
ATOM   1615 C  CB  . ILE A 1 252 ? 18.364  -8.881  12.814  1.00 42.10  ? 203 ILE A CB  1 
ATOM   1616 C  CG1 . ILE A 1 252 ? 18.148  -8.383  11.371  1.00 41.25  ? 203 ILE A CG1 1 
ATOM   1617 C  CG2 . ILE A 1 252 ? 17.046  -9.291  13.477  1.00 37.43  ? 203 ILE A CG2 1 
ATOM   1618 C  CD1 . ILE A 1 252 ? 17.587  -9.439  10.450  1.00 37.33  ? 203 ILE A CD1 1 
ATOM   1619 N  N   . VAL A 1 253 ? 18.697  -7.834  16.043  1.00 45.88  ? 204 VAL A N   1 
ATOM   1620 C  CA  . VAL A 1 253 ? 18.985  -8.170  17.433  1.00 46.33  ? 204 VAL A CA  1 
ATOM   1621 C  C   . VAL A 1 253 ? 17.937  -9.051  18.121  1.00 46.45  ? 204 VAL A C   1 
ATOM   1622 O  O   . VAL A 1 253 ? 18.193  -9.603  19.195  1.00 46.82  ? 204 VAL A O   1 
ATOM   1623 C  CB  . VAL A 1 253 ? 19.245  -6.902  18.277  1.00 47.64  ? 204 VAL A CB  1 
ATOM   1624 C  CG1 . VAL A 1 253 ? 20.378  -6.093  17.662  1.00 48.63  ? 204 VAL A CG1 1 
ATOM   1625 C  CG2 . VAL A 1 253 ? 17.988  -6.058  18.405  1.00 47.67  ? 204 VAL A CG2 1 
ATOM   1626 N  N   . ARG A 1 254 ? 16.770  -9.197  17.497  1.00 46.62  ? 205 ARG A N   1 
ATOM   1627 C  CA  . ARG A 1 254 ? 15.665  -9.974  18.067  1.00 45.35  ? 205 ARG A CA  1 
ATOM   1628 C  C   . ARG A 1 254 ? 14.631  -10.280 16.983  1.00 45.33  ? 205 ARG A C   1 
ATOM   1629 O  O   . ARG A 1 254 ? 14.357  -9.439  16.121  1.00 42.30  ? 205 ARG A O   1 
ATOM   1630 C  CB  . ARG A 1 254 ? 15.036  -9.215  19.258  1.00 45.49  ? 205 ARG A CB  1 
ATOM   1631 C  CG  . ARG A 1 254 ? 13.853  -9.888  19.939  1.00 44.84  ? 205 ARG A CG  1 
ATOM   1632 C  CD  . ARG A 1 254 ? 13.275  -8.970  21.011  1.00 44.87  ? 205 ARG A CD  1 
ATOM   1633 N  NE  . ARG A 1 254 ? 11.963  -9.404  21.505  1.00 44.99  ? 205 ARG A NE  1 
ATOM   1634 C  CZ  . ARG A 1 254 ? 11.767  -10.249 22.514  1.00 48.52  ? 205 ARG A CZ  1 
ATOM   1635 N  NH1 . ARG A 1 254 ? 12.798  -10.783 23.169  1.00 47.92  ? 205 ARG A NH1 1 
ATOM   1636 N  NH2 . ARG A 1 254 ? 10.531  -10.558 22.870  1.00 46.03  ? 205 ARG A NH2 1 
ATOM   1637 N  N   . VAL A 1 255 ? 14.094  -11.500 17.013  1.00 44.63  ? 206 VAL A N   1 
ATOM   1638 C  CA  . VAL A 1 255 ? 12.978  -11.875 16.157  1.00 43.86  ? 206 VAL A CA  1 
ATOM   1639 C  C   . VAL A 1 255 ? 11.762  -12.363 16.975  1.00 44.97  ? 206 VAL A C   1 
ATOM   1640 O  O   . VAL A 1 255 ? 11.914  -13.069 17.985  1.00 43.40  ? 206 VAL A O   1 
ATOM   1641 C  CB  . VAL A 1 255 ? 13.398  -12.900 15.087  1.00 46.02  ? 206 VAL A CB  1 
ATOM   1642 C  CG1 . VAL A 1 255 ? 12.208  -13.293 14.207  1.00 44.86  ? 206 VAL A CG1 1 
ATOM   1643 C  CG2 . VAL A 1 255 ? 14.534  -12.335 14.237  1.00 43.32  ? 206 VAL A CG2 1 
ATOM   1644 N  N   . GLU A 1 256 ? 10.566  -11.959 16.535  1.00 42.85  ? 207 GLU A N   1 
ATOM   1645 C  CA  . GLU A 1 256 ? 9.321   -12.397 17.133  1.00 42.34  ? 207 GLU A CA  1 
ATOM   1646 C  C   . GLU A 1 256 ? 8.336   -12.906 16.097  1.00 42.80  ? 207 GLU A C   1 
ATOM   1647 O  O   . GLU A 1 256 ? 8.260   -12.378 15.001  1.00 46.31  ? 207 GLU A O   1 
ATOM   1648 C  CB  . GLU A 1 256 ? 8.667   -11.246 17.857  1.00 47.12  ? 207 GLU A CB  1 
ATOM   1649 C  CG  . GLU A 1 256 ? 9.212   -10.970 19.236  1.00 52.54  ? 207 GLU A CG  1 
ATOM   1650 C  CD  . GLU A 1 256 ? 8.702   -9.650  19.769  1.00 52.74  ? 207 GLU A CD  1 
ATOM   1651 O  OE1 . GLU A 1 256 ? 7.643   -9.167  19.300  1.00 50.28  ? 207 GLU A OE1 1 
ATOM   1652 O  OE2 . GLU A 1 256 ? 9.360   -9.101  20.659  1.00 50.98  ? 207 GLU A OE2 1 
ATOM   1653 N  N   . ILE A 1 257 ? 7.575   -13.930 16.469  1.00 44.39  ? 208 ILE A N   1 
ATOM   1654 C  CA  . ILE A 1 257 ? 6.405   -14.347 15.721  1.00 44.72  ? 208 ILE A CA  1 
ATOM   1655 C  C   . ILE A 1 257 ? 5.195   -14.166 16.650  1.00 46.42  ? 208 ILE A C   1 
ATOM   1656 O  O   . ILE A 1 257 ? 5.176   -14.682 17.774  1.00 42.81  ? 208 ILE A O   1 
ATOM   1657 C  CB  . ILE A 1 257 ? 6.520   -15.809 15.259  1.00 43.21  ? 208 ILE A CB  1 
ATOM   1658 C  CG1 . ILE A 1 257 ? 7.938   -16.132 14.756  1.00 44.90  ? 208 ILE A CG1 1 
ATOM   1659 C  CG2 . ILE A 1 257 ? 5.500   -16.089 14.182  1.00 40.89  ? 208 ILE A CG2 1 
ATOM   1660 C  CD1 . ILE A 1 257 ? 8.309   -15.567 13.400  1.00 41.46  ? 208 ILE A CD1 1 
ATOM   1661 N  N   . ASN A 1 258 ? 4.206   -13.397 16.196  1.00 44.27  ? 209 ASN A N   1 
ATOM   1662 C  CA  . ASN A 1 258 ? 3.087   -13.008 17.047  1.00 42.97  ? 209 ASN A CA  1 
ATOM   1663 C  C   . ASN A 1 258 ? 3.531   -12.763 18.495  1.00 45.55  ? 209 ASN A C   1 
ATOM   1664 O  O   . ASN A 1 258 ? 2.944   -13.289 19.446  1.00 47.38  ? 209 ASN A O   1 
ATOM   1665 C  CB  . ASN A 1 258 ? 1.937   -14.028 16.976  1.00 43.62  ? 209 ASN A CB  1 
ATOM   1666 C  CG  . ASN A 1 258 ? 0.860   -13.641 15.975  1.00 43.84  ? 209 ASN A CG  1 
ATOM   1667 O  OD1 . ASN A 1 258 ? 0.922   -12.583 15.334  1.00 46.12  ? 209 ASN A OD1 1 
ATOM   1668 N  ND2 . ASN A 1 258 ? -0.141  -14.494 15.840  1.00 40.08  ? 209 ASN A ND2 1 
ATOM   1669 N  N   . GLY A 1 259 ? 4.587   -11.970 18.646  1.00 42.83  ? 210 GLY A N   1 
ATOM   1670 C  CA  . GLY A 1 259 ? 5.009   -11.502 19.952  1.00 43.00  ? 210 GLY A CA  1 
ATOM   1671 C  C   . GLY A 1 259 ? 5.920   -12.471 20.665  1.00 45.92  ? 210 GLY A C   1 
ATOM   1672 O  O   . GLY A 1 259 ? 6.597   -12.093 21.620  1.00 43.04  ? 210 GLY A O   1 
ATOM   1673 N  N   . GLN A 1 260 ? 5.934   -13.721 20.201  1.00 44.41  ? 211 GLN A N   1 
ATOM   1674 C  CA  . GLN A 1 260 ? 6.727   -14.744 20.836  1.00 41.39  ? 211 GLN A CA  1 
ATOM   1675 C  C   . GLN A 1 260 ? 8.170   -14.707 20.310  1.00 43.27  ? 211 GLN A C   1 
ATOM   1676 O  O   . GLN A 1 260 ? 8.425   -14.967 19.131  1.00 40.86  ? 211 GLN A O   1 
ATOM   1677 C  CB  . GLN A 1 260 ? 6.085   -16.106 20.616  1.00 42.46  ? 211 GLN A CB  1 
ATOM   1678 C  CG  . GLN A 1 260 ? 6.726   -17.213 21.434  1.00 49.81  ? 211 GLN A CG  1 
ATOM   1679 C  CD  . GLN A 1 260 ? 6.079   -18.558 21.204  1.00 55.24  ? 211 GLN A CD  1 
ATOM   1680 O  OE1 . GLN A 1 260 ? 5.430   -18.777 20.177  1.00 61.52  ? 211 GLN A OE1 1 
ATOM   1681 N  NE2 . GLN A 1 260 ? 6.263   -19.474 22.153  1.00 57.15  ? 211 GLN A NE2 1 
ATOM   1682 N  N   . ASP A 1 261 ? 9.102   -14.380 21.204  1.00 44.43  ? 212 ASP A N   1 
ATOM   1683 C  CA  . ASP A 1 261 ? 10.535  -14.402 20.930  1.00 44.46  ? 212 ASP A CA  1 
ATOM   1684 C  C   . ASP A 1 261 ? 10.958  -15.781 20.400  1.00 48.14  ? 212 ASP A C   1 
ATOM   1685 O  O   . ASP A 1 261 ? 10.745  -16.802 21.066  1.00 44.81  ? 212 ASP A O   1 
ATOM   1686 C  CB  . ASP A 1 261 ? 11.267  -14.078 22.235  1.00 45.24  ? 212 ASP A CB  1 
ATOM   1687 C  CG  . ASP A 1 261 ? 12.806  -14.058 22.095  1.00 48.00  ? 212 ASP A CG  1 
ATOM   1688 O  OD1 . ASP A 1 261 ? 13.344  -13.910 20.969  1.00 46.72  ? 212 ASP A OD1 1 
ATOM   1689 O  OD2 . ASP A 1 261 ? 13.491  -14.186 23.150  1.00 47.29  ? 212 ASP A OD2 1 
ATOM   1690 N  N   . LEU A 1 262 ? 11.532  -15.802 19.196  1.00 47.83  ? 213 LEU A N   1 
ATOM   1691 C  CA  . LEU A 1 262 ? 12.123  -17.009 18.619  1.00 48.29  ? 213 LEU A CA  1 
ATOM   1692 C  C   . LEU A 1 262 ? 13.254  -17.538 19.518  1.00 49.57  ? 213 LEU A C   1 
ATOM   1693 O  O   . LEU A 1 262 ? 13.564  -18.725 19.507  1.00 52.42  ? 213 LEU A O   1 
ATOM   1694 C  CB  . LEU A 1 262 ? 12.657  -16.701 17.220  1.00 49.54  ? 213 LEU A CB  1 
ATOM   1695 C  CG  . LEU A 1 262 ? 12.560  -17.743 16.117  1.00 49.10  ? 213 LEU A CG  1 
ATOM   1696 C  CD1 . LEU A 1 262 ? 11.138  -18.248 15.984  1.00 48.57  ? 213 LEU A CD1 1 
ATOM   1697 C  CD2 . LEU A 1 262 ? 13.014  -17.117 14.806  1.00 49.49  ? 213 LEU A CD2 1 
ATOM   1698 N  N   . LYS A 1 263 ? 13.851  -16.642 20.303  1.00 51.80  ? 214 LYS A N   1 
ATOM   1699 C  CA  . LYS A 1 263 ? 14.813  -16.979 21.377  1.00 56.85  ? 214 LYS A CA  1 
ATOM   1700 C  C   . LYS A 1 263 ? 16.109  -17.668 20.949  1.00 57.68  ? 214 LYS A C   1 
ATOM   1701 O  O   . LYS A 1 263 ? 16.717  -18.397 21.720  1.00 59.42  ? 214 LYS A O   1 
ATOM   1702 C  CB  . LYS A 1 263 ? 14.159  -17.726 22.556  1.00 56.28  ? 214 LYS A CB  1 
ATOM   1703 C  CG  . LYS A 1 263 ? 14.710  -17.214 23.873  1.00 60.34  ? 214 LYS A CG  1 
ATOM   1704 C  CD  . LYS A 1 263 ? 14.333  -18.035 25.086  1.00 68.45  ? 214 LYS A CD  1 
ATOM   1705 C  CE  . LYS A 1 263 ? 14.932  -17.368 26.325  1.00 70.09  ? 214 LYS A CE  1 
ATOM   1706 N  NZ  . LYS A 1 263 ? 14.725  -18.163 27.570  1.00 71.55  ? 214 LYS A NZ  1 
ATOM   1707 N  N   . MET A 1 264 ? 16.539  -17.409 19.725  1.00 62.04  ? 215 MET A N   1 
ATOM   1708 C  CA  . MET A 1 264 ? 17.853  -17.826 19.278  1.00 58.27  ? 215 MET A CA  1 
ATOM   1709 C  C   . MET A 1 264 ? 18.903  -16.804 19.701  1.00 57.75  ? 215 MET A C   1 
ATOM   1710 O  O   . MET A 1 264 ? 18.590  -15.637 19.935  1.00 56.83  ? 215 MET A O   1 
ATOM   1711 C  CB  . MET A 1 264 ? 17.857  -17.993 17.769  1.00 55.31  ? 215 MET A CB  1 
ATOM   1712 C  CG  . MET A 1 264 ? 16.887  -19.049 17.298  1.00 57.50  ? 215 MET A CG  1 
ATOM   1713 S  SD  . MET A 1 264 ? 16.916  -19.153 15.506  1.00 61.48  ? 215 MET A SD  1 
ATOM   1714 C  CE  . MET A 1 264 ? 18.397  -20.108 15.208  1.00 64.47  ? 215 MET A CE  1 
ATOM   1715 N  N   . ASP A 1 265 ? 20.140  -17.269 19.825  1.00 58.95  ? 216 ASP A N   1 
ATOM   1716 C  CA  . ASP A 1 265 ? 21.314  -16.416 19.983  1.00 61.00  ? 216 ASP A CA  1 
ATOM   1717 C  C   . ASP A 1 265 ? 21.372  -15.435 18.798  1.00 60.58  ? 216 ASP A C   1 
ATOM   1718 O  O   . ASP A 1 265 ? 21.399  -15.885 17.648  1.00 56.72  ? 216 ASP A O   1 
ATOM   1719 C  CB  . ASP A 1 265 ? 22.527  -17.352 20.009  1.00 64.01  ? 216 ASP A CB  1 
ATOM   1720 C  CG  . ASP A 1 265 ? 23.866  -16.628 19.981  1.00 71.45  ? 216 ASP A CG  1 
ATOM   1721 O  OD1 . ASP A 1 265 ? 23.947  -15.378 20.051  1.00 66.51  ? 216 ASP A OD1 1 
ATOM   1722 O  OD2 . ASP A 1 265 ? 24.875  -17.356 19.891  1.00 83.63  ? 216 ASP A OD2 1 
ATOM   1723 N  N   . CYS A 1 266 ? 21.386  -14.119 19.065  1.00 56.85  ? 217 CYS A N   1 
ATOM   1724 C  CA  . CYS A 1 266 ? 21.196  -13.110 17.993  1.00 56.31  ? 217 CYS A CA  1 
ATOM   1725 C  C   . CYS A 1 266 ? 22.215  -13.174 16.842  1.00 58.39  ? 217 CYS A C   1 
ATOM   1726 O  O   . CYS A 1 266 ? 21.937  -12.692 15.744  1.00 59.60  ? 217 CYS A O   1 
ATOM   1727 C  CB  . CYS A 1 266 ? 21.061  -11.680 18.541  1.00 55.75  ? 217 CYS A CB  1 
ATOM   1728 S  SG  . CYS A 1 266 ? 22.529  -11.036 19.376  1.00 63.55  ? 217 CYS A SG  1 
ATOM   1729 N  N   . LYS A 1 267 ? 23.380  -13.773 17.087  1.00 62.35  ? 218 LYS A N   1 
ATOM   1730 C  CA  . LYS A 1 267 ? 24.371  -14.017 16.028  1.00 62.40  ? 218 LYS A CA  1 
ATOM   1731 C  C   . LYS A 1 267 ? 23.815  -14.844 14.881  1.00 61.12  ? 218 LYS A C   1 
ATOM   1732 O  O   . LYS A 1 267 ? 24.283  -14.706 13.750  1.00 57.50  ? 218 LYS A O   1 
ATOM   1733 C  CB  . LYS A 1 267 ? 25.628  -14.702 16.569  1.00 64.55  ? 218 LYS A CB  1 
ATOM   1734 C  CG  . LYS A 1 267 ? 26.875  -13.825 16.563  1.00 70.56  ? 218 LYS A CG  1 
ATOM   1735 C  CD  . LYS A 1 267 ? 27.865  -14.297 17.626  1.00 76.64  ? 218 LYS A CD  1 
ATOM   1736 C  CE  . LYS A 1 267 ? 29.254  -13.697 17.445  1.00 71.77  ? 218 LYS A CE  1 
ATOM   1737 N  NZ  . LYS A 1 267 ? 29.311  -12.226 17.675  1.00 72.85  ? 218 LYS A NZ  1 
ATOM   1738 N  N   . GLU A 1 268 ? 22.839  -15.712 15.171  1.00 59.27  ? 219 GLU A N   1 
ATOM   1739 C  CA  . GLU A 1 268 ? 22.207  -16.544 14.129  1.00 62.64  ? 219 GLU A CA  1 
ATOM   1740 C  C   . GLU A 1 268 ? 21.433  -15.712 13.123  1.00 60.32  ? 219 GLU A C   1 
ATOM   1741 O  O   . GLU A 1 268 ? 21.496  -15.971 11.922  1.00 62.48  ? 219 GLU A O   1 
ATOM   1742 C  CB  . GLU A 1 268 ? 21.280  -17.591 14.734  1.00 62.48  ? 219 GLU A CB  1 
ATOM   1743 C  CG  . GLU A 1 268 ? 21.969  -18.551 15.689  1.00 66.28  ? 219 GLU A CG  1 
ATOM   1744 C  CD  . GLU A 1 268 ? 22.906  -19.512 14.985  1.00 65.86  ? 219 GLU A CD  1 
ATOM   1745 O  OE1 . GLU A 1 268 ? 22.883  -19.600 13.731  1.00 67.46  ? 219 GLU A OE1 1 
ATOM   1746 O  OE2 . GLU A 1 268 ? 23.658  -20.194 15.704  1.00 69.91  ? 219 GLU A OE2 1 
ATOM   1747 N  N   . TYR A 1 269 ? 20.720  -14.704 13.633  1.00 58.23  ? 220 TYR A N   1 
ATOM   1748 C  CA  . TYR A 1 269 ? 19.952  -13.758 12.815  1.00 50.60  ? 220 TYR A CA  1 
ATOM   1749 C  C   . TYR A 1 269 ? 20.803  -13.042 11.772  1.00 48.92  ? 220 TYR A C   1 
ATOM   1750 O  O   . TYR A 1 269 ? 20.289  -12.666 10.710  1.00 48.77  ? 220 TYR A O   1 
ATOM   1751 C  CB  . TYR A 1 269 ? 19.249  -12.726 13.690  1.00 46.77  ? 220 TYR A CB  1 
ATOM   1752 C  CG  . TYR A 1 269 ? 18.346  -13.335 14.725  1.00 47.11  ? 220 TYR A CG  1 
ATOM   1753 C  CD1 . TYR A 1 269 ? 17.626  -14.493 14.452  1.00 44.99  ? 220 TYR A CD1 1 
ATOM   1754 C  CD2 . TYR A 1 269 ? 18.201  -12.744 15.980  1.00 46.18  ? 220 TYR A CD2 1 
ATOM   1755 C  CE1 . TYR A 1 269 ? 16.792  -15.054 15.404  1.00 48.29  ? 220 TYR A CE1 1 
ATOM   1756 C  CE2 . TYR A 1 269 ? 17.368  -13.294 16.936  1.00 48.45  ? 220 TYR A CE2 1 
ATOM   1757 C  CZ  . TYR A 1 269 ? 16.667  -14.451 16.644  1.00 49.56  ? 220 TYR A CZ  1 
ATOM   1758 O  OH  . TYR A 1 269 ? 15.835  -15.004 17.591  1.00 50.86  ? 220 TYR A OH  1 
ATOM   1759 N  N   . ASN A 1 270 ? 22.090  -12.862 12.064  1.00 43.57  ? 221 ASN A N   1 
ATOM   1760 C  CA  . ASN A 1 270 ? 22.995  -12.205 11.130  1.00 46.84  ? 221 ASN A CA  1 
ATOM   1761 C  C   . ASN A 1 270 ? 24.155  -13.073 10.633  1.00 46.61  ? 221 ASN A C   1 
ATOM   1762 O  O   . ASN A 1 270 ? 25.233  -12.559 10.346  1.00 49.97  ? 221 ASN A O   1 
ATOM   1763 C  CB  . ASN A 1 270 ? 23.544  -10.920 11.752  1.00 48.13  ? 221 ASN A CB  1 
ATOM   1764 C  CG  . ASN A 1 270 ? 22.471  -10.099 12.411  1.00 48.66  ? 221 ASN A CG  1 
ATOM   1765 O  OD1 . ASN A 1 270 ? 21.621  -9.517  11.729  1.00 48.79  ? 221 ASN A OD1 1 
ATOM   1766 N  ND2 . ASN A 1 270 ? 22.486  -10.058 13.752  1.00 47.47  ? 221 ASN A ND2 1 
ATOM   1767 N  N   . TYR A 1 271 ? 23.946  -14.378 10.547  1.00 49.98  ? 222 TYR A N   1 
ATOM   1768 C  CA  . TYR A 1 271 ? 25.001  -15.272 10.135  1.00 52.01  ? 222 TYR A CA  1 
ATOM   1769 C  C   . TYR A 1 271 ? 24.830  -15.618 8.663   1.00 54.06  ? 222 TYR A C   1 
ATOM   1770 O  O   . TYR A 1 271 ? 23.836  -16.257 8.334   1.00 55.95  ? 222 TYR A O   1 
ATOM   1771 C  CB  . TYR A 1 271 ? 24.916  -16.537 10.970  1.00 57.98  ? 222 TYR A CB  1 
ATOM   1772 C  CG  . TYR A 1 271 ? 25.801  -17.644 10.463  1.00 63.84  ? 222 TYR A CG  1 
ATOM   1773 C  CD1 . TYR A 1 271 ? 27.181  -17.458 10.353  1.00 62.87  ? 222 TYR A CD1 1 
ATOM   1774 C  CD2 . TYR A 1 271 ? 25.264  -18.877 10.096  1.00 65.82  ? 222 TYR A CD2 1 
ATOM   1775 C  CE1 . TYR A 1 271 ? 28.002  -18.469 9.893   1.00 66.13  ? 222 TYR A CE1 1 
ATOM   1776 C  CE2 . TYR A 1 271 ? 26.081  -19.900 9.635   1.00 69.10  ? 222 TYR A CE2 1 
ATOM   1777 C  CZ  . TYR A 1 271 ? 27.449  -19.685 9.535   1.00 68.87  ? 222 TYR A CZ  1 
ATOM   1778 O  OH  . TYR A 1 271 ? 28.277  -20.684 9.080   1.00 69.96  ? 222 TYR A OH  1 
ATOM   1779 N  N   . ASP A 1 272 ? 25.752  -15.228 7.768   1.00 49.39  ? 223 ASP A N   1 
ATOM   1780 C  CA  . ASP A 1 272 ? 26.988  -14.478 8.060   1.00 50.56  ? 223 ASP A CA  1 
ATOM   1781 C  C   . ASP A 1 272 ? 26.881  -12.957 7.842   1.00 52.51  ? 223 ASP A C   1 
ATOM   1782 O  O   . ASP A 1 272 ? 27.829  -12.221 8.120   1.00 50.33  ? 223 ASP A O   1 
ATOM   1783 C  CB  . ASP A 1 272 ? 28.170  -15.013 7.224   1.00 54.26  ? 223 ASP A CB  1 
ATOM   1784 C  CG  . ASP A 1 272 ? 27.849  -15.124 5.722   1.00 59.92  ? 223 ASP A CG  1 
ATOM   1785 O  OD1 . ASP A 1 272 ? 26.679  -15.341 5.355   1.00 60.73  ? 223 ASP A OD1 1 
ATOM   1786 O  OD2 . ASP A 1 272 ? 28.775  -15.027 4.896   1.00 66.55  ? 223 ASP A OD2 1 
ATOM   1787 N  N   . LYS A 1 273 ? 25.740  -12.488 7.338   1.00 49.62  ? 224 LYS A N   1 
ATOM   1788 C  CA  . LYS A 1 273 ? 25.468  -11.043 7.208   1.00 47.27  ? 224 LYS A CA  1 
ATOM   1789 C  C   . LYS A 1 273 ? 23.972  -10.848 7.137   1.00 46.63  ? 224 LYS A C   1 
ATOM   1790 O  O   . LYS A 1 273 ? 23.230  -11.811 6.899   1.00 47.58  ? 224 LYS A O   1 
ATOM   1791 C  CB  . LYS A 1 273 ? 26.135  -10.423 5.964   1.00 42.59  ? 224 LYS A CB  1 
ATOM   1792 C  CG  . LYS A 1 273 ? 25.653  -10.989 4.640   1.00 45.81  ? 224 LYS A CG  1 
ATOM   1793 C  CD  . LYS A 1 273 ? 26.423  -10.451 3.433   1.00 46.38  ? 224 LYS A CD  1 
ATOM   1794 C  CE  . LYS A 1 273 ? 25.898  -11.082 2.138   1.00 48.45  ? 224 LYS A CE  1 
ATOM   1795 N  NZ  . LYS A 1 273 ? 26.371  -12.485 1.910   1.00 46.04  ? 224 LYS A NZ  1 
ATOM   1796 N  N   . SER A 1 274 ? 23.535  -9.612  7.360   1.00 46.33  ? 225 SER A N   1 
ATOM   1797 C  CA  . SER A 1 274 ? 22.169  -9.209  7.069   1.00 46.31  ? 225 SER A CA  1 
ATOM   1798 C  C   . SER A 1 274 ? 22.164  -7.983  6.168   1.00 44.79  ? 225 SER A C   1 
ATOM   1799 O  O   . SER A 1 274 ? 22.753  -6.949  6.503   1.00 46.57  ? 225 SER A O   1 
ATOM   1800 C  CB  . SER A 1 274 ? 21.387  -8.928  8.354   1.00 45.33  ? 225 SER A CB  1 
ATOM   1801 O  OG  . SER A 1 274 ? 21.252  -10.112 9.104   1.00 47.98  ? 225 SER A OG  1 
ATOM   1802 N  N   . ILE A 1 275 ? 21.456  -8.092  5.048   1.00 43.71  ? 226 ILE A N   1 
ATOM   1803 C  CA  . ILE A 1 275 ? 21.393  -7.022  4.067   1.00 42.61  ? 226 ILE A CA  1 
ATOM   1804 C  C   . ILE A 1 275 ? 19.959  -6.667  3.680   1.00 45.24  ? 226 ILE A C   1 
ATOM   1805 O  O   . ILE A 1 275 ? 19.051  -7.508  3.754   1.00 44.77  ? 226 ILE A O   1 
ATOM   1806 C  CB  . ILE A 1 275 ? 22.226  -7.365  2.806   1.00 42.34  ? 226 ILE A CB  1 
ATOM   1807 C  CG1 . ILE A 1 275 ? 21.506  -8.365  1.917   1.00 41.84  ? 226 ILE A CG1 1 
ATOM   1808 C  CG2 . ILE A 1 275 ? 23.603  -7.900  3.193   1.00 41.48  ? 226 ILE A CG2 1 
ATOM   1809 C  CD1 . ILE A 1 275 ? 22.194  -8.595  0.587   1.00 46.22  ? 226 ILE A CD1 1 
ATOM   1810 N  N   . VAL A 1 276 ? 19.770  -5.406  3.292   1.00 44.66  ? 227 VAL A N   1 
ATOM   1811 C  CA  . VAL A 1 276 ? 18.536  -4.944  2.670   1.00 45.26  ? 227 VAL A CA  1 
ATOM   1812 C  C   . VAL A 1 276 ? 18.765  -5.009  1.165   1.00 45.99  ? 227 VAL A C   1 
ATOM   1813 O  O   . VAL A 1 276 ? 19.718  -4.408  0.663   1.00 47.92  ? 227 VAL A O   1 
ATOM   1814 C  CB  . VAL A 1 276 ? 18.205  -3.491  3.075   1.00 43.81  ? 227 VAL A CB  1 
ATOM   1815 C  CG1 . VAL A 1 276 ? 16.923  -3.031  2.405   1.00 40.39  ? 227 VAL A CG1 1 
ATOM   1816 C  CG2 . VAL A 1 276 ? 18.092  -3.380  4.587   1.00 43.06  ? 227 VAL A CG2 1 
ATOM   1817 N  N   . ASP A 1 277 ? 17.907  -5.740  0.449   1.00 44.96  ? 228 ASP A N   1 
ATOM   1818 C  CA  . ASP A 1 277 ? 18.186  -6.079  -0.952  1.00 46.39  ? 228 ASP A CA  1 
ATOM   1819 C  C   . ASP A 1 277 ? 16.950  -6.124  -1.845  1.00 45.82  ? 228 ASP A C   1 
ATOM   1820 O  O   . ASP A 1 277 ? 16.283  -7.160  -1.941  1.00 46.58  ? 228 ASP A O   1 
ATOM   1821 C  CB  . ASP A 1 277 ? 18.922  -7.428  -1.024  1.00 48.28  ? 228 ASP A CB  1 
ATOM   1822 C  CG  . ASP A 1 277 ? 19.177  -7.883  -2.455  1.00 53.24  ? 228 ASP A CG  1 
ATOM   1823 O  OD1 . ASP A 1 277 ? 19.084  -7.036  -3.378  1.00 47.39  ? 228 ASP A OD1 1 
ATOM   1824 O  OD2 . ASP A 1 277 ? 19.460  -9.095  -2.651  1.00 54.39  ? 228 ASP A OD2 1 
ATOM   1825 N  N   . SER A 1 278 ? 16.673  -5.015  -2.523  1.00 43.19  ? 229 SER A N   1 
ATOM   1826 C  CA  . SER A 1 278 ? 15.528  -4.923  -3.455  1.00 43.48  ? 229 SER A CA  1 
ATOM   1827 C  C   . SER A 1 278 ? 15.622  -5.811  -4.703  1.00 44.02  ? 229 SER A C   1 
ATOM   1828 O  O   . SER A 1 278 ? 14.644  -5.918  -5.434  1.00 47.01  ? 229 SER A O   1 
ATOM   1829 C  CB  . SER A 1 278 ? 15.360  -3.494  -3.938  1.00 39.97  ? 229 SER A CB  1 
ATOM   1830 O  OG  . SER A 1 278 ? 16.440  -3.205  -4.800  1.00 39.11  ? 229 SER A OG  1 
ATOM   1831 N  N   . GLY A 1 279 ? 16.784  -6.408  -4.966  1.00 42.57  ? 230 GLY A N   1 
ATOM   1832 C  CA  . GLY A 1 279 ? 16.963  -7.306  -6.125  1.00 41.63  ? 230 GLY A CA  1 
ATOM   1833 C  C   . GLY A 1 279 ? 16.692  -8.793  -5.820  1.00 44.90  ? 230 GLY A C   1 
ATOM   1834 O  O   . GLY A 1 279 ? 16.930  -9.667  -6.660  1.00 42.05  ? 230 GLY A O   1 
ATOM   1835 N  N   . THR A 1 280 ? 16.214  -9.072  -4.605  1.00 44.76  ? 231 THR A N   1 
ATOM   1836 C  CA  . THR A 1 280 ? 15.792  -10.402 -4.171  1.00 46.31  ? 231 THR A CA  1 
ATOM   1837 C  C   . THR A 1 280 ? 14.319  -10.309 -3.805  1.00 49.00  ? 231 THR A C   1 
ATOM   1838 O  O   . THR A 1 280 ? 13.876  -9.302  -3.231  1.00 46.33  ? 231 THR A O   1 
ATOM   1839 C  CB  . THR A 1 280 ? 16.592  -10.859 -2.943  1.00 47.37  ? 231 THR A CB  1 
ATOM   1840 O  OG1 . THR A 1 280 ? 17.948  -11.085 -3.331  1.00 51.23  ? 231 THR A OG1 1 
ATOM   1841 C  CG2 . THR A 1 280 ? 16.034  -12.134 -2.366  1.00 52.45  ? 231 THR A CG2 1 
ATOM   1842 N  N   . THR A 1 281 ? 13.560  -11.352 -4.143  1.00 53.86  ? 232 THR A N   1 
ATOM   1843 C  CA  . THR A 1 281 ? 12.104  -11.368 -3.919  1.00 51.79  ? 232 THR A CA  1 
ATOM   1844 C  C   . THR A 1 281 ? 11.763  -11.591 -2.447  1.00 50.78  ? 232 THR A C   1 
ATOM   1845 O  O   . THR A 1 281 ? 11.136  -10.722 -1.815  1.00 48.23  ? 232 THR A O   1 
ATOM   1846 C  CB  . THR A 1 281 ? 11.397  -12.435 -4.793  1.00 49.65  ? 232 THR A CB  1 
ATOM   1847 O  OG1 . THR A 1 281 ? 11.459  -12.041 -6.167  1.00 48.95  ? 232 THR A OG1 1 
ATOM   1848 C  CG2 . THR A 1 281 ? 9.932   -12.600 -4.392  1.00 48.02  ? 232 THR A CG2 1 
ATOM   1849 N  N   . ASN A 1 282 ? 12.195  -12.739 -1.921  1.00 45.93  ? 233 ASN A N   1 
ATOM   1850 C  CA  . ASN A 1 282 ? 11.812  -13.203 -0.600  1.00 44.57  ? 233 ASN A CA  1 
ATOM   1851 C  C   . ASN A 1 282 ? 12.540  -12.536 0.544   1.00 46.27  ? 233 ASN A C   1 
ATOM   1852 O  O   . ASN A 1 282 ? 13.573  -11.872 0.344   1.00 43.46  ? 233 ASN A O   1 
ATOM   1853 C  CB  . ASN A 1 282 ? 12.072  -14.696 -0.486  1.00 46.00  ? 233 ASN A CB  1 
ATOM   1854 C  CG  . ASN A 1 282 ? 11.124  -15.521 -1.318  1.00 47.33  ? 233 ASN A CG  1 
ATOM   1855 O  OD1 . ASN A 1 282 ? 10.156  -15.003 -1.881  1.00 47.63  ? 233 ASN A OD1 1 
ATOM   1856 N  ND2 . ASN A 1 282 ? 11.380  -16.835 -1.380  1.00 49.48  ? 233 ASN A ND2 1 
ATOM   1857 N  N   . LEU A 1 283 ? 11.965  -12.709 1.740   1.00 46.56  ? 234 LEU A N   1 
ATOM   1858 C  CA  . LEU A 1 283 ? 12.691  -12.584 2.991   1.00 46.51  ? 234 LEU A CA  1 
ATOM   1859 C  C   . LEU A 1 283 ? 13.489  -13.877 3.068   1.00 47.74  ? 234 LEU A C   1 
ATOM   1860 O  O   . LEU A 1 283 ? 12.905  -14.956 3.142   1.00 49.02  ? 234 LEU A O   1 
ATOM   1861 C  CB  . LEU A 1 283 ? 11.724  -12.489 4.182   1.00 43.32  ? 234 LEU A CB  1 
ATOM   1862 C  CG  . LEU A 1 283 ? 12.306  -12.631 5.606   1.00 44.57  ? 234 LEU A CG  1 
ATOM   1863 C  CD1 . LEU A 1 283 ? 13.360  -11.566 5.863   1.00 39.90  ? 234 LEU A CD1 1 
ATOM   1864 C  CD2 . LEU A 1 283 ? 11.236  -12.625 6.715   1.00 41.08  ? 234 LEU A CD2 1 
ATOM   1865 N  N   . ARG A 1 284 ? 14.812  -13.788 3.008   1.00 45.97  ? 235 ARG A N   1 
ATOM   1866 C  CA  . ARG A 1 284 ? 15.622  -14.996 3.106   1.00 47.44  ? 235 ARG A CA  1 
ATOM   1867 C  C   . ARG A 1 284 ? 16.294  -15.091 4.474   1.00 46.81  ? 235 ARG A C   1 
ATOM   1868 O  O   . ARG A 1 284 ? 16.793  -14.100 5.006   1.00 48.59  ? 235 ARG A O   1 
ATOM   1869 C  CB  . ARG A 1 284 ? 16.617  -15.074 1.956   1.00 46.15  ? 235 ARG A CB  1 
ATOM   1870 C  CG  . ARG A 1 284 ? 15.947  -14.981 0.598   1.00 49.10  ? 235 ARG A CG  1 
ATOM   1871 C  CD  . ARG A 1 284 ? 16.954  -15.011 -0.551  1.00 52.36  ? 235 ARG A CD  1 
ATOM   1872 N  NE  . ARG A 1 284 ? 17.348  -16.381 -0.878  1.00 58.83  ? 235 ARG A NE  1 
ATOM   1873 C  CZ  . ARG A 1 284 ? 18.580  -16.877 -0.737  1.00 66.02  ? 235 ARG A CZ  1 
ATOM   1874 N  NH1 . ARG A 1 284 ? 19.580  -16.119 -0.296  1.00 65.59  ? 235 ARG A NH1 1 
ATOM   1875 N  NH2 . ARG A 1 284 ? 18.819  -18.144 -1.052  1.00 73.68  ? 235 ARG A NH2 1 
ATOM   1876 N  N   . LEU A 1 285 ? 16.271  -16.278 5.060   1.00 45.69  ? 236 LEU A N   1 
ATOM   1877 C  CA  . LEU A 1 285 ? 16.757  -16.458 6.423   1.00 46.40  ? 236 LEU A CA  1 
ATOM   1878 C  C   . LEU A 1 285 ? 17.785  -17.599 6.477   1.00 48.42  ? 236 LEU A C   1 
ATOM   1879 O  O   . LEU A 1 285 ? 17.585  -18.620 5.811   1.00 52.14  ? 236 LEU A O   1 
ATOM   1880 C  CB  . LEU A 1 285 ? 15.566  -16.730 7.383   1.00 42.86  ? 236 LEU A CB  1 
ATOM   1881 C  CG  . LEU A 1 285 ? 14.459  -15.679 7.576   1.00 41.54  ? 236 LEU A CG  1 
ATOM   1882 C  CD1 . LEU A 1 285 ? 13.295  -16.235 8.379   1.00 39.40  ? 236 LEU A CD1 1 
ATOM   1883 C  CD2 . LEU A 1 285 ? 14.998  -14.418 8.234   1.00 41.25  ? 236 LEU A CD2 1 
ATOM   1884 N  N   . PRO A 1 286 ? 18.879  -17.435 7.262   1.00 49.15  ? 237 PRO A N   1 
ATOM   1885 C  CA  . PRO A 1 286 ? 19.846  -18.512 7.523   1.00 51.15  ? 237 PRO A CA  1 
ATOM   1886 C  C   . PRO A 1 286 ? 19.187  -19.837 7.940   1.00 55.38  ? 237 PRO A C   1 
ATOM   1887 O  O   . PRO A 1 286 ? 18.271  -19.832 8.782   1.00 59.14  ? 237 PRO A O   1 
ATOM   1888 C  CB  . PRO A 1 286 ? 20.676  -17.951 8.678   1.00 51.01  ? 237 PRO A CB  1 
ATOM   1889 C  CG  . PRO A 1 286 ? 20.654  -16.486 8.454   1.00 51.53  ? 237 PRO A CG  1 
ATOM   1890 C  CD  . PRO A 1 286 ? 19.293  -16.175 7.909   1.00 51.42  ? 237 PRO A CD  1 
ATOM   1891 N  N   . LYS A 1 287 ? 19.638  -20.953 7.360   1.00 54.35  ? 238 LYS A N   1 
ATOM   1892 C  CA  . LYS A 1 287 ? 19.015  -22.269 7.594   1.00 60.28  ? 238 LYS A CA  1 
ATOM   1893 C  C   . LYS A 1 287 ? 18.408  -22.471 9.001   1.00 61.34  ? 238 LYS A C   1 
ATOM   1894 O  O   . LYS A 1 287 ? 17.273  -22.952 9.115   1.00 63.64  ? 238 LYS A O   1 
ATOM   1895 C  CB  . LYS A 1 287 ? 20.001  -23.411 7.271   1.00 65.95  ? 238 LYS A CB  1 
ATOM   1896 C  CG  . LYS A 1 287 ? 19.358  -24.796 7.199   1.00 72.33  ? 238 LYS A CG  1 
ATOM   1897 C  CD  . LYS A 1 287 ? 20.373  -25.929 7.070   1.00 72.85  ? 238 LYS A CD  1 
ATOM   1898 C  CE  . LYS A 1 287 ? 19.794  -27.050 6.214   1.00 75.55  ? 238 LYS A CE  1 
ATOM   1899 N  NZ  . LYS A 1 287 ? 20.567  -28.321 6.309   1.00 76.12  ? 238 LYS A NZ  1 
ATOM   1900 N  N   . LYS A 1 288 ? 19.165  -22.121 10.051  1.00 56.24  ? 239 LYS A N   1 
ATOM   1901 C  CA  . LYS A 1 288 ? 18.746  -22.371 11.430  1.00 55.78  ? 239 LYS A CA  1 
ATOM   1902 C  C   . LYS A 1 288 ? 17.596  -21.485 11.890  1.00 56.21  ? 239 LYS A C   1 
ATOM   1903 O  O   . LYS A 1 288 ? 16.720  -21.943 12.634  1.00 58.19  ? 239 LYS A O   1 
ATOM   1904 C  CB  . LYS A 1 288 ? 19.924  -22.259 12.401  1.00 57.67  ? 239 LYS A CB  1 
ATOM   1905 C  CG  . LYS A 1 288 ? 20.225  -23.550 13.135  1.00 59.25  ? 239 LYS A CG  1 
ATOM   1906 C  CD  . LYS A 1 288 ? 21.308  -23.369 14.179  1.00 65.84  ? 239 LYS A CD  1 
ATOM   1907 C  CE  . LYS A 1 288 ? 22.687  -23.517 13.556  1.00 73.02  ? 239 LYS A CE  1 
ATOM   1908 N  NZ  . LYS A 1 288 ? 23.764  -23.312 14.564  1.00 79.91  ? 239 LYS A NZ  1 
ATOM   1909 N  N   . VAL A 1 289 ? 17.630  -20.217 11.471  1.00 53.11  ? 240 VAL A N   1 
ATOM   1910 C  CA  . VAL A 1 289 ? 16.561  -19.248 11.711  1.00 50.66  ? 240 VAL A CA  1 
ATOM   1911 C  C   . VAL A 1 289 ? 15.318  -19.639 10.901  1.00 53.00  ? 240 VAL A C   1 
ATOM   1912 O  O   . VAL A 1 289 ? 14.190  -19.607 11.416  1.00 56.46  ? 240 VAL A O   1 
ATOM   1913 C  CB  . VAL A 1 289 ? 16.999  -17.815 11.334  1.00 47.89  ? 240 VAL A CB  1 
ATOM   1914 C  CG1 . VAL A 1 289 ? 15.879  -16.833 11.580  1.00 42.79  ? 240 VAL A CG1 1 
ATOM   1915 C  CG2 . VAL A 1 289 ? 18.236  -17.414 12.125  1.00 46.90  ? 240 VAL A CG2 1 
ATOM   1916 N  N   . PHE A 1 290 ? 15.531  -20.055 9.655   1.00 48.23  ? 241 PHE A N   1 
ATOM   1917 C  CA  . PHE A 1 290 ? 14.427  -20.428 8.779   1.00 49.10  ? 241 PHE A CA  1 
ATOM   1918 C  C   . PHE A 1 290 ? 13.632  -21.596 9.343   1.00 51.86  ? 241 PHE A C   1 
ATOM   1919 O  O   . PHE A 1 290 ? 12.401  -21.590 9.303   1.00 58.19  ? 241 PHE A O   1 
ATOM   1920 C  CB  . PHE A 1 290 ? 14.923  -20.733 7.358   1.00 47.43  ? 241 PHE A CB  1 
ATOM   1921 C  CG  . PHE A 1 290 ? 13.852  -21.251 6.444   1.00 47.87  ? 241 PHE A CG  1 
ATOM   1922 C  CD1 . PHE A 1 290 ? 12.993  -20.371 5.785   1.00 46.72  ? 241 PHE A CD1 1 
ATOM   1923 C  CD2 . PHE A 1 290 ? 13.690  -22.620 6.244   1.00 47.32  ? 241 PHE A CD2 1 
ATOM   1924 C  CE1 . PHE A 1 290 ? 11.995  -20.850 4.947   1.00 45.25  ? 241 PHE A CE1 1 
ATOM   1925 C  CE2 . PHE A 1 290 ? 12.691  -23.103 5.406   1.00 47.68  ? 241 PHE A CE2 1 
ATOM   1926 C  CZ  . PHE A 1 290 ? 11.844  -22.217 4.756   1.00 47.45  ? 241 PHE A CZ  1 
ATOM   1927 N  N   . GLU A 1 291 ? 14.326  -22.593 9.872   1.00 52.74  ? 242 GLU A N   1 
ATOM   1928 C  CA  A GLU A 1 291 ? 13.687  -23.774 10.442  0.50 55.10  ? 242 GLU A CA  1 
ATOM   1929 C  CA  B GLU A 1 291 ? 13.624  -23.752 10.387  0.50 54.76  ? 242 GLU A CA  1 
ATOM   1930 C  C   . GLU A 1 291 ? 12.852  -23.416 11.671  1.00 55.86  ? 242 GLU A C   1 
ATOM   1931 O  O   . GLU A 1 291 ? 11.706  -23.850 11.821  1.00 62.46  ? 242 GLU A O   1 
ATOM   1932 C  CB  A GLU A 1 291 ? 14.743  -24.831 10.785  0.50 54.48  ? 242 GLU A CB  1 
ATOM   1933 C  CB  B GLU A 1 291 ? 14.549  -24.969 10.531  0.50 53.83  ? 242 GLU A CB  1 
ATOM   1934 C  CG  A GLU A 1 291 ? 15.295  -25.567 9.566   0.50 56.11  ? 242 GLU A CG  1 
ATOM   1935 C  CG  B GLU A 1 291 ? 15.039  -25.558 9.201   0.50 53.92  ? 242 GLU A CG  1 
ATOM   1936 C  CD  A GLU A 1 291 ? 16.579  -26.324 9.856   0.50 56.89  ? 242 GLU A CD  1 
ATOM   1937 C  CD  B GLU A 1 291 ? 13.931  -26.141 8.321   0.50 54.28  ? 242 GLU A CD  1 
ATOM   1938 O  OE1 A GLU A 1 291 ? 17.030  -26.344 11.037  0.50 56.31  ? 242 GLU A OE1 1 
ATOM   1939 O  OE1 B GLU A 1 291 ? 12.769  -26.254 8.777   0.50 54.03  ? 242 GLU A OE1 1 
ATOM   1940 O  OE2 A GLU A 1 291 ? 17.138  -26.896 8.891   0.50 56.08  ? 242 GLU A OE2 1 
ATOM   1941 O  OE2 B GLU A 1 291 ? 14.224  -26.496 7.157   0.50 52.38  ? 242 GLU A OE2 1 
ATOM   1942 N  N   . ALA A 1 292 ? 13.434  -22.612 12.558  1.00 51.65  ? 243 ALA A N   1 
ATOM   1943 C  CA  . ALA A 1 292 ? 12.726  -22.181 13.769  1.00 54.38  ? 243 ALA A CA  1 
ATOM   1944 C  C   . ALA A 1 292 ? 11.538  -21.237 13.467  1.00 55.11  ? 243 ALA A C   1 
ATOM   1945 O  O   . ALA A 1 292 ? 10.488  -21.334 14.108  1.00 55.76  ? 243 ALA A O   1 
ATOM   1946 C  CB  . ALA A 1 292 ? 13.693  -21.559 14.774  1.00 53.21  ? 243 ALA A CB  1 
ATOM   1947 N  N   . ALA A 1 293 ? 11.703  -20.348 12.486  1.00 49.86  ? 244 ALA A N   1 
ATOM   1948 C  CA  . ALA A 1 293 ? 10.616  -19.489 12.033  1.00 49.15  ? 244 ALA A CA  1 
ATOM   1949 C  C   . ALA A 1 293 ? 9.477   -20.274 11.367  1.00 51.13  ? 244 ALA A C   1 
ATOM   1950 O  O   . ALA A 1 293 ? 8.309   -20.017 11.641  1.00 57.36  ? 244 ALA A O   1 
ATOM   1951 C  CB  . ALA A 1 293 ? 11.130  -18.407 11.104  1.00 46.86  ? 244 ALA A CB  1 
ATOM   1952 N  N   . VAL A 1 294 ? 9.794   -21.237 10.510  1.00 50.94  ? 245 VAL A N   1 
ATOM   1953 C  CA  . VAL A 1 294 ? 8.740   -22.010 9.851   1.00 49.56  ? 245 VAL A CA  1 
ATOM   1954 C  C   . VAL A 1 294 ? 7.968   -22.861 10.870  1.00 51.20  ? 245 VAL A C   1 
ATOM   1955 O  O   . VAL A 1 294 ? 6.749   -22.992 10.772  1.00 48.69  ? 245 VAL A O   1 
ATOM   1956 C  CB  . VAL A 1 294 ? 9.272   -22.828 8.653   1.00 50.08  ? 245 VAL A CB  1 
ATOM   1957 C  CG1 . VAL A 1 294 ? 8.233   -23.826 8.170   1.00 48.98  ? 245 VAL A CG1 1 
ATOM   1958 C  CG2 . VAL A 1 294 ? 9.641   -21.891 7.515   1.00 45.52  ? 245 VAL A CG2 1 
ATOM   1959 N  N   . LYS A 1 295 ? 8.679   -23.394 11.863  1.00 52.28  ? 246 LYS A N   1 
ATOM   1960 C  CA  . LYS A 1 295 ? 8.065   -24.125 12.978  1.00 56.58  ? 246 LYS A CA  1 
ATOM   1961 C  C   . LYS A 1 295 ? 7.048   -23.241 13.713  1.00 57.07  ? 246 LYS A C   1 
ATOM   1962 O  O   . LYS A 1 295 ? 5.950   -23.688 14.058  1.00 55.58  ? 246 LYS A O   1 
ATOM   1963 C  CB  . LYS A 1 295 ? 9.146   -24.556 13.968  1.00 59.84  ? 246 LYS A CB  1 
ATOM   1964 C  CG  . LYS A 1 295 ? 8.940   -25.909 14.635  1.00 68.93  ? 246 LYS A CG  1 
ATOM   1965 C  CD  . LYS A 1 295 ? 9.837   -26.992 14.007  1.00 76.99  ? 246 LYS A CD  1 
ATOM   1966 C  CE  . LYS A 1 295 ? 11.316  -26.577 13.969  1.00 79.23  ? 246 LYS A CE  1 
ATOM   1967 N  NZ  . LYS A 1 295 ? 12.307  -27.697 13.950  1.00 71.68  ? 246 LYS A NZ  1 
ATOM   1968 N  N   . SER A 1 296 ? 7.436   -21.987 13.949  1.00 55.85  ? 247 SER A N   1 
ATOM   1969 C  CA  . SER A 1 296 ? 6.635   -21.030 14.689  1.00 50.97  ? 247 SER A CA  1 
ATOM   1970 C  C   . SER A 1 296 ? 5.429   -20.576 13.860  1.00 50.16  ? 247 SER A C   1 
ATOM   1971 O  O   . SER A 1 296 ? 4.303   -20.669 14.333  1.00 50.03  ? 247 SER A O   1 
ATOM   1972 C  CB  . SER A 1 296 ? 7.500   -19.850 15.133  1.00 52.70  ? 247 SER A CB  1 
ATOM   1973 O  OG  . SER A 1 296 ? 6.829   -19.061 16.099  1.00 56.07  ? 247 SER A OG  1 
ATOM   1974 N  N   . ILE A 1 297 ? 5.660   -20.119 12.627  1.00 47.63  ? 248 ILE A N   1 
ATOM   1975 C  CA  . ILE A 1 297 ? 4.563   -19.804 11.687  1.00 49.01  ? 248 ILE A CA  1 
ATOM   1976 C  C   . ILE A 1 297 ? 3.584   -20.973 11.507  1.00 51.54  ? 248 ILE A C   1 
ATOM   1977 O  O   . ILE A 1 297 ? 2.368   -20.753 11.531  1.00 58.34  ? 248 ILE A O   1 
ATOM   1978 C  CB  . ILE A 1 297 ? 5.076   -19.305 10.304  1.00 46.20  ? 248 ILE A CB  1 
ATOM   1979 C  CG1 . ILE A 1 297 ? 6.001   -18.099 10.474  1.00 43.60  ? 248 ILE A CG1 1 
ATOM   1980 C  CG2 . ILE A 1 297 ? 3.920   -18.909 9.388   1.00 44.12  ? 248 ILE A CG2 1 
ATOM   1981 C  CD1 . ILE A 1 297 ? 6.965   -17.908 9.325   1.00 41.51  ? 248 ILE A CD1 1 
ATOM   1982 N  N   . LYS A 1 298 ? 4.103   -22.197 11.338  1.00 52.15  ? 249 LYS A N   1 
ATOM   1983 C  CA  . LYS A 1 298 ? 3.271   -23.424 11.287  1.00 53.02  ? 249 LYS A CA  1 
ATOM   1984 C  C   . LYS A 1 298 ? 2.361   -23.598 12.512  1.00 53.67  ? 249 LYS A C   1 
ATOM   1985 O  O   . LYS A 1 298 ? 1.153   -23.818 12.373  1.00 56.90  ? 249 LYS A O   1 
ATOM   1986 C  CB  . LYS A 1 298 ? 4.128   -24.680 11.152  1.00 52.84  ? 249 LYS A CB  1 
ATOM   1987 C  CG  . LYS A 1 298 ? 4.427   -25.087 9.727   1.00 54.82  ? 249 LYS A CG  1 
ATOM   1988 C  CD  . LYS A 1 298 ? 5.145   -26.425 9.721   1.00 54.84  ? 249 LYS A CD  1 
ATOM   1989 C  CE  . LYS A 1 298 ? 5.645   -26.758 8.334   1.00 59.33  ? 249 LYS A CE  1 
ATOM   1990 N  NZ  . LYS A 1 298 ? 6.552   -27.935 8.331   1.00 61.64  ? 249 LYS A NZ  1 
ATOM   1991 N  N   . ALA A 1 299 ? 2.963   -23.511 13.697  1.00 49.39  ? 250 ALA A N   1 
ATOM   1992 C  CA  . ALA A 1 299 ? 2.255   -23.556 14.972  1.00 48.73  ? 250 ALA A CA  1 
ATOM   1993 C  C   . ALA A 1 299 ? 1.146   -22.495 15.080  1.00 52.82  ? 250 ALA A C   1 
ATOM   1994 O  O   . ALA A 1 299 ? 0.017   -22.807 15.485  1.00 54.21  ? 250 ALA A O   1 
ATOM   1995 C  CB  . ALA A 1 299 ? 3.252   -23.409 16.121  1.00 45.20  ? 250 ALA A CB  1 
ATOM   1996 N  N   . ALA A 1 300 ? 1.477   -21.250 14.720  1.00 50.08  ? 251 ALA A N   1 
ATOM   1997 C  CA  . ALA A 1 300 ? 0.536   -20.139 14.813  1.00 46.13  ? 251 ALA A CA  1 
ATOM   1998 C  C   . ALA A 1 300 ? -0.632  -20.225 13.820  1.00 49.07  ? 251 ALA A C   1 
ATOM   1999 O  O   . ALA A 1 300 ? -1.747  -19.769 14.126  1.00 49.78  ? 251 ALA A O   1 
ATOM   2000 C  CB  . ALA A 1 300 ? 1.265   -18.808 14.709  1.00 42.23  ? 251 ALA A CB  1 
ATOM   2001 N  N   . SER A 1 301 ? -0.398  -20.847 12.661  1.00 48.01  ? 252 SER A N   1 
ATOM   2002 C  CA  . SER A 1 301 ? -1.452  -20.990 11.644  1.00 44.51  ? 252 SER A CA  1 
ATOM   2003 C  C   . SER A 1 301 ? -2.056  -22.382 11.577  1.00 46.89  ? 252 SER A C   1 
ATOM   2004 O  O   . SER A 1 301 ? -2.746  -22.711 10.608  1.00 49.10  ? 252 SER A O   1 
ATOM   2005 C  CB  . SER A 1 301 ? -0.925  -20.620 10.259  1.00 42.18  ? 252 SER A CB  1 
ATOM   2006 O  OG  . SER A 1 301 ? 0.144   -21.467 9.896   1.00 39.12  ? 252 SER A OG  1 
ATOM   2007 N  N   . SER A 1 302 ? -1.837  -23.194 12.603  1.00 49.21  ? 253 SER A N   1 
ATOM   2008 C  CA  . SER A 1 302 ? -2.152  -24.633 12.505  1.00 52.41  ? 253 SER A CA  1 
ATOM   2009 C  C   . SER A 1 302 ? -3.633  -25.047 12.347  1.00 57.04  ? 253 SER A C   1 
ATOM   2010 O  O   . SER A 1 302 ? -3.902  -26.232 12.175  1.00 63.60  ? 253 SER A O   1 
ATOM   2011 C  CB  . SER A 1 302 ? -1.527  -25.390 13.670  1.00 47.06  ? 253 SER A CB  1 
ATOM   2012 O  OG  . SER A 1 302 ? -2.324  -25.235 14.818  1.00 50.88  ? 253 SER A OG  1 
ATOM   2013 N  N   . THR A 1 303 ? -4.577  -24.100 12.400  1.00 57.20  ? 254 THR A N   1 
ATOM   2014 C  CA  . THR A 1 303 ? -6.006  -24.402 12.151  1.00 57.76  ? 254 THR A CA  1 
ATOM   2015 C  C   . THR A 1 303 ? -6.316  -24.674 10.661  1.00 57.86  ? 254 THR A C   1 
ATOM   2016 O  O   . THR A 1 303 ? -7.403  -25.128 10.318  1.00 60.13  ? 254 THR A O   1 
ATOM   2017 C  CB  . THR A 1 303 ? -6.948  -23.292 12.668  1.00 58.91  ? 254 THR A CB  1 
ATOM   2018 O  OG1 . THR A 1 303 ? -6.535  -22.028 12.136  1.00 58.55  ? 254 THR A OG1 1 
ATOM   2019 C  CG2 . THR A 1 303 ? -6.945  -23.234 14.203  1.00 62.89  ? 254 THR A CG2 1 
ATOM   2020 N  N   . GLU A 1 304 ? -5.372  -24.350 9.786   1.00 58.11  ? 255 GLU A N   1 
ATOM   2021 C  CA  . GLU A 1 304 ? -5.336  -24.903 8.437   1.00 60.50  ? 255 GLU A CA  1 
ATOM   2022 C  C   . GLU A 1 304 ? -3.968  -25.518 8.213   1.00 62.71  ? 255 GLU A C   1 
ATOM   2023 O  O   . GLU A 1 304 ? -2.948  -24.948 8.630   1.00 63.68  ? 255 GLU A O   1 
ATOM   2024 C  CB  . GLU A 1 304 ? -5.603  -23.841 7.385   1.00 60.06  ? 255 GLU A CB  1 
ATOM   2025 C  CG  . GLU A 1 304 ? -7.074  -23.490 7.241   1.00 65.44  ? 255 GLU A CG  1 
ATOM   2026 C  CD  . GLU A 1 304 ? -7.338  -22.386 6.224   1.00 67.70  ? 255 GLU A CD  1 
ATOM   2027 O  OE1 . GLU A 1 304 ? -6.748  -22.429 5.121   1.00 64.87  ? 255 GLU A OE1 1 
ATOM   2028 O  OE2 . GLU A 1 304 ? -8.155  -21.481 6.527   1.00 68.63  ? 255 GLU A OE2 1 
ATOM   2029 N  N   . LYS A 1 305 ? -3.943  -26.692 7.582   1.00 63.19  ? 256 LYS A N   1 
ATOM   2030 C  CA  . LYS A 1 305 ? -2.674  -27.364 7.262   1.00 62.82  ? 256 LYS A CA  1 
ATOM   2031 C  C   . LYS A 1 305 ? -2.363  -27.238 5.778   1.00 59.86  ? 256 LYS A C   1 
ATOM   2032 O  O   . LYS A 1 305 ? -3.252  -27.345 4.931   1.00 60.70  ? 256 LYS A O   1 
ATOM   2033 C  CB  . LYS A 1 305 ? -2.690  -28.841 7.674   1.00 63.01  ? 256 LYS A CB  1 
ATOM   2034 C  CG  . LYS A 1 305 ? -3.020  -29.098 9.139   1.00 66.54  ? 256 LYS A CG  1 
ATOM   2035 C  CD  . LYS A 1 305 ? -1.878  -28.701 10.061  1.00 68.92  ? 256 LYS A CD  1 
ATOM   2036 C  CE  . LYS A 1 305 ? -2.330  -28.845 11.504  1.00 70.57  ? 256 LYS A CE  1 
ATOM   2037 N  NZ  . LYS A 1 305 ? -1.304  -28.342 12.458  1.00 72.50  ? 256 LYS A NZ  1 
ATOM   2038 N  N   . PHE A 1 306 ? -1.096  -27.016 5.462   1.00 57.79  ? 257 PHE A N   1 
ATOM   2039 C  CA  . PHE A 1 306 ? -0.704  -26.845 4.068   1.00 59.40  ? 257 PHE A CA  1 
ATOM   2040 C  C   . PHE A 1 306 ? 0.333   -27.887 3.654   1.00 61.00  ? 257 PHE A C   1 
ATOM   2041 O  O   . PHE A 1 306 ? 1.070   -28.394 4.501   1.00 57.97  ? 257 PHE A O   1 
ATOM   2042 C  CB  . PHE A 1 306 ? -0.190  -25.420 3.835   1.00 58.15  ? 257 PHE A CB  1 
ATOM   2043 C  CG  . PHE A 1 306 ? -1.124  -24.348 4.350   1.00 57.44  ? 257 PHE A CG  1 
ATOM   2044 C  CD1 . PHE A 1 306 ? -2.266  -23.992 3.628   1.00 56.11  ? 257 PHE A CD1 1 
ATOM   2045 C  CD2 . PHE A 1 306 ? -0.870  -23.704 5.562   1.00 54.34  ? 257 PHE A CD2 1 
ATOM   2046 C  CE1 . PHE A 1 306 ? -3.124  -23.011 4.101   1.00 54.37  ? 257 PHE A CE1 1 
ATOM   2047 C  CE2 . PHE A 1 306 ? -1.721  -22.722 6.038   1.00 53.46  ? 257 PHE A CE2 1 
ATOM   2048 C  CZ  . PHE A 1 306 ? -2.846  -22.374 5.307   1.00 56.99  ? 257 PHE A CZ  1 
ATOM   2049 N  N   . PRO A 1 307 ? 0.369   -28.230 2.351   1.00 65.88  ? 258 PRO A N   1 
ATOM   2050 C  CA  . PRO A 1 307 ? 1.409   -29.106 1.801   1.00 66.12  ? 258 PRO A CA  1 
ATOM   2051 C  C   . PRO A 1 307 ? 2.815   -28.579 2.072   1.00 68.57  ? 258 PRO A C   1 
ATOM   2052 O  O   . PRO A 1 307 ? 3.036   -27.364 2.049   1.00 68.29  ? 258 PRO A O   1 
ATOM   2053 C  CB  . PRO A 1 307 ? 1.127   -29.088 0.282   1.00 67.07  ? 258 PRO A CB  1 
ATOM   2054 C  CG  . PRO A 1 307 ? 0.120   -27.994 0.058   1.00 65.71  ? 258 PRO A CG  1 
ATOM   2055 C  CD  . PRO A 1 307 ? -0.651  -27.894 1.335   1.00 66.08  ? 258 PRO A CD  1 
ATOM   2056 N  N   . ASP A 1 308 ? 3.748   -29.497 2.323   1.00 69.28  ? 259 ASP A N   1 
ATOM   2057 C  CA  . ASP A 1 308 ? 5.164   -29.171 2.523   1.00 71.05  ? 259 ASP A CA  1 
ATOM   2058 C  C   . ASP A 1 308 ? 5.774   -28.329 1.393   1.00 67.28  ? 259 ASP A C   1 
ATOM   2059 O  O   . ASP A 1 308 ? 6.737   -27.589 1.621   1.00 67.47  ? 259 ASP A O   1 
ATOM   2060 C  CB  . ASP A 1 308 ? 5.995   -30.448 2.704   1.00 78.19  ? 259 ASP A CB  1 
ATOM   2061 C  CG  . ASP A 1 308 ? 5.708   -31.161 4.012   1.00 83.25  ? 259 ASP A CG  1 
ATOM   2062 O  OD1 . ASP A 1 308 ? 5.359   -30.481 5.011   1.00 90.36  ? 259 ASP A OD1 1 
ATOM   2063 O  OD2 . ASP A 1 308 ? 5.851   -32.407 4.035   1.00 80.62  ? 259 ASP A OD2 1 
ATOM   2064 N  N   . GLY A 1 309 ? 5.224   -28.456 0.186   1.00 59.18  ? 260 GLY A N   1 
ATOM   2065 C  CA  . GLY A 1 309 ? 5.681   -27.664 -0.948  1.00 57.22  ? 260 GLY A CA  1 
ATOM   2066 C  C   . GLY A 1 309 ? 5.352   -26.187 -0.807  1.00 58.14  ? 260 GLY A C   1 
ATOM   2067 O  O   . GLY A 1 309 ? 6.009   -25.345 -1.416  1.00 58.89  ? 260 GLY A O   1 
ATOM   2068 N  N   . PHE A 1 310 ? 4.322   -25.876 -0.016  1.00 56.31  ? 261 PHE A N   1 
ATOM   2069 C  CA  . PHE A 1 310 ? 3.967   -24.491 0.298   1.00 53.80  ? 261 PHE A CA  1 
ATOM   2070 C  C   . PHE A 1 310 ? 5.071   -23.841 1.138   1.00 53.95  ? 261 PHE A C   1 
ATOM   2071 O  O   . PHE A 1 310 ? 5.553   -22.764 0.805   1.00 55.46  ? 261 PHE A O   1 
ATOM   2072 C  CB  . PHE A 1 310 ? 2.601   -24.408 1.028   1.00 53.52  ? 261 PHE A CB  1 
ATOM   2073 C  CG  . PHE A 1 310 ? 2.279   -23.037 1.574   1.00 49.54  ? 261 PHE A CG  1 
ATOM   2074 C  CD1 . PHE A 1 310 ? 1.922   -21.999 0.724   1.00 47.76  ? 261 PHE A CD1 1 
ATOM   2075 C  CD2 . PHE A 1 310 ? 2.358   -22.782 2.933   1.00 50.50  ? 261 PHE A CD2 1 
ATOM   2076 C  CE1 . PHE A 1 310 ? 1.634   -20.747 1.219   1.00 43.95  ? 261 PHE A CE1 1 
ATOM   2077 C  CE2 . PHE A 1 310 ? 2.077   -21.519 3.431   1.00 47.66  ? 261 PHE A CE2 1 
ATOM   2078 C  CZ  . PHE A 1 310 ? 1.707   -20.508 2.576   1.00 43.15  ? 261 PHE A CZ  1 
ATOM   2079 N  N   . TRP A 1 311 ? 5.470   -24.498 2.226   1.00 52.76  ? 262 TRP A N   1 
ATOM   2080 C  CA  . TRP A 1 311 ? 6.470   -23.936 3.123   1.00 52.17  ? 262 TRP A CA  1 
ATOM   2081 C  C   . TRP A 1 311 ? 7.860   -23.864 2.494   1.00 53.04  ? 262 TRP A C   1 
ATOM   2082 O  O   . TRP A 1 311 ? 8.701   -23.098 2.961   1.00 56.32  ? 262 TRP A O   1 
ATOM   2083 C  CB  . TRP A 1 311 ? 6.495   -24.701 4.438   1.00 50.78  ? 262 TRP A CB  1 
ATOM   2084 C  CG  . TRP A 1 311 ? 5.180   -24.676 5.155   1.00 53.98  ? 262 TRP A CG  1 
ATOM   2085 C  CD1 . TRP A 1 311 ? 4.298   -25.716 5.302   1.00 57.13  ? 262 TRP A CD1 1 
ATOM   2086 C  CD2 . TRP A 1 311 ? 4.589   -23.555 5.815   1.00 54.10  ? 262 TRP A CD2 1 
ATOM   2087 N  NE1 . TRP A 1 311 ? 3.200   -25.312 6.027   1.00 56.41  ? 262 TRP A NE1 1 
ATOM   2088 C  CE2 . TRP A 1 311 ? 3.351   -23.989 6.354   1.00 56.30  ? 262 TRP A CE2 1 
ATOM   2089 C  CE3 . TRP A 1 311 ? 4.988   -22.223 6.013   1.00 54.24  ? 262 TRP A CE3 1 
ATOM   2090 C  CZ2 . TRP A 1 311 ? 2.506   -23.138 7.090   1.00 56.31  ? 262 TRP A CZ2 1 
ATOM   2091 C  CZ3 . TRP A 1 311 ? 4.139   -21.368 6.736   1.00 55.44  ? 262 TRP A CZ3 1 
ATOM   2092 C  CH2 . TRP A 1 311 ? 2.913   -21.838 7.271   1.00 55.16  ? 262 TRP A CH2 1 
ATOM   2093 N  N   . LEU A 1 312 ? 8.086   -24.650 1.438   1.00 53.08  ? 263 LEU A N   1 
ATOM   2094 C  CA  . LEU A 1 312 ? 9.335   -24.620 0.659   1.00 56.21  ? 263 LEU A CA  1 
ATOM   2095 C  C   . LEU A 1 312 ? 9.266   -23.590 -0.473  1.00 59.14  ? 263 LEU A C   1 
ATOM   2096 O  O   . LEU A 1 312 ? 10.173  -23.500 -1.302  1.00 63.42  ? 263 LEU A O   1 
ATOM   2097 C  CB  . LEU A 1 312 ? 9.667   -26.010 0.078   1.00 57.60  ? 263 LEU A CB  1 
ATOM   2098 C  CG  . LEU A 1 312 ? 10.019  -27.197 0.992   1.00 59.19  ? 263 LEU A CG  1 
ATOM   2099 C  CD1 . LEU A 1 312 ? 10.132  -28.500 0.203   1.00 56.85  ? 263 LEU A CD1 1 
ATOM   2100 C  CD2 . LEU A 1 312 ? 11.285  -26.942 1.800   1.00 58.49  ? 263 LEU A CD2 1 
ATOM   2101 N  N   . GLY A 1 313 ? 8.177   -22.825 -0.515  1.00 61.56  ? 264 GLY A N   1 
ATOM   2102 C  CA  . GLY A 1 313 ? 8.021   -21.729 -1.473  1.00 59.59  ? 264 GLY A CA  1 
ATOM   2103 C  C   . GLY A 1 313 ? 7.790   -22.148 -2.912  1.00 60.84  ? 264 GLY A C   1 
ATOM   2104 O  O   . GLY A 1 313 ? 7.736   -21.299 -3.802  1.00 57.00  ? 264 GLY A O   1 
ATOM   2105 N  N   . GLU A 1 314 ? 7.642   -23.454 -3.139  1.00 66.17  ? 265 GLU A N   1 
ATOM   2106 C  CA  . GLU A 1 314 ? 7.479   -24.005 -4.490  1.00 69.55  ? 265 GLU A CA  1 
ATOM   2107 C  C   . GLU A 1 314 ? 6.043   -23.923 -5.002  1.00 67.74  ? 265 GLU A C   1 
ATOM   2108 O  O   . GLU A 1 314 ? 5.806   -23.346 -6.056  1.00 71.36  ? 265 GLU A O   1 
ATOM   2109 C  CB  . GLU A 1 314 ? 7.978   -25.447 -4.554  1.00 76.19  ? 265 GLU A CB  1 
ATOM   2110 C  CG  . GLU A 1 314 ? 9.489   -25.569 -4.504  1.00 84.46  ? 265 GLU A CG  1 
ATOM   2111 C  CD  . GLU A 1 314 ? 9.945   -26.901 -3.938  1.00 95.00  ? 265 GLU A CD  1 
ATOM   2112 O  OE1 . GLU A 1 314 ? 9.080   -27.773 -3.676  1.00 93.73  ? 265 GLU A OE1 1 
ATOM   2113 O  OE2 . GLU A 1 314 ? 11.173  -27.072 -3.746  1.00 100.97 ? 265 GLU A OE2 1 
ATOM   2114 N  N   . GLN A 1 315 ? 5.086   -24.486 -4.265  1.00 66.56  ? 266 GLN A N   1 
ATOM   2115 C  CA  . GLN A 1 315 ? 3.690   -24.427 -4.719  1.00 66.85  ? 266 GLN A CA  1 
ATOM   2116 C  C   . GLN A 1 315 ? 2.792   -23.378 -4.038  1.00 60.69  ? 266 GLN A C   1 
ATOM   2117 O  O   . GLN A 1 315 ? 3.064   -22.907 -2.922  1.00 58.12  ? 266 GLN A O   1 
ATOM   2118 C  CB  . GLN A 1 315 ? 3.027   -25.817 -4.754  1.00 69.62  ? 266 GLN A CB  1 
ATOM   2119 C  CG  . GLN A 1 315 ? 2.762   -26.456 -3.408  1.00 75.53  ? 266 GLN A CG  1 
ATOM   2120 C  CD  . GLN A 1 315 ? 2.181   -27.850 -3.551  1.00 81.60  ? 266 GLN A CD  1 
ATOM   2121 O  OE1 . GLN A 1 315 ? 2.803   -28.728 -4.143  1.00 82.06  ? 266 GLN A OE1 1 
ATOM   2122 N  NE2 . GLN A 1 315 ? 0.980   -28.059 -3.010  1.00 81.08  ? 266 GLN A NE2 1 
ATOM   2123 N  N   . LEU A 1 316 ? 1.719   -23.037 -4.746  1.00 55.14  ? 267 LEU A N   1 
ATOM   2124 C  CA  . LEU A 1 316 ? 0.787   -22.017 -4.337  1.00 57.42  ? 267 LEU A CA  1 
ATOM   2125 C  C   . LEU A 1 316 ? -0.340  -22.628 -3.495  1.00 58.59  ? 267 LEU A C   1 
ATOM   2126 O  O   . LEU A 1 316 ? -0.566  -23.836 -3.547  1.00 60.90  ? 267 LEU A O   1 
ATOM   2127 C  CB  . LEU A 1 316 ? 0.258   -21.280 -5.584  1.00 55.82  ? 267 LEU A CB  1 
ATOM   2128 C  CG  . LEU A 1 316 ? -0.935  -21.783 -6.414  1.00 57.35  ? 267 LEU A CG  1 
ATOM   2129 C  CD1 . LEU A 1 316 ? -1.064  -20.955 -7.688  1.00 50.49  ? 267 LEU A CD1 1 
ATOM   2130 C  CD2 . LEU A 1 316 ? -0.870  -23.277 -6.731  1.00 58.88  ? 267 LEU A CD2 1 
ATOM   2131 N  N   . VAL A 1 317 ? -1.004  -21.786 -2.699  1.00 59.71  ? 268 VAL A N   1 
ATOM   2132 C  CA  . VAL A 1 317 ? -2.214  -22.136 -1.953  1.00 56.71  ? 268 VAL A CA  1 
ATOM   2133 C  C   . VAL A 1 317 ? -3.290  -21.125 -2.330  1.00 55.69  ? 268 VAL A C   1 
ATOM   2134 O  O   . VAL A 1 317 ? -3.001  -19.932 -2.416  1.00 56.14  ? 268 VAL A O   1 
ATOM   2135 C  CB  . VAL A 1 317 ? -1.977  -22.093 -0.436  1.00 57.89  ? 268 VAL A CB  1 
ATOM   2136 C  CG1 . VAL A 1 317 ? -3.298  -22.146 0.315   1.00 61.55  ? 268 VAL A CG1 1 
ATOM   2137 C  CG2 . VAL A 1 317 ? -1.108  -23.263 -0.012  1.00 59.33  ? 268 VAL A CG2 1 
ATOM   2138 N  N   . CYS A 1 318 ? -4.516  -21.605 -2.570  1.00 56.26  ? 269 CYS A N   1 
ATOM   2139 C  CA  . CYS A 1 318 ? -5.634  -20.746 -2.983  1.00 53.90  ? 269 CYS A CA  1 
ATOM   2140 C  C   . CYS A 1 318 ? -6.825  -20.835 -2.031  1.00 52.23  ? 269 CYS A C   1 
ATOM   2141 O  O   . CYS A 1 318 ? -7.107  -21.898 -1.452  1.00 48.28  ? 269 CYS A O   1 
ATOM   2142 C  CB  . CYS A 1 318 ? -6.104  -21.081 -4.399  1.00 53.26  ? 269 CYS A CB  1 
ATOM   2143 S  SG  . CYS A 1 318 ? -4.808  -21.014 -5.659  1.00 59.91  ? 269 CYS A SG  1 
ATOM   2144 N  N   . TRP A 1 319 ? -7.504  -19.700 -1.868  1.00 46.75  ? 270 TRP A N   1 
ATOM   2145 C  CA  . TRP A 1 319 ? -8.784  -19.650 -1.183  1.00 47.88  ? 270 TRP A CA  1 
ATOM   2146 C  C   . TRP A 1 319 ? -9.822  -19.044 -2.130  1.00 49.41  ? 270 TRP A C   1 
ATOM   2147 O  O   . TRP A 1 319 ? -9.471  -18.426 -3.138  1.00 49.61  ? 270 TRP A O   1 
ATOM   2148 C  CB  . TRP A 1 319 ? -8.697  -18.821 0.099   1.00 44.61  ? 270 TRP A CB  1 
ATOM   2149 C  CG  . TRP A 1 319 ? -7.848  -19.417 1.177   1.00 44.74  ? 270 TRP A CG  1 
ATOM   2150 C  CD1 . TRP A 1 319 ? -8.262  -20.239 2.173   1.00 42.27  ? 270 TRP A CD1 1 
ATOM   2151 C  CD2 . TRP A 1 319 ? -6.438  -19.212 1.378   1.00 43.95  ? 270 TRP A CD2 1 
ATOM   2152 N  NE1 . TRP A 1 319 ? -7.202  -20.571 2.983   1.00 45.12  ? 270 TRP A NE1 1 
ATOM   2153 C  CE2 . TRP A 1 319 ? -6.070  -19.958 2.512   1.00 43.27  ? 270 TRP A CE2 1 
ATOM   2154 C  CE3 . TRP A 1 319 ? -5.457  -18.460 0.709   1.00 47.02  ? 270 TRP A CE3 1 
ATOM   2155 C  CZ2 . TRP A 1 319 ? -4.763  -19.970 3.013   1.00 47.16  ? 270 TRP A CZ2 1 
ATOM   2156 C  CZ3 . TRP A 1 319 ? -4.161  -18.481 1.185   1.00 47.43  ? 270 TRP A CZ3 1 
ATOM   2157 C  CH2 . TRP A 1 319 ? -3.823  -19.226 2.336   1.00 50.61  ? 270 TRP A CH2 1 
ATOM   2158 N  N   . GLN A 1 320 ? -11.098 -19.216 -1.798  1.00 50.35  ? 271 GLN A N   1 
ATOM   2159 C  CA  . GLN A 1 320 ? -12.162 -18.651 -2.600  1.00 55.89  ? 271 GLN A CA  1 
ATOM   2160 C  C   . GLN A 1 320 ? -12.066 -17.114 -2.495  1.00 54.45  ? 271 GLN A C   1 
ATOM   2161 O  O   . GLN A 1 320 ? -11.594 -16.570 -1.483  1.00 54.38  ? 271 GLN A O   1 
ATOM   2162 C  CB  . GLN A 1 320 ? -13.506 -19.196 -2.115  1.00 61.27  ? 271 GLN A CB  1 
ATOM   2163 C  CG  . GLN A 1 320 ? -14.739 -18.619 -2.789  1.00 71.64  ? 271 GLN A CG  1 
ATOM   2164 C  CD  . GLN A 1 320 ? -15.962 -18.718 -1.895  1.00 78.93  ? 271 GLN A CD  1 
ATOM   2165 O  OE1 . GLN A 1 320 ? -16.300 -19.802 -1.412  1.00 80.42  ? 271 GLN A OE1 1 
ATOM   2166 N  NE2 . GLN A 1 320 ? -16.627 -17.583 -1.657  1.00 79.11  ? 271 GLN A NE2 1 
ATOM   2167 N  N   . ALA A 1 321 ? -12.494 -16.433 -3.551  1.00 48.45  ? 272 ALA A N   1 
ATOM   2168 C  CA  . ALA A 1 321 ? -12.381 -14.982 -3.662  1.00 45.82  ? 272 ALA A CA  1 
ATOM   2169 C  C   . ALA A 1 321 ? -12.671 -14.260 -2.343  1.00 44.36  ? 272 ALA A C   1 
ATOM   2170 O  O   . ALA A 1 321 ? -13.766 -14.361 -1.784  1.00 42.86  ? 272 ALA A O   1 
ATOM   2171 C  CB  . ALA A 1 321 ? -13.295 -14.472 -4.771  1.00 42.96  ? 272 ALA A CB  1 
ATOM   2172 N  N   . GLY A 1 322 ? -11.674 -13.544 -1.841  1.00 44.82  ? 273 GLY A N   1 
ATOM   2173 C  CA  . GLY A 1 322 ? -11.868 -12.663 -0.695  1.00 45.93  ? 273 GLY A CA  1 
ATOM   2174 C  C   . GLY A 1 322 ? -11.931 -13.361 0.655   1.00 49.75  ? 273 GLY A C   1 
ATOM   2175 O  O   . GLY A 1 322 ? -12.118 -12.690 1.685   1.00 49.33  ? 273 GLY A O   1 
ATOM   2176 N  N   . THR A 1 323 ? -11.775 -14.688 0.683   1.00 45.32  ? 274 THR A N   1 
ATOM   2177 C  CA  . THR A 1 323 ? -11.843 -15.389 1.968   1.00 45.71  ? 274 THR A CA  1 
ATOM   2178 C  C   . THR A 1 323 ? -10.477 -15.740 2.592   1.00 45.43  ? 274 THR A C   1 
ATOM   2179 O  O   . THR A 1 323 ? -10.438 -16.482 3.568   1.00 51.48  ? 274 THR A O   1 
ATOM   2180 C  CB  . THR A 1 323 ? -12.735 -16.658 1.917   1.00 44.11  ? 274 THR A CB  1 
ATOM   2181 O  OG1 . THR A 1 323 ? -12.073 -17.686 1.170   1.00 44.21  ? 274 THR A OG1 1 
ATOM   2182 C  CG2 . THR A 1 323 ? -14.120 -16.358 1.319   1.00 40.39  ? 274 THR A CG2 1 
ATOM   2183 N  N   . THR A 1 324 ? -9.376  -15.219 2.041   1.00 44.29  ? 275 THR A N   1 
ATOM   2184 C  CA  . THR A 1 324 ? -8.026  -15.462 2.587   1.00 44.81  ? 275 THR A CA  1 
ATOM   2185 C  C   . THR A 1 324 ? -8.002  -15.224 4.111   1.00 44.03  ? 275 THR A C   1 
ATOM   2186 O  O   . THR A 1 324 ? -8.326  -14.141 4.581   1.00 44.34  ? 275 THR A O   1 
ATOM   2187 C  CB  . THR A 1 324 ? -6.940  -14.583 1.908   1.00 45.03  ? 275 THR A CB  1 
ATOM   2188 O  OG1 . THR A 1 324 ? -7.057  -14.639 0.482   1.00 40.53  ? 275 THR A OG1 1 
ATOM   2189 C  CG2 . THR A 1 324 ? -5.533  -15.032 2.315   1.00 45.77  ? 275 THR A CG2 1 
ATOM   2190 N  N   . PRO A 1 325 ? -7.632  -16.245 4.890   1.00 45.26  ? 276 PRO A N   1 
ATOM   2191 C  CA  . PRO A 1 325 ? -7.703  -16.113 6.337   1.00 44.53  ? 276 PRO A CA  1 
ATOM   2192 C  C   . PRO A 1 325 ? -6.445  -15.450 6.954   1.00 43.03  ? 276 PRO A C   1 
ATOM   2193 O  O   . PRO A 1 325 ? -5.762  -16.052 7.799   1.00 41.92  ? 276 PRO A O   1 
ATOM   2194 C  CB  . PRO A 1 325 ? -7.855  -17.571 6.797   1.00 43.98  ? 276 PRO A CB  1 
ATOM   2195 C  CG  . PRO A 1 325 ? -7.010  -18.317 5.824   1.00 41.90  ? 276 PRO A CG  1 
ATOM   2196 C  CD  . PRO A 1 325 ? -7.209  -17.600 4.497   1.00 44.43  ? 276 PRO A CD  1 
ATOM   2197 N  N   . TRP A 1 326 ? -6.178  -14.209 6.547   1.00 40.12  ? 277 TRP A N   1 
ATOM   2198 C  CA  . TRP A 1 326 ? -5.075  -13.403 7.062   1.00 38.76  ? 277 TRP A CA  1 
ATOM   2199 C  C   . TRP A 1 326 ? -4.840  -13.579 8.549   1.00 41.49  ? 277 TRP A C   1 
ATOM   2200 O  O   . TRP A 1 326 ? -3.691  -13.703 8.991   1.00 42.59  ? 277 TRP A O   1 
ATOM   2201 C  CB  . TRP A 1 326 ? -5.346  -11.919 6.773   1.00 41.63  ? 277 TRP A CB  1 
ATOM   2202 C  CG  . TRP A 1 326 ? -5.477  -11.639 5.317   1.00 42.33  ? 277 TRP A CG  1 
ATOM   2203 C  CD1 . TRP A 1 326 ? -6.589  -11.160 4.651   1.00 41.86  ? 277 TRP A CD1 1 
ATOM   2204 C  CD2 . TRP A 1 326 ? -4.473  -11.858 4.321   1.00 38.80  ? 277 TRP A CD2 1 
ATOM   2205 N  NE1 . TRP A 1 326 ? -6.314  -11.052 3.296   1.00 40.14  ? 277 TRP A NE1 1 
ATOM   2206 C  CE2 . TRP A 1 326 ? -5.030  -11.486 3.070   1.00 39.31  ? 277 TRP A CE2 1 
ATOM   2207 C  CE3 . TRP A 1 326 ? -3.158  -12.329 4.360   1.00 39.01  ? 277 TRP A CE3 1 
ATOM   2208 C  CZ2 . TRP A 1 326 ? -4.308  -11.574 1.873   1.00 36.12  ? 277 TRP A CZ2 1 
ATOM   2209 C  CZ3 . TRP A 1 326 ? -2.432  -12.398 3.148   1.00 36.95  ? 277 TRP A CZ3 1 
ATOM   2210 C  CH2 . TRP A 1 326 ? -3.017  -12.028 1.939   1.00 34.11  ? 277 TRP A CH2 1 
ATOM   2211 N  N   . ASN A 1 327 ? -5.938  -13.580 9.317   1.00 43.16  ? 278 ASN A N   1 
ATOM   2212 C  CA  . ASN A 1 327 ? -5.890  -13.563 10.777  1.00 42.53  ? 278 ASN A CA  1 
ATOM   2213 C  C   . ASN A 1 327 ? -5.248  -14.812 11.399  1.00 44.32  ? 278 ASN A C   1 
ATOM   2214 O  O   . ASN A 1 327 ? -4.724  -14.739 12.515  1.00 43.50  ? 278 ASN A O   1 
ATOM   2215 C  CB  . ASN A 1 327 ? -7.285  -13.284 11.386  1.00 41.51  ? 278 ASN A CB  1 
ATOM   2216 C  CG  . ASN A 1 327 ? -8.205  -14.500 11.329  1.00 45.48  ? 278 ASN A CG  1 
ATOM   2217 O  OD1 . ASN A 1 327 ? -8.383  -15.221 12.329  1.00 43.70  ? 278 ASN A OD1 1 
ATOM   2218 N  ND2 . ASN A 1 327 ? -8.792  -14.742 10.153  1.00 46.43  ? 278 ASN A ND2 1 
ATOM   2219 N  N   . ILE A 1 328 ? -5.295  -15.952 10.695  1.00 48.98  ? 279 ILE A N   1 
ATOM   2220 C  CA  . ILE A 1 328 ? -4.679  -17.196 11.222  1.00 51.68  ? 279 ILE A CA  1 
ATOM   2221 C  C   . ILE A 1 328 ? -3.147  -17.180 11.099  1.00 52.83  ? 279 ILE A C   1 
ATOM   2222 O  O   . ILE A 1 328 ? -2.469  -17.945 11.781  1.00 56.09  ? 279 ILE A O   1 
ATOM   2223 C  CB  . ILE A 1 328 ? -5.246  -18.514 10.603  1.00 49.42  ? 279 ILE A CB  1 
ATOM   2224 C  CG1 . ILE A 1 328 ? -4.757  -18.714 9.160   1.00 46.32  ? 279 ILE A CG1 1 
ATOM   2225 C  CG2 . ILE A 1 328 ? -6.765  -18.598 10.735  1.00 45.91  ? 279 ILE A CG2 1 
ATOM   2226 C  CD1 . ILE A 1 328 ? -4.926  -20.137 8.645   1.00 47.23  ? 279 ILE A CD1 1 
ATOM   2227 N  N   . PHE A 1 329 ? -2.624  -16.308 10.232  1.00 48.12  ? 280 PHE A N   1 
ATOM   2228 C  CA  . PHE A 1 329 ? -1.184  -16.138 10.052  1.00 45.83  ? 280 PHE A CA  1 
ATOM   2229 C  C   . PHE A 1 329 ? -0.601  -15.089 10.996  1.00 45.76  ? 280 PHE A C   1 
ATOM   2230 O  O   . PHE A 1 329 ? -1.229  -14.052 11.253  1.00 43.72  ? 280 PHE A O   1 
ATOM   2231 C  CB  . PHE A 1 329 ? -0.875  -15.776 8.604   1.00 45.26  ? 280 PHE A CB  1 
ATOM   2232 C  CG  . PHE A 1 329 ? -1.108  -16.902 7.635   1.00 45.59  ? 280 PHE A CG  1 
ATOM   2233 C  CD1 . PHE A 1 329 ? -0.109  -17.854 7.391   1.00 45.15  ? 280 PHE A CD1 1 
ATOM   2234 C  CD2 . PHE A 1 329 ? -2.316  -17.013 6.955   1.00 44.25  ? 280 PHE A CD2 1 
ATOM   2235 C  CE1 . PHE A 1 329 ? -0.316  -18.889 6.492   1.00 47.31  ? 280 PHE A CE1 1 
ATOM   2236 C  CE2 . PHE A 1 329 ? -2.528  -18.047 6.057   1.00 45.75  ? 280 PHE A CE2 1 
ATOM   2237 C  CZ  . PHE A 1 329 ? -1.535  -18.990 5.829   1.00 47.62  ? 280 PHE A CZ  1 
ATOM   2238 N  N   . PRO A 1 330 ? 0.598   -15.359 11.533  1.00 44.01  ? 281 PRO A N   1 
ATOM   2239 C  CA  . PRO A 1 330 ? 1.166   -14.453 12.537  1.00 44.00  ? 281 PRO A CA  1 
ATOM   2240 C  C   . PRO A 1 330 ? 1.857   -13.240 11.926  1.00 44.61  ? 281 PRO A C   1 
ATOM   2241 O  O   . PRO A 1 330 ? 2.223   -13.267 10.744  1.00 46.14  ? 281 PRO A O   1 
ATOM   2242 C  CB  . PRO A 1 330 ? 2.198   -15.327 13.259  1.00 40.05  ? 281 PRO A CB  1 
ATOM   2243 C  CG  . PRO A 1 330 ? 2.607   -16.332 12.243  1.00 41.56  ? 281 PRO A CG  1 
ATOM   2244 C  CD  . PRO A 1 330 ? 1.413   -16.574 11.355  1.00 43.67  ? 281 PRO A CD  1 
ATOM   2245 N  N   . VAL A 1 331 ? 2.027   -12.180 12.718  1.00 44.05  ? 282 VAL A N   1 
ATOM   2246 C  CA  . VAL A 1 331 ? 2.905   -11.087 12.296  1.00 43.31  ? 282 VAL A CA  1 
ATOM   2247 C  C   . VAL A 1 331 ? 4.335   -11.493 12.637  1.00 43.16  ? 282 VAL A C   1 
ATOM   2248 O  O   . VAL A 1 331 ? 4.552   -12.361 13.502  1.00 44.19  ? 282 VAL A O   1 
ATOM   2249 C  CB  . VAL A 1 331 ? 2.540   -9.722  12.924  1.00 42.26  ? 282 VAL A CB  1 
ATOM   2250 C  CG1 . VAL A 1 331 ? 1.088   -9.387  12.635  1.00 42.67  ? 282 VAL A CG1 1 
ATOM   2251 C  CG2 . VAL A 1 331 ? 2.801   -9.700  14.434  1.00 40.38  ? 282 VAL A CG2 1 
ATOM   2252 N  N   . ILE A 1 332 ? 5.283   -10.878 11.932  1.00 42.48  ? 283 ILE A N   1 
ATOM   2253 C  CA  . ILE A 1 332 ? 6.710   -11.074 12.122  1.00 41.69  ? 283 ILE A CA  1 
ATOM   2254 C  C   . ILE A 1 332 ? 7.365   -9.738  12.436  1.00 44.32  ? 283 ILE A C   1 
ATOM   2255 O  O   . ILE A 1 332 ? 7.258   -8.791  11.645  1.00 43.37  ? 283 ILE A O   1 
ATOM   2256 C  CB  . ILE A 1 332 ? 7.350   -11.626 10.845  1.00 44.90  ? 283 ILE A CB  1 
ATOM   2257 C  CG1 . ILE A 1 332 ? 6.742   -12.999 10.505  1.00 43.88  ? 283 ILE A CG1 1 
ATOM   2258 C  CG2 . ILE A 1 332 ? 8.874   -11.642 10.975  1.00 45.38  ? 283 ILE A CG2 1 
ATOM   2259 C  CD1 . ILE A 1 332 ? 7.306   -13.617 9.249   1.00 43.55  ? 283 ILE A CD1 1 
ATOM   2260 N  N   . SER A 1 333 ? 8.028   -9.659  13.595  1.00 42.38  ? 284 SER A N   1 
ATOM   2261 C  CA  . SER A 1 333 ? 8.782   -8.461  13.965  1.00 40.56  ? 284 SER A CA  1 
ATOM   2262 C  C   . SER A 1 333 ? 10.283  -8.721  13.918  1.00 42.08  ? 284 SER A C   1 
ATOM   2263 O  O   . SER A 1 333 ? 10.779  -9.716  14.466  1.00 45.05  ? 284 SER A O   1 
ATOM   2264 C  CB  . SER A 1 333 ? 8.366   -7.970  15.353  1.00 40.00  ? 284 SER A CB  1 
ATOM   2265 O  OG  . SER A 1 333 ? 6.962   -7.759  15.390  1.00 41.03  ? 284 SER A OG  1 
ATOM   2266 N  N   . LEU A 1 334 ? 10.992  -7.843  13.222  1.00 42.98  ? 285 LEU A N   1 
ATOM   2267 C  CA  . LEU A 1 334 ? 12.444  -7.840  13.219  1.00 42.68  ? 285 LEU A CA  1 
ATOM   2268 C  C   . LEU A 1 334 ? 12.945  -6.617  13.976  1.00 44.37  ? 285 LEU A C   1 
ATOM   2269 O  O   . LEU A 1 334 ? 12.650  -5.472  13.596  1.00 42.20  ? 285 LEU A O   1 
ATOM   2270 C  CB  . LEU A 1 334 ? 12.970  -7.843  11.789  1.00 42.01  ? 285 LEU A CB  1 
ATOM   2271 C  CG  . LEU A 1 334 ? 12.545  -8.983  10.858  1.00 43.98  ? 285 LEU A CG  1 
ATOM   2272 C  CD1 . LEU A 1 334 ? 13.253  -8.833  9.519   1.00 42.99  ? 285 LEU A CD1 1 
ATOM   2273 C  CD2 . LEU A 1 334 ? 12.806  -10.366 11.439  1.00 43.07  ? 285 LEU A CD2 1 
ATOM   2274 N  N   . TYR A 1 335 ? 13.679  -6.849  15.064  1.00 42.87  ? 286 TYR A N   1 
ATOM   2275 C  CA  . TYR A 1 335 ? 14.257  -5.737  15.791  1.00 43.42  ? 286 TYR A CA  1 
ATOM   2276 C  C   . TYR A 1 335 ? 15.644  -5.434  15.222  1.00 46.76  ? 286 TYR A C   1 
ATOM   2277 O  O   . TYR A 1 335 ? 16.489  -6.341  15.048  1.00 46.26  ? 286 TYR A O   1 
ATOM   2278 C  CB  . TYR A 1 335 ? 14.337  -6.033  17.281  1.00 42.33  ? 286 TYR A CB  1 
ATOM   2279 C  CG  . TYR A 1 335 ? 13.026  -6.178  18.022  1.00 41.27  ? 286 TYR A CG  1 
ATOM   2280 C  CD1 . TYR A 1 335 ? 12.177  -7.276  17.798  1.00 41.55  ? 286 TYR A CD1 1 
ATOM   2281 C  CD2 . TYR A 1 335 ? 12.662  -5.257  19.006  1.00 40.18  ? 286 TYR A CD2 1 
ATOM   2282 C  CE1 . TYR A 1 335 ? 10.984  -7.430  18.514  1.00 39.90  ? 286 TYR A CE1 1 
ATOM   2283 C  CE2 . TYR A 1 335 ? 11.475  -5.397  19.724  1.00 40.94  ? 286 TYR A CE2 1 
ATOM   2284 C  CZ  . TYR A 1 335 ? 10.641  -6.486  19.486  1.00 41.22  ? 286 TYR A CZ  1 
ATOM   2285 O  OH  . TYR A 1 335 ? 9.467   -6.631  20.224  1.00 40.59  ? 286 TYR A OH  1 
ATOM   2286 N  N   . LEU A 1 336 ? 15.864  -4.160  14.915  1.00 46.67  ? 287 LEU A N   1 
ATOM   2287 C  CA  . LEU A 1 336 ? 17.130  -3.708  14.342  1.00 49.80  ? 287 LEU A CA  1 
ATOM   2288 C  C   . LEU A 1 336 ? 17.901  -2.870  15.354  1.00 52.11  ? 287 LEU A C   1 
ATOM   2289 O  O   . LEU A 1 336 ? 17.298  -2.312  16.271  1.00 52.28  ? 287 LEU A O   1 
ATOM   2290 C  CB  . LEU A 1 336 ? 16.874  -2.886  13.088  1.00 48.66  ? 287 LEU A CB  1 
ATOM   2291 C  CG  . LEU A 1 336 ? 16.176  -3.640  11.963  1.00 50.88  ? 287 LEU A CG  1 
ATOM   2292 C  CD1 . LEU A 1 336 ? 15.520  -2.662  11.001  1.00 49.67  ? 287 LEU A CD1 1 
ATOM   2293 C  CD2 . LEU A 1 336 ? 17.140  -4.562  11.240  1.00 50.36  ? 287 LEU A CD2 1 
ATOM   2294 N  N   . MET A 1 337 ? 19.223  -2.792  15.201  1.00 52.01  ? 288 MET A N   1 
ATOM   2295 C  CA  . MET A 1 337 ? 20.038  -1.982  16.104  1.00 57.53  ? 288 MET A CA  1 
ATOM   2296 C  C   . MET A 1 337 ? 19.720  -0.500  15.870  1.00 58.17  ? 288 MET A C   1 
ATOM   2297 O  O   . MET A 1 337 ? 19.592  -0.055  14.715  1.00 52.77  ? 288 MET A O   1 
ATOM   2298 C  CB  . MET A 1 337 ? 21.530  -2.281  15.906  1.00 58.65  ? 288 MET A CB  1 
ATOM   2299 C  CG  . MET A 1 337 ? 22.500  -1.331  16.606  1.00 60.65  ? 288 MET A CG  1 
ATOM   2300 S  SD  . MET A 1 337 ? 24.168  -1.604  15.966  1.00 66.50  ? 288 MET A SD  1 
ATOM   2301 C  CE  . MET A 1 337 ? 24.510  -3.195  16.713  1.00 63.17  ? 288 MET A CE  1 
ATOM   2302 N  N   . GLY A 1 338 ? 19.556  0.250   16.961  1.00 55.83  ? 289 GLY A N   1 
ATOM   2303 C  CA  . GLY A 1 338 ? 19.347  1.708   16.861  1.00 58.07  ? 289 GLY A CA  1 
ATOM   2304 C  C   . GLY A 1 338 ? 20.614  2.530   16.626  1.00 55.38  ? 289 GLY A C   1 
ATOM   2305 O  O   . GLY A 1 338 ? 21.734  1.998   16.584  1.00 50.61  ? 289 GLY A O   1 
ATOM   2306 N  N   . GLU A 1 339 ? 20.432  3.836   16.468  1.00 55.91  ? 290 GLU A N   1 
ATOM   2307 C  CA  . GLU A 1 339 ? 21.557  4.758   16.472  1.00 56.69  ? 290 GLU A CA  1 
ATOM   2308 C  C   . GLU A 1 339 ? 22.063  5.090   17.896  1.00 61.53  ? 290 GLU A C   1 
ATOM   2309 O  O   . GLU A 1 339 ? 23.263  5.257   18.089  1.00 64.72  ? 290 GLU A O   1 
ATOM   2310 C  CB  . GLU A 1 339 ? 21.206  6.023   15.701  1.00 57.47  ? 290 GLU A CB  1 
ATOM   2311 C  CG  . GLU A 1 339 ? 21.070  5.778   14.205  1.00 62.56  ? 290 GLU A CG  1 
ATOM   2312 C  CD  . GLU A 1 339 ? 21.285  7.029   13.370  1.00 64.54  ? 290 GLU A CD  1 
ATOM   2313 O  OE1 . GLU A 1 339 ? 20.362  7.874   13.317  1.00 63.21  ? 290 GLU A OE1 1 
ATOM   2314 O  OE2 . GLU A 1 339 ? 22.374  7.150   12.751  1.00 64.70  ? 290 GLU A OE2 1 
ATOM   2315 N  N   . VAL A 1 340 ? 21.160  5.176   18.880  1.00 58.38  ? 291 VAL A N   1 
ATOM   2316 C  CA  . VAL A 1 340 ? 21.528  5.417   20.279  1.00 58.39  ? 291 VAL A CA  1 
ATOM   2317 C  C   . VAL A 1 340 ? 22.032  4.122   20.940  1.00 61.95  ? 291 VAL A C   1 
ATOM   2318 O  O   . VAL A 1 340 ? 21.506  3.037   20.674  1.00 66.67  ? 291 VAL A O   1 
ATOM   2319 C  CB  . VAL A 1 340 ? 20.339  6.033   21.078  1.00 62.54  ? 291 VAL A CB  1 
ATOM   2320 C  CG1 . VAL A 1 340 ? 20.592  6.029   22.589  1.00 58.48  ? 291 VAL A CG1 1 
ATOM   2321 C  CG2 . VAL A 1 340 ? 20.018  7.444   20.584  1.00 58.86  ? 291 VAL A CG2 1 
ATOM   2322 N  N   . THR A 1 341 ? 23.058  4.247   21.789  1.00 63.58  ? 292 THR A N   1 
ATOM   2323 C  CA  . THR A 1 341 ? 23.613  3.132   22.579  1.00 61.19  ? 292 THR A CA  1 
ATOM   2324 C  C   . THR A 1 341 ? 22.496  2.403   23.350  1.00 61.43  ? 292 THR A C   1 
ATOM   2325 O  O   . THR A 1 341 ? 21.643  3.052   23.986  1.00 54.84  ? 292 THR A O   1 
ATOM   2326 C  CB  . THR A 1 341 ? 24.695  3.627   23.598  1.00 65.24  ? 292 THR A CB  1 
ATOM   2327 O  OG1 . THR A 1 341 ? 25.542  4.617   22.996  1.00 67.50  ? 292 THR A OG1 1 
ATOM   2328 C  CG2 . THR A 1 341 ? 25.569  2.474   24.118  1.00 60.52  ? 292 THR A CG2 1 
ATOM   2329 N  N   . ASN A 1 342 ? 22.521  1.063   23.285  1.00 60.36  ? 293 ASN A N   1 
ATOM   2330 C  CA  . ASN A 1 342 ? 21.565  0.165   23.972  1.00 60.51  ? 293 ASN A CA  1 
ATOM   2331 C  C   . ASN A 1 342 ? 20.086  0.450   23.664  1.00 59.13  ? 293 ASN A C   1 
ATOM   2332 O  O   . ASN A 1 342 ? 19.211  0.265   24.520  1.00 66.09  ? 293 ASN A O   1 
ATOM   2333 C  CB  . ASN A 1 342 ? 21.774  0.145   25.502  1.00 64.49  ? 293 ASN A CB  1 
ATOM   2334 C  CG  . ASN A 1 342 ? 23.152  -0.347  25.921  1.00 64.89  ? 293 ASN A CG  1 
ATOM   2335 O  OD1 . ASN A 1 342 ? 23.605  -1.429  25.529  1.00 67.80  ? 293 ASN A OD1 1 
ATOM   2336 N  ND2 . ASN A 1 342 ? 23.812  0.448   26.758  1.00 59.86  ? 293 ASN A ND2 1 
ATOM   2337 N  N   . GLN A 1 343 ? 19.820  0.913   22.448  1.00 55.55  ? 294 GLN A N   1 
ATOM   2338 C  CA  . GLN A 1 343 ? 18.471  1.194   21.990  1.00 56.07  ? 294 GLN A CA  1 
ATOM   2339 C  C   . GLN A 1 343 ? 18.247  0.497   20.643  1.00 58.04  ? 294 GLN A C   1 
ATOM   2340 O  O   . GLN A 1 343 ? 19.081  0.607   19.745  1.00 64.37  ? 294 GLN A O   1 
ATOM   2341 C  CB  . GLN A 1 343 ? 18.290  2.697   21.879  1.00 57.68  ? 294 GLN A CB  1 
ATOM   2342 C  CG  . GLN A 1 343 ? 17.030  3.149   21.177  1.00 65.84  ? 294 GLN A CG  1 
ATOM   2343 C  CD  . GLN A 1 343 ? 16.722  4.617   21.438  1.00 71.37  ? 294 GLN A CD  1 
ATOM   2344 O  OE1 . GLN A 1 343 ? 16.985  5.139   22.534  1.00 75.02  ? 294 GLN A OE1 1 
ATOM   2345 N  NE2 . GLN A 1 343 ? 16.141  5.286   20.444  1.00 64.55  ? 294 GLN A NE2 1 
ATOM   2346 N  N   . SER A 1 344 ? 17.157  -0.261  20.528  1.00 52.18  ? 295 SER A N   1 
ATOM   2347 C  CA  . SER A 1 344 ? 16.757  -0.857  19.249  1.00 48.57  ? 295 SER A CA  1 
ATOM   2348 C  C   . SER A 1 344 ? 15.358  -0.382  18.881  1.00 48.66  ? 295 SER A C   1 
ATOM   2349 O  O   . SER A 1 344 ? 14.764  0.415   19.606  1.00 55.49  ? 295 SER A O   1 
ATOM   2350 C  CB  . SER A 1 344 ? 16.846  -2.395  19.276  1.00 46.19  ? 295 SER A CB  1 
ATOM   2351 O  OG  . SER A 1 344 ? 15.969  -2.962  20.217  1.00 46.03  ? 295 SER A OG  1 
ATOM   2352 N  N   . PHE A 1 345 ? 14.852  -0.840  17.738  1.00 47.94  ? 296 PHE A N   1 
ATOM   2353 C  CA  . PHE A 1 345 ? 13.477  -0.568  17.290  1.00 45.28  ? 296 PHE A CA  1 
ATOM   2354 C  C   . PHE A 1 345 ? 13.030  -1.778  16.474  1.00 45.56  ? 296 PHE A C   1 
ATOM   2355 O  O   . PHE A 1 345 ? 13.848  -2.647  16.176  1.00 46.84  ? 296 PHE A O   1 
ATOM   2356 C  CB  . PHE A 1 345 ? 13.366  0.760   16.503  1.00 43.48  ? 296 PHE A CB  1 
ATOM   2357 C  CG  . PHE A 1 345 ? 14.044  0.742   15.163  1.00 42.72  ? 296 PHE A CG  1 
ATOM   2358 C  CD1 . PHE A 1 345 ? 15.385  1.050   15.042  1.00 40.66  ? 296 PHE A CD1 1 
ATOM   2359 C  CD2 . PHE A 1 345 ? 13.329  0.416   14.010  1.00 44.62  ? 296 PHE A CD2 1 
ATOM   2360 C  CE1 . PHE A 1 345 ? 16.006  1.021   13.794  1.00 40.48  ? 296 PHE A CE1 1 
ATOM   2361 C  CE2 . PHE A 1 345 ? 13.937  0.388   12.765  1.00 41.08  ? 296 PHE A CE2 1 
ATOM   2362 C  CZ  . PHE A 1 345 ? 15.284  0.692   12.661  1.00 40.24  ? 296 PHE A CZ  1 
ATOM   2363 N  N   . ARG A 1 346 ? 11.746  -1.863  16.137  1.00 42.86  ? 297 ARG A N   1 
ATOM   2364 C  CA  . ARG A 1 346 ? 11.261  -3.027  15.408  1.00 41.49  ? 297 ARG A CA  1 
ATOM   2365 C  C   . ARG A 1 346 ? 10.444  -2.619  14.204  1.00 44.49  ? 297 ARG A C   1 
ATOM   2366 O  O   . ARG A 1 346 ? 9.754   -1.593  14.212  1.00 49.88  ? 297 ARG A O   1 
ATOM   2367 C  CB  . ARG A 1 346 ? 10.460  -3.987  16.310  1.00 41.27  ? 297 ARG A CB  1 
ATOM   2368 C  CG  . ARG A 1 346 ? 9.129   -3.449  16.831  1.00 41.08  ? 297 ARG A CG  1 
ATOM   2369 C  CD  . ARG A 1 346 ? 8.506   -4.376  17.856  1.00 39.88  ? 297 ARG A CD  1 
ATOM   2370 N  NE  . ARG A 1 346 ? 7.166   -3.941  18.229  1.00 39.73  ? 297 ARG A NE  1 
ATOM   2371 C  CZ  . ARG A 1 346 ? 6.617   -4.084  19.438  1.00 41.27  ? 297 ARG A CZ  1 
ATOM   2372 N  NH1 . ARG A 1 346 ? 7.276   -4.645  20.450  1.00 40.28  ? 297 ARG A NH1 1 
ATOM   2373 N  NH2 . ARG A 1 346 ? 5.388   -3.640  19.645  1.00 41.36  ? 297 ARG A NH2 1 
ATOM   2374 N  N   . ILE A 1 347 ? 10.553  -3.419  13.154  1.00 44.38  ? 298 ILE A N   1 
ATOM   2375 C  CA  . ILE A 1 347 ? 9.657   -3.328  12.004  1.00 40.60  ? 298 ILE A CA  1 
ATOM   2376 C  C   . ILE A 1 347 ? 8.789   -4.583  12.026  1.00 41.58  ? 298 ILE A C   1 
ATOM   2377 O  O   . ILE A 1 347 ? 9.284   -5.700  12.270  1.00 41.97  ? 298 ILE A O   1 
ATOM   2378 C  CB  . ILE A 1 347 ? 10.405  -3.152  10.648  1.00 38.37  ? 298 ILE A CB  1 
ATOM   2379 C  CG1 . ILE A 1 347 ? 11.279  -4.353  10.316  1.00 38.56  ? 298 ILE A CG1 1 
ATOM   2380 C  CG2 . ILE A 1 347 ? 11.255  -1.896  10.652  1.00 36.09  ? 298 ILE A CG2 1 
ATOM   2381 C  CD1 . ILE A 1 347 ? 11.950  -4.256  8.962   1.00 40.57  ? 298 ILE A CD1 1 
ATOM   2382 N  N   . THR A 1 348 ? 7.494   -4.391  11.817  1.00 38.93  ? 299 THR A N   1 
ATOM   2383 C  CA  . THR A 1 348 ? 6.539   -5.482  11.914  1.00 39.20  ? 299 THR A CA  1 
ATOM   2384 C  C   . THR A 1 348 ? 5.844   -5.662  10.576  1.00 40.64  ? 299 THR A C   1 
ATOM   2385 O  O   . THR A 1 348 ? 5.304   -4.697  10.016  1.00 40.08  ? 299 THR A O   1 
ATOM   2386 C  CB  . THR A 1 348 ? 5.516   -5.243  13.061  1.00 37.98  ? 299 THR A CB  1 
ATOM   2387 O  OG1 . THR A 1 348 ? 6.203   -5.289  14.328  1.00 38.54  ? 299 THR A OG1 1 
ATOM   2388 C  CG2 . THR A 1 348 ? 4.463   -6.327  13.058  1.00 37.56  ? 299 THR A CG2 1 
ATOM   2389 N  N   . ILE A 1 349 ? 5.878   -6.888  10.058  1.00 40.18  ? 300 ILE A N   1 
ATOM   2390 C  CA  . ILE A 1 349 ? 5.226   -7.174  8.793   1.00 42.31  ? 300 ILE A CA  1 
ATOM   2391 C  C   . ILE A 1 349 ? 4.073   -8.173  8.942   1.00 43.13  ? 300 ILE A C   1 
ATOM   2392 O  O   . ILE A 1 349 ? 4.083   -9.041  9.826   1.00 41.11  ? 300 ILE A O   1 
ATOM   2393 C  CB  . ILE A 1 349 ? 6.221   -7.605  7.677   1.00 45.10  ? 300 ILE A CB  1 
ATOM   2394 C  CG1 . ILE A 1 349 ? 6.886   -8.926  7.990   1.00 44.99  ? 300 ILE A CG1 1 
ATOM   2395 C  CG2 . ILE A 1 349 ? 7.327   -6.587  7.492   1.00 48.66  ? 300 ILE A CG2 1 
ATOM   2396 C  CD1 . ILE A 1 349 ? 7.198   -9.677  6.728   1.00 46.27  ? 300 ILE A CD1 1 
ATOM   2397 N  N   . LEU A 1 350 ? 3.088   -8.031  8.058   1.00 43.72  ? 301 LEU A N   1 
ATOM   2398 C  CA  . LEU A 1 350 ? 1.880   -8.843  8.048   1.00 42.44  ? 301 LEU A CA  1 
ATOM   2399 C  C   . LEU A 1 350 ? 2.022   -9.991  7.043   1.00 42.38  ? 301 LEU A C   1 
ATOM   2400 O  O   . LEU A 1 350 ? 2.871   -9.919  6.145   1.00 47.26  ? 301 LEU A O   1 
ATOM   2401 C  CB  . LEU A 1 350 ? 0.708   -7.953  7.623   1.00 40.75  ? 301 LEU A CB  1 
ATOM   2402 C  CG  . LEU A 1 350 ? 0.536   -6.597  8.306   1.00 42.78  ? 301 LEU A CG  1 
ATOM   2403 C  CD1 . LEU A 1 350 ? -0.704  -5.936  7.731   1.00 38.18  ? 301 LEU A CD1 1 
ATOM   2404 C  CD2 . LEU A 1 350 ? 0.443   -6.719  9.832   1.00 41.12  ? 301 LEU A CD2 1 
ATOM   2405 N  N   . PRO A 1 351 ? 1.171   -11.033 7.150   1.00 41.87  ? 302 PRO A N   1 
ATOM   2406 C  CA  . PRO A 1 351 ? 1.138   -12.043 6.066   1.00 41.71  ? 302 PRO A CA  1 
ATOM   2407 C  C   . PRO A 1 351 ? 0.812   -11.440 4.698   1.00 44.42  ? 302 PRO A C   1 
ATOM   2408 O  O   . PRO A 1 351 ? 1.154   -12.020 3.688   1.00 47.72  ? 302 PRO A O   1 
ATOM   2409 C  CB  . PRO A 1 351 ? 0.005   -12.998 6.478   1.00 40.97  ? 302 PRO A CB  1 
ATOM   2410 C  CG  . PRO A 1 351 ? -0.799  -12.252 7.501   1.00 43.07  ? 302 PRO A CG  1 
ATOM   2411 C  CD  . PRO A 1 351 ? 0.155   -11.299 8.190   1.00 41.75  ? 302 PRO A CD  1 
ATOM   2412 N  N   . GLN A 1 352 ? 0.156   -10.284 4.655   1.00 45.73  ? 303 GLN A N   1 
ATOM   2413 C  CA  . GLN A 1 352 ? -0.043  -9.603  3.383   1.00 44.57  ? 303 GLN A CA  1 
ATOM   2414 C  C   . GLN A 1 352 ? 1.306   -9.281  2.700   1.00 46.23  ? 303 GLN A C   1 
ATOM   2415 O  O   . GLN A 1 352 ? 1.334   -9.095  1.479   1.00 40.55  ? 303 GLN A O   1 
ATOM   2416 C  CB  . GLN A 1 352 ? -0.912  -8.350  3.557   1.00 46.35  ? 303 GLN A CB  1 
ATOM   2417 C  CG  . GLN A 1 352 ? -2.391  -8.660  3.762   1.00 47.76  ? 303 GLN A CG  1 
ATOM   2418 C  CD  . GLN A 1 352 ? -2.830  -8.695  5.230   1.00 48.67  ? 303 GLN A CD  1 
ATOM   2419 O  OE1 . GLN A 1 352 ? -2.076  -9.092  6.134   1.00 44.58  ? 303 GLN A OE1 1 
ATOM   2420 N  NE2 . GLN A 1 352 ? -4.065  -8.274  5.470   1.00 47.98  ? 303 GLN A NE2 1 
ATOM   2421 N  N   . GLN A 1 353 ? 2.407   -9.215  3.479   1.00 45.25  ? 304 GLN A N   1 
ATOM   2422 C  CA  . GLN A 1 353 ? 3.772   -9.041  2.909   1.00 44.01  ? 304 GLN A CA  1 
ATOM   2423 C  C   . GLN A 1 353 ? 4.463   -10.378 2.572   1.00 47.56  ? 304 GLN A C   1 
ATOM   2424 O  O   . GLN A 1 353 ? 5.001   -10.538 1.478   1.00 49.86  ? 304 GLN A O   1 
ATOM   2425 C  CB  . GLN A 1 353 ? 4.677   -8.193  3.815   1.00 42.15  ? 304 GLN A CB  1 
ATOM   2426 C  CG  . GLN A 1 353 ? 4.485   -6.668  3.724   1.00 41.43  ? 304 GLN A CG  1 
ATOM   2427 C  CD  . GLN A 1 353 ? 3.240   -6.144  4.454   1.00 42.20  ? 304 GLN A CD  1 
ATOM   2428 O  OE1 . GLN A 1 353 ? 3.085   -6.303  5.675   1.00 43.04  ? 304 GLN A OE1 1 
ATOM   2429 N  NE2 . GLN A 1 353 ? 2.349   -5.514  3.702   1.00 40.61  ? 304 GLN A NE2 1 
ATOM   2430 N  N   . TYR A 1 354 ? 4.439   -11.349 3.484   1.00 45.62  ? 305 TYR A N   1 
ATOM   2431 C  CA  . TYR A 1 354 ? 5.194   -12.584 3.237   1.00 44.90  ? 305 TYR A CA  1 
ATOM   2432 C  C   . TYR A 1 354 ? 4.480   -13.656 2.422   1.00 42.54  ? 305 TYR A C   1 
ATOM   2433 O  O   . TYR A 1 354 ? 5.114   -14.549 1.915   1.00 45.13  ? 305 TYR A O   1 
ATOM   2434 C  CB  . TYR A 1 354 ? 5.868   -13.141 4.504   1.00 42.04  ? 305 TYR A CB  1 
ATOM   2435 C  CG  . TYR A 1 354 ? 4.954   -13.576 5.623   1.00 40.34  ? 305 TYR A CG  1 
ATOM   2436 C  CD1 . TYR A 1 354 ? 4.285   -14.799 5.574   1.00 41.00  ? 305 TYR A CD1 1 
ATOM   2437 C  CD2 . TYR A 1 354 ? 4.811   -12.801 6.764   1.00 41.36  ? 305 TYR A CD2 1 
ATOM   2438 C  CE1 . TYR A 1 354 ? 3.471   -15.217 6.623   1.00 40.95  ? 305 TYR A CE1 1 
ATOM   2439 C  CE2 . TYR A 1 354 ? 4.004   -13.207 7.825   1.00 40.63  ? 305 TYR A CE2 1 
ATOM   2440 C  CZ  . TYR A 1 354 ? 3.338   -14.410 7.749   1.00 40.51  ? 305 TYR A CZ  1 
ATOM   2441 O  OH  . TYR A 1 354 ? 2.543   -14.812 8.791   1.00 42.53  ? 305 TYR A OH  1 
ATOM   2442 N  N   . LEU A 1 355 ? 3.164   -13.557 2.279   1.00 47.93  ? 306 LEU A N   1 
ATOM   2443 C  CA  . LEU A 1 355 ? 2.425   -14.366 1.298   1.00 42.86  ? 306 LEU A CA  1 
ATOM   2444 C  C   . LEU A 1 355 ? 2.306   -13.571 -0.008  1.00 43.36  ? 306 LEU A C   1 
ATOM   2445 O  O   . LEU A 1 355 ? 1.537   -12.621 -0.090  1.00 47.40  ? 306 LEU A O   1 
ATOM   2446 C  CB  . LEU A 1 355 ? 1.041   -14.749 1.827   1.00 40.12  ? 306 LEU A CB  1 
ATOM   2447 C  CG  . LEU A 1 355 ? 0.979   -15.593 3.095   1.00 41.68  ? 306 LEU A CG  1 
ATOM   2448 C  CD1 . LEU A 1 355 ? -0.465  -15.992 3.368   1.00 39.20  ? 306 LEU A CD1 1 
ATOM   2449 C  CD2 . LEU A 1 355 ? 1.868   -16.829 2.970   1.00 38.43  ? 306 LEU A CD2 1 
ATOM   2450 N  N   . ARG A 1 356 ? 3.073   -13.970 -1.017  1.00 41.68  ? 307 ARG A N   1 
ATOM   2451 C  CA  . ARG A 1 356 ? 3.162   -13.256 -2.290  1.00 45.93  ? 307 ARG A CA  1 
ATOM   2452 C  C   . ARG A 1 356 ? 2.031   -13.639 -3.274  1.00 45.24  ? 307 ARG A C   1 
ATOM   2453 O  O   . ARG A 1 356 ? 1.901   -14.806 -3.628  1.00 45.15  ? 307 ARG A O   1 
ATOM   2454 C  CB  . ARG A 1 356 ? 4.532   -13.543 -2.917  1.00 46.02  ? 307 ARG A CB  1 
ATOM   2455 C  CG  . ARG A 1 356 ? 4.763   -12.850 -4.247  1.00 47.82  ? 307 ARG A CG  1 
ATOM   2456 C  CD  . ARG A 1 356 ? 6.216   -12.977 -4.683  1.00 47.52  ? 307 ARG A CD  1 
ATOM   2457 N  NE  . ARG A 1 356 ? 6.559   -14.338 -5.092  1.00 47.63  ? 307 ARG A NE  1 
ATOM   2458 C  CZ  . ARG A 1 356 ? 6.300   -14.850 -6.294  1.00 49.70  ? 307 ARG A CZ  1 
ATOM   2459 N  NH1 . ARG A 1 356 ? 5.678   -14.128 -7.241  1.00 42.13  ? 307 ARG A NH1 1 
ATOM   2460 N  NH2 . ARG A 1 356 ? 6.651   -16.104 -6.543  1.00 50.82  ? 307 ARG A NH2 1 
ATOM   2461 N  N   . PRO A 1 357 ? 1.212   -12.663 -3.710  1.00 45.54  ? 308 PRO A N   1 
ATOM   2462 C  CA  . PRO A 1 357 ? 0.113   -12.956 -4.658  1.00 47.93  ? 308 PRO A CA  1 
ATOM   2463 C  C   . PRO A 1 357 ? 0.608   -13.463 -6.012  1.00 50.71  ? 308 PRO A C   1 
ATOM   2464 O  O   . PRO A 1 357 ? 1.449   -12.814 -6.651  1.00 50.97  ? 308 PRO A O   1 
ATOM   2465 C  CB  . PRO A 1 357 ? -0.582  -11.600 -4.851  1.00 46.15  ? 308 PRO A CB  1 
ATOM   2466 C  CG  . PRO A 1 357 ? -0.105  -10.735 -3.734  1.00 49.04  ? 308 PRO A CG  1 
ATOM   2467 C  CD  . PRO A 1 357 ? 1.246   -11.241 -3.323  1.00 45.79  ? 308 PRO A CD  1 
ATOM   2468 N  N   . VAL A 1 358 ? 0.092   -14.618 -6.424  1.00 50.17  ? 309 VAL A N   1 
ATOM   2469 C  CA  . VAL A 1 358 ? 0.357   -15.184 -7.746  1.00 54.23  ? 309 VAL A CA  1 
ATOM   2470 C  C   . VAL A 1 358 ? -0.939  -15.580 -8.451  1.00 60.03  ? 309 VAL A C   1 
ATOM   2471 O  O   . VAL A 1 358 ? -1.962  -15.824 -7.795  1.00 64.01  ? 309 VAL A O   1 
ATOM   2472 C  CB  . VAL A 1 358 ? 1.290   -16.406 -7.671  1.00 52.92  ? 309 VAL A CB  1 
ATOM   2473 C  CG1 . VAL A 1 358 ? 2.666   -15.975 -7.203  1.00 50.82  ? 309 VAL A CG1 1 
ATOM   2474 C  CG2 . VAL A 1 358 ? 0.716   -17.497 -6.766  1.00 53.02  ? 309 VAL A CG2 1 
ATOM   2475 N  N   . GLU A 1 359 ? -0.888  -15.636 -9.782  1.00 69.41  ? 310 GLU A N   1 
ATOM   2476 C  CA  . GLU A 1 359 ? -2.004  -16.110 -10.614 1.00 74.76  ? 310 GLU A CA  1 
ATOM   2477 C  C   . GLU A 1 359 ? -2.161  -17.631 -10.482 1.00 71.36  ? 310 GLU A C   1 
ATOM   2478 O  O   . GLU A 1 359 ? -1.164  -18.347 -10.433 1.00 72.63  ? 310 GLU A O   1 
ATOM   2479 C  CB  . GLU A 1 359 ? -1.790  -15.692 -12.080 1.00 82.70  ? 310 GLU A CB  1 
ATOM   2480 C  CG  . GLU A 1 359 ? -2.982  -15.936 -13.006 1.00 100.70 ? 310 GLU A CG  1 
ATOM   2481 C  CD  . GLU A 1 359 ? -4.328  -15.567 -12.381 1.00 110.70 ? 310 GLU A CD  1 
ATOM   2482 O  OE1 . GLU A 1 359 ? -4.575  -14.360 -12.130 1.00 114.53 ? 310 GLU A OE1 1 
ATOM   2483 O  OE2 . GLU A 1 359 ? -5.146  -16.491 -12.145 1.00 112.11 ? 310 GLU A OE2 1 
ATOM   2484 N  N   . ASP A 1 360 ? -3.407  -18.108 -10.404 1.00 72.85  ? 311 ASP A N   1 
ATOM   2485 C  CA  . ASP A 1 360 ? -3.730  -19.542 -10.234 1.00 77.30  ? 311 ASP A CA  1 
ATOM   2486 C  C   . ASP A 1 360 ? -3.154  -20.431 -11.364 1.00 79.80  ? 311 ASP A C   1 
ATOM   2487 O  O   . ASP A 1 360 ? -3.047  -19.989 -12.514 1.00 72.83  ? 311 ASP A O   1 
ATOM   2488 C  CB  . ASP A 1 360 ? -5.264  -19.717 -10.130 1.00 79.83  ? 311 ASP A CB  1 
ATOM   2489 C  CG  . ASP A 1 360 ? -5.685  -21.007 -9.399  1.00 83.30  ? 311 ASP A CG  1 
ATOM   2490 O  OD1 . ASP A 1 360 ? -4.908  -21.994 -9.386  1.00 81.65  ? 311 ASP A OD1 1 
ATOM   2491 O  OD2 . ASP A 1 360 ? -6.811  -21.041 -8.839  1.00 78.07  ? 311 ASP A OD2 1 
ATOM   2492 N  N   . VAL A 1 361 ? -2.783  -21.673 -11.024 1.00 91.32  ? 312 VAL A N   1 
ATOM   2493 C  CA  . VAL A 1 361 ? -2.334  -22.688 -12.015 1.00 96.88  ? 312 VAL A CA  1 
ATOM   2494 C  C   . VAL A 1 361 ? -3.396  -22.959 -13.095 1.00 98.42  ? 312 VAL A C   1 
ATOM   2495 O  O   . VAL A 1 361 ? -3.066  -23.083 -14.279 1.00 94.96  ? 312 VAL A O   1 
ATOM   2496 C  CB  . VAL A 1 361 ? -1.835  -24.033 -11.379 1.00 96.65  ? 312 VAL A CB  1 
ATOM   2497 C  CG1 . VAL A 1 361 ? -0.570  -23.821 -10.552 1.00 95.55  ? 312 VAL A CG1 1 
ATOM   2498 C  CG2 . VAL A 1 361 ? -2.917  -24.741 -10.560 1.00 93.09  ? 312 VAL A CG2 1 
ATOM   2499 N  N   . ALA A 1 362 ? -4.660  -23.042 -12.671 1.00 99.81  ? 313 ALA A N   1 
ATOM   2500 C  CA  . ALA A 1 362 ? -5.801  -23.150 -13.574 1.00 95.95  ? 313 ALA A CA  1 
ATOM   2501 C  C   . ALA A 1 362 ? -6.291  -21.747 -13.949 1.00 94.86  ? 313 ALA A C   1 
ATOM   2502 O  O   . ALA A 1 362 ? -5.496  -20.821 -14.107 1.00 98.35  ? 313 ALA A O   1 
ATOM   2503 C  CB  . ALA A 1 362 ? -6.915  -23.957 -12.916 1.00 91.40  ? 313 ALA A CB  1 
ATOM   2504 N  N   . THR A 1 363 ? -7.600  -21.607 -14.128 1.00 96.15  ? 314 THR A N   1 
ATOM   2505 C  CA  . THR A 1 363 ? -8.236  -20.293 -14.195 1.00 99.82  ? 314 THR A CA  1 
ATOM   2506 C  C   . THR A 1 363 ? -9.429  -20.310 -13.242 1.00 100.31 ? 314 THR A C   1 
ATOM   2507 O  O   . THR A 1 363 ? -10.344 -21.139 -13.360 1.00 98.10  ? 314 THR A O   1 
ATOM   2508 C  CB  . THR A 1 363 ? -8.654  -19.850 -15.628 1.00 98.72  ? 314 THR A CB  1 
ATOM   2509 O  OG1 . THR A 1 363 ? -9.248  -20.949 -16.341 1.00 94.11  ? 314 THR A OG1 1 
ATOM   2510 C  CG2 . THR A 1 363 ? -7.452  -19.294 -16.408 1.00 95.82  ? 314 THR A CG2 1 
ATOM   2511 N  N   . SER A 1 364 ? -9.384  -19.401 -12.276 1.00 88.93  ? 315 SER A N   1 
ATOM   2512 C  CA  . SER A 1 364 ? -10.390 -19.323 -11.235 1.00 77.68  ? 315 SER A CA  1 
ATOM   2513 C  C   . SER A 1 364 ? -10.500 -17.869 -10.816 1.00 72.11  ? 315 SER A C   1 
ATOM   2514 O  O   . SER A 1 364 ? -9.752  -17.026 -11.303 1.00 71.08  ? 315 SER A O   1 
ATOM   2515 C  CB  . SER A 1 364 ? -9.962  -20.181 -10.046 1.00 78.04  ? 315 SER A CB  1 
ATOM   2516 O  OG  . SER A 1 364 ? -8.641  -19.847 -9.631  1.00 73.45  ? 315 SER A OG  1 
ATOM   2517 N  N   . GLN A 1 365 ? -11.438 -17.577 -9.927  1.00 66.27  ? 316 GLN A N   1 
ATOM   2518 C  CA  . GLN A 1 365 ? -11.476 -16.276 -9.289  1.00 67.50  ? 316 GLN A CA  1 
ATOM   2519 C  C   . GLN A 1 365 ? -10.823 -16.319 -7.914  1.00 63.73  ? 316 GLN A C   1 
ATOM   2520 O  O   . GLN A 1 365 ? -10.847 -15.334 -7.183  1.00 68.23  ? 316 GLN A O   1 
ATOM   2521 C  CB  . GLN A 1 365 ? -12.908 -15.747 -9.221  1.00 70.52  ? 316 GLN A CB  1 
ATOM   2522 C  CG  . GLN A 1 365 ? -13.333 -15.060 -10.509 1.00 74.94  ? 316 GLN A CG  1 
ATOM   2523 C  CD  . GLN A 1 365 ? -14.834 -15.032 -10.696 1.00 76.03  ? 316 GLN A CD  1 
ATOM   2524 O  OE1 . GLN A 1 365 ? -15.599 -15.471 -9.828  1.00 77.55  ? 316 GLN A OE1 1 
ATOM   2525 N  NE2 . GLN A 1 365 ? -15.265 -14.517 -11.841 1.00 72.46  ? 316 GLN A NE2 1 
ATOM   2526 N  N   . ASP A 1 366 ? -10.228 -17.464 -7.588  1.00 58.16  ? 317 ASP A N   1 
ATOM   2527 C  CA  . ASP A 1 366 ? -9.550  -17.689 -6.310  1.00 54.33  ? 317 ASP A CA  1 
ATOM   2528 C  C   . ASP A 1 366 ? -8.412  -16.712 -6.063  1.00 51.80  ? 317 ASP A C   1 
ATOM   2529 O  O   . ASP A 1 366 ? -7.792  -16.249 -7.011  1.00 48.19  ? 317 ASP A O   1 
ATOM   2530 C  CB  . ASP A 1 366 ? -8.993  -19.111 -6.260  1.00 55.45  ? 317 ASP A CB  1 
ATOM   2531 C  CG  . ASP A 1 366 ? -10.071 -20.161 -6.135  1.00 55.45  ? 317 ASP A CG  1 
ATOM   2532 O  OD1 . ASP A 1 366 ? -11.269 -19.836 -6.296  1.00 59.05  ? 317 ASP A OD1 1 
ATOM   2533 O  OD2 . ASP A 1 366 ? -9.711  -21.322 -5.863  1.00 55.48  ? 317 ASP A OD2 1 
ATOM   2534 N  N   . ASP A 1 367 ? -8.155  -16.394 -4.791  1.00 50.88  ? 318 ASP A N   1 
ATOM   2535 C  CA  . ASP A 1 367 ? -6.999  -15.576 -4.415  1.00 48.44  ? 318 ASP A CA  1 
ATOM   2536 C  C   . ASP A 1 367 ? -5.881  -16.502 -3.976  1.00 47.81  ? 318 ASP A C   1 
ATOM   2537 O  O   . ASP A 1 367 ? -6.022  -17.193 -2.975  1.00 46.33  ? 318 ASP A O   1 
ATOM   2538 C  CB  . ASP A 1 367 ? -7.359  -14.577 -3.311  1.00 49.05  ? 318 ASP A CB  1 
ATOM   2539 C  CG  . ASP A 1 367 ? -8.294  -13.473 -3.803  1.00 52.14  ? 318 ASP A CG  1 
ATOM   2540 O  OD1 . ASP A 1 367 ? -8.200  -13.077 -4.980  1.00 52.52  ? 318 ASP A OD1 1 
ATOM   2541 O  OD2 . ASP A 1 367 ? -9.132  -12.990 -3.019  1.00 51.01  ? 318 ASP A OD2 1 
ATOM   2542 N  N   . CYS A 1 368 ? -4.785  -16.518 -4.743  1.00 51.20  ? 319 CYS A N   1 
ATOM   2543 C  CA  . CYS A 1 368 ? -3.682  -17.474 -4.562  1.00 49.61  ? 319 CYS A CA  1 
ATOM   2544 C  C   . CYS A 1 368 ? -2.387  -16.785 -4.164  1.00 49.43  ? 319 CYS A C   1 
ATOM   2545 O  O   . CYS A 1 368 ? -2.155  -15.641 -4.548  1.00 50.02  ? 319 CYS A O   1 
ATOM   2546 C  CB  . CYS A 1 368 ? -3.460  -18.267 -5.852  1.00 50.68  ? 319 CYS A CB  1 
ATOM   2547 S  SG  . CYS A 1 368 ? -4.950  -19.116 -6.447  1.00 57.97  ? 319 CYS A SG  1 
ATOM   2548 N  N   . TYR A 1 369 ? -1.549  -17.489 -3.398  1.00 49.02  ? 320 TYR A N   1 
ATOM   2549 C  CA  . TYR A 1 369 ? -0.301  -16.936 -2.865  1.00 46.13  ? 320 TYR A CA  1 
ATOM   2550 C  C   . TYR A 1 369 ? 0.780   -17.990 -2.748  1.00 48.22  ? 320 TYR A C   1 
ATOM   2551 O  O   . TYR A 1 369 ? 0.483   -19.160 -2.542  1.00 50.93  ? 320 TYR A O   1 
ATOM   2552 C  CB  . TYR A 1 369 ? -0.521  -16.339 -1.476  1.00 46.57  ? 320 TYR A CB  1 
ATOM   2553 C  CG  . TYR A 1 369 ? -1.700  -15.403 -1.376  1.00 47.53  ? 320 TYR A CG  1 
ATOM   2554 C  CD1 . TYR A 1 369 ? -2.980  -15.899 -1.108  1.00 45.49  ? 320 TYR A CD1 1 
ATOM   2555 C  CD2 . TYR A 1 369 ? -1.544  -14.021 -1.554  1.00 46.89  ? 320 TYR A CD2 1 
ATOM   2556 C  CE1 . TYR A 1 369 ? -4.065  -15.053 -1.026  1.00 46.79  ? 320 TYR A CE1 1 
ATOM   2557 C  CE2 . TYR A 1 369 ? -2.631  -13.167 -1.460  1.00 48.04  ? 320 TYR A CE2 1 
ATOM   2558 C  CZ  . TYR A 1 369 ? -3.885  -13.695 -1.199  1.00 49.11  ? 320 TYR A CZ  1 
ATOM   2559 O  OH  . TYR A 1 369 ? -4.976  -12.878 -1.104  1.00 54.89  ? 320 TYR A OH  1 
ATOM   2560 N  N   . LYS A 1 370 ? 2.033   -17.570 -2.883  1.00 46.50  ? 321 LYS A N   1 
ATOM   2561 C  CA  . LYS A 1 370 ? 3.177   -18.408 -2.537  1.00 47.88  ? 321 LYS A CA  1 
ATOM   2562 C  C   . LYS A 1 370 ? 3.844   -17.902 -1.246  1.00 46.94  ? 321 LYS A C   1 
ATOM   2563 O  O   . LYS A 1 370 ? 3.792   -16.698 -0.946  1.00 45.56  ? 321 LYS A O   1 
ATOM   2564 C  CB  . LYS A 1 370 ? 4.189   -18.401 -3.679  1.00 48.75  ? 321 LYS A CB  1 
ATOM   2565 C  CG  . LYS A 1 370 ? 3.838   -19.316 -4.834  1.00 52.31  ? 321 LYS A CG  1 
ATOM   2566 C  CD  . LYS A 1 370 ? 5.018   -19.476 -5.785  1.00 53.16  ? 321 LYS A CD  1 
ATOM   2567 C  CE  . LYS A 1 370 ? 4.611   -20.330 -6.971  1.00 56.81  ? 321 LYS A CE  1 
ATOM   2568 N  NZ  . LYS A 1 370 ? 5.495   -20.089 -8.139  1.00 56.13  ? 321 LYS A NZ  1 
ATOM   2569 N  N   . PHE A 1 371 ? 4.469   -18.807 -0.493  1.00 46.54  ? 322 PHE A N   1 
ATOM   2570 C  CA  . PHE A 1 371 ? 5.181   -18.444 0.744   1.00 47.74  ? 322 PHE A CA  1 
ATOM   2571 C  C   . PHE A 1 371 ? 6.506   -17.766 0.398   1.00 47.92  ? 322 PHE A C   1 
ATOM   2572 O  O   . PHE A 1 371 ? 7.414   -18.421 -0.099  1.00 51.35  ? 322 PHE A O   1 
ATOM   2573 C  CB  . PHE A 1 371 ? 5.404   -19.698 1.600   1.00 46.99  ? 322 PHE A CB  1 
ATOM   2574 C  CG  . PHE A 1 371 ? 5.936   -19.427 2.994   1.00 46.17  ? 322 PHE A CG  1 
ATOM   2575 C  CD1 . PHE A 1 371 ? 5.222   -18.648 3.902   1.00 47.47  ? 322 PHE A CD1 1 
ATOM   2576 C  CD2 . PHE A 1 371 ? 7.132   -19.999 3.411   1.00 44.67  ? 322 PHE A CD2 1 
ATOM   2577 C  CE1 . PHE A 1 371 ? 5.704   -18.421 5.188   1.00 48.25  ? 322 PHE A CE1 1 
ATOM   2578 C  CE2 . PHE A 1 371 ? 7.622   -19.777 4.684   1.00 47.29  ? 322 PHE A CE2 1 
ATOM   2579 C  CZ  . PHE A 1 371 ? 6.909   -18.983 5.577   1.00 47.55  ? 322 PHE A CZ  1 
ATOM   2580 N  N   . ALA A 1 372 ? 6.600   -16.458 0.655   1.00 45.82  ? 323 ALA A N   1 
ATOM   2581 C  CA  . ALA A 1 372 ? 7.766   -15.626 0.277   1.00 41.76  ? 323 ALA A CA  1 
ATOM   2582 C  C   . ALA A 1 372 ? 8.882   -15.494 1.348   1.00 44.82  ? 323 ALA A C   1 
ATOM   2583 O  O   . ALA A 1 372 ? 9.591   -14.472 1.417   1.00 46.66  ? 323 ALA A O   1 
ATOM   2584 C  CB  . ALA A 1 372 ? 7.301   -14.246 -0.170  1.00 41.88  ? 323 ALA A CB  1 
ATOM   2585 N  N   . ILE A 1 373 ? 9.016   -16.516 2.188   1.00 45.62  ? 324 ILE A N   1 
ATOM   2586 C  CA  . ILE A 1 373 ? 10.126  -16.636 3.130   1.00 45.82  ? 324 ILE A CA  1 
ATOM   2587 C  C   . ILE A 1 373 ? 10.857  -17.922 2.757   1.00 49.56  ? 324 ILE A C   1 
ATOM   2588 O  O   . ILE A 1 373 ? 10.231  -18.980 2.620   1.00 47.57  ? 324 ILE A O   1 
ATOM   2589 C  CB  . ILE A 1 373 ? 9.645   -16.765 4.591   1.00 43.16  ? 324 ILE A CB  1 
ATOM   2590 C  CG1 . ILE A 1 373 ? 8.646   -15.669 4.945   1.00 42.56  ? 324 ILE A CG1 1 
ATOM   2591 C  CG2 . ILE A 1 373 ? 10.827  -16.793 5.568   1.00 42.41  ? 324 ILE A CG2 1 
ATOM   2592 C  CD1 . ILE A 1 373 ? 8.229   -15.718 6.403   1.00 41.84  ? 324 ILE A CD1 1 
ATOM   2593 N  N   . SER A 1 374 ? 12.170  -17.831 2.574   1.00 49.44  ? 325 SER A N   1 
ATOM   2594 C  CA  . SER A 1 374 ? 12.958  -19.013 2.233   1.00 52.67  ? 325 SER A CA  1 
ATOM   2595 C  C   . SER A 1 374 ? 14.361  -19.075 2.876   1.00 52.42  ? 325 SER A C   1 
ATOM   2596 O  O   . SER A 1 374 ? 14.791  -18.171 3.611   1.00 50.25  ? 325 SER A O   1 
ATOM   2597 C  CB  . SER A 1 374 ? 13.023  -19.212 0.719   1.00 47.98  ? 325 SER A CB  1 
ATOM   2598 O  OG  . SER A 1 374 ? 13.535  -18.053 0.121   1.00 47.59  ? 325 SER A OG  1 
ATOM   2599 N  N   . GLN A 1 375 ? 15.037  -20.185 2.604   1.00 54.86  ? 326 GLN A N   1 
ATOM   2600 C  CA  . GLN A 1 375 ? 16.308  -20.518 3.203   1.00 57.01  ? 326 GLN A CA  1 
ATOM   2601 C  C   . GLN A 1 375 ? 17.439  -19.820 2.466   1.00 58.11  ? 326 GLN A C   1 
ATOM   2602 O  O   . GLN A 1 375 ? 17.415  -19.665 1.242   1.00 55.53  ? 326 GLN A O   1 
ATOM   2603 C  CB  . GLN A 1 375 ? 16.502  -22.024 3.144   1.00 60.99  ? 326 GLN A CB  1 
ATOM   2604 C  CG  . GLN A 1 375 ? 17.262  -22.606 4.319   1.00 65.63  ? 326 GLN A CG  1 
ATOM   2605 C  CD  . GLN A 1 375 ? 17.457  -24.096 4.163   1.00 66.82  ? 326 GLN A CD  1 
ATOM   2606 O  OE1 . GLN A 1 375 ? 18.573  -24.558 3.960   1.00 74.92  ? 326 GLN A OE1 1 
ATOM   2607 N  NE2 . GLN A 1 375 ? 16.369  -24.853 4.224   1.00 65.25  ? 326 GLN A NE2 1 
ATOM   2608 N  N   . SER A 1 376 ? 18.434  -19.399 3.228   1.00 59.65  ? 327 SER A N   1 
ATOM   2609 C  CA  . SER A 1 376 ? 19.585  -18.723 2.676   1.00 58.17  ? 327 SER A CA  1 
ATOM   2610 C  C   . SER A 1 376 ? 20.822  -19.361 3.273   1.00 59.94  ? 327 SER A C   1 
ATOM   2611 O  O   . SER A 1 376 ? 20.839  -19.726 4.456   1.00 58.49  ? 327 SER A O   1 
ATOM   2612 C  CB  . SER A 1 376 ? 19.522  -17.239 3.048   1.00 59.09  ? 327 SER A CB  1 
ATOM   2613 O  OG  . SER A 1 376 ? 20.755  -16.575 2.830   1.00 55.34  ? 327 SER A OG  1 
ATOM   2614 N  N   . SER A 1 377 ? 21.865  -19.494 2.463   1.00 66.00  ? 328 SER A N   1 
ATOM   2615 C  CA  . SER A 1 377 ? 23.155  -19.944 2.996   1.00 67.94  ? 328 SER A CA  1 
ATOM   2616 C  C   . SER A 1 377 ? 24.142  -18.782 3.062   1.00 65.14  ? 328 SER A C   1 
ATOM   2617 O  O   . SER A 1 377 ? 25.287  -18.960 3.465   1.00 65.83  ? 328 SER A O   1 
ATOM   2618 C  CB  . SER A 1 377 ? 23.712  -21.113 2.182   1.00 67.18  ? 328 SER A CB  1 
ATOM   2619 O  OG  . SER A 1 377 ? 23.630  -20.815 0.803   1.00 69.59  ? 328 SER A OG  1 
ATOM   2620 N  N   . THR A 1 378 ? 23.673  -17.586 2.699   1.00 64.10  ? 329 THR A N   1 
ATOM   2621 C  CA  . THR A 1 378 ? 24.509  -16.375 2.704   1.00 61.04  ? 329 THR A CA  1 
ATOM   2622 C  C   . THR A 1 378 ? 23.968  -15.251 3.626   1.00 57.73  ? 329 THR A C   1 
ATOM   2623 O  O   . THR A 1 378 ? 24.165  -14.066 3.359   1.00 59.36  ? 329 THR A O   1 
ATOM   2624 C  CB  . THR A 1 378 ? 24.760  -15.853 1.263   1.00 61.20  ? 329 THR A CB  1 
ATOM   2625 O  OG1 . THR A 1 378 ? 23.518  -15.442 0.685   1.00 61.26  ? 329 THR A OG1 1 
ATOM   2626 C  CG2 . THR A 1 378 ? 25.385  -16.949 0.370   1.00 54.99  ? 329 THR A CG2 1 
ATOM   2627 N  N   . GLY A 1 379 ? 23.322  -15.631 4.730   1.00 56.40  ? 330 GLY A N   1 
ATOM   2628 C  CA  . GLY A 1 379 ? 22.799  -14.664 5.706   1.00 53.40  ? 330 GLY A CA  1 
ATOM   2629 C  C   . GLY A 1 379 ? 21.396  -14.136 5.408   1.00 55.95  ? 330 GLY A C   1 
ATOM   2630 O  O   . GLY A 1 379 ? 20.795  -14.450 4.376   1.00 55.85  ? 330 GLY A O   1 
ATOM   2631 N  N   . THR A 1 380 ? 20.864  -13.330 6.315   1.00 52.78  ? 331 THR A N   1 
ATOM   2632 C  CA  . THR A 1 380 ? 19.534  -12.756 6.136   1.00 49.48  ? 331 THR A CA  1 
ATOM   2633 C  C   . THR A 1 380 ? 19.504  -11.772 4.979   1.00 48.72  ? 331 THR A C   1 
ATOM   2634 O  O   . THR A 1 380 ? 20.392  -10.923 4.865   1.00 42.93  ? 331 THR A O   1 
ATOM   2635 C  CB  . THR A 1 380 ? 19.050  -12.042 7.408   1.00 47.85  ? 331 THR A CB  1 
ATOM   2636 O  OG1 . THR A 1 380 ? 18.922  -13.013 8.457   1.00 47.95  ? 331 THR A OG1 1 
ATOM   2637 C  CG2 . THR A 1 380 ? 17.693  -11.357 7.163   1.00 44.87  ? 331 THR A CG2 1 
ATOM   2638 N  N   . VAL A 1 381 ? 18.480  -11.916 4.130   1.00 46.84  ? 332 VAL A N   1 
ATOM   2639 C  CA  . VAL A 1 381 ? 18.201  -10.998 3.030   1.00 46.39  ? 332 VAL A CA  1 
ATOM   2640 C  C   . VAL A 1 381 ? 16.769  -10.491 3.155   1.00 48.18  ? 332 VAL A C   1 
ATOM   2641 O  O   . VAL A 1 381 ? 15.812  -11.266 3.070   1.00 50.82  ? 332 VAL A O   1 
ATOM   2642 C  CB  . VAL A 1 381 ? 18.390  -11.644 1.636   1.00 44.41  ? 332 VAL A CB  1 
ATOM   2643 C  CG1 . VAL A 1 381 ? 18.153  -10.616 0.547   1.00 42.50  ? 332 VAL A CG1 1 
ATOM   2644 C  CG2 . VAL A 1 381 ? 19.796  -12.183 1.470   1.00 43.43  ? 332 VAL A CG2 1 
ATOM   2645 N  N   . MET A 1 382 ? 16.643  -9.187  3.382   1.00 46.71  ? 333 MET A N   1 
ATOM   2646 C  CA  . MET A 1 382 ? 15.357  -8.526  3.469   1.00 45.45  ? 333 MET A CA  1 
ATOM   2647 C  C   . MET A 1 382 ? 15.018  -8.052  2.068   1.00 41.92  ? 333 MET A C   1 
ATOM   2648 O  O   . MET A 1 382 ? 15.459  -6.996  1.635   1.00 47.07  ? 333 MET A O   1 
ATOM   2649 C  CB  . MET A 1 382 ? 15.428  -7.354  4.473   1.00 51.05  ? 333 MET A CB  1 
ATOM   2650 C  CG  . MET A 1 382 ? 15.721  -7.772  5.921   1.00 57.11  ? 333 MET A CG  1 
ATOM   2651 S  SD  . MET A 1 382 ? 16.080  -6.424  7.090   1.00 60.80  ? 333 MET A SD  1 
ATOM   2652 C  CE  . MET A 1 382 ? 14.630  -5.410  6.860   1.00 54.20  ? 333 MET A CE  1 
ATOM   2653 N  N   . GLY A 1 383 ? 14.234  -8.840  1.352   1.00 43.74  ? 334 GLY A N   1 
ATOM   2654 C  CA  . GLY A 1 383 ? 13.949  -8.575  -0.049  1.00 40.74  ? 334 GLY A CA  1 
ATOM   2655 C  C   . GLY A 1 383 ? 12.736  -7.712  -0.336  1.00 42.65  ? 334 GLY A C   1 
ATOM   2656 O  O   . GLY A 1 383 ? 12.222  -7.031  0.553   1.00 41.96  ? 334 GLY A O   1 
ATOM   2657 N  N   . ALA A 1 384 ? 12.287  -7.743  -1.599  1.00 40.74  ? 335 ALA A N   1 
ATOM   2658 C  CA  . ALA A 1 384 ? 11.162  -6.940  -2.061  1.00 39.68  ? 335 ALA A CA  1 
ATOM   2659 C  C   . ALA A 1 384 ? 9.914   -7.065  -1.182  1.00 40.77  ? 335 ALA A C   1 
ATOM   2660 O  O   . ALA A 1 384 ? 9.266   -6.055  -0.898  1.00 43.68  ? 335 ALA A O   1 
ATOM   2661 C  CB  . ALA A 1 384 ? 10.824  -7.265  -3.502  1.00 38.77  ? 335 ALA A CB  1 
ATOM   2662 N  N   . VAL A 1 385 ? 9.585   -8.277  -0.739  1.00 38.68  ? 336 VAL A N   1 
ATOM   2663 C  CA  . VAL A 1 385 ? 8.350   -8.491  0.024   1.00 42.38  ? 336 VAL A CA  1 
ATOM   2664 C  C   . VAL A 1 385 ? 8.374   -7.844  1.417   1.00 47.45  ? 336 VAL A C   1 
ATOM   2665 O  O   . VAL A 1 385 ? 7.331   -7.370  1.886   1.00 53.55  ? 336 VAL A O   1 
ATOM   2666 C  CB  . VAL A 1 385 ? 7.883   -9.981  0.067   1.00 40.78  ? 336 VAL A CB  1 
ATOM   2667 C  CG1 . VAL A 1 385 ? 7.618   -10.500 -1.340  1.00 38.35  ? 336 VAL A CG1 1 
ATOM   2668 C  CG2 . VAL A 1 385 ? 8.873   -10.878 0.783   1.00 37.89  ? 336 VAL A CG2 1 
ATOM   2669 N  N   . ILE A 1 386 ? 9.543   -7.792  2.062   1.00 44.35  ? 337 ILE A N   1 
ATOM   2670 C  CA  . ILE A 1 386 ? 9.695   -6.997  3.291   1.00 45.55  ? 337 ILE A CA  1 
ATOM   2671 C  C   . ILE A 1 386 ? 9.697   -5.485  3.000   1.00 46.90  ? 337 ILE A C   1 
ATOM   2672 O  O   . ILE A 1 386 ? 9.083   -4.697  3.720   1.00 50.65  ? 337 ILE A O   1 
ATOM   2673 C  CB  . ILE A 1 386 ? 10.968  -7.369  4.062   1.00 45.01  ? 337 ILE A CB  1 
ATOM   2674 C  CG1 . ILE A 1 386 ? 11.040  -8.873  4.209   1.00 50.27  ? 337 ILE A CG1 1 
ATOM   2675 C  CG2 . ILE A 1 386 ? 10.969  -6.752  5.457   1.00 44.28  ? 337 ILE A CG2 1 
ATOM   2676 C  CD1 . ILE A 1 386 ? 9.935   -9.433  5.076   1.00 54.01  ? 337 ILE A CD1 1 
ATOM   2677 N  N   . MET A 1 387 ? 10.381  -5.093  1.936   1.00 44.16  ? 338 MET A N   1 
ATOM   2678 C  CA  . MET A 1 387 ? 10.535  -3.698  1.599   1.00 43.29  ? 338 MET A CA  1 
ATOM   2679 C  C   . MET A 1 387 ? 9.216   -3.054  1.176   1.00 45.67  ? 338 MET A C   1 
ATOM   2680 O  O   . MET A 1 387 ? 9.032   -1.853  1.366   1.00 45.91  ? 338 MET A O   1 
ATOM   2681 C  CB  . MET A 1 387 ? 11.582  -3.557  0.503   1.00 44.79  ? 338 MET A CB  1 
ATOM   2682 C  CG  . MET A 1 387 ? 13.021  -3.731  0.973   1.00 42.62  ? 338 MET A CG  1 
ATOM   2683 S  SD  . MET A 1 387 ? 14.207  -3.304  -0.328  1.00 46.54  ? 338 MET A SD  1 
ATOM   2684 C  CE  . MET A 1 387 ? 13.849  -1.561  -0.596  1.00 40.00  ? 338 MET A CE  1 
ATOM   2685 N  N   . GLU A 1 388 ? 8.304   -3.858  0.624   1.00 44.67  ? 339 GLU A N   1 
ATOM   2686 C  CA  . GLU A 1 388 ? 6.949   -3.411  0.244   1.00 44.58  ? 339 GLU A CA  1 
ATOM   2687 C  C   . GLU A 1 388 ? 6.082   -2.903  1.410   1.00 45.85  ? 339 GLU A C   1 
ATOM   2688 O  O   . GLU A 1 388 ? 5.088   -2.201  1.184   1.00 41.67  ? 339 GLU A O   1 
ATOM   2689 C  CB  . GLU A 1 388 ? 6.209   -4.548  -0.435  1.00 45.04  ? 339 GLU A CB  1 
ATOM   2690 C  CG  . GLU A 1 388 ? 6.566   -4.763  -1.902  1.00 44.69  ? 339 GLU A CG  1 
ATOM   2691 C  CD  . GLU A 1 388 ? 5.888   -5.993  -2.480  1.00 41.20  ? 339 GLU A CD  1 
ATOM   2692 O  OE1 . GLU A 1 388 ? 6.083   -6.265  -3.668  1.00 44.06  ? 339 GLU A OE1 1 
ATOM   2693 O  OE2 . GLU A 1 388 ? 5.138   -6.676  -1.752  1.00 45.58  ? 339 GLU A OE2 1 
ATOM   2694 N  N   . GLY A 1 389 ? 6.459   -3.267  2.641   1.00 41.42  ? 340 GLY A N   1 
ATOM   2695 C  CA  . GLY A 1 389 ? 5.780   -2.799  3.849   1.00 43.77  ? 340 GLY A CA  1 
ATOM   2696 C  C   . GLY A 1 389 ? 6.222   -1.424  4.327   1.00 45.12  ? 340 GLY A C   1 
ATOM   2697 O  O   . GLY A 1 389 ? 5.527   -0.797  5.130   1.00 42.70  ? 340 GLY A O   1 
ATOM   2698 N  N   . PHE A 1 390 ? 7.368   -0.952  3.814   1.00 44.88  ? 341 PHE A N   1 
ATOM   2699 C  CA  . PHE A 1 390 ? 8.055   0.238   4.346   1.00 41.83  ? 341 PHE A CA  1 
ATOM   2700 C  C   . PHE A 1 390 ? 8.579   1.162   3.274   1.00 44.96  ? 341 PHE A C   1 
ATOM   2701 O  O   . PHE A 1 390 ? 8.832   0.756   2.130   1.00 41.90  ? 341 PHE A O   1 
ATOM   2702 C  CB  . PHE A 1 390 ? 9.209   -0.167  5.288   1.00 39.44  ? 341 PHE A CB  1 
ATOM   2703 C  CG  . PHE A 1 390 ? 8.818   -1.231  6.260   1.00 38.84  ? 341 PHE A CG  1 
ATOM   2704 C  CD1 . PHE A 1 390 ? 8.123   -0.902  7.426   1.00 38.77  ? 341 PHE A CD1 1 
ATOM   2705 C  CD2 . PHE A 1 390 ? 9.063   -2.579  5.972   1.00 35.39  ? 341 PHE A CD2 1 
ATOM   2706 C  CE1 . PHE A 1 390 ? 7.706   -1.893  8.315   1.00 38.02  ? 341 PHE A CE1 1 
ATOM   2707 C  CE2 . PHE A 1 390 ? 8.645   -3.566  6.850   1.00 37.46  ? 341 PHE A CE2 1 
ATOM   2708 C  CZ  . PHE A 1 390 ? 7.956   -3.223  8.020   1.00 36.32  ? 341 PHE A CZ  1 
ATOM   2709 N  N   . TYR A 1 391 ? 8.701   2.426   3.665   1.00 45.75  ? 342 TYR A N   1 
ATOM   2710 C  CA  . TYR A 1 391 ? 9.523   3.385   2.968   1.00 45.38  ? 342 TYR A CA  1 
ATOM   2711 C  C   . TYR A 1 391 ? 10.927  3.143   3.530   1.00 44.55  ? 342 TYR A C   1 
ATOM   2712 O  O   . TYR A 1 391 ? 11.116  3.117   4.765   1.00 41.01  ? 342 TYR A O   1 
ATOM   2713 C  CB  . TYR A 1 391 ? 9.030   4.806   3.279   1.00 46.65  ? 342 TYR A CB  1 
ATOM   2714 C  CG  . TYR A 1 391 ? 9.654   5.912   2.461   1.00 45.29  ? 342 TYR A CG  1 
ATOM   2715 C  CD1 . TYR A 1 391 ? 10.003  5.722   1.113   1.00 47.89  ? 342 TYR A CD1 1 
ATOM   2716 C  CD2 . TYR A 1 391 ? 9.850   7.162   3.014   1.00 48.42  ? 342 TYR A CD2 1 
ATOM   2717 C  CE1 . TYR A 1 391 ? 10.567  6.744   0.363   1.00 46.08  ? 342 TYR A CE1 1 
ATOM   2718 C  CE2 . TYR A 1 391 ? 10.407  8.195   2.276   1.00 49.55  ? 342 TYR A CE2 1 
ATOM   2719 C  CZ  . TYR A 1 391 ? 10.766  7.981   0.957   1.00 49.22  ? 342 TYR A CZ  1 
ATOM   2720 O  OH  . TYR A 1 391 ? 11.314  9.024   0.260   1.00 47.87  ? 342 TYR A OH  1 
ATOM   2721 N  N   . VAL A 1 392 ? 11.889  2.890   2.637   1.00 42.66  ? 343 VAL A N   1 
ATOM   2722 C  CA  . VAL A 1 392 ? 13.242  2.556   3.074   1.00 44.07  ? 343 VAL A CA  1 
ATOM   2723 C  C   . VAL A 1 392 ? 14.235  3.624   2.644   1.00 45.53  ? 343 VAL A C   1 
ATOM   2724 O  O   . VAL A 1 392 ? 14.383  3.868   1.454   1.00 46.75  ? 343 VAL A O   1 
ATOM   2725 C  CB  . VAL A 1 392 ? 13.699  1.171   2.583   1.00 41.46  ? 343 VAL A CB  1 
ATOM   2726 C  CG1 . VAL A 1 392 ? 15.022  0.800   3.253   1.00 42.00  ? 343 VAL A CG1 1 
ATOM   2727 C  CG2 . VAL A 1 392 ? 12.658  0.116   2.941   1.00 39.19  ? 343 VAL A CG2 1 
ATOM   2728 N  N   . VAL A 1 393 ? 14.896  4.271   3.608   1.00 42.27  ? 344 VAL A N   1 
ATOM   2729 C  CA  . VAL A 1 393 ? 15.762  5.415   3.276   1.00 44.43  ? 344 VAL A CA  1 
ATOM   2730 C  C   . VAL A 1 393 ? 17.230  5.017   3.368   1.00 44.75  ? 344 VAL A C   1 
ATOM   2731 O  O   . VAL A 1 393 ? 17.722  4.664   4.456   1.00 44.41  ? 344 VAL A O   1 
ATOM   2732 C  CB  . VAL A 1 393 ? 15.472  6.670   4.131   1.00 46.27  ? 344 VAL A CB  1 
ATOM   2733 C  CG1 . VAL A 1 393 ? 16.401  7.818   3.747   1.00 46.20  ? 344 VAL A CG1 1 
ATOM   2734 C  CG2 . VAL A 1 393 ? 14.018  7.107   3.986   1.00 44.73  ? 344 VAL A CG2 1 
ATOM   2735 N  N   . PHE A 1 394 ? 17.910  5.051   2.218   1.00 41.84  ? 345 PHE A N   1 
ATOM   2736 C  CA  . PHE A 1 394 ? 19.293  4.615   2.125   1.00 43.72  ? 345 PHE A CA  1 
ATOM   2737 C  C   . PHE A 1 394 ? 20.161  5.836   2.300   1.00 45.82  ? 345 PHE A C   1 
ATOM   2738 O  O   . PHE A 1 394 ? 20.540  6.491   1.337   1.00 52.71  ? 345 PHE A O   1 
ATOM   2739 C  CB  . PHE A 1 394 ? 19.537  3.895   0.804   1.00 41.03  ? 345 PHE A CB  1 
ATOM   2740 C  CG  . PHE A 1 394 ? 18.803  2.593   0.698   1.00 39.79  ? 345 PHE A CG  1 
ATOM   2741 C  CD1 . PHE A 1 394 ? 17.470  2.563   0.283   1.00 41.72  ? 345 PHE A CD1 1 
ATOM   2742 C  CD2 . PHE A 1 394 ? 19.429  1.383   1.038   1.00 42.21  ? 345 PHE A CD2 1 
ATOM   2743 C  CE1 . PHE A 1 394 ? 16.771  1.352   0.193   1.00 41.62  ? 345 PHE A CE1 1 
ATOM   2744 C  CE2 . PHE A 1 394 ? 18.731  0.168   0.962   1.00 42.07  ? 345 PHE A CE2 1 
ATOM   2745 C  CZ  . PHE A 1 394 ? 17.403  0.156   0.531   1.00 40.41  ? 345 PHE A CZ  1 
ATOM   2746 N  N   . ASP A 1 395 ? 20.431  6.155   3.561   1.00 43.70  ? 346 ASP A N   1 
ATOM   2747 C  CA  . ASP A 1 395 ? 21.110  7.380   3.917   1.00 45.10  ? 346 ASP A CA  1 
ATOM   2748 C  C   . ASP A 1 395 ? 22.617  7.139   3.968   1.00 46.18  ? 346 ASP A C   1 
ATOM   2749 O  O   . ASP A 1 395 ? 23.206  6.912   5.037   1.00 47.52  ? 346 ASP A O   1 
ATOM   2750 C  CB  . ASP A 1 395 ? 20.575  7.909   5.245   1.00 47.15  ? 346 ASP A CB  1 
ATOM   2751 C  CG  . ASP A 1 395 ? 21.124  9.290   5.583   1.00 51.78  ? 346 ASP A CG  1 
ATOM   2752 O  OD1 . ASP A 1 395 ? 22.052  9.745   4.860   1.00 47.70  ? 346 ASP A OD1 1 
ATOM   2753 O  OD2 . ASP A 1 395 ? 20.644  9.899   6.582   1.00 49.57  ? 346 ASP A OD2 1 
ATOM   2754 N  N   . ARG A 1 396 ? 23.215  7.175   2.783   1.00 45.52  ? 347 ARG A N   1 
ATOM   2755 C  CA  . ARG A 1 396 ? 24.635  6.946   2.578   1.00 45.56  ? 347 ARG A CA  1 
ATOM   2756 C  C   . ARG A 1 396 ? 25.487  7.986   3.291   1.00 44.26  ? 347 ARG A C   1 
ATOM   2757 O  O   . ARG A 1 396 ? 26.438  7.636   3.975   1.00 45.66  ? 347 ARG A O   1 
ATOM   2758 C  CB  . ARG A 1 396 ? 24.930  6.920   1.079   1.00 45.35  ? 347 ARG A CB  1 
ATOM   2759 C  CG  . ARG A 1 396 ? 24.373  5.692   0.380   1.00 46.49  ? 347 ARG A CG  1 
ATOM   2760 C  CD  . ARG A 1 396 ? 24.189  5.881   -1.116  1.00 44.18  ? 347 ARG A CD  1 
ATOM   2761 N  NE  . ARG A 1 396 ? 25.437  6.080   -1.859  1.00 41.28  ? 347 ARG A NE  1 
ATOM   2762 C  CZ  . ARG A 1 396 ? 26.096  5.124   -2.514  1.00 45.20  ? 347 ARG A CZ  1 
ATOM   2763 N  NH1 . ARG A 1 396 ? 25.650  3.864   -2.492  1.00 43.70  ? 347 ARG A NH1 1 
ATOM   2764 N  NH2 . ARG A 1 396 ? 27.227  5.419   -3.173  1.00 42.33  ? 347 ARG A NH2 1 
ATOM   2765 N  N   . ALA A 1 397 ? 25.127  9.259   3.147   1.00 45.83  ? 348 ALA A N   1 
ATOM   2766 C  CA  . ALA A 1 397 ? 25.834  10.362  3.805   1.00 45.45  ? 348 ALA A CA  1 
ATOM   2767 C  C   . ALA A 1 397 ? 26.022  10.139  5.305   1.00 48.75  ? 348 ALA A C   1 
ATOM   2768 O  O   . ALA A 1 397 ? 27.102  10.387  5.826   1.00 51.85  ? 348 ALA A O   1 
ATOM   2769 C  CB  . ALA A 1 397 ? 25.123  11.687  3.555   1.00 42.53  ? 348 ALA A CB  1 
ATOM   2770 N  N   . ARG A 1 398 ? 24.984  9.662   5.992   1.00 47.81  ? 349 ARG A N   1 
ATOM   2771 C  CA  . ARG A 1 398 ? 25.055  9.508   7.443   1.00 47.69  ? 349 ARG A CA  1 
ATOM   2772 C  C   . ARG A 1 398 ? 25.179  8.040   7.845   1.00 51.13  ? 349 ARG A C   1 
ATOM   2773 O  O   . ARG A 1 398 ? 24.992  7.685   9.012   1.00 49.85  ? 349 ARG A O   1 
ATOM   2774 C  CB  . ARG A 1 398 ? 23.884  10.217  8.133   1.00 47.95  ? 349 ARG A CB  1 
ATOM   2775 C  CG  . ARG A 1 398 ? 23.868  11.720  7.838   1.00 54.75  ? 349 ARG A CG  1 
ATOM   2776 C  CD  . ARG A 1 398 ? 22.736  12.450  8.528   1.00 60.75  ? 349 ARG A CD  1 
ATOM   2777 N  NE  . ARG A 1 398 ? 22.801  12.239  9.974   1.00 66.22  ? 349 ARG A NE  1 
ATOM   2778 C  CZ  . ARG A 1 398 ? 22.002  12.830  10.856  1.00 69.85  ? 349 ARG A CZ  1 
ATOM   2779 N  NH1 . ARG A 1 398 ? 21.062  13.689  10.445  1.00 69.11  ? 349 ARG A NH1 1 
ATOM   2780 N  NH2 . ARG A 1 398 ? 22.144  12.555  12.151  1.00 68.04  ? 349 ARG A NH2 1 
ATOM   2781 N  N   . LYS A 1 399 ? 25.514  7.203   6.858   1.00 50.34  ? 350 LYS A N   1 
ATOM   2782 C  CA  . LYS A 1 399 ? 25.841  5.779   7.054   1.00 51.84  ? 350 LYS A CA  1 
ATOM   2783 C  C   . LYS A 1 399 ? 24.723  5.013   7.790   1.00 51.08  ? 350 LYS A C   1 
ATOM   2784 O  O   . LYS A 1 399 ? 24.965  4.263   8.733   1.00 55.08  ? 350 LYS A O   1 
ATOM   2785 C  CB  . LYS A 1 399 ? 27.213  5.645   7.733   1.00 53.82  ? 350 LYS A CB  1 
ATOM   2786 C  CG  . LYS A 1 399 ? 27.998  4.411   7.339   1.00 60.09  ? 350 LYS A CG  1 
ATOM   2787 C  CD  . LYS A 1 399 ? 29.363  4.354   8.020   1.00 63.92  ? 350 LYS A CD  1 
ATOM   2788 C  CE  . LYS A 1 399 ? 29.784  2.899   8.202   1.00 65.93  ? 350 LYS A CE  1 
ATOM   2789 N  NZ  . LYS A 1 399 ? 31.167  2.703   8.711   1.00 68.71  ? 350 LYS A NZ  1 
ATOM   2790 N  N   . ARG A 1 400 ? 23.485  5.207   7.341   1.00 51.74  ? 351 ARG A N   1 
ATOM   2791 C  CA  . ARG A 1 400 ? 22.337  4.599   8.001   1.00 48.30  ? 351 ARG A CA  1 
ATOM   2792 C  C   . ARG A 1 400 ? 21.208  4.271   7.045   1.00 47.77  ? 351 ARG A C   1 
ATOM   2793 O  O   . ARG A 1 400 ? 21.075  4.866   5.985   1.00 45.87  ? 351 ARG A O   1 
ATOM   2794 C  CB  . ARG A 1 400 ? 21.814  5.513   9.119   1.00 48.08  ? 351 ARG A CB  1 
ATOM   2795 C  CG  . ARG A 1 400 ? 21.412  6.899   8.643   1.00 47.94  ? 351 ARG A CG  1 
ATOM   2796 C  CD  . ARG A 1 400 ? 21.063  7.806   9.804   1.00 47.89  ? 351 ARG A CD  1 
ATOM   2797 N  NE  . ARG A 1 400 ? 20.338  8.983   9.329   1.00 47.26  ? 351 ARG A NE  1 
ATOM   2798 C  CZ  . ARG A 1 400 ? 19.757  9.877   10.126  1.00 50.24  ? 351 ARG A CZ  1 
ATOM   2799 N  NH1 . ARG A 1 400 ? 19.822  9.752   11.450  1.00 52.37  ? 351 ARG A NH1 1 
ATOM   2800 N  NH2 . ARG A 1 400 ? 19.116  10.906  9.598   1.00 47.76  ? 351 ARG A NH2 1 
ATOM   2801 N  N   . ILE A 1 401 ? 20.383  3.316   7.447   1.00 50.29  ? 352 ILE A N   1 
ATOM   2802 C  CA  . ILE A 1 401 ? 19.124  3.050   6.757   1.00 49.87  ? 352 ILE A CA  1 
ATOM   2803 C  C   . ILE A 1 401 ? 17.918  3.345   7.670   1.00 50.37  ? 352 ILE A C   1 
ATOM   2804 O  O   . ILE A 1 401 ? 17.911  2.981   8.861   1.00 46.34  ? 352 ILE A O   1 
ATOM   2805 C  CB  . ILE A 1 401 ? 19.074  1.617   6.211   1.00 47.82  ? 352 ILE A CB  1 
ATOM   2806 C  CG1 . ILE A 1 401 ? 20.238  1.401   5.236   1.00 48.24  ? 352 ILE A CG1 1 
ATOM   2807 C  CG2 . ILE A 1 401 ? 17.742  1.385   5.528   1.00 45.49  ? 352 ILE A CG2 1 
ATOM   2808 C  CD1 . ILE A 1 401 ? 20.607  -0.046  5.022   1.00 50.21  ? 352 ILE A CD1 1 
ATOM   2809 N  N   . GLY A 1 402 ? 16.917  4.021   7.104   1.00 46.86  ? 353 GLY A N   1 
ATOM   2810 C  CA  . GLY A 1 402 ? 15.724  4.389   7.841   1.00 46.85  ? 353 GLY A CA  1 
ATOM   2811 C  C   . GLY A 1 402 ? 14.499  3.690   7.334   1.00 46.19  ? 353 GLY A C   1 
ATOM   2812 O  O   . GLY A 1 402 ? 14.352  3.513   6.133   1.00 48.23  ? 353 GLY A O   1 
ATOM   2813 N  N   . PHE A 1 403 ? 13.628  3.296   8.265   1.00 45.74  ? 354 PHE A N   1 
ATOM   2814 C  CA  . PHE A 1 403 ? 12.391  2.584   7.959   1.00 45.66  ? 354 PHE A CA  1 
ATOM   2815 C  C   . PHE A 1 403 ? 11.195  3.358   8.488   1.00 49.60  ? 354 PHE A C   1 
ATOM   2816 O  O   . PHE A 1 403 ? 11.220  3.884   9.613   1.00 50.54  ? 354 PHE A O   1 
ATOM   2817 C  CB  . PHE A 1 403 ? 12.366  1.213   8.619   1.00 43.75  ? 354 PHE A CB  1 
ATOM   2818 C  CG  . PHE A 1 403 ? 13.364  0.250   8.068   1.00 47.83  ? 354 PHE A CG  1 
ATOM   2819 C  CD1 . PHE A 1 403 ? 14.667  0.211   8.571   1.00 47.15  ? 354 PHE A CD1 1 
ATOM   2820 C  CD2 . PHE A 1 403 ? 12.996  -0.659  7.073   1.00 47.18  ? 354 PHE A CD2 1 
ATOM   2821 C  CE1 . PHE A 1 403 ? 15.591  -0.692  8.062   1.00 45.01  ? 354 PHE A CE1 1 
ATOM   2822 C  CE2 . PHE A 1 403 ? 13.914  -1.566  6.568   1.00 47.21  ? 354 PHE A CE2 1 
ATOM   2823 C  CZ  . PHE A 1 403 ? 15.212  -1.579  7.063   1.00 47.84  ? 354 PHE A CZ  1 
ATOM   2824 N  N   . ALA A 1 404 ? 10.148  3.415   7.668   1.00 48.86  ? 355 ALA A N   1 
ATOM   2825 C  CA  . ALA A 1 404 ? 8.858   3.921   8.089   1.00 46.91  ? 355 ALA A CA  1 
ATOM   2826 C  C   . ALA A 1 404 ? 7.754   3.059   7.460   1.00 49.88  ? 355 ALA A C   1 
ATOM   2827 O  O   . ALA A 1 404 ? 7.971   2.428   6.416   1.00 47.77  ? 355 ALA A O   1 
ATOM   2828 C  CB  . ALA A 1 404 ? 8.710   5.382   7.693   1.00 41.49  ? 355 ALA A CB  1 
ATOM   2829 N  N   . VAL A 1 405 ? 6.588   3.004   8.111   1.00 48.95  ? 356 VAL A N   1 
ATOM   2830 C  CA  . VAL A 1 405 ? 5.418   2.353   7.529   1.00 48.49  ? 356 VAL A CA  1 
ATOM   2831 C  C   . VAL A 1 405 ? 5.167   2.951   6.143   1.00 46.27  ? 356 VAL A C   1 
ATOM   2832 O  O   . VAL A 1 405 ? 5.130   4.173   5.997   1.00 48.74  ? 356 VAL A O   1 
ATOM   2833 C  CB  . VAL A 1 405 ? 4.174   2.540   8.427   1.00 47.08  ? 356 VAL A CB  1 
ATOM   2834 C  CG1 . VAL A 1 405 ? 2.904   2.088   7.710   1.00 44.87  ? 356 VAL A CG1 1 
ATOM   2835 C  CG2 . VAL A 1 405 ? 4.363   1.807   9.746   1.00 47.50  ? 356 VAL A CG2 1 
ATOM   2836 N  N   . SER A 1 406 ? 5.026   2.109   5.126   1.00 44.20  ? 357 SER A N   1 
ATOM   2837 C  CA  . SER A 1 406 ? 4.763   2.624   3.768   1.00 45.86  ? 357 SER A CA  1 
ATOM   2838 C  C   . SER A 1 406 ? 3.305   3.053   3.585   1.00 45.42  ? 357 SER A C   1 
ATOM   2839 O  O   . SER A 1 406 ? 2.393   2.389   4.094   1.00 44.48  ? 357 SER A O   1 
ATOM   2840 C  CB  . SER A 1 406 ? 5.137   1.603   2.710   1.00 44.02  ? 357 SER A CB  1 
ATOM   2841 O  OG  . SER A 1 406 ? 4.787   2.073   1.431   1.00 45.22  ? 357 SER A OG  1 
ATOM   2842 N  N   . ALA A 1 407 ? 3.099   4.162   2.869   1.00 43.58  ? 358 ALA A N   1 
ATOM   2843 C  CA  . ALA A 1 407 ? 1.760   4.662   2.562   1.00 45.65  ? 358 ALA A CA  1 
ATOM   2844 C  C   . ALA A 1 407 ? 1.030   3.752   1.568   1.00 46.18  ? 358 ALA A C   1 
ATOM   2845 O  O   . ALA A 1 407 ? -0.184  3.843   1.395   1.00 46.07  ? 358 ALA A O   1 
ATOM   2846 C  CB  . ALA A 1 407 ? 1.819   6.095   2.037   1.00 45.71  ? 358 ALA A CB  1 
ATOM   2847 N  N   . CYS A 1 408 ? 1.769   2.853   0.934   1.00 47.04  ? 359 CYS A N   1 
ATOM   2848 C  CA  . CYS A 1 408 ? 1.169   1.933   -0.018  1.00 48.17  ? 359 CYS A CA  1 
ATOM   2849 C  C   . CYS A 1 408 ? 1.255   0.469   0.434   1.00 46.76  ? 359 CYS A C   1 
ATOM   2850 O  O   . CYS A 1 408 ? 1.057   -0.436  -0.367  1.00 49.70  ? 359 CYS A O   1 
ATOM   2851 C  CB  . CYS A 1 408 ? 1.767   2.130   -1.430  1.00 48.10  ? 359 CYS A CB  1 
ATOM   2852 S  SG  . CYS A 1 408 ? 3.491   1.594   -1.602  1.00 58.28  ? 359 CYS A SG  1 
ATOM   2853 N  N   . HIS A 1 409 ? 1.509   0.222   1.714   1.00 46.10  ? 360 HIS A N   1 
ATOM   2854 C  CA  . HIS A 1 409 ? 1.573   -1.174  2.181   1.00 46.82  ? 360 HIS A CA  1 
ATOM   2855 C  C   . HIS A 1 409 ? 0.184   -1.846  2.272   1.00 47.60  ? 360 HIS A C   1 
ATOM   2856 O  O   . HIS A 1 409 ? -0.813  -1.182  2.601   1.00 42.67  ? 360 HIS A O   1 
ATOM   2857 C  CB  . HIS A 1 409 ? 2.391   -1.312  3.483   1.00 44.32  ? 360 HIS A CB  1 
ATOM   2858 C  CG  . HIS A 1 409 ? 1.584   -1.229  4.734   1.00 44.01  ? 360 HIS A CG  1 
ATOM   2859 N  ND1 . HIS A 1 409 ? 1.266   -0.032  5.337   1.00 47.54  ? 360 HIS A ND1 1 
ATOM   2860 C  CD2 . HIS A 1 409 ? 1.047   -2.196  5.515   1.00 45.24  ? 360 HIS A CD2 1 
ATOM   2861 C  CE1 . HIS A 1 409 ? 0.564   -0.261  6.434   1.00 45.97  ? 360 HIS A CE1 1 
ATOM   2862 N  NE2 . HIS A 1 409 ? 0.417   -1.567  6.565   1.00 48.56  ? 360 HIS A NE2 1 
ATOM   2863 N  N   . VAL A 1 410 ? 0.136   -3.152  1.957   1.00 45.46  ? 361 VAL A N   1 
ATOM   2864 C  CA  . VAL A 1 410 ? -1.108  -3.912  1.985   1.00 41.79  ? 361 VAL A CA  1 
ATOM   2865 C  C   . VAL A 1 410 ? -1.449  -4.349  3.418   1.00 45.46  ? 361 VAL A C   1 
ATOM   2866 O  O   . VAL A 1 410 ? -0.594  -4.852  4.146   1.00 47.05  ? 361 VAL A O   1 
ATOM   2867 C  CB  . VAL A 1 410 ? -1.090  -5.105  1.003   1.00 40.16  ? 361 VAL A CB  1 
ATOM   2868 C  CG1 . VAL A 1 410 ? -2.465  -5.757  0.918   1.00 37.15  ? 361 VAL A CG1 1 
ATOM   2869 C  CG2 . VAL A 1 410 ? -0.659  -4.652  -0.385  1.00 36.39  ? 361 VAL A CG2 1 
ATOM   2870 N  N   . HIS A 1 411 ? -2.695  -4.126  3.827   1.00 44.65  ? 362 HIS A N   1 
ATOM   2871 C  CA  . HIS A 1 411 ? -3.115  -4.494  5.171   1.00 46.21  ? 362 HIS A CA  1 
ATOM   2872 C  C   . HIS A 1 411 ? -4.596  -4.847  5.199   1.00 46.91  ? 362 HIS A C   1 
ATOM   2873 O  O   . HIS A 1 411 ? -5.217  -4.961  4.143   1.00 43.82  ? 362 HIS A O   1 
ATOM   2874 C  CB  . HIS A 1 411 ? -2.782  -3.378  6.166   1.00 50.11  ? 362 HIS A CB  1 
ATOM   2875 C  CG  . HIS A 1 411 ? -3.429  -2.060  5.861   1.00 50.44  ? 362 HIS A CG  1 
ATOM   2876 N  ND1 . HIS A 1 411 ? -4.526  -1.594  6.559   1.00 49.46  ? 362 HIS A ND1 1 
ATOM   2877 C  CD2 . HIS A 1 411 ? -3.113  -1.094  4.963   1.00 48.47  ? 362 HIS A CD2 1 
ATOM   2878 C  CE1 . HIS A 1 411 ? -4.868  -0.405  6.092   1.00 49.20  ? 362 HIS A CE1 1 
ATOM   2879 N  NE2 . HIS A 1 411 ? -4.026  -0.078  5.124   1.00 50.85  ? 362 HIS A NE2 1 
ATOM   2880 N  N   . ASP A 1 412 ? -5.153  -5.074  6.388   1.00 48.13  ? 363 ASP A N   1 
ATOM   2881 C  CA  . ASP A 1 412 ? -6.601  -5.307  6.506   1.00 48.88  ? 363 ASP A CA  1 
ATOM   2882 C  C   . ASP A 1 412 ? -7.186  -4.332  7.513   1.00 48.04  ? 363 ASP A C   1 
ATOM   2883 O  O   . ASP A 1 412 ? -6.490  -3.416  7.953   1.00 50.27  ? 363 ASP A O   1 
ATOM   2884 C  CB  . ASP A 1 412 ? -6.932  -6.771  6.839   1.00 47.84  ? 363 ASP A CB  1 
ATOM   2885 C  CG  . ASP A 1 412 ? -6.222  -7.278  8.086   1.00 53.72  ? 363 ASP A CG  1 
ATOM   2886 O  OD1 . ASP A 1 412 ? -6.288  -6.623  9.157   1.00 51.92  ? 363 ASP A OD1 1 
ATOM   2887 O  OD2 . ASP A 1 412 ? -5.618  -8.369  7.997   1.00 53.13  ? 363 ASP A OD2 1 
ATOM   2888 N  N   . GLU A 1 413 ? -8.445  -4.496  7.893   1.00 47.66  ? 364 GLU A N   1 
ATOM   2889 C  CA  . GLU A 1 413 ? -8.992  -3.517  8.826   1.00 49.40  ? 364 GLU A CA  1 
ATOM   2890 C  C   . GLU A 1 413 ? -8.546  -3.745  10.282  1.00 47.87  ? 364 GLU A C   1 
ATOM   2891 O  O   . GLU A 1 413 ? -8.736  -2.883  11.137  1.00 44.64  ? 364 GLU A O   1 
ATOM   2892 C  CB  . GLU A 1 413 ? -10.510 -3.356  8.673   1.00 53.83  ? 364 GLU A CB  1 
ATOM   2893 C  CG  . GLU A 1 413 ? -11.385 -4.482  9.209   1.00 63.59  ? 364 GLU A CG  1 
ATOM   2894 C  CD  . GLU A 1 413 ? -12.811 -3.999  9.507   1.00 74.75  ? 364 GLU A CD  1 
ATOM   2895 O  OE1 . GLU A 1 413 ? -13.762 -4.820  9.391   1.00 77.58  ? 364 GLU A OE1 1 
ATOM   2896 O  OE2 . GLU A 1 413 ? -12.982 -2.787  9.841   1.00 71.13  ? 364 GLU A OE2 1 
ATOM   2897 N  N   . PHE A 1 414 ? -7.920  -4.896  10.539  1.00 44.87  ? 365 PHE A N   1 
ATOM   2898 C  CA  . PHE A 1 414 ? -7.556  -5.284  11.885  1.00 43.23  ? 365 PHE A CA  1 
ATOM   2899 C  C   . PHE A 1 414 ? -6.082  -5.083  12.282  1.00 43.76  ? 365 PHE A C   1 
ATOM   2900 O  O   . PHE A 1 414 ? -5.795  -4.886  13.475  1.00 41.65  ? 365 PHE A O   1 
ATOM   2901 C  CB  . PHE A 1 414 ? -8.016  -6.725  12.138  1.00 46.83  ? 365 PHE A CB  1 
ATOM   2902 C  CG  . PHE A 1 414 ? -9.485  -6.927  11.907  1.00 48.83  ? 365 PHE A CG  1 
ATOM   2903 C  CD1 . PHE A 1 414 ? -10.422 -6.357  12.770  1.00 49.95  ? 365 PHE A CD1 1 
ATOM   2904 C  CD2 . PHE A 1 414 ? -9.938  -7.666  10.818  1.00 49.33  ? 365 PHE A CD2 1 
ATOM   2905 C  CE1 . PHE A 1 414 ? -11.787 -6.528  12.551  1.00 53.72  ? 365 PHE A CE1 1 
ATOM   2906 C  CE2 . PHE A 1 414 ? -11.293 -7.852  10.601  1.00 50.39  ? 365 PHE A CE2 1 
ATOM   2907 C  CZ  . PHE A 1 414 ? -12.222 -7.288  11.474  1.00 52.43  ? 365 PHE A CZ  1 
ATOM   2908 N  N   . ARG A 1 415 ? -5.164  -5.128  11.305  1.00 43.26  ? 366 ARG A N   1 
ATOM   2909 C  CA  . ARG A 1 415 ? -3.723  -4.937  11.542  1.00 43.50  ? 366 ARG A CA  1 
ATOM   2910 C  C   . ARG A 1 415 ? -3.054  -4.110  10.440  1.00 43.72  ? 366 ARG A C   1 
ATOM   2911 O  O   . ARG A 1 415 ? -3.530  -4.081  9.298   1.00 43.58  ? 366 ARG A O   1 
ATOM   2912 C  CB  . ARG A 1 415 ? -2.999  -6.287  11.605  1.00 44.55  ? 366 ARG A CB  1 
ATOM   2913 C  CG  . ARG A 1 415 ? -3.533  -7.263  12.640  1.00 45.81  ? 366 ARG A CG  1 
ATOM   2914 C  CD  . ARG A 1 415 ? -2.661  -8.511  12.787  1.00 44.95  ? 366 ARG A CD  1 
ATOM   2915 N  NE  . ARG A 1 415 ? -2.668  -9.353  11.598  1.00 40.90  ? 366 ARG A NE  1 
ATOM   2916 C  CZ  . ARG A 1 415 ? -2.475  -10.673 11.610  1.00 43.01  ? 366 ARG A CZ  1 
ATOM   2917 N  NH1 . ARG A 1 415 ? -2.262  -11.308 12.762  1.00 37.89  ? 366 ARG A NH1 1 
ATOM   2918 N  NH2 . ARG A 1 415 ? -2.493  -11.358 10.456  1.00 38.23  ? 366 ARG A NH2 1 
ATOM   2919 N  N   . THR A 1 416 ? -1.941  -3.450  10.774  1.00 39.87  ? 367 THR A N   1 
ATOM   2920 C  CA  . THR A 1 416 ? -1.117  -2.794  9.761   1.00 43.47  ? 367 THR A CA  1 
ATOM   2921 C  C   . THR A 1 416 ? 0.323   -3.099  10.085  1.00 44.33  ? 367 THR A C   1 
ATOM   2922 O  O   . THR A 1 416 ? 0.635   -3.502  11.203  1.00 42.20  ? 367 THR A O   1 
ATOM   2923 C  CB  . THR A 1 416 ? -1.284  -1.248  9.720   1.00 43.04  ? 367 THR A CB  1 
ATOM   2924 O  OG1 . THR A 1 416 ? -0.922  -0.695  10.990  1.00 46.96  ? 367 THR A OG1 1 
ATOM   2925 C  CG2 . THR A 1 416 ? -2.705  -0.854  9.423   1.00 41.48  ? 367 THR A CG2 1 
ATOM   2926 N  N   . ALA A 1 417 ? 1.207   -2.885  9.113   1.00 45.91  ? 368 ALA A N   1 
ATOM   2927 C  CA  . ALA A 1 417 ? 2.636   -2.905  9.366   1.00 44.30  ? 368 ALA A CA  1 
ATOM   2928 C  C   . ALA A 1 417 ? 2.985   -1.810  10.390  1.00 45.01  ? 368 ALA A C   1 
ATOM   2929 O  O   . ALA A 1 417 ? 2.201   -0.874  10.606  1.00 47.35  ? 368 ALA A O   1 
ATOM   2930 C  CB  . ALA A 1 417 ? 3.399   -2.710  8.060   1.00 44.19  ? 368 ALA A CB  1 
ATOM   2931 N  N   . ALA A 1 418 ? 4.142   -1.927  11.034  1.00 42.12  ? 369 ALA A N   1 
ATOM   2932 C  CA  . ALA A 1 418 ? 4.521   -0.966  12.077  1.00 42.57  ? 369 ALA A CA  1 
ATOM   2933 C  C   . ALA A 1 418 ? 6.034   -0.758  12.177  1.00 42.20  ? 369 ALA A C   1 
ATOM   2934 O  O   . ALA A 1 418 ? 6.811   -1.690  11.958  1.00 40.04  ? 369 ALA A O   1 
ATOM   2935 C  CB  . ALA A 1 418 ? 3.941   -1.375  13.439  1.00 37.41  ? 369 ALA A CB  1 
ATOM   2936 N  N   . VAL A 1 419 ? 6.437   0.473   12.490  1.00 42.09  ? 370 VAL A N   1 
ATOM   2937 C  CA  . VAL A 1 419 ? 7.804   0.755   12.895  1.00 41.90  ? 370 VAL A CA  1 
ATOM   2938 C  C   . VAL A 1 419 ? 7.756   1.460   14.241  1.00 45.39  ? 370 VAL A C   1 
ATOM   2939 O  O   . VAL A 1 419 ? 7.258   2.587   14.355  1.00 44.84  ? 370 VAL A O   1 
ATOM   2940 C  CB  . VAL A 1 419 ? 8.552   1.632   11.881  1.00 41.88  ? 370 VAL A CB  1 
ATOM   2941 C  CG1 . VAL A 1 419 ? 9.990   1.810   12.317  1.00 41.63  ? 370 VAL A CG1 1 
ATOM   2942 C  CG2 . VAL A 1 419 ? 8.517   1.030   10.490  1.00 40.85  ? 370 VAL A CG2 1 
ATOM   2943 N  N   . GLU A 1 420 ? 8.274   0.787   15.262  1.00 49.05  ? 371 GLU A N   1 
ATOM   2944 C  CA  . GLU A 1 420 ? 8.146   1.251   16.636  1.00 50.70  ? 371 GLU A CA  1 
ATOM   2945 C  C   . GLU A 1 420 ? 9.451   1.122   17.403  1.00 49.16  ? 371 GLU A C   1 
ATOM   2946 O  O   . GLU A 1 420 ? 10.262  0.245   17.113  1.00 48.21  ? 371 GLU A O   1 
ATOM   2947 C  CB  . GLU A 1 420 ? 7.073   0.445   17.379  1.00 50.90  ? 371 GLU A CB  1 
ATOM   2948 C  CG  . GLU A 1 420 ? 5.721   0.358   16.699  1.00 54.05  ? 371 GLU A CG  1 
ATOM   2949 C  CD  . GLU A 1 420 ? 4.934   -0.876  17.108  1.00 55.03  ? 371 GLU A CD  1 
ATOM   2950 O  OE1 . GLU A 1 420 ? 3.845   -0.704  17.661  1.00 58.70  ? 371 GLU A OE1 1 
ATOM   2951 O  OE2 . GLU A 1 420 ? 5.390   -2.018  16.880  1.00 61.13  ? 371 GLU A OE2 1 
ATOM   2952 N  N   . GLY A 1 421 ? 9.602   1.983   18.410  1.00 51.36  ? 372 GLY A N   1 
ATOM   2953 C  CA  . GLY A 1 421 ? 10.712  1.961   19.367  1.00 49.26  ? 372 GLY A CA  1 
ATOM   2954 C  C   . GLY A 1 421 ? 10.538  3.111   20.353  1.00 48.40  ? 372 GLY A C   1 
ATOM   2955 O  O   . GLY A 1 421 ? 9.545   3.849   20.271  1.00 43.48  ? 372 GLY A O   1 
ATOM   2956 N  N   . PRO A 1 422 ? 11.497  3.284   21.290  1.00 48.41  ? 373 PRO A N   1 
ATOM   2957 C  CA  . PRO A 1 422 ? 12.721  2.499   21.466  1.00 49.80  ? 373 PRO A CA  1 
ATOM   2958 C  C   . PRO A 1 422 ? 12.566  1.277   22.386  1.00 48.15  ? 373 PRO A C   1 
ATOM   2959 O  O   . PRO A 1 422 ? 11.636  1.217   23.201  1.00 47.84  ? 373 PRO A O   1 
ATOM   2960 C  CB  . PRO A 1 422 ? 13.645  3.514   22.132  1.00 49.14  ? 373 PRO A CB  1 
ATOM   2961 C  CG  . PRO A 1 422 ? 12.720  4.257   23.046  1.00 47.32  ? 373 PRO A CG  1 
ATOM   2962 C  CD  . PRO A 1 422 ? 11.472  4.434   22.217  1.00 48.78  ? 373 PRO A CD  1 
ATOM   2963 N  N   . PHE A 1 423 ? 13.485  0.326   22.262  1.00 47.30  ? 374 PHE A N   1 
ATOM   2964 C  CA  . PHE A 1 423 ? 13.599  -0.776  23.223  1.00 50.52  ? 374 PHE A CA  1 
ATOM   2965 C  C   . PHE A 1 423 ? 14.994  -0.820  23.813  1.00 50.48  ? 374 PHE A C   1 
ATOM   2966 O  O   . PHE A 1 423 ? 15.970  -0.635  23.102  1.00 52.40  ? 374 PHE A O   1 
ATOM   2967 C  CB  . PHE A 1 423 ? 13.249  -2.116  22.560  1.00 49.15  ? 374 PHE A CB  1 
ATOM   2968 C  CG  . PHE A 1 423 ? 11.898  -2.113  21.939  1.00 47.05  ? 374 PHE A CG  1 
ATOM   2969 C  CD1 . PHE A 1 423 ? 10.761  -2.228  22.735  1.00 45.92  ? 374 PHE A CD1 1 
ATOM   2970 C  CD2 . PHE A 1 423 ? 11.756  -1.924  20.566  1.00 44.06  ? 374 PHE A CD2 1 
ATOM   2971 C  CE1 . PHE A 1 423 ? 9.495   -2.176  22.159  1.00 44.66  ? 374 PHE A CE1 1 
ATOM   2972 C  CE2 . PHE A 1 423 ? 10.508  -1.876  19.987  1.00 41.71  ? 374 PHE A CE2 1 
ATOM   2973 C  CZ  . PHE A 1 423 ? 9.368   -1.997  20.784  1.00 44.27  ? 374 PHE A CZ  1 
ATOM   2974 N  N   . VAL A 1 424 ? 15.087  -1.058  25.113  1.00 52.72  ? 375 VAL A N   1 
ATOM   2975 C  CA  . VAL A 1 424 ? 16.390  -1.208  25.763  1.00 57.30  ? 375 VAL A CA  1 
ATOM   2976 C  C   . VAL A 1 424 ? 17.000  -2.596  25.462  1.00 64.47  ? 375 VAL A C   1 
ATOM   2977 O  O   . VAL A 1 424 ? 16.533  -3.631  25.983  1.00 61.00  ? 375 VAL A O   1 
ATOM   2978 C  CB  . VAL A 1 424 ? 16.290  -0.976  27.287  1.00 57.64  ? 375 VAL A CB  1 
ATOM   2979 C  CG1 . VAL A 1 424 ? 17.566  -1.458  27.983  1.00 57.20  ? 375 VAL A CG1 1 
ATOM   2980 C  CG2 . VAL A 1 424 ? 16.001  0.500   27.593  1.00 52.79  ? 375 VAL A CG2 1 
ATOM   2981 N  N   . THR A 1 425 ? 18.035  -2.611  24.617  1.00 65.32  ? 376 THR A N   1 
ATOM   2982 C  CA  . THR A 1 425 ? 18.726  -3.855  24.262  1.00 67.75  ? 376 THR A CA  1 
ATOM   2983 C  C   . THR A 1 425 ? 20.236  -3.726  24.485  1.00 70.26  ? 376 THR A C   1 
ATOM   2984 O  O   . THR A 1 425 ? 20.844  -2.715  24.113  1.00 66.05  ? 376 THR A O   1 
ATOM   2985 C  CB  . THR A 1 425 ? 18.444  -4.277  22.804  1.00 64.07  ? 376 THR A CB  1 
ATOM   2986 O  OG1 . THR A 1 425 ? 17.092  -3.960  22.467  1.00 58.62  ? 376 THR A OG1 1 
ATOM   2987 C  CG2 . THR A 1 425 ? 18.659  -5.779  22.627  1.00 64.21  ? 376 THR A CG2 1 
ATOM   2988 N  N   . LEU A 1 426 ? 20.825  -4.758  25.094  1.00 72.35  ? 377 LEU A N   1 
ATOM   2989 C  CA  . LEU A 1 426 ? 22.260  -4.778  25.418  1.00 74.10  ? 377 LEU A CA  1 
ATOM   2990 C  C   . LEU A 1 426 ? 23.080  -5.673  24.472  1.00 75.67  ? 377 LEU A C   1 
ATOM   2991 O  O   . LEU A 1 426 ? 22.525  -6.508  23.742  1.00 70.86  ? 377 LEU A O   1 
ATOM   2992 C  CB  . LEU A 1 426 ? 22.475  -5.237  26.869  1.00 71.86  ? 377 LEU A CB  1 
ATOM   2993 C  CG  . LEU A 1 426 ? 21.630  -4.632  27.994  1.00 72.44  ? 377 LEU A CG  1 
ATOM   2994 C  CD1 . LEU A 1 426 ? 21.757  -5.479  29.255  1.00 68.05  ? 377 LEU A CD1 1 
ATOM   2995 C  CD2 . LEU A 1 426 ? 22.005  -3.170  28.235  1.00 68.26  ? 377 LEU A CD2 1 
ATOM   2996 N  N   . ASP A 1 427 ? 24.404  -5.479  24.496  1.00 79.78  ? 378 ASP A N   1 
ATOM   2997 C  CA  . ASP A 1 427 ? 25.371  -6.327  23.776  1.00 78.79  ? 378 ASP A CA  1 
ATOM   2998 C  C   . ASP A 1 427 ? 24.980  -6.554  22.308  1.00 76.59  ? 378 ASP A C   1 
ATOM   2999 O  O   . ASP A 1 427 ? 25.012  -7.687  21.806  1.00 73.29  ? 378 ASP A O   1 
ATOM   3000 C  CB  . ASP A 1 427 ? 25.556  -7.671  24.508  1.00 82.55  ? 378 ASP A CB  1 
ATOM   3001 C  CG  . ASP A 1 427 ? 25.863  -7.500  25.996  1.00 87.02  ? 378 ASP A CG  1 
ATOM   3002 O  OD1 . ASP A 1 427 ? 26.583  -6.540  26.370  1.00 87.47  ? 378 ASP A OD1 1 
ATOM   3003 O  OD2 . ASP A 1 427 ? 25.381  -8.333  26.793  1.00 86.21  ? 378 ASP A OD2 1 
ATOM   3004 N  N   . MET A 1 428 ? 24.601  -5.472  21.631  1.00 68.76  ? 379 MET A N   1 
ATOM   3005 C  CA  . MET A 1 428 ? 24.091  -5.568  20.265  1.00 71.12  ? 379 MET A CA  1 
ATOM   3006 C  C   . MET A 1 428 ? 25.199  -5.771  19.216  1.00 78.71  ? 379 MET A C   1 
ATOM   3007 O  O   . MET A 1 428 ? 24.953  -6.361  18.154  1.00 77.92  ? 379 MET A O   1 
ATOM   3008 C  CB  . MET A 1 428 ? 23.229  -4.355  19.922  1.00 66.99  ? 379 MET A CB  1 
ATOM   3009 C  CG  . MET A 1 428 ? 21.934  -4.267  20.709  1.00 64.39  ? 379 MET A CG  1 
ATOM   3010 S  SD  . MET A 1 428 ? 20.835  -2.992  20.076  1.00 63.12  ? 379 MET A SD  1 
ATOM   3011 C  CE  . MET A 1 428 ? 21.796  -1.475  20.165  1.00 58.53  ? 379 MET A CE  1 
ATOM   3012 N  N   . GLU A 1 429 ? 26.404  -5.276  19.521  1.00 81.13  ? 380 GLU A N   1 
ATOM   3013 C  CA  . GLU A 1 429 ? 27.603  -5.534  18.715  1.00 81.04  ? 380 GLU A CA  1 
ATOM   3014 C  C   . GLU A 1 429 ? 27.840  -7.038  18.621  1.00 75.13  ? 380 GLU A C   1 
ATOM   3015 O  O   . GLU A 1 429 ? 28.248  -7.532  17.573  1.00 75.30  ? 380 GLU A O   1 
ATOM   3016 C  CB  . GLU A 1 429 ? 28.841  -4.863  19.330  1.00 88.29  ? 380 GLU A CB  1 
ATOM   3017 C  CG  . GLU A 1 429 ? 28.667  -3.401  19.729  1.00 93.14  ? 380 GLU A CG  1 
ATOM   3018 C  CD  . GLU A 1 429 ? 28.866  -2.439  18.572  1.00 95.37  ? 380 GLU A CD  1 
ATOM   3019 O  OE1 . GLU A 1 429 ? 29.793  -1.591  18.653  1.00 96.77  ? 380 GLU A OE1 1 
ATOM   3020 O  OE2 . GLU A 1 429 ? 28.103  -2.533  17.579  1.00 94.40  ? 380 GLU A OE2 1 
ATOM   3021 N  N   . ASP A 1 430 ? 27.574  -7.748  19.722  1.00 71.00  ? 381 ASP A N   1 
ATOM   3022 C  CA  . ASP A 1 430 ? 27.676  -9.212  19.789  1.00 70.45  ? 381 ASP A CA  1 
ATOM   3023 C  C   . ASP A 1 430 ? 26.817  -9.956  18.777  1.00 65.31  ? 381 ASP A C   1 
ATOM   3024 O  O   . ASP A 1 430 ? 27.045  -11.137 18.545  1.00 66.51  ? 381 ASP A O   1 
ATOM   3025 C  CB  . ASP A 1 430 ? 27.313  -9.726  21.187  1.00 73.75  ? 381 ASP A CB  1 
ATOM   3026 C  CG  . ASP A 1 430 ? 28.413  -9.481  22.215  1.00 85.24  ? 381 ASP A CG  1 
ATOM   3027 O  OD1 . ASP A 1 430 ? 29.421  -8.808  21.879  1.00 85.04  ? 381 ASP A OD1 1 
ATOM   3028 O  OD2 . ASP A 1 430 ? 28.258  -9.969  23.369  1.00 83.29  ? 381 ASP A OD2 1 
ATOM   3029 N  N   . CYS A 1 431 ? 25.821  -9.279  18.202  1.00 62.76  ? 382 CYS A N   1 
ATOM   3030 C  CA  . CYS A 1 431 ? 24.898  -9.910  17.246  1.00 61.52  ? 382 CYS A CA  1 
ATOM   3031 C  C   . CYS A 1 431 ? 25.496  -10.016 15.848  1.00 60.36  ? 382 CYS A C   1 
ATOM   3032 O  O   . CYS A 1 431 ? 25.124  -10.899 15.077  1.00 60.44  ? 382 CYS A O   1 
ATOM   3033 C  CB  . CYS A 1 431 ? 23.568  -9.166  17.196  1.00 60.70  ? 382 CYS A CB  1 
ATOM   3034 S  SG  . CYS A 1 431 ? 22.704  -9.079  18.782  1.00 64.04  ? 382 CYS A SG  1 
ATOM   3035 N  N   . GLY A 1 432 ? 26.423  -9.109  15.539  1.00 60.76  ? 383 GLY A N   1 
ATOM   3036 C  CA  . GLY A 1 432 ? 27.160  -9.123  14.281  1.00 60.62  ? 383 GLY A CA  1 
ATOM   3037 C  C   . GLY A 1 432 ? 28.103  -10.305 14.192  1.00 64.54  ? 383 GLY A C   1 
ATOM   3038 O  O   . GLY A 1 432 ? 28.579  -10.821 15.207  1.00 68.40  ? 383 GLY A O   1 
ATOM   3039 N  N   . TYR A 1 433 ? 28.357  -10.743 12.965  1.00 69.92  ? 384 TYR A N   1 
ATOM   3040 C  CA  . TYR A 1 433 ? 29.282  -11.840 12.696  1.00 72.00  ? 384 TYR A CA  1 
ATOM   3041 C  C   . TYR A 1 433 ? 30.631  -11.283 12.216  1.00 70.88  ? 384 TYR A C   1 
ATOM   3042 O  O   . TYR A 1 433 ? 30.686  -10.197 11.648  1.00 62.89  ? 384 TYR A O   1 
ATOM   3043 C  CB  . TYR A 1 433 ? 28.663  -12.771 11.652  1.00 71.48  ? 384 TYR A CB  1 
ATOM   3044 C  CG  . TYR A 1 433 ? 29.507  -13.948 11.228  1.00 72.32  ? 384 TYR A CG  1 
ATOM   3045 C  CD1 . TYR A 1 433 ? 29.495  -15.145 11.961  1.00 73.14  ? 384 TYR A CD1 1 
ATOM   3046 C  CD2 . TYR A 1 433 ? 30.297  -13.880 10.072  1.00 70.91  ? 384 TYR A CD2 1 
ATOM   3047 C  CE1 . TYR A 1 433 ? 30.262  -16.235 11.561  1.00 75.23  ? 384 TYR A CE1 1 
ATOM   3048 C  CE2 . TYR A 1 433 ? 31.065  -14.961 9.658   1.00 74.62  ? 384 TYR A CE2 1 
ATOM   3049 C  CZ  . TYR A 1 433 ? 31.048  -16.139 10.404  1.00 78.21  ? 384 TYR A CZ  1 
ATOM   3050 O  OH  . TYR A 1 433 ? 31.810  -17.221 9.993   1.00 78.93  ? 384 TYR A OH  1 
ATOM   3051 N  N   . ASN A 1 434 ? 31.709  -12.028 12.476  1.00 74.13  ? 385 ASN A N   1 
ATOM   3052 C  CA  . ASN A 1 434 ? 33.061  -11.658 12.047  1.00 69.84  ? 385 ASN A CA  1 
ATOM   3053 C  C   . ASN A 1 434 ? 33.696  -12.772 11.236  1.00 67.19  ? 385 ASN A C   1 
ATOM   3054 O  O   . ASN A 1 434 ? 33.477  -13.944 11.543  1.00 65.34  ? 385 ASN A O   1 
ATOM   3055 C  CB  . ASN A 1 434 ? 33.929  -11.360 13.264  1.00 69.86  ? 385 ASN A CB  1 
ATOM   3056 C  CG  . ASN A 1 434 ? 33.397  -10.205 14.087  1.00 71.55  ? 385 ASN A CG  1 
ATOM   3057 O  OD1 . ASN A 1 434 ? 33.259  -9.085  13.590  1.00 75.08  ? 385 ASN A OD1 1 
ATOM   3058 N  ND2 . ASN A 1 434 ? 33.099  -10.468 15.356  1.00 68.74  ? 385 ASN A ND2 1 
ATOM   3059 N  N   . GLY B 1 46  ? -31.903 -17.625 -32.111 1.00 99.49  ? -3  GLY B N   1 
ATOM   3060 C  CA  . GLY B 1 46  ? -32.959 -18.247 -31.253 1.00 98.23  ? -3  GLY B CA  1 
ATOM   3061 C  C   . GLY B 1 46  ? -33.649 -17.268 -30.309 1.00 92.83  ? -3  GLY B C   1 
ATOM   3062 O  O   . GLY B 1 46  ? -34.197 -16.237 -30.748 1.00 92.21  ? -3  GLY B O   1 
ATOM   3063 N  N   . SER B 1 47  ? -33.599 -17.583 -28.999 1.00 85.62  ? -2  SER B N   1 
ATOM   3064 C  CA  . SER B 1 47  ? -34.350 -16.834 -27.984 1.00 83.86  ? -2  SER B CA  1 
ATOM   3065 C  C   . SER B 1 47  ? -33.600 -16.735 -26.636 1.00 90.78  ? -2  SER B C   1 
ATOM   3066 O  O   . SER B 1 47  ? -33.057 -17.744 -26.142 1.00 96.31  ? -2  SER B O   1 
ATOM   3067 C  CB  . SER B 1 47  ? -35.728 -17.501 -27.803 1.00 80.66  ? -2  SER B CB  1 
ATOM   3068 O  OG  . SER B 1 47  ? -36.262 -17.223 -26.507 1.00 85.47  ? -2  SER B OG  1 
ATOM   3069 N  N   . PHE B 1 48  ? -33.582 -15.526 -26.049 1.00 83.50  ? -1  PHE B N   1 
ATOM   3070 C  CA  . PHE B 1 48  ? -32.854 -15.236 -24.789 1.00 74.38  ? -1  PHE B CA  1 
ATOM   3071 C  C   . PHE B 1 48  ? -33.791 -14.678 -23.710 1.00 74.08  ? -1  PHE B C   1 
ATOM   3072 O  O   . PHE B 1 48  ? -33.634 -13.537 -23.271 1.00 77.21  ? -1  PHE B O   1 
ATOM   3073 C  CB  . PHE B 1 48  ? -31.674 -14.263 -25.037 1.00 65.19  ? -1  PHE B CB  1 
ATOM   3074 C  CG  . PHE B 1 48  ? -30.605 -14.802 -25.967 1.00 61.07  ? -1  PHE B CG  1 
ATOM   3075 C  CD1 . PHE B 1 48  ? -30.737 -14.675 -27.360 1.00 57.09  ? -1  PHE B CD1 1 
ATOM   3076 C  CD2 . PHE B 1 48  ? -29.458 -15.434 -25.456 1.00 59.75  ? -1  PHE B CD2 1 
ATOM   3077 C  CE1 . PHE B 1 48  ? -29.757 -15.185 -28.220 1.00 59.94  ? -1  PHE B CE1 1 
ATOM   3078 C  CE2 . PHE B 1 48  ? -28.480 -15.943 -26.312 1.00 59.48  ? -1  PHE B CE2 1 
ATOM   3079 C  CZ  . PHE B 1 48  ? -28.626 -15.820 -27.699 1.00 58.16  ? -1  PHE B CZ  1 
ATOM   3080 N  N   . VAL B 1 49  ? -34.746 -15.497 -23.274 1.00 75.28  ? 0   VAL B N   1 
ATOM   3081 C  CA  . VAL B 1 49  ? -35.848 -15.056 -22.395 1.00 78.55  ? 0   VAL B CA  1 
ATOM   3082 C  C   . VAL B 1 49  ? -35.446 -14.528 -21.008 1.00 73.76  ? 0   VAL B C   1 
ATOM   3083 O  O   . VAL B 1 49  ? -36.250 -13.874 -20.329 1.00 78.56  ? 0   VAL B O   1 
ATOM   3084 C  CB  . VAL B 1 49  ? -36.929 -16.162 -22.250 1.00 86.27  ? 0   VAL B CB  1 
ATOM   3085 C  CG1 . VAL B 1 49  ? -36.397 -17.338 -21.436 1.00 91.81  ? 0   VAL B CG1 1 
ATOM   3086 C  CG2 . VAL B 1 49  ? -38.212 -15.603 -21.636 1.00 84.11  ? 0   VAL B CG2 1 
ATOM   3087 N  N   . GLU B 1 50  ? -34.218 -14.811 -20.584 1.00 74.82  ? 1   GLU B N   1 
ATOM   3088 C  CA  . GLU B 1 50  ? -33.731 -14.334 -19.283 1.00 72.95  ? 1   GLU B CA  1 
ATOM   3089 C  C   . GLU B 1 50  ? -33.341 -12.842 -19.291 1.00 67.90  ? 1   GLU B C   1 
ATOM   3090 O  O   . GLU B 1 50  ? -33.317 -12.177 -18.244 1.00 65.54  ? 1   GLU B O   1 
ATOM   3091 C  CB  . GLU B 1 50  ? -32.547 -15.188 -18.843 1.00 84.73  ? 1   GLU B CB  1 
ATOM   3092 C  CG  . GLU B 1 50  ? -32.289 -15.163 -17.349 1.00 94.05  ? 1   GLU B CG  1 
ATOM   3093 C  CD  . GLU B 1 50  ? -31.241 -16.178 -16.936 1.00 107.51 ? 1   GLU B CD  1 
ATOM   3094 O  OE1 . GLU B 1 50  ? -31.316 -17.342 -17.401 1.00 108.07 ? 1   GLU B OE1 1 
ATOM   3095 O  OE2 . GLU B 1 50  ? -30.344 -15.810 -16.142 1.00 111.20 ? 1   GLU B OE2 1 
ATOM   3096 N  N   . MET B 1 51  ? -33.046 -12.331 -20.487 1.00 63.72  ? 2   MET B N   1 
ATOM   3097 C  CA  . MET B 1 51  ? -32.604 -10.956 -20.687 1.00 56.88  ? 2   MET B CA  1 
ATOM   3098 C  C   . MET B 1 51  ? -33.667 -10.027 -21.299 1.00 57.67  ? 2   MET B C   1 
ATOM   3099 O  O   . MET B 1 51  ? -33.560 -8.809  -21.148 1.00 56.18  ? 2   MET B O   1 
ATOM   3100 C  CB  . MET B 1 51  ? -31.308 -10.939 -21.510 1.00 59.68  ? 2   MET B CB  1 
ATOM   3101 C  CG  . MET B 1 51  ? -30.141 -11.551 -20.751 1.00 58.86  ? 2   MET B CG  1 
ATOM   3102 S  SD  . MET B 1 51  ? -28.607 -11.875 -21.637 1.00 57.88  ? 2   MET B SD  1 
ATOM   3103 C  CE  . MET B 1 51  ? -29.084 -13.026 -22.911 1.00 55.99  ? 2   MET B CE  1 
ATOM   3104 N  N   . VAL B 1 52  ? -34.685 -10.582 -21.970 1.00 52.96  ? 3   VAL B N   1 
ATOM   3105 C  CA  . VAL B 1 52  ? -35.783 -9.773  -22.502 1.00 51.50  ? 3   VAL B CA  1 
ATOM   3106 C  C   . VAL B 1 52  ? -36.394 -8.953  -21.353 1.00 58.88  ? 3   VAL B C   1 
ATOM   3107 O  O   . VAL B 1 52  ? -36.634 -9.491  -20.262 1.00 59.89  ? 3   VAL B O   1 
ATOM   3108 C  CB  . VAL B 1 52  ? -36.863 -10.649 -23.194 1.00 54.13  ? 3   VAL B CB  1 
ATOM   3109 C  CG1 . VAL B 1 52  ? -38.126 -9.859  -23.474 1.00 53.53  ? 3   VAL B CG1 1 
ATOM   3110 C  CG2 . VAL B 1 52  ? -36.346 -11.251 -24.488 1.00 52.53  ? 3   VAL B CG2 1 
ATOM   3111 N  N   . ASP B 1 53  ? -36.609 -7.652  -21.579 1.00 55.13  ? 4   ASP B N   1 
ATOM   3112 C  CA  . ASP B 1 53  ? -37.280 -6.788  -20.601 1.00 54.55  ? 4   ASP B CA  1 
ATOM   3113 C  C   . ASP B 1 53  ? -36.430 -6.424  -19.389 1.00 54.36  ? 4   ASP B C   1 
ATOM   3114 O  O   . ASP B 1 53  ? -36.987 -6.076  -18.332 1.00 53.87  ? 4   ASP B O   1 
ATOM   3115 C  CB  . ASP B 1 53  ? -38.623 -7.388  -20.114 1.00 64.15  ? 4   ASP B CB  1 
ATOM   3116 C  CG  . ASP B 1 53  ? -39.648 -7.567  -21.234 1.00 68.41  ? 4   ASP B CG  1 
ATOM   3117 O  OD1 . ASP B 1 53  ? -39.516 -6.931  -22.300 1.00 71.04  ? 4   ASP B OD1 1 
ATOM   3118 O  OD2 . ASP B 1 53  ? -40.601 -8.352  -21.039 1.00 72.88  ? 4   ASP B OD2 1 
ATOM   3119 N  N   . ASN B 1 54  ? -35.102 -6.476  -19.527 1.00 51.26  ? 5   ASN B N   1 
ATOM   3120 C  CA  . ASN B 1 54  ? -34.212 -6.122  -18.402 1.00 48.93  ? 5   ASN B CA  1 
ATOM   3121 C  C   . ASN B 1 54  ? -33.878 -4.624  -18.301 1.00 51.28  ? 5   ASN B C   1 
ATOM   3122 O  O   . ASN B 1 54  ? -33.181 -4.186  -17.368 1.00 51.34  ? 5   ASN B O   1 
ATOM   3123 C  CB  . ASN B 1 54  ? -32.942 -6.964  -18.394 1.00 45.32  ? 5   ASN B CB  1 
ATOM   3124 C  CG  . ASN B 1 54  ? -32.146 -6.824  -19.673 1.00 48.16  ? 5   ASN B CG  1 
ATOM   3125 O  OD1 . ASN B 1 54  ? -32.503 -6.036  -20.542 1.00 52.45  ? 5   ASN B OD1 1 
ATOM   3126 N  ND2 . ASN B 1 54  ? -31.073 -7.612  -19.811 1.00 45.46  ? 5   ASN B ND2 1 
ATOM   3127 N  N   . LEU B 1 55  ? -34.410 -3.825  -19.220 1.00 44.94  ? 6   LEU B N   1 
ATOM   3128 C  CA  . LEU B 1 55  ? -34.158 -2.388  -19.154 1.00 45.03  ? 6   LEU B CA  1 
ATOM   3129 C  C   . LEU B 1 55  ? -35.325 -1.594  -18.594 1.00 45.84  ? 6   LEU B C   1 
ATOM   3130 O  O   . LEU B 1 55  ? -36.489 -2.002  -18.679 1.00 49.80  ? 6   LEU B O   1 
ATOM   3131 C  CB  . LEU B 1 55  ? -33.774 -1.830  -20.524 1.00 41.52  ? 6   LEU B CB  1 
ATOM   3132 C  CG  . LEU B 1 55  ? -32.514 -2.364  -21.198 1.00 42.54  ? 6   LEU B CG  1 
ATOM   3133 C  CD1 . LEU B 1 55  ? -32.238 -1.523  -22.433 1.00 45.58  ? 6   LEU B CD1 1 
ATOM   3134 C  CD2 . LEU B 1 55  ? -31.329 -2.323  -20.259 1.00 42.43  ? 6   LEU B CD2 1 
ATOM   3135 N  N   . ARG B 1 56  ? -35.005 -0.450  -18.015 1.00 46.77  ? 7   ARG B N   1 
ATOM   3136 C  CA  . ARG B 1 56  ? -36.014 0.501   -17.601 1.00 50.44  ? 7   ARG B CA  1 
ATOM   3137 C  C   . ARG B 1 56  ? -35.482 1.854   -17.953 1.00 49.87  ? 7   ARG B C   1 
ATOM   3138 O  O   . ARG B 1 56  ? -34.302 1.992   -18.237 1.00 52.24  ? 7   ARG B O   1 
ATOM   3139 C  CB  . ARG B 1 56  ? -36.274 0.421   -16.093 1.00 53.11  ? 7   ARG B CB  1 
ATOM   3140 C  CG  . ARG B 1 56  ? -36.786 -0.930  -15.654 1.00 57.47  ? 7   ARG B CG  1 
ATOM   3141 C  CD  . ARG B 1 56  ? -37.330 -0.909  -14.253 1.00 61.10  ? 7   ARG B CD  1 
ATOM   3142 N  NE  . ARG B 1 56  ? -38.292 -1.983  -14.159 1.00 75.00  ? 7   ARG B NE  1 
ATOM   3143 C  CZ  . ARG B 1 56  ? -38.478 -2.725  -13.079 1.00 92.18  ? 7   ARG B CZ  1 
ATOM   3144 N  NH1 . ARG B 1 56  ? -37.754 -2.497  -11.988 1.00 97.67  ? 7   ARG B NH1 1 
ATOM   3145 N  NH2 . ARG B 1 56  ? -39.386 -3.698  -13.093 1.00 98.46  ? 7   ARG B NH2 1 
ATOM   3146 N  N   . GLY B 1 57  ? -36.353 2.853   -17.926 1.00 51.77  ? 8   GLY B N   1 
ATOM   3147 C  CA  . GLY B 1 57  ? -35.963 4.210   -18.231 1.00 53.30  ? 8   GLY B CA  1 
ATOM   3148 C  C   . GLY B 1 57  ? -36.717 4.772   -19.415 1.00 57.70  ? 8   GLY B C   1 
ATOM   3149 O  O   . GLY B 1 57  ? -37.759 4.238   -19.835 1.00 57.24  ? 8   GLY B O   1 
ATOM   3150 N  N   . LYS B 1 58  ? -36.172 5.860   -19.948 1.00 58.67  ? 9   LYS B N   1 
ATOM   3151 C  CA  . LYS B 1 58  ? -36.782 6.610   -21.029 1.00 55.64  ? 9   LYS B CA  1 
ATOM   3152 C  C   . LYS B 1 58  ? -35.720 7.546   -21.628 1.00 53.21  ? 9   LYS B C   1 
ATOM   3153 O  O   . LYS B 1 58  ? -34.746 7.903   -20.957 1.00 53.73  ? 9   LYS B O   1 
ATOM   3154 C  CB  . LYS B 1 58  ? -37.992 7.389   -20.508 1.00 53.22  ? 9   LYS B CB  1 
ATOM   3155 C  CG  . LYS B 1 58  ? -37.673 8.460   -19.474 1.00 55.11  ? 9   LYS B CG  1 
ATOM   3156 C  CD  . LYS B 1 58  ? -38.953 9.001   -18.860 1.00 59.90  ? 9   LYS B CD  1 
ATOM   3157 C  CE  . LYS B 1 58  ? -38.742 10.359  -18.214 1.00 60.69  ? 9   LYS B CE  1 
ATOM   3158 N  NZ  . LYS B 1 58  ? -39.941 10.676  -17.382 1.00 61.55  ? 9   LYS B NZ  1 
ATOM   3159 N  N   . SER B 1 59  ? -35.905 7.936   -22.884 1.00 49.68  ? 10  SER B N   1 
ATOM   3160 C  CA  . SER B 1 59  ? -34.885 8.675   -23.627 1.00 48.63  ? 10  SER B CA  1 
ATOM   3161 C  C   . SER B 1 59  ? -34.378 9.928   -22.934 1.00 48.96  ? 10  SER B C   1 
ATOM   3162 O  O   . SER B 1 59  ? -33.229 10.312  -23.128 1.00 54.60  ? 10  SER B O   1 
ATOM   3163 C  CB  . SER B 1 59  ? -35.395 9.053   -25.018 1.00 47.30  ? 10  SER B CB  1 
ATOM   3164 O  OG  . SER B 1 59  ? -36.522 9.898   -24.925 1.00 45.06  ? 10  SER B OG  1 
ATOM   3165 N  N   . GLY B 1 60  ? -35.228 10.564  -22.138 1.00 46.98  ? 11  GLY B N   1 
ATOM   3166 C  CA  . GLY B 1 60  ? -34.866 11.814  -21.484 1.00 47.08  ? 11  GLY B CA  1 
ATOM   3167 C  C   . GLY B 1 60  ? -33.988 11.655  -20.252 1.00 51.69  ? 11  GLY B C   1 
ATOM   3168 O  O   . GLY B 1 60  ? -33.356 12.622  -19.811 1.00 51.32  ? 11  GLY B O   1 
ATOM   3169 N  N   . GLN B 1 61  ? -33.943 10.449  -19.690 1.00 49.09  ? 12  GLN B N   1 
ATOM   3170 C  CA  . GLN B 1 61  ? -33.190 10.205  -18.443 1.00 54.98  ? 12  GLN B CA  1 
ATOM   3171 C  C   . GLN B 1 61  ? -32.261 9.000   -18.548 1.00 54.52  ? 12  GLN B C   1 
ATOM   3172 O  O   . GLN B 1 61  ? -31.459 8.742   -17.655 1.00 55.31  ? 12  GLN B O   1 
ATOM   3173 C  CB  . GLN B 1 61  ? -34.148 10.024  -17.267 1.00 57.72  ? 12  GLN B CB  1 
ATOM   3174 C  CG  . GLN B 1 61  ? -34.992 11.257  -16.987 1.00 61.64  ? 12  GLN B CG  1 
ATOM   3175 C  CD  . GLN B 1 61  ? -35.566 11.217  -15.597 1.00 71.46  ? 12  GLN B CD  1 
ATOM   3176 O  OE1 . GLN B 1 61  ? -36.341 10.311  -15.257 1.00 71.72  ? 12  GLN B OE1 1 
ATOM   3177 N  NE2 . GLN B 1 61  ? -35.173 12.188  -14.768 1.00 71.15  ? 12  GLN B NE2 1 
ATOM   3178 N  N   . GLY B 1 62  ? -32.385 8.271   -19.652 1.00 51.86  ? 13  GLY B N   1 
ATOM   3179 C  CA  . GLY B 1 62  ? -31.530 7.149   -19.949 1.00 44.44  ? 13  GLY B CA  1 
ATOM   3180 C  C   . GLY B 1 62  ? -32.155 5.815   -19.615 1.00 46.96  ? 13  GLY B C   1 
ATOM   3181 O  O   . GLY B 1 62  ? -33.008 5.700   -18.726 1.00 50.98  ? 13  GLY B O   1 
ATOM   3182 N  N   . TYR B 1 63  ? -31.700 4.796   -20.326 1.00 46.92  ? 14  TYR B N   1 
ATOM   3183 C  CA  . TYR B 1 63  ? -32.117 3.435   -20.092 1.00 45.16  ? 14  TYR B CA  1 
ATOM   3184 C  C   . TYR B 1 63  ? -31.082 2.735   -19.245 1.00 46.92  ? 14  TYR B C   1 
ATOM   3185 O  O   . TYR B 1 63  ? -29.897 2.766   -19.571 1.00 50.53  ? 14  TYR B O   1 
ATOM   3186 C  CB  . TYR B 1 63  ? -32.277 2.736   -21.435 1.00 45.25  ? 14  TYR B CB  1 
ATOM   3187 C  CG  . TYR B 1 63  ? -33.501 3.227   -22.161 1.00 50.84  ? 14  TYR B CG  1 
ATOM   3188 C  CD1 . TYR B 1 63  ? -34.757 2.651   -21.920 1.00 52.75  ? 14  TYR B CD1 1 
ATOM   3189 C  CD2 . TYR B 1 63  ? -33.427 4.287   -23.061 1.00 51.56  ? 14  TYR B CD2 1 
ATOM   3190 C  CE1 . TYR B 1 63  ? -35.888 3.106   -22.575 1.00 52.38  ? 14  TYR B CE1 1 
ATOM   3191 C  CE2 . TYR B 1 63  ? -34.560 4.745   -23.719 1.00 52.51  ? 14  TYR B CE2 1 
ATOM   3192 C  CZ  . TYR B 1 63  ? -35.783 4.156   -23.469 1.00 53.43  ? 14  TYR B CZ  1 
ATOM   3193 O  OH  . TYR B 1 63  ? -36.907 4.606   -24.116 1.00 54.38  ? 14  TYR B OH  1 
ATOM   3194 N  N   . TYR B 1 64  ? -31.519 2.108   -18.156 1.00 50.69  ? 15  TYR B N   1 
ATOM   3195 C  CA  . TYR B 1 64  ? -30.585 1.434   -17.256 1.00 52.53  ? 15  TYR B CA  1 
ATOM   3196 C  C   . TYR B 1 64  ? -30.819 -0.086  -17.103 1.00 53.74  ? 15  TYR B C   1 
ATOM   3197 O  O   . TYR B 1 64  ? -31.919 -0.593  -17.383 1.00 57.04  ? 15  TYR B O   1 
ATOM   3198 C  CB  . TYR B 1 64  ? -30.536 2.161   -15.914 1.00 53.56  ? 15  TYR B CB  1 
ATOM   3199 C  CG  . TYR B 1 64  ? -31.847 2.192   -15.156 1.00 58.34  ? 15  TYR B CG  1 
ATOM   3200 C  CD1 . TYR B 1 64  ? -32.227 1.118   -14.361 1.00 58.57  ? 15  TYR B CD1 1 
ATOM   3201 C  CD2 . TYR B 1 64  ? -32.691 3.305   -15.201 1.00 61.64  ? 15  TYR B CD2 1 
ATOM   3202 C  CE1 . TYR B 1 64  ? -33.407 1.134   -13.642 1.00 61.40  ? 15  TYR B CE1 1 
ATOM   3203 C  CE2 . TYR B 1 64  ? -33.883 3.326   -14.482 1.00 60.75  ? 15  TYR B CE2 1 
ATOM   3204 C  CZ  . TYR B 1 64  ? -34.231 2.231   -13.709 1.00 60.58  ? 15  TYR B CZ  1 
ATOM   3205 O  OH  . TYR B 1 64  ? -35.392 2.196   -12.985 1.00 62.28  ? 15  TYR B OH  1 
ATOM   3206 N  N   . VAL B 1 65  ? -29.765 -0.802  -16.708 1.00 48.76  ? 16  VAL B N   1 
ATOM   3207 C  CA  . VAL B 1 65  ? -29.845 -2.230  -16.396 1.00 46.55  ? 16  VAL B CA  1 
ATOM   3208 C  C   . VAL B 1 65  ? -29.464 -2.461  -14.918 1.00 53.07  ? 16  VAL B C   1 
ATOM   3209 O  O   . VAL B 1 65  ? -28.661 -1.704  -14.353 1.00 52.29  ? 16  VAL B O   1 
ATOM   3210 C  CB  . VAL B 1 65  ? -28.962 -3.078  -17.350 1.00 43.89  ? 16  VAL B CB  1 
ATOM   3211 C  CG1 . VAL B 1 65  ? -27.472 -2.856  -17.073 1.00 41.01  ? 16  VAL B CG1 1 
ATOM   3212 C  CG2 . VAL B 1 65  ? -29.335 -4.565  -17.265 1.00 38.76  ? 16  VAL B CG2 1 
ATOM   3213 N  N   . GLU B 1 66  ? -30.047 -3.483  -14.287 1.00 55.42  ? 17  GLU B N   1 
ATOM   3214 C  CA  . GLU B 1 66  ? -29.660 -3.837  -12.925 1.00 57.01  ? 17  GLU B CA  1 
ATOM   3215 C  C   . GLU B 1 66  ? -28.337 -4.611  -12.961 1.00 54.87  ? 17  GLU B C   1 
ATOM   3216 O  O   . GLU B 1 66  ? -28.166 -5.503  -13.803 1.00 51.12  ? 17  GLU B O   1 
ATOM   3217 C  CB  . GLU B 1 66  ? -30.774 -4.621  -12.209 1.00 61.00  ? 17  GLU B CB  1 
ATOM   3218 C  CG  . GLU B 1 66  ? -30.367 -5.159  -10.831 1.00 68.15  ? 17  GLU B CG  1 
ATOM   3219 C  CD  . GLU B 1 66  ? -31.523 -5.773  -10.034 1.00 67.92  ? 17  GLU B CD  1 
ATOM   3220 O  OE1 . GLU B 1 66  ? -32.342 -4.997  -9.465  1.00 59.87  ? 17  GLU B OE1 1 
ATOM   3221 O  OE2 . GLU B 1 66  ? -31.593 -7.031  -9.958  1.00 65.46  ? 17  GLU B OE2 1 
ATOM   3222 N  N   . MET B 1 67  ? -27.404 -4.238  -12.072 1.00 50.68  ? 18  MET B N   1 
ATOM   3223 C  CA  . MET B 1 67  ? -26.111 -4.936  -11.924 1.00 49.95  ? 18  MET B CA  1 
ATOM   3224 C  C   . MET B 1 67  ? -25.764 -5.118  -10.444 1.00 51.59  ? 18  MET B C   1 
ATOM   3225 O  O   . MET B 1 67  ? -26.192 -4.319  -9.606  1.00 54.14  ? 18  MET B O   1 
ATOM   3226 C  CB  . MET B 1 67  ? -24.968 -4.176  -12.614 1.00 46.56  ? 18  MET B CB  1 
ATOM   3227 C  CG  . MET B 1 67  ? -25.176 -3.852  -14.085 1.00 46.84  ? 18  MET B CG  1 
ATOM   3228 S  SD  . MET B 1 67  ? -23.765 -3.065  -14.908 1.00 48.27  ? 18  MET B SD  1 
ATOM   3229 C  CE  . MET B 1 67  ? -22.670 -4.472  -15.040 1.00 48.02  ? 18  MET B CE  1 
ATOM   3230 N  N   . THR B 1 68  ? -24.989 -6.158  -10.126 1.00 50.71  ? 19  THR B N   1 
ATOM   3231 C  CA  . THR B 1 68  ? -24.385 -6.297  -8.785  1.00 50.47  ? 19  THR B CA  1 
ATOM   3232 C  C   . THR B 1 68  ? -22.862 -6.095  -8.825  1.00 49.35  ? 19  THR B C   1 
ATOM   3233 O  O   . THR B 1 68  ? -22.210 -6.426  -9.805  1.00 48.54  ? 19  THR B O   1 
ATOM   3234 C  CB  . THR B 1 68  ? -24.750 -7.636  -8.090  1.00 50.94  ? 19  THR B CB  1 
ATOM   3235 O  OG1 . THR B 1 68  ? -24.143 -8.740  -8.783  1.00 52.09  ? 19  THR B OG1 1 
ATOM   3236 C  CG2 . THR B 1 68  ? -26.296 -7.841  -8.035  1.00 47.38  ? 19  THR B CG2 1 
ATOM   3237 N  N   . VAL B 1 69  ? -22.308 -5.513  -7.768  1.00 51.11  ? 20  VAL B N   1 
ATOM   3238 C  CA  . VAL B 1 69  ? -20.855 -5.390  -7.628  1.00 52.78  ? 20  VAL B CA  1 
ATOM   3239 C  C   . VAL B 1 69  ? -20.431 -5.828  -6.220  1.00 55.94  ? 20  VAL B C   1 
ATOM   3240 O  O   . VAL B 1 69  ? -21.096 -5.488  -5.245  1.00 57.74  ? 20  VAL B O   1 
ATOM   3241 C  CB  . VAL B 1 69  ? -20.346 -3.952  -7.932  1.00 52.28  ? 20  VAL B CB  1 
ATOM   3242 C  CG1 . VAL B 1 69  ? -20.726 -3.515  -9.340  1.00 51.38  ? 20  VAL B CG1 1 
ATOM   3243 C  CG2 . VAL B 1 69  ? -20.881 -2.944  -6.930  1.00 47.68  ? 20  VAL B CG2 1 
ATOM   3244 N  N   . GLY B 1 70  ? -19.355 -6.605  -6.110  1.00 57.93  ? 21  GLY B N   1 
ATOM   3245 C  CA  . GLY B 1 70  ? -18.766 -6.924  -4.802  1.00 57.58  ? 21  GLY B CA  1 
ATOM   3246 C  C   . GLY B 1 70  ? -19.301 -8.169  -4.112  1.00 57.90  ? 21  GLY B C   1 
ATOM   3247 O  O   . GLY B 1 70  ? -20.287 -8.749  -4.559  1.00 61.07  ? 21  GLY B O   1 
ATOM   3248 N  N   . SER B 1 71  ? -18.652 -8.556  -3.009  1.00 56.05  ? 22  SER B N   1 
ATOM   3249 C  CA  . SER B 1 71  ? -19.044 -9.711  -2.197  1.00 54.00  ? 22  SER B CA  1 
ATOM   3250 C  C   . SER B 1 71  ? -19.312 -9.345  -0.724  1.00 55.62  ? 22  SER B C   1 
ATOM   3251 O  O   . SER B 1 71  ? -18.431 -8.805  -0.055  1.00 61.14  ? 22  SER B O   1 
ATOM   3252 C  CB  . SER B 1 71  ? -17.955 -10.765 -2.263  1.00 49.83  ? 22  SER B CB  1 
ATOM   3253 O  OG  . SER B 1 71  ? -17.571 -10.980 -3.600  1.00 50.95  ? 22  SER B OG  1 
ATOM   3254 N  N   . PRO B 1 72  ? -20.533 -9.607  -0.214  1.00 55.66  ? 23  PRO B N   1 
ATOM   3255 C  CA  . PRO B 1 72  ? -21.757 -10.036 -0.907  1.00 54.75  ? 23  PRO B CA  1 
ATOM   3256 C  C   . PRO B 1 72  ? -22.213 -9.001  -1.959  1.00 51.82  ? 23  PRO B C   1 
ATOM   3257 O  O   . PRO B 1 72  ? -21.791 -7.836  -1.894  1.00 48.65  ? 23  PRO B O   1 
ATOM   3258 C  CB  . PRO B 1 72  ? -22.798 -10.140 0.236   1.00 53.50  ? 23  PRO B CB  1 
ATOM   3259 C  CG  . PRO B 1 72  ? -22.221 -9.394  1.382   1.00 50.41  ? 23  PRO B CG  1 
ATOM   3260 C  CD  . PRO B 1 72  ? -20.737 -9.527  1.245   1.00 51.84  ? 23  PRO B CD  1 
ATOM   3261 N  N   . PRO B 1 73  ? -23.068 -9.420  -2.920  1.00 51.91  ? 24  PRO B N   1 
ATOM   3262 C  CA  . PRO B 1 73  ? -23.525 -8.564  -4.039  1.00 48.47  ? 24  PRO B CA  1 
ATOM   3263 C  C   . PRO B 1 73  ? -24.201 -7.262  -3.619  1.00 46.73  ? 24  PRO B C   1 
ATOM   3264 O  O   . PRO B 1 73  ? -25.196 -7.300  -2.908  1.00 52.14  ? 24  PRO B O   1 
ATOM   3265 C  CB  . PRO B 1 73  ? -24.542 -9.448  -4.759  1.00 48.89  ? 24  PRO B CB  1 
ATOM   3266 C  CG  . PRO B 1 73  ? -24.145 -10.851 -4.432  1.00 51.14  ? 24  PRO B CG  1 
ATOM   3267 C  CD  . PRO B 1 73  ? -23.555 -10.811 -3.052  1.00 50.57  ? 24  PRO B CD  1 
ATOM   3268 N  N   . GLN B 1 74  ? -23.661 -6.123  -4.047  1.00 46.22  ? 25  GLN B N   1 
ATOM   3269 C  CA  . GLN B 1 74  ? -24.337 -4.811  -3.912  1.00 46.98  ? 25  GLN B CA  1 
ATOM   3270 C  C   . GLN B 1 74  ? -25.078 -4.478  -5.193  1.00 50.26  ? 25  GLN B C   1 
ATOM   3271 O  O   . GLN B 1 74  ? -24.463 -4.444  -6.260  1.00 48.14  ? 25  GLN B O   1 
ATOM   3272 C  CB  . GLN B 1 74  ? -23.315 -3.709  -3.648  1.00 47.54  ? 25  GLN B CB  1 
ATOM   3273 C  CG  . GLN B 1 74  ? -22.810 -3.732  -2.225  1.00 50.56  ? 25  GLN B CG  1 
ATOM   3274 C  CD  . GLN B 1 74  ? -21.619 -2.850  -2.006  1.00 50.28  ? 25  GLN B CD  1 
ATOM   3275 O  OE1 . GLN B 1 74  ? -21.682 -1.622  -2.179  1.00 49.00  ? 25  GLN B OE1 1 
ATOM   3276 N  NE2 . GLN B 1 74  ? -20.518 -3.470  -1.583  1.00 52.40  ? 25  GLN B NE2 1 
ATOM   3277 N  N   . THR B 1 75  ? -26.381 -4.227  -5.096  1.00 52.90  ? 26  THR B N   1 
ATOM   3278 C  CA  . THR B 1 75  ? -27.209 -4.015  -6.292  1.00 55.03  ? 26  THR B CA  1 
ATOM   3279 C  C   . THR B 1 75  ? -27.212 -2.544  -6.681  1.00 56.42  ? 26  THR B C   1 
ATOM   3280 O  O   . THR B 1 75  ? -27.424 -1.681  -5.826  1.00 61.52  ? 26  THR B O   1 
ATOM   3281 C  CB  . THR B 1 75  ? -28.658 -4.491  -6.069  1.00 57.60  ? 26  THR B CB  1 
ATOM   3282 O  OG1 . THR B 1 75  ? -28.662 -5.910  -5.887  1.00 57.10  ? 26  THR B OG1 1 
ATOM   3283 C  CG2 . THR B 1 75  ? -29.543 -4.149  -7.266  1.00 54.96  ? 26  THR B CG2 1 
ATOM   3284 N  N   . LEU B 1 76  ? -26.951 -2.261  -7.960  1.00 50.99  ? 27  LEU B N   1 
ATOM   3285 C  CA  . LEU B 1 76  ? -27.039 -0.901  -8.497  1.00 47.56  ? 27  LEU B CA  1 
ATOM   3286 C  C   . LEU B 1 76  ? -27.718 -0.895  -9.876  1.00 50.56  ? 27  LEU B C   1 
ATOM   3287 O  O   . LEU B 1 76  ? -27.675 -1.906  -10.623 1.00 45.63  ? 27  LEU B O   1 
ATOM   3288 C  CB  . LEU B 1 76  ? -25.665 -0.222  -8.585  1.00 44.95  ? 27  LEU B CB  1 
ATOM   3289 C  CG  . LEU B 1 76  ? -24.749 -0.191  -7.348  1.00 49.77  ? 27  LEU B CG  1 
ATOM   3290 C  CD1 . LEU B 1 76  ? -23.282 -0.051  -7.752  1.00 47.83  ? 27  LEU B CD1 1 
ATOM   3291 C  CD2 . LEU B 1 76  ? -25.141 0.852   -6.306  1.00 44.08  ? 27  LEU B CD2 1 
ATOM   3292 N  N   . ASN B 1 77  ? -28.381 0.229   -10.181 1.00 48.24  ? 28  ASN B N   1 
ATOM   3293 C  CA  . ASN B 1 77  ? -28.886 0.497   -11.521 1.00 48.58  ? 28  ASN B CA  1 
ATOM   3294 C  C   . ASN B 1 77  ? -27.849 1.274   -12.281 1.00 48.40  ? 28  ASN B C   1 
ATOM   3295 O  O   . ASN B 1 77  ? -27.361 2.294   -11.798 1.00 51.73  ? 28  ASN B O   1 
ATOM   3296 C  CB  . ASN B 1 77  ? -30.156 1.329   -11.482 1.00 47.41  ? 28  ASN B CB  1 
ATOM   3297 C  CG  . ASN B 1 77  ? -31.334 0.568   -10.940 1.00 47.52  ? 28  ASN B CG  1 
ATOM   3298 O  OD1 . ASN B 1 77  ? -31.438 -0.661  -11.074 1.00 47.42  ? 28  ASN B OD1 1 
ATOM   3299 N  ND2 . ASN B 1 77  ? -32.234 1.296   -10.317 1.00 46.07  ? 28  ASN B ND2 1 
ATOM   3300 N  N   . ILE B 1 78  ? -27.545 0.799   -13.483 1.00 46.29  ? 29  ILE B N   1 
ATOM   3301 C  CA  . ILE B 1 78  ? -26.424 1.296   -14.278 1.00 43.37  ? 29  ILE B CA  1 
ATOM   3302 C  C   . ILE B 1 78  ? -26.878 1.665   -15.694 1.00 43.62  ? 29  ILE B C   1 
ATOM   3303 O  O   . ILE B 1 78  ? -27.381 0.815   -16.440 1.00 42.44  ? 29  ILE B O   1 
ATOM   3304 C  CB  . ILE B 1 78  ? -25.299 0.238   -14.355 1.00 41.43  ? 29  ILE B CB  1 
ATOM   3305 C  CG1 . ILE B 1 78  ? -24.892 -0.269  -12.954 1.00 39.09  ? 29  ILE B CG1 1 
ATOM   3306 C  CG2 . ILE B 1 78  ? -24.124 0.802   -15.110 1.00 41.59  ? 29  ILE B CG2 1 
ATOM   3307 C  CD1 . ILE B 1 78  ? -24.368 0.811   -12.012 1.00 37.92  ? 29  ILE B CD1 1 
ATOM   3308 N  N   . LEU B 1 79  ? -26.717 2.937   -16.047 1.00 41.48  ? 30  LEU B N   1 
ATOM   3309 C  CA  . LEU B 1 79  ? -27.001 3.432   -17.386 1.00 41.30  ? 30  LEU B CA  1 
ATOM   3310 C  C   . LEU B 1 79  ? -26.295 2.620   -18.480 1.00 45.33  ? 30  LEU B C   1 
ATOM   3311 O  O   . LEU B 1 79  ? -25.093 2.316   -18.388 1.00 44.69  ? 30  LEU B O   1 
ATOM   3312 C  CB  . LEU B 1 79  ? -26.572 4.911   -17.511 1.00 43.60  ? 30  LEU B CB  1 
ATOM   3313 C  CG  . LEU B 1 79  ? -26.851 5.595   -18.858 1.00 40.19  ? 30  LEU B CG  1 
ATOM   3314 C  CD1 . LEU B 1 79  ? -28.293 6.062   -18.887 1.00 40.58  ? 30  LEU B CD1 1 
ATOM   3315 C  CD2 . LEU B 1 79  ? -25.919 6.758   -19.102 1.00 41.38  ? 30  LEU B CD2 1 
ATOM   3316 N  N   . VAL B 1 80  ? -27.036 2.285   -19.527 1.00 49.05  ? 31  VAL B N   1 
ATOM   3317 C  CA  . VAL B 1 80  ? -26.462 1.560   -20.641 1.00 50.48  ? 31  VAL B CA  1 
ATOM   3318 C  C   . VAL B 1 80  ? -25.948 2.619   -21.587 1.00 47.88  ? 31  VAL B C   1 
ATOM   3319 O  O   . VAL B 1 80  ? -26.747 3.347   -22.158 1.00 49.95  ? 31  VAL B O   1 
ATOM   3320 C  CB  . VAL B 1 80  ? -27.505 0.642   -21.300 1.00 51.94  ? 31  VAL B CB  1 
ATOM   3321 C  CG1 . VAL B 1 80  ? -27.023 0.170   -22.662 1.00 55.98  ? 31  VAL B CG1 1 
ATOM   3322 C  CG2 . VAL B 1 80  ? -27.775 -0.546  -20.390 1.00 52.36  ? 31  VAL B CG2 1 
ATOM   3323 N  N   . ASP B 1 81  ? -24.623 2.728   -21.740 1.00 44.49  ? 32  ASP B N   1 
ATOM   3324 C  CA  . ASP B 1 81  ? -24.054 3.826   -22.536 1.00 42.21  ? 32  ASP B CA  1 
ATOM   3325 C  C   . ASP B 1 81  ? -23.030 3.404   -23.591 1.00 41.19  ? 32  ASP B C   1 
ATOM   3326 O  O   . ASP B 1 81  ? -21.879 3.174   -23.271 1.00 44.90  ? 32  ASP B O   1 
ATOM   3327 C  CB  . ASP B 1 81  ? -23.522 4.924   -21.601 1.00 43.51  ? 32  ASP B CB  1 
ATOM   3328 C  CG  . ASP B 1 81  ? -22.748 6.005   -22.328 1.00 45.23  ? 32  ASP B CG  1 
ATOM   3329 O  OD1 . ASP B 1 81  ? -23.019 6.296   -23.515 1.00 42.32  ? 32  ASP B OD1 1 
ATOM   3330 O  OD2 . ASP B 1 81  ? -21.835 6.559   -21.686 1.00 47.18  ? 32  ASP B OD2 1 
ATOM   3331 N  N   . THR B 1 82  ? -23.464 3.321   -24.850 1.00 41.86  ? 33  THR B N   1 
ATOM   3332 C  CA  . THR B 1 82  ? -22.599 2.890   -25.961 1.00 43.07  ? 33  THR B CA  1 
ATOM   3333 C  C   . THR B 1 82  ? -21.715 4.020   -26.510 1.00 44.23  ? 33  THR B C   1 
ATOM   3334 O  O   . THR B 1 82  ? -20.987 3.804   -27.479 1.00 46.88  ? 33  THR B O   1 
ATOM   3335 C  CB  . THR B 1 82  ? -23.394 2.303   -27.171 1.00 43.25  ? 33  THR B CB  1 
ATOM   3336 O  OG1 . THR B 1 82  ? -24.237 3.312   -27.739 1.00 46.98  ? 33  THR B OG1 1 
ATOM   3337 C  CG2 . THR B 1 82  ? -24.239 1.116   -26.793 1.00 41.91  ? 33  THR B CG2 1 
ATOM   3338 N  N   . GLY B 1 83  ? -21.794 5.217   -25.919 1.00 44.94  ? 34  GLY B N   1 
ATOM   3339 C  CA  . GLY B 1 83  ? -20.932 6.345   -26.314 1.00 42.17  ? 34  GLY B CA  1 
ATOM   3340 C  C   . GLY B 1 83  ? -19.751 6.637   -25.392 1.00 43.04  ? 34  GLY B C   1 
ATOM   3341 O  O   . GLY B 1 83  ? -19.131 7.697   -25.484 1.00 44.55  ? 34  GLY B O   1 
ATOM   3342 N  N   . SER B 1 84  ? -19.462 5.707   -24.486 1.00 41.78  ? 35  SER B N   1 
ATOM   3343 C  CA  . SER B 1 84  ? -18.312 5.788   -23.580 1.00 42.12  ? 35  SER B CA  1 
ATOM   3344 C  C   . SER B 1 84  ? -17.820 4.368   -23.245 1.00 42.35  ? 35  SER B C   1 
ATOM   3345 O  O   . SER B 1 84  ? -18.443 3.372   -23.651 1.00 42.24  ? 35  SER B O   1 
ATOM   3346 C  CB  . SER B 1 84  ? -18.640 6.612   -22.310 1.00 44.16  ? 35  SER B CB  1 
ATOM   3347 O  OG  . SER B 1 84  ? -19.468 5.927   -21.359 1.00 46.31  ? 35  SER B OG  1 
ATOM   3348 N  N   . SER B 1 85  ? -16.714 4.283   -22.506 1.00 40.23  ? 36  SER B N   1 
ATOM   3349 C  CA  . SER B 1 85  ? -15.988 3.033   -22.351 1.00 41.10  ? 36  SER B CA  1 
ATOM   3350 C  C   . SER B 1 85  ? -15.588 2.686   -20.916 1.00 44.47  ? 36  SER B C   1 
ATOM   3351 O  O   . SER B 1 85  ? -14.901 1.675   -20.696 1.00 46.41  ? 36  SER B O   1 
ATOM   3352 C  CB  . SER B 1 85  ? -14.761 3.037   -23.253 1.00 42.29  ? 36  SER B CB  1 
ATOM   3353 O  OG  . SER B 1 85  ? -15.159 3.172   -24.607 1.00 41.14  ? 36  SER B OG  1 
ATOM   3354 N  N   . ASN B 1 86  ? -16.044 3.499   -19.958 1.00 44.49  ? 37  ASN B N   1 
ATOM   3355 C  CA  . ASN B 1 86  ? -15.830 3.257   -18.517 1.00 46.25  ? 37  ASN B CA  1 
ATOM   3356 C  C   . ASN B 1 86  ? -17.050 2.686   -17.780 1.00 46.14  ? 37  ASN B C   1 
ATOM   3357 O  O   . ASN B 1 86  ? -18.182 3.151   -17.983 1.00 43.38  ? 37  ASN B O   1 
ATOM   3358 C  CB  . ASN B 1 86  ? -15.398 4.553   -17.804 1.00 46.56  ? 37  ASN B CB  1 
ATOM   3359 C  CG  . ASN B 1 86  ? -13.957 4.937   -18.090 1.00 48.47  ? 37  ASN B CG  1 
ATOM   3360 O  OD1 . ASN B 1 86  ? -13.631 5.474   -19.161 1.00 49.32  ? 37  ASN B OD1 1 
ATOM   3361 N  ND2 . ASN B 1 86  ? -13.085 4.692   -17.116 1.00 44.71  ? 37  ASN B ND2 1 
ATOM   3362 N  N   . PHE B 1 87  ? -16.803 1.679   -16.936 1.00 44.23  ? 38  PHE B N   1 
ATOM   3363 C  CA  . PHE B 1 87  ? -17.742 1.270   -15.885 1.00 44.17  ? 38  PHE B CA  1 
ATOM   3364 C  C   . PHE B 1 87  ? -17.441 2.160   -14.662 1.00 44.29  ? 38  PHE B C   1 
ATOM   3365 O  O   . PHE B 1 87  ? -16.330 2.152   -14.132 1.00 43.88  ? 38  PHE B O   1 
ATOM   3366 C  CB  . PHE B 1 87  ? -17.576 -0.233  -15.576 1.00 41.87  ? 38  PHE B CB  1 
ATOM   3367 C  CG  . PHE B 1 87  ? -18.569 -0.784  -14.583 1.00 44.94  ? 38  PHE B CG  1 
ATOM   3368 C  CD1 . PHE B 1 87  ? -19.827 -0.225  -14.425 1.00 45.67  ? 38  PHE B CD1 1 
ATOM   3369 C  CD2 . PHE B 1 87  ? -18.253 -1.895  -13.815 1.00 50.54  ? 38  PHE B CD2 1 
ATOM   3370 C  CE1 . PHE B 1 87  ? -20.732 -0.738  -13.505 1.00 43.37  ? 38  PHE B CE1 1 
ATOM   3371 C  CE2 . PHE B 1 87  ? -19.151 -2.410  -12.884 1.00 50.66  ? 38  PHE B CE2 1 
ATOM   3372 C  CZ  . PHE B 1 87  ? -20.394 -1.831  -12.736 1.00 45.91  ? 38  PHE B CZ  1 
ATOM   3373 N  N   . ALA B 1 88  ? -18.427 2.938   -14.232 1.00 43.74  ? 39  ALA B N   1 
ATOM   3374 C  CA  . ALA B 1 88  ? -18.221 3.989   -13.230 1.00 43.62  ? 39  ALA B CA  1 
ATOM   3375 C  C   . ALA B 1 88  ? -19.454 4.143   -12.367 1.00 46.03  ? 39  ALA B C   1 
ATOM   3376 O  O   . ALA B 1 88  ? -20.526 4.417   -12.878 1.00 51.91  ? 39  ALA B O   1 
ATOM   3377 C  CB  . ALA B 1 88  ? -17.925 5.296   -13.917 1.00 41.65  ? 39  ALA B CB  1 
ATOM   3378 N  N   . VAL B 1 89  ? -19.311 3.966   -11.061 1.00 46.42  ? 40  VAL B N   1 
ATOM   3379 C  CA  . VAL B 1 89  ? -20.468 3.969   -10.169 1.00 46.36  ? 40  VAL B CA  1 
ATOM   3380 C  C   . VAL B 1 89  ? -20.304 4.961   -9.020  1.00 50.29  ? 40  VAL B C   1 
ATOM   3381 O  O   . VAL B 1 89  ? -19.179 5.231   -8.561  1.00 51.38  ? 40  VAL B O   1 
ATOM   3382 C  CB  . VAL B 1 89  ? -20.726 2.574   -9.554  1.00 46.63  ? 40  VAL B CB  1 
ATOM   3383 C  CG1 . VAL B 1 89  ? -20.916 1.523   -10.638 1.00 41.01  ? 40  VAL B CG1 1 
ATOM   3384 C  CG2 . VAL B 1 89  ? -19.602 2.177   -8.593  1.00 45.76  ? 40  VAL B CG2 1 
ATOM   3385 N  N   . GLY B 1 90  ? -21.433 5.489   -8.551  1.00 50.59  ? 41  GLY B N   1 
ATOM   3386 C  CA  . GLY B 1 90  ? -21.463 6.282   -7.338  1.00 48.94  ? 41  GLY B CA  1 
ATOM   3387 C  C   . GLY B 1 90  ? -20.841 5.432   -6.262  1.00 52.09  ? 41  GLY B C   1 
ATOM   3388 O  O   . GLY B 1 90  ? -21.166 4.247   -6.148  1.00 56.62  ? 41  GLY B O   1 
ATOM   3389 N  N   . ALA B 1 91  ? -19.920 6.020   -5.497  1.00 55.45  ? 42  ALA B N   1 
ATOM   3390 C  CA  . ALA B 1 91  ? -19.233 5.291   -4.420  1.00 56.59  ? 42  ALA B CA  1 
ATOM   3391 C  C   . ALA B 1 91  ? -19.157 6.082   -3.132  1.00 56.02  ? 42  ALA B C   1 
ATOM   3392 O  O   . ALA B 1 91  ? -18.355 5.754   -2.274  1.00 62.08  ? 42  ALA B O   1 
ATOM   3393 C  CB  . ALA B 1 91  ? -17.833 4.885   -4.858  1.00 55.48  ? 42  ALA B CB  1 
ATOM   3394 N  N   . ALA B 1 92  ? -19.978 7.125   -3.018  1.00 59.53  ? 43  ALA B N   1 
ATOM   3395 C  CA  . ALA B 1 92  ? -20.039 8.012   -1.845  1.00 65.12  ? 43  ALA B CA  1 
ATOM   3396 C  C   . ALA B 1 92  ? -21.394 8.743   -1.867  1.00 71.65  ? 43  ALA B C   1 
ATOM   3397 O  O   . ALA B 1 92  ? -21.982 8.890   -2.945  1.00 80.07  ? 43  ALA B O   1 
ATOM   3398 C  CB  . ALA B 1 92  ? -18.874 9.001   -1.848  1.00 56.83  ? 43  ALA B CB  1 
ATOM   3399 N  N   . PRO B 1 93  ? -21.906 9.192   -0.692  1.00 73.82  ? 44  PRO B N   1 
ATOM   3400 C  CA  . PRO B 1 93  ? -23.249 9.798   -0.699  1.00 67.49  ? 44  PRO B CA  1 
ATOM   3401 C  C   . PRO B 1 93  ? -23.375 11.038  -1.592  1.00 64.09  ? 44  PRO B C   1 
ATOM   3402 O  O   . PRO B 1 93  ? -22.454 11.854  -1.706  1.00 61.83  ? 44  PRO B O   1 
ATOM   3403 C  CB  . PRO B 1 93  ? -23.484 10.168  0.775   1.00 68.42  ? 44  PRO B CB  1 
ATOM   3404 C  CG  . PRO B 1 93  ? -22.555 9.290   1.546   1.00 70.09  ? 44  PRO B CG  1 
ATOM   3405 C  CD  . PRO B 1 93  ? -21.337 9.162   0.670   1.00 69.06  ? 44  PRO B CD  1 
ATOM   3406 N  N   . HIS B 1 94  ? -24.524 11.153  -2.235  1.00 62.97  ? 45  HIS B N   1 
ATOM   3407 C  CA  . HIS B 1 94  ? -24.844 12.300  -3.057  1.00 61.43  ? 45  HIS B CA  1 
ATOM   3408 C  C   . HIS B 1 94  ? -26.331 12.542  -2.871  1.00 64.56  ? 45  HIS B C   1 
ATOM   3409 O  O   . HIS B 1 94  ? -27.081 11.576  -2.655  1.00 62.43  ? 45  HIS B O   1 
ATOM   3410 C  CB  . HIS B 1 94  ? -24.547 11.993  -4.520  1.00 62.31  ? 45  HIS B CB  1 
ATOM   3411 C  CG  . HIS B 1 94  ? -24.701 13.178  -5.424  1.00 61.85  ? 45  HIS B CG  1 
ATOM   3412 N  ND1 . HIS B 1 94  ? -25.899 13.501  -6.033  1.00 61.26  ? 45  HIS B ND1 1 
ATOM   3413 C  CD2 . HIS B 1 94  ? -23.811 14.128  -5.811  1.00 58.86  ? 45  HIS B CD2 1 
ATOM   3414 C  CE1 . HIS B 1 94  ? -25.734 14.592  -6.767  1.00 60.58  ? 45  HIS B CE1 1 
ATOM   3415 N  NE2 . HIS B 1 94  ? -24.477 14.988  -6.653  1.00 61.19  ? 45  HIS B NE2 1 
ATOM   3416 N  N   . PRO B 1 95  ? -26.770 13.821  -2.929  1.00 63.92  ? 46  PRO B N   1 
ATOM   3417 C  CA  . PRO B 1 95  ? -28.208 14.096  -2.782  1.00 67.93  ? 46  PRO B CA  1 
ATOM   3418 C  C   . PRO B 1 95  ? -29.115 13.350  -3.794  1.00 72.98  ? 46  PRO B C   1 
ATOM   3419 O  O   . PRO B 1 95  ? -30.233 12.964  -3.421  1.00 72.94  ? 46  PRO B O   1 
ATOM   3420 C  CB  . PRO B 1 95  ? -28.308 15.618  -2.959  1.00 66.87  ? 46  PRO B CB  1 
ATOM   3421 C  CG  . PRO B 1 95  ? -26.952 16.132  -2.598  1.00 65.64  ? 46  PRO B CG  1 
ATOM   3422 C  CD  . PRO B 1 95  ? -25.980 15.068  -3.030  1.00 64.11  ? 46  PRO B CD  1 
ATOM   3423 N  N   . PHE B 1 96  ? -28.657 13.113  -5.031  1.00 69.46  ? 47  PHE B N   1 
ATOM   3424 C  CA  . PHE B 1 96  ? -29.507 12.372  -5.989  1.00 69.51  ? 47  PHE B CA  1 
ATOM   3425 C  C   . PHE B 1 96  ? -29.255 10.863  -6.076  1.00 67.05  ? 47  PHE B C   1 
ATOM   3426 O  O   . PHE B 1 96  ? -29.863 10.181  -6.896  1.00 69.10  ? 47  PHE B O   1 
ATOM   3427 C  CB  . PHE B 1 96  ? -29.525 13.010  -7.383  1.00 65.99  ? 47  PHE B CB  1 
ATOM   3428 C  CG  . PHE B 1 96  ? -29.857 14.480  -7.375  1.00 69.33  ? 47  PHE B CG  1 
ATOM   3429 C  CD1 . PHE B 1 96  ? -30.864 14.994  -6.547  1.00 72.30  ? 47  PHE B CD1 1 
ATOM   3430 C  CD2 . PHE B 1 96  ? -29.171 15.355  -8.216  1.00 67.81  ? 47  PHE B CD2 1 
ATOM   3431 C  CE1 . PHE B 1 96  ? -31.159 16.355  -6.543  1.00 74.38  ? 47  PHE B CE1 1 
ATOM   3432 C  CE2 . PHE B 1 96  ? -29.466 16.713  -8.221  1.00 71.42  ? 47  PHE B CE2 1 
ATOM   3433 C  CZ  . PHE B 1 96  ? -30.461 17.214  -7.382  1.00 72.34  ? 47  PHE B CZ  1 
ATOM   3434 N  N   . LEU B 1 97  ? -28.388 10.341  -5.214  1.00 64.43  ? 48  LEU B N   1 
ATOM   3435 C  CA  . LEU B 1 97  ? -28.168 8.901   -5.142  1.00 60.96  ? 48  LEU B CA  1 
ATOM   3436 C  C   . LEU B 1 97  ? -28.940 8.291   -3.987  1.00 62.55  ? 48  LEU B C   1 
ATOM   3437 O  O   . LEU B 1 97  ? -28.770 8.700   -2.837  1.00 64.16  ? 48  LEU B O   1 
ATOM   3438 C  CB  . LEU B 1 97  ? -26.674 8.579   -5.010  1.00 61.43  ? 48  LEU B CB  1 
ATOM   3439 C  CG  . LEU B 1 97  ? -25.855 8.684   -6.298  1.00 64.12  ? 48  LEU B CG  1 
ATOM   3440 C  CD1 . LEU B 1 97  ? -24.368 8.489   -6.031  1.00 63.09  ? 48  LEU B CD1 1 
ATOM   3441 C  CD2 . LEU B 1 97  ? -26.360 7.691   -7.337  1.00 62.46  ? 48  LEU B CD2 1 
ATOM   3442 N  N   . HIS B 1 98  ? -29.783 7.310   -4.303  1.00 69.30  ? 49  HIS B N   1 
ATOM   3443 C  CA  . HIS B 1 98  ? -30.531 6.566   -3.288  1.00 75.25  ? 49  HIS B CA  1 
ATOM   3444 C  C   . HIS B 1 98  ? -29.629 5.527   -2.651  1.00 69.61  ? 49  HIS B C   1 
ATOM   3445 O  O   . HIS B 1 98  ? -29.967 4.974   -1.608  1.00 69.97  ? 49  HIS B O   1 
ATOM   3446 C  CB  . HIS B 1 98  ? -31.748 5.832   -3.890  1.00 88.24  ? 49  HIS B CB  1 
ATOM   3447 C  CG  . HIS B 1 98  ? -32.800 6.736   -4.476  1.00 102.02 ? 49  HIS B CG  1 
ATOM   3448 N  ND1 . HIS B 1 98  ? -33.558 7.602   -3.712  1.00 103.01 ? 49  HIS B ND1 1 
ATOM   3449 C  CD2 . HIS B 1 98  ? -33.252 6.868   -5.753  1.00 103.37 ? 49  HIS B CD2 1 
ATOM   3450 C  CE1 . HIS B 1 98  ? -34.410 8.248   -4.496  1.00 105.88 ? 49  HIS B CE1 1 
ATOM   3451 N  NE2 . HIS B 1 98  ? -34.244 7.822   -5.739  1.00 104.17 ? 49  HIS B NE2 1 
ATOM   3452 N  N   . ARG B 1 99  ? -28.509 5.240   -3.317  1.00 69.51  ? 50  ARG B N   1 
ATOM   3453 C  CA  . ARG B 1 99  ? -27.543 4.193   -2.913  1.00 64.62  ? 50  ARG B CA  1 
ATOM   3454 C  C   . ARG B 1 99  ? -26.235 4.284   -3.721  1.00 63.32  ? 50  ARG B C   1 
ATOM   3455 O  O   . ARG B 1 99  ? -26.168 4.985   -4.737  1.00 58.89  ? 50  ARG B O   1 
ATOM   3456 C  CB  . ARG B 1 99  ? -28.146 2.782   -3.032  1.00 62.96  ? 50  ARG B CB  1 
ATOM   3457 C  CG  . ARG B 1 99  ? -28.462 2.343   -4.451  1.00 60.24  ? 50  ARG B CG  1 
ATOM   3458 C  CD  . ARG B 1 99  ? -29.110 0.972   -4.481  1.00 57.46  ? 50  ARG B CD  1 
ATOM   3459 N  NE  . ARG B 1 99  ? -29.675 0.729   -5.803  1.00 57.77  ? 50  ARG B NE  1 
ATOM   3460 C  CZ  . ARG B 1 99  ? -30.442 -0.308  -6.132  1.00 55.75  ? 50  ARG B CZ  1 
ATOM   3461 N  NH1 . ARG B 1 99  ? -30.764 -1.225  -5.223  1.00 54.13  ? 50  ARG B NH1 1 
ATOM   3462 N  NH2 . ARG B 1 99  ? -30.894 -0.419  -7.375  1.00 52.96  ? 50  ARG B NH2 1 
ATOM   3463 N  N   . TYR B 1 100 ? -25.208 3.579   -3.250  1.00 58.69  ? 51  TYR B N   1 
ATOM   3464 C  CA  . TYR B 1 100 ? -23.884 3.639   -3.854  1.00 58.40  ? 51  TYR B CA  1 
ATOM   3465 C  C   . TYR B 1 100 ? -23.008 2.433   -3.496  1.00 56.83  ? 51  TYR B C   1 
ATOM   3466 O  O   . TYR B 1 100 ? -23.309 1.671   -2.575  1.00 56.73  ? 51  TYR B O   1 
ATOM   3467 C  CB  . TYR B 1 100 ? -23.183 4.954   -3.494  1.00 62.44  ? 51  TYR B CB  1 
ATOM   3468 C  CG  . TYR B 1 100 ? -23.049 5.223   -2.011  1.00 68.06  ? 51  TYR B CG  1 
ATOM   3469 C  CD1 . TYR B 1 100 ? -24.095 5.801   -1.289  1.00 70.46  ? 51  TYR B CD1 1 
ATOM   3470 C  CD2 . TYR B 1 100 ? -21.866 4.914   -1.329  1.00 67.23  ? 51  TYR B CD2 1 
ATOM   3471 C  CE1 . TYR B 1 100 ? -23.971 6.055   0.068   1.00 73.44  ? 51  TYR B CE1 1 
ATOM   3472 C  CE2 . TYR B 1 100 ? -21.728 5.162   0.024   1.00 68.77  ? 51  TYR B CE2 1 
ATOM   3473 C  CZ  . TYR B 1 100 ? -22.783 5.732   0.715   1.00 73.73  ? 51  TYR B CZ  1 
ATOM   3474 O  OH  . TYR B 1 100 ? -22.655 5.973   2.057   1.00 73.11  ? 51  TYR B OH  1 
ATOM   3475 N  N   . TYR B 1 101 ? -21.935 2.264   -4.256  1.00 51.58  ? 52  TYR B N   1 
ATOM   3476 C  CA  . TYR B 1 101 ? -20.943 1.223   -4.034  1.00 50.99  ? 52  TYR B CA  1 
ATOM   3477 C  C   . TYR B 1 101 ? -20.169 1.507   -2.761  1.00 53.70  ? 52  TYR B C   1 
ATOM   3478 O  O   . TYR B 1 101 ? -19.580 2.600   -2.609  1.00 53.50  ? 52  TYR B O   1 
ATOM   3479 C  CB  . TYR B 1 101 ? -19.966 1.257   -5.202  1.00 49.50  ? 52  TYR B CB  1 
ATOM   3480 C  CG  . TYR B 1 101 ? -18.864 0.216   -5.247  1.00 42.84  ? 52  TYR B CG  1 
ATOM   3481 C  CD1 . TYR B 1 101 ? -19.030 -1.049  -4.681  1.00 42.93  ? 52  TYR B CD1 1 
ATOM   3482 C  CD2 . TYR B 1 101 ? -17.680 0.488   -5.940  1.00 40.68  ? 52  TYR B CD2 1 
ATOM   3483 C  CE1 . TYR B 1 101 ? -18.037 -2.009  -4.783  1.00 42.37  ? 52  TYR B CE1 1 
ATOM   3484 C  CE2 . TYR B 1 101 ? -16.683 -0.454  -6.056  1.00 40.52  ? 52  TYR B CE2 1 
ATOM   3485 C  CZ  . TYR B 1 101 ? -16.856 -1.698  -5.475  1.00 43.57  ? 52  TYR B CZ  1 
ATOM   3486 O  OH  . TYR B 1 101 ? -15.833 -2.616  -5.580  1.00 42.35  ? 52  TYR B OH  1 
ATOM   3487 N  N   . GLN B 1 102 ? -20.151 0.528   -1.857  1.00 53.57  ? 53  GLN B N   1 
ATOM   3488 C  CA  . GLN B 1 102 ? -19.361 0.645   -0.628  1.00 53.75  ? 53  GLN B CA  1 
ATOM   3489 C  C   . GLN B 1 102 ? -18.221 -0.351  -0.659  1.00 51.37  ? 53  GLN B C   1 
ATOM   3490 O  O   . GLN B 1 102 ? -18.399 -1.521  -0.311  1.00 51.71  ? 53  GLN B O   1 
ATOM   3491 C  CB  . GLN B 1 102 ? -20.250 0.419   0.586   1.00 55.58  ? 53  GLN B CB  1 
ATOM   3492 C  CG  . GLN B 1 102 ? -21.403 1.396   0.652   1.00 60.48  ? 53  GLN B CG  1 
ATOM   3493 C  CD  . GLN B 1 102 ? -22.075 1.388   2.000   1.00 61.57  ? 53  GLN B CD  1 
ATOM   3494 O  OE1 . GLN B 1 102 ? -22.967 0.581   2.251   1.00 60.88  ? 53  GLN B OE1 1 
ATOM   3495 N  NE2 . GLN B 1 102 ? -21.658 2.297   2.873   1.00 61.33  ? 53  GLN B NE2 1 
ATOM   3496 N  N   . ARG B 1 103 ? -17.055 0.098   -1.103  1.00 50.11  ? 54  ARG B N   1 
ATOM   3497 C  CA  . ARG B 1 103 ? -15.907 -0.807  -1.269  1.00 51.12  ? 54  ARG B CA  1 
ATOM   3498 C  C   . ARG B 1 103 ? -15.480 -1.519  0.019   1.00 52.18  ? 54  ARG B C   1 
ATOM   3499 O  O   . ARG B 1 103 ? -15.134 -2.697  -0.008  1.00 53.37  ? 54  ARG B O   1 
ATOM   3500 C  CB  . ARG B 1 103 ? -14.724 -0.072  -1.893  1.00 50.00  ? 54  ARG B CB  1 
ATOM   3501 C  CG  . ARG B 1 103 ? -15.012 0.424   -3.304  1.00 46.19  ? 54  ARG B CG  1 
ATOM   3502 C  CD  . ARG B 1 103 ? -14.067 1.546   -3.724  1.00 47.34  ? 54  ARG B CD  1 
ATOM   3503 N  NE  . ARG B 1 103 ? -14.343 2.804   -3.032  1.00 50.98  ? 54  ARG B NE  1 
ATOM   3504 C  CZ  . ARG B 1 103 ? -13.601 3.906   -3.141  1.00 53.28  ? 54  ARG B CZ  1 
ATOM   3505 N  NH1 . ARG B 1 103 ? -12.525 3.931   -3.917  1.00 53.66  ? 54  ARG B NH1 1 
ATOM   3506 N  NH2 . ARG B 1 103 ? -13.933 4.991   -2.462  1.00 52.65  ? 54  ARG B NH2 1 
ATOM   3507 N  N   . GLN B 1 104 ? -15.534 -0.807  1.144   1.00 57.87  ? 55  GLN B N   1 
ATOM   3508 C  CA  . GLN B 1 104 ? -15.109 -1.341  2.449   1.00 57.43  ? 55  GLN B CA  1 
ATOM   3509 C  C   . GLN B 1 104 ? -16.022 -2.472  2.941   1.00 55.75  ? 55  GLN B C   1 
ATOM   3510 O  O   . GLN B 1 104 ? -15.690 -3.156  3.902   1.00 53.41  ? 55  GLN B O   1 
ATOM   3511 C  CB  . GLN B 1 104 ? -14.956 -0.211  3.497   1.00 59.85  ? 55  GLN B CB  1 
ATOM   3512 C  CG  . GLN B 1 104 ? -16.250 0.250   4.180   1.00 70.68  ? 55  GLN B CG  1 
ATOM   3513 C  CD  . GLN B 1 104 ? -17.206 1.082   3.298   1.00 77.90  ? 55  GLN B CD  1 
ATOM   3514 O  OE1 . GLN B 1 104 ? -16.922 1.389   2.125   1.00 68.49  ? 55  GLN B OE1 1 
ATOM   3515 N  NE2 . GLN B 1 104 ? -18.360 1.449   3.876   1.00 76.21  ? 55  GLN B NE2 1 
ATOM   3516 N  N   . LEU B 1 105 ? -17.151 -2.694  2.260   1.00 55.02  ? 56  LEU B N   1 
ATOM   3517 C  CA  . LEU B 1 105 ? -18.039 -3.818  2.593   1.00 48.87  ? 56  LEU B CA  1 
ATOM   3518 C  C   . LEU B 1 105 ? -17.892 -4.996  1.644   1.00 49.51  ? 56  LEU B C   1 
ATOM   3519 O  O   . LEU B 1 105 ? -18.579 -6.015  1.804   1.00 46.84  ? 56  LEU B O   1 
ATOM   3520 C  CB  . LEU B 1 105 ? -19.500 -3.388  2.660   1.00 46.80  ? 56  LEU B CB  1 
ATOM   3521 C  CG  . LEU B 1 105 ? -19.857 -2.339  3.707   1.00 50.91  ? 56  LEU B CG  1 
ATOM   3522 C  CD1 . LEU B 1 105 ? -21.367 -2.151  3.726   1.00 48.73  ? 56  LEU B CD1 1 
ATOM   3523 C  CD2 . LEU B 1 105 ? -19.330 -2.739  5.084   1.00 50.23  ? 56  LEU B CD2 1 
ATOM   3524 N  N   . SER B 1 106 ? -16.991 -4.864  0.671   1.00 47.89  ? 57  SER B N   1 
ATOM   3525 C  CA  . SER B 1 106 ? -16.767 -5.912  -0.311  1.00 44.86  ? 57  SER B CA  1 
ATOM   3526 C  C   . SER B 1 106 ? -15.451 -6.627  -0.036  1.00 45.74  ? 57  SER B C   1 
ATOM   3527 O  O   . SER B 1 106 ? -14.398 -6.015  -0.070  1.00 46.27  ? 57  SER B O   1 
ATOM   3528 C  CB  . SER B 1 106 ? -16.767 -5.335  -1.722  1.00 44.33  ? 57  SER B CB  1 
ATOM   3529 O  OG  . SER B 1 106 ? -16.436 -6.341  -2.664  1.00 44.21  ? 57  SER B OG  1 
ATOM   3530 N  N   . SER B 1 107 ? -15.522 -7.929  0.228   1.00 44.38  ? 58  SER B N   1 
ATOM   3531 C  CA  . SER B 1 107 ? -14.341 -8.721  0.510   1.00 42.96  ? 58  SER B CA  1 
ATOM   3532 C  C   . SER B 1 107 ? -13.467 -8.950  -0.737  1.00 43.02  ? 58  SER B C   1 
ATOM   3533 O  O   . SER B 1 107 ? -12.271 -9.283  -0.628  1.00 42.44  ? 58  SER B O   1 
ATOM   3534 C  CB  . SER B 1 107 ? -14.753 -10.053 1.124   1.00 44.60  ? 58  SER B CB  1 
ATOM   3535 O  OG  . SER B 1 107 ? -15.482 -10.799 0.179   1.00 45.49  ? 58  SER B OG  1 
ATOM   3536 N  N   . THR B 1 108 ? -14.054 -8.764  -1.916  1.00 42.15  ? 59  THR B N   1 
ATOM   3537 C  CA  . THR B 1 108 ? -13.346 -9.020  -3.181  1.00 41.02  ? 59  THR B CA  1 
ATOM   3538 C  C   . THR B 1 108 ? -12.850 -7.747  -3.878  1.00 43.99  ? 59  THR B C   1 
ATOM   3539 O  O   . THR B 1 108 ? -12.249 -7.815  -4.942  1.00 50.51  ? 59  THR B O   1 
ATOM   3540 C  CB  . THR B 1 108 ? -14.207 -9.843  -4.144  1.00 42.90  ? 59  THR B CB  1 
ATOM   3541 O  OG1 . THR B 1 108 ? -15.534 -9.318  -4.134  1.00 45.54  ? 59  THR B OG1 1 
ATOM   3542 C  CG2 . THR B 1 108 ? -14.272 -11.298 -3.709  1.00 41.29  ? 59  THR B CG2 1 
ATOM   3543 N  N   . TYR B 1 109 ? -13.092 -6.593  -3.262  1.00 48.11  ? 60  TYR B N   1 
ATOM   3544 C  CA  . TYR B 1 109 ? -12.630 -5.309  -3.782  1.00 47.97  ? 60  TYR B CA  1 
ATOM   3545 C  C   . TYR B 1 109 ? -11.103 -5.257  -3.859  1.00 48.09  ? 60  TYR B C   1 
ATOM   3546 O  O   . TYR B 1 109 ? -10.417 -5.642  -2.909  1.00 51.11  ? 60  TYR B O   1 
ATOM   3547 C  CB  . TYR B 1 109 ? -13.167 -4.160  -2.898  1.00 47.54  ? 60  TYR B CB  1 
ATOM   3548 C  CG  . TYR B 1 109 ? -12.446 -2.843  -3.092  1.00 51.62  ? 60  TYR B CG  1 
ATOM   3549 C  CD1 . TYR B 1 109 ? -12.519 -2.145  -4.314  1.00 47.18  ? 60  TYR B CD1 1 
ATOM   3550 C  CD2 . TYR B 1 109 ? -11.671 -2.290  -2.050  1.00 54.80  ? 60  TYR B CD2 1 
ATOM   3551 C  CE1 . TYR B 1 109 ? -11.844 -0.946  -4.495  1.00 45.92  ? 60  TYR B CE1 1 
ATOM   3552 C  CE2 . TYR B 1 109 ? -10.992 -1.084  -2.219  1.00 51.26  ? 60  TYR B CE2 1 
ATOM   3553 C  CZ  . TYR B 1 109 ? -11.080 -0.423  -3.440  1.00 50.60  ? 60  TYR B CZ  1 
ATOM   3554 O  OH  . TYR B 1 109 ? -10.393 0.755   -3.593  1.00 52.41  ? 60  TYR B OH  1 
ATOM   3555 N  N   . ARG B 1 110 ? -10.581 -4.773  -4.983  1.00 45.73  ? 61  ARG B N   1 
ATOM   3556 C  CA  . ARG B 1 110 ? -9.144  -4.528  -5.131  1.00 45.38  ? 61  ARG B CA  1 
ATOM   3557 C  C   . ARG B 1 110 ? -8.883  -3.076  -5.550  1.00 49.50  ? 61  ARG B C   1 
ATOM   3558 O  O   . ARG B 1 110 ? -9.461  -2.588  -6.516  1.00 51.31  ? 61  ARG B O   1 
ATOM   3559 C  CB  . ARG B 1 110 ? -8.537  -5.466  -6.166  1.00 41.77  ? 61  ARG B CB  1 
ATOM   3560 C  CG  . ARG B 1 110 ? -8.573  -6.943  -5.805  1.00 43.53  ? 61  ARG B CG  1 
ATOM   3561 C  CD  . ARG B 1 110 ? -8.080  -7.736  -7.002  1.00 41.60  ? 61  ARG B CD  1 
ATOM   3562 N  NE  . ARG B 1 110 ? -8.049  -9.171  -6.760  1.00 41.32  ? 61  ARG B NE  1 
ATOM   3563 C  CZ  . ARG B 1 110 ? -7.736  -10.080 -7.681  1.00 43.38  ? 61  ARG B CZ  1 
ATOM   3564 N  NH1 . ARG B 1 110 ? -7.428  -9.699  -8.928  1.00 41.97  ? 61  ARG B NH1 1 
ATOM   3565 N  NH2 . ARG B 1 110 ? -7.737  -11.378 -7.355  1.00 39.32  ? 61  ARG B NH2 1 
ATOM   3566 N  N   . ASP B 1 111 ? -8.007  -2.400  -4.816  1.00 49.44  ? 62  ASP B N   1 
ATOM   3567 C  CA  . ASP B 1 111 ? -7.659  -1.002  -5.063  1.00 50.50  ? 62  ASP B CA  1 
ATOM   3568 C  C   . ASP B 1 111 ? -6.535  -0.907  -6.112  1.00 51.37  ? 62  ASP B C   1 
ATOM   3569 O  O   . ASP B 1 111 ? -5.481  -1.524  -5.966  1.00 54.40  ? 62  ASP B O   1 
ATOM   3570 C  CB  . ASP B 1 111 ? -7.215  -0.388  -3.730  1.00 50.30  ? 62  ASP B CB  1 
ATOM   3571 C  CG  . ASP B 1 111 ? -7.107  1.133   -3.759  1.00 52.13  ? 62  ASP B CG  1 
ATOM   3572 O  OD1 . ASP B 1 111 ? -7.195  1.775   -4.834  1.00 53.42  ? 62  ASP B OD1 1 
ATOM   3573 O  OD2 . ASP B 1 111 ? -6.903  1.691   -2.660  1.00 51.38  ? 62  ASP B OD2 1 
ATOM   3574 N  N   . LEU B 1 112 ? -6.766  -0.147  -7.176  1.00 53.11  ? 63  LEU B N   1 
ATOM   3575 C  CA  . LEU B 1 112 ? -5.735  0.082   -8.189  1.00 49.76  ? 63  LEU B CA  1 
ATOM   3576 C  C   . LEU B 1 112 ? -4.846  1.278   -7.860  1.00 49.22  ? 63  LEU B C   1 
ATOM   3577 O  O   . LEU B 1 112 ? -3.895  1.541   -8.585  1.00 53.18  ? 63  LEU B O   1 
ATOM   3578 C  CB  . LEU B 1 112 ? -6.332  0.198   -9.611  1.00 46.43  ? 63  LEU B CB  1 
ATOM   3579 C  CG  . LEU B 1 112 ? -6.803  -1.114  -10.257 1.00 47.18  ? 63  LEU B CG  1 
ATOM   3580 C  CD1 . LEU B 1 112 ? -7.667  -0.842  -11.474 1.00 45.47  ? 63  LEU B CD1 1 
ATOM   3581 C  CD2 . LEU B 1 112 ? -5.659  -2.079  -10.599 1.00 47.17  ? 63  LEU B CD2 1 
ATOM   3582 N  N   . ARG B 1 113 ? -5.145  1.988   -6.769  1.00 48.71  ? 64  ARG B N   1 
ATOM   3583 C  CA  . ARG B 1 113 ? -4.334  3.141   -6.311  1.00 54.73  ? 64  ARG B CA  1 
ATOM   3584 C  C   . ARG B 1 113 ? -4.078  4.171   -7.407  1.00 55.01  ? 64  ARG B C   1 
ATOM   3585 O  O   . ARG B 1 113 ? -2.957  4.680   -7.512  1.00 55.98  ? 64  ARG B O   1 
ATOM   3586 C  CB  . ARG B 1 113 ? -2.957  2.716   -5.787  1.00 54.05  ? 64  ARG B CB  1 
ATOM   3587 C  CG  . ARG B 1 113 ? -2.855  2.180   -4.371  1.00 57.85  ? 64  ARG B CG  1 
ATOM   3588 C  CD  . ARG B 1 113 ? -1.385  2.138   -3.924  1.00 62.23  ? 64  ARG B CD  1 
ATOM   3589 N  NE  . ARG B 1 113 ? -0.468  1.749   -5.015  1.00 66.13  ? 64  ARG B NE  1 
ATOM   3590 C  CZ  . ARG B 1 113 ? 0.531   2.499   -5.510  1.00 63.77  ? 64  ARG B CZ  1 
ATOM   3591 N  NH1 . ARG B 1 113 ? 0.812   3.707   -5.011  1.00 59.93  ? 64  ARG B NH1 1 
ATOM   3592 N  NH2 . ARG B 1 113 ? 1.268   2.028   -6.513  1.00 58.05  ? 64  ARG B NH2 1 
ATOM   3593 N  N   . LYS B 1 114 ? -5.089  4.445   -8.232  1.00 53.43  ? 65  LYS B N   1 
ATOM   3594 C  CA  . LYS B 1 114 ? -4.994  5.475   -9.269  1.00 55.27  ? 65  LYS B CA  1 
ATOM   3595 C  C   . LYS B 1 114 ? -6.271  6.278   -9.329  1.00 55.94  ? 65  LYS B C   1 
ATOM   3596 O  O   . LYS B 1 114 ? -7.367  5.714   -9.265  1.00 59.30  ? 65  LYS B O   1 
ATOM   3597 C  CB  . LYS B 1 114 ? -4.696  4.888   -10.652 1.00 55.11  ? 65  LYS B CB  1 
ATOM   3598 C  CG  . LYS B 1 114 ? -4.032  5.910   -11.545 1.00 61.44  ? 65  LYS B CG  1 
ATOM   3599 C  CD  . LYS B 1 114 ? -3.903  5.468   -12.987 1.00 71.99  ? 65  LYS B CD  1 
ATOM   3600 C  CE  . LYS B 1 114 ? -3.374  6.644   -13.797 1.00 77.12  ? 65  LYS B CE  1 
ATOM   3601 N  NZ  . LYS B 1 114 ? -3.194  6.329   -15.241 1.00 85.74  ? 65  LYS B NZ  1 
ATOM   3602 N  N   . GLY B 1 115 ? -6.118  7.596   -9.421  1.00 58.19  ? 66  GLY B N   1 
ATOM   3603 C  CA  . GLY B 1 115 ? -7.245  8.502   -9.603  1.00 57.70  ? 66  GLY B CA  1 
ATOM   3604 C  C   . GLY B 1 115 ? -7.583  8.626   -11.074 1.00 61.20  ? 66  GLY B C   1 
ATOM   3605 O  O   . GLY B 1 115 ? -6.777  8.256   -11.933 1.00 68.01  ? 66  GLY B O   1 
ATOM   3606 N  N   . VAL B 1 116 ? -8.784  9.115   -11.363 1.00 59.28  ? 67  VAL B N   1 
ATOM   3607 C  CA  . VAL B 1 116 ? -9.220  9.390   -12.735 1.00 62.44  ? 67  VAL B CA  1 
ATOM   3608 C  C   . VAL B 1 116 ? -10.093 10.649  -12.753 1.00 70.87  ? 67  VAL B C   1 
ATOM   3609 O  O   . VAL B 1 116 ? -11.004 10.805  -11.925 1.00 73.85  ? 67  VAL B O   1 
ATOM   3610 C  CB  . VAL B 1 116 ? -9.930  8.175   -13.392 1.00 59.25  ? 67  VAL B CB  1 
ATOM   3611 C  CG1 . VAL B 1 116 ? -11.146 7.727   -12.593 1.00 57.44  ? 67  VAL B CG1 1 
ATOM   3612 C  CG2 . VAL B 1 116 ? -10.300 8.479   -14.836 1.00 58.23  ? 67  VAL B CG2 1 
ATOM   3613 N  N   . TYR B 1 117 ? -9.797  11.564  -13.669 1.00 72.40  ? 68  TYR B N   1 
ATOM   3614 C  CA  . TYR B 1 117 ? -10.558 12.796  -13.738 1.00 70.71  ? 68  TYR B CA  1 
ATOM   3615 C  C   . TYR B 1 117 ? -11.225 12.880  -15.109 1.00 69.04  ? 68  TYR B C   1 
ATOM   3616 O  O   . TYR B 1 117 ? -10.552 12.969  -16.126 1.00 74.59  ? 68  TYR B O   1 
ATOM   3617 C  CB  . TYR B 1 117 ? -9.669  14.006  -13.390 1.00 75.38  ? 68  TYR B CB  1 
ATOM   3618 C  CG  . TYR B 1 117 ? -10.311 15.358  -13.660 1.00 84.53  ? 68  TYR B CG  1 
ATOM   3619 C  CD1 . TYR B 1 117 ? -11.413 15.800  -12.909 1.00 82.01  ? 68  TYR B CD1 1 
ATOM   3620 C  CD2 . TYR B 1 117 ? -9.818  16.196  -14.680 1.00 85.80  ? 68  TYR B CD2 1 
ATOM   3621 C  CE1 . TYR B 1 117 ? -12.008 17.025  -13.172 1.00 81.44  ? 68  TYR B CE1 1 
ATOM   3622 C  CE2 . TYR B 1 117 ? -10.407 17.422  -14.948 1.00 81.49  ? 68  TYR B CE2 1 
ATOM   3623 C  CZ  . TYR B 1 117 ? -11.499 17.827  -14.194 1.00 81.79  ? 68  TYR B CZ  1 
ATOM   3624 O  OH  . TYR B 1 117 ? -12.082 19.037  -14.458 1.00 80.61  ? 68  TYR B OH  1 
ATOM   3625 N  N   . VAL B 1 118 ? -12.554 12.816  -15.122 1.00 66.51  ? 69  VAL B N   1 
ATOM   3626 C  CA  . VAL B 1 118 ? -13.337 12.764  -16.363 1.00 66.28  ? 69  VAL B CA  1 
ATOM   3627 C  C   . VAL B 1 118 ? -14.217 14.016  -16.550 1.00 70.87  ? 69  VAL B C   1 
ATOM   3628 O  O   . VAL B 1 118 ? -15.326 14.090  -16.015 1.00 73.29  ? 69  VAL B O   1 
ATOM   3629 C  CB  . VAL B 1 118 ? -14.231 11.500  -16.400 1.00 65.05  ? 69  VAL B CB  1 
ATOM   3630 C  CG1 . VAL B 1 118 ? -15.034 11.452  -17.674 1.00 59.08  ? 69  VAL B CG1 1 
ATOM   3631 C  CG2 . VAL B 1 118 ? -13.395 10.236  -16.280 1.00 63.08  ? 69  VAL B CG2 1 
ATOM   3632 N  N   . PRO B 1 119 ? -13.724 15.020  -17.293 1.00 71.31  ? 70  PRO B N   1 
ATOM   3633 C  CA  . PRO B 1 119 ? -14.573 16.178  -17.557 1.00 70.37  ? 70  PRO B CA  1 
ATOM   3634 C  C   . PRO B 1 119 ? -15.195 16.131  -18.955 1.00 68.12  ? 70  PRO B C   1 
ATOM   3635 O  O   . PRO B 1 119 ? -14.499 15.842  -19.920 1.00 70.90  ? 70  PRO B O   1 
ATOM   3636 C  CB  . PRO B 1 119 ? -13.588 17.340  -17.448 1.00 70.83  ? 70  PRO B CB  1 
ATOM   3637 C  CG  . PRO B 1 119 ? -12.270 16.760  -17.896 1.00 71.23  ? 70  PRO B CG  1 
ATOM   3638 C  CD  . PRO B 1 119 ? -12.325 15.261  -17.702 1.00 69.48  ? 70  PRO B CD  1 
ATOM   3639 N  N   . TYR B 1 120 ? -16.496 16.388  -19.054 1.00 70.21  ? 71  TYR B N   1 
ATOM   3640 C  CA  . TYR B 1 120 ? -17.175 16.492  -20.357 1.00 73.27  ? 71  TYR B CA  1 
ATOM   3641 C  C   . TYR B 1 120 ? -17.691 17.901  -20.543 1.00 78.08  ? 71  TYR B C   1 
ATOM   3642 O  O   . TYR B 1 120 ? -17.502 18.750  -19.676 1.00 85.10  ? 71  TYR B O   1 
ATOM   3643 C  CB  . TYR B 1 120 ? -18.393 15.571  -20.463 1.00 72.19  ? 71  TYR B CB  1 
ATOM   3644 C  CG  . TYR B 1 120 ? -18.340 14.249  -19.735 1.00 70.78  ? 71  TYR B CG  1 
ATOM   3645 C  CD1 . TYR B 1 120 ? -17.418 13.254  -20.108 1.00 67.61  ? 71  TYR B CD1 1 
ATOM   3646 C  CD2 . TYR B 1 120 ? -19.259 13.963  -18.706 1.00 70.65  ? 71  TYR B CD2 1 
ATOM   3647 C  CE1 . TYR B 1 120 ? -17.389 12.022  -19.462 1.00 66.30  ? 71  TYR B CE1 1 
ATOM   3648 C  CE2 . TYR B 1 120 ? -19.238 12.731  -18.047 1.00 69.87  ? 71  TYR B CE2 1 
ATOM   3649 C  CZ  . TYR B 1 120 ? -18.299 11.766  -18.429 1.00 70.36  ? 71  TYR B CZ  1 
ATOM   3650 O  OH  . TYR B 1 120 ? -18.275 10.542  -17.794 1.00 72.78  ? 71  TYR B OH  1 
ATOM   3651 N  N   . THR B 1 121 ? -18.379 18.142  -21.657 1.00 82.83  ? 72  THR B N   1 
ATOM   3652 C  CA  . THR B 1 121 ? -19.000 19.443  -21.905 1.00 86.75  ? 72  THR B CA  1 
ATOM   3653 C  C   . THR B 1 121 ? -20.090 19.725  -20.878 1.00 87.38  ? 72  THR B C   1 
ATOM   3654 O  O   . THR B 1 121 ? -20.027 20.720  -20.167 1.00 91.38  ? 72  THR B O   1 
ATOM   3655 C  CB  . THR B 1 121 ? -19.573 19.544  -23.334 1.00 83.99  ? 72  THR B CB  1 
ATOM   3656 O  OG1 . THR B 1 121 ? -18.535 19.233  -24.264 1.00 88.68  ? 72  THR B OG1 1 
ATOM   3657 C  CG2 . THR B 1 121 ? -20.092 20.953  -23.632 1.00 78.81  ? 72  THR B CG2 1 
ATOM   3658 N  N   . GLN B 1 122 ? -21.072 18.836  -20.789 1.00 95.41  ? 73  GLN B N   1 
ATOM   3659 C  CA  . GLN B 1 122 ? -22.247 19.090  -19.963 1.00 101.27 ? 73  GLN B CA  1 
ATOM   3660 C  C   . GLN B 1 122 ? -22.158 18.468  -18.556 1.00 96.75  ? 73  GLN B C   1 
ATOM   3661 O  O   . GLN B 1 122 ? -23.170 17.999  -18.000 1.00 104.60 ? 73  GLN B O   1 
ATOM   3662 C  CB  . GLN B 1 122 ? -23.529 18.642  -20.705 1.00 109.20 ? 73  GLN B CB  1 
ATOM   3663 C  CG  . GLN B 1 122 ? -23.826 19.388  -22.016 1.00 122.61 ? 73  GLN B CG  1 
ATOM   3664 C  CD  . GLN B 1 122 ? -24.096 20.896  -21.820 1.00 132.63 ? 73  GLN B CD  1 
ATOM   3665 O  OE1 . GLN B 1 122 ? -24.551 21.341  -20.736 1.00 139.23 ? 73  GLN B OE1 1 
ATOM   3666 N  NE2 . GLN B 1 122 ? -23.822 21.684  -22.895 1.00 133.35 ? 73  GLN B NE2 1 
ATOM   3667 N  N   . GLY B 1 123 ? -20.960 18.467  -17.970 1.00 86.15  ? 74  GLY B N   1 
ATOM   3668 C  CA  . GLY B 1 123 ? -20.777 17.901  -16.630 1.00 82.77  ? 74  GLY B CA  1 
ATOM   3669 C  C   . GLY B 1 123 ? -19.432 17.232  -16.417 1.00 84.35  ? 74  GLY B C   1 
ATOM   3670 O  O   . GLY B 1 123 ? -18.580 17.247  -17.310 1.00 84.97  ? 74  GLY B O   1 
ATOM   3671 N  N   . LYS B 1 124 ? -19.239 16.651  -15.227 1.00 83.33  ? 75  LYS B N   1 
ATOM   3672 C  CA  . LYS B 1 124 ? -17.986 15.956  -14.871 1.00 84.75  ? 75  LYS B CA  1 
ATOM   3673 C  C   . LYS B 1 124 ? -18.064 15.065  -13.629 1.00 81.05  ? 75  LYS B C   1 
ATOM   3674 O  O   . LYS B 1 124 ? -18.897 15.273  -12.750 1.00 80.74  ? 75  LYS B O   1 
ATOM   3675 C  CB  . LYS B 1 124 ? -16.810 16.944  -14.730 1.00 83.93  ? 75  LYS B CB  1 
ATOM   3676 C  CG  . LYS B 1 124 ? -16.977 18.022  -13.674 1.00 87.88  ? 75  LYS B CG  1 
ATOM   3677 C  CD  . LYS B 1 124 ? -16.533 19.369  -14.228 1.00 91.74  ? 75  LYS B CD  1 
ATOM   3678 C  CE  . LYS B 1 124 ? -16.195 20.352  -13.120 1.00 95.97  ? 75  LYS B CE  1 
ATOM   3679 N  NZ  . LYS B 1 124 ? -14.825 20.104  -12.581 1.00 96.05  ? 75  LYS B NZ  1 
ATOM   3680 N  N   . TRP B 1 125 ? -17.191 14.061  -13.585 1.00 80.84  ? 76  TRP B N   1 
ATOM   3681 C  CA  . TRP B 1 125 ? -16.914 13.332  -12.350 1.00 76.45  ? 76  TRP B CA  1 
ATOM   3682 C  C   . TRP B 1 125 ? -15.430 13.119  -12.087 1.00 76.54  ? 76  TRP B C   1 
ATOM   3683 O  O   . TRP B 1 125 ? -14.577 13.401  -12.927 1.00 81.26  ? 76  TRP B O   1 
ATOM   3684 C  CB  . TRP B 1 125 ? -17.671 12.003  -12.279 1.00 72.30  ? 76  TRP B CB  1 
ATOM   3685 C  CG  . TRP B 1 125 ? -17.498 11.068  -13.433 1.00 69.95  ? 76  TRP B CG  1 
ATOM   3686 C  CD1 . TRP B 1 125 ? -18.229 11.054  -14.576 1.00 67.48  ? 76  TRP B CD1 1 
ATOM   3687 C  CD2 . TRP B 1 125 ? -16.574 9.966   -13.532 1.00 68.81  ? 76  TRP B CD2 1 
ATOM   3688 N  NE1 . TRP B 1 125 ? -17.812 10.031  -15.393 1.00 70.14  ? 76  TRP B NE1 1 
ATOM   3689 C  CE2 . TRP B 1 125 ? -16.801 9.345   -14.777 1.00 66.79  ? 76  TRP B CE2 1 
ATOM   3690 C  CE3 . TRP B 1 125 ? -15.573 9.454   -12.694 1.00 64.35  ? 76  TRP B CE3 1 
ATOM   3691 C  CZ2 . TRP B 1 125 ? -16.071 8.232   -15.210 1.00 62.58  ? 76  TRP B CZ2 1 
ATOM   3692 C  CZ3 . TRP B 1 125 ? -14.847 8.350   -13.127 1.00 62.62  ? 76  TRP B CZ3 1 
ATOM   3693 C  CH2 . TRP B 1 125 ? -15.100 7.753   -14.375 1.00 60.37  ? 76  TRP B CH2 1 
ATOM   3694 N  N   . GLU B 1 126 ? -15.139 12.624  -10.895 1.00 73.20  ? 77  GLU B N   1 
ATOM   3695 C  CA  . GLU B 1 126 ? -13.797 12.320  -10.486 1.00 70.07  ? 77  GLU B CA  1 
ATOM   3696 C  C   . GLU B 1 126 ? -13.918 11.030  -9.689  1.00 68.87  ? 77  GLU B C   1 
ATOM   3697 O  O   . GLU B 1 126 ? -14.918 10.827  -8.997  1.00 71.33  ? 77  GLU B O   1 
ATOM   3698 C  CB  . GLU B 1 126 ? -13.299 13.454  -9.609  1.00 78.63  ? 77  GLU B CB  1 
ATOM   3699 C  CG  . GLU B 1 126 ? -11.794 13.594  -9.528  1.00 89.47  ? 77  GLU B CG  1 
ATOM   3700 C  CD  . GLU B 1 126 ? -11.406 14.860  -8.806  1.00 97.11  ? 77  GLU B CD  1 
ATOM   3701 O  OE1 . GLU B 1 126 ? -10.710 15.698  -9.420  1.00 102.09 ? 77  GLU B OE1 1 
ATOM   3702 O  OE2 . GLU B 1 126 ? -11.822 15.027  -7.636  1.00 98.31  ? 77  GLU B OE2 1 
ATOM   3703 N  N   . GLY B 1 127 ? -12.931 10.145  -9.784  1.00 63.05  ? 78  GLY B N   1 
ATOM   3704 C  CA  . GLY B 1 127 ? -13.019 8.890   -9.054  1.00 60.06  ? 78  GLY B CA  1 
ATOM   3705 C  C   . GLY B 1 127 ? -11.741 8.170   -8.675  1.00 60.66  ? 78  GLY B C   1 
ATOM   3706 O  O   . GLY B 1 127 ? -10.640 8.673   -8.862  1.00 61.50  ? 78  GLY B O   1 
ATOM   3707 N  N   . GLU B 1 128 ? -11.914 6.971   -8.130  1.00 58.21  ? 79  GLU B N   1 
ATOM   3708 C  CA  . GLU B 1 128 ? -10.806 6.116   -7.720  1.00 55.75  ? 79  GLU B CA  1 
ATOM   3709 C  C   . GLU B 1 128 ? -10.971 4.739   -8.362  1.00 52.07  ? 79  GLU B C   1 
ATOM   3710 O  O   . GLU B 1 128 ? -12.008 4.079   -8.213  1.00 50.84  ? 79  GLU B O   1 
ATOM   3711 C  CB  . GLU B 1 128 ? -10.719 6.024   -6.184  1.00 58.26  ? 79  GLU B CB  1 
ATOM   3712 C  CG  . GLU B 1 128 ? -10.421 7.365   -5.485  1.00 61.07  ? 79  GLU B CG  1 
ATOM   3713 C  CD  . GLU B 1 128 ? -10.614 7.358   -3.960  1.00 60.46  ? 79  GLU B CD  1 
ATOM   3714 O  OE1 . GLU B 1 128 ? -10.459 8.434   -3.354  1.00 62.08  ? 79  GLU B OE1 1 
ATOM   3715 O  OE2 . GLU B 1 128 ? -10.924 6.302   -3.353  1.00 55.05  ? 79  GLU B OE2 1 
ATOM   3716 N  N   . LEU B 1 129 ? -9.945  4.336   -9.103  1.00 47.19  ? 80  LEU B N   1 
ATOM   3717 C  CA  . LEU B 1 129 ? -9.957  3.091   -9.851  1.00 44.52  ? 80  LEU B CA  1 
ATOM   3718 C  C   . LEU B 1 129 ? -9.783  1.882   -8.939  1.00 42.71  ? 80  LEU B C   1 
ATOM   3719 O  O   . LEU B 1 129 ? -9.099  1.963   -7.917  1.00 45.27  ? 80  LEU B O   1 
ATOM   3720 C  CB  . LEU B 1 129 ? -8.869  3.112   -10.940 1.00 42.64  ? 80  LEU B CB  1 
ATOM   3721 C  CG  . LEU B 1 129 ? -9.055  4.130   -12.071 1.00 40.54  ? 80  LEU B CG  1 
ATOM   3722 C  CD1 . LEU B 1 129 ? -7.902  4.083   -13.061 1.00 36.66  ? 80  LEU B CD1 1 
ATOM   3723 C  CD2 . LEU B 1 129 ? -10.380 3.906   -12.787 1.00 40.33  ? 80  LEU B CD2 1 
ATOM   3724 N  N   . GLY B 1 130 ? -10.396 0.767   -9.330  1.00 42.09  ? 81  GLY B N   1 
ATOM   3725 C  CA  . GLY B 1 130 ? -10.293 -0.509  -8.615  1.00 38.41  ? 81  GLY B CA  1 
ATOM   3726 C  C   . GLY B 1 130 ? -10.866 -1.641  -9.444  1.00 40.42  ? 81  GLY B C   1 
ATOM   3727 O  O   . GLY B 1 130 ? -11.301 -1.416  -10.562 1.00 40.90  ? 81  GLY B O   1 
ATOM   3728 N  N   . THR B 1 131 ? -10.816 -2.868  -8.927  1.00 41.84  ? 82  THR B N   1 
ATOM   3729 C  CA  . THR B 1 131 ? -11.517 -3.994  -9.544  1.00 42.65  ? 82  THR B CA  1 
ATOM   3730 C  C   . THR B 1 131 ? -12.393 -4.721  -8.501  1.00 46.70  ? 82  THR B C   1 
ATOM   3731 O  O   . THR B 1 131 ? -12.152 -4.621  -7.288  1.00 47.47  ? 82  THR B O   1 
ATOM   3732 C  CB  . THR B 1 131 ? -10.565 -4.999  -10.252 1.00 43.61  ? 82  THR B CB  1 
ATOM   3733 O  OG1 . THR B 1 131 ? -10.035 -5.946  -9.305  1.00 46.19  ? 82  THR B OG1 1 
ATOM   3734 C  CG2 . THR B 1 131 ? -9.437  -4.291  -10.974 1.00 40.93  ? 82  THR B CG2 1 
ATOM   3735 N  N   . ASP B 1 132 ? -13.408 -5.443  -8.978  1.00 46.72  ? 83  ASP B N   1 
ATOM   3736 C  CA  . ASP B 1 132 ? -14.280 -6.245  -8.111  1.00 45.96  ? 83  ASP B CA  1 
ATOM   3737 C  C   . ASP B 1 132 ? -15.005 -7.308  -8.919  1.00 45.84  ? 83  ASP B C   1 
ATOM   3738 O  O   . ASP B 1 132 ? -14.876 -7.373  -10.145 1.00 49.74  ? 83  ASP B O   1 
ATOM   3739 C  CB  . ASP B 1 132 ? -15.306 -5.347  -7.411  1.00 44.63  ? 83  ASP B CB  1 
ATOM   3740 C  CG  . ASP B 1 132 ? -15.630 -5.808  -6.004  1.00 47.06  ? 83  ASP B CG  1 
ATOM   3741 O  OD1 . ASP B 1 132 ? -15.631 -7.023  -5.704  1.00 48.04  ? 83  ASP B OD1 1 
ATOM   3742 O  OD2 . ASP B 1 132 ? -15.891 -4.934  -5.174  1.00 48.67  ? 83  ASP B OD2 1 
ATOM   3743 N  N   . LEU B 1 133 ? -15.783 -8.134  -8.235  1.00 45.83  ? 84  LEU B N   1 
ATOM   3744 C  CA  . LEU B 1 133 ? -16.632 -9.091  -8.924  1.00 48.04  ? 84  LEU B CA  1 
ATOM   3745 C  C   . LEU B 1 133 ? -17.981 -8.446  -9.306  1.00 50.35  ? 84  LEU B C   1 
ATOM   3746 O  O   . LEU B 1 133 ? -18.605 -7.763  -8.484  1.00 52.77  ? 84  LEU B O   1 
ATOM   3747 C  CB  . LEU B 1 133 ? -16.808 -10.358 -8.089  1.00 45.67  ? 84  LEU B CB  1 
ATOM   3748 C  CG  . LEU B 1 133 ? -15.550 -11.169 -7.796  1.00 43.07  ? 84  LEU B CG  1 
ATOM   3749 C  CD1 . LEU B 1 133 ? -15.943 -12.513 -7.208  1.00 43.90  ? 84  LEU B CD1 1 
ATOM   3750 C  CD2 . LEU B 1 133 ? -14.726 -11.361 -9.056  1.00 43.95  ? 84  LEU B CD2 1 
ATOM   3751 N  N   . VAL B 1 134 ? -18.407 -8.670  -10.554 1.00 51.56  ? 85  VAL B N   1 
ATOM   3752 C  CA  . VAL B 1 134 ? -19.524 -7.948  -11.168 1.00 53.13  ? 85  VAL B CA  1 
ATOM   3753 C  C   . VAL B 1 134 ? -20.460 -8.911  -11.913 1.00 56.03  ? 85  VAL B C   1 
ATOM   3754 O  O   . VAL B 1 134 ? -20.003 -9.690  -12.775 1.00 55.05  ? 85  VAL B O   1 
ATOM   3755 C  CB  . VAL B 1 134 ? -19.017 -6.881  -12.174 1.00 53.32  ? 85  VAL B CB  1 
ATOM   3756 C  CG1 . VAL B 1 134 ? -20.177 -6.198  -12.877 1.00 51.74  ? 85  VAL B CG1 1 
ATOM   3757 C  CG2 . VAL B 1 134 ? -18.146 -5.842  -11.486 1.00 54.53  ? 85  VAL B CG2 1 
ATOM   3758 N  N   . SER B 1 135 ? -21.758 -8.843  -11.581 1.00 55.60  ? 86  SER B N   1 
ATOM   3759 C  CA  . SER B 1 135 ? -22.810 -9.584  -12.289 1.00 53.85  ? 86  SER B CA  1 
ATOM   3760 C  C   . SER B 1 135 ? -23.893 -8.701  -12.899 1.00 53.31  ? 86  SER B C   1 
ATOM   3761 O  O   . SER B 1 135 ? -24.116 -7.567  -12.462 1.00 51.81  ? 86  SER B O   1 
ATOM   3762 C  CB  . SER B 1 135 ? -23.477 -10.598 -11.361 1.00 55.34  ? 86  SER B CB  1 
ATOM   3763 O  OG  . SER B 1 135 ? -22.656 -11.736 -11.216 1.00 62.16  ? 86  SER B OG  1 
ATOM   3764 N  N   . ILE B 1 136 ? -24.558 -9.257  -13.913 1.00 53.36  ? 87  ILE B N   1 
ATOM   3765 C  CA  . ILE B 1 136 ? -25.822 -8.744  -14.421 1.00 52.69  ? 87  ILE B CA  1 
ATOM   3766 C  C   . ILE B 1 136 ? -26.925 -9.784  -14.099 1.00 54.12  ? 87  ILE B C   1 
ATOM   3767 O  O   . ILE B 1 136 ? -27.038 -10.790 -14.810 1.00 52.29  ? 87  ILE B O   1 
ATOM   3768 C  CB  . ILE B 1 136 ? -25.742 -8.465  -15.938 1.00 52.38  ? 87  ILE B CB  1 
ATOM   3769 C  CG1 . ILE B 1 136 ? -24.593 -7.502  -16.246 1.00 51.92  ? 87  ILE B CG1 1 
ATOM   3770 C  CG2 . ILE B 1 136 ? -27.068 -7.922  -16.471 1.00 48.76  ? 87  ILE B CG2 1 
ATOM   3771 C  CD1 . ILE B 1 136 ? -24.265 -7.367  -17.729 1.00 50.94  ? 87  ILE B CD1 1 
ATOM   3772 N  N   . PRO B 1 137 ? -27.734 -9.550  -13.023 1.00 51.49  ? 88  PRO B N   1 
ATOM   3773 C  CA  . PRO B 1 137 ? -28.724 -10.529 -12.576 1.00 51.62  ? 88  PRO B CA  1 
ATOM   3774 C  C   . PRO B 1 137 ? -29.650 -10.971 -13.704 1.00 56.77  ? 88  PRO B C   1 
ATOM   3775 O  O   . PRO B 1 137 ? -29.915 -12.168 -13.846 1.00 59.32  ? 88  PRO B O   1 
ATOM   3776 C  CB  . PRO B 1 137 ? -29.514 -9.777  -11.503 1.00 51.76  ? 88  PRO B CB  1 
ATOM   3777 C  CG  . PRO B 1 137 ? -28.569 -8.749  -10.999 1.00 51.76  ? 88  PRO B CG  1 
ATOM   3778 C  CD  . PRO B 1 137 ? -27.820 -8.314  -12.228 1.00 52.27  ? 88  PRO B CD  1 
ATOM   3779 N  N   . HIS B 1 138 ? -30.133 -10.034 -14.510 1.00 57.32  ? 89  HIS B N   1 
ATOM   3780 C  CA  . HIS B 1 138 ? -30.942 -10.418 -15.664 1.00 59.84  ? 89  HIS B CA  1 
ATOM   3781 C  C   . HIS B 1 138 ? -30.112 -10.447 -16.938 1.00 59.25  ? 89  HIS B C   1 
ATOM   3782 O  O   . HIS B 1 138 ? -30.432 -9.784  -17.920 1.00 66.73  ? 89  HIS B O   1 
ATOM   3783 C  CB  . HIS B 1 138 ? -32.195 -9.543  -15.780 1.00 58.94  ? 89  HIS B CB  1 
ATOM   3784 C  CG  . HIS B 1 138 ? -33.097 -9.652  -14.593 1.00 64.71  ? 89  HIS B CG  1 
ATOM   3785 N  ND1 . HIS B 1 138 ? -33.800 -10.806 -14.302 1.00 65.71  ? 89  HIS B ND1 1 
ATOM   3786 C  CD2 . HIS B 1 138 ? -33.377 -8.772  -13.597 1.00 68.33  ? 89  HIS B CD2 1 
ATOM   3787 C  CE1 . HIS B 1 138 ? -34.482 -10.625 -13.182 1.00 65.80  ? 89  HIS B CE1 1 
ATOM   3788 N  NE2 . HIS B 1 138 ? -34.243 -9.401  -12.734 1.00 66.10  ? 89  HIS B NE2 1 
ATOM   3789 N  N   . GLY B 1 139 ? -29.034 -11.222 -16.902 1.00 58.15  ? 90  GLY B N   1 
ATOM   3790 C  CA  . GLY B 1 139 ? -28.070 -11.304 -17.996 1.00 55.56  ? 90  GLY B CA  1 
ATOM   3791 C  C   . GLY B 1 139 ? -27.582 -12.735 -18.130 1.00 60.10  ? 90  GLY B C   1 
ATOM   3792 O  O   . GLY B 1 139 ? -28.291 -13.655 -17.735 1.00 60.44  ? 90  GLY B O   1 
ATOM   3793 N  N   . PRO B 1 140 ? -26.366 -12.946 -18.682 1.00 62.37  ? 91  PRO B N   1 
ATOM   3794 C  CA  . PRO B 1 140 ? -25.910 -14.337 -18.728 1.00 63.58  ? 91  PRO B CA  1 
ATOM   3795 C  C   . PRO B 1 140 ? -25.542 -14.799 -17.316 1.00 69.91  ? 91  PRO B C   1 
ATOM   3796 O  O   . PRO B 1 140 ? -25.358 -13.959 -16.419 1.00 70.63  ? 91  PRO B O   1 
ATOM   3797 C  CB  . PRO B 1 140 ? -24.672 -14.290 -19.638 1.00 61.25  ? 91  PRO B CB  1 
ATOM   3798 C  CG  . PRO B 1 140 ? -24.452 -12.850 -19.986 1.00 61.52  ? 91  PRO B CG  1 
ATOM   3799 C  CD  . PRO B 1 140 ? -25.318 -12.001 -19.111 1.00 59.53  ? 91  PRO B CD  1 
ATOM   3800 N  N   . ASN B 1 141 ? -25.457 -16.107 -17.098 1.00 69.31  ? 92  ASN B N   1 
ATOM   3801 C  CA  . ASN B 1 141 ? -25.153 -16.606 -15.760 1.00 71.29  ? 92  ASN B CA  1 
ATOM   3802 C  C   . ASN B 1 141 ? -23.661 -16.648 -15.449 1.00 67.34  ? 92  ASN B C   1 
ATOM   3803 O  O   . ASN B 1 141 ? -23.079 -17.712 -15.250 1.00 65.80  ? 92  ASN B O   1 
ATOM   3804 C  CB  . ASN B 1 141 ? -25.845 -17.941 -15.495 1.00 75.46  ? 92  ASN B CB  1 
ATOM   3805 C  CG  . ASN B 1 141 ? -27.033 -17.791 -14.563 1.00 87.44  ? 92  ASN B CG  1 
ATOM   3806 O  OD1 . ASN B 1 141 ? -26.874 -17.727 -13.337 1.00 91.29  ? 92  ASN B OD1 1 
ATOM   3807 N  ND2 . ASN B 1 141 ? -28.231 -17.725 -15.136 1.00 87.28  ? 92  ASN B ND2 1 
ATOM   3808 N  N   . VAL B 1 142 ? -23.058 -15.463 -15.411 1.00 61.96  ? 93  VAL B N   1 
ATOM   3809 C  CA  . VAL B 1 142 ? -21.623 -15.326 -15.193 1.00 64.29  ? 93  VAL B CA  1 
ATOM   3810 C  C   . VAL B 1 142 ? -21.304 -14.161 -14.248 1.00 64.50  ? 93  VAL B C   1 
ATOM   3811 O  O   . VAL B 1 142 ? -22.050 -13.176 -14.192 1.00 65.20  ? 93  VAL B O   1 
ATOM   3812 C  CB  . VAL B 1 142 ? -20.844 -15.127 -16.516 1.00 59.82  ? 93  VAL B CB  1 
ATOM   3813 C  CG1 . VAL B 1 142 ? -21.004 -16.328 -17.441 1.00 56.00  ? 93  VAL B CG1 1 
ATOM   3814 C  CG2 . VAL B 1 142 ? -21.275 -13.836 -17.206 1.00 58.52  ? 93  VAL B CG2 1 
ATOM   3815 N  N   . THR B 1 143 ? -20.194 -14.297 -13.515 1.00 60.54  ? 94  THR B N   1 
ATOM   3816 C  CA  . THR B 1 143 ? -19.611 -13.224 -12.713 1.00 57.03  ? 94  THR B CA  1 
ATOM   3817 C  C   . THR B 1 143 ? -18.206 -13.008 -13.231 1.00 57.99  ? 94  THR B C   1 
ATOM   3818 O  O   . THR B 1 143 ? -17.479 -13.981 -13.457 1.00 59.14  ? 94  THR B O   1 
ATOM   3819 C  CB  . THR B 1 143 ? -19.555 -13.630 -11.247 1.00 56.41  ? 94  THR B CB  1 
ATOM   3820 O  OG1 . THR B 1 143 ? -20.880 -13.964 -10.827 1.00 59.72  ? 94  THR B OG1 1 
ATOM   3821 C  CG2 . THR B 1 143 ? -19.036 -12.490 -10.394 1.00 57.57  ? 94  THR B CG2 1 
ATOM   3822 N  N   . VAL B 1 144 ? -17.828 -11.754 -13.465 1.00 57.24  ? 95  VAL B N   1 
ATOM   3823 C  CA  . VAL B 1 144 ? -16.486 -11.459 -13.991 1.00 56.80  ? 95  VAL B CA  1 
ATOM   3824 C  C   . VAL B 1 144 ? -15.761 -10.475 -13.098 1.00 55.06  ? 95  VAL B C   1 
ATOM   3825 O  O   . VAL B 1 144 ? -16.404 -9.730  -12.357 1.00 56.03  ? 95  VAL B O   1 
ATOM   3826 C  CB  . VAL B 1 144 ? -16.503 -10.908 -15.439 1.00 59.89  ? 95  VAL B CB  1 
ATOM   3827 C  CG1 . VAL B 1 144 ? -16.895 -11.993 -16.425 1.00 62.75  ? 95  VAL B CG1 1 
ATOM   3828 C  CG2 . VAL B 1 144 ? -17.414 -9.697  -15.566 1.00 61.12  ? 95  VAL B CG2 1 
ATOM   3829 N  N   . ARG B 1 145 ? -14.428 -10.473 -13.150 1.00 51.10  ? 96  ARG B N   1 
ATOM   3830 C  CA  . ARG B 1 145 ? -13.684 -9.425  -12.470 1.00 47.34  ? 96  ARG B CA  1 
ATOM   3831 C  C   . ARG B 1 145 ? -13.483 -8.299  -13.475 1.00 48.23  ? 96  ARG B C   1 
ATOM   3832 O  O   . ARG B 1 145 ? -13.014 -8.537  -14.590 1.00 46.22  ? 96  ARG B O   1 
ATOM   3833 C  CB  . ARG B 1 145 ? -12.351 -9.911  -11.863 1.00 46.37  ? 96  ARG B CB  1 
ATOM   3834 C  CG  . ARG B 1 145 ? -11.688 -8.836  -11.008 1.00 44.66  ? 96  ARG B CG  1 
ATOM   3835 C  CD  . ARG B 1 145 ? -10.530 -9.344  -10.171 1.00 49.57  ? 96  ARG B CD  1 
ATOM   3836 N  NE  . ARG B 1 145 ? -10.912 -9.975  -8.896  1.00 52.77  ? 96  ARG B NE  1 
ATOM   3837 C  CZ  . ARG B 1 145 ? -11.264 -9.321  -7.782  1.00 52.78  ? 96  ARG B CZ  1 
ATOM   3838 N  NH1 . ARG B 1 145 ? -11.333 -7.986  -7.770  1.00 52.02  ? 96  ARG B NH1 1 
ATOM   3839 N  NH2 . ARG B 1 145 ? -11.569 -10.004 -6.673  1.00 51.42  ? 96  ARG B NH2 1 
ATOM   3840 N  N   . ALA B 1 146 ? -13.849 -7.079  -13.082 1.00 45.43  ? 97  ALA B N   1 
ATOM   3841 C  CA  . ALA B 1 146 ? -13.866 -5.965  -14.016 1.00 44.86  ? 97  ALA B CA  1 
ATOM   3842 C  C   . ALA B 1 146 ? -13.474 -4.682  -13.312 1.00 44.60  ? 97  ALA B C   1 
ATOM   3843 O  O   . ALA B 1 146 ? -13.639 -4.560  -12.103 1.00 45.67  ? 97  ALA B O   1 
ATOM   3844 C  CB  . ALA B 1 146 ? -15.260 -5.823  -14.652 1.00 44.92  ? 97  ALA B CB  1 
ATOM   3845 N  N   . ASN B 1 147 ? -12.968 -3.730  -14.093 1.00 44.54  ? 98  ASN B N   1 
ATOM   3846 C  CA  . ASN B 1 147 ? -12.553 -2.437  -13.595 1.00 44.98  ? 98  ASN B CA  1 
ATOM   3847 C  C   . ASN B 1 147 ? -13.755 -1.619  -13.168 1.00 44.27  ? 98  ASN B C   1 
ATOM   3848 O  O   . ASN B 1 147 ? -14.751 -1.598  -13.847 1.00 48.88  ? 98  ASN B O   1 
ATOM   3849 C  CB  . ASN B 1 147 ? -11.738 -1.690  -14.654 1.00 44.72  ? 98  ASN B CB  1 
ATOM   3850 C  CG  . ASN B 1 147 ? -10.397 -2.363  -14.958 1.00 47.75  ? 98  ASN B CG  1 
ATOM   3851 O  OD1 . ASN B 1 147 ? -9.606  -2.645  -14.055 1.00 51.11  ? 98  ASN B OD1 1 
ATOM   3852 N  ND2 . ASN B 1 147 ? -10.137 -2.618  -16.239 1.00 44.18  ? 98  ASN B ND2 1 
ATOM   3853 N  N   . ILE B 1 148 ? -13.664 -0.980  -12.013 1.00 44.37  ? 99  ILE B N   1 
ATOM   3854 C  CA  . ILE B 1 148 ? -14.709 -0.100  -11.528 1.00 43.80  ? 99  ILE B CA  1 
ATOM   3855 C  C   . ILE B 1 148 ? -14.081 1.234   -11.149 1.00 45.52  ? 99  ILE B C   1 
ATOM   3856 O  O   . ILE B 1 148 ? -13.120 1.279   -10.373 1.00 43.99  ? 99  ILE B O   1 
ATOM   3857 C  CB  . ILE B 1 148 ? -15.443 -0.685  -10.287 1.00 43.51  ? 99  ILE B CB  1 
ATOM   3858 C  CG1 . ILE B 1 148 ? -15.922 -2.131  -10.567 1.00 41.03  ? 99  ILE B CG1 1 
ATOM   3859 C  CG2 . ILE B 1 148 ? -16.571 0.254   -9.845  1.00 37.57  ? 99  ILE B CG2 1 
ATOM   3860 C  CD1 . ILE B 1 148 ? -16.962 -2.659  -9.604  1.00 39.89  ? 99  ILE B CD1 1 
ATOM   3861 N  N   . ALA B 1 149 ? -14.614 2.314   -11.710 1.00 42.69  ? 100 ALA B N   1 
ATOM   3862 C  CA  . ALA B 1 149 ? -14.249 3.643   -11.271 1.00 43.73  ? 100 ALA B CA  1 
ATOM   3863 C  C   . ALA B 1 149 ? -15.219 4.005   -10.170 1.00 47.20  ? 100 ALA B C   1 
ATOM   3864 O  O   . ALA B 1 149 ? -16.410 4.142   -10.422 1.00 49.54  ? 100 ALA B O   1 
ATOM   3865 C  CB  . ALA B 1 149 ? -14.341 4.634   -12.413 1.00 44.18  ? 100 ALA B CB  1 
ATOM   3866 N  N   . ALA B 1 150 ? -14.715 4.136   -8.942  1.00 48.56  ? 101 ALA B N   1 
ATOM   3867 C  CA  . ALA B 1 150 ? -15.547 4.507   -7.802  1.00 44.90  ? 101 ALA B CA  1 
ATOM   3868 C  C   . ALA B 1 150 ? -15.677 6.027   -7.772  1.00 48.87  ? 101 ALA B C   1 
ATOM   3869 O  O   . ALA B 1 150 ? -14.730 6.727   -7.399  1.00 45.53  ? 101 ALA B O   1 
ATOM   3870 C  CB  . ALA B 1 150 ? -14.920 3.995   -6.524  1.00 45.76  ? 101 ALA B CB  1 
ATOM   3871 N  N   . ILE B 1 151 ? -16.831 6.546   -8.187  1.00 53.63  ? 102 ILE B N   1 
ATOM   3872 C  CA  . ILE B 1 151 ? -17.026 8.013   -8.287  1.00 57.07  ? 102 ILE B CA  1 
ATOM   3873 C  C   . ILE B 1 151 ? -17.098 8.629   -6.884  1.00 55.80  ? 102 ILE B C   1 
ATOM   3874 O  O   . ILE B 1 151 ? -17.963 8.248   -6.086  1.00 58.94  ? 102 ILE B O   1 
ATOM   3875 C  CB  . ILE B 1 151 ? -18.301 8.371   -9.094  1.00 55.99  ? 102 ILE B CB  1 
ATOM   3876 C  CG1 . ILE B 1 151 ? -18.099 8.127   -10.591 1.00 56.64  ? 102 ILE B CG1 1 
ATOM   3877 C  CG2 . ILE B 1 151 ? -18.708 9.820   -8.864  1.00 61.77  ? 102 ILE B CG2 1 
ATOM   3878 C  CD1 . ILE B 1 151 ? -19.399 8.008   -11.383 1.00 56.16  ? 102 ILE B CD1 1 
ATOM   3879 N  N   . THR B 1 152 ? -16.195 9.560   -6.582  1.00 54.81  ? 103 THR B N   1 
ATOM   3880 C  CA  . THR B 1 152 ? -16.147 10.179  -5.249  1.00 58.73  ? 103 THR B CA  1 
ATOM   3881 C  C   . THR B 1 152 ? -16.543 11.646  -5.290  1.00 62.39  ? 103 THR B C   1 
ATOM   3882 O  O   . THR B 1 152 ? -16.909 12.225  -4.273  1.00 71.88  ? 103 THR B O   1 
ATOM   3883 C  CB  . THR B 1 152 ? -14.770 10.007  -4.537  1.00 57.05  ? 103 THR B CB  1 
ATOM   3884 O  OG1 . THR B 1 152 ? -13.709 10.295  -5.448  1.00 54.56  ? 103 THR B OG1 1 
ATOM   3885 C  CG2 . THR B 1 152 ? -14.582 8.590   -4.034  1.00 55.86  ? 103 THR B CG2 1 
ATOM   3886 N  N   . GLU B 1 153 ? -16.478 12.245  -6.469  1.00 63.57  ? 104 GLU B N   1 
ATOM   3887 C  CA  . GLU B 1 153 ? -16.891 13.628  -6.651  1.00 70.44  ? 104 GLU B CA  1 
ATOM   3888 C  C   . GLU B 1 153 ? -17.598 13.710  -7.986  1.00 69.18  ? 104 GLU B C   1 
ATOM   3889 O  O   . GLU B 1 153 ? -17.211 13.028  -8.929  1.00 74.17  ? 104 GLU B O   1 
ATOM   3890 C  CB  . GLU B 1 153 ? -15.677 14.568  -6.675  1.00 81.24  ? 104 GLU B CB  1 
ATOM   3891 C  CG  . GLU B 1 153 ? -14.894 14.694  -5.371  1.00 88.15  ? 104 GLU B CG  1 
ATOM   3892 C  CD  . GLU B 1 153 ? -15.445 15.768  -4.458  1.00 91.28  ? 104 GLU B CD  1 
ATOM   3893 O  OE1 . GLU B 1 153 ? -15.523 16.942  -4.891  1.00 96.73  ? 104 GLU B OE1 1 
ATOM   3894 O  OE2 . GLU B 1 153 ? -15.795 15.440  -3.305  1.00 90.78  ? 104 GLU B OE2 1 
ATOM   3895 N  N   . SER B 1 154 ? -18.626 14.547  -8.071  1.00 73.20  ? 105 SER B N   1 
ATOM   3896 C  CA  . SER B 1 154 ? -19.335 14.784  -9.333  1.00 77.24  ? 105 SER B CA  1 
ATOM   3897 C  C   . SER B 1 154 ? -19.945 16.183  -9.417  1.00 79.88  ? 105 SER B C   1 
ATOM   3898 O  O   . SER B 1 154 ? -20.116 16.872  -8.410  1.00 73.98  ? 105 SER B O   1 
ATOM   3899 C  CB  . SER B 1 154 ? -20.408 13.711  -9.591  1.00 73.55  ? 105 SER B CB  1 
ATOM   3900 O  OG  . SER B 1 154 ? -21.331 13.636  -8.521  1.00 70.85  ? 105 SER B OG  1 
ATOM   3901 N  N   . ASP B 1 155 ? -20.253 16.589  -10.645 1.00 91.04  ? 106 ASP B N   1 
ATOM   3902 C  CA  . ASP B 1 155 ? -20.928 17.850  -10.910 1.00 93.58  ? 106 ASP B CA  1 
ATOM   3903 C  C   . ASP B 1 155 ? -21.819 17.736  -12.143 1.00 89.19  ? 106 ASP B C   1 
ATOM   3904 O  O   . ASP B 1 155 ? -21.343 17.432  -13.241 1.00 84.08  ? 106 ASP B O   1 
ATOM   3905 C  CB  . ASP B 1 155 ? -19.917 18.983  -11.085 1.00 100.24 ? 106 ASP B CB  1 
ATOM   3906 C  CG  . ASP B 1 155 ? -20.582 20.310  -11.382 1.00 105.87 ? 106 ASP B CG  1 
ATOM   3907 O  OD1 . ASP B 1 155 ? -21.736 20.516  -10.947 1.00 104.57 ? 106 ASP B OD1 1 
ATOM   3908 O  OD2 . ASP B 1 155 ? -19.952 21.147  -12.055 1.00 113.27 ? 106 ASP B OD2 1 
ATOM   3909 N  N   . LYS B 1 156 ? -23.111 17.985  -11.939 1.00 87.01  ? 107 LYS B N   1 
ATOM   3910 C  CA  . LYS B 1 156 ? -24.132 17.912  -12.994 1.00 86.97  ? 107 LYS B CA  1 
ATOM   3911 C  C   . LYS B 1 156 ? -24.089 16.599  -13.790 1.00 82.35  ? 107 LYS B C   1 
ATOM   3912 O  O   . LYS B 1 156 ? -24.467 16.560  -14.961 1.00 85.96  ? 107 LYS B O   1 
ATOM   3913 C  CB  . LYS B 1 156 ? -24.073 19.154  -13.905 1.00 88.07  ? 107 LYS B CB  1 
ATOM   3914 C  CG  . LYS B 1 156 ? -24.505 20.433  -13.190 1.00 87.89  ? 107 LYS B CG  1 
ATOM   3915 C  CD  . LYS B 1 156 ? -24.104 21.697  -13.936 1.00 89.80  ? 107 LYS B CD  1 
ATOM   3916 C  CE  . LYS B 1 156 ? -24.543 22.940  -13.120 1.00 95.89  ? 107 LYS B CE  1 
ATOM   3917 N  NZ  . LYS B 1 156 ? -24.060 24.211  -13.734 1.00 86.20  ? 107 LYS B NZ  1 
ATOM   3918 N  N   . PHE B 1 157 ? -23.638 15.531  -13.133 1.00 78.51  ? 108 PHE B N   1 
ATOM   3919 C  CA  . PHE B 1 157 ? -23.598 14.187  -13.718 1.00 73.22  ? 108 PHE B CA  1 
ATOM   3920 C  C   . PHE B 1 157 ? -24.802 13.363  -13.282 1.00 70.36  ? 108 PHE B C   1 
ATOM   3921 O  O   . PHE B 1 157 ? -25.581 12.919  -14.122 1.00 72.09  ? 108 PHE B O   1 
ATOM   3922 C  CB  . PHE B 1 157 ? -22.297 13.472  -13.338 1.00 71.61  ? 108 PHE B CB  1 
ATOM   3923 C  CG  . PHE B 1 157 ? -22.210 12.050  -13.824 1.00 67.19  ? 108 PHE B CG  1 
ATOM   3924 C  CD1 . PHE B 1 157 ? -21.857 11.777  -15.141 1.00 65.86  ? 108 PHE B CD1 1 
ATOM   3925 C  CD2 . PHE B 1 157 ? -22.449 10.976  -12.945 1.00 66.75  ? 108 PHE B CD2 1 
ATOM   3926 C  CE1 . PHE B 1 157 ? -21.762 10.463  -15.574 1.00 68.45  ? 108 PHE B CE1 1 
ATOM   3927 C  CE2 . PHE B 1 157 ? -22.356 9.657   -13.375 1.00 62.16  ? 108 PHE B CE2 1 
ATOM   3928 C  CZ  . PHE B 1 157 ? -22.015 9.403   -14.692 1.00 63.99  ? 108 PHE B CZ  1 
ATOM   3929 N  N   . PHE B 1 158 ? -24.947 13.135  -11.978 1.00 68.88  ? 109 PHE B N   1 
ATOM   3930 C  CA  . PHE B 1 158 ? -26.140 12.456  -11.476 1.00 69.50  ? 109 PHE B CA  1 
ATOM   3931 C  C   . PHE B 1 158 ? -27.335 13.409  -11.531 1.00 74.88  ? 109 PHE B C   1 
ATOM   3932 O  O   . PHE B 1 158 ? -27.205 14.608  -11.268 1.00 77.50  ? 109 PHE B O   1 
ATOM   3933 C  CB  . PHE B 1 158 ? -25.934 11.910  -10.068 1.00 67.36  ? 109 PHE B CB  1 
ATOM   3934 C  CG  . PHE B 1 158 ? -24.910 10.811  -9.978  1.00 66.37  ? 109 PHE B CG  1 
ATOM   3935 C  CD1 . PHE B 1 158 ? -25.171 9.555   -10.508 1.00 61.44  ? 109 PHE B CD1 1 
ATOM   3936 C  CD2 . PHE B 1 158 ? -23.683 11.030  -9.335  1.00 65.55  ? 109 PHE B CD2 1 
ATOM   3937 C  CE1 . PHE B 1 158 ? -24.230 8.536   -10.413 1.00 62.70  ? 109 PHE B CE1 1 
ATOM   3938 C  CE2 . PHE B 1 158 ? -22.742 10.021  -9.238  1.00 61.49  ? 109 PHE B CE2 1 
ATOM   3939 C  CZ  . PHE B 1 158 ? -23.018 8.769   -9.777  1.00 63.85  ? 109 PHE B CZ  1 
ATOM   3940 N  N   . ILE B 1 159 ? -28.492 12.867  -11.894 1.00 81.12  ? 110 ILE B N   1 
ATOM   3941 C  CA  . ILE B 1 159 ? -29.670 13.668  -12.219 1.00 81.50  ? 110 ILE B CA  1 
ATOM   3942 C  C   . ILE B 1 159 ? -30.833 13.310  -11.284 1.00 78.20  ? 110 ILE B C   1 
ATOM   3943 O  O   . ILE B 1 159 ? -31.132 12.125  -11.093 1.00 67.90  ? 110 ILE B O   1 
ATOM   3944 C  CB  . ILE B 1 159 ? -30.033 13.473  -13.724 1.00 86.22  ? 110 ILE B CB  1 
ATOM   3945 C  CG1 . ILE B 1 159 ? -29.083 14.282  -14.626 1.00 90.51  ? 110 ILE B CG1 1 
ATOM   3946 C  CG2 . ILE B 1 159 ? -31.493 13.801  -14.025 1.00 91.11  ? 110 ILE B CG2 1 
ATOM   3947 C  CD1 . ILE B 1 159 ? -28.764 15.692  -14.148 1.00 94.75  ? 110 ILE B CD1 1 
ATOM   3948 N  N   . ASN B 1 160 ? -31.476 14.325  -10.696 1.00 77.87  ? 111 ASN B N   1 
ATOM   3949 C  CA  . ASN B 1 160 ? -32.603 14.101  -9.766  1.00 78.10  ? 111 ASN B CA  1 
ATOM   3950 C  C   . ASN B 1 160 ? -33.674 13.161  -10.330 1.00 77.76  ? 111 ASN B C   1 
ATOM   3951 O  O   . ASN B 1 160 ? -34.273 13.441  -11.369 1.00 81.10  ? 111 ASN B O   1 
ATOM   3952 C  CB  . ASN B 1 160 ? -33.235 15.433  -9.338  1.00 82.47  ? 111 ASN B CB  1 
ATOM   3953 C  CG  . ASN B 1 160 ? -34.281 15.256  -8.232  1.00 91.56  ? 111 ASN B CG  1 
ATOM   3954 O  OD1 . ASN B 1 160 ? -34.317 14.236  -7.521  1.00 95.89  ? 111 ASN B OD1 1 
ATOM   3955 N  ND2 . ASN B 1 160 ? -35.140 16.257  -8.082  1.00 92.06  ? 111 ASN B ND2 1 
ATOM   3956 N  N   . GLY B 1 161 ? -33.886 12.036  -9.649  1.00 75.30  ? 112 GLY B N   1 
ATOM   3957 C  CA  . GLY B 1 161 ? -34.913 11.076  -10.037 1.00 72.24  ? 112 GLY B CA  1 
ATOM   3958 C  C   . GLY B 1 161 ? -34.615 10.246  -11.274 1.00 78.82  ? 112 GLY B C   1 
ATOM   3959 O  O   . GLY B 1 161 ? -35.522 9.599   -11.794 1.00 82.32  ? 112 GLY B O   1 
ATOM   3960 N  N   . SER B 1 162 ? -33.357 10.244  -11.737 1.00 78.94  ? 113 SER B N   1 
ATOM   3961 C  CA  . SER B 1 162 ? -32.926 9.446   -12.919 1.00 74.67  ? 113 SER B CA  1 
ATOM   3962 C  C   . SER B 1 162 ? -33.075 7.936   -12.712 1.00 70.47  ? 113 SER B C   1 
ATOM   3963 O  O   . SER B 1 162 ? -33.344 7.195   -13.666 1.00 63.18  ? 113 SER B O   1 
ATOM   3964 C  CB  . SER B 1 162 ? -31.468 9.749   -13.308 1.00 76.92  ? 113 SER B CB  1 
ATOM   3965 O  OG  . SER B 1 162 ? -30.547 8.891   -12.617 1.00 74.11  ? 113 SER B OG  1 
ATOM   3966 N  N   . ASN B 1 163 ? -32.866 7.499   -11.467 1.00 65.27  ? 114 ASN B N   1 
ATOM   3967 C  CA  . ASN B 1 163 ? -33.039 6.103   -11.055 1.00 63.56  ? 114 ASN B CA  1 
ATOM   3968 C  C   . ASN B 1 163 ? -31.811 5.232   -11.230 1.00 58.79  ? 114 ASN B C   1 
ATOM   3969 O  O   . ASN B 1 163 ? -31.859 4.050   -10.872 1.00 57.05  ? 114 ASN B O   1 
ATOM   3970 C  CB  . ASN B 1 163 ? -34.254 5.441   -11.739 1.00 75.50  ? 114 ASN B CB  1 
ATOM   3971 C  CG  . ASN B 1 163 ? -35.583 6.040   -11.279 1.00 85.75  ? 114 ASN B CG  1 
ATOM   3972 O  OD1 . ASN B 1 163 ? -35.851 6.130   -10.075 1.00 87.35  ? 114 ASN B OD1 1 
ATOM   3973 N  ND2 . ASN B 1 163 ? -36.423 6.452   -12.239 1.00 79.86  ? 114 ASN B ND2 1 
ATOM   3974 N  N   . TRP B 1 164 ? -30.716 5.798   -11.759 1.00 54.88  ? 115 TRP B N   1 
ATOM   3975 C  CA  . TRP B 1 164 ? -29.453 5.039   -11.857 1.00 54.92  ? 115 TRP B CA  1 
ATOM   3976 C  C   . TRP B 1 164 ? -28.259 5.596   -11.052 1.00 53.93  ? 115 TRP B C   1 
ATOM   3977 O  O   . TRP B 1 164 ? -28.144 6.805   -10.804 1.00 53.02  ? 115 TRP B O   1 
ATOM   3978 C  CB  . TRP B 1 164 ? -29.072 4.730   -13.315 1.00 51.51  ? 115 TRP B CB  1 
ATOM   3979 C  CG  . TRP B 1 164 ? -29.080 5.905   -14.250 1.00 47.32  ? 115 TRP B CG  1 
ATOM   3980 C  CD1 . TRP B 1 164 ? -30.049 6.222   -15.155 1.00 47.34  ? 115 TRP B CD1 1 
ATOM   3981 C  CD2 . TRP B 1 164 ? -28.050 6.888   -14.405 1.00 44.87  ? 115 TRP B CD2 1 
ATOM   3982 N  NE1 . TRP B 1 164 ? -29.700 7.355   -15.849 1.00 44.56  ? 115 TRP B NE1 1 
ATOM   3983 C  CE2 . TRP B 1 164 ? -28.475 7.781   -15.413 1.00 43.66  ? 115 TRP B CE2 1 
ATOM   3984 C  CE3 . TRP B 1 164 ? -26.801 7.100   -13.789 1.00 45.74  ? 115 TRP B CE3 1 
ATOM   3985 C  CZ2 . TRP B 1 164 ? -27.708 8.875   -15.817 1.00 45.39  ? 115 TRP B CZ2 1 
ATOM   3986 C  CZ3 . TRP B 1 164 ? -26.029 8.194   -14.191 1.00 44.59  ? 115 TRP B CZ3 1 
ATOM   3987 C  CH2 . TRP B 1 164 ? -26.490 9.070   -15.190 1.00 46.16  ? 115 TRP B CH2 1 
ATOM   3988 N  N   . GLU B 1 165 ? -27.376 4.695   -10.645 1.00 53.61  ? 116 GLU B N   1 
ATOM   3989 C  CA  . GLU B 1 165 ? -26.269 5.066   -9.763  1.00 56.04  ? 116 GLU B CA  1 
ATOM   3990 C  C   . GLU B 1 165 ? -24.906 4.900   -10.426 1.00 53.26  ? 116 GLU B C   1 
ATOM   3991 O  O   . GLU B 1 165 ? -23.881 5.020   -9.759  1.00 54.82  ? 116 GLU B O   1 
ATOM   3992 C  CB  . GLU B 1 165 ? -26.317 4.242   -8.468  1.00 57.56  ? 116 GLU B CB  1 
ATOM   3993 C  CG  . GLU B 1 165 ? -27.523 4.504   -7.570  1.00 64.88  ? 116 GLU B CG  1 
ATOM   3994 C  CD  . GLU B 1 165 ? -28.738 3.637   -7.892  1.00 72.57  ? 116 GLU B CD  1 
ATOM   3995 O  OE1 . GLU B 1 165 ? -29.855 4.223   -8.008  1.00 76.85  ? 116 GLU B OE1 1 
ATOM   3996 O  OE2 . GLU B 1 165 ? -28.584 2.385   -8.027  1.00 70.74  ? 116 GLU B OE2 1 
ATOM   3997 N  N   . GLY B 1 166 ? -24.892 4.602   -11.724 1.00 49.69  ? 117 GLY B N   1 
ATOM   3998 C  CA  . GLY B 1 166 ? -23.640 4.443   -12.450 1.00 50.39  ? 117 GLY B CA  1 
ATOM   3999 C  C   . GLY B 1 166 ? -23.825 4.264   -13.940 1.00 49.65  ? 117 GLY B C   1 
ATOM   4000 O  O   . GLY B 1 166 ? -24.950 4.157   -14.412 1.00 48.67  ? 117 GLY B O   1 
ATOM   4001 N  N   . ILE B 1 167 ? -22.715 4.254   -14.680 1.00 48.35  ? 118 ILE B N   1 
ATOM   4002 C  CA  . ILE B 1 167 ? -22.746 4.108   -16.147 1.00 48.79  ? 118 ILE B CA  1 
ATOM   4003 C  C   . ILE B 1 167 ? -21.954 2.895   -16.621 1.00 46.39  ? 118 ILE B C   1 
ATOM   4004 O  O   . ILE B 1 167 ? -20.887 2.589   -16.090 1.00 44.62  ? 118 ILE B O   1 
ATOM   4005 C  CB  . ILE B 1 167 ? -22.283 5.378   -16.925 1.00 48.53  ? 118 ILE B CB  1 
ATOM   4006 C  CG1 . ILE B 1 167 ? -20.831 5.739   -16.609 1.00 51.15  ? 118 ILE B CG1 1 
ATOM   4007 C  CG2 . ILE B 1 167 ? -23.193 6.562   -16.629 1.00 50.06  ? 118 ILE B CG2 1 
ATOM   4008 C  CD1 . ILE B 1 167 ? -20.306 6.906   -17.423 1.00 54.42  ? 118 ILE B CD1 1 
ATOM   4009 N  N   . LEU B 1 168 ? -22.501 2.209   -17.620 1.00 45.66  ? 119 LEU B N   1 
ATOM   4010 C  CA  . LEU B 1 168 ? -21.821 1.102   -18.264 1.00 45.82  ? 119 LEU B CA  1 
ATOM   4011 C  C   . LEU B 1 168 ? -21.443 1.552   -19.657 1.00 44.27  ? 119 LEU B C   1 
ATOM   4012 O  O   . LEU B 1 168 ? -22.278 1.544   -20.578 1.00 44.15  ? 119 LEU B O   1 
ATOM   4013 C  CB  . LEU B 1 168 ? -22.700 -0.164  -18.317 1.00 46.39  ? 119 LEU B CB  1 
ATOM   4014 C  CG  . LEU B 1 168 ? -22.085 -1.474  -18.834 1.00 43.17  ? 119 LEU B CG  1 
ATOM   4015 C  CD1 . LEU B 1 168 ? -21.045 -1.996  -17.850 1.00 43.93  ? 119 LEU B CD1 1 
ATOM   4016 C  CD2 . LEU B 1 168 ? -23.177 -2.515  -19.031 1.00 42.57  ? 119 LEU B CD2 1 
ATOM   4017 N  N   . GLY B 1 169 ? -20.180 1.969   -19.787 1.00 44.44  ? 120 GLY B N   1 
ATOM   4018 C  CA  . GLY B 1 169 ? -19.580 2.376   -21.062 1.00 39.17  ? 120 GLY B CA  1 
ATOM   4019 C  C   . GLY B 1 169 ? -19.278 1.127   -21.878 1.00 42.30  ? 120 GLY B C   1 
ATOM   4020 O  O   . GLY B 1 169 ? -18.449 0.293   -21.472 1.00 37.90  ? 120 GLY B O   1 
ATOM   4021 N  N   . LEU B 1 170 ? -19.970 0.987   -23.012 1.00 40.37  ? 121 LEU B N   1 
ATOM   4022 C  CA  . LEU B 1 170 ? -19.913 -0.231  -23.791 1.00 41.79  ? 121 LEU B CA  1 
ATOM   4023 C  C   . LEU B 1 170 ? -19.069 -0.106  -25.050 1.00 44.90  ? 121 LEU B C   1 
ATOM   4024 O  O   . LEU B 1 170 ? -18.944 -1.077  -25.802 1.00 46.42  ? 121 LEU B O   1 
ATOM   4025 C  CB  . LEU B 1 170 ? -21.322 -0.719  -24.149 1.00 40.46  ? 121 LEU B CB  1 
ATOM   4026 C  CG  . LEU B 1 170 ? -22.122 -1.364  -23.018 1.00 39.22  ? 121 LEU B CG  1 
ATOM   4027 C  CD1 . LEU B 1 170 ? -23.583 -1.506  -23.455 1.00 37.54  ? 121 LEU B CD1 1 
ATOM   4028 C  CD2 . LEU B 1 170 ? -21.522 -2.707  -22.603 1.00 37.26  ? 121 LEU B CD2 1 
ATOM   4029 N  N   . ALA B 1 171 ? -18.496 1.074   -25.296 1.00 42.63  ? 122 ALA B N   1 
ATOM   4030 C  CA  . ALA B 1 171 ? -17.564 1.228   -26.444 1.00 42.27  ? 122 ALA B CA  1 
ATOM   4031 C  C   . ALA B 1 171 ? -16.107 0.737   -26.149 1.00 40.20  ? 122 ALA B C   1 
ATOM   4032 O  O   . ALA B 1 171 ? -15.795 0.254   -25.059 1.00 39.94  ? 122 ALA B O   1 
ATOM   4033 C  CB  . ALA B 1 171 ? -17.588 2.659   -26.974 1.00 39.61  ? 122 ALA B CB  1 
ATOM   4034 N  N   . TYR B 1 172 ? -15.219 0.877   -27.119 1.00 41.60  ? 123 TYR B N   1 
ATOM   4035 C  CA  . TYR B 1 172 ? -13.882 0.282   -27.049 1.00 41.99  ? 123 TYR B CA  1 
ATOM   4036 C  C   . TYR B 1 172 ? -12.841 0.984   -26.180 1.00 42.51  ? 123 TYR B C   1 
ATOM   4037 O  O   . TYR B 1 172 ? -12.961 2.172   -25.882 1.00 44.67  ? 123 TYR B O   1 
ATOM   4038 C  CB  . TYR B 1 172 ? -13.347 0.156   -28.458 1.00 39.51  ? 123 TYR B CB  1 
ATOM   4039 C  CG  . TYR B 1 172 ? -14.269 -0.621  -29.357 1.00 40.80  ? 123 TYR B CG  1 
ATOM   4040 C  CD1 . TYR B 1 172 ? -14.176 -2.021  -29.435 1.00 41.59  ? 123 TYR B CD1 1 
ATOM   4041 C  CD2 . TYR B 1 172 ? -15.231 0.026   -30.136 1.00 37.38  ? 123 TYR B CD2 1 
ATOM   4042 C  CE1 . TYR B 1 172 ? -15.013 -2.751  -30.261 1.00 39.62  ? 123 TYR B CE1 1 
ATOM   4043 C  CE2 . TYR B 1 172 ? -16.054 -0.695  -30.982 1.00 38.98  ? 123 TYR B CE2 1 
ATOM   4044 C  CZ  . TYR B 1 172 ? -15.945 -2.088  -31.026 1.00 39.90  ? 123 TYR B CZ  1 
ATOM   4045 O  OH  . TYR B 1 172 ? -16.744 -2.831  -31.846 1.00 40.26  ? 123 TYR B OH  1 
ATOM   4046 N  N   . ALA B 1 173 ? -11.801 0.232   -25.813 1.00 43.89  ? 124 ALA B N   1 
ATOM   4047 C  CA  . ALA B 1 173 ? -10.695 0.726   -24.969 1.00 43.48  ? 124 ALA B CA  1 
ATOM   4048 C  C   . ALA B 1 173 ? -10.096 2.095   -25.364 1.00 43.20  ? 124 ALA B C   1 
ATOM   4049 O  O   . ALA B 1 173 ? -9.740  2.885   -24.502 1.00 44.95  ? 124 ALA B O   1 
ATOM   4050 C  CB  . ALA B 1 173 ? -9.601  -0.333  -24.853 1.00 38.50  ? 124 ALA B CB  1 
ATOM   4051 N  N   . GLU B 1 174 ? -10.007 2.377   -26.655 1.00 47.13  ? 125 GLU B N   1 
ATOM   4052 C  CA  . GLU B 1 174 ? -9.407  3.620   -27.141 1.00 52.08  ? 125 GLU B CA  1 
ATOM   4053 C  C   . GLU B 1 174 ? -9.871  4.917   -26.477 1.00 54.21  ? 125 GLU B C   1 
ATOM   4054 O  O   . GLU B 1 174 ? -9.091  5.855   -26.355 1.00 60.03  ? 125 GLU B O   1 
ATOM   4055 C  CB  . GLU B 1 174 ? -9.606  3.761   -28.638 1.00 54.42  ? 125 GLU B CB  1 
ATOM   4056 C  CG  . GLU B 1 174 ? -8.729  4.856   -29.198 1.00 63.29  ? 125 GLU B CG  1 
ATOM   4057 C  CD  . GLU B 1 174 ? -8.655  4.827   -30.697 1.00 70.80  ? 125 GLU B CD  1 
ATOM   4058 O  OE1 . GLU B 1 174 ? -8.656  3.723   -31.292 1.00 75.53  ? 125 GLU B OE1 1 
ATOM   4059 O  OE2 . GLU B 1 174 ? -8.586  5.925   -31.278 1.00 73.88  ? 125 GLU B OE2 1 
ATOM   4060 N  N   . ILE B 1 175 ? -11.135 4.973   -26.068 1.00 50.80  ? 126 ILE B N   1 
ATOM   4061 C  CA  . ILE B 1 175 ? -11.711 6.178   -25.474 1.00 47.91  ? 126 ILE B CA  1 
ATOM   4062 C  C   . ILE B 1 175 ? -11.964 5.974   -23.964 1.00 49.77  ? 126 ILE B C   1 
ATOM   4063 O  O   . ILE B 1 175 ? -12.591 6.814   -23.301 1.00 45.82  ? 126 ILE B O   1 
ATOM   4064 C  CB  . ILE B 1 175 ? -12.984 6.659   -26.236 1.00 47.45  ? 126 ILE B CB  1 
ATOM   4065 C  CG1 . ILE B 1 175 ? -14.122 5.628   -26.125 1.00 48.11  ? 126 ILE B CG1 1 
ATOM   4066 C  CG2 . ILE B 1 175 ? -12.655 6.922   -27.697 1.00 45.10  ? 126 ILE B CG2 1 
ATOM   4067 C  CD1 . ILE B 1 175 ? -15.504 6.102   -26.542 1.00 44.68  ? 126 ILE B CD1 1 
ATOM   4068 N  N   . ALA B 1 176 ? -11.462 4.861   -23.426 1.00 47.42  ? 127 ALA B N   1 
ATOM   4069 C  CA  . ALA B 1 176 ? -11.476 4.633   -21.982 1.00 48.79  ? 127 ALA B CA  1 
ATOM   4070 C  C   . ALA B 1 176 ? -10.607 5.693   -21.263 1.00 50.60  ? 127 ALA B C   1 
ATOM   4071 O  O   . ALA B 1 176 ? -9.584  6.133   -21.793 1.00 52.49  ? 127 ALA B O   1 
ATOM   4072 C  CB  . ALA B 1 176 ? -11.005 3.216   -21.658 1.00 41.52  ? 127 ALA B CB  1 
ATOM   4073 N  N   . ARG B 1 177 ? -11.021 6.117   -20.070 1.00 51.22  ? 128 ARG B N   1 
ATOM   4074 C  CA  . ARG B 1 177 ? -10.182 7.003   -19.251 1.00 52.14  ? 128 ARG B CA  1 
ATOM   4075 C  C   . ARG B 1 177 ? -9.618  6.220   -18.082 1.00 52.02  ? 128 ARG B C   1 
ATOM   4076 O  O   . ARG B 1 177 ? -10.296 5.309   -17.591 1.00 49.73  ? 128 ARG B O   1 
ATOM   4077 C  CB  . ARG B 1 177 ? -10.968 8.223   -18.782 1.00 53.17  ? 128 ARG B CB  1 
ATOM   4078 C  CG  . ARG B 1 177 ? -11.776 8.786   -19.920 1.00 57.96  ? 128 ARG B CG  1 
ATOM   4079 C  CD  . ARG B 1 177 ? -11.912 10.285  -19.906 1.00 68.16  ? 128 ARG B CD  1 
ATOM   4080 N  NE  . ARG B 1 177 ? -13.012 10.620  -20.806 1.00 80.10  ? 128 ARG B NE  1 
ATOM   4081 C  CZ  . ARG B 1 177 ? -13.328 11.842  -21.225 1.00 80.45  ? 128 ARG B CZ  1 
ATOM   4082 N  NH1 . ARG B 1 177 ? -12.623 12.903  -20.829 1.00 78.31  ? 128 ARG B NH1 1 
ATOM   4083 N  NH2 . ARG B 1 177 ? -14.365 11.989  -22.041 1.00 76.41  ? 128 ARG B NH2 1 
ATOM   4084 N  N   . PRO B 1 178 ? -8.375  6.542   -17.641 1.00 52.18  ? 129 PRO B N   1 
ATOM   4085 C  CA  . PRO B 1 178 ? -7.417  7.574   -18.091 1.00 53.41  ? 129 PRO B CA  1 
ATOM   4086 C  C   . PRO B 1 178 ? -6.816  7.335   -19.466 1.00 55.97  ? 129 PRO B C   1 
ATOM   4087 O  O   . PRO B 1 178 ? -6.373  8.279   -20.107 1.00 55.73  ? 129 PRO B O   1 
ATOM   4088 C  CB  . PRO B 1 178 ? -6.284  7.486   -17.064 1.00 50.76  ? 129 PRO B CB  1 
ATOM   4089 C  CG  . PRO B 1 178 ? -6.875  6.794   -15.898 1.00 55.59  ? 129 PRO B CG  1 
ATOM   4090 C  CD  . PRO B 1 178 ? -7.861  5.826   -16.465 1.00 52.09  ? 129 PRO B CD  1 
ATOM   4091 N  N   . ASP B 1 179 ? -6.777  6.080   -19.898 1.00 55.63  ? 130 ASP B N   1 
ATOM   4092 C  CA  . ASP B 1 179 ? -6.165  5.709   -21.173 1.00 57.96  ? 130 ASP B CA  1 
ATOM   4093 C  C   . ASP B 1 179 ? -6.651  4.325   -21.570 1.00 55.52  ? 130 ASP B C   1 
ATOM   4094 O  O   . ASP B 1 179 ? -7.419  3.694   -20.828 1.00 52.41  ? 130 ASP B O   1 
ATOM   4095 C  CB  . ASP B 1 179 ? -4.632  5.713   -21.075 1.00 59.16  ? 130 ASP B CB  1 
ATOM   4096 C  CG  . ASP B 1 179 ? -4.128  4.983   -19.845 1.00 64.70  ? 130 ASP B CG  1 
ATOM   4097 O  OD1 . ASP B 1 179 ? -4.216  3.728   -19.801 1.00 56.28  ? 130 ASP B OD1 1 
ATOM   4098 O  OD2 . ASP B 1 179 ? -3.660  5.677   -18.910 1.00 71.44  ? 130 ASP B OD2 1 
ATOM   4099 N  N   . ASP B 1 180 ? -6.173  3.854   -22.719 1.00 50.59  ? 131 ASP B N   1 
ATOM   4100 C  CA  . ASP B 1 180 ? -6.702  2.652   -23.343 1.00 49.51  ? 131 ASP B CA  1 
ATOM   4101 C  C   . ASP B 1 180 ? -6.226  1.371   -22.669 1.00 47.63  ? 131 ASP B C   1 
ATOM   4102 O  O   . ASP B 1 180 ? -6.570  0.272   -23.091 1.00 49.43  ? 131 ASP B O   1 
ATOM   4103 C  CB  . ASP B 1 180 ? -6.425  2.643   -24.860 1.00 51.40  ? 131 ASP B CB  1 
ATOM   4104 C  CG  . ASP B 1 180 ? -4.951  2.581   -25.204 1.00 53.39  ? 131 ASP B CG  1 
ATOM   4105 O  OD1 . ASP B 1 180 ? -4.120  2.454   -24.295 1.00 58.70  ? 131 ASP B OD1 1 
ATOM   4106 O  OD2 . ASP B 1 180 ? -4.616  2.643   -26.403 1.00 58.83  ? 131 ASP B OD2 1 
ATOM   4107 N  N   . SER B 1 181 ? -5.452  1.523   -21.604 1.00 47.65  ? 132 SER B N   1 
ATOM   4108 C  CA  . SER B 1 181 ? -4.961  0.376   -20.866 1.00 50.71  ? 132 SER B CA  1 
ATOM   4109 C  C   . SER B 1 181 ? -6.001  -0.141  -19.875 1.00 49.05  ? 132 SER B C   1 
ATOM   4110 O  O   . SER B 1 181 ? -5.873  -1.270  -19.388 1.00 51.17  ? 132 SER B O   1 
ATOM   4111 C  CB  . SER B 1 181 ? -3.632  0.693   -20.159 1.00 52.17  ? 132 SER B CB  1 
ATOM   4112 O  OG  . SER B 1 181 ? -3.869  1.495   -19.007 1.00 54.64  ? 132 SER B OG  1 
ATOM   4113 N  N   . LEU B 1 182 ? -7.023  0.668   -19.575 1.00 47.48  ? 133 LEU B N   1 
ATOM   4114 C  CA  . LEU B 1 182 ? -8.101  0.227   -18.686 1.00 43.92  ? 133 LEU B CA  1 
ATOM   4115 C  C   . LEU B 1 182 ? -9.214  -0.476  -19.484 1.00 48.44  ? 133 LEU B C   1 
ATOM   4116 O  O   . LEU B 1 182 ? -10.061 0.183   -20.114 1.00 46.58  ? 133 LEU B O   1 
ATOM   4117 C  CB  . LEU B 1 182 ? -8.662  1.387   -17.878 1.00 40.58  ? 133 LEU B CB  1 
ATOM   4118 C  CG  . LEU B 1 182 ? -9.573  1.041   -16.693 1.00 42.59  ? 133 LEU B CG  1 
ATOM   4119 C  CD1 . LEU B 1 182 ? -8.745  0.742   -15.440 1.00 42.56  ? 133 LEU B CD1 1 
ATOM   4120 C  CD2 . LEU B 1 182 ? -10.548 2.176   -16.419 1.00 39.89  ? 133 LEU B CD2 1 
ATOM   4121 N  N   . GLU B 1 183 ? -9.189  -1.813  -19.431 1.00 43.18  ? 134 GLU B N   1 
ATOM   4122 C  CA  . GLU B 1 183 ? -10.110 -2.685  -20.121 1.00 42.77  ? 134 GLU B CA  1 
ATOM   4123 C  C   . GLU B 1 183 ? -11.568 -2.321  -19.826 1.00 45.47  ? 134 GLU B C   1 
ATOM   4124 O  O   . GLU B 1 183 ? -11.964 -2.197  -18.653 1.00 43.68  ? 134 GLU B O   1 
ATOM   4125 C  CB  . GLU B 1 183 ? -9.832  -4.140  -19.713 1.00 43.12  ? 134 GLU B CB  1 
ATOM   4126 C  CG  . GLU B 1 183 ? -10.362 -5.185  -20.681 1.00 44.70  ? 134 GLU B CG  1 
ATOM   4127 C  CD  . GLU B 1 183 ? -9.987  -6.613  -20.302 1.00 48.82  ? 134 GLU B CD  1 
ATOM   4128 O  OE1 . GLU B 1 183 ? -9.279  -7.269  -21.096 1.00 56.19  ? 134 GLU B OE1 1 
ATOM   4129 O  OE2 . GLU B 1 183 ? -10.386 -7.095  -19.217 1.00 46.80  ? 134 GLU B OE2 1 
ATOM   4130 N  N   . PRO B 1 184 ? -12.378 -2.134  -20.891 1.00 45.20  ? 135 PRO B N   1 
ATOM   4131 C  CA  . PRO B 1 184 ? -13.812 -1.868  -20.663 1.00 43.05  ? 135 PRO B CA  1 
ATOM   4132 C  C   . PRO B 1 184 ? -14.521 -3.130  -20.187 1.00 47.06  ? 135 PRO B C   1 
ATOM   4133 O  O   . PRO B 1 184 ? -14.033 -4.249  -20.442 1.00 49.16  ? 135 PRO B O   1 
ATOM   4134 C  CB  . PRO B 1 184 ? -14.320 -1.431  -22.039 1.00 42.87  ? 135 PRO B CB  1 
ATOM   4135 C  CG  . PRO B 1 184 ? -13.095 -0.948  -22.763 1.00 42.54  ? 135 PRO B CG  1 
ATOM   4136 C  CD  . PRO B 1 184 ? -11.975 -1.837  -22.277 1.00 42.62  ? 135 PRO B CD  1 
ATOM   4137 N  N   . PHE B 1 185 ? -15.632 -2.958  -19.471 1.00 42.02  ? 136 PHE B N   1 
ATOM   4138 C  CA  . PHE B 1 185 ? -16.375 -4.083  -18.957 1.00 42.41  ? 136 PHE B CA  1 
ATOM   4139 C  C   . PHE B 1 185 ? -16.613 -5.199  -20.003 1.00 45.27  ? 136 PHE B C   1 
ATOM   4140 O  O   . PHE B 1 185 ? -16.284 -6.363  -19.735 1.00 44.27  ? 136 PHE B O   1 
ATOM   4141 C  CB  . PHE B 1 185 ? -17.693 -3.614  -18.300 1.00 43.74  ? 136 PHE B CB  1 
ATOM   4142 C  CG  . PHE B 1 185 ? -18.597 -4.749  -17.894 1.00 44.96  ? 136 PHE B CG  1 
ATOM   4143 C  CD1 . PHE B 1 185 ? -18.451 -5.357  -16.653 1.00 44.30  ? 136 PHE B CD1 1 
ATOM   4144 C  CD2 . PHE B 1 185 ? -19.580 -5.231  -18.768 1.00 45.63  ? 136 PHE B CD2 1 
ATOM   4145 C  CE1 . PHE B 1 185 ? -19.265 -6.410  -16.276 1.00 47.57  ? 136 PHE B CE1 1 
ATOM   4146 C  CE2 . PHE B 1 185 ? -20.401 -6.291  -18.395 1.00 47.67  ? 136 PHE B CE2 1 
ATOM   4147 C  CZ  . PHE B 1 185 ? -20.245 -6.878  -17.148 1.00 48.15  ? 136 PHE B CZ  1 
ATOM   4148 N  N   . PHE B 1 186 ? -17.165 -4.862  -21.179 1.00 43.98  ? 137 PHE B N   1 
ATOM   4149 C  CA  . PHE B 1 186 ? -17.538 -5.905  -22.160 1.00 46.14  ? 137 PHE B CA  1 
ATOM   4150 C  C   . PHE B 1 186 ? -16.336 -6.779  -22.600 1.00 46.98  ? 137 PHE B C   1 
ATOM   4151 O  O   . PHE B 1 186 ? -16.464 -8.002  -22.758 1.00 43.85  ? 137 PHE B O   1 
ATOM   4152 C  CB  . PHE B 1 186 ? -18.350 -5.353  -23.371 1.00 45.85  ? 137 PHE B CB  1 
ATOM   4153 C  CG  . PHE B 1 186 ? -19.204 -6.403  -24.067 1.00 44.01  ? 137 PHE B CG  1 
ATOM   4154 C  CD1 . PHE B 1 186 ? -20.509 -6.655  -23.655 1.00 46.35  ? 137 PHE B CD1 1 
ATOM   4155 C  CD2 . PHE B 1 186 ? -18.693 -7.166  -25.106 1.00 44.45  ? 137 PHE B CD2 1 
ATOM   4156 C  CE1 . PHE B 1 186 ? -21.278 -7.646  -24.268 1.00 45.56  ? 137 PHE B CE1 1 
ATOM   4157 C  CE2 . PHE B 1 186 ? -19.462 -8.149  -25.730 1.00 44.91  ? 137 PHE B CE2 1 
ATOM   4158 C  CZ  . PHE B 1 186 ? -20.754 -8.389  -25.311 1.00 45.50  ? 137 PHE B CZ  1 
ATOM   4159 N  N   . ASP B 1 187 ? -15.164 -6.161  -22.760 1.00 50.36  ? 138 ASP B N   1 
ATOM   4160 C  CA  . ASP B 1 187 ? -13.945 -6.900  -23.099 1.00 48.63  ? 138 ASP B CA  1 
ATOM   4161 C  C   . ASP B 1 187 ? -13.613 -7.882  -21.990 1.00 50.39  ? 138 ASP B C   1 
ATOM   4162 O  O   . ASP B 1 187 ? -13.351 -9.056  -22.267 1.00 50.65  ? 138 ASP B O   1 
ATOM   4163 C  CB  . ASP B 1 187 ? -12.773 -5.972  -23.340 1.00 49.95  ? 138 ASP B CB  1 
ATOM   4164 C  CG  . ASP B 1 187 ? -13.005 -5.029  -24.497 1.00 53.85  ? 138 ASP B CG  1 
ATOM   4165 O  OD1 . ASP B 1 187 ? -13.730 -4.030  -24.336 1.00 55.68  ? 138 ASP B OD1 1 
ATOM   4166 O  OD2 . ASP B 1 187 ? -12.430 -5.265  -25.573 1.00 62.56  ? 138 ASP B OD2 1 
ATOM   4167 N  N   . SER B 1 188 ? -13.673 -7.421  -20.738 1.00 47.36  ? 139 SER B N   1 
ATOM   4168 C  CA  . SER B 1 188 ? -13.517 -8.319  -19.589 1.00 46.50  ? 139 SER B CA  1 
ATOM   4169 C  C   . SER B 1 188 ? -14.471 -9.494  -19.637 1.00 46.74  ? 139 SER B C   1 
ATOM   4170 O  O   . SER B 1 188 ? -14.066 -10.630 -19.379 1.00 51.30  ? 139 SER B O   1 
ATOM   4171 C  CB  . SER B 1 188 ? -13.725 -7.572  -18.284 1.00 42.58  ? 139 SER B CB  1 
ATOM   4172 O  OG  . SER B 1 188 ? -12.624 -6.727  -18.071 1.00 46.97  ? 139 SER B OG  1 
ATOM   4173 N  N   . LEU B 1 189 ? -15.735 -9.204  -19.955 1.00 48.15  ? 140 LEU B N   1 
ATOM   4174 C  CA  . LEU B 1 189 ? -16.795 -10.217 -20.046 1.00 49.43  ? 140 LEU B CA  1 
ATOM   4175 C  C   . LEU B 1 189 ? -16.467 -11.267 -21.104 1.00 48.02  ? 140 LEU B C   1 
ATOM   4176 O  O   . LEU B 1 189 ? -16.630 -12.463 -20.867 1.00 49.84  ? 140 LEU B O   1 
ATOM   4177 C  CB  . LEU B 1 189 ? -18.161 -9.564  -20.314 1.00 46.37  ? 140 LEU B CB  1 
ATOM   4178 C  CG  . LEU B 1 189 ? -19.404 -10.458 -20.412 1.00 48.43  ? 140 LEU B CG  1 
ATOM   4179 C  CD1 . LEU B 1 189 ? -19.782 -11.100 -19.076 1.00 47.46  ? 140 LEU B CD1 1 
ATOM   4180 C  CD2 . LEU B 1 189 ? -20.563 -9.624  -20.923 1.00 46.59  ? 140 LEU B CD2 1 
ATOM   4181 N  N   . VAL B 1 190 ? -15.956 -10.815 -22.243 1.00 47.77  ? 141 VAL B N   1 
ATOM   4182 C  CA  . VAL B 1 190 ? -15.630 -11.703 -23.360 1.00 49.78  ? 141 VAL B CA  1 
ATOM   4183 C  C   . VAL B 1 190 ? -14.351 -12.525 -23.108 1.00 52.08  ? 141 VAL B C   1 
ATOM   4184 O  O   . VAL B 1 190 ? -14.325 -13.756 -23.301 1.00 56.48  ? 141 VAL B O   1 
ATOM   4185 C  CB  . VAL B 1 190 ? -15.646 -10.908 -24.679 1.00 48.23  ? 141 VAL B CB  1 
ATOM   4186 C  CG1 . VAL B 1 190 ? -15.099 -11.714 -25.846 1.00 44.31  ? 141 VAL B CG1 1 
ATOM   4187 C  CG2 . VAL B 1 190 ? -17.077 -10.478 -24.949 1.00 43.06  ? 141 VAL B CG2 1 
ATOM   4188 N  N   . LYS B 1 191 ? -13.322 -11.855 -22.607 1.00 50.41  ? 142 LYS B N   1 
ATOM   4189 C  CA  . LYS B 1 191 ? -12.085 -12.521 -22.192 1.00 53.13  ? 142 LYS B CA  1 
ATOM   4190 C  C   . LYS B 1 191 ? -12.305 -13.606 -21.135 1.00 52.26  ? 142 LYS B C   1 
ATOM   4191 O  O   . LYS B 1 191 ? -11.748 -14.691 -21.241 1.00 50.26  ? 142 LYS B O   1 
ATOM   4192 C  CB  . LYS B 1 191 ? -11.073 -11.494 -21.675 1.00 58.12  ? 142 LYS B CB  1 
ATOM   4193 C  CG  . LYS B 1 191 ? -9.649  -11.728 -22.151 1.00 67.07  ? 142 LYS B CG  1 
ATOM   4194 C  CD  . LYS B 1 191 ? -8.993  -10.406 -22.535 1.00 75.23  ? 142 LYS B CD  1 
ATOM   4195 C  CE  . LYS B 1 191 ? -7.961  -10.639 -23.622 1.00 81.31  ? 142 LYS B CE  1 
ATOM   4196 N  NZ  . LYS B 1 191 ? -7.976  -9.509  -24.584 1.00 87.62  ? 142 LYS B NZ  1 
ATOM   4197 N  N   . GLN B 1 192 ? -13.116 -13.319 -20.122 1.00 51.88  ? 143 GLN B N   1 
ATOM   4198 C  CA  . GLN B 1 192 ? -13.264 -14.248 -19.014 1.00 54.59  ? 143 GLN B CA  1 
ATOM   4199 C  C   . GLN B 1 192 ? -14.329 -15.350 -19.192 1.00 57.68  ? 143 GLN B C   1 
ATOM   4200 O  O   . GLN B 1 192 ? -14.285 -16.358 -18.488 1.00 58.44  ? 143 GLN B O   1 
ATOM   4201 C  CB  . GLN B 1 192 ? -13.463 -13.482 -17.706 1.00 50.32  ? 143 GLN B CB  1 
ATOM   4202 C  CG  . GLN B 1 192 ? -12.253 -12.660 -17.323 1.00 44.00  ? 143 GLN B CG  1 
ATOM   4203 C  CD  . GLN B 1 192 ? -12.578 -11.631 -16.272 1.00 45.56  ? 143 GLN B CD  1 
ATOM   4204 O  OE1 . GLN B 1 192 ? -13.343 -11.887 -15.339 1.00 48.56  ? 143 GLN B OE1 1 
ATOM   4205 N  NE2 . GLN B 1 192 ? -12.008 -10.447 -16.422 1.00 45.69  ? 143 GLN B NE2 1 
ATOM   4206 N  N   . THR B 1 193 ? -15.263 -15.179 -20.127 1.00 56.97  ? 144 THR B N   1 
ATOM   4207 C  CA  . THR B 1 193 ? -16.354 -16.140 -20.283 1.00 57.25  ? 144 THR B CA  1 
ATOM   4208 C  C   . THR B 1 193 ? -16.467 -16.751 -21.685 1.00 60.15  ? 144 THR B C   1 
ATOM   4209 O  O   . THR B 1 193 ? -15.637 -16.509 -22.569 1.00 57.45  ? 144 THR B O   1 
ATOM   4210 C  CB  . THR B 1 193 ? -17.727 -15.498 -19.982 1.00 57.14  ? 144 THR B CB  1 
ATOM   4211 O  OG1 . THR B 1 193 ? -18.065 -14.620 -21.058 1.00 57.77  ? 144 THR B OG1 1 
ATOM   4212 C  CG2 . THR B 1 193 ? -17.744 -14.739 -18.650 1.00 48.18  ? 144 THR B CG2 1 
ATOM   4213 N  N   . HIS B 1 194 ? -17.532 -17.530 -21.877 1.00 64.33  ? 145 HIS B N   1 
ATOM   4214 C  CA  . HIS B 1 194 ? -17.872 -18.046 -23.194 1.00 69.99  ? 145 HIS B CA  1 
ATOM   4215 C  C   . HIS B 1 194 ? -18.969 -17.222 -23.874 1.00 67.78  ? 145 HIS B C   1 
ATOM   4216 O  O   . HIS B 1 194 ? -19.543 -17.662 -24.874 1.00 63.90  ? 145 HIS B O   1 
ATOM   4217 C  CB  . HIS B 1 194 ? -18.258 -19.530 -23.118 1.00 79.06  ? 145 HIS B CB  1 
ATOM   4218 C  CG  . HIS B 1 194 ? -17.078 -20.451 -23.062 1.00 86.13  ? 145 HIS B CG  1 
ATOM   4219 N  ND1 . HIS B 1 194 ? -16.793 -21.231 -21.956 1.00 88.88  ? 145 HIS B ND1 1 
ATOM   4220 C  CD2 . HIS B 1 194 ? -16.095 -20.694 -23.964 1.00 86.30  ? 145 HIS B CD2 1 
ATOM   4221 C  CE1 . HIS B 1 194 ? -15.689 -21.921 -22.182 1.00 89.77  ? 145 HIS B CE1 1 
ATOM   4222 N  NE2 . HIS B 1 194 ? -15.246 -21.614 -23.393 1.00 87.59  ? 145 HIS B NE2 1 
ATOM   4223 N  N   . VAL B 1 195 ? -19.261 -16.034 -23.334 1.00 63.94  ? 146 VAL B N   1 
ATOM   4224 C  CA  . VAL B 1 195 ? -20.252 -15.141 -23.939 1.00 54.97  ? 146 VAL B CA  1 
ATOM   4225 C  C   . VAL B 1 195 ? -19.647 -14.690 -25.255 1.00 54.49  ? 146 VAL B C   1 
ATOM   4226 O  O   . VAL B 1 195 ? -18.463 -14.369 -25.271 1.00 55.86  ? 146 VAL B O   1 
ATOM   4227 C  CB  . VAL B 1 195 ? -20.556 -13.920 -23.048 1.00 54.19  ? 146 VAL B CB  1 
ATOM   4228 C  CG1 . VAL B 1 195 ? -21.447 -12.924 -23.780 1.00 49.64  ? 146 VAL B CG1 1 
ATOM   4229 C  CG2 . VAL B 1 195 ? -21.204 -14.351 -21.731 1.00 51.32  ? 146 VAL B CG2 1 
ATOM   4230 N  N   . PRO B 1 196 ? -20.427 -14.730 -26.365 1.00 48.46  ? 147 PRO B N   1 
ATOM   4231 C  CA  . PRO B 1 196 ? -19.934 -14.289 -27.670 1.00 47.19  ? 147 PRO B CA  1 
ATOM   4232 C  C   . PRO B 1 196 ? -19.810 -12.757 -27.744 1.00 49.82  ? 147 PRO B C   1 
ATOM   4233 O  O   . PRO B 1 196 ? -20.560 -12.043 -27.057 1.00 48.52  ? 147 PRO B O   1 
ATOM   4234 C  CB  . PRO B 1 196 ? -21.011 -14.771 -28.647 1.00 46.37  ? 147 PRO B CB  1 
ATOM   4235 C  CG  . PRO B 1 196 ? -21.836 -15.737 -27.901 1.00 47.24  ? 147 PRO B CG  1 
ATOM   4236 C  CD  . PRO B 1 196 ? -21.785 -15.287 -26.470 1.00 49.68  ? 147 PRO B CD  1 
ATOM   4237 N  N   . ASN B 1 197 ? -18.871 -12.270 -28.566 1.00 48.17  ? 148 ASN B N   1 
ATOM   4238 C  CA  . ASN B 1 197 ? -18.553 -10.832 -28.659 1.00 45.92  ? 148 ASN B CA  1 
ATOM   4239 C  C   . ASN B 1 197 ? -19.585 -10.052 -29.507 1.00 45.43  ? 148 ASN B C   1 
ATOM   4240 O  O   . ASN B 1 197 ? -19.372 -9.738  -30.692 1.00 47.66  ? 148 ASN B O   1 
ATOM   4241 C  CB  . ASN B 1 197 ? -17.106 -10.623 -29.135 1.00 42.97  ? 148 ASN B CB  1 
ATOM   4242 C  CG  . ASN B 1 197 ? -16.659 -9.173  -29.031 1.00 48.47  ? 148 ASN B CG  1 
ATOM   4243 O  OD1 . ASN B 1 197 ? -17.159 -8.417  -28.192 1.00 50.66  ? 148 ASN B OD1 1 
ATOM   4244 N  ND2 . ASN B 1 197 ? -15.704 -8.774  -29.883 1.00 48.50  ? 148 ASN B ND2 1 
ATOM   4245 N  N   . LEU B 1 198 ? -20.710 -9.757  -28.865 1.00 44.26  ? 149 LEU B N   1 
ATOM   4246 C  CA  . LEU B 1 198 ? -21.889 -9.217  -29.511 1.00 45.73  ? 149 LEU B CA  1 
ATOM   4247 C  C   . LEU B 1 198 ? -22.929 -8.909  -28.423 1.00 49.19  ? 149 LEU B C   1 
ATOM   4248 O  O   . LEU B 1 198 ? -23.125 -9.691  -27.490 1.00 47.98  ? 149 LEU B O   1 
ATOM   4249 C  CB  . LEU B 1 198 ? -22.440 -10.220 -30.531 1.00 46.62  ? 149 LEU B CB  1 
ATOM   4250 C  CG  . LEU B 1 198 ? -23.706 -9.842  -31.298 1.00 50.98  ? 149 LEU B CG  1 
ATOM   4251 C  CD1 . LEU B 1 198 ? -23.794 -10.526 -32.655 1.00 49.86  ? 149 LEU B CD1 1 
ATOM   4252 C  CD2 . LEU B 1 198 ? -24.937 -10.157 -30.474 1.00 53.78  ? 149 LEU B CD2 1 
ATOM   4253 N  N   . PHE B 1 199 ? -23.568 -7.747  -28.529 1.00 49.28  ? 150 PHE B N   1 
ATOM   4254 C  CA  . PHE B 1 199 ? -24.732 -7.435  -27.719 1.00 46.47  ? 150 PHE B CA  1 
ATOM   4255 C  C   . PHE B 1 199 ? -25.718 -6.646  -28.575 1.00 47.21  ? 150 PHE B C   1 
ATOM   4256 O  O   . PHE B 1 199 ? -25.321 -6.050  -29.590 1.00 49.82  ? 150 PHE B O   1 
ATOM   4257 C  CB  . PHE B 1 199 ? -24.355 -6.673  -26.437 1.00 43.90  ? 150 PHE B CB  1 
ATOM   4258 C  CG  . PHE B 1 199 ? -23.838 -5.289  -26.680 1.00 43.08  ? 150 PHE B CG  1 
ATOM   4259 C  CD1 . PHE B 1 199 ? -22.496 -5.076  -26.960 1.00 45.23  ? 150 PHE B CD1 1 
ATOM   4260 C  CD2 . PHE B 1 199 ? -24.682 -4.195  -26.611 1.00 40.90  ? 150 PHE B CD2 1 
ATOM   4261 C  CE1 . PHE B 1 199 ? -22.016 -3.797  -27.196 1.00 45.40  ? 150 PHE B CE1 1 
ATOM   4262 C  CE2 . PHE B 1 199 ? -24.204 -2.916  -26.843 1.00 41.87  ? 150 PHE B CE2 1 
ATOM   4263 C  CZ  . PHE B 1 199 ? -22.872 -2.714  -27.130 1.00 42.54  ? 150 PHE B CZ  1 
ATOM   4264 N  N   . SER B 1 200 ? -26.993 -6.638  -28.165 1.00 43.74  ? 151 SER B N   1 
ATOM   4265 C  CA  . SER B 1 200 ? -28.027 -5.956  -28.926 1.00 41.38  ? 151 SER B CA  1 
ATOM   4266 C  C   . SER B 1 200 ? -29.001 -5.190  -28.030 1.00 43.04  ? 151 SER B C   1 
ATOM   4267 O  O   . SER B 1 200 ? -29.174 -5.513  -26.842 1.00 43.81  ? 151 SER B O   1 
ATOM   4268 C  CB  . SER B 1 200 ? -28.731 -6.930  -29.865 1.00 40.76  ? 151 SER B CB  1 
ATOM   4269 O  OG  . SER B 1 200 ? -29.388 -7.936  -29.130 1.00 45.36  ? 151 SER B OG  1 
ATOM   4270 N  N   . LEU B 1 201 ? -29.603 -4.146  -28.598 1.00 43.31  ? 152 LEU B N   1 
ATOM   4271 C  CA  . LEU B 1 201 ? -30.331 -3.155  -27.810 1.00 41.33  ? 152 LEU B CA  1 
ATOM   4272 C  C   . LEU B 1 201 ? -31.674 -2.816  -28.434 1.00 40.83  ? 152 LEU B C   1 
ATOM   4273 O  O   . LEU B 1 201 ? -31.734 -2.433  -29.603 1.00 38.24  ? 152 LEU B O   1 
ATOM   4274 C  CB  . LEU B 1 201 ? -29.492 -1.886  -27.620 1.00 42.94  ? 152 LEU B CB  1 
ATOM   4275 C  CG  . LEU B 1 201 ? -28.274 -1.907  -26.679 1.00 45.85  ? 152 LEU B CG  1 
ATOM   4276 C  CD1 . LEU B 1 201 ? -27.739 -0.498  -26.468 1.00 42.63  ? 152 LEU B CD1 1 
ATOM   4277 C  CD2 . LEU B 1 201 ? -28.625 -2.518  -25.329 1.00 47.95  ? 152 LEU B CD2 1 
ATOM   4278 N  N   . GLN B 1 202 ? -32.736 -3.026  -27.649 1.00 39.80  ? 153 GLN B N   1 
ATOM   4279 C  CA  . GLN B 1 202 ? -34.088 -2.595  -27.959 1.00 39.41  ? 153 GLN B CA  1 
ATOM   4280 C  C   . GLN B 1 202 ? -34.467 -1.509  -26.943 1.00 41.59  ? 153 GLN B C   1 
ATOM   4281 O  O   . GLN B 1 202 ? -34.873 -1.804  -25.816 1.00 49.68  ? 153 GLN B O   1 
ATOM   4282 C  CB  . GLN B 1 202 ? -35.063 -3.775  -27.848 1.00 39.80  ? 153 GLN B CB  1 
ATOM   4283 C  CG  . GLN B 1 202 ? -36.339 -3.588  -28.656 1.00 45.72  ? 153 GLN B CG  1 
ATOM   4284 C  CD  . GLN B 1 202 ? -37.555 -4.350  -28.107 1.00 52.04  ? 153 GLN B CD  1 
ATOM   4285 O  OE1 . GLN B 1 202 ? -37.802 -4.391  -26.890 1.00 48.70  ? 153 GLN B OE1 1 
ATOM   4286 N  NE2 . GLN B 1 202 ? -38.342 -4.939  -29.023 1.00 52.64  ? 153 GLN B NE2 1 
ATOM   4287 N  N   . LEU B 1 203 ? -34.302 -0.251  -27.306 1.00 40.55  ? 154 LEU B N   1 
ATOM   4288 C  CA  . LEU B 1 203 ? -34.746 0.820   -26.412 1.00 38.54  ? 154 LEU B CA  1 
ATOM   4289 C  C   . LEU B 1 203 ? -36.227 1.113   -26.709 1.00 39.17  ? 154 LEU B C   1 
ATOM   4290 O  O   . LEU B 1 203 ? -36.569 1.398   -27.861 1.00 39.10  ? 154 LEU B O   1 
ATOM   4291 C  CB  . LEU B 1 203 ? -33.853 2.061   -26.584 1.00 37.90  ? 154 LEU B CB  1 
ATOM   4292 C  CG  . LEU B 1 203 ? -32.336 1.880   -26.371 1.00 38.34  ? 154 LEU B CG  1 
ATOM   4293 C  CD1 . LEU B 1 203 ? -31.667 3.232   -26.297 1.00 38.94  ? 154 LEU B CD1 1 
ATOM   4294 C  CD2 . LEU B 1 203 ? -31.995 1.064   -25.125 1.00 37.89  ? 154 LEU B CD2 1 
ATOM   4295 N  N   . CYS B 1 204 ? -37.103 0.992   -25.699 1.00 39.47  ? 155 CYS B N   1 
ATOM   4296 C  CA  . CYS B 1 204 ? -38.566 1.140   -25.902 1.00 42.32  ? 155 CYS B CA  1 
ATOM   4297 C  C   . CYS B 1 204 ? -39.158 2.436   -25.324 1.00 45.85  ? 155 CYS B C   1 
ATOM   4298 O  O   . CYS B 1 204 ? -39.365 2.537   -24.120 1.00 47.39  ? 155 CYS B O   1 
ATOM   4299 C  CB  . CYS B 1 204 ? -39.324 -0.069  -25.340 1.00 43.26  ? 155 CYS B CB  1 
ATOM   4300 S  SG  . CYS B 1 204 ? -38.935 -1.614  -26.196 1.00 48.95  ? 155 CYS B SG  1 
ATOM   4301 N  N   . GLY B 1 205 ? -39.432 3.417   -26.186 1.00 44.04  ? 156 GLY B N   1 
ATOM   4302 C  CA  . GLY B 1 205 ? -40.043 4.672   -25.755 1.00 46.03  ? 156 GLY B CA  1 
ATOM   4303 C  C   . GLY B 1 205 ? -41.544 4.501   -25.667 1.00 52.19  ? 156 GLY B C   1 
ATOM   4304 O  O   . GLY B 1 205 ? -42.153 3.838   -26.534 1.00 50.80  ? 156 GLY B O   1 
ATOM   4305 N  N   . ALA B 1 206 ? -42.143 5.079   -24.623 1.00 49.35  ? 157 ALA B N   1 
ATOM   4306 C  CA  . ALA B 1 206 ? -43.546 4.816   -24.330 1.00 45.88  ? 157 ALA B CA  1 
ATOM   4307 C  C   . ALA B 1 206 ? -44.482 5.407   -25.391 1.00 46.70  ? 157 ALA B C   1 
ATOM   4308 O  O   . ALA B 1 206 ? -45.502 4.803   -25.738 1.00 43.87  ? 157 ALA B O   1 
ATOM   4309 C  CB  . ALA B 1 206 ? -43.902 5.316   -22.938 1.00 44.01  ? 157 ALA B CB  1 
ATOM   4310 N  N   . GLY B 1 207 ? -44.114 6.582   -25.900 1.00 49.45  ? 158 GLY B N   1 
ATOM   4311 C  CA  . GLY B 1 207 ? -44.940 7.339   -26.823 1.00 47.09  ? 158 GLY B CA  1 
ATOM   4312 C  C   . GLY B 1 207 ? -45.760 8.395   -26.111 1.00 49.89  ? 158 GLY B C   1 
ATOM   4313 O  O   . GLY B 1 207 ? -46.558 9.098   -26.734 1.00 53.18  ? 158 GLY B O   1 
ATOM   4314 N  N   . PHE B 1 208 ? -45.553 8.504   -24.801 1.00 53.27  ? 159 PHE B N   1 
ATOM   4315 C  CA  . PHE B 1 208 ? -46.281 9.427   -23.917 1.00 54.30  ? 159 PHE B CA  1 
ATOM   4316 C  C   . PHE B 1 208 ? -45.462 9.582   -22.613 1.00 54.92  ? 159 PHE B C   1 
ATOM   4317 O  O   . PHE B 1 208 ? -44.588 8.757   -22.344 1.00 51.14  ? 159 PHE B O   1 
ATOM   4318 C  CB  . PHE B 1 208 ? -47.715 8.915   -23.658 1.00 50.36  ? 159 PHE B CB  1 
ATOM   4319 C  CG  . PHE B 1 208 ? -47.786 7.482   -23.201 1.00 49.70  ? 159 PHE B CG  1 
ATOM   4320 C  CD1 . PHE B 1 208 ? -47.680 7.160   -21.845 1.00 52.12  ? 159 PHE B CD1 1 
ATOM   4321 C  CD2 . PHE B 1 208 ? -47.977 6.449   -24.121 1.00 48.80  ? 159 PHE B CD2 1 
ATOM   4322 C  CE1 . PHE B 1 208 ? -47.739 5.835   -21.419 1.00 50.46  ? 159 PHE B CE1 1 
ATOM   4323 C  CE2 . PHE B 1 208 ? -48.035 5.127   -23.703 1.00 47.95  ? 159 PHE B CE2 1 
ATOM   4324 C  CZ  . PHE B 1 208 ? -47.916 4.822   -22.351 1.00 50.42  ? 159 PHE B CZ  1 
ATOM   4325 N  N   . PRO B 1 209 ? -45.715 10.639  -21.809 1.00 58.47  ? 160 PRO B N   1 
ATOM   4326 C  CA  . PRO B 1 209 ? -44.860 10.808  -20.622 1.00 61.53  ? 160 PRO B CA  1 
ATOM   4327 C  C   . PRO B 1 209 ? -45.135 9.750   -19.560 1.00 64.50  ? 160 PRO B C   1 
ATOM   4328 O  O   . PRO B 1 209 ? -46.253 9.240   -19.465 1.00 66.09  ? 160 PRO B O   1 
ATOM   4329 C  CB  . PRO B 1 209 ? -45.239 12.199  -20.093 1.00 58.76  ? 160 PRO B CB  1 
ATOM   4330 C  CG  . PRO B 1 209 ? -46.087 12.823  -21.166 1.00 61.66  ? 160 PRO B CG  1 
ATOM   4331 C  CD  . PRO B 1 209 ? -46.753 11.682  -21.872 1.00 58.56  ? 160 PRO B CD  1 
ATOM   4332 N  N   . LEU B 1 210 ? -44.104 9.402   -18.800 1.00 67.73  ? 161 LEU B N   1 
ATOM   4333 C  CA  . LEU B 1 210 ? -44.224 8.440   -17.721 1.00 67.13  ? 161 LEU B CA  1 
ATOM   4334 C  C   . LEU B 1 210 ? -43.817 9.130   -16.425 1.00 71.10  ? 161 LEU B C   1 
ATOM   4335 O  O   . LEU B 1 210 ? -42.696 9.650   -16.337 1.00 73.61  ? 161 LEU B O   1 
ATOM   4336 C  CB  . LEU B 1 210 ? -43.333 7.231   -17.996 1.00 62.69  ? 161 LEU B CB  1 
ATOM   4337 C  CG  . LEU B 1 210 ? -43.736 6.258   -19.104 1.00 62.85  ? 161 LEU B CG  1 
ATOM   4338 C  CD1 . LEU B 1 210 ? -42.588 5.308   -19.430 1.00 59.02  ? 161 LEU B CD1 1 
ATOM   4339 C  CD2 . LEU B 1 210 ? -44.990 5.486   -18.716 1.00 62.45  ? 161 LEU B CD2 1 
ATOM   4340 N  N   . ASN B 1 211 ? -44.719 9.150   -15.434 1.00 70.67  ? 162 ASN B N   1 
ATOM   4341 C  CA  . ASN B 1 211 ? -44.373 9.679   -14.096 1.00 75.06  ? 162 ASN B CA  1 
ATOM   4342 C  C   . ASN B 1 211 ? -43.383 8.731   -13.398 1.00 76.04  ? 162 ASN B C   1 
ATOM   4343 O  O   . ASN B 1 211 ? -43.186 7.602   -13.877 1.00 72.97  ? 162 ASN B O   1 
ATOM   4344 C  CB  . ASN B 1 211 ? -45.633 9.978   -13.243 1.00 69.26  ? 162 ASN B CB  1 
ATOM   4345 C  CG  . ASN B 1 211 ? -46.414 8.728   -12.844 1.00 68.98  ? 162 ASN B CG  1 
ATOM   4346 O  OD1 . ASN B 1 211 ? -45.891 7.611   -12.823 1.00 70.70  ? 162 ASN B OD1 1 
ATOM   4347 N  ND2 . ASN B 1 211 ? -47.675 8.923   -12.498 1.00 69.44  ? 162 ASN B ND2 1 
ATOM   4348 N  N   . GLN B 1 212 ? -42.766 9.149   -12.288 1.00 80.15  ? 163 GLN B N   1 
ATOM   4349 C  CA  . GLN B 1 212 ? -41.731 8.283   -11.685 1.00 82.02  ? 163 GLN B CA  1 
ATOM   4350 C  C   . GLN B 1 212 ? -42.223 6.905   -11.213 1.00 77.24  ? 163 GLN B C   1 
ATOM   4351 O  O   . GLN B 1 212 ? -41.482 5.921   -11.324 1.00 75.70  ? 163 GLN B O   1 
ATOM   4352 C  CB  . GLN B 1 212 ? -40.895 8.972   -10.605 1.00 84.45  ? 163 GLN B CB  1 
ATOM   4353 C  CG  . GLN B 1 212 ? -39.509 8.337   -10.501 1.00 87.71  ? 163 GLN B CG  1 
ATOM   4354 C  CD  . GLN B 1 212 ? -38.719 8.833   -9.311  1.00 99.41  ? 163 GLN B CD  1 
ATOM   4355 O  OE1 . GLN B 1 212 ? -38.513 10.036  -9.148  1.00 105.96 ? 163 GLN B OE1 1 
ATOM   4356 N  NE2 . GLN B 1 212 ? -38.262 7.905   -8.471  1.00 94.29  ? 163 GLN B NE2 1 
ATOM   4357 N  N   . SER B 1 213 ? -43.460 6.826   -10.715 1.00 71.97  ? 164 SER B N   1 
ATOM   4358 C  CA  . SER B 1 213 ? -44.044 5.520   -10.357 1.00 72.26  ? 164 SER B CA  1 
ATOM   4359 C  C   . SER B 1 213 ? -44.086 4.633   -11.596 1.00 66.23  ? 164 SER B C   1 
ATOM   4360 O  O   . SER B 1 213 ? -43.731 3.456   -11.533 1.00 62.68  ? 164 SER B O   1 
ATOM   4361 C  CB  . SER B 1 213 ? -45.457 5.657   -9.764  1.00 71.48  ? 164 SER B CB  1 
ATOM   4362 O  OG  . SER B 1 213 ? -45.623 6.907   -9.112  1.00 68.17  ? 164 SER B OG  1 
ATOM   4363 N  N   . GLU B 1 214 ? -44.509 5.229   -12.714 1.00 67.12  ? 165 GLU B N   1 
ATOM   4364 C  CA  . GLU B 1 214 ? -44.668 4.533   -13.990 1.00 68.11  ? 165 GLU B CA  1 
ATOM   4365 C  C   . GLU B 1 214 ? -43.349 4.084   -14.614 1.00 63.39  ? 165 GLU B C   1 
ATOM   4366 O  O   . GLU B 1 214 ? -43.252 2.946   -15.092 1.00 62.64  ? 165 GLU B O   1 
ATOM   4367 C  CB  . GLU B 1 214 ? -45.452 5.391   -14.987 1.00 74.45  ? 165 GLU B CB  1 
ATOM   4368 C  CG  . GLU B 1 214 ? -46.966 5.336   -14.817 1.00 76.59  ? 165 GLU B CG  1 
ATOM   4369 C  CD  . GLU B 1 214 ? -47.689 6.296   -15.751 1.00 80.56  ? 165 GLU B CD  1 
ATOM   4370 O  OE1 . GLU B 1 214 ? -48.640 5.834   -16.426 1.00 80.70  ? 165 GLU B OE1 1 
ATOM   4371 O  OE2 . GLU B 1 214 ? -47.315 7.502   -15.804 1.00 74.49  ? 165 GLU B OE2 1 
ATOM   4372 N  N   . VAL B 1 215 ? -42.335 4.954   -14.612 1.00 61.61  ? 166 VAL B N   1 
ATOM   4373 C  CA  . VAL B 1 215 ? -41.028 4.544   -15.152 1.00 64.38  ? 166 VAL B CA  1 
ATOM   4374 C  C   . VAL B 1 215 ? -40.481 3.362   -14.356 1.00 68.09  ? 166 VAL B C   1 
ATOM   4375 O  O   . VAL B 1 215 ? -39.928 2.431   -14.942 1.00 66.62  ? 166 VAL B O   1 
ATOM   4376 C  CB  . VAL B 1 215 ? -39.949 5.645   -15.182 1.00 65.51  ? 166 VAL B CB  1 
ATOM   4377 C  CG1 . VAL B 1 215 ? -38.932 5.314   -16.266 1.00 65.69  ? 166 VAL B CG1 1 
ATOM   4378 C  CG2 . VAL B 1 215 ? -40.543 7.019   -15.449 1.00 68.10  ? 166 VAL B CG2 1 
ATOM   4379 N  N   . LEU B 1 216 ? -40.656 3.385   -13.030 1.00 64.22  ? 167 LEU B N   1 
ATOM   4380 C  CA  . LEU B 1 216 ? -40.149 2.305   -12.185 1.00 62.95  ? 167 LEU B CA  1 
ATOM   4381 C  C   . LEU B 1 216 ? -40.844 0.980   -12.484 1.00 63.75  ? 167 LEU B C   1 
ATOM   4382 O  O   . LEU B 1 216 ? -40.240 -0.084  -12.368 1.00 63.47  ? 167 LEU B O   1 
ATOM   4383 C  CB  . LEU B 1 216 ? -40.255 2.664   -10.693 1.00 61.96  ? 167 LEU B CB  1 
ATOM   4384 C  CG  . LEU B 1 216 ? -39.372 3.815   -10.193 1.00 62.67  ? 167 LEU B CG  1 
ATOM   4385 C  CD1 . LEU B 1 216 ? -39.685 4.122   -8.737  1.00 60.78  ? 167 LEU B CD1 1 
ATOM   4386 C  CD2 . LEU B 1 216 ? -37.898 3.495   -10.382 1.00 59.86  ? 167 LEU B CD2 1 
ATOM   4387 N  N   . ALA B 1 217 ? -42.106 1.055   -12.892 1.00 64.37  ? 168 ALA B N   1 
ATOM   4388 C  CA  . ALA B 1 217 ? -42.929 -0.132  -13.028 1.00 64.57  ? 168 ALA B CA  1 
ATOM   4389 C  C   . ALA B 1 217 ? -42.987 -0.640  -14.461 1.00 64.62  ? 168 ALA B C   1 
ATOM   4390 O  O   . ALA B 1 217 ? -43.299 -1.809  -14.695 1.00 65.59  ? 168 ALA B O   1 
ATOM   4391 C  CB  . ALA B 1 217 ? -44.323 0.154   -12.499 1.00 67.18  ? 168 ALA B CB  1 
ATOM   4392 N  N   . SER B 1 218 ? -42.702 0.237   -15.421 1.00 61.84  ? 169 SER B N   1 
ATOM   4393 C  CA  . SER B 1 218 ? -42.755 -0.144  -16.832 1.00 60.28  ? 169 SER B CA  1 
ATOM   4394 C  C   . SER B 1 218 ? -41.477 -0.851  -17.279 1.00 60.87  ? 169 SER B C   1 
ATOM   4395 O  O   . SER B 1 218 ? -40.380 -0.495  -16.846 1.00 58.72  ? 169 SER B O   1 
ATOM   4396 C  CB  . SER B 1 218 ? -43.023 1.089   -17.708 1.00 60.77  ? 169 SER B CB  1 
ATOM   4397 O  OG  . SER B 1 218 ? -42.797 0.837   -19.090 1.00 62.70  ? 169 SER B OG  1 
ATOM   4398 N  N   . VAL B 1 219 ? -41.633 -1.852  -18.144 1.00 58.73  ? 170 VAL B N   1 
ATOM   4399 C  CA  . VAL B 1 219 ? -40.514 -2.420  -18.897 1.00 57.56  ? 170 VAL B CA  1 
ATOM   4400 C  C   . VAL B 1 219 ? -40.061 -1.429  -19.978 1.00 56.33  ? 170 VAL B C   1 
ATOM   4401 O  O   . VAL B 1 219 ? -40.874 -0.934  -20.740 1.00 60.11  ? 170 VAL B O   1 
ATOM   4402 C  CB  . VAL B 1 219 ? -40.900 -3.762  -19.549 1.00 57.10  ? 170 VAL B CB  1 
ATOM   4403 C  CG1 . VAL B 1 219 ? -39.825 -4.204  -20.541 1.00 55.34  ? 170 VAL B CG1 1 
ATOM   4404 C  CG2 . VAL B 1 219 ? -41.141 -4.816  -18.470 1.00 54.82  ? 170 VAL B CG2 1 
ATOM   4405 N  N   . GLY B 1 220 ? -38.769 -1.137  -20.040 1.00 53.69  ? 171 GLY B N   1 
ATOM   4406 C  CA  . GLY B 1 220 ? -38.290 -0.090  -20.930 1.00 51.01  ? 171 GLY B CA  1 
ATOM   4407 C  C   . GLY B 1 220 ? -37.462 -0.597  -22.094 1.00 50.73  ? 171 GLY B C   1 
ATOM   4408 O  O   . GLY B 1 220 ? -36.954 0.207   -22.875 1.00 53.07  ? 171 GLY B O   1 
ATOM   4409 N  N   . GLY B 1 221 ? -37.296 -1.918  -22.205 1.00 46.94  ? 172 GLY B N   1 
ATOM   4410 C  CA  . GLY B 1 221 ? -36.517 -2.485  -23.299 1.00 48.22  ? 172 GLY B CA  1 
ATOM   4411 C  C   . GLY B 1 221 ? -35.708 -3.740  -22.992 1.00 51.08  ? 172 GLY B C   1 
ATOM   4412 O  O   . GLY B 1 221 ? -35.884 -4.381  -21.955 1.00 50.96  ? 172 GLY B O   1 
ATOM   4413 N  N   . SER B 1 222 ? -34.810 -4.087  -23.907 1.00 48.17  ? 173 SER B N   1 
ATOM   4414 C  CA  . SER B 1 222 ? -33.989 -5.265  -23.755 1.00 47.52  ? 173 SER B CA  1 
ATOM   4415 C  C   . SER B 1 222 ? -32.555 -5.022  -24.191 1.00 48.38  ? 173 SER B C   1 
ATOM   4416 O  O   . SER B 1 222 ? -32.318 -4.534  -25.302 1.00 48.47  ? 173 SER B O   1 
ATOM   4417 C  CB  . SER B 1 222 ? -34.574 -6.404  -24.577 1.00 47.41  ? 173 SER B CB  1 
ATOM   4418 O  OG  . SER B 1 222 ? -35.822 -6.778  -24.031 1.00 55.51  ? 173 SER B OG  1 
ATOM   4419 N  N   . MET B 1 223 ? -31.612 -5.360  -23.309 1.00 47.90  ? 174 MET B N   1 
ATOM   4420 C  CA  . MET B 1 223 ? -30.222 -5.601  -23.693 1.00 48.27  ? 174 MET B CA  1 
ATOM   4421 C  C   . MET B 1 223 ? -29.957 -7.104  -23.685 1.00 49.71  ? 174 MET B C   1 
ATOM   4422 O  O   . MET B 1 223 ? -29.993 -7.747  -22.631 1.00 55.90  ? 174 MET B O   1 
ATOM   4423 C  CB  . MET B 1 223 ? -29.250 -4.888  -22.750 1.00 49.47  ? 174 MET B CB  1 
ATOM   4424 C  CG  . MET B 1 223 ? -27.781 -5.191  -23.013 1.00 49.03  ? 174 MET B CG  1 
ATOM   4425 S  SD  . MET B 1 223 ? -26.612 -4.126  -22.138 1.00 51.54  ? 174 MET B SD  1 
ATOM   4426 C  CE  . MET B 1 223 ? -27.000 -4.422  -20.408 1.00 52.47  ? 174 MET B CE  1 
ATOM   4427 N  N   . ILE B 1 224 ? -29.690 -7.654  -24.865 1.00 50.52  ? 175 ILE B N   1 
ATOM   4428 C  CA  . ILE B 1 224 ? -29.333 -9.060  -25.019 1.00 48.22  ? 175 ILE B CA  1 
ATOM   4429 C  C   . ILE B 1 224 ? -27.800 -9.174  -25.127 1.00 50.48  ? 175 ILE B C   1 
ATOM   4430 O  O   . ILE B 1 224 ? -27.216 -8.857  -26.175 1.00 48.62  ? 175 ILE B O   1 
ATOM   4431 C  CB  . ILE B 1 224 ? -30.014 -9.689  -26.270 1.00 49.48  ? 175 ILE B CB  1 
ATOM   4432 C  CG1 . ILE B 1 224 ? -31.509 -9.323  -26.357 1.00 48.52  ? 175 ILE B CG1 1 
ATOM   4433 C  CG2 . ILE B 1 224 ? -29.778 -11.193 -26.313 1.00 47.94  ? 175 ILE B CG2 1 
ATOM   4434 C  CD1 . ILE B 1 224 ? -32.357 -9.681  -25.135 1.00 50.65  ? 175 ILE B CD1 1 
ATOM   4435 N  N   . ILE B 1 225 ? -27.162 -9.587  -24.025 1.00 47.21  ? 176 ILE B N   1 
ATOM   4436 C  CA  . ILE B 1 225 ? -25.732 -9.796  -23.973 1.00 45.57  ? 176 ILE B CA  1 
ATOM   4437 C  C   . ILE B 1 225 ? -25.470 -11.143 -24.626 1.00 47.59  ? 176 ILE B C   1 
ATOM   4438 O  O   . ILE B 1 225 ? -26.032 -12.153 -24.189 1.00 49.95  ? 176 ILE B O   1 
ATOM   4439 C  CB  . ILE B 1 225 ? -25.214 -9.869  -22.513 1.00 46.98  ? 176 ILE B CB  1 
ATOM   4440 C  CG1 . ILE B 1 225 ? -25.649 -8.660  -21.673 1.00 49.55  ? 176 ILE B CG1 1 
ATOM   4441 C  CG2 . ILE B 1 225 ? -23.706 -10.092 -22.490 1.00 42.40  ? 176 ILE B CG2 1 
ATOM   4442 C  CD1 . ILE B 1 225 ? -24.914 -7.372  -22.017 1.00 53.13  ? 176 ILE B CD1 1 
ATOM   4443 N  N   . GLY B 1 226 ? -24.634 -11.157 -25.668 1.00 46.68  ? 177 GLY B N   1 
ATOM   4444 C  CA  . GLY B 1 226 ? -24.170 -12.396 -26.302 1.00 45.56  ? 177 GLY B CA  1 
ATOM   4445 C  C   . GLY B 1 226 ? -24.994 -12.952 -27.451 1.00 52.95  ? 177 GLY B C   1 
ATOM   4446 O  O   . GLY B 1 226 ? -24.721 -14.064 -27.913 1.00 57.29  ? 177 GLY B O   1 
ATOM   4447 N  N   . GLY B 1 227 ? -26.005 -12.214 -27.915 1.00 53.73  ? 178 GLY B N   1 
ATOM   4448 C  CA  . GLY B 1 227 ? -26.849 -12.722 -29.000 1.00 58.65  ? 178 GLY B CA  1 
ATOM   4449 C  C   . GLY B 1 227 ? -27.916 -11.793 -29.542 1.00 59.52  ? 178 GLY B C   1 
ATOM   4450 O  O   . GLY B 1 227 ? -28.052 -10.655 -29.089 1.00 59.70  ? 178 GLY B O   1 
ATOM   4451 N  N   . ILE B 1 228 ? -28.668 -12.304 -30.521 1.00 58.50  ? 179 ILE B N   1 
ATOM   4452 C  CA  . ILE B 1 228 ? -29.803 -11.604 -31.166 1.00 56.92  ? 179 ILE B CA  1 
ATOM   4453 C  C   . ILE B 1 228 ? -31.146 -12.303 -30.871 1.00 54.91  ? 179 ILE B C   1 
ATOM   4454 O  O   . ILE B 1 228 ? -31.297 -13.475 -31.170 1.00 54.30  ? 179 ILE B O   1 
ATOM   4455 C  CB  . ILE B 1 228 ? -29.620 -11.572 -32.700 1.00 53.16  ? 179 ILE B CB  1 
ATOM   4456 C  CG1 . ILE B 1 228 ? -28.338 -10.826 -33.087 1.00 52.90  ? 179 ILE B CG1 1 
ATOM   4457 C  CG2 . ILE B 1 228 ? -30.829 -10.955 -33.390 1.00 53.29  ? 179 ILE B CG2 1 
ATOM   4458 C  CD1 . ILE B 1 228 ? -27.914 -11.058 -34.531 1.00 48.24  ? 179 ILE B CD1 1 
ATOM   4459 N  N   . ASP B 1 229 ? -32.114 -11.599 -30.288 1.00 51.56  ? 180 ASP B N   1 
ATOM   4460 C  CA  . ASP B 1 229 ? -33.431 -12.197 -30.052 1.00 55.99  ? 180 ASP B CA  1 
ATOM   4461 C  C   . ASP B 1 229 ? -34.395 -11.799 -31.186 1.00 57.96  ? 180 ASP B C   1 
ATOM   4462 O  O   . ASP B 1 229 ? -34.643 -10.604 -31.396 1.00 57.08  ? 180 ASP B O   1 
ATOM   4463 C  CB  . ASP B 1 229 ? -33.974 -11.759 -28.688 1.00 57.98  ? 180 ASP B CB  1 
ATOM   4464 C  CG  . ASP B 1 229 ? -35.277 -12.458 -28.308 1.00 61.02  ? 180 ASP B CG  1 
ATOM   4465 O  OD1 . ASP B 1 229 ? -36.316 -12.220 -28.961 1.00 64.14  ? 180 ASP B OD1 1 
ATOM   4466 O  OD2 . ASP B 1 229 ? -35.267 -13.224 -27.324 1.00 65.19  ? 180 ASP B OD2 1 
ATOM   4467 N  N   . HIS B 1 230 ? -34.936 -12.790 -31.901 1.00 56.77  ? 181 HIS B N   1 
ATOM   4468 C  CA  . HIS B 1 230 ? -35.790 -12.542 -33.078 1.00 60.39  ? 181 HIS B CA  1 
ATOM   4469 C  C   . HIS B 1 230 ? -37.195 -11.960 -32.811 1.00 56.69  ? 181 HIS B C   1 
ATOM   4470 O  O   . HIS B 1 230 ? -37.829 -11.477 -33.732 1.00 52.23  ? 181 HIS B O   1 
ATOM   4471 C  CB  . HIS B 1 230 ? -35.867 -13.776 -33.984 1.00 69.09  ? 181 HIS B CB  1 
ATOM   4472 C  CG  . HIS B 1 230 ? -34.532 -14.184 -34.552 1.00 89.49  ? 181 HIS B CG  1 
ATOM   4473 N  ND1 . HIS B 1 230 ? -33.629 -13.273 -35.097 1.00 97.83  ? 181 HIS B ND1 1 
ATOM   4474 C  CD2 . HIS B 1 230 ? -33.948 -15.404 -34.670 1.00 99.89  ? 181 HIS B CD2 1 
ATOM   4475 C  CE1 . HIS B 1 230 ? -32.544 -13.912 -35.515 1.00 98.53  ? 181 HIS B CE1 1 
ATOM   4476 N  NE2 . HIS B 1 230 ? -32.714 -15.207 -35.272 1.00 101.31 ? 181 HIS B NE2 1 
ATOM   4477 N  N   . SER B 1 231 ? -37.669 -11.990 -31.565 1.00 54.22  ? 182 SER B N   1 
ATOM   4478 C  CA  . SER B 1 231 ? -38.993 -11.456 -31.232 1.00 51.74  ? 182 SER B CA  1 
ATOM   4479 C  C   . SER B 1 231 ? -38.963 -9.950  -30.921 1.00 54.38  ? 182 SER B C   1 
ATOM   4480 O  O   . SER B 1 231 ? -39.996 -9.337  -30.614 1.00 54.55  ? 182 SER B O   1 
ATOM   4481 C  CB  . SER B 1 231 ? -39.571 -12.203 -30.040 1.00 51.67  ? 182 SER B CB  1 
ATOM   4482 O  OG  . SER B 1 231 ? -38.881 -11.834 -28.860 1.00 55.45  ? 182 SER B OG  1 
ATOM   4483 N  N   . LEU B 1 232 ? -37.778 -9.354  -31.006 1.00 55.26  ? 183 LEU B N   1 
ATOM   4484 C  CA  . LEU B 1 232 ? -37.598 -7.946  -30.663 1.00 51.54  ? 183 LEU B CA  1 
ATOM   4485 C  C   . LEU B 1 232 ? -37.664 -7.064  -31.897 1.00 50.42  ? 183 LEU B C   1 
ATOM   4486 O  O   . LEU B 1 232 ? -37.719 -5.842  -31.777 1.00 49.52  ? 183 LEU B O   1 
ATOM   4487 C  CB  . LEU B 1 232 ? -36.272 -7.748  -29.919 1.00 50.85  ? 183 LEU B CB  1 
ATOM   4488 C  CG  . LEU B 1 232 ? -36.179 -8.402  -28.540 1.00 49.02  ? 183 LEU B CG  1 
ATOM   4489 C  CD1 . LEU B 1 232 ? -34.836 -8.080  -27.913 1.00 50.17  ? 183 LEU B CD1 1 
ATOM   4490 C  CD2 . LEU B 1 232 ? -37.311 -7.934  -27.636 1.00 48.71  ? 183 LEU B CD2 1 
ATOM   4491 N  N   . TYR B 1 233 ? -37.675 -7.698  -33.073 1.00 50.44  ? 184 TYR B N   1 
ATOM   4492 C  CA  . TYR B 1 233 ? -37.746 -6.988  -34.356 1.00 50.08  ? 184 TYR B CA  1 
ATOM   4493 C  C   . TYR B 1 233 ? -38.661 -7.639  -35.411 1.00 50.35  ? 184 TYR B C   1 
ATOM   4494 O  O   . TYR B 1 233 ? -39.029 -8.817  -35.286 1.00 51.43  ? 184 TYR B O   1 
ATOM   4495 C  CB  . TYR B 1 233 ? -36.334 -6.770  -34.916 1.00 45.56  ? 184 TYR B CB  1 
ATOM   4496 C  CG  . TYR B 1 233 ? -35.622 -7.975  -35.507 1.00 45.74  ? 184 TYR B CG  1 
ATOM   4497 C  CD1 . TYR B 1 233 ? -34.929 -8.867  -34.697 1.00 46.69  ? 184 TYR B CD1 1 
ATOM   4498 C  CD2 . TYR B 1 233 ? -35.592 -8.190  -36.896 1.00 44.31  ? 184 TYR B CD2 1 
ATOM   4499 C  CE1 . TYR B 1 233 ? -34.246 -9.945  -35.245 1.00 47.12  ? 184 TYR B CE1 1 
ATOM   4500 C  CE2 . TYR B 1 233 ? -34.916 -9.265  -37.450 1.00 45.18  ? 184 TYR B CE2 1 
ATOM   4501 C  CZ  . TYR B 1 233 ? -34.240 -10.135 -36.616 1.00 48.34  ? 184 TYR B CZ  1 
ATOM   4502 O  OH  . TYR B 1 233 ? -33.559 -11.194 -37.156 1.00 52.27  ? 184 TYR B OH  1 
ATOM   4503 N  N   . THR B 1 234 ? -39.025 -6.862  -36.434 1.00 45.39  ? 185 THR B N   1 
ATOM   4504 C  CA  . THR B 1 234 ? -39.713 -7.366  -37.634 1.00 46.96  ? 185 THR B CA  1 
ATOM   4505 C  C   . THR B 1 234 ? -38.881 -7.018  -38.866 1.00 48.85  ? 185 THR B C   1 
ATOM   4506 O  O   . THR B 1 234 ? -37.998 -6.169  -38.796 1.00 49.90  ? 185 THR B O   1 
ATOM   4507 C  CB  . THR B 1 234 ? -41.125 -6.761  -37.798 1.00 49.01  ? 185 THR B CB  1 
ATOM   4508 O  OG1 . THR B 1 234 ? -41.068 -5.326  -37.702 1.00 51.08  ? 185 THR B OG1 1 
ATOM   4509 C  CG2 . THR B 1 234 ? -42.080 -7.290  -36.730 1.00 49.14  ? 185 THR B CG2 1 
ATOM   4510 N  N   . GLY B 1 235 ? -39.158 -7.661  -39.996 1.00 51.34  ? 186 GLY B N   1 
ATOM   4511 C  CA  . GLY B 1 235 ? -38.396 -7.418  -41.225 1.00 47.13  ? 186 GLY B CA  1 
ATOM   4512 C  C   . GLY B 1 235 ? -36.985 -7.944  -41.062 1.00 49.16  ? 186 GLY B C   1 
ATOM   4513 O  O   . GLY B 1 235 ? -36.716 -8.676  -40.119 1.00 51.07  ? 186 GLY B O   1 
ATOM   4514 N  N   . SER B 1 236 ? -36.092 -7.567  -41.981 1.00 51.44  ? 187 SER B N   1 
ATOM   4515 C  CA  . SER B 1 236 ? -34.693 -8.009  -41.985 1.00 52.12  ? 187 SER B CA  1 
ATOM   4516 C  C   . SER B 1 236 ? -33.757 -7.108  -41.175 1.00 53.02  ? 187 SER B C   1 
ATOM   4517 O  O   . SER B 1 236 ? -34.011 -5.906  -41.024 1.00 45.11  ? 187 SER B O   1 
ATOM   4518 C  CB  . SER B 1 236 ? -34.155 -8.037  -43.418 1.00 54.15  ? 187 SER B CB  1 
ATOM   4519 O  OG  . SER B 1 236 ? -34.813 -9.007  -44.203 1.00 59.90  ? 187 SER B OG  1 
ATOM   4520 N  N   . LEU B 1 237 ? -32.670 -7.707  -40.680 1.00 50.48  ? 188 LEU B N   1 
ATOM   4521 C  CA  . LEU B 1 237 ? -31.519 -6.972  -40.154 1.00 48.06  ? 188 LEU B CA  1 
ATOM   4522 C  C   . LEU B 1 237 ? -30.590 -6.566  -41.301 1.00 48.84  ? 188 LEU B C   1 
ATOM   4523 O  O   . LEU B 1 237 ? -30.166 -7.429  -42.086 1.00 49.43  ? 188 LEU B O   1 
ATOM   4524 C  CB  . LEU B 1 237 ? -30.721 -7.851  -39.171 1.00 45.51  ? 188 LEU B CB  1 
ATOM   4525 C  CG  . LEU B 1 237 ? -31.180 -7.944  -37.719 1.00 44.90  ? 188 LEU B CG  1 
ATOM   4526 C  CD1 . LEU B 1 237 ? -30.493 -9.110  -37.047 1.00 45.21  ? 188 LEU B CD1 1 
ATOM   4527 C  CD2 . LEU B 1 237 ? -30.915 -6.650  -36.957 1.00 44.29  ? 188 LEU B CD2 1 
ATOM   4528 N  N   . TRP B 1 238 ? -30.270 -5.271  -41.395 1.00 45.47  ? 189 TRP B N   1 
ATOM   4529 C  CA  . TRP B 1 238 ? -29.245 -4.772  -42.323 1.00 42.35  ? 189 TRP B CA  1 
ATOM   4530 C  C   . TRP B 1 238 ? -28.006 -4.264  -41.581 1.00 45.21  ? 189 TRP B C   1 
ATOM   4531 O  O   . TRP B 1 238 ? -28.135 -3.539  -40.590 1.00 47.65  ? 189 TRP B O   1 
ATOM   4532 C  CB  . TRP B 1 238 ? -29.807 -3.640  -43.157 1.00 41.49  ? 189 TRP B CB  1 
ATOM   4533 C  CG  . TRP B 1 238 ? -30.727 -4.100  -44.219 1.00 41.88  ? 189 TRP B CG  1 
ATOM   4534 C  CD1 . TRP B 1 238 ? -32.052 -4.409  -44.083 1.00 40.28  ? 189 TRP B CD1 1 
ATOM   4535 C  CD2 . TRP B 1 238 ? -30.399 -4.309  -45.598 1.00 41.90  ? 189 TRP B CD2 1 
ATOM   4536 N  NE1 . TRP B 1 238 ? -32.573 -4.792  -45.302 1.00 42.10  ? 189 TRP B NE1 1 
ATOM   4537 C  CE2 . TRP B 1 238 ? -31.582 -4.740  -46.248 1.00 43.54  ? 189 TRP B CE2 1 
ATOM   4538 C  CE3 . TRP B 1 238 ? -29.222 -4.172  -46.348 1.00 43.38  ? 189 TRP B CE3 1 
ATOM   4539 C  CZ2 . TRP B 1 238 ? -31.622 -5.042  -47.616 1.00 41.59  ? 189 TRP B CZ2 1 
ATOM   4540 C  CZ3 . TRP B 1 238 ? -29.260 -4.474  -47.716 1.00 43.71  ? 189 TRP B CZ3 1 
ATOM   4541 C  CH2 . TRP B 1 238 ? -30.459 -4.902  -48.332 1.00 42.98  ? 189 TRP B CH2 1 
ATOM   4542 N  N   . TYR B 1 239 ? -26.812 -4.630  -42.062 1.00 44.91  ? 190 TYR B N   1 
ATOM   4543 C  CA  . TYR B 1 239 ? -25.566 -4.280  -41.367 1.00 44.03  ? 190 TYR B CA  1 
ATOM   4544 C  C   . TYR B 1 239 ? -24.748 -3.174  -42.027 1.00 43.86  ? 190 TYR B C   1 
ATOM   4545 O  O   . TYR B 1 239 ? -24.542 -3.176  -43.237 1.00 43.57  ? 190 TYR B O   1 
ATOM   4546 C  CB  . TYR B 1 239 ? -24.701 -5.525  -41.158 1.00 46.55  ? 190 TYR B CB  1 
ATOM   4547 C  CG  . TYR B 1 239 ? -25.310 -6.494  -40.187 1.00 46.84  ? 190 TYR B CG  1 
ATOM   4548 C  CD1 . TYR B 1 239 ? -25.128 -6.343  -38.790 1.00 49.39  ? 190 TYR B CD1 1 
ATOM   4549 C  CD2 . TYR B 1 239 ? -26.097 -7.543  -40.634 1.00 44.80  ? 190 TYR B CD2 1 
ATOM   4550 C  CE1 . TYR B 1 239 ? -25.702 -7.236  -37.883 1.00 48.14  ? 190 TYR B CE1 1 
ATOM   4551 C  CE2 . TYR B 1 239 ? -26.683 -8.434  -39.729 1.00 47.25  ? 190 TYR B CE2 1 
ATOM   4552 C  CZ  . TYR B 1 239 ? -26.479 -8.280  -38.364 1.00 46.52  ? 190 TYR B CZ  1 
ATOM   4553 O  OH  . TYR B 1 239 ? -27.049 -9.172  -37.492 1.00 49.64  ? 190 TYR B OH  1 
ATOM   4554 N  N   . THR B 1 240 ? -24.304 -2.221  -41.210 1.00 43.04  ? 191 THR B N   1 
ATOM   4555 C  CA  . THR B 1 240 ? -23.352 -1.211  -41.641 1.00 44.64  ? 191 THR B CA  1 
ATOM   4556 C  C   . THR B 1 240 ? -22.015 -1.502  -40.928 1.00 45.14  ? 191 THR B C   1 
ATOM   4557 O  O   . THR B 1 240 ? -22.023 -2.032  -39.810 1.00 45.94  ? 191 THR B O   1 
ATOM   4558 C  CB  . THR B 1 240 ? -23.881 0.220   -41.375 1.00 45.00  ? 191 THR B CB  1 
ATOM   4559 O  OG1 . THR B 1 240 ? -22.994 1.176   -41.947 1.00 45.14  ? 191 THR B OG1 1 
ATOM   4560 C  CG2 . THR B 1 240 ? -24.025 0.519   -39.892 1.00 41.90  ? 191 THR B CG2 1 
ATOM   4561 N  N   . PRO B 1 241 ? -20.866 -1.228  -41.591 1.00 44.81  ? 192 PRO B N   1 
ATOM   4562 C  CA  . PRO B 1 241 ? -19.555 -1.528  -40.948 1.00 44.62  ? 192 PRO B CA  1 
ATOM   4563 C  C   . PRO B 1 241 ? -19.238 -0.596  -39.789 1.00 45.09  ? 192 PRO B C   1 
ATOM   4564 O  O   . PRO B 1 241 ? -19.566 0.585   -39.859 1.00 45.10  ? 192 PRO B O   1 
ATOM   4565 C  CB  . PRO B 1 241 ? -18.530 -1.311  -42.086 1.00 41.01  ? 192 PRO B CB  1 
ATOM   4566 C  CG  . PRO B 1 241 ? -19.323 -1.419  -43.353 1.00 41.51  ? 192 PRO B CG  1 
ATOM   4567 C  CD  . PRO B 1 241 ? -20.728 -0.966  -43.041 1.00 42.50  ? 192 PRO B CD  1 
ATOM   4568 N  N   . ILE B 1 242 ? -18.605 -1.105  -38.732 1.00 45.96  ? 193 ILE B N   1 
ATOM   4569 C  CA  . ILE B 1 242 ? -18.021 -0.205  -37.727 1.00 43.88  ? 193 ILE B CA  1 
ATOM   4570 C  C   . ILE B 1 242 ? -16.724 0.324   -38.349 1.00 49.68  ? 193 ILE B C   1 
ATOM   4571 O  O   . ILE B 1 242 ? -15.820 -0.458  -38.661 1.00 53.58  ? 193 ILE B O   1 
ATOM   4572 C  CB  . ILE B 1 242 ? -17.762 -0.916  -36.390 1.00 40.48  ? 193 ILE B CB  1 
ATOM   4573 C  CG1 . ILE B 1 242 ? -19.083 -1.186  -35.668 1.00 37.53  ? 193 ILE B CG1 1 
ATOM   4574 C  CG2 . ILE B 1 242 ? -16.843 -0.080  -35.509 1.00 37.84  ? 193 ILE B CG2 1 
ATOM   4575 C  CD1 . ILE B 1 242 ? -18.955 -2.130  -34.488 1.00 38.91  ? 193 ILE B CD1 1 
ATOM   4576 N  N   . ARG B 1 243 ? -16.645 1.635   -38.587 1.00 50.70  ? 194 ARG B N   1 
ATOM   4577 C  CA  . ARG B 1 243 ? -15.531 2.186   -39.375 1.00 47.60  ? 194 ARG B CA  1 
ATOM   4578 C  C   . ARG B 1 243 ? -14.194 1.952   -38.680 1.00 48.17  ? 194 ARG B C   1 
ATOM   4579 O  O   . ARG B 1 243 ? -13.172 1.684   -39.337 1.00 44.68  ? 194 ARG B O   1 
ATOM   4580 C  CB  . ARG B 1 243 ? -15.729 3.673   -39.636 1.00 46.58  ? 194 ARG B CB  1 
ATOM   4581 C  CG  . ARG B 1 243 ? -14.853 4.228   -40.745 1.00 43.72  ? 194 ARG B CG  1 
ATOM   4582 C  CD  . ARG B 1 243 ? -14.871 5.736   -40.642 1.00 45.65  ? 194 ARG B CD  1 
ATOM   4583 N  NE  . ARG B 1 243 ? -13.959 6.402   -41.563 1.00 49.79  ? 194 ARG B NE  1 
ATOM   4584 C  CZ  . ARG B 1 243 ? -13.678 7.704   -41.519 1.00 49.74  ? 194 ARG B CZ  1 
ATOM   4585 N  NH1 . ARG B 1 243 ? -14.230 8.479   -40.594 1.00 50.02  ? 194 ARG B NH1 1 
ATOM   4586 N  NH2 . ARG B 1 243 ? -12.845 8.229   -42.406 1.00 47.50  ? 194 ARG B NH2 1 
ATOM   4587 N  N   . ARG B 1 244 ? -14.242 2.025   -37.346 1.00 45.46  ? 195 ARG B N   1 
ATOM   4588 C  CA  . ARG B 1 244 ? -13.079 1.961   -36.467 1.00 47.62  ? 195 ARG B CA  1 
ATOM   4589 C  C   . ARG B 1 244 ? -13.583 1.730   -35.039 1.00 51.66  ? 195 ARG B C   1 
ATOM   4590 O  O   . ARG B 1 244 ? -14.639 2.239   -34.633 1.00 49.66  ? 195 ARG B O   1 
ATOM   4591 C  CB  . ARG B 1 244 ? -12.288 3.267   -36.552 1.00 49.03  ? 195 ARG B CB  1 
ATOM   4592 C  CG  . ARG B 1 244 ? -11.044 3.366   -35.683 1.00 52.49  ? 195 ARG B CG  1 
ATOM   4593 C  CD  . ARG B 1 244 ? -10.312 4.677   -35.970 1.00 57.45  ? 195 ARG B CD  1 
ATOM   4594 N  NE  . ARG B 1 244 ? -9.683  5.253   -34.783 1.00 62.37  ? 195 ARG B NE  1 
ATOM   4595 C  CZ  . ARG B 1 244 ? -9.668  6.562   -34.526 1.00 68.52  ? 195 ARG B CZ  1 
ATOM   4596 N  NH1 . ARG B 1 244 ? -10.257 7.431   -35.355 1.00 68.53  ? 195 ARG B NH1 1 
ATOM   4597 N  NH2 . ARG B 1 244 ? -9.077  7.012   -33.430 1.00 76.86  ? 195 ARG B NH2 1 
ATOM   4598 N  N   . GLU B 1 245 ? -12.815 0.960   -34.282 1.00 51.74  ? 196 GLU B N   1 
ATOM   4599 C  CA  . GLU B 1 245 ? -13.219 0.555   -32.962 1.00 51.40  ? 196 GLU B CA  1 
ATOM   4600 C  C   . GLU B 1 245 ? -12.749 1.551   -31.932 1.00 51.17  ? 196 GLU B C   1 
ATOM   4601 O  O   . GLU B 1 245 ? -11.703 1.376   -31.325 1.00 55.81  ? 196 GLU B O   1 
ATOM   4602 C  CB  . GLU B 1 245 ? -12.705 -0.851  -32.670 1.00 50.95  ? 196 GLU B CB  1 
ATOM   4603 C  CG  . GLU B 1 245 ? -13.358 -1.886  -33.565 1.00 53.49  ? 196 GLU B CG  1 
ATOM   4604 C  CD  . GLU B 1 245 ? -12.473 -3.076  -33.815 1.00 57.39  ? 196 GLU B CD  1 
ATOM   4605 O  OE1 . GLU B 1 245 ? -11.375 -2.888  -34.390 1.00 59.29  ? 196 GLU B OE1 1 
ATOM   4606 O  OE2 . GLU B 1 245 ? -12.890 -4.198  -33.456 1.00 57.03  ? 196 GLU B OE2 1 
ATOM   4607 N  N   . TRP B 1 246 ? -13.529 2.612   -31.765 1.00 48.63  ? 197 TRP B N   1 
ATOM   4608 C  CA  . TRP B 1 246 ? -13.365 3.526   -30.643 1.00 46.17  ? 197 TRP B CA  1 
ATOM   4609 C  C   . TRP B 1 246 ? -14.743 3.872   -30.055 1.00 44.39  ? 197 TRP B C   1 
ATOM   4610 O  O   . TRP B 1 246 ? -15.200 3.213   -29.129 1.00 42.48  ? 197 TRP B O   1 
ATOM   4611 C  CB  . TRP B 1 246 ? -12.511 4.740   -31.028 1.00 44.41  ? 197 TRP B CB  1 
ATOM   4612 C  CG  . TRP B 1 246 ? -12.980 5.571   -32.184 1.00 42.50  ? 197 TRP B CG  1 
ATOM   4613 C  CD1 . TRP B 1 246 ? -13.658 5.145   -33.303 1.00 42.21  ? 197 TRP B CD1 1 
ATOM   4614 C  CD2 . TRP B 1 246 ? -12.761 6.977   -32.359 1.00 41.40  ? 197 TRP B CD2 1 
ATOM   4615 N  NE1 . TRP B 1 246 ? -13.897 6.216   -34.150 1.00 42.89  ? 197 TRP B NE1 1 
ATOM   4616 C  CE2 . TRP B 1 246 ? -13.352 7.346   -33.601 1.00 42.55  ? 197 TRP B CE2 1 
ATOM   4617 C  CE3 . TRP B 1 246 ? -12.137 7.967   -31.580 1.00 42.00  ? 197 TRP B CE3 1 
ATOM   4618 C  CZ2 . TRP B 1 246 ? -13.332 8.660   -34.082 1.00 43.92  ? 197 TRP B CZ2 1 
ATOM   4619 C  CZ3 . TRP B 1 246 ? -12.119 9.273   -32.052 1.00 40.89  ? 197 TRP B CZ3 1 
ATOM   4620 C  CH2 . TRP B 1 246 ? -12.714 9.610   -33.295 1.00 44.80  ? 197 TRP B CH2 1 
ATOM   4621 N  N   . TYR B 1 247 ? -15.405 4.886   -30.591 1.00 43.19  ? 198 TYR B N   1 
ATOM   4622 C  CA  . TYR B 1 247 ? -16.867 4.930   -30.511 1.00 44.72  ? 198 TYR B CA  1 
ATOM   4623 C  C   . TYR B 1 247 ? -17.405 3.840   -31.427 1.00 42.65  ? 198 TYR B C   1 
ATOM   4624 O  O   . TYR B 1 247 ? -16.647 3.200   -32.160 1.00 42.65  ? 198 TYR B O   1 
ATOM   4625 C  CB  . TYR B 1 247 ? -17.409 6.297   -30.970 1.00 41.95  ? 198 TYR B CB  1 
ATOM   4626 C  CG  . TYR B 1 247 ? -16.887 7.473   -30.154 1.00 44.29  ? 198 TYR B CG  1 
ATOM   4627 C  CD1 . TYR B 1 247 ? -17.549 7.911   -29.004 1.00 43.13  ? 198 TYR B CD1 1 
ATOM   4628 C  CD2 . TYR B 1 247 ? -15.726 8.138   -30.531 1.00 45.63  ? 198 TYR B CD2 1 
ATOM   4629 C  CE1 . TYR B 1 247 ? -17.069 8.982   -28.267 1.00 44.83  ? 198 TYR B CE1 1 
ATOM   4630 C  CE2 . TYR B 1 247 ? -15.245 9.209   -29.803 1.00 47.31  ? 198 TYR B CE2 1 
ATOM   4631 C  CZ  . TYR B 1 247 ? -15.917 9.621   -28.676 1.00 48.72  ? 198 TYR B CZ  1 
ATOM   4632 O  OH  . TYR B 1 247 ? -15.396 10.677  -27.962 1.00 51.86  ? 198 TYR B OH  1 
ATOM   4633 N  N   . TYR B 1 248 ? -18.705 3.623   -31.419 1.00 39.56  ? 199 TYR B N   1 
ATOM   4634 C  CA  . TYR B 1 248 ? -19.254 2.803   -32.473 1.00 43.87  ? 199 TYR B CA  1 
ATOM   4635 C  C   . TYR B 1 248 ? -19.451 3.685   -33.698 1.00 41.52  ? 199 TYR B C   1 
ATOM   4636 O  O   . TYR B 1 248 ? -20.535 4.220   -33.899 1.00 41.67  ? 199 TYR B O   1 
ATOM   4637 C  CB  . TYR B 1 248 ? -20.554 2.128   -32.025 1.00 42.96  ? 199 TYR B CB  1 
ATOM   4638 C  CG  . TYR B 1 248 ? -20.300 1.035   -31.036 1.00 41.06  ? 199 TYR B CG  1 
ATOM   4639 C  CD1 . TYR B 1 248 ? -19.859 -0.227  -31.459 1.00 40.24  ? 199 TYR B CD1 1 
ATOM   4640 C  CD2 . TYR B 1 248 ? -20.470 1.262   -29.665 1.00 40.45  ? 199 TYR B CD2 1 
ATOM   4641 C  CE1 . TYR B 1 248 ? -19.600 -1.234  -30.541 1.00 38.77  ? 199 TYR B CE1 1 
ATOM   4642 C  CE2 . TYR B 1 248 ? -20.226 0.260   -28.745 1.00 40.95  ? 199 TYR B CE2 1 
ATOM   4643 C  CZ  . TYR B 1 248 ? -19.787 -0.976  -29.190 1.00 39.86  ? 199 TYR B CZ  1 
ATOM   4644 O  OH  . TYR B 1 248 ? -19.549 -1.963  -28.280 1.00 43.54  ? 199 TYR B OH  1 
ATOM   4645 N  N   . GLU B 1 249 ? -18.396 3.842   -34.501 1.00 41.97  ? 200 GLU B N   1 
ATOM   4646 C  CA  . GLU B 1 249 ? -18.406 4.804   -35.616 1.00 43.50  ? 200 GLU B CA  1 
ATOM   4647 C  C   . GLU B 1 249 ? -19.006 4.202   -36.874 1.00 43.16  ? 200 GLU B C   1 
ATOM   4648 O  O   . GLU B 1 249 ? -18.634 3.090   -37.251 1.00 47.06  ? 200 GLU B O   1 
ATOM   4649 C  CB  . GLU B 1 249 ? -16.995 5.355   -35.905 1.00 41.94  ? 200 GLU B CB  1 
ATOM   4650 C  CG  . GLU B 1 249 ? -16.994 6.610   -36.775 1.00 46.24  ? 200 GLU B CG  1 
ATOM   4651 C  CD  . GLU B 1 249 ? -15.625 7.057   -37.318 1.00 47.41  ? 200 GLU B CD  1 
ATOM   4652 O  OE1 . GLU B 1 249 ? -14.561 6.761   -36.722 1.00 51.07  ? 200 GLU B OE1 1 
ATOM   4653 O  OE2 . GLU B 1 249 ? -15.614 7.753   -38.357 1.00 45.39  ? 200 GLU B OE2 1 
ATOM   4654 N  N   . VAL B 1 250 ? -19.938 4.923   -37.503 1.00 41.78  ? 201 VAL B N   1 
ATOM   4655 C  CA  . VAL B 1 250 ? -20.534 4.488   -38.787 1.00 41.72  ? 201 VAL B CA  1 
ATOM   4656 C  C   . VAL B 1 250 ? -20.440 5.590   -39.845 1.00 42.34  ? 201 VAL B C   1 
ATOM   4657 O  O   . VAL B 1 250 ? -20.099 6.725   -39.512 1.00 43.85  ? 201 VAL B O   1 
ATOM   4658 C  CB  . VAL B 1 250 ? -22.028 4.100   -38.644 1.00 41.00  ? 201 VAL B CB  1 
ATOM   4659 C  CG1 . VAL B 1 250 ? -22.214 2.879   -37.742 1.00 36.51  ? 201 VAL B CG1 1 
ATOM   4660 C  CG2 . VAL B 1 250 ? -22.852 5.296   -38.172 1.00 38.20  ? 201 VAL B CG2 1 
ATOM   4661 N  N   . ILE B 1 251 ? -20.770 5.267   -41.104 1.00 40.19  ? 202 ILE B N   1 
ATOM   4662 C  CA  . ILE B 1 251 ? -20.773 6.261   -42.178 1.00 40.40  ? 202 ILE B CA  1 
ATOM   4663 C  C   . ILE B 1 251 ? -22.162 6.447   -42.801 1.00 42.24  ? 202 ILE B C   1 
ATOM   4664 O  O   . ILE B 1 251 ? -22.753 5.492   -43.290 1.00 37.33  ? 202 ILE B O   1 
ATOM   4665 C  CB  . ILE B 1 251 ? -19.706 5.957   -43.271 1.00 43.16  ? 202 ILE B CB  1 
ATOM   4666 C  CG1 . ILE B 1 251 ? -18.294 6.110   -42.690 1.00 45.00  ? 202 ILE B CG1 1 
ATOM   4667 C  CG2 . ILE B 1 251 ? -19.845 6.884   -44.474 1.00 39.02  ? 202 ILE B CG2 1 
ATOM   4668 C  CD1 . ILE B 1 251 ? -17.204 5.468   -43.535 1.00 50.81  ? 202 ILE B CD1 1 
ATOM   4669 N  N   . ILE B 1 252 ? -22.666 7.691   -42.769 1.00 42.58  ? 203 ILE B N   1 
ATOM   4670 C  CA  . ILE B 1 252 ? -23.932 8.077   -43.425 1.00 38.23  ? 203 ILE B CA  1 
ATOM   4671 C  C   . ILE B 1 252 ? -23.665 8.637   -44.817 1.00 41.02  ? 203 ILE B C   1 
ATOM   4672 O  O   . ILE B 1 252 ? -22.839 9.518   -44.978 1.00 46.80  ? 203 ILE B O   1 
ATOM   4673 C  CB  . ILE B 1 252 ? -24.720 9.115   -42.592 1.00 35.51  ? 203 ILE B CB  1 
ATOM   4674 C  CG1 . ILE B 1 252 ? -24.870 8.621   -41.142 1.00 33.23  ? 203 ILE B CG1 1 
ATOM   4675 C  CG2 . ILE B 1 252 ? -26.063 9.403   -43.250 1.00 32.27  ? 203 ILE B CG2 1 
ATOM   4676 C  CD1 . ILE B 1 252 ? -25.680 9.530   -40.260 1.00 32.58  ? 203 ILE B CD1 1 
ATOM   4677 N  N   . VAL B 1 253 ? -24.362 8.120   -45.822 1.00 44.19  ? 204 VAL B N   1 
ATOM   4678 C  CA  . VAL B 1 253 ? -24.047 8.427   -47.217 1.00 41.98  ? 204 VAL B CA  1 
ATOM   4679 C  C   . VAL B 1 253 ? -25.090 9.307   -47.922 1.00 43.02  ? 204 VAL B C   1 
ATOM   4680 O  O   . VAL B 1 253 ? -24.845 9.807   -49.022 1.00 44.07  ? 204 VAL B O   1 
ATOM   4681 C  CB  . VAL B 1 253 ? -23.761 7.142   -48.030 1.00 41.15  ? 204 VAL B CB  1 
ATOM   4682 C  CG1 . VAL B 1 253 ? -22.762 6.265   -47.299 1.00 41.49  ? 204 VAL B CG1 1 
ATOM   4683 C  CG2 . VAL B 1 253 ? -25.019 6.356   -48.280 1.00 42.45  ? 204 VAL B CG2 1 
ATOM   4684 N  N   . ARG B 1 254 ? -26.249 9.489   -47.285 1.00 41.39  ? 205 ARG B N   1 
ATOM   4685 C  CA  . ARG B 1 254 ? -27.365 10.257  -47.844 1.00 40.00  ? 205 ARG B CA  1 
ATOM   4686 C  C   . ARG B 1 254 ? -28.384 10.558  -46.747 1.00 43.34  ? 205 ARG B C   1 
ATOM   4687 O  O   . ARG B 1 254 ? -28.557 9.768   -45.807 1.00 43.86  ? 205 ARG B O   1 
ATOM   4688 C  CB  . ARG B 1 254 ? -28.024 9.481   -48.989 1.00 42.37  ? 205 ARG B CB  1 
ATOM   4689 C  CG  . ARG B 1 254 ? -29.178 10.171  -49.715 1.00 41.80  ? 205 ARG B CG  1 
ATOM   4690 C  CD  . ARG B 1 254 ? -29.766 9.237   -50.784 1.00 43.92  ? 205 ARG B CD  1 
ATOM   4691 N  NE  . ARG B 1 254 ? -31.061 9.702   -51.303 1.00 43.62  ? 205 ARG B NE  1 
ATOM   4692 C  CZ  . ARG B 1 254 ? -31.222 10.414  -52.418 1.00 46.22  ? 205 ARG B CZ  1 
ATOM   4693 N  NH1 . ARG B 1 254 ? -30.178 10.748  -53.179 1.00 43.83  ? 205 ARG B NH1 1 
ATOM   4694 N  NH2 . ARG B 1 254 ? -32.439 10.786  -52.773 1.00 45.76  ? 205 ARG B NH2 1 
ATOM   4695 N  N   . VAL B 1 255 ? -29.032 11.714  -46.843 1.00 41.54  ? 206 VAL B N   1 
ATOM   4696 C  CA  . VAL B 1 255 ? -30.112 12.053  -45.931 1.00 39.95  ? 206 VAL B CA  1 
ATOM   4697 C  C   . VAL B 1 255 ? -31.323 12.510  -46.749 1.00 40.56  ? 206 VAL B C   1 
ATOM   4698 O  O   . VAL B 1 255 ? -31.160 13.169  -47.785 1.00 39.28  ? 206 VAL B O   1 
ATOM   4699 C  CB  . VAL B 1 255 ? -29.656 13.097  -44.879 1.00 39.52  ? 206 VAL B CB  1 
ATOM   4700 C  CG1 . VAL B 1 255 ? -30.792 13.473  -43.927 1.00 37.81  ? 206 VAL B CG1 1 
ATOM   4701 C  CG2 . VAL B 1 255 ? -28.460 12.558  -44.098 1.00 36.36  ? 206 VAL B CG2 1 
ATOM   4702 N  N   . GLU B 1 256 ? -32.522 12.121  -46.309 1.00 40.36  ? 207 GLU B N   1 
ATOM   4703 C  CA  . GLU B 1 256 ? -33.763 12.567  -46.940 1.00 41.91  ? 207 GLU B CA  1 
ATOM   4704 C  C   . GLU B 1 256 ? -34.747 13.071  -45.904 1.00 42.80  ? 207 GLU B C   1 
ATOM   4705 O  O   . GLU B 1 256 ? -34.730 12.647  -44.747 1.00 45.29  ? 207 GLU B O   1 
ATOM   4706 C  CB  . GLU B 1 256 ? -34.444 11.464  -47.749 1.00 41.38  ? 207 GLU B CB  1 
ATOM   4707 C  CG  . GLU B 1 256 ? -33.774 11.053  -49.047 1.00 42.57  ? 207 GLU B CG  1 
ATOM   4708 C  CD  . GLU B 1 256 ? -34.300 9.709   -49.564 1.00 45.05  ? 207 GLU B CD  1 
ATOM   4709 O  OE1 . GLU B 1 256 ? -35.332 9.213   -49.043 1.00 43.59  ? 207 GLU B OE1 1 
ATOM   4710 O  OE2 . GLU B 1 256 ? -33.689 9.133   -50.483 1.00 43.44  ? 207 GLU B OE2 1 
ATOM   4711 N  N   . ILE B 1 257 ? -35.603 13.986  -46.336 1.00 43.21  ? 208 ILE B N   1 
ATOM   4712 C  CA  . ILE B 1 257 ? -36.694 14.458  -45.524 1.00 43.06  ? 208 ILE B CA  1 
ATOM   4713 C  C   . ILE B 1 257 ? -37.918 14.248  -46.402 1.00 45.25  ? 208 ILE B C   1 
ATOM   4714 O  O   . ILE B 1 257 ? -38.050 14.886  -47.443 1.00 43.27  ? 208 ILE B O   1 
ATOM   4715 C  CB  . ILE B 1 257 ? -36.506 15.944  -45.173 1.00 40.76  ? 208 ILE B CB  1 
ATOM   4716 C  CG1 . ILE B 1 257 ? -35.081 16.208  -44.656 1.00 38.37  ? 208 ILE B CG1 1 
ATOM   4717 C  CG2 . ILE B 1 257 ? -37.556 16.394  -44.175 1.00 41.33  ? 208 ILE B CG2 1 
ATOM   4718 C  CD1 . ILE B 1 257 ? -34.758 15.688  -43.269 1.00 36.22  ? 208 ILE B CD1 1 
ATOM   4719 N  N   . ASN B 1 258 ? -38.796 13.327  -46.007 1.00 46.09  ? 209 ASN B N   1 
ATOM   4720 C  CA  . ASN B 1 258 ? -39.942 12.966  -46.854 1.00 47.83  ? 209 ASN B CA  1 
ATOM   4721 C  C   . ASN B 1 258 ? -39.491 12.757  -48.296 1.00 47.16  ? 209 ASN B C   1 
ATOM   4722 O  O   . ASN B 1 258 ? -40.047 13.359  -49.208 1.00 48.59  ? 209 ASN B O   1 
ATOM   4723 C  CB  . ASN B 1 258 ? -41.062 14.036  -46.812 1.00 48.11  ? 209 ASN B CB  1 
ATOM   4724 C  CG  . ASN B 1 258 ? -42.195 13.690  -45.846 1.00 48.98  ? 209 ASN B CG  1 
ATOM   4725 O  OD1 . ASN B 1 258 ? -42.197 12.632  -45.208 1.00 49.87  ? 209 ASN B OD1 1 
ATOM   4726 N  ND2 . ASN B 1 258 ? -43.163 14.600  -45.726 1.00 46.94  ? 209 ASN B ND2 1 
ATOM   4727 N  N   . GLY B 1 259 ? -38.467 11.927  -48.490 1.00 43.53  ? 210 GLY B N   1 
ATOM   4728 C  CA  . GLY B 1 259 ? -38.031 11.550  -49.836 1.00 42.95  ? 210 GLY B CA  1 
ATOM   4729 C  C   . GLY B 1 259 ? -37.099 12.537  -50.520 1.00 43.83  ? 210 GLY B C   1 
ATOM   4730 O  O   . GLY B 1 259 ? -36.367 12.173  -51.427 1.00 45.64  ? 210 GLY B O   1 
ATOM   4731 N  N   . GLN B 1 260 ? -37.108 13.789  -50.079 1.00 44.93  ? 211 GLN B N   1 
ATOM   4732 C  CA  . GLN B 1 260 ? -36.278 14.798  -50.700 1.00 40.59  ? 211 GLN B CA  1 
ATOM   4733 C  C   . GLN B 1 260 ? -34.845 14.754  -50.159 1.00 40.10  ? 211 GLN B C   1 
ATOM   4734 O  O   . GLN B 1 260 ? -34.622 14.825  -48.948 1.00 41.56  ? 211 GLN B O   1 
ATOM   4735 C  CB  . GLN B 1 260 ? -36.902 16.170  -50.498 1.00 40.13  ? 211 GLN B CB  1 
ATOM   4736 C  CG  . GLN B 1 260 ? -36.347 17.212  -51.452 1.00 46.03  ? 211 GLN B CG  1 
ATOM   4737 C  CD  . GLN B 1 260 ? -36.847 18.600  -51.137 1.00 49.83  ? 211 GLN B CD  1 
ATOM   4738 O  OE1 . GLN B 1 260 ? -37.749 18.773  -50.319 1.00 54.88  ? 211 GLN B OE1 1 
ATOM   4739 N  NE2 . GLN B 1 260 ? -36.253 19.598  -51.765 1.00 51.03  ? 211 GLN B NE2 1 
ATOM   4740 N  N   . ASP B 1 261 ? -33.884 14.628  -51.069 1.00 37.80  ? 212 ASP B N   1 
ATOM   4741 C  CA  . ASP B 1 261 ? -32.474 14.593  -50.741 1.00 37.70  ? 212 ASP B CA  1 
ATOM   4742 C  C   . ASP B 1 261 ? -32.107 15.917  -50.079 1.00 41.52  ? 212 ASP B C   1 
ATOM   4743 O  O   . ASP B 1 261 ? -32.511 16.989  -50.562 1.00 41.73  ? 212 ASP B O   1 
ATOM   4744 C  CB  . ASP B 1 261 ? -31.703 14.407  -52.053 1.00 39.73  ? 212 ASP B CB  1 
ATOM   4745 C  CG  . ASP B 1 261 ? -30.181 14.259  -51.868 1.00 40.59  ? 212 ASP B CG  1 
ATOM   4746 O  OD1 . ASP B 1 261 ? -29.702 14.032  -50.741 1.00 41.30  ? 212 ASP B OD1 1 
ATOM   4747 O  OD2 . ASP B 1 261 ? -29.457 14.343  -52.891 1.00 40.50  ? 212 ASP B OD2 1 
ATOM   4748 N  N   . LEU B 1 262 ? -31.364 15.862  -48.973 1.00 40.43  ? 213 LEU B N   1 
ATOM   4749 C  CA  . LEU B 1 262 ? -30.873 17.075  -48.349 1.00 41.73  ? 213 LEU B CA  1 
ATOM   4750 C  C   . LEU B 1 262 ? -29.781 17.665  -49.243 1.00 46.98  ? 213 LEU B C   1 
ATOM   4751 O  O   . LEU B 1 262 ? -29.519 18.856  -49.203 1.00 49.75  ? 213 LEU B O   1 
ATOM   4752 C  CB  . LEU B 1 262 ? -30.339 16.788  -46.964 1.00 42.88  ? 213 LEU B CB  1 
ATOM   4753 C  CG  . LEU B 1 262 ? -30.618 17.809  -45.882 1.00 42.11  ? 213 LEU B CG  1 
ATOM   4754 C  CD1 . LEU B 1 262 ? -32.107 17.846  -45.674 1.00 44.04  ? 213 LEU B CD1 1 
ATOM   4755 C  CD2 . LEU B 1 262 ? -29.949 17.407  -44.577 1.00 42.94  ? 213 LEU B CD2 1 
ATOM   4756 N  N   . LYS B 1 263 ? -29.157 16.810  -50.050 1.00 50.92  ? 214 LYS B N   1 
ATOM   4757 C  CA  . LYS B 1 263 ? -28.254 17.209  -51.138 1.00 55.38  ? 214 LYS B CA  1 
ATOM   4758 C  C   . LYS B 1 263 ? -26.951 17.895  -50.720 1.00 55.12  ? 214 LYS B C   1 
ATOM   4759 O  O   . LYS B 1 263 ? -26.447 18.771  -51.410 1.00 57.30  ? 214 LYS B O   1 
ATOM   4760 C  CB  . LYS B 1 263 ? -28.990 18.021  -52.213 1.00 58.61  ? 214 LYS B CB  1 
ATOM   4761 C  CG  . LYS B 1 263 ? -28.561 17.584  -53.603 1.00 66.10  ? 214 LYS B CG  1 
ATOM   4762 C  CD  . LYS B 1 263 ? -28.874 18.585  -54.698 1.00 71.42  ? 214 LYS B CD  1 
ATOM   4763 C  CE  . LYS B 1 263 ? -28.306 18.063  -56.014 1.00 79.70  ? 214 LYS B CE  1 
ATOM   4764 N  NZ  . LYS B 1 263 ? -28.068 19.136  -57.022 1.00 87.06  ? 214 LYS B NZ  1 
ATOM   4765 N  N   . MET B 1 264 ? -26.396 17.489  -49.591 1.00 56.04  ? 215 MET B N   1 
ATOM   4766 C  CA  . MET B 1 264 ? -25.112 18.009  -49.171 1.00 51.59  ? 215 MET B CA  1 
ATOM   4767 C  C   . MET B 1 264 ? -24.036 17.010  -49.547 1.00 53.18  ? 215 MET B C   1 
ATOM   4768 O  O   . MET B 1 264 ? -24.325 15.827  -49.776 1.00 50.83  ? 215 MET B O   1 
ATOM   4769 C  CB  . MET B 1 264 ? -25.109 18.259  -47.673 1.00 50.76  ? 215 MET B CB  1 
ATOM   4770 C  CG  . MET B 1 264 ? -26.260 19.121  -47.192 1.00 50.45  ? 215 MET B CG  1 
ATOM   4771 S  SD  . MET B 1 264 ? -26.176 19.294  -45.406 1.00 58.37  ? 215 MET B SD  1 
ATOM   4772 C  CE  . MET B 1 264 ? -24.784 20.403  -45.205 1.00 58.11  ? 215 MET B CE  1 
ATOM   4773 N  N   . ASP B 1 265 ? -22.803 17.498  -49.637 1.00 55.53  ? 216 ASP B N   1 
ATOM   4774 C  CA  . ASP B 1 265 ? -21.627 16.643  -49.750 1.00 59.56  ? 216 ASP B CA  1 
ATOM   4775 C  C   . ASP B 1 265 ? -21.673 15.648  -48.578 1.00 57.92  ? 216 ASP B C   1 
ATOM   4776 O  O   . ASP B 1 265 ? -21.755 16.094  -47.413 1.00 57.66  ? 216 ASP B O   1 
ATOM   4777 C  CB  . ASP B 1 265 ? -20.367 17.523  -49.675 1.00 63.19  ? 216 ASP B CB  1 
ATOM   4778 C  CG  . ASP B 1 265 ? -19.119 16.812  -50.161 1.00 70.02  ? 216 ASP B CG  1 
ATOM   4779 O  OD1 . ASP B 1 265 ? -18.682 15.817  -49.530 1.00 64.63  ? 216 ASP B OD1 1 
ATOM   4780 O  OD2 . ASP B 1 265 ? -18.564 17.268  -51.183 1.00 79.77  ? 216 ASP B OD2 1 
ATOM   4781 N  N   . CYS B 1 266 ? -21.634 14.335  -48.860 1.00 50.18  ? 217 CYS B N   1 
ATOM   4782 C  CA  . CYS B 1 266 ? -21.850 13.327  -47.801 1.00 52.26  ? 217 CYS B CA  1 
ATOM   4783 C  C   . CYS B 1 266 ? -20.857 13.427  -46.602 1.00 56.33  ? 217 CYS B C   1 
ATOM   4784 O  O   . CYS B 1 266 ? -21.195 13.046  -45.462 1.00 53.36  ? 217 CYS B O   1 
ATOM   4785 C  CB  . CYS B 1 266 ? -21.987 11.893  -48.360 1.00 51.09  ? 217 CYS B CB  1 
ATOM   4786 S  SG  . CYS B 1 266 ? -20.536 11.253  -49.244 1.00 59.01  ? 217 CYS B SG  1 
ATOM   4787 N  N   . LYS B 1 267 ? -19.666 13.986  -46.852 1.00 55.37  ? 218 LYS B N   1 
ATOM   4788 C  CA  . LYS B 1 267 ? -18.702 14.290  -45.783 1.00 54.55  ? 218 LYS B CA  1 
ATOM   4789 C  C   . LYS B 1 267 ? -19.291 15.162  -44.686 1.00 51.52  ? 218 LYS B C   1 
ATOM   4790 O  O   . LYS B 1 267 ? -18.858 15.085  -43.538 1.00 51.67  ? 218 LYS B O   1 
ATOM   4791 C  CB  . LYS B 1 267 ? -17.466 14.992  -46.332 1.00 53.56  ? 218 LYS B CB  1 
ATOM   4792 C  CG  . LYS B 1 267 ? -16.293 14.077  -46.555 1.00 60.81  ? 218 LYS B CG  1 
ATOM   4793 C  CD  . LYS B 1 267 ? -15.021 14.876  -46.766 1.00 63.08  ? 218 LYS B CD  1 
ATOM   4794 C  CE  . LYS B 1 267 ? -13.876 13.957  -47.156 1.00 63.99  ? 218 LYS B CE  1 
ATOM   4795 N  NZ  . LYS B 1 267 ? -13.964 13.545  -48.583 1.00 61.15  ? 218 LYS B NZ  1 
ATOM   4796 N  N   . GLU B 1 268 ? -20.243 16.016  -45.048 1.00 49.12  ? 219 GLU B N   1 
ATOM   4797 C  CA  . GLU B 1 268 ? -20.913 16.867  -44.073 1.00 51.59  ? 219 GLU B CA  1 
ATOM   4798 C  C   . GLU B 1 268 ? -21.675 16.061  -43.025 1.00 51.88  ? 219 GLU B C   1 
ATOM   4799 O  O   . GLU B 1 268 ? -21.707 16.437  -41.846 1.00 50.21  ? 219 GLU B O   1 
ATOM   4800 C  CB  . GLU B 1 268 ? -21.867 17.839  -44.757 1.00 54.64  ? 219 GLU B CB  1 
ATOM   4801 C  CG  . GLU B 1 268 ? -21.218 18.784  -45.759 1.00 57.74  ? 219 GLU B CG  1 
ATOM   4802 C  CD  . GLU B 1 268 ? -20.283 19.804  -45.133 1.00 56.66  ? 219 GLU B CD  1 
ATOM   4803 O  OE1 . GLU B 1 268 ? -20.315 20.010  -43.910 1.00 57.23  ? 219 GLU B OE1 1 
ATOM   4804 O  OE2 . GLU B 1 268 ? -19.503 20.414  -45.877 1.00 60.19  ? 219 GLU B OE2 1 
ATOM   4805 N  N   . TYR B 1 269 ? -22.259 14.938  -43.450 1.00 51.71  ? 220 TYR B N   1 
ATOM   4806 C  CA  . TYR B 1 269 ? -23.061 14.098  -42.574 1.00 43.68  ? 220 TYR B CA  1 
ATOM   4807 C  C   . TYR B 1 269 ? -22.215 13.439  -41.494 1.00 44.61  ? 220 TYR B C   1 
ATOM   4808 O  O   . TYR B 1 269 ? -22.724 13.087  -40.405 1.00 44.55  ? 220 TYR B O   1 
ATOM   4809 C  CB  . TYR B 1 269 ? -23.800 13.046  -43.386 1.00 46.39  ? 220 TYR B CB  1 
ATOM   4810 C  CG  . TYR B 1 269 ? -24.686 13.602  -44.494 1.00 45.61  ? 220 TYR B CG  1 
ATOM   4811 C  CD1 . TYR B 1 269 ? -25.563 14.651  -44.262 1.00 43.59  ? 220 TYR B CD1 1 
ATOM   4812 C  CD2 . TYR B 1 269 ? -24.654 13.056  -45.761 1.00 44.51  ? 220 TYR B CD2 1 
ATOM   4813 C  CE1 . TYR B 1 269 ? -26.366 15.148  -45.271 1.00 42.31  ? 220 TYR B CE1 1 
ATOM   4814 C  CE2 . TYR B 1 269 ? -25.457 13.550  -46.767 1.00 44.55  ? 220 TYR B CE2 1 
ATOM   4815 C  CZ  . TYR B 1 269 ? -26.304 14.597  -46.513 1.00 42.40  ? 220 TYR B CZ  1 
ATOM   4816 O  OH  . TYR B 1 269 ? -27.103 15.072  -47.517 1.00 43.32  ? 220 TYR B OH  1 
ATOM   4817 N  N   . ASN B 1 270 ? -20.919 13.319  -41.771 1.00 41.51  ? 221 ASN B N   1 
ATOM   4818 C  CA  . ASN B 1 270 ? -20.006 12.577  -40.907 1.00 46.83  ? 221 ASN B CA  1 
ATOM   4819 C  C   . ASN B 1 270 ? -18.852 13.403  -40.358 1.00 50.31  ? 221 ASN B C   1 
ATOM   4820 O  O   . ASN B 1 270 ? -17.805 12.857  -39.976 1.00 55.46  ? 221 ASN B O   1 
ATOM   4821 C  CB  . ASN B 1 270 ? -19.482 11.344  -41.645 1.00 45.81  ? 221 ASN B CB  1 
ATOM   4822 C  CG  . ASN B 1 270 ? -20.600 10.527  -42.253 1.00 46.22  ? 221 ASN B CG  1 
ATOM   4823 O  OD1 . ASN B 1 270 ? -21.410 9.944   -41.531 1.00 50.15  ? 221 ASN B OD1 1 
ATOM   4824 N  ND2 . ASN B 1 270 ? -20.658 10.487  -43.584 1.00 41.34  ? 221 ASN B ND2 1 
ATOM   4825 N  N   . TYR B 1 271 ? -19.071 14.714  -40.309 1.00 51.63  ? 222 TYR B N   1 
ATOM   4826 C  CA  . TYR B 1 271 ? -18.091 15.672  -39.838 1.00 53.04  ? 222 TYR B CA  1 
ATOM   4827 C  C   . TYR B 1 271 ? -18.267 15.966  -38.322 1.00 52.46  ? 222 TYR B C   1 
ATOM   4828 O  O   . TYR B 1 271 ? -19.266 16.571  -37.924 1.00 51.74  ? 222 TYR B O   1 
ATOM   4829 C  CB  . TYR B 1 271 ? -18.208 16.949  -40.690 1.00 58.09  ? 222 TYR B CB  1 
ATOM   4830 C  CG  . TYR B 1 271 ? -17.315 18.053  -40.214 1.00 64.53  ? 222 TYR B CG  1 
ATOM   4831 C  CD1 . TYR B 1 271 ? -15.932 17.979  -40.405 1.00 65.70  ? 222 TYR B CD1 1 
ATOM   4832 C  CD2 . TYR B 1 271 ? -17.844 19.161  -39.538 1.00 68.24  ? 222 TYR B CD2 1 
ATOM   4833 C  CE1 . TYR B 1 271 ? -15.098 18.981  -39.939 1.00 71.86  ? 222 TYR B CE1 1 
ATOM   4834 C  CE2 . TYR B 1 271 ? -17.019 20.167  -39.066 1.00 72.38  ? 222 TYR B CE2 1 
ATOM   4835 C  CZ  . TYR B 1 271 ? -15.647 20.072  -39.270 1.00 73.73  ? 222 TYR B CZ  1 
ATOM   4836 O  OH  . TYR B 1 271 ? -14.818 21.060  -38.803 1.00 73.87  ? 222 TYR B OH  1 
ATOM   4837 N  N   . ASP B 1 272 ? -17.321 15.557  -37.469 1.00 47.84  ? 223 ASP B N   1 
ATOM   4838 C  CA  . ASP B 1 272 ? -16.077 14.870  -37.847 1.00 48.34  ? 223 ASP B CA  1 
ATOM   4839 C  C   . ASP B 1 272 ? -16.158 13.357  -37.610 1.00 48.99  ? 223 ASP B C   1 
ATOM   4840 O  O   . ASP B 1 272 ? -15.170 12.648  -37.789 1.00 46.61  ? 223 ASP B O   1 
ATOM   4841 C  CB  . ASP B 1 272 ? -14.875 15.437  -37.048 1.00 50.55  ? 223 ASP B CB  1 
ATOM   4842 C  CG  . ASP B 1 272 ? -15.073 15.384  -35.508 1.00 53.85  ? 223 ASP B CG  1 
ATOM   4843 O  OD1 . ASP B 1 272 ? -16.177 15.072  -35.014 1.00 52.60  ? 223 ASP B OD1 1 
ATOM   4844 O  OD2 . ASP B 1 272 ? -14.113 15.692  -34.774 1.00 57.62  ? 223 ASP B OD2 1 
ATOM   4845 N  N   . LYS B 1 273 ? -17.322 12.878  -37.171 1.00 47.08  ? 224 LYS B N   1 
ATOM   4846 C  CA  . LYS B 1 273 ? -17.579 11.447  -36.979 1.00 46.37  ? 224 LYS B CA  1 
ATOM   4847 C  C   . LYS B 1 273 ? -19.075 11.253  -36.917 1.00 46.63  ? 224 LYS B C   1 
ATOM   4848 O  O   . LYS B 1 273 ? -19.792 12.217  -36.627 1.00 50.54  ? 224 LYS B O   1 
ATOM   4849 C  CB  . LYS B 1 273 ? -16.917 10.920  -35.697 1.00 45.39  ? 224 LYS B CB  1 
ATOM   4850 C  CG  . LYS B 1 273 ? -17.427 11.523  -34.394 1.00 46.06  ? 224 LYS B CG  1 
ATOM   4851 C  CD  . LYS B 1 273 ? -16.567 11.088  -33.220 1.00 46.25  ? 224 LYS B CD  1 
ATOM   4852 C  CE  . LYS B 1 273 ? -17.211 11.453  -31.884 1.00 49.16  ? 224 LYS B CE  1 
ATOM   4853 N  NZ  . LYS B 1 273 ? -16.967 12.862  -31.453 1.00 50.05  ? 224 LYS B NZ  1 
ATOM   4854 N  N   . SER B 1 274 ? -19.546 10.034  -37.209 1.00 45.09  ? 225 SER B N   1 
ATOM   4855 C  CA  . SER B 1 274 ? -20.926 9.624   -36.889 1.00 44.86  ? 225 SER B CA  1 
ATOM   4856 C  C   . SER B 1 274 ? -20.907 8.444   -35.937 1.00 45.07  ? 225 SER B C   1 
ATOM   4857 O  O   . SER B 1 274 ? -20.202 7.467   -36.190 1.00 44.71  ? 225 SER B O   1 
ATOM   4858 C  CB  . SER B 1 274 ? -21.726 9.241   -38.133 1.00 42.63  ? 225 SER B CB  1 
ATOM   4859 O  OG  . SER B 1 274 ? -21.859 10.331  -39.000 1.00 43.49  ? 225 SER B OG  1 
ATOM   4860 N  N   . ILE B 1 275 ? -21.703 8.525   -34.870 1.00 42.94  ? 226 ILE B N   1 
ATOM   4861 C  CA  . ILE B 1 275 ? -21.702 7.479   -33.851 1.00 45.81  ? 226 ILE B CA  1 
ATOM   4862 C  C   . ILE B 1 275 ? -23.111 7.035   -33.422 1.00 48.96  ? 226 ILE B C   1 
ATOM   4863 O  O   . ILE B 1 275 ? -24.076 7.796   -33.556 1.00 47.24  ? 226 ILE B O   1 
ATOM   4864 C  CB  . ILE B 1 275 ? -20.835 7.846   -32.606 1.00 43.63  ? 226 ILE B CB  1 
ATOM   4865 C  CG1 . ILE B 1 275 ? -21.528 8.846   -31.688 1.00 42.06  ? 226 ILE B CG1 1 
ATOM   4866 C  CG2 . ILE B 1 275 ? -19.438 8.331   -32.993 1.00 40.90  ? 226 ILE B CG2 1 
ATOM   4867 C  CD1 . ILE B 1 275 ? -20.899 8.896   -30.293 1.00 41.16  ? 226 ILE B CD1 1 
ATOM   4868 N  N   . VAL B 1 276 ? -23.213 5.795   -32.934 1.00 48.34  ? 227 VAL B N   1 
ATOM   4869 C  CA  . VAL B 1 276 ? -24.423 5.299   -32.293 1.00 46.32  ? 227 VAL B CA  1 
ATOM   4870 C  C   . VAL B 1 276 ? -24.256 5.321   -30.770 1.00 47.20  ? 227 VAL B C   1 
ATOM   4871 O  O   . VAL B 1 276 ? -23.386 4.638   -30.215 1.00 55.64  ? 227 VAL B O   1 
ATOM   4872 C  CB  . VAL B 1 276 ? -24.763 3.884   -32.755 1.00 43.60  ? 227 VAL B CB  1 
ATOM   4873 C  CG1 . VAL B 1 276 ? -26.078 3.452   -32.112 1.00 42.51  ? 227 VAL B CG1 1 
ATOM   4874 C  CG2 . VAL B 1 276 ? -24.841 3.833   -34.272 1.00 41.36  ? 227 VAL B CG2 1 
ATOM   4875 N  N   . ASP B 1 277 ? -25.092 6.095   -30.089 1.00 42.16  ? 228 ASP B N   1 
ATOM   4876 C  CA  . ASP B 1 277 ? -24.825 6.407   -28.690 1.00 43.04  ? 228 ASP B CA  1 
ATOM   4877 C  C   . ASP B 1 277 ? -26.080 6.332   -27.803 1.00 42.48  ? 228 ASP B C   1 
ATOM   4878 O  O   . ASP B 1 277 ? -26.869 7.262   -27.760 1.00 42.37  ? 228 ASP B O   1 
ATOM   4879 C  CB  . ASP B 1 277 ? -24.139 7.788   -28.625 1.00 45.34  ? 228 ASP B CB  1 
ATOM   4880 C  CG  . ASP B 1 277 ? -23.812 8.242   -27.202 1.00 48.74  ? 228 ASP B CG  1 
ATOM   4881 O  OD1 . ASP B 1 277 ? -23.919 7.439   -26.246 1.00 47.45  ? 228 ASP B OD1 1 
ATOM   4882 O  OD2 . ASP B 1 277 ? -23.443 9.431   -27.044 1.00 50.03  ? 228 ASP B OD2 1 
ATOM   4883 N  N   . SER B 1 278 ? -26.254 5.220   -27.093 1.00 42.45  ? 229 SER B N   1 
ATOM   4884 C  CA  . SER B 1 278 ? -27.419 5.053   -26.217 1.00 44.67  ? 229 SER B CA  1 
ATOM   4885 C  C   . SER B 1 278 ? -27.424 6.007   -25.012 1.00 45.04  ? 229 SER B C   1 
ATOM   4886 O  O   . SER B 1 278 ? -28.438 6.131   -24.333 1.00 47.59  ? 229 SER B O   1 
ATOM   4887 C  CB  . SER B 1 278 ? -27.565 3.594   -25.756 1.00 43.03  ? 229 SER B CB  1 
ATOM   4888 O  OG  . SER B 1 278 ? -26.585 3.268   -24.780 1.00 43.05  ? 229 SER B OG  1 
ATOM   4889 N  N   . GLY B 1 279 ? -26.302 6.686   -24.772 1.00 44.05  ? 230 GLY B N   1 
ATOM   4890 C  CA  . GLY B 1 279 ? -26.142 7.609   -23.639 1.00 41.14  ? 230 GLY B CA  1 
ATOM   4891 C  C   . GLY B 1 279 ? -26.367 9.090   -23.949 1.00 42.54  ? 230 GLY B C   1 
ATOM   4892 O  O   . GLY B 1 279 ? -26.042 9.974   -23.145 1.00 45.53  ? 230 GLY B O   1 
ATOM   4893 N  N   . THR B 1 280 ? -26.908 9.359   -25.124 1.00 42.14  ? 231 THR B N   1 
ATOM   4894 C  CA  . THR B 1 280 ? -27.244 10.694  -25.569 1.00 43.08  ? 231 THR B CA  1 
ATOM   4895 C  C   . THR B 1 280 ? -28.713 10.610  -25.965 1.00 47.82  ? 231 THR B C   1 
ATOM   4896 O  O   . THR B 1 280 ? -29.152 9.613   -26.589 1.00 44.04  ? 231 THR B O   1 
ATOM   4897 C  CB  . THR B 1 280 ? -26.398 11.080  -26.796 1.00 44.42  ? 231 THR B CB  1 
ATOM   4898 O  OG1 . THR B 1 280 ? -25.057 11.363  -26.375 1.00 46.70  ? 231 THR B OG1 1 
ATOM   4899 C  CG2 . THR B 1 280 ? -26.960 12.303  -27.517 1.00 43.67  ? 231 THR B CG2 1 
ATOM   4900 N  N   . THR B 1 281 ? -29.474 11.649  -25.609 1.00 49.40  ? 232 THR B N   1 
ATOM   4901 C  CA  . THR B 1 281 ? -30.935 11.627  -25.783 1.00 48.61  ? 232 THR B CA  1 
ATOM   4902 C  C   . THR B 1 281 ? -31.325 11.825  -27.240 1.00 49.18  ? 232 THR B C   1 
ATOM   4903 O  O   . THR B 1 281 ? -32.050 11.006  -27.802 1.00 51.12  ? 232 THR B O   1 
ATOM   4904 C  CB  . THR B 1 281 ? -31.636 12.697  -24.919 1.00 44.90  ? 232 THR B CB  1 
ATOM   4905 O  OG1 . THR B 1 281 ? -31.470 12.379  -23.542 1.00 45.07  ? 232 THR B OG1 1 
ATOM   4906 C  CG2 . THR B 1 281 ? -33.131 12.752  -25.218 1.00 48.31  ? 232 THR B CG2 1 
ATOM   4907 N  N   . ASN B 1 282 ? -30.809 12.903  -27.829 1.00 46.47  ? 233 ASN B N   1 
ATOM   4908 C  CA  . ASN B 1 282 ? -31.262 13.423  -29.099 1.00 43.91  ? 233 ASN B CA  1 
ATOM   4909 C  C   . ASN B 1 282 ? -30.518 12.816  -30.258 1.00 44.32  ? 233 ASN B C   1 
ATOM   4910 O  O   . ASN B 1 282 ? -29.452 12.227  -30.070 1.00 42.76  ? 233 ASN B O   1 
ATOM   4911 C  CB  . ASN B 1 282 ? -31.004 14.927  -29.141 1.00 44.62  ? 233 ASN B CB  1 
ATOM   4912 C  CG  . ASN B 1 282 ? -32.040 15.741  -28.382 1.00 45.75  ? 233 ASN B CG  1 
ATOM   4913 O  OD1 . ASN B 1 282 ? -32.947 15.207  -27.732 1.00 48.26  ? 233 ASN B OD1 1 
ATOM   4914 N  ND2 . ASN B 1 282 ? -31.916 17.060  -28.481 1.00 44.07  ? 233 ASN B ND2 1 
ATOM   4915 N  N   . LEU B 1 283 ? -31.110 12.955  -31.450 1.00 44.91  ? 234 LEU B N   1 
ATOM   4916 C  CA  . LEU B 1 283 ? -30.396 12.846  -32.722 1.00 42.90  ? 234 LEU B CA  1 
ATOM   4917 C  C   . LEU B 1 283 ? -29.630 14.143  -32.774 1.00 46.13  ? 234 LEU B C   1 
ATOM   4918 O  O   . LEU B 1 283 ? -30.232 15.212  -32.764 1.00 47.65  ? 234 LEU B O   1 
ATOM   4919 C  CB  . LEU B 1 283 ? -31.364 12.761  -33.922 1.00 37.72  ? 234 LEU B CB  1 
ATOM   4920 C  CG  . LEU B 1 283 ? -30.810 12.914  -35.360 1.00 38.24  ? 234 LEU B CG  1 
ATOM   4921 C  CD1 . LEU B 1 283 ? -29.682 11.936  -35.640 1.00 37.00  ? 234 LEU B CD1 1 
ATOM   4922 C  CD2 . LEU B 1 283 ? -31.887 12.761  -36.445 1.00 35.47  ? 234 LEU B CD2 1 
ATOM   4923 N  N   . ARG B 1 284 ? -28.308 14.060  -32.772 1.00 46.00  ? 235 ARG B N   1 
ATOM   4924 C  CA  . ARG B 1 284 ? -27.487 15.259  -32.893 1.00 46.77  ? 235 ARG B CA  1 
ATOM   4925 C  C   . ARG B 1 284 ? -26.810 15.297  -34.264 1.00 46.07  ? 235 ARG B C   1 
ATOM   4926 O  O   . ARG B 1 284 ? -26.308 14.273  -34.736 1.00 44.81  ? 235 ARG B O   1 
ATOM   4927 C  CB  . ARG B 1 284 ? -26.464 15.353  -31.749 1.00 44.63  ? 235 ARG B CB  1 
ATOM   4928 C  CG  . ARG B 1 284 ? -27.091 15.311  -30.372 1.00 47.43  ? 235 ARG B CG  1 
ATOM   4929 C  CD  . ARG B 1 284 ? -26.039 15.410  -29.288 1.00 50.42  ? 235 ARG B CD  1 
ATOM   4930 N  NE  . ARG B 1 284 ? -25.595 16.792  -29.142 1.00 59.72  ? 235 ARG B NE  1 
ATOM   4931 C  CZ  . ARG B 1 284 ? -24.324 17.160  -28.998 1.00 63.34  ? 235 ARG B CZ  1 
ATOM   4932 N  NH1 . ARG B 1 284 ? -23.355 16.242  -28.975 1.00 57.53  ? 235 ARG B NH1 1 
ATOM   4933 N  NH2 . ARG B 1 284 ? -24.021 18.451  -28.881 1.00 61.95  ? 235 ARG B NH2 1 
ATOM   4934 N  N   . LEU B 1 285 ? -26.814 16.477  -34.889 1.00 44.70  ? 236 LEU B N   1 
ATOM   4935 C  CA  . LEU B 1 285 ? -26.304 16.683  -36.248 1.00 43.05  ? 236 LEU B CA  1 
ATOM   4936 C  C   . LEU B 1 285 ? -25.303 17.844  -36.308 1.00 46.32  ? 236 LEU B C   1 
ATOM   4937 O  O   . LEU B 1 285 ? -25.488 18.853  -35.610 1.00 49.03  ? 236 LEU B O   1 
ATOM   4938 C  CB  . LEU B 1 285 ? -27.466 16.987  -37.200 1.00 42.22  ? 236 LEU B CB  1 
ATOM   4939 C  CG  . LEU B 1 285 ? -28.564 15.936  -37.396 1.00 43.27  ? 236 LEU B CG  1 
ATOM   4940 C  CD1 . LEU B 1 285 ? -29.686 16.513  -38.246 1.00 41.84  ? 236 LEU B CD1 1 
ATOM   4941 C  CD2 . LEU B 1 285 ? -28.057 14.620  -37.985 1.00 41.22  ? 236 LEU B CD2 1 
ATOM   4942 N  N   . PRO B 1 286 ? -24.243 17.716  -37.144 1.00 48.16  ? 237 PRO B N   1 
ATOM   4943 C  CA  . PRO B 1 286 ? -23.238 18.777  -37.308 1.00 47.87  ? 237 PRO B CA  1 
ATOM   4944 C  C   . PRO B 1 286 ? -23.906 20.065  -37.751 1.00 51.56  ? 237 PRO B C   1 
ATOM   4945 O  O   . PRO B 1 286 ? -24.822 20.013  -38.570 1.00 56.04  ? 237 PRO B O   1 
ATOM   4946 C  CB  . PRO B 1 286 ? -22.349 18.257  -38.441 1.00 48.29  ? 237 PRO B CB  1 
ATOM   4947 C  CG  . PRO B 1 286 ? -22.535 16.789  -38.440 1.00 50.50  ? 237 PRO B CG  1 
ATOM   4948 C  CD  . PRO B 1 286 ? -23.966 16.566  -38.026 1.00 50.29  ? 237 PRO B CD  1 
ATOM   4949 N  N   . LYS B 1 287 ? -23.456 21.204  -37.218 1.00 55.71  ? 238 LYS B N   1 
ATOM   4950 C  CA  . LYS B 1 287 ? -24.061 22.534  -37.480 1.00 58.37  ? 238 LYS B CA  1 
ATOM   4951 C  C   . LYS B 1 287 ? -24.752 22.729  -38.846 1.00 57.32  ? 238 LYS B C   1 
ATOM   4952 O  O   . LYS B 1 287 ? -25.934 23.088  -38.889 1.00 56.65  ? 238 LYS B O   1 
ATOM   4953 C  CB  . LYS B 1 287 ? -23.029 23.643  -37.245 1.00 63.01  ? 238 LYS B CB  1 
ATOM   4954 C  CG  . LYS B 1 287 ? -23.573 25.052  -37.408 1.00 69.77  ? 238 LYS B CG  1 
ATOM   4955 C  CD  . LYS B 1 287 ? -22.646 26.074  -36.763 1.00 78.47  ? 238 LYS B CD  1 
ATOM   4956 C  CE  . LYS B 1 287 ? -23.219 27.479  -36.849 1.00 78.91  ? 238 LYS B CE  1 
ATOM   4957 N  NZ  . LYS B 1 287 ? -23.246 27.958  -38.257 1.00 81.25  ? 238 LYS B NZ  1 
ATOM   4958 N  N   . LYS B 1 288 ? -24.014 22.491  -39.936 1.00 53.48  ? 239 LYS B N   1 
ATOM   4959 C  CA  . LYS B 1 288 ? -24.513 22.697  -41.297 1.00 53.72  ? 239 LYS B CA  1 
ATOM   4960 C  C   . LYS B 1 288 ? -25.623 21.738  -41.678 1.00 54.67  ? 239 LYS B C   1 
ATOM   4961 O  O   . LYS B 1 288 ? -26.534 22.112  -42.415 1.00 57.66  ? 239 LYS B O   1 
ATOM   4962 C  CB  . LYS B 1 288 ? -23.387 22.542  -42.324 1.00 56.43  ? 239 LYS B CB  1 
ATOM   4963 C  CG  . LYS B 1 288 ? -22.723 23.835  -42.729 1.00 60.82  ? 239 LYS B CG  1 
ATOM   4964 C  CD  . LYS B 1 288 ? -21.767 23.609  -43.880 1.00 62.63  ? 239 LYS B CD  1 
ATOM   4965 C  CE  . LYS B 1 288 ? -20.560 24.517  -43.726 1.00 65.67  ? 239 LYS B CE  1 
ATOM   4966 N  NZ  . LYS B 1 288 ? -19.491 24.186  -44.709 1.00 71.01  ? 239 LYS B NZ  1 
ATOM   4967 N  N   . VAL B 1 289 ? -25.513 20.490  -41.220 1.00 51.15  ? 240 VAL B N   1 
ATOM   4968 C  CA  . VAL B 1 289 ? -26.532 19.463  -41.480 1.00 48.88  ? 240 VAL B CA  1 
ATOM   4969 C  C   . VAL B 1 289 ? -27.785 19.760  -40.655 1.00 48.77  ? 240 VAL B C   1 
ATOM   4970 O  O   . VAL B 1 289 ? -28.904 19.599  -41.143 1.00 51.73  ? 240 VAL B O   1 
ATOM   4971 C  CB  . VAL B 1 289 ? -26.006 18.028  -41.222 1.00 45.14  ? 240 VAL B CB  1 
ATOM   4972 C  CG1 . VAL B 1 289 ? -27.092 16.995  -41.465 1.00 42.02  ? 240 VAL B CG1 1 
ATOM   4973 C  CG2 . VAL B 1 289 ? -24.813 17.750  -42.122 1.00 43.78  ? 240 VAL B CG2 1 
ATOM   4974 N  N   . PHE B 1 290 ? -27.590 20.235  -39.425 1.00 48.24  ? 241 PHE B N   1 
ATOM   4975 C  CA  . PHE B 1 290 ? -28.705 20.590  -38.562 1.00 48.51  ? 241 PHE B CA  1 
ATOM   4976 C  C   . PHE B 1 290 ? -29.492 21.733  -39.166 1.00 52.90  ? 241 PHE B C   1 
ATOM   4977 O  O   . PHE B 1 290 ? -30.716 21.725  -39.112 1.00 55.77  ? 241 PHE B O   1 
ATOM   4978 C  CB  . PHE B 1 290 ? -28.238 20.967  -37.157 1.00 44.94  ? 241 PHE B CB  1 
ATOM   4979 C  CG  . PHE B 1 290 ? -29.335 21.526  -36.282 1.00 47.51  ? 241 PHE B CG  1 
ATOM   4980 C  CD1 . PHE B 1 290 ? -30.262 20.682  -35.667 1.00 48.69  ? 241 PHE B CD1 1 
ATOM   4981 C  CD2 . PHE B 1 290 ? -29.446 22.901  -36.067 1.00 48.53  ? 241 PHE B CD2 1 
ATOM   4982 C  CE1 . PHE B 1 290 ? -31.275 21.188  -34.851 1.00 49.78  ? 241 PHE B CE1 1 
ATOM   4983 C  CE2 . PHE B 1 290 ? -30.454 23.412  -35.260 1.00 48.15  ? 241 PHE B CE2 1 
ATOM   4984 C  CZ  . PHE B 1 290 ? -31.368 22.556  -34.644 1.00 50.70  ? 241 PHE B CZ  1 
ATOM   4985 N  N   . GLU B 1 291 ? -28.793 22.716  -39.732 1.00 54.69  ? 242 GLU B N   1 
ATOM   4986 C  CA  . GLU B 1 291 ? -29.456 23.897  -40.286 1.00 53.18  ? 242 GLU B CA  1 
ATOM   4987 C  C   . GLU B 1 291 ? -30.266 23.526  -41.516 1.00 52.51  ? 242 GLU B C   1 
ATOM   4988 O  O   . GLU B 1 291 ? -31.401 23.981  -41.668 1.00 52.90  ? 242 GLU B O   1 
ATOM   4989 C  CB  . GLU B 1 291 ? -28.459 25.028  -40.571 1.00 57.36  ? 242 GLU B CB  1 
ATOM   4990 C  CG  . GLU B 1 291 ? -28.004 25.759  -39.302 1.00 66.40  ? 242 GLU B CG  1 
ATOM   4991 C  CD  . GLU B 1 291 ? -26.719 26.574  -39.470 1.00 77.82  ? 242 GLU B CD  1 
ATOM   4992 O  OE1 . GLU B 1 291 ? -26.142 26.587  -40.588 1.00 80.74  ? 242 GLU B OE1 1 
ATOM   4993 O  OE2 . GLU B 1 291 ? -26.271 27.201  -38.473 1.00 79.00  ? 242 GLU B OE2 1 
ATOM   4994 N  N   . ALA B 1 292 ? -29.709 22.658  -42.356 1.00 50.93  ? 243 ALA B N   1 
ATOM   4995 C  CA  . ALA B 1 292 ? -30.382 22.230  -43.582 1.00 52.53  ? 243 ALA B CA  1 
ATOM   4996 C  C   . ALA B 1 292 ? -31.585 21.348  -43.282 1.00 54.05  ? 243 ALA B C   1 
ATOM   4997 O  O   . ALA B 1 292 ? -32.612 21.429  -43.959 1.00 54.44  ? 243 ALA B O   1 
ATOM   4998 C  CB  . ALA B 1 292 ? -29.409 21.497  -44.493 1.00 52.88  ? 243 ALA B CB  1 
ATOM   4999 N  N   . ALA B 1 293 ? -31.447 20.506  -42.261 1.00 51.17  ? 244 ALA B N   1 
ATOM   5000 C  CA  . ALA B 1 293 ? -32.510 19.607  -41.873 1.00 51.01  ? 244 ALA B CA  1 
ATOM   5001 C  C   . ALA B 1 293 ? -33.649 20.388  -41.215 1.00 52.95  ? 244 ALA B C   1 
ATOM   5002 O  O   . ALA B 1 293 ? -34.813 20.192  -41.579 1.00 55.69  ? 244 ALA B O   1 
ATOM   5003 C  CB  . ALA B 1 293 ? -31.984 18.504  -40.960 1.00 48.72  ? 244 ALA B CB  1 
ATOM   5004 N  N   . VAL B 1 294 ? -33.319 21.281  -40.274 1.00 53.61  ? 245 VAL B N   1 
ATOM   5005 C  CA  . VAL B 1 294 ? -34.337 22.091  -39.573 1.00 52.91  ? 245 VAL B CA  1 
ATOM   5006 C  C   . VAL B 1 294 ? -35.142 22.927  -40.550 1.00 52.22  ? 245 VAL B C   1 
ATOM   5007 O  O   . VAL B 1 294 ? -36.358 23.019  -40.424 1.00 54.11  ? 245 VAL B O   1 
ATOM   5008 C  CB  . VAL B 1 294 ? -33.759 22.976  -38.450 1.00 53.46  ? 245 VAL B CB  1 
ATOM   5009 C  CG1 . VAL B 1 294 ? -34.840 23.849  -37.846 1.00 52.24  ? 245 VAL B CG1 1 
ATOM   5010 C  CG2 . VAL B 1 294 ? -33.208 22.093  -37.351 1.00 58.10  ? 245 VAL B CG2 1 
ATOM   5011 N  N   . LYS B 1 295 ? -34.471 23.507  -41.536 1.00 48.92  ? 246 LYS B N   1 
ATOM   5012 C  CA  . LYS B 1 295 ? -35.162 24.265  -42.574 1.00 51.11  ? 246 LYS B CA  1 
ATOM   5013 C  C   . LYS B 1 295 ? -36.164 23.379  -43.347 1.00 50.55  ? 246 LYS B C   1 
ATOM   5014 O  O   . LYS B 1 295 ? -37.309 23.768  -43.593 1.00 50.20  ? 246 LYS B O   1 
ATOM   5015 C  CB  . LYS B 1 295 ? -34.144 24.918  -43.526 1.00 51.49  ? 246 LYS B CB  1 
ATOM   5016 C  CG  . LYS B 1 295 ? -34.778 25.540  -44.762 1.00 54.93  ? 246 LYS B CG  1 
ATOM   5017 C  CD  . LYS B 1 295 ? -33.798 26.350  -45.590 1.00 57.69  ? 246 LYS B CD  1 
ATOM   5018 C  CE  . LYS B 1 295 ? -34.454 26.745  -46.911 1.00 60.84  ? 246 LYS B CE  1 
ATOM   5019 N  NZ  . LYS B 1 295 ? -33.443 27.084  -47.948 1.00 63.38  ? 246 LYS B NZ  1 
ATOM   5020 N  N   . SER B 1 296 ? -35.723 22.180  -43.706 1.00 51.39  ? 247 SER B N   1 
ATOM   5021 C  CA  . SER B 1 296 ? -36.518 21.268  -44.517 1.00 49.16  ? 247 SER B CA  1 
ATOM   5022 C  C   . SER B 1 296 ? -37.681 20.637  -43.721 1.00 47.60  ? 247 SER B C   1 
ATOM   5023 O  O   . SER B 1 296 ? -38.791 20.522  -44.245 1.00 47.56  ? 247 SER B O   1 
ATOM   5024 C  CB  . SER B 1 296 ? -35.609 20.221  -45.166 1.00 47.89  ? 247 SER B CB  1 
ATOM   5025 O  OG  . SER B 1 296 ? -36.365 19.229  -45.805 1.00 45.70  ? 247 SER B OG  1 
ATOM   5026 N  N   . ILE B 1 297 ? -37.440 20.257  -42.465 1.00 47.27  ? 248 ILE B N   1 
ATOM   5027 C  CA  . ILE B 1 297 ? -38.528 19.840  -41.541 1.00 49.36  ? 248 ILE B CA  1 
ATOM   5028 C  C   . ILE B 1 297 ? -39.579 20.963  -41.324 1.00 53.10  ? 248 ILE B C   1 
ATOM   5029 O  O   . ILE B 1 297 ? -40.798 20.686  -41.264 1.00 53.54  ? 248 ILE B O   1 
ATOM   5030 C  CB  . ILE B 1 297 ? -37.967 19.309  -40.192 1.00 45.03  ? 248 ILE B CB  1 
ATOM   5031 C  CG1 . ILE B 1 297 ? -37.041 18.106  -40.435 1.00 45.55  ? 248 ILE B CG1 1 
ATOM   5032 C  CG2 . ILE B 1 297 ? -39.086 18.902  -39.236 1.00 42.82  ? 248 ILE B CG2 1 
ATOM   5033 C  CD1 . ILE B 1 297 ? -36.089 17.791  -39.287 1.00 41.89  ? 248 ILE B CD1 1 
ATOM   5034 N  N   . LYS B 1 298 ? -39.102 22.215  -41.216 1.00 51.03  ? 249 LYS B N   1 
ATOM   5035 C  CA  . LYS B 1 298 ? -39.970 23.403  -41.119 1.00 48.49  ? 249 LYS B CA  1 
ATOM   5036 C  C   . LYS B 1 298 ? -40.827 23.556  -42.360 1.00 47.95  ? 249 LYS B C   1 
ATOM   5037 O  O   . LYS B 1 298 ? -42.025 23.807  -42.258 1.00 50.13  ? 249 LYS B O   1 
ATOM   5038 C  CB  . LYS B 1 298 ? -39.168 24.690  -40.935 1.00 48.17  ? 249 LYS B CB  1 
ATOM   5039 C  CG  . LYS B 1 298 ? -38.738 25.022  -39.519 1.00 48.81  ? 249 LYS B CG  1 
ATOM   5040 C  CD  . LYS B 1 298 ? -37.795 26.212  -39.580 1.00 48.78  ? 249 LYS B CD  1 
ATOM   5041 C  CE  . LYS B 1 298 ? -37.569 26.832  -38.225 1.00 50.57  ? 249 LYS B CE  1 
ATOM   5042 N  NZ  . LYS B 1 298 ? -36.454 27.809  -38.277 1.00 52.47  ? 249 LYS B NZ  1 
ATOM   5043 N  N   . ALA B 1 299 ? -40.214 23.420  -43.530 1.00 46.28  ? 250 ALA B N   1 
ATOM   5044 C  CA  . ALA B 1 299 ? -40.958 23.524  -44.786 1.00 48.32  ? 250 ALA B CA  1 
ATOM   5045 C  C   . ALA B 1 299 ? -42.057 22.459  -44.834 1.00 53.61  ? 250 ALA B C   1 
ATOM   5046 O  O   . ALA B 1 299 ? -43.221 22.789  -45.000 1.00 63.83  ? 250 ALA B O   1 
ATOM   5047 C  CB  . ALA B 1 299 ? -40.019 23.389  -45.972 1.00 43.64  ? 250 ALA B CB  1 
ATOM   5048 N  N   . ALA B 1 300 ? -41.685 21.188  -44.654 1.00 53.57  ? 251 ALA B N   1 
ATOM   5049 C  CA  . ALA B 1 300 ? -42.645 20.084  -44.673 1.00 46.66  ? 251 ALA B CA  1 
ATOM   5050 C  C   . ALA B 1 300 ? -43.782 20.258  -43.669 1.00 44.94  ? 251 ALA B C   1 
ATOM   5051 O  O   . ALA B 1 300 ? -44.918 19.889  -43.954 1.00 46.93  ? 251 ALA B O   1 
ATOM   5052 C  CB  . ALA B 1 300 ? -41.940 18.734  -44.484 1.00 44.80  ? 251 ALA B CB  1 
ATOM   5053 N  N   . SER B 1 301 ? -43.497 20.827  -42.502 1.00 43.90  ? 252 SER B N   1 
ATOM   5054 C  CA  . SER B 1 301 ? -44.545 20.981  -41.483 1.00 44.15  ? 252 SER B CA  1 
ATOM   5055 C  C   . SER B 1 301 ? -45.219 22.350  -41.492 1.00 49.67  ? 252 SER B C   1 
ATOM   5056 O  O   . SER B 1 301 ? -45.935 22.687  -40.544 1.00 50.52  ? 252 SER B O   1 
ATOM   5057 C  CB  . SER B 1 301 ? -43.989 20.690  -40.080 1.00 43.92  ? 252 SER B CB  1 
ATOM   5058 O  OG  . SER B 1 301 ? -42.823 21.452  -39.805 1.00 41.75  ? 252 SER B OG  1 
ATOM   5059 N  N   . SER B 1 302 ? -45.016 23.125  -42.559 1.00 53.70  ? 253 SER B N   1 
ATOM   5060 C  CA  . SER B 1 302 ? -45.324 24.570  -42.542 1.00 59.03  ? 253 SER B CA  1 
ATOM   5061 C  C   . SER B 1 302 ? -46.792 24.979  -42.403 1.00 64.17  ? 253 SER B C   1 
ATOM   5062 O  O   . SER B 1 302 ? -47.074 26.176  -42.339 1.00 73.47  ? 253 SER B O   1 
ATOM   5063 C  CB  . SER B 1 302 ? -44.726 25.275  -43.758 1.00 52.88  ? 253 SER B CB  1 
ATOM   5064 O  OG  . SER B 1 302 ? -45.553 25.059  -44.875 1.00 57.36  ? 253 SER B OG  1 
ATOM   5065 N  N   . THR B 1 303 ? -47.720 24.019  -42.362 1.00 65.72  ? 254 THR B N   1 
ATOM   5066 C  CA  . THR B 1 303 ? -49.132 24.348  -42.076 1.00 67.17  ? 254 THR B CA  1 
ATOM   5067 C  C   . THR B 1 303 ? -49.392 24.740  -40.605 1.00 66.53  ? 254 THR B C   1 
ATOM   5068 O  O   . THR B 1 303 ? -50.395 25.381  -40.305 1.00 70.95  ? 254 THR B O   1 
ATOM   5069 C  CB  . THR B 1 303 ? -50.127 23.252  -42.539 1.00 69.45  ? 254 THR B CB  1 
ATOM   5070 O  OG1 . THR B 1 303 ? -49.821 22.007  -41.902 1.00 70.87  ? 254 THR B OG1 1 
ATOM   5071 C  CG2 . THR B 1 303 ? -50.085 23.079  -44.063 1.00 69.96  ? 254 THR B CG2 1 
ATOM   5072 N  N   . GLU B 1 304 ? -48.504 24.332  -39.699 1.00 66.10  ? 255 GLU B N   1 
ATOM   5073 C  CA  . GLU B 1 304 ? -48.408 24.935  -38.365 1.00 66.92  ? 255 GLU B CA  1 
ATOM   5074 C  C   . GLU B 1 304 ? -47.057 25.649  -38.174 1.00 69.66  ? 255 GLU B C   1 
ATOM   5075 O  O   . GLU B 1 304 ? -46.007 25.140  -38.596 1.00 68.07  ? 255 GLU B O   1 
ATOM   5076 C  CB  . GLU B 1 304 ? -48.621 23.898  -37.258 1.00 64.49  ? 255 GLU B CB  1 
ATOM   5077 C  CG  . GLU B 1 304 ? -50.078 23.715  -36.867 1.00 69.39  ? 255 GLU B CG  1 
ATOM   5078 C  CD  . GLU B 1 304 ? -50.282 22.751  -35.707 1.00 72.40  ? 255 GLU B CD  1 
ATOM   5079 O  OE1 . GLU B 1 304 ? -49.786 23.030  -34.586 1.00 74.34  ? 255 GLU B OE1 1 
ATOM   5080 O  OE2 . GLU B 1 304 ? -50.954 21.713  -35.920 1.00 69.56  ? 255 GLU B OE2 1 
ATOM   5081 N  N   . LYS B 1 305 ? -47.097 26.829  -37.549 1.00 70.21  ? 256 LYS B N   1 
ATOM   5082 C  CA  . LYS B 1 305 ? -45.881 27.578  -37.201 1.00 68.75  ? 256 LYS B CA  1 
ATOM   5083 C  C   . LYS B 1 305 ? -45.582 27.416  -35.726 1.00 65.90  ? 256 LYS B C   1 
ATOM   5084 O  O   . LYS B 1 305 ? -46.473 27.561  -34.885 1.00 69.30  ? 256 LYS B O   1 
ATOM   5085 C  CB  . LYS B 1 305 ? -46.006 29.062  -37.559 1.00 69.10  ? 256 LYS B CB  1 
ATOM   5086 C  CG  . LYS B 1 305 ? -45.953 29.337  -39.053 1.00 75.74  ? 256 LYS B CG  1 
ATOM   5087 C  CD  . LYS B 1 305 ? -44.523 29.345  -39.577 1.00 85.55  ? 256 LYS B CD  1 
ATOM   5088 C  CE  . LYS B 1 305 ? -44.480 29.418  -41.101 1.00 90.90  ? 256 LYS B CE  1 
ATOM   5089 N  NZ  . LYS B 1 305 ? -44.778 28.100  -41.739 1.00 88.58  ? 256 LYS B NZ  1 
ATOM   5090 N  N   . PHE B 1 306 ? -44.327 27.105  -35.417 1.00 62.20  ? 257 PHE B N   1 
ATOM   5091 C  CA  . PHE B 1 306 ? -43.917 26.855  -34.042 1.00 59.80  ? 257 PHE B CA  1 
ATOM   5092 C  C   . PHE B 1 306 ? -42.897 27.888  -33.592 1.00 59.40  ? 257 PHE B C   1 
ATOM   5093 O  O   . PHE B 1 306 ? -42.144 28.399  -34.424 1.00 59.80  ? 257 PHE B O   1 
ATOM   5094 C  CB  . PHE B 1 306 ? -43.347 25.439  -33.908 1.00 60.43  ? 257 PHE B CB  1 
ATOM   5095 C  CG  . PHE B 1 306 ? -44.271 24.367  -34.411 1.00 58.16  ? 257 PHE B CG  1 
ATOM   5096 C  CD1 . PHE B 1 306 ? -45.239 23.822  -33.577 1.00 60.85  ? 257 PHE B CD1 1 
ATOM   5097 C  CD2 . PHE B 1 306 ? -44.182 23.915  -35.718 1.00 55.86  ? 257 PHE B CD2 1 
ATOM   5098 C  CE1 . PHE B 1 306 ? -46.099 22.846  -34.042 1.00 58.88  ? 257 PHE B CE1 1 
ATOM   5099 C  CE2 . PHE B 1 306 ? -45.035 22.942  -36.190 1.00 55.35  ? 257 PHE B CE2 1 
ATOM   5100 C  CZ  . PHE B 1 306 ? -45.990 22.404  -35.351 1.00 57.89  ? 257 PHE B CZ  1 
ATOM   5101 N  N   . PRO B 1 307 ? -42.875 28.204  -32.276 1.00 61.25  ? 258 PRO B N   1 
ATOM   5102 C  CA  . PRO B 1 307 ? -41.850 29.098  -31.714 1.00 63.61  ? 258 PRO B CA  1 
ATOM   5103 C  C   . PRO B 1 307 ? -40.402 28.662  -32.029 1.00 68.63  ? 258 PRO B C   1 
ATOM   5104 O  O   . PRO B 1 307 ? -40.122 27.470  -32.213 1.00 71.64  ? 258 PRO B O   1 
ATOM   5105 C  CB  . PRO B 1 307 ? -42.119 29.054  -30.189 1.00 63.21  ? 258 PRO B CB  1 
ATOM   5106 C  CG  . PRO B 1 307 ? -43.212 28.056  -29.964 1.00 61.30  ? 258 PRO B CG  1 
ATOM   5107 C  CD  . PRO B 1 307 ? -43.909 27.855  -31.280 1.00 60.79  ? 258 PRO B CD  1 
ATOM   5108 N  N   . ASP B 1 308 ? -39.487 29.625  -32.086 1.00 70.67  ? 259 ASP B N   1 
ATOM   5109 C  CA  . ASP B 1 308 ? -38.081 29.322  -32.335 1.00 69.96  ? 259 ASP B CA  1 
ATOM   5110 C  C   . ASP B 1 308 ? -37.472 28.435  -31.257 1.00 66.12  ? 259 ASP B C   1 
ATOM   5111 O  O   . ASP B 1 308 ? -36.593 27.634  -31.544 1.00 68.16  ? 259 ASP B O   1 
ATOM   5112 C  CB  . ASP B 1 308 ? -37.280 30.611  -32.500 1.00 75.24  ? 259 ASP B CB  1 
ATOM   5113 C  CG  . ASP B 1 308 ? -37.598 31.326  -33.810 1.00 77.62  ? 259 ASP B CG  1 
ATOM   5114 O  OD1 . ASP B 1 308 ? -38.445 30.821  -34.577 1.00 80.33  ? 259 ASP B OD1 1 
ATOM   5115 O  OD2 . ASP B 1 308 ? -37.000 32.388  -34.080 1.00 77.77  ? 259 ASP B OD2 1 
ATOM   5116 N  N   . GLY B 1 309 ? -37.963 28.565  -30.029 1.00 60.69  ? 260 GLY B N   1 
ATOM   5117 C  CA  . GLY B 1 309 ? -37.483 27.766  -28.908 1.00 57.48  ? 260 GLY B CA  1 
ATOM   5118 C  C   . GLY B 1 309 ? -37.900 26.303  -28.979 1.00 60.30  ? 260 GLY B C   1 
ATOM   5119 O  O   . GLY B 1 309 ? -37.341 25.460  -28.247 1.00 58.60  ? 260 GLY B O   1 
ATOM   5120 N  N   . PHE B 1 310 ? -38.901 26.006  -29.823 1.00 55.84  ? 261 PHE B N   1 
ATOM   5121 C  CA  . PHE B 1 310 ? -39.275 24.623  -30.144 1.00 50.83  ? 261 PHE B CA  1 
ATOM   5122 C  C   . PHE B 1 310 ? -38.146 23.997  -30.950 1.00 52.58  ? 261 PHE B C   1 
ATOM   5123 O  O   . PHE B 1 310 ? -37.600 22.972  -30.546 1.00 57.52  ? 261 PHE B O   1 
ATOM   5124 C  CB  . PHE B 1 310 ? -40.607 24.541  -30.917 1.00 49.79  ? 261 PHE B CB  1 
ATOM   5125 C  CG  . PHE B 1 310 ? -40.891 23.177  -31.518 1.00 48.71  ? 261 PHE B CG  1 
ATOM   5126 C  CD1 . PHE B 1 310 ? -41.192 22.074  -30.708 1.00 49.44  ? 261 PHE B CD1 1 
ATOM   5127 C  CD2 . PHE B 1 310 ? -40.848 22.987  -32.888 1.00 48.16  ? 261 PHE B CD2 1 
ATOM   5128 C  CE1 . PHE B 1 310 ? -41.437 20.821  -31.265 1.00 46.52  ? 261 PHE B CE1 1 
ATOM   5129 C  CE2 . PHE B 1 310 ? -41.091 21.734  -33.448 1.00 47.30  ? 261 PHE B CE2 1 
ATOM   5130 C  CZ  . PHE B 1 310 ? -41.387 20.651  -32.637 1.00 45.65  ? 261 PHE B CZ  1 
ATOM   5131 N  N   . TRP B 1 311 ? -37.790 24.631  -32.068 1.00 49.79  ? 262 TRP B N   1 
ATOM   5132 C  CA  . TRP B 1 311 ? -36.743 24.135  -32.956 1.00 51.28  ? 262 TRP B CA  1 
ATOM   5133 C  C   . TRP B 1 311 ? -35.349 24.066  -32.329 1.00 54.36  ? 262 TRP B C   1 
ATOM   5134 O  O   . TRP B 1 311 ? -34.505 23.285  -32.782 1.00 52.94  ? 262 TRP B O   1 
ATOM   5135 C  CB  . TRP B 1 311 ? -36.703 24.946  -34.241 1.00 48.09  ? 262 TRP B CB  1 
ATOM   5136 C  CG  . TRP B 1 311 ? -37.982 24.875  -35.027 1.00 54.07  ? 262 TRP B CG  1 
ATOM   5137 C  CD1 . TRP B 1 311 ? -38.891 25.885  -35.213 1.00 58.33  ? 262 TRP B CD1 1 
ATOM   5138 C  CD2 . TRP B 1 311 ? -38.502 23.738  -35.739 1.00 54.64  ? 262 TRP B CD2 1 
ATOM   5139 N  NE1 . TRP B 1 311 ? -39.939 25.453  -36.001 1.00 54.45  ? 262 TRP B NE1 1 
ATOM   5140 C  CE2 . TRP B 1 311 ? -39.730 24.141  -36.335 1.00 56.04  ? 262 TRP B CE2 1 
ATOM   5141 C  CE3 . TRP B 1 311 ? -38.054 22.417  -35.928 1.00 50.95  ? 262 TRP B CE3 1 
ATOM   5142 C  CZ2 . TRP B 1 311 ? -40.522 23.263  -37.109 1.00 57.60  ? 262 TRP B CZ2 1 
ATOM   5143 C  CZ3 . TRP B 1 311 ? -38.835 21.549  -36.701 1.00 51.78  ? 262 TRP B CZ3 1 
ATOM   5144 C  CH2 . TRP B 1 311 ? -40.062 21.978  -37.280 1.00 54.15  ? 262 TRP B CH2 1 
ATOM   5145 N  N   . LEU B 1 312 ? -35.117 24.874  -31.293 1.00 58.74  ? 263 LEU B N   1 
ATOM   5146 C  CA  . LEU B 1 312 ? -33.844 24.873  -30.540 1.00 60.61  ? 263 LEU B CA  1 
ATOM   5147 C  C   . LEU B 1 312 ? -33.844 23.829  -29.415 1.00 60.53  ? 263 LEU B C   1 
ATOM   5148 O  O   . LEU B 1 312 ? -32.905 23.752  -28.617 1.00 61.52  ? 263 LEU B O   1 
ATOM   5149 C  CB  . LEU B 1 312 ? -33.513 26.277  -29.982 1.00 60.05  ? 263 LEU B CB  1 
ATOM   5150 C  CG  . LEU B 1 312 ? -33.229 27.412  -30.980 1.00 59.81  ? 263 LEU B CG  1 
ATOM   5151 C  CD1 . LEU B 1 312 ? -33.242 28.776  -30.311 1.00 61.01  ? 263 LEU B CD1 1 
ATOM   5152 C  CD2 . LEU B 1 312 ? -31.927 27.180  -31.723 1.00 59.48  ? 263 LEU B CD2 1 
ATOM   5153 N  N   . GLY B 1 313 ? -34.905 23.028  -29.360 1.00 60.57  ? 264 GLY B N   1 
ATOM   5154 C  CA  . GLY B 1 313 ? -34.991 21.911  -28.422 1.00 59.29  ? 264 GLY B CA  1 
ATOM   5155 C  C   . GLY B 1 313 ? -35.357 22.329  -27.014 1.00 62.27  ? 264 GLY B C   1 
ATOM   5156 O  O   . GLY B 1 313 ? -35.426 21.493  -26.112 1.00 60.91  ? 264 GLY B O   1 
ATOM   5157 N  N   . GLU B 1 314 ? -35.607 23.619  -26.823 1.00 67.45  ? 265 GLU B N   1 
ATOM   5158 C  CA  . GLU B 1 314 ? -35.782 24.155  -25.484 1.00 74.49  ? 265 GLU B CA  1 
ATOM   5159 C  C   . GLU B 1 314 ? -37.219 24.070  -24.974 1.00 73.71  ? 265 GLU B C   1 
ATOM   5160 O  O   . GLU B 1 314 ? -37.459 23.476  -23.917 1.00 76.19  ? 265 GLU B O   1 
ATOM   5161 C  CB  . GLU B 1 314 ? -35.223 25.578  -25.398 1.00 81.09  ? 265 GLU B CB  1 
ATOM   5162 C  CG  . GLU B 1 314 ? -33.698 25.615  -25.390 1.00 87.22  ? 265 GLU B CG  1 
ATOM   5163 C  CD  . GLU B 1 314 ? -33.131 26.967  -25.795 1.00 92.95  ? 265 GLU B CD  1 
ATOM   5164 O  OE1 . GLU B 1 314 ? -32.113 27.383  -25.195 1.00 91.52  ? 265 GLU B OE1 1 
ATOM   5165 O  OE2 . GLU B 1 314 ? -33.699 27.615  -26.710 1.00 93.11  ? 265 GLU B OE2 1 
ATOM   5166 N  N   . GLN B 1 315 ? -38.175 24.628  -25.716 1.00 70.99  ? 266 GLN B N   1 
ATOM   5167 C  CA  . GLN B 1 315 ? -39.563 24.660  -25.224 1.00 73.55  ? 266 GLN B CA  1 
ATOM   5168 C  C   . GLN B 1 315 ? -40.489 23.592  -25.804 1.00 69.34  ? 266 GLN B C   1 
ATOM   5169 O  O   . GLN B 1 315 ? -40.294 23.114  -26.929 1.00 63.70  ? 266 GLN B O   1 
ATOM   5170 C  CB  . GLN B 1 315 ? -40.191 26.076  -25.286 1.00 78.90  ? 266 GLN B CB  1 
ATOM   5171 C  CG  . GLN B 1 315 ? -40.330 26.708  -26.664 1.00 78.27  ? 266 GLN B CG  1 
ATOM   5172 C  CD  . GLN B 1 315 ? -40.991 28.084  -26.619 1.00 79.70  ? 266 GLN B CD  1 
ATOM   5173 O  OE1 . GLN B 1 315 ? -40.341 29.105  -26.841 1.00 82.06  ? 266 GLN B OE1 1 
ATOM   5174 N  NE2 . GLN B 1 315 ? -42.287 28.113  -26.332 1.00 77.93  ? 266 GLN B NE2 1 
ATOM   5175 N  N   . LEU B 1 316 ? -41.482 23.213  -25.003 1.00 63.87  ? 267 LEU B N   1 
ATOM   5176 C  CA  . LEU B 1 316 ? -42.414 22.160  -25.372 1.00 63.04  ? 267 LEU B CA  1 
ATOM   5177 C  C   . LEU B 1 316 ? -43.521 22.731  -26.238 1.00 62.60  ? 267 LEU B C   1 
ATOM   5178 O  O   . LEU B 1 316 ? -43.829 23.911  -26.143 1.00 67.84  ? 267 LEU B O   1 
ATOM   5179 C  CB  . LEU B 1 316 ? -42.972 21.439  -24.123 1.00 60.58  ? 267 LEU B CB  1 
ATOM   5180 C  CG  . LEU B 1 316 ? -44.088 21.974  -23.217 1.00 57.92  ? 267 LEU B CG  1 
ATOM   5181 C  CD1 . LEU B 1 316 ? -44.362 20.974  -22.098 1.00 54.65  ? 267 LEU B CD1 1 
ATOM   5182 C  CD2 . LEU B 1 316 ? -43.777 23.357  -22.653 1.00 61.85  ? 267 LEU B CD2 1 
ATOM   5183 N  N   . VAL B 1 317 ? -44.085 21.890  -27.102 1.00 61.70  ? 268 VAL B N   1 
ATOM   5184 C  CA  . VAL B 1 317 ? -45.268 22.229  -27.905 1.00 57.79  ? 268 VAL B CA  1 
ATOM   5185 C  C   . VAL B 1 317 ? -46.403 21.270  -27.538 1.00 56.32  ? 268 VAL B C   1 
ATOM   5186 O  O   . VAL B 1 317 ? -46.175 20.051  -27.462 1.00 55.33  ? 268 VAL B O   1 
ATOM   5187 C  CB  . VAL B 1 317 ? -44.972 22.141  -29.408 1.00 57.89  ? 268 VAL B CB  1 
ATOM   5188 C  CG1 . VAL B 1 317 ? -46.262 22.206  -30.201 1.00 60.92  ? 268 VAL B CG1 1 
ATOM   5189 C  CG2 . VAL B 1 317 ? -44.075 23.289  -29.817 1.00 60.63  ? 268 VAL B CG2 1 
ATOM   5190 N  N   . CYS B 1 318 ? -47.602 21.815  -27.283 1.00 50.35  ? 269 CYS B N   1 
ATOM   5191 C  CA  . CYS B 1 318 ? -48.728 20.996  -26.856 1.00 50.95  ? 269 CYS B CA  1 
ATOM   5192 C  C   . CYS B 1 318 ? -49.871 21.019  -27.858 1.00 53.32  ? 269 CYS B C   1 
ATOM   5193 O  O   . CYS B 1 318 ? -50.077 22.012  -28.571 1.00 54.09  ? 269 CYS B O   1 
ATOM   5194 C  CB  . CYS B 1 318 ? -49.216 21.388  -25.456 1.00 49.41  ? 269 CYS B CB  1 
ATOM   5195 S  SG  . CYS B 1 318 ? -47.951 21.276  -24.147 1.00 56.78  ? 269 CYS B SG  1 
ATOM   5196 N  N   . TRP B 1 319 ? -50.574 19.889  -27.933 1.00 52.78  ? 270 TRP B N   1 
ATOM   5197 C  CA  . TRP B 1 319 ? -51.818 19.764  -28.679 1.00 52.91  ? 270 TRP B CA  1 
ATOM   5198 C  C   . TRP B 1 319 ? -52.904 19.210  -27.771 1.00 56.34  ? 270 TRP B C   1 
ATOM   5199 O  O   . TRP B 1 319 ? -52.614 18.552  -26.766 1.00 60.42  ? 270 TRP B O   1 
ATOM   5200 C  CB  . TRP B 1 319 ? -51.645 18.823  -29.865 1.00 53.27  ? 270 TRP B CB  1 
ATOM   5201 C  CG  . TRP B 1 319 ? -50.839 19.406  -31.016 1.00 55.34  ? 270 TRP B CG  1 
ATOM   5202 C  CD1 . TRP B 1 319 ? -51.301 20.213  -32.015 1.00 49.14  ? 270 TRP B CD1 1 
ATOM   5203 C  CD2 . TRP B 1 319 ? -49.439 19.208  -31.274 1.00 53.96  ? 270 TRP B CD2 1 
ATOM   5204 N  NE1 . TRP B 1 319 ? -50.279 20.539  -32.869 1.00 51.90  ? 270 TRP B NE1 1 
ATOM   5205 C  CE2 . TRP B 1 319 ? -49.125 19.933  -32.443 1.00 51.85  ? 270 TRP B CE2 1 
ATOM   5206 C  CE3 . TRP B 1 319 ? -48.419 18.494  -30.620 1.00 53.67  ? 270 TRP B CE3 1 
ATOM   5207 C  CZ2 . TRP B 1 319 ? -47.833 19.959  -32.992 1.00 54.46  ? 270 TRP B CZ2 1 
ATOM   5208 C  CZ3 . TRP B 1 319 ? -47.135 18.524  -31.157 1.00 57.55  ? 270 TRP B CZ3 1 
ATOM   5209 C  CH2 . TRP B 1 319 ? -46.853 19.257  -32.339 1.00 56.10  ? 270 TRP B CH2 1 
ATOM   5210 N  N   . GLN B 1 320 ? -54.154 19.476  -28.131 1.00 54.42  ? 271 GLN B N   1 
ATOM   5211 C  CA  . GLN B 1 320 ? -55.304 18.944  -27.421 1.00 57.31  ? 271 GLN B CA  1 
ATOM   5212 C  C   . GLN B 1 320 ? -55.180 17.418  -27.429 1.00 56.67  ? 271 GLN B C   1 
ATOM   5213 O  O   . GLN B 1 320 ? -54.644 16.847  -28.379 1.00 58.18  ? 271 GLN B O   1 
ATOM   5214 C  CB  . GLN B 1 320 ? -56.563 19.411  -28.148 1.00 65.37  ? 271 GLN B CB  1 
ATOM   5215 C  CG  . GLN B 1 320 ? -57.909 19.239  -27.440 1.00 72.86  ? 271 GLN B CG  1 
ATOM   5216 C  CD  . GLN B 1 320 ? -59.063 19.470  -28.416 1.00 77.04  ? 271 GLN B CD  1 
ATOM   5217 O  OE1 . GLN B 1 320 ? -58.885 20.080  -29.474 1.00 76.43  ? 271 GLN B OE1 1 
ATOM   5218 N  NE2 . GLN B 1 320 ? -60.244 18.973  -28.074 1.00 81.05  ? 271 GLN B NE2 1 
ATOM   5219 N  N   . ALA B 1 321 ? -55.660 16.775  -26.367 1.00 54.85  ? 272 ALA B N   1 
ATOM   5220 C  CA  . ALA B 1 321 ? -55.482 15.334  -26.146 1.00 49.88  ? 272 ALA B CA  1 
ATOM   5221 C  C   . ALA B 1 321 ? -55.791 14.497  -27.384 1.00 48.77  ? 272 ALA B C   1 
ATOM   5222 O  O   . ALA B 1 321 ? -56.835 14.657  -27.993 1.00 51.76  ? 272 ALA B O   1 
ATOM   5223 C  CB  . ALA B 1 321 ? -56.326 14.884  -24.963 1.00 47.20  ? 272 ALA B CB  1 
ATOM   5224 N  N   . GLY B 1 322 ? -54.873 13.611  -27.763 1.00 52.22  ? 273 GLY B N   1 
ATOM   5225 C  CA  . GLY B 1 322 ? -55.072 12.757  -28.936 1.00 50.05  ? 273 GLY B CA  1 
ATOM   5226 C  C   . GLY B 1 322 ? -55.068 13.452  -30.303 1.00 48.98  ? 273 GLY B C   1 
ATOM   5227 O  O   . GLY B 1 322 ? -55.274 12.790  -31.310 1.00 48.63  ? 273 GLY B O   1 
ATOM   5228 N  N   . THR B 1 323 ? -54.820 14.762  -30.375 1.00 46.00  ? 274 THR B N   1 
ATOM   5229 C  CA  . THR B 1 323 ? -54.865 15.452  -31.697 1.00 47.47  ? 274 THR B CA  1 
ATOM   5230 C  C   . THR B 1 323 ? -53.523 15.760  -32.390 1.00 49.95  ? 274 THR B C   1 
ATOM   5231 O  O   . THR B 1 323 ? -53.511 16.445  -33.429 1.00 50.88  ? 274 THR B O   1 
ATOM   5232 C  CB  . THR B 1 323 ? -55.696 16.747  -31.661 1.00 45.26  ? 274 THR B CB  1 
ATOM   5233 O  OG1 . THR B 1 323 ? -55.026 17.720  -30.840 1.00 45.75  ? 274 THR B OG1 1 
ATOM   5234 C  CG2 . THR B 1 323 ? -57.112 16.457  -31.125 1.00 44.84  ? 274 THR B CG2 1 
ATOM   5235 N  N   . THR B 1 324 ? -52.408 15.274  -31.829 1.00 48.65  ? 275 THR B N   1 
ATOM   5236 C  CA  . THR B 1 324 ? -51.079 15.535  -32.403 1.00 48.52  ? 275 THR B CA  1 
ATOM   5237 C  C   . THR B 1 324 ? -51.121 15.224  -33.904 1.00 45.23  ? 275 THR B C   1 
ATOM   5238 O  O   . THR B 1 324 ? -51.445 14.099  -34.292 1.00 44.76  ? 275 THR B O   1 
ATOM   5239 C  CB  . THR B 1 324 ? -49.964 14.715  -31.703 1.00 47.69  ? 275 THR B CB  1 
ATOM   5240 O  OG1 . THR B 1 324 ? -50.047 14.885  -30.281 1.00 45.50  ? 275 THR B OG1 1 
ATOM   5241 C  CG2 . THR B 1 324 ? -48.575 15.147  -32.189 1.00 44.56  ? 275 THR B CG2 1 
ATOM   5242 N  N   . PRO B 1 325 ? -50.804 16.220  -34.750 1.00 44.16  ? 276 PRO B N   1 
ATOM   5243 C  CA  . PRO B 1 325 ? -50.905 16.047  -36.200 1.00 45.03  ? 276 PRO B CA  1 
ATOM   5244 C  C   . PRO B 1 325 ? -49.656 15.395  -36.801 1.00 44.57  ? 276 PRO B C   1 
ATOM   5245 O  O   . PRO B 1 325 ? -48.938 16.028  -37.575 1.00 43.13  ? 276 PRO B O   1 
ATOM   5246 C  CB  . PRO B 1 325 ? -51.071 17.498  -36.704 1.00 45.74  ? 276 PRO B CB  1 
ATOM   5247 C  CG  . PRO B 1 325 ? -50.317 18.330  -35.708 1.00 44.08  ? 276 PRO B CG  1 
ATOM   5248 C  CD  . PRO B 1 325 ? -50.232 17.539  -34.408 1.00 46.01  ? 276 PRO B CD  1 
ATOM   5249 N  N   . TRP B 1 326 ? -49.399 14.140  -36.434 1.00 47.29  ? 277 TRP B N   1 
ATOM   5250 C  CA  . TRP B 1 326 ? -48.220 13.405  -36.895 1.00 45.21  ? 277 TRP B CA  1 
ATOM   5251 C  C   . TRP B 1 326 ? -47.975 13.560  -38.396 1.00 47.61  ? 277 TRP B C   1 
ATOM   5252 O  O   . TRP B 1 326 ? -46.832 13.705  -38.833 1.00 51.60  ? 277 TRP B O   1 
ATOM   5253 C  CB  . TRP B 1 326 ? -48.356 11.916  -36.542 1.00 48.78  ? 277 TRP B CB  1 
ATOM   5254 C  CG  . TRP B 1 326 ? -48.494 11.682  -35.069 1.00 50.52  ? 277 TRP B CG  1 
ATOM   5255 C  CD1 . TRP B 1 326 ? -49.608 11.203  -34.399 1.00 47.57  ? 277 TRP B CD1 1 
ATOM   5256 C  CD2 . TRP B 1 326 ? -47.502 11.953  -34.066 1.00 47.08  ? 277 TRP B CD2 1 
ATOM   5257 N  NE1 . TRP B 1 326 ? -49.352 11.160  -33.045 1.00 47.47  ? 277 TRP B NE1 1 
ATOM   5258 C  CE2 . TRP B 1 326 ? -48.068 11.609  -32.815 1.00 49.18  ? 277 TRP B CE2 1 
ATOM   5259 C  CE3 . TRP B 1 326 ? -46.190 12.445  -34.103 1.00 46.92  ? 277 TRP B CE3 1 
ATOM   5260 C  CZ2 . TRP B 1 326 ? -47.351 11.731  -31.613 1.00 48.01  ? 277 TRP B CZ2 1 
ATOM   5261 C  CZ3 . TRP B 1 326 ? -45.485 12.568  -32.911 1.00 45.09  ? 277 TRP B CZ3 1 
ATOM   5262 C  CH2 . TRP B 1 326 ? -46.068 12.215  -31.685 1.00 44.63  ? 277 TRP B CH2 1 
ATOM   5263 N  N   . ASN B 1 327 ? -49.052 13.545  -39.179 1.00 45.51  ? 278 ASN B N   1 
ATOM   5264 C  CA  . ASN B 1 327 ? -48.958 13.523  -40.647 1.00 45.95  ? 278 ASN B CA  1 
ATOM   5265 C  C   . ASN B 1 327 ? -48.360 14.800  -41.270 1.00 45.29  ? 278 ASN B C   1 
ATOM   5266 O  O   . ASN B 1 327 ? -47.859 14.764  -42.401 1.00 41.24  ? 278 ASN B O   1 
ATOM   5267 C  CB  . ASN B 1 327 ? -50.327 13.205  -41.295 1.00 44.67  ? 278 ASN B CB  1 
ATOM   5268 C  CG  . ASN B 1 327 ? -51.270 14.403  -41.277 1.00 46.22  ? 278 ASN B CG  1 
ATOM   5269 O  OD1 . ASN B 1 327 ? -51.350 15.155  -42.238 1.00 46.10  ? 278 ASN B OD1 1 
ATOM   5270 N  ND2 . ASN B 1 327 ? -51.969 14.591  -40.168 1.00 46.83  ? 278 ASN B ND2 1 
ATOM   5271 N  N   . ILE B 1 328 ? -48.416 15.919  -40.548 1.00 46.27  ? 279 ILE B N   1 
ATOM   5272 C  CA  . ILE B 1 328 ? -47.813 17.170  -41.052 1.00 47.55  ? 279 ILE B CA  1 
ATOM   5273 C  C   . ILE B 1 328 ? -46.275 17.146  -40.956 1.00 47.26  ? 279 ILE B C   1 
ATOM   5274 O  O   . ILE B 1 328 ? -45.618 17.857  -41.695 1.00 46.54  ? 279 ILE B O   1 
ATOM   5275 C  CB  . ILE B 1 328 ? -48.374 18.453  -40.362 1.00 48.93  ? 279 ILE B CB  1 
ATOM   5276 C  CG1 . ILE B 1 328 ? -47.830 18.600  -38.931 1.00 47.07  ? 279 ILE B CG1 1 
ATOM   5277 C  CG2 . ILE B 1 328 ? -49.904 18.483  -40.367 1.00 44.28  ? 279 ILE B CG2 1 
ATOM   5278 C  CD1 . ILE B 1 328 ? -48.024 19.980  -38.339 1.00 50.39  ? 279 ILE B CD1 1 
ATOM   5279 N  N   . PHE B 1 329 ? -45.710 16.332  -40.056 1.00 44.29  ? 280 PHE B N   1 
ATOM   5280 C  CA  . PHE B 1 329 ? -44.252 16.204  -39.945 1.00 41.46  ? 280 PHE B CA  1 
ATOM   5281 C  C   . PHE B 1 329 ? -43.715 15.128  -40.868 1.00 42.85  ? 280 PHE B C   1 
ATOM   5282 O  O   . PHE B 1 329 ? -44.349 14.081  -41.029 1.00 43.38  ? 280 PHE B O   1 
ATOM   5283 C  CB  . PHE B 1 329 ? -43.839 15.879  -38.517 1.00 42.33  ? 280 PHE B CB  1 
ATOM   5284 C  CG  . PHE B 1 329 ? -44.119 16.976  -37.544 1.00 43.63  ? 280 PHE B CG  1 
ATOM   5285 C  CD1 . PHE B 1 329 ? -45.334 17.028  -36.871 1.00 43.58  ? 280 PHE B CD1 1 
ATOM   5286 C  CD2 . PHE B 1 329 ? -43.164 17.959  -37.289 1.00 44.49  ? 280 PHE B CD2 1 
ATOM   5287 C  CE1 . PHE B 1 329 ? -45.604 18.039  -35.956 1.00 44.92  ? 280 PHE B CE1 1 
ATOM   5288 C  CE2 . PHE B 1 329 ? -43.426 18.968  -36.379 1.00 46.86  ? 280 PHE B CE2 1 
ATOM   5289 C  CZ  . PHE B 1 329 ? -44.650 19.011  -35.710 1.00 46.54  ? 280 PHE B CZ  1 
ATOM   5290 N  N   . PRO B 1 330 ? -42.528 15.364  -41.461 1.00 42.49  ? 281 PRO B N   1 
ATOM   5291 C  CA  . PRO B 1 330 ? -41.948 14.422  -42.406 1.00 40.53  ? 281 PRO B CA  1 
ATOM   5292 C  C   . PRO B 1 330 ? -41.207 13.261  -41.746 1.00 42.90  ? 281 PRO B C   1 
ATOM   5293 O  O   . PRO B 1 330 ? -40.776 13.366  -40.581 1.00 45.01  ? 281 PRO B O   1 
ATOM   5294 C  CB  . PRO B 1 330 ? -40.951 15.289  -43.175 1.00 37.37  ? 281 PRO B CB  1 
ATOM   5295 C  CG  . PRO B 1 330 ? -40.475 16.248  -42.154 1.00 40.55  ? 281 PRO B CG  1 
ATOM   5296 C  CD  . PRO B 1 330 ? -41.689 16.572  -41.326 1.00 42.75  ? 281 PRO B CD  1 
ATOM   5297 N  N   . VAL B 1 331 ? -41.063 12.162  -42.487 1.00 41.13  ? 282 VAL B N   1 
ATOM   5298 C  CA  . VAL B 1 331 ? -40.150 11.096  -42.093 1.00 40.71  ? 282 VAL B CA  1 
ATOM   5299 C  C   . VAL B 1 331 ? -38.716 11.524  -42.454 1.00 42.88  ? 282 VAL B C   1 
ATOM   5300 O  O   . VAL B 1 331 ? -38.508 12.306  -43.381 1.00 43.57  ? 282 VAL B O   1 
ATOM   5301 C  CB  . VAL B 1 331 ? -40.510 9.741   -42.758 1.00 39.44  ? 282 VAL B CB  1 
ATOM   5302 C  CG1 . VAL B 1 331 ? -41.980 9.419   -42.544 1.00 35.69  ? 282 VAL B CG1 1 
ATOM   5303 C  CG2 . VAL B 1 331 ? -40.171 9.732   -44.245 1.00 36.16  ? 282 VAL B CG2 1 
ATOM   5304 N  N   . ILE B 1 332 ? -37.744 11.035  -41.691 1.00 43.52  ? 283 ILE B N   1 
ATOM   5305 C  CA  . ILE B 1 332 ? -36.335 11.281  -41.948 1.00 42.91  ? 283 ILE B CA  1 
ATOM   5306 C  C   . ILE B 1 332 ? -35.668 9.934   -42.229 1.00 44.17  ? 283 ILE B C   1 
ATOM   5307 O  O   . ILE B 1 332 ? -35.798 8.989   -41.441 1.00 44.26  ? 283 ILE B O   1 
ATOM   5308 C  CB  . ILE B 1 332 ? -35.667 11.976  -40.741 1.00 45.55  ? 283 ILE B CB  1 
ATOM   5309 C  CG1 . ILE B 1 332 ? -36.378 13.304  -40.437 1.00 43.24  ? 283 ILE B CG1 1 
ATOM   5310 C  CG2 . ILE B 1 332 ? -34.164 12.162  -40.970 1.00 45.08  ? 283 ILE B CG2 1 
ATOM   5311 C  CD1 . ILE B 1 332 ? -36.006 13.901  -39.107 1.00 44.96  ? 283 ILE B CD1 1 
ATOM   5312 N  N   . SER B 1 333 ? -34.992 9.837   -43.373 1.00 42.25  ? 284 SER B N   1 
ATOM   5313 C  CA  . SER B 1 333 ? -34.214 8.642   -43.707 1.00 41.89  ? 284 SER B CA  1 
ATOM   5314 C  C   . SER B 1 333 ? -32.706 8.920   -43.685 1.00 42.77  ? 284 SER B C   1 
ATOM   5315 O  O   . SER B 1 333 ? -32.230 9.913   -44.236 1.00 45.35  ? 284 SER B O   1 
ATOM   5316 C  CB  . SER B 1 333 ? -34.623 8.090   -45.075 1.00 39.05  ? 284 SER B CB  1 
ATOM   5317 O  OG  . SER B 1 333 ? -36.016 7.865   -45.094 1.00 38.68  ? 284 SER B OG  1 
ATOM   5318 N  N   . LEU B 1 334 ? -31.969 8.043   -43.022 1.00 40.37  ? 285 LEU B N   1 
ATOM   5319 C  CA  . LEU B 1 334 ? -30.520 8.079   -43.031 1.00 38.92  ? 285 LEU B CA  1 
ATOM   5320 C  C   . LEU B 1 334 ? -30.060 6.874   -43.835 1.00 39.57  ? 285 LEU B C   1 
ATOM   5321 O  O   . LEU B 1 334 ? -30.434 5.727   -43.518 1.00 38.27  ? 285 LEU B O   1 
ATOM   5322 C  CB  . LEU B 1 334 ? -29.973 8.038   -41.585 1.00 35.36  ? 285 LEU B CB  1 
ATOM   5323 C  CG  . LEU B 1 334 ? -30.457 9.152   -40.639 1.00 39.94  ? 285 LEU B CG  1 
ATOM   5324 C  CD1 . LEU B 1 334 ? -29.956 8.939   -39.216 1.00 41.91  ? 285 LEU B CD1 1 
ATOM   5325 C  CD2 . LEU B 1 334 ? -30.090 10.552  -41.131 1.00 36.22  ? 285 LEU B CD2 1 
ATOM   5326 N  N   . TYR B 1 335 ? -29.283 7.118   -44.887 1.00 38.07  ? 286 TYR B N   1 
ATOM   5327 C  CA  . TYR B 1 335 ? -28.693 6.011   -45.619 1.00 40.25  ? 286 TYR B CA  1 
ATOM   5328 C  C   . TYR B 1 335 ? -27.341 5.671   -45.038 1.00 42.04  ? 286 TYR B C   1 
ATOM   5329 O  O   . TYR B 1 335 ? -26.559 6.566   -44.698 1.00 38.83  ? 286 TYR B O   1 
ATOM   5330 C  CB  . TYR B 1 335 ? -28.571 6.313   -47.105 1.00 39.51  ? 286 TYR B CB  1 
ATOM   5331 C  CG  . TYR B 1 335 ? -29.882 6.369   -47.844 1.00 39.89  ? 286 TYR B CG  1 
ATOM   5332 C  CD1 . TYR B 1 335 ? -30.788 7.403   -47.623 1.00 39.11  ? 286 TYR B CD1 1 
ATOM   5333 C  CD2 . TYR B 1 335 ? -30.210 5.405   -48.791 1.00 39.13  ? 286 TYR B CD2 1 
ATOM   5334 C  CE1 . TYR B 1 335 ? -31.990 7.466   -48.313 1.00 38.83  ? 286 TYR B CE1 1 
ATOM   5335 C  CE2 . TYR B 1 335 ? -31.410 5.455   -49.490 1.00 38.72  ? 286 TYR B CE2 1 
ATOM   5336 C  CZ  . TYR B 1 335 ? -32.298 6.492   -49.262 1.00 41.64  ? 286 TYR B CZ  1 
ATOM   5337 O  OH  . TYR B 1 335 ? -33.496 6.552   -49.985 1.00 43.29  ? 286 TYR B OH  1 
ATOM   5338 N  N   . LEU B 1 336 ? -27.075 4.371   -44.908 1.00 42.48  ? 287 LEU B N   1 
ATOM   5339 C  CA  . LEU B 1 336 ? -25.850 3.906   -44.267 1.00 45.55  ? 287 LEU B CA  1 
ATOM   5340 C  C   . LEU B 1 336 ? -25.044 3.004   -45.190 1.00 47.17  ? 287 LEU B C   1 
ATOM   5341 O  O   . LEU B 1 336 ? -25.600 2.181   -45.890 1.00 52.95  ? 287 LEU B O   1 
ATOM   5342 C  CB  . LEU B 1 336 ? -26.184 3.191   -42.965 1.00 45.11  ? 287 LEU B CB  1 
ATOM   5343 C  CG  . LEU B 1 336 ? -26.706 4.058   -41.811 1.00 46.06  ? 287 LEU B CG  1 
ATOM   5344 C  CD1 . LEU B 1 336 ? -27.441 3.221   -40.767 1.00 45.23  ? 287 LEU B CD1 1 
ATOM   5345 C  CD2 . LEU B 1 336 ? -25.557 4.820   -41.171 1.00 48.49  ? 287 LEU B CD2 1 
ATOM   5346 N  N   . MET B 1 337 ? -23.728 3.169   -45.203 1.00 46.07  ? 288 MET B N   1 
ATOM   5347 C  CA  . MET B 1 337 ? -22.871 2.312   -46.008 1.00 47.36  ? 288 MET B CA  1 
ATOM   5348 C  C   . MET B 1 337 ? -23.209 0.845   -45.684 1.00 45.65  ? 288 MET B C   1 
ATOM   5349 O  O   . MET B 1 337 ? -23.369 0.468   -44.517 1.00 44.37  ? 288 MET B O   1 
ATOM   5350 C  CB  . MET B 1 337 ? -21.401 2.636   -45.706 1.00 47.26  ? 288 MET B CB  1 
ATOM   5351 C  CG  . MET B 1 337 ? -20.361 1.968   -46.596 1.00 52.64  ? 288 MET B CG  1 
ATOM   5352 S  SD  . MET B 1 337 ? -18.662 2.439   -46.152 1.00 55.65  ? 288 MET B SD  1 
ATOM   5353 C  CE  . MET B 1 337 ? -18.746 2.253   -44.351 1.00 55.59  ? 288 MET B CE  1 
ATOM   5354 N  N   . GLY B 1 338 ? -23.345 0.021   -46.709 1.00 46.08  ? 289 GLY B N   1 
ATOM   5355 C  CA  . GLY B 1 338 ? -23.627 -1.409  -46.488 1.00 51.01  ? 289 GLY B CA  1 
ATOM   5356 C  C   . GLY B 1 338 ? -22.398 -2.308  -46.427 1.00 50.51  ? 289 GLY B C   1 
ATOM   5357 O  O   . GLY B 1 338 ? -21.269 -1.836  -46.546 1.00 51.96  ? 289 GLY B O   1 
ATOM   5358 N  N   . GLU B 1 339 ? -22.614 -3.607  -46.259 1.00 50.85  ? 290 GLU B N   1 
ATOM   5359 C  CA  . GLU B 1 339 ? -21.498 -4.543  -46.227 1.00 51.18  ? 290 GLU B CA  1 
ATOM   5360 C  C   . GLU B 1 339 ? -20.993 -4.942  -47.627 1.00 51.92  ? 290 GLU B C   1 
ATOM   5361 O  O   . GLU B 1 339 ? -19.809 -5.203  -47.801 1.00 51.85  ? 290 GLU B O   1 
ATOM   5362 C  CB  . GLU B 1 339 ? -21.858 -5.761  -45.385 1.00 55.51  ? 290 GLU B CB  1 
ATOM   5363 C  CG  . GLU B 1 339 ? -21.986 -5.460  -43.895 1.00 55.44  ? 290 GLU B CG  1 
ATOM   5364 C  CD  . GLU B 1 339 ? -21.532 -6.625  -43.027 1.00 60.07  ? 290 GLU B CD  1 
ATOM   5365 O  OE1 . GLU B 1 339 ? -22.287 -7.624  -42.920 1.00 53.52  ? 290 GLU B OE1 1 
ATOM   5366 O  OE2 . GLU B 1 339 ? -20.410 -6.544  -42.446 1.00 60.19  ? 290 GLU B OE2 1 
ATOM   5367 N  N   . VAL B 1 340 ? -21.886 -4.979  -48.619 1.00 55.01  ? 291 VAL B N   1 
ATOM   5368 C  CA  . VAL B 1 340 ? -21.506 -5.224  -50.021 1.00 52.28  ? 291 VAL B CA  1 
ATOM   5369 C  C   . VAL B 1 340 ? -20.980 -3.941  -50.701 1.00 53.98  ? 291 VAL B C   1 
ATOM   5370 O  O   . VAL B 1 340 ? -21.539 -2.856  -50.510 1.00 55.48  ? 291 VAL B O   1 
ATOM   5371 C  CB  . VAL B 1 340 ? -22.694 -5.810  -50.822 1.00 53.27  ? 291 VAL B CB  1 
ATOM   5372 C  CG1 . VAL B 1 340 ? -22.320 -6.040  -52.286 1.00 50.00  ? 291 VAL B CG1 1 
ATOM   5373 C  CG2 . VAL B 1 340 ? -23.200 -7.099  -50.182 1.00 54.43  ? 291 VAL B CG2 1 
ATOM   5374 N  N   . THR B 1 341 ? -19.913 -4.078  -51.491 1.00 55.69  ? 292 THR B N   1 
ATOM   5375 C  CA  . THR B 1 341 ? -19.309 -2.981  -52.281 1.00 55.83  ? 292 THR B CA  1 
ATOM   5376 C  C   . THR B 1 341 ? -20.320 -2.203  -53.139 1.00 56.90  ? 292 THR B C   1 
ATOM   5377 O  O   . THR B 1 341 ? -21.082 -2.807  -53.895 1.00 59.01  ? 292 THR B O   1 
ATOM   5378 C  CB  . THR B 1 341 ? -18.158 -3.529  -53.165 1.00 55.63  ? 292 THR B CB  1 
ATOM   5379 O  OG1 . THR B 1 341 ? -17.049 -3.851  -52.321 1.00 57.13  ? 292 THR B OG1 1 
ATOM   5380 C  CG2 . THR B 1 341 ? -17.675 -2.497  -54.202 1.00 55.62  ? 292 THR B CG2 1 
ATOM   5381 N  N   . ASN B 1 342 ? -20.321 -0.874  -53.010 1.00 52.05  ? 293 ASN B N   1 
ATOM   5382 C  CA  . ASN B 1 342 ? -21.274 0.019   -53.734 1.00 56.02  ? 293 ASN B CA  1 
ATOM   5383 C  C   . ASN B 1 342 ? -22.771 -0.135  -53.390 1.00 54.58  ? 293 ASN B C   1 
ATOM   5384 O  O   . ASN B 1 342 ? -23.659 0.217   -54.184 1.00 54.42  ? 293 ASN B O   1 
ATOM   5385 C  CB  . ASN B 1 342 ? -21.073 -0.029  -55.261 1.00 56.25  ? 293 ASN B CB  1 
ATOM   5386 C  CG  . ASN B 1 342 ? -19.697 0.443   -55.685 1.00 57.02  ? 293 ASN B CG  1 
ATOM   5387 O  OD1 . ASN B 1 342 ? -18.953 1.024   -54.896 1.00 59.01  ? 293 ASN B OD1 1 
ATOM   5388 N  ND2 . ASN B 1 342 ? -19.354 0.199   -56.937 1.00 52.94  ? 293 ASN B ND2 1 
ATOM   5389 N  N   . GLN B 1 343 ? -23.041 -0.634  -52.191 1.00 51.00  ? 294 GLN B N   1 
ATOM   5390 C  CA  . GLN B 1 343 ? -24.399 -0.918  -51.786 1.00 49.30  ? 294 GLN B CA  1 
ATOM   5391 C  C   . GLN B 1 343 ? -24.644 -0.243  -50.457 1.00 48.75  ? 294 GLN B C   1 
ATOM   5392 O  O   . GLN B 1 343 ? -23.760 -0.229  -49.593 1.00 52.48  ? 294 GLN B O   1 
ATOM   5393 C  CB  . GLN B 1 343 ? -24.582 -2.428  -51.701 1.00 50.18  ? 294 GLN B CB  1 
ATOM   5394 C  CG  . GLN B 1 343 ? -25.807 -2.908  -50.948 1.00 56.29  ? 294 GLN B CG  1 
ATOM   5395 C  CD  . GLN B 1 343 ? -26.071 -4.402  -51.141 1.00 64.93  ? 294 GLN B CD  1 
ATOM   5396 O  OE1 . GLN B 1 343 ? -25.850 -4.969  -52.230 1.00 66.36  ? 294 GLN B OE1 1 
ATOM   5397 N  NE2 . GLN B 1 343 ? -26.562 -5.046  -50.084 1.00 66.32  ? 294 GLN B NE2 1 
ATOM   5398 N  N   . SER B 1 344 ? -25.827 0.348   -50.305 1.00 49.39  ? 295 SER B N   1 
ATOM   5399 C  CA  . SER B 1 344 ? -26.235 0.935   -49.015 1.00 47.12  ? 295 SER B CA  1 
ATOM   5400 C  C   . SER B 1 344 ? -27.666 0.540   -48.689 1.00 46.80  ? 295 SER B C   1 
ATOM   5401 O  O   . SER B 1 344 ? -28.367 -0.033  -49.522 1.00 49.28  ? 295 SER B O   1 
ATOM   5402 C  CB  . SER B 1 344 ? -26.106 2.455   -49.044 1.00 46.79  ? 295 SER B CB  1 
ATOM   5403 O  OG  . SER B 1 344 ? -27.018 3.005   -49.977 1.00 49.32  ? 295 SER B OG  1 
ATOM   5404 N  N   . PHE B 1 345 ? -28.100 0.853   -47.476 1.00 43.55  ? 296 PHE B N   1 
ATOM   5405 C  CA  . PHE B 1 345 ? -29.468 0.610   -47.069 1.00 39.57  ? 296 PHE B CA  1 
ATOM   5406 C  C   . PHE B 1 345 ? -29.937 1.857   -46.336 1.00 41.55  ? 296 PHE B C   1 
ATOM   5407 O  O   . PHE B 1 345 ? -29.137 2.749   -46.113 1.00 43.15  ? 296 PHE B O   1 
ATOM   5408 C  CB  . PHE B 1 345 ? -29.542 -0.656  -46.206 1.00 37.19  ? 296 PHE B CB  1 
ATOM   5409 C  CG  . PHE B 1 345 ? -28.869 -0.541  -44.849 1.00 36.45  ? 296 PHE B CG  1 
ATOM   5410 C  CD1 . PHE B 1 345 ? -27.502 -0.739  -44.707 1.00 33.95  ? 296 PHE B CD1 1 
ATOM   5411 C  CD2 . PHE B 1 345 ? -29.626 -0.285  -43.711 1.00 34.13  ? 296 PHE B CD2 1 
ATOM   5412 C  CE1 . PHE B 1 345 ? -26.896 -0.647  -43.470 1.00 33.99  ? 296 PHE B CE1 1 
ATOM   5413 C  CE2 . PHE B 1 345 ? -29.031 -0.201  -42.470 1.00 33.27  ? 296 PHE B CE2 1 
ATOM   5414 C  CZ  . PHE B 1 345 ? -27.664 -0.392  -42.348 1.00 35.86  ? 296 PHE B CZ  1 
ATOM   5415 N  N   . ARG B 1 346 ? -31.214 1.941   -45.971 1.00 42.00  ? 297 ARG B N   1 
ATOM   5416 C  CA  . ARG B 1 346 ? -31.691 3.113   -45.228 1.00 41.71  ? 297 ARG B CA  1 
ATOM   5417 C  C   . ARG B 1 346 ? -32.500 2.791   -43.972 1.00 42.56  ? 297 ARG B C   1 
ATOM   5418 O  O   . ARG B 1 346 ? -33.177 1.756   -43.891 1.00 44.76  ? 297 ARG B O   1 
ATOM   5419 C  CB  . ARG B 1 346 ? -32.491 4.048   -46.134 1.00 41.04  ? 297 ARG B CB  1 
ATOM   5420 C  CG  . ARG B 1 346 ? -33.824 3.486   -46.613 1.00 39.31  ? 297 ARG B CG  1 
ATOM   5421 C  CD  . ARG B 1 346 ? -34.385 4.366   -47.693 1.00 36.48  ? 297 ARG B CD  1 
ATOM   5422 N  NE  . ARG B 1 346 ? -35.752 4.023   -48.006 1.00 39.62  ? 297 ARG B NE  1 
ATOM   5423 C  CZ  . ARG B 1 346 ? -36.332 4.233   -49.184 1.00 40.49  ? 297 ARG B CZ  1 
ATOM   5424 N  NH1 . ARG B 1 346 ? -35.660 4.783   -50.200 1.00 38.41  ? 297 ARG B NH1 1 
ATOM   5425 N  NH2 . ARG B 1 346 ? -37.592 3.869   -49.353 1.00 40.15  ? 297 ARG B NH2 1 
ATOM   5426 N  N   . ILE B 1 347 ? -32.401 3.682   -42.991 1.00 40.93  ? 298 ILE B N   1 
ATOM   5427 C  CA  . ILE B 1 347 ? -33.277 3.636   -41.820 1.00 40.60  ? 298 ILE B CA  1 
ATOM   5428 C  C   . ILE B 1 347 ? -34.176 4.856   -41.861 1.00 40.75  ? 298 ILE B C   1 
ATOM   5429 O  O   . ILE B 1 347 ? -33.711 5.978   -42.116 1.00 40.68  ? 298 ILE B O   1 
ATOM   5430 C  CB  . ILE B 1 347 ? -32.519 3.508   -40.456 1.00 36.97  ? 298 ILE B CB  1 
ATOM   5431 C  CG1 . ILE B 1 347 ? -31.683 4.738   -40.136 1.00 34.74  ? 298 ILE B CG1 1 
ATOM   5432 C  CG2 . ILE B 1 347 ? -31.671 2.242   -40.418 1.00 32.19  ? 298 ILE B CG2 1 
ATOM   5433 C  CD1 . ILE B 1 347 ? -30.997 4.674   -38.778 1.00 34.07  ? 298 ILE B CD1 1 
ATOM   5434 N  N   . THR B 1 348 ? -35.466 4.631   -41.656 1.00 38.94  ? 299 THR B N   1 
ATOM   5435 C  CA  . THR B 1 348 ? -36.438 5.705   -41.729 1.00 39.49  ? 299 THR B CA  1 
ATOM   5436 C  C   . THR B 1 348 ? -37.132 5.866   -40.387 1.00 43.24  ? 299 THR B C   1 
ATOM   5437 O  O   . THR B 1 348 ? -37.677 4.892   -39.855 1.00 43.88  ? 299 THR B O   1 
ATOM   5438 C  CB  . THR B 1 348 ? -37.444 5.433   -42.862 1.00 38.96  ? 299 THR B CB  1 
ATOM   5439 O  OG1 . THR B 1 348 ? -36.740 5.453   -44.112 1.00 38.41  ? 299 THR B OG1 1 
ATOM   5440 C  CG2 . THR B 1 348 ? -38.507 6.496   -42.902 1.00 38.18  ? 299 THR B CG2 1 
ATOM   5441 N  N   . ILE B 1 349 ? -37.087 7.080   -39.829 1.00 42.52  ? 300 ILE B N   1 
ATOM   5442 C  CA  . ILE B 1 349 ? -37.729 7.346   -38.542 1.00 43.13  ? 300 ILE B CA  1 
ATOM   5443 C  C   . ILE B 1 349 ? -38.896 8.304   -38.697 1.00 40.49  ? 300 ILE B C   1 
ATOM   5444 O  O   . ILE B 1 349 ? -38.910 9.118   -39.600 1.00 38.74  ? 300 ILE B O   1 
ATOM   5445 C  CB  . ILE B 1 349 ? -36.751 7.871   -37.450 1.00 46.40  ? 300 ILE B CB  1 
ATOM   5446 C  CG1 . ILE B 1 349 ? -36.116 9.189   -37.848 1.00 47.99  ? 300 ILE B CG1 1 
ATOM   5447 C  CG2 . ILE B 1 349 ? -35.619 6.901   -37.206 1.00 48.94  ? 300 ILE B CG2 1 
ATOM   5448 C  CD1 . ILE B 1 349 ? -35.964 10.105  -36.661 1.00 52.14  ? 300 ILE B CD1 1 
ATOM   5449 N  N   . LEU B 1 350 ? -39.859 8.200   -37.785 1.00 42.62  ? 301 LEU B N   1 
ATOM   5450 C  CA  . LEU B 1 350 ? -41.069 8.996   -37.805 1.00 40.56  ? 301 LEU B CA  1 
ATOM   5451 C  C   . LEU B 1 350 ? -40.997 10.165  -36.805 1.00 42.43  ? 301 LEU B C   1 
ATOM   5452 O  O   . LEU B 1 350 ? -40.179 10.140  -35.868 1.00 45.94  ? 301 LEU B O   1 
ATOM   5453 C  CB  . LEU B 1 350 ? -42.218 8.085   -37.412 1.00 40.15  ? 301 LEU B CB  1 
ATOM   5454 C  CG  . LEU B 1 350 ? -42.450 6.759   -38.133 1.00 41.83  ? 301 LEU B CG  1 
ATOM   5455 C  CD1 . LEU B 1 350 ? -43.697 6.132   -37.523 1.00 37.17  ? 301 LEU B CD1 1 
ATOM   5456 C  CD2 . LEU B 1 350 ? -42.619 6.965   -39.632 1.00 39.35  ? 301 LEU B CD2 1 
ATOM   5457 N  N   . PRO B 1 351 ? -41.881 11.172  -36.953 1.00 42.18  ? 302 PRO B N   1 
ATOM   5458 C  CA  . PRO B 1 351 ? -41.978 12.184  -35.887 1.00 41.55  ? 302 PRO B CA  1 
ATOM   5459 C  C   . PRO B 1 351 ? -42.219 11.580  -34.485 1.00 43.53  ? 302 PRO B C   1 
ATOM   5460 O  O   . PRO B 1 351 ? -41.900 12.210  -33.463 1.00 45.42  ? 302 PRO B O   1 
ATOM   5461 C  CB  . PRO B 1 351 ? -43.195 13.027  -36.310 1.00 42.99  ? 302 PRO B CB  1 
ATOM   5462 C  CG  . PRO B 1 351 ? -43.949 12.191  -37.298 1.00 42.37  ? 302 PRO B CG  1 
ATOM   5463 C  CD  . PRO B 1 351 ? -42.879 11.404  -38.018 1.00 42.07  ? 302 PRO B CD  1 
ATOM   5464 N  N   . GLN B 1 352 ? -42.780 10.373  -34.430 1.00 41.61  ? 303 GLN B N   1 
ATOM   5465 C  CA  . GLN B 1 352 ? -43.013 9.716   -33.158 1.00 39.94  ? 303 GLN B CA  1 
ATOM   5466 C  C   . GLN B 1 352 ? -41.697 9.388   -32.457 1.00 39.43  ? 303 GLN B C   1 
ATOM   5467 O  O   . GLN B 1 352 ? -41.682 9.224   -31.237 1.00 34.72  ? 303 GLN B O   1 
ATOM   5468 C  CB  . GLN B 1 352 ? -43.872 8.477   -33.338 1.00 42.35  ? 303 GLN B CB  1 
ATOM   5469 C  CG  . GLN B 1 352 ? -45.341 8.811   -33.509 1.00 41.80  ? 303 GLN B CG  1 
ATOM   5470 C  CD  . GLN B 1 352 ? -45.791 8.851   -34.965 1.00 41.20  ? 303 GLN B CD  1 
ATOM   5471 O  OE1 . GLN B 1 352 ? -44.996 9.072   -35.895 1.00 37.86  ? 303 GLN B OE1 1 
ATOM   5472 N  NE2 . GLN B 1 352 ? -47.084 8.633   -35.168 1.00 39.58  ? 303 GLN B NE2 1 
ATOM   5473 N  N   . GLN B 1 353 ? -40.599 9.324   -33.226 1.00 41.79  ? 304 GLN B N   1 
ATOM   5474 C  CA  . GLN B 1 353 ? -39.234 9.163   -32.668 1.00 42.39  ? 304 GLN B CA  1 
ATOM   5475 C  C   . GLN B 1 353 ? -38.554 10.497  -32.363 1.00 44.67  ? 304 GLN B C   1 
ATOM   5476 O  O   . GLN B 1 353 ? -38.011 10.680  -31.262 1.00 46.50  ? 304 GLN B O   1 
ATOM   5477 C  CB  . GLN B 1 353 ? -38.324 8.336   -33.586 1.00 40.84  ? 304 GLN B CB  1 
ATOM   5478 C  CG  . GLN B 1 353 ? -38.541 6.826   -33.502 1.00 42.27  ? 304 GLN B CG  1 
ATOM   5479 C  CD  . GLN B 1 353 ? -39.805 6.373   -34.221 1.00 45.81  ? 304 GLN B CD  1 
ATOM   5480 O  OE1 . GLN B 1 353 ? -40.006 6.676   -35.397 1.00 46.03  ? 304 GLN B OE1 1 
ATOM   5481 N  NE2 . GLN B 1 353 ? -40.671 5.657   -33.506 1.00 46.88  ? 304 GLN B NE2 1 
ATOM   5482 N  N   . TYR B 1 354 ? -38.572 11.424  -33.319 1.00 41.12  ? 305 TYR B N   1 
ATOM   5483 C  CA  . TYR B 1 354 ? -37.857 12.675  -33.107 1.00 44.82  ? 305 TYR B CA  1 
ATOM   5484 C  C   . TYR B 1 354 ? -38.605 13.748  -32.317 1.00 47.65  ? 305 TYR B C   1 
ATOM   5485 O  O   . TYR B 1 354 ? -38.018 14.770  -31.968 1.00 52.31  ? 305 TYR B O   1 
ATOM   5486 C  CB  . TYR B 1 354 ? -37.230 13.227  -34.387 1.00 43.04  ? 305 TYR B CB  1 
ATOM   5487 C  CG  . TYR B 1 354 ? -38.165 13.699  -35.475 1.00 43.52  ? 305 TYR B CG  1 
ATOM   5488 C  CD1 . TYR B 1 354 ? -38.831 14.925  -35.376 1.00 44.82  ? 305 TYR B CD1 1 
ATOM   5489 C  CD2 . TYR B 1 354 ? -38.305 12.974  -36.662 1.00 43.60  ? 305 TYR B CD2 1 
ATOM   5490 C  CE1 . TYR B 1 354 ? -39.640 15.390  -36.404 1.00 42.08  ? 305 TYR B CE1 1 
ATOM   5491 C  CE2 . TYR B 1 354 ? -39.113 13.431  -37.699 1.00 42.74  ? 305 TYR B CE2 1 
ATOM   5492 C  CZ  . TYR B 1 354 ? -39.780 14.635  -37.559 1.00 44.79  ? 305 TYR B CZ  1 
ATOM   5493 O  OH  . TYR B 1 354 ? -40.582 15.095  -38.576 1.00 45.12  ? 305 TYR B OH  1 
ATOM   5494 N  N   . LEU B 1 355 ? -39.879 13.517  -32.012 1.00 49.36  ? 306 LEU B N   1 
ATOM   5495 C  CA  . LEU B 1 355 ? -40.577 14.383  -31.059 1.00 48.29  ? 306 LEU B CA  1 
ATOM   5496 C  C   . LEU B 1 355 ? -40.669 13.611  -29.753 1.00 51.09  ? 306 LEU B C   1 
ATOM   5497 O  O   . LEU B 1 355 ? -41.309 12.556  -29.698 1.00 56.22  ? 306 LEU B O   1 
ATOM   5498 C  CB  . LEU B 1 355 ? -41.954 14.799  -31.576 1.00 45.62  ? 306 LEU B CB  1 
ATOM   5499 C  CG  . LEU B 1 355 ? -41.985 15.586  -32.891 1.00 44.04  ? 306 LEU B CG  1 
ATOM   5500 C  CD1 . LEU B 1 355 ? -43.411 15.877  -33.314 1.00 42.63  ? 306 LEU B CD1 1 
ATOM   5501 C  CD2 . LEU B 1 355 ? -41.222 16.891  -32.766 1.00 44.43  ? 306 LEU B CD2 1 
ATOM   5502 N  N   . ARG B 1 356 ? -39.989 14.117  -28.721 1.00 48.18  ? 307 ARG B N   1 
ATOM   5503 C  CA  . ARG B 1 356 ? -39.907 13.437  -27.425 1.00 48.65  ? 307 ARG B CA  1 
ATOM   5504 C  C   . ARG B 1 356 ? -41.095 13.796  -26.502 1.00 46.54  ? 307 ARG B C   1 
ATOM   5505 O  O   . ARG B 1 356 ? -41.269 14.951  -26.151 1.00 47.59  ? 307 ARG B O   1 
ATOM   5506 C  CB  . ARG B 1 356 ? -38.547 13.742  -26.758 1.00 46.60  ? 307 ARG B CB  1 
ATOM   5507 C  CG  . ARG B 1 356 ? -38.267 12.935  -25.499 1.00 45.65  ? 307 ARG B CG  1 
ATOM   5508 C  CD  . ARG B 1 356 ? -36.855 13.148  -24.992 1.00 46.45  ? 307 ARG B CD  1 
ATOM   5509 N  NE  . ARG B 1 356 ? -36.562 14.555  -24.707 1.00 48.10  ? 307 ARG B NE  1 
ATOM   5510 C  CZ  . ARG B 1 356 ? -36.885 15.176  -23.573 1.00 50.78  ? 307 ARG B CZ  1 
ATOM   5511 N  NH1 . ARG B 1 356 ? -37.522 14.518  -22.599 1.00 46.18  ? 307 ARG B NH1 1 
ATOM   5512 N  NH2 . ARG B 1 356 ? -36.577 16.460  -23.411 1.00 53.47  ? 307 ARG B NH2 1 
ATOM   5513 N  N   . PRO B 1 357 ? -41.923 12.806  -26.122 1.00 48.07  ? 308 PRO B N   1 
ATOM   5514 C  CA  . PRO B 1 357 ? -43.005 13.069  -25.150 1.00 49.78  ? 308 PRO B CA  1 
ATOM   5515 C  C   . PRO B 1 357 ? -42.494 13.698  -23.844 1.00 53.30  ? 308 PRO B C   1 
ATOM   5516 O  O   . PRO B 1 357 ? -41.596 13.136  -23.201 1.00 54.36  ? 308 PRO B O   1 
ATOM   5517 C  CB  . PRO B 1 357 ? -43.556 11.670  -24.856 1.00 48.51  ? 308 PRO B CB  1 
ATOM   5518 C  CG  . PRO B 1 357 ? -43.225 10.872  -26.075 1.00 49.67  ? 308 PRO B CG  1 
ATOM   5519 C  CD  . PRO B 1 357 ? -41.913 11.400  -26.578 1.00 45.62  ? 308 PRO B CD  1 
ATOM   5520 N  N   . VAL B 1 358 ? -43.034 14.862  -23.478 1.00 53.43  ? 309 VAL B N   1 
ATOM   5521 C  CA  . VAL B 1 358 ? -42.796 15.432  -22.144 1.00 55.87  ? 309 VAL B CA  1 
ATOM   5522 C  C   . VAL B 1 358 ? -44.104 15.770  -21.429 1.00 59.34  ? 309 VAL B C   1 
ATOM   5523 O  O   . VAL B 1 358 ? -45.101 16.069  -22.078 1.00 58.21  ? 309 VAL B O   1 
ATOM   5524 C  CB  . VAL B 1 358 ? -41.855 16.662  -22.172 1.00 52.04  ? 309 VAL B CB  1 
ATOM   5525 C  CG1 . VAL B 1 358 ? -40.478 16.253  -22.656 1.00 52.89  ? 309 VAL B CG1 1 
ATOM   5526 C  CG2 . VAL B 1 358 ? -42.419 17.782  -23.032 1.00 50.69  ? 309 VAL B CG2 1 
ATOM   5527 N  N   . GLU B 1 359 ? -44.098 15.701  -20.098 1.00 66.98  ? 310 GLU B N   1 
ATOM   5528 C  CA  . GLU B 1 359 ? -45.258 16.095  -19.288 1.00 76.09  ? 310 GLU B CA  1 
ATOM   5529 C  C   . GLU B 1 359 ? -45.488 17.614  -19.405 1.00 73.50  ? 310 GLU B C   1 
ATOM   5530 O  O   . GLU B 1 359 ? -44.542 18.360  -19.635 1.00 72.18  ? 310 GLU B O   1 
ATOM   5531 C  CB  . GLU B 1 359 ? -45.075 15.634  -17.827 1.00 85.38  ? 310 GLU B CB  1 
ATOM   5532 C  CG  . GLU B 1 359 ? -46.303 15.753  -16.922 1.00 99.41  ? 310 GLU B CG  1 
ATOM   5533 C  CD  . GLU B 1 359 ? -47.639 15.558  -17.644 1.00 107.97 ? 310 GLU B CD  1 
ATOM   5534 O  OE1 . GLU B 1 359 ? -47.966 14.406  -18.051 1.00 107.46 ? 310 GLU B OE1 1 
ATOM   5535 O  OE2 . GLU B 1 359 ? -48.373 16.571  -17.795 1.00 111.15 ? 310 GLU B OE2 1 
ATOM   5536 N  N   . ASP B 1 360 ? -46.738 18.064  -19.294 1.00 76.74  ? 311 ASP B N   1 
ATOM   5537 C  CA  . ASP B 1 360 ? -47.062 19.482  -19.497 1.00 83.51  ? 311 ASP B CA  1 
ATOM   5538 C  C   . ASP B 1 360 ? -46.505 20.393  -18.387 1.00 87.07  ? 311 ASP B C   1 
ATOM   5539 O  O   . ASP B 1 360 ? -46.468 20.011  -17.213 1.00 89.26  ? 311 ASP B O   1 
ATOM   5540 C  CB  . ASP B 1 360 ? -48.578 19.683  -19.657 1.00 84.31  ? 311 ASP B CB  1 
ATOM   5541 C  CG  . ASP B 1 360 ? -48.939 21.031  -20.312 1.00 89.88  ? 311 ASP B CG  1 
ATOM   5542 O  OD1 . ASP B 1 360 ? -48.127 21.988  -20.261 1.00 86.38  ? 311 ASP B OD1 1 
ATOM   5543 O  OD2 . ASP B 1 360 ? -50.051 21.135  -20.892 1.00 89.67  ? 311 ASP B OD2 1 
ATOM   5544 N  N   . VAL B 1 361 ? -46.072 21.591  -18.784 1.00 89.93  ? 312 VAL B N   1 
ATOM   5545 C  CA  . VAL B 1 361 ? -45.583 22.630  -17.865 1.00 94.14  ? 312 VAL B CA  1 
ATOM   5546 C  C   . VAL B 1 361 ? -46.688 23.097  -16.896 1.00 99.66  ? 312 VAL B C   1 
ATOM   5547 O  O   . VAL B 1 361 ? -46.417 23.381  -15.728 1.00 100.53 ? 312 VAL B O   1 
ATOM   5548 C  CB  . VAL B 1 361 ? -44.915 23.795  -18.654 1.00 93.50  ? 312 VAL B CB  1 
ATOM   5549 C  CG1 . VAL B 1 361 ? -45.091 25.155  -17.970 1.00 90.93  ? 312 VAL B CG1 1 
ATOM   5550 C  CG2 . VAL B 1 361 ? -43.437 23.477  -18.884 1.00 89.36  ? 312 VAL B CG2 1 
ATOM   5551 N  N   . ALA B 1 362 ? -47.928 23.151  -17.387 1.00 102.22 ? 313 ALA B N   1 
ATOM   5552 C  CA  . ALA B 1 362 ? -49.105 23.360  -16.541 1.00 97.28  ? 313 ALA B CA  1 
ATOM   5553 C  C   . ALA B 1 362 ? -49.597 22.014  -15.984 1.00 95.75  ? 313 ALA B C   1 
ATOM   5554 O  O   . ALA B 1 362 ? -48.821 21.072  -15.799 1.00 92.31  ? 313 ALA B O   1 
ATOM   5555 C  CB  . ALA B 1 362 ? -50.210 24.060  -17.332 1.00 92.79  ? 313 ALA B CB  1 
ATOM   5556 N  N   . THR B 1 363 ? -50.885 21.937  -15.686 1.00 94.04  ? 314 THR B N   1 
ATOM   5557 C  CA  . THR B 1 363 ? -51.513 20.649  -15.460 1.00 95.51  ? 314 THR B CA  1 
ATOM   5558 C  C   . THR B 1 363 ? -52.682 20.544  -16.440 1.00 95.03  ? 314 THR B C   1 
ATOM   5559 O  O   . THR B 1 363 ? -53.717 21.208  -16.282 1.00 88.10  ? 314 THR B O   1 
ATOM   5560 C  CB  . THR B 1 363 ? -51.908 20.409  -13.978 1.00 97.07  ? 314 THR B CB  1 
ATOM   5561 O  OG1 . THR B 1 363 ? -52.434 21.615  -13.409 1.00 95.59  ? 314 THR B OG1 1 
ATOM   5562 C  CG2 . THR B 1 363 ? -50.684 19.971  -13.160 1.00 94.79  ? 314 THR B CG2 1 
ATOM   5563 N  N   . SER B 1 364 ? -52.470 19.737  -17.481 1.00 88.72  ? 315 SER B N   1 
ATOM   5564 C  CA  . SER B 1 364 ? -53.435 19.565  -18.569 1.00 79.77  ? 315 SER B CA  1 
ATOM   5565 C  C   . SER B 1 364 ? -53.536 18.094  -18.969 1.00 75.49  ? 315 SER B C   1 
ATOM   5566 O  O   . SER B 1 364 ? -52.810 17.249  -18.439 1.00 78.05  ? 315 SER B O   1 
ATOM   5567 C  CB  . SER B 1 364 ? -53.005 20.387  -19.784 1.00 78.81  ? 315 SER B CB  1 
ATOM   5568 O  OG  . SER B 1 364 ? -51.837 19.829  -20.370 1.00 78.10  ? 315 SER B OG  1 
ATOM   5569 N  N   . GLN B 1 365 ? -54.441 17.798  -19.899 1.00 68.65  ? 316 GLN B N   1 
ATOM   5570 C  CA  . GLN B 1 365 ? -54.494 16.487  -20.534 1.00 65.50  ? 316 GLN B CA  1 
ATOM   5571 C  C   . GLN B 1 365 ? -53.992 16.568  -21.977 1.00 64.06  ? 316 GLN B C   1 
ATOM   5572 O  O   . GLN B 1 365 ? -54.202 15.650  -22.769 1.00 60.63  ? 316 GLN B O   1 
ATOM   5573 C  CB  . GLN B 1 365 ? -55.905 15.909  -20.475 1.00 64.32  ? 316 GLN B CB  1 
ATOM   5574 C  CG  . GLN B 1 365 ? -56.284 15.403  -19.098 1.00 64.54  ? 316 GLN B CG  1 
ATOM   5575 C  CD  . GLN B 1 365 ? -57.762 15.565  -18.813 1.00 65.78  ? 316 GLN B CD  1 
ATOM   5576 O  OE1 . GLN B 1 365 ? -58.556 15.880  -19.701 1.00 67.38  ? 316 GLN B OE1 1 
ATOM   5577 N  NE2 . GLN B 1 365 ? -58.141 15.349  -17.560 1.00 72.05  ? 316 GLN B NE2 1 
ATOM   5578 N  N   . ASP B 1 366 ? -53.326 17.678  -22.296 1.00 61.16  ? 317 ASP B N   1 
ATOM   5579 C  CA  . ASP B 1 366 ? -52.651 17.875  -23.578 1.00 58.48  ? 317 ASP B CA  1 
ATOM   5580 C  C   . ASP B 1 366 ? -51.482 16.918  -23.784 1.00 54.98  ? 317 ASP B C   1 
ATOM   5581 O  O   . ASP B 1 366 ? -50.778 16.575  -22.835 1.00 52.38  ? 317 ASP B O   1 
ATOM   5582 C  CB  . ASP B 1 366 ? -52.121 19.303  -23.669 1.00 59.20  ? 317 ASP B CB  1 
ATOM   5583 C  CG  . ASP B 1 366 ? -53.214 20.317  -23.824 1.00 58.86  ? 317 ASP B CG  1 
ATOM   5584 O  OD1 . ASP B 1 366 ? -54.389 19.910  -23.897 1.00 61.32  ? 317 ASP B OD1 1 
ATOM   5585 O  OD2 . ASP B 1 366 ? -52.898 21.521  -23.881 1.00 57.02  ? 317 ASP B OD2 1 
ATOM   5586 N  N   . ASP B 1 367 ? -51.293 16.498  -25.033 1.00 53.48  ? 318 ASP B N   1 
ATOM   5587 C  CA  . ASP B 1 367 ? -50.122 15.734  -25.453 1.00 52.56  ? 318 ASP B CA  1 
ATOM   5588 C  C   . ASP B 1 367 ? -49.006 16.704  -25.872 1.00 51.90  ? 318 ASP B C   1 
ATOM   5589 O  O   . ASP B 1 367 ? -49.170 17.471  -26.824 1.00 47.12  ? 318 ASP B O   1 
ATOM   5590 C  CB  . ASP B 1 367 ? -50.498 14.763  -26.579 1.00 50.99  ? 318 ASP B CB  1 
ATOM   5591 C  CG  . ASP B 1 367 ? -51.427 13.650  -26.098 1.00 53.50  ? 318 ASP B CG  1 
ATOM   5592 O  OD1 . ASP B 1 367 ? -51.406 13.315  -24.893 1.00 53.63  ? 318 ASP B OD1 1 
ATOM   5593 O  OD2 . ASP B 1 367 ? -52.191 13.105  -26.912 1.00 52.66  ? 318 ASP B OD2 1 
ATOM   5594 N  N   . CYS B 1 368 ? -47.897 16.689  -25.127 1.00 49.99  ? 319 CYS B N   1 
ATOM   5595 C  CA  . CYS B 1 368 ? -46.839 17.671  -25.296 1.00 48.72  ? 319 CYS B CA  1 
ATOM   5596 C  C   . CYS B 1 368 ? -45.538 16.990  -25.669 1.00 49.09  ? 319 CYS B C   1 
ATOM   5597 O  O   . CYS B 1 368 ? -45.294 15.842  -25.263 1.00 47.44  ? 319 CYS B O   1 
ATOM   5598 C  CB  . CYS B 1 368 ? -46.654 18.484  -24.008 1.00 54.34  ? 319 CYS B CB  1 
ATOM   5599 S  SG  . CYS B 1 368 ? -48.133 19.360  -23.409 1.00 57.56  ? 319 CYS B SG  1 
ATOM   5600 N  N   . TYR B 1 369 ? -44.709 17.697  -26.444 1.00 47.70  ? 320 TYR B N   1 
ATOM   5601 C  CA  . TYR B 1 369 ? -43.436 17.150  -26.952 1.00 46.92  ? 320 TYR B CA  1 
ATOM   5602 C  C   . TYR B 1 369 ? -42.336 18.186  -27.037 1.00 49.39  ? 320 TYR B C   1 
ATOM   5603 O  O   . TYR B 1 369 ? -42.620 19.381  -27.186 1.00 50.07  ? 320 TYR B O   1 
ATOM   5604 C  CB  . TYR B 1 369 ? -43.623 16.553  -28.340 1.00 42.97  ? 320 TYR B CB  1 
ATOM   5605 C  CG  . TYR B 1 369 ? -44.790 15.607  -28.430 1.00 43.01  ? 320 TYR B CG  1 
ATOM   5606 C  CD1 . TYR B 1 369 ? -46.072 16.099  -28.714 1.00 43.96  ? 320 TYR B CD1 1 
ATOM   5607 C  CD2 . TYR B 1 369 ? -44.628 14.222  -28.223 1.00 42.28  ? 320 TYR B CD2 1 
ATOM   5608 C  CE1 . TYR B 1 369 ? -47.167 15.257  -28.801 1.00 43.27  ? 320 TYR B CE1 1 
ATOM   5609 C  CE2 . TYR B 1 369 ? -45.721 13.362  -28.304 1.00 44.16  ? 320 TYR B CE2 1 
ATOM   5610 C  CZ  . TYR B 1 369 ? -46.988 13.894  -28.600 1.00 46.05  ? 320 TYR B CZ  1 
ATOM   5611 O  OH  . TYR B 1 369 ? -48.105 13.098  -28.696 1.00 48.07  ? 320 TYR B OH  1 
ATOM   5612 N  N   . LYS B 1 370 ? -41.084 17.734  -26.942 1.00 47.17  ? 321 LYS B N   1 
ATOM   5613 C  CA  . LYS B 1 370 ? -39.946 18.587  -27.311 1.00 49.63  ? 321 LYS B CA  1 
ATOM   5614 C  C   . LYS B 1 370 ? -39.321 18.050  -28.598 1.00 47.61  ? 321 LYS B C   1 
ATOM   5615 O  O   . LYS B 1 370 ? -39.354 16.828  -28.852 1.00 44.86  ? 321 LYS B O   1 
ATOM   5616 C  CB  . LYS B 1 370 ? -38.891 18.662  -26.186 1.00 52.07  ? 321 LYS B CB  1 
ATOM   5617 C  CG  . LYS B 1 370 ? -39.307 19.435  -24.940 1.00 53.81  ? 321 LYS B CG  1 
ATOM   5618 C  CD  . LYS B 1 370 ? -38.114 19.816  -24.061 1.00 53.51  ? 321 LYS B CD  1 
ATOM   5619 C  CE  . LYS B 1 370 ? -38.609 20.599  -22.836 1.00 57.82  ? 321 LYS B CE  1 
ATOM   5620 N  NZ  . LYS B 1 370 ? -37.754 20.457  -21.617 1.00 54.06  ? 321 LYS B NZ  1 
ATOM   5621 N  N   . PHE B 1 371 ? -38.762 18.956  -29.401 1.00 47.24  ? 322 PHE B N   1 
ATOM   5622 C  CA  . PHE B 1 371 ? -38.006 18.609  -30.620 1.00 47.44  ? 322 PHE B CA  1 
ATOM   5623 C  C   . PHE B 1 371 ? -36.646 17.998  -30.249 1.00 49.71  ? 322 PHE B C   1 
ATOM   5624 O  O   . PHE B 1 371 ? -35.772 18.686  -29.728 1.00 46.49  ? 322 PHE B O   1 
ATOM   5625 C  CB  . PHE B 1 371 ? -37.808 19.869  -31.462 1.00 47.63  ? 322 PHE B CB  1 
ATOM   5626 C  CG  . PHE B 1 371 ? -37.241 19.632  -32.848 1.00 46.18  ? 322 PHE B CG  1 
ATOM   5627 C  CD1 . PHE B 1 371 ? -37.905 18.837  -33.776 1.00 45.19  ? 322 PHE B CD1 1 
ATOM   5628 C  CD2 . PHE B 1 371 ? -36.078 20.274  -33.244 1.00 44.25  ? 322 PHE B CD2 1 
ATOM   5629 C  CE1 . PHE B 1 371 ? -37.407 18.661  -35.059 1.00 47.07  ? 322 PHE B CE1 1 
ATOM   5630 C  CE2 . PHE B 1 371 ? -35.563 20.101  -34.522 1.00 46.87  ? 322 PHE B CE2 1 
ATOM   5631 C  CZ  . PHE B 1 371 ? -36.227 19.292  -35.437 1.00 48.29  ? 322 PHE B CZ  1 
ATOM   5632 N  N   . ALA B 1 372 ? -36.483 16.704  -30.540 1.00 48.17  ? 323 ALA B N   1 
ATOM   5633 C  CA  . ALA B 1 372 ? -35.356 15.905  -30.069 1.00 44.48  ? 323 ALA B CA  1 
ATOM   5634 C  C   . ALA B 1 372 ? -34.258 15.745  -31.142 1.00 48.08  ? 323 ALA B C   1 
ATOM   5635 O  O   . ALA B 1 372 ? -33.585 14.688  -31.243 1.00 46.88  ? 323 ALA B O   1 
ATOM   5636 C  CB  . ALA B 1 372 ? -35.857 14.547  -29.577 1.00 43.74  ? 323 ALA B CB  1 
ATOM   5637 N  N   . ILE B 1 373 ? -34.099 16.797  -31.943 1.00 46.36  ? 324 ILE B N   1 
ATOM   5638 C  CA  . ILE B 1 373 ? -32.991 16.932  -32.899 1.00 47.98  ? 324 ILE B CA  1 
ATOM   5639 C  C   . ILE B 1 373 ? -32.238 18.200  -32.529 1.00 48.83  ? 324 ILE B C   1 
ATOM   5640 O  O   . ILE B 1 373 ? -32.850 19.259  -32.394 1.00 51.21  ? 324 ILE B O   1 
ATOM   5641 C  CB  . ILE B 1 373 ? -33.494 17.060  -34.348 1.00 45.47  ? 324 ILE B CB  1 
ATOM   5642 C  CG1 . ILE B 1 373 ? -34.347 15.842  -34.713 1.00 42.24  ? 324 ILE B CG1 1 
ATOM   5643 C  CG2 . ILE B 1 373 ? -32.333 17.276  -35.324 1.00 46.97  ? 324 ILE B CG2 1 
ATOM   5644 C  CD1 . ILE B 1 373 ? -34.868 15.898  -36.125 1.00 40.52  ? 324 ILE B CD1 1 
ATOM   5645 N  N   . SER B 1 374 ? -30.926 18.089  -32.337 1.00 48.68  ? 325 SER B N   1 
ATOM   5646 C  CA  . SER B 1 374 ? -30.118 19.245  -31.954 1.00 48.30  ? 325 SER B CA  1 
ATOM   5647 C  C   . SER B 1 374 ? -28.772 19.311  -32.649 1.00 50.39  ? 325 SER B C   1 
ATOM   5648 O  O   . SER B 1 374 ? -28.297 18.323  -33.220 1.00 47.65  ? 325 SER B O   1 
ATOM   5649 C  CB  . SER B 1 374 ? -29.971 19.368  -30.435 1.00 49.64  ? 325 SER B CB  1 
ATOM   5650 O  OG  . SER B 1 374 ? -29.729 18.112  -29.828 1.00 55.55  ? 325 SER B OG  1 
ATOM   5651 N  N   . GLN B 1 375 ? -28.199 20.513  -32.610 1.00 54.97  ? 326 GLN B N   1 
ATOM   5652 C  CA  . GLN B 1 375 ? -26.949 20.877  -33.262 1.00 56.33  ? 326 GLN B CA  1 
ATOM   5653 C  C   . GLN B 1 375 ? -25.777 20.286  -32.500 1.00 55.74  ? 326 GLN B C   1 
ATOM   5654 O  O   . GLN B 1 375 ? -25.796 20.204  -31.268 1.00 51.49  ? 326 GLN B O   1 
ATOM   5655 C  CB  . GLN B 1 375 ? -26.830 22.398  -33.252 1.00 61.41  ? 326 GLN B CB  1 
ATOM   5656 C  CG  . GLN B 1 375 ? -25.767 22.985  -34.157 1.00 65.62  ? 326 GLN B CG  1 
ATOM   5657 C  CD  . GLN B 1 375 ? -25.714 24.497  -34.042 1.00 72.32  ? 326 GLN B CD  1 
ATOM   5658 O  OE1 . GLN B 1 375 ? -25.934 25.220  -35.018 1.00 76.85  ? 326 GLN B OE1 1 
ATOM   5659 N  NE2 . GLN B 1 375 ? -25.440 24.984  -32.841 1.00 68.31  ? 326 GLN B NE2 1 
ATOM   5660 N  N   . SER B 1 376 ? -24.749 19.887  -33.236 1.00 54.53  ? 327 SER B N   1 
ATOM   5661 C  CA  . SER B 1 376 ? -23.596 19.240  -32.640 1.00 54.31  ? 327 SER B CA  1 
ATOM   5662 C  C   . SER B 1 376 ? -22.338 19.835  -33.250 1.00 56.52  ? 327 SER B C   1 
ATOM   5663 O  O   . SER B 1 376 ? -22.322 20.170  -34.442 1.00 53.66  ? 327 SER B O   1 
ATOM   5664 C  CB  . SER B 1 376 ? -23.676 17.733  -32.915 1.00 54.02  ? 327 SER B CB  1 
ATOM   5665 O  OG  . SER B 1 376 ? -22.551 17.018  -32.448 1.00 52.85  ? 327 SER B OG  1 
ATOM   5666 N  N   . SER B 1 377 ? -21.283 19.971  -32.443 1.00 59.96  ? 328 SER B N   1 
ATOM   5667 C  CA  . SER B 1 377 ? -19.958 20.306  -32.994 1.00 65.63  ? 328 SER B CA  1 
ATOM   5668 C  C   . SER B 1 377 ? -18.972 19.112  -32.965 1.00 65.32  ? 328 SER B C   1 
ATOM   5669 O  O   . SER B 1 377 ? -17.822 19.235  -33.398 1.00 65.53  ? 328 SER B O   1 
ATOM   5670 C  CB  . SER B 1 377 ? -19.364 21.556  -32.329 1.00 62.22  ? 328 SER B CB  1 
ATOM   5671 O  OG  . SER B 1 377 ? -19.011 21.282  -30.984 1.00 69.38  ? 328 SER B OG  1 
ATOM   5672 N  N   . THR B 1 378 ? -19.439 17.960  -32.483 1.00 64.57  ? 329 THR B N   1 
ATOM   5673 C  CA  . THR B 1 378 ? -18.624 16.738  -32.470 1.00 61.38  ? 329 THR B CA  1 
ATOM   5674 C  C   . THR B 1 378 ? -19.168 15.653  -33.400 1.00 56.75  ? 329 THR B C   1 
ATOM   5675 O  O   . THR B 1 378 ? -18.918 14.459  -33.194 1.00 55.40  ? 329 THR B O   1 
ATOM   5676 C  CB  . THR B 1 378 ? -18.481 16.161  -31.051 1.00 63.35  ? 329 THR B CB  1 
ATOM   5677 O  OG1 . THR B 1 378 ? -19.784 15.945  -30.500 1.00 63.64  ? 329 THR B OG1 1 
ATOM   5678 C  CG2 . THR B 1 378 ? -17.678 17.115  -30.144 1.00 60.29  ? 329 THR B CG2 1 
ATOM   5679 N  N   . GLY B 1 379 ? -19.902 16.073  -34.428 1.00 56.71  ? 330 GLY B N   1 
ATOM   5680 C  CA  . GLY B 1 379 ? -20.443 15.137  -35.419 1.00 55.41  ? 330 GLY B CA  1 
ATOM   5681 C  C   . GLY B 1 379 ? -21.824 14.573  -35.110 1.00 52.94  ? 330 GLY B C   1 
ATOM   5682 O  O   . GLY B 1 379 ? -22.452 14.934  -34.108 1.00 51.43  ? 330 GLY B O   1 
ATOM   5683 N  N   . THR B 1 380 ? -22.293 13.681  -35.980 1.00 48.74  ? 331 THR B N   1 
ATOM   5684 C  CA  . THR B 1 380 ? -23.621 13.093  -35.853 1.00 43.74  ? 331 THR B CA  1 
ATOM   5685 C  C   . THR B 1 380 ? -23.639 12.112  -34.693 1.00 42.74  ? 331 THR B C   1 
ATOM   5686 O  O   . THR B 1 380 ? -22.715 11.320  -34.531 1.00 41.23  ? 331 THR B O   1 
ATOM   5687 C  CB  . THR B 1 380 ? -24.037 12.352  -37.134 1.00 43.05  ? 331 THR B CB  1 
ATOM   5688 O  OG1 . THR B 1 380 ? -24.122 13.275  -38.220 1.00 40.63  ? 331 THR B OG1 1 
ATOM   5689 C  CG2 . THR B 1 380 ? -25.383 11.641  -36.954 1.00 42.04  ? 331 THR B CG2 1 
ATOM   5690 N  N   . VAL B 1 381 ? -24.698 12.187  -33.896 1.00 41.10  ? 332 VAL B N   1 
ATOM   5691 C  CA  . VAL B 1 381 ? -24.936 11.263  -32.808 1.00 40.43  ? 332 VAL B CA  1 
ATOM   5692 C  C   . VAL B 1 381 ? -26.331 10.658  -32.952 1.00 43.68  ? 332 VAL B C   1 
ATOM   5693 O  O   . VAL B 1 381 ? -27.342 11.348  -32.837 1.00 49.00  ? 332 VAL B O   1 
ATOM   5694 C  CB  . VAL B 1 381 ? -24.774 11.949  -31.428 1.00 39.51  ? 332 VAL B CB  1 
ATOM   5695 C  CG1 . VAL B 1 381 ? -25.024 10.959  -30.314 1.00 39.93  ? 332 VAL B CG1 1 
ATOM   5696 C  CG2 . VAL B 1 381 ? -23.371 12.521  -31.278 1.00 38.72  ? 332 VAL B CG2 1 
ATOM   5697 N  N   . MET B 1 382 ? -26.391 9.364   -33.232 1.00 44.91  ? 333 MET B N   1 
ATOM   5698 C  CA  . MET B 1 382 ? -27.664 8.666   -33.232 1.00 42.97  ? 333 MET B CA  1 
ATOM   5699 C  C   . MET B 1 382 ? -28.008 8.254   -31.800 1.00 40.87  ? 333 MET B C   1 
ATOM   5700 O  O   . MET B 1 382 ? -27.589 7.207   -31.311 1.00 41.29  ? 333 MET B O   1 
ATOM   5701 C  CB  . MET B 1 382 ? -27.640 7.491   -34.213 1.00 47.02  ? 333 MET B CB  1 
ATOM   5702 C  CG  . MET B 1 382 ? -27.484 7.944   -35.665 1.00 52.73  ? 333 MET B CG  1 
ATOM   5703 S  SD  . MET B 1 382 ? -26.899 6.710   -36.850 1.00 62.43  ? 333 MET B SD  1 
ATOM   5704 C  CE  . MET B 1 382 ? -28.151 5.457   -36.631 1.00 53.72  ? 333 MET B CE  1 
ATOM   5705 N  N   . GLY B 1 383 ? -28.778 9.105   -31.135 1.00 39.24  ? 334 GLY B N   1 
ATOM   5706 C  CA  . GLY B 1 383 ? -29.097 8.928   -29.732 1.00 38.66  ? 334 GLY B CA  1 
ATOM   5707 C  C   . GLY B 1 383 ? -30.283 8.048   -29.425 1.00 38.39  ? 334 GLY B C   1 
ATOM   5708 O  O   . GLY B 1 383 ? -30.761 7.312   -30.281 1.00 37.11  ? 334 GLY B O   1 
ATOM   5709 N  N   . ALA B 1 384 ? -30.762 8.136   -28.182 1.00 40.66  ? 335 ALA B N   1 
ATOM   5710 C  CA  . ALA B 1 384 ? -31.798 7.242   -27.704 1.00 39.52  ? 335 ALA B CA  1 
ATOM   5711 C  C   . ALA B 1 384 ? -33.047 7.373   -28.551 1.00 41.65  ? 335 ALA B C   1 
ATOM   5712 O  O   . ALA B 1 384 ? -33.733 6.378   -28.758 1.00 43.58  ? 335 ALA B O   1 
ATOM   5713 C  CB  . ALA B 1 384 ? -32.103 7.480   -26.239 1.00 36.69  ? 335 ALA B CB  1 
ATOM   5714 N  N   . VAL B 1 385 ? -33.339 8.570   -29.061 1.00 40.78  ? 336 VAL B N   1 
ATOM   5715 C  CA  . VAL B 1 385 ? -34.609 8.787   -29.795 1.00 42.66  ? 336 VAL B CA  1 
ATOM   5716 C  C   . VAL B 1 385 ? -34.655 8.124   -31.177 1.00 44.82  ? 336 VAL B C   1 
ATOM   5717 O  O   . VAL B 1 385 ? -35.726 7.705   -31.605 1.00 51.97  ? 336 VAL B O   1 
ATOM   5718 C  CB  . VAL B 1 385 ? -35.077 10.276  -29.889 1.00 42.57  ? 336 VAL B CB  1 
ATOM   5719 C  CG1 . VAL B 1 385 ? -35.400 10.845  -28.508 1.00 39.86  ? 336 VAL B CG1 1 
ATOM   5720 C  CG2 . VAL B 1 385 ? -34.083 11.144  -30.649 1.00 39.55  ? 336 VAL B CG2 1 
ATOM   5721 N  N   . ILE B 1 386 ? -33.513 8.040   -31.867 1.00 42.06  ? 337 ILE B N   1 
ATOM   5722 C  CA  . ILE B 1 386 ? -33.381 7.214   -33.096 1.00 43.33  ? 337 ILE B CA  1 
ATOM   5723 C  C   . ILE B 1 386 ? -33.322 5.704   -32.751 1.00 41.62  ? 337 ILE B C   1 
ATOM   5724 O  O   . ILE B 1 386 ? -33.962 4.883   -33.392 1.00 41.08  ? 337 ILE B O   1 
ATOM   5725 C  CB  . ILE B 1 386 ? -32.129 7.606   -33.926 1.00 45.36  ? 337 ILE B CB  1 
ATOM   5726 C  CG1 . ILE B 1 386 ? -32.131 9.100   -34.213 1.00 49.08  ? 337 ILE B CG1 1 
ATOM   5727 C  CG2 . ILE B 1 386 ? -32.048 6.852   -35.250 1.00 42.91  ? 337 ILE B CG2 1 
ATOM   5728 C  CD1 . ILE B 1 386 ? -33.411 9.586   -34.849 1.00 48.83  ? 337 ILE B CD1 1 
ATOM   5729 N  N   . MET B 1 387 ? -32.559 5.355   -31.720 1.00 41.01  ? 338 MET B N   1 
ATOM   5730 C  CA  . MET B 1 387 ? -32.398 3.967   -31.325 1.00 43.92  ? 338 MET B CA  1 
ATOM   5731 C  C   . MET B 1 387 ? -33.738 3.302   -30.890 1.00 46.93  ? 338 MET B C   1 
ATOM   5732 O  O   . MET B 1 387 ? -33.937 2.107   -31.115 1.00 46.45  ? 338 MET B O   1 
ATOM   5733 C  CB  . MET B 1 387 ? -31.325 3.872   -30.251 1.00 41.59  ? 338 MET B CB  1 
ATOM   5734 C  CG  . MET B 1 387 ? -29.894 4.127   -30.734 1.00 39.56  ? 338 MET B CG  1 
ATOM   5735 S  SD  . MET B 1 387 ? -28.768 3.739   -29.374 1.00 45.21  ? 338 MET B SD  1 
ATOM   5736 C  CE  . MET B 1 387 ? -28.803 1.936   -29.365 1.00 38.04  ? 338 MET B CE  1 
ATOM   5737 N  N   . GLU B 1 388 ? -34.652 4.098   -30.316 1.00 43.75  ? 339 GLU B N   1 
ATOM   5738 C  CA  . GLU B 1 388 ? -36.021 3.680   -29.974 1.00 43.84  ? 339 GLU B CA  1 
ATOM   5739 C  C   . GLU B 1 388 ? -36.884 3.259   -31.169 1.00 43.46  ? 339 GLU B C   1 
ATOM   5740 O  O   . GLU B 1 388 ? -37.958 2.698   -30.987 1.00 44.08  ? 339 GLU B O   1 
ATOM   5741 C  CB  . GLU B 1 388 ? -36.757 4.809   -29.246 1.00 44.99  ? 339 GLU B CB  1 
ATOM   5742 C  CG  . GLU B 1 388 ? -36.491 4.935   -27.753 1.00 42.04  ? 339 GLU B CG  1 
ATOM   5743 C  CD  . GLU B 1 388 ? -37.123 6.194   -27.179 1.00 46.30  ? 339 GLU B CD  1 
ATOM   5744 O  OE1 . GLU B 1 388 ? -37.039 6.401   -25.945 1.00 52.54  ? 339 GLU B OE1 1 
ATOM   5745 O  OE2 . GLU B 1 388 ? -37.724 6.978   -27.955 1.00 49.67  ? 339 GLU B OE2 1 
ATOM   5746 N  N   . GLY B 1 389 ? -36.428 3.554   -32.379 1.00 41.21  ? 340 GLY B N   1 
ATOM   5747 C  CA  . GLY B 1 389 ? -37.097 3.091   -33.588 1.00 43.30  ? 340 GLY B CA  1 
ATOM   5748 C  C   . GLY B 1 389 ? -36.679 1.692   -33.993 1.00 43.55  ? 340 GLY B C   1 
ATOM   5749 O  O   . GLY B 1 389 ? -37.432 0.992   -34.680 1.00 42.44  ? 340 GLY B O   1 
ATOM   5750 N  N   . PHE B 1 390 ? -35.492 1.279   -33.544 1.00 41.74  ? 341 PHE B N   1 
ATOM   5751 C  CA  . PHE B 1 390 ? -34.809 0.114   -34.112 1.00 41.61  ? 341 PHE B CA  1 
ATOM   5752 C  C   . PHE B 1 390 ? -34.274 -0.832  -33.080 1.00 43.46  ? 341 PHE B C   1 
ATOM   5753 O  O   . PHE B 1 390 ? -33.997 -0.436  -31.938 1.00 43.90  ? 341 PHE B O   1 
ATOM   5754 C  CB  . PHE B 1 390 ? -33.663 0.563   -35.048 1.00 40.80  ? 341 PHE B CB  1 
ATOM   5755 C  CG  . PHE B 1 390 ? -34.109 1.553   -36.074 1.00 39.02  ? 341 PHE B CG  1 
ATOM   5756 C  CD1 . PHE B 1 390 ? -34.771 1.131   -37.230 1.00 38.34  ? 341 PHE B CD1 1 
ATOM   5757 C  CD2 . PHE B 1 390 ? -33.947 2.929   -35.845 1.00 38.51  ? 341 PHE B CD2 1 
ATOM   5758 C  CE1 . PHE B 1 390 ? -35.238 2.062   -38.167 1.00 36.36  ? 341 PHE B CE1 1 
ATOM   5759 C  CE2 . PHE B 1 390 ? -34.408 3.853   -36.770 1.00 36.66  ? 341 PHE B CE2 1 
ATOM   5760 C  CZ  . PHE B 1 390 ? -35.064 3.421   -37.928 1.00 36.21  ? 341 PHE B CZ  1 
ATOM   5761 N  N   . TYR B 1 391 ? -34.139 -2.090  -33.495 1.00 43.06  ? 342 TYR B N   1 
ATOM   5762 C  CA  . TYR B 1 391 ? -33.396 -3.081  -32.749 1.00 42.40  ? 342 TYR B CA  1 
ATOM   5763 C  C   . TYR B 1 391 ? -31.981 -2.932  -33.263 1.00 45.60  ? 342 TYR B C   1 
ATOM   5764 O  O   . TYR B 1 391 ? -31.745 -3.064  -34.474 1.00 44.77  ? 342 TYR B O   1 
ATOM   5765 C  CB  . TYR B 1 391 ? -33.910 -4.475  -33.089 1.00 46.68  ? 342 TYR B CB  1 
ATOM   5766 C  CG  . TYR B 1 391 ? -33.307 -5.579  -32.259 1.00 46.88  ? 342 TYR B CG  1 
ATOM   5767 C  CD1 . TYR B 1 391 ? -33.082 -5.413  -30.881 1.00 49.23  ? 342 TYR B CD1 1 
ATOM   5768 C  CD2 . TYR B 1 391 ? -32.991 -6.797  -32.836 1.00 46.33  ? 342 TYR B CD2 1 
ATOM   5769 C  CE1 . TYR B 1 391 ? -32.544 -6.432  -30.121 1.00 50.28  ? 342 TYR B CE1 1 
ATOM   5770 C  CE2 . TYR B 1 391 ? -32.458 -7.827  -32.082 1.00 47.10  ? 342 TYR B CE2 1 
ATOM   5771 C  CZ  . TYR B 1 391 ? -32.238 -7.637  -30.731 1.00 47.50  ? 342 TYR B CZ  1 
ATOM   5772 O  OH  . TYR B 1 391 ? -31.714 -8.658  -29.997 1.00 46.71  ? 342 TYR B OH  1 
ATOM   5773 N  N   . VAL B 1 392 ? -31.035 -2.617  -32.376 1.00 44.38  ? 343 VAL B N   1 
ATOM   5774 C  CA  . VAL B 1 392 ? -29.683 -2.315  -32.859 1.00 42.92  ? 343 VAL B CA  1 
ATOM   5775 C  C   . VAL B 1 392 ? -28.705 -3.370  -32.371 1.00 42.85  ? 343 VAL B C   1 
ATOM   5776 O  O   . VAL B 1 392 ? -28.594 -3.597  -31.156 1.00 40.31  ? 343 VAL B O   1 
ATOM   5777 C  CB  . VAL B 1 392 ? -29.193 -0.910  -32.452 1.00 41.35  ? 343 VAL B CB  1 
ATOM   5778 C  CG1 . VAL B 1 392 ? -27.836 -0.648  -33.087 1.00 38.85  ? 343 VAL B CG1 1 
ATOM   5779 C  CG2 . VAL B 1 392 ? -30.188 0.162   -32.887 1.00 37.58  ? 343 VAL B CG2 1 
ATOM   5780 N  N   . VAL B 1 393 ? -28.042 -4.032  -33.320 1.00 39.50  ? 344 VAL B N   1 
ATOM   5781 C  CA  . VAL B 1 393 ? -27.145 -5.145  -32.998 1.00 41.83  ? 344 VAL B CA  1 
ATOM   5782 C  C   . VAL B 1 393 ? -25.697 -4.661  -33.063 1.00 44.21  ? 344 VAL B C   1 
ATOM   5783 O  O   . VAL B 1 393 ? -25.221 -4.219  -34.140 1.00 43.57  ? 344 VAL B O   1 
ATOM   5784 C  CB  . VAL B 1 393 ? -27.377 -6.386  -33.912 1.00 42.47  ? 344 VAL B CB  1 
ATOM   5785 C  CG1 . VAL B 1 393 ? -26.413 -7.515  -33.573 1.00 40.88  ? 344 VAL B CG1 1 
ATOM   5786 C  CG2 . VAL B 1 393 ? -28.819 -6.885  -33.812 1.00 43.72  ? 344 VAL B CG2 1 
ATOM   5787 N  N   . PHE B 1 394 ? -25.008 -4.722  -31.918 1.00 39.96  ? 345 PHE B N   1 
ATOM   5788 C  CA  . PHE B 1 394 ? -23.622 -4.294  -31.875 1.00 42.79  ? 345 PHE B CA  1 
ATOM   5789 C  C   . PHE B 1 394 ? -22.717 -5.498  -32.059 1.00 45.62  ? 345 PHE B C   1 
ATOM   5790 O  O   . PHE B 1 394 ? -22.330 -6.149  -31.085 1.00 52.93  ? 345 PHE B O   1 
ATOM   5791 C  CB  . PHE B 1 394 ? -23.329 -3.511  -30.595 1.00 40.24  ? 345 PHE B CB  1 
ATOM   5792 C  CG  . PHE B 1 394 ? -24.086 -2.198  -30.499 1.00 37.87  ? 345 PHE B CG  1 
ATOM   5793 C  CD1 . PHE B 1 394 ? -25.414 -2.169  -30.087 1.00 38.18  ? 345 PHE B CD1 1 
ATOM   5794 C  CD2 . PHE B 1 394 ? -23.458 -0.978  -30.802 1.00 38.88  ? 345 PHE B CD2 1 
ATOM   5795 C  CE1 . PHE B 1 394 ? -26.101 -0.957  -29.993 1.00 41.27  ? 345 PHE B CE1 1 
ATOM   5796 C  CE2 . PHE B 1 394 ? -24.144 0.237   -30.721 1.00 35.90  ? 345 PHE B CE2 1 
ATOM   5797 C  CZ  . PHE B 1 394 ? -25.463 0.247   -30.308 1.00 37.58  ? 345 PHE B CZ  1 
ATOM   5798 N  N   . ASP B 1 395 ? -22.418 -5.797  -33.324 1.00 45.06  ? 346 ASP B N   1 
ATOM   5799 C  CA  . ASP B 1 395 ? -21.740 -7.029  -33.710 1.00 44.80  ? 346 ASP B CA  1 
ATOM   5800 C  C   . ASP B 1 395 ? -20.239 -6.815  -33.717 1.00 47.37  ? 346 ASP B C   1 
ATOM   5801 O  O   . ASP B 1 395 ? -19.604 -6.763  -34.784 1.00 45.42  ? 346 ASP B O   1 
ATOM   5802 C  CB  . ASP B 1 395 ? -22.214 -7.503  -35.090 1.00 47.19  ? 346 ASP B CB  1 
ATOM   5803 C  CG  . ASP B 1 395 ? -21.765 -8.935  -35.422 1.00 51.27  ? 346 ASP B CG  1 
ATOM   5804 O  OD1 . ASP B 1 395 ? -20.948 -9.534  -34.670 1.00 50.44  ? 346 ASP B OD1 1 
ATOM   5805 O  OD2 . ASP B 1 395 ? -22.234 -9.466  -36.451 1.00 47.18  ? 346 ASP B OD2 1 
ATOM   5806 N  N   . ARG B 1 396 ? -19.678 -6.690  -32.514 1.00 45.76  ? 347 ARG B N   1 
ATOM   5807 C  CA  . ARG B 1 396 ? -18.254 -6.452  -32.333 1.00 44.95  ? 347 ARG B CA  1 
ATOM   5808 C  C   . ARG B 1 396 ? -17.396 -7.515  -33.026 1.00 46.32  ? 347 ARG B C   1 
ATOM   5809 O  O   . ARG B 1 396 ? -16.433 -7.158  -33.701 1.00 45.10  ? 347 ARG B O   1 
ATOM   5810 C  CB  . ARG B 1 396 ? -17.929 -6.350  -30.839 1.00 47.83  ? 347 ARG B CB  1 
ATOM   5811 C  CG  . ARG B 1 396 ? -18.542 -5.141  -30.156 1.00 46.87  ? 347 ARG B CG  1 
ATOM   5812 C  CD  . ARG B 1 396 ? -18.769 -5.394  -28.676 1.00 53.65  ? 347 ARG B CD  1 
ATOM   5813 N  NE  . ARG B 1 396 ? -17.544 -5.659  -27.903 1.00 49.41  ? 347 ARG B NE  1 
ATOM   5814 C  CZ  . ARG B 1 396 ? -16.843 -4.742  -27.235 1.00 48.20  ? 347 ARG B CZ  1 
ATOM   5815 N  NH1 . ARG B 1 396 ? -17.210 -3.473  -27.263 1.00 45.88  ? 347 ARG B NH1 1 
ATOM   5816 N  NH2 . ARG B 1 396 ? -15.752 -5.091  -26.554 1.00 47.06  ? 347 ARG B NH2 1 
ATOM   5817 N  N   . ALA B 1 397 ? -17.760 -8.801  -32.887 1.00 44.97  ? 348 ALA B N   1 
ATOM   5818 C  CA  . ALA B 1 397 ? -17.018 -9.912  -33.527 1.00 44.53  ? 348 ALA B CA  1 
ATOM   5819 C  C   . ALA B 1 397 ? -16.830 -9.733  -35.036 1.00 47.40  ? 348 ALA B C   1 
ATOM   5820 O  O   . ALA B 1 397 ? -15.739 -9.950  -35.564 1.00 50.93  ? 348 ALA B O   1 
ATOM   5821 C  CB  . ALA B 1 397 ? -17.681 -11.252 -33.239 1.00 41.67  ? 348 ALA B CB  1 
ATOM   5822 N  N   . ARG B 1 398 ? -17.891 -9.319  -35.725 1.00 47.95  ? 349 ARG B N   1 
ATOM   5823 C  CA  . ARG B 1 398 ? -17.809 -9.057  -37.161 1.00 44.98  ? 349 ARG B CA  1 
ATOM   5824 C  C   . ARG B 1 398 ? -17.724 -7.555  -37.498 1.00 44.86  ? 349 ARG B C   1 
ATOM   5825 O  O   . ARG B 1 398 ? -17.882 -7.167  -38.656 1.00 41.54  ? 349 ARG B O   1 
ATOM   5826 C  CB  . ARG B 1 398 ? -18.941 -9.759  -37.904 1.00 44.68  ? 349 ARG B CB  1 
ATOM   5827 C  CG  . ARG B 1 398 ? -18.944 -11.274 -37.687 1.00 50.03  ? 349 ARG B CG  1 
ATOM   5828 C  CD  . ARG B 1 398 ? -20.059 -11.977 -38.443 1.00 52.87  ? 349 ARG B CD  1 
ATOM   5829 N  NE  . ARG B 1 398 ? -19.909 -11.765 -39.884 1.00 59.18  ? 349 ARG B NE  1 
ATOM   5830 C  CZ  . ARG B 1 398 ? -20.746 -12.216 -40.817 1.00 61.74  ? 349 ARG B CZ  1 
ATOM   5831 N  NH1 . ARG B 1 398 ? -21.813 -12.932 -40.483 1.00 58.14  ? 349 ARG B NH1 1 
ATOM   5832 N  NH2 . ARG B 1 398 ? -20.496 -11.961 -42.097 1.00 61.53  ? 349 ARG B NH2 1 
ATOM   5833 N  N   . LYS B 1 399 ? -17.442 -6.719  -36.492 1.00 44.67  ? 350 LYS B N   1 
ATOM   5834 C  CA  . LYS B 1 399 ? -17.092 -5.315  -36.739 1.00 45.38  ? 350 LYS B CA  1 
ATOM   5835 C  C   . LYS B 1 399 ? -18.183 -4.640  -37.637 1.00 44.70  ? 350 LYS B C   1 
ATOM   5836 O  O   . LYS B 1 399 ? -17.929 -4.121  -38.732 1.00 39.97  ? 350 LYS B O   1 
ATOM   5837 C  CB  . LYS B 1 399 ? -15.668 -5.257  -37.333 1.00 45.61  ? 350 LYS B CB  1 
ATOM   5838 C  CG  . LYS B 1 399 ? -14.988 -3.908  -37.211 1.00 55.84  ? 350 LYS B CG  1 
ATOM   5839 C  CD  . LYS B 1 399 ? -13.616 -3.852  -37.880 1.00 58.80  ? 350 LYS B CD  1 
ATOM   5840 C  CE  . LYS B 1 399 ? -13.095 -2.411  -37.865 1.00 61.87  ? 350 LYS B CE  1 
ATOM   5841 N  NZ  . LYS B 1 399 ? -11.813 -2.180  -38.609 1.00 62.45  ? 350 LYS B NZ  1 
ATOM   5842 N  N   . ARG B 1 400 ? -19.424 -4.686  -37.170 1.00 41.50  ? 351 ARG B N   1 
ATOM   5843 C  CA  . ARG B 1 400 ? -20.532 -4.141  -37.948 1.00 41.20  ? 351 ARG B CA  1 
ATOM   5844 C  C   . ARG B 1 400 ? -21.704 -3.848  -37.015 1.00 43.03  ? 351 ARG B C   1 
ATOM   5845 O  O   . ARG B 1 400 ? -21.802 -4.419  -35.906 1.00 45.04  ? 351 ARG B O   1 
ATOM   5846 C  CB  . ARG B 1 400 ? -20.942 -5.126  -39.066 1.00 42.02  ? 351 ARG B CB  1 
ATOM   5847 C  CG  . ARG B 1 400 ? -21.470 -6.468  -38.553 1.00 41.81  ? 351 ARG B CG  1 
ATOM   5848 C  CD  . ARG B 1 400 ? -21.682 -7.493  -39.656 1.00 42.09  ? 351 ARG B CD  1 
ATOM   5849 N  NE  . ARG B 1 400 ? -22.302 -8.696  -39.111 1.00 42.31  ? 351 ARG B NE  1 
ATOM   5850 C  CZ  . ARG B 1 400 ? -23.026 -9.563  -39.819 1.00 47.32  ? 351 ARG B CZ  1 
ATOM   5851 N  NH1 . ARG B 1 400 ? -23.215 -9.381  -41.116 1.00 46.23  ? 351 ARG B NH1 1 
ATOM   5852 N  NH2 . ARG B 1 400 ? -23.575 -10.621 -39.223 1.00 48.16  ? 351 ARG B NH2 1 
ATOM   5853 N  N   . ILE B 1 401 ? -22.589 -2.962  -37.454 1.00 41.80  ? 352 ILE B N   1 
ATOM   5854 C  CA  . ILE B 1 401 ? -23.794 -2.686  -36.690 1.00 42.89  ? 352 ILE B CA  1 
ATOM   5855 C  C   . ILE B 1 401 ? -25.049 -3.016  -37.496 1.00 45.56  ? 352 ILE B C   1 
ATOM   5856 O  O   . ILE B 1 401 ? -25.147 -2.688  -38.685 1.00 41.92  ? 352 ILE B O   1 
ATOM   5857 C  CB  . ILE B 1 401 ? -23.803 -1.248  -36.129 1.00 45.41  ? 352 ILE B CB  1 
ATOM   5858 C  CG1 . ILE B 1 401 ? -22.688 -1.093  -35.076 1.00 47.23  ? 352 ILE B CG1 1 
ATOM   5859 C  CG2 . ILE B 1 401 ? -25.138 -0.959  -35.451 1.00 42.45  ? 352 ILE B CG2 1 
ATOM   5860 C  CD1 . ILE B 1 401 ? -22.256 0.325   -34.860 1.00 46.89  ? 352 ILE B CD1 1 
ATOM   5861 N  N   . GLY B 1 402 ? -25.995 -3.690  -36.841 1.00 46.03  ? 353 GLY B N   1 
ATOM   5862 C  CA  . GLY B 1 402 ? -27.186 -4.159  -37.518 1.00 42.50  ? 353 GLY B CA  1 
ATOM   5863 C  C   . GLY B 1 402 ? -28.369 -3.352  -37.094 1.00 40.05  ? 353 GLY B C   1 
ATOM   5864 O  O   . GLY B 1 402 ? -28.476 -3.030  -35.909 1.00 38.20  ? 353 GLY B O   1 
ATOM   5865 N  N   . PHE B 1 403 ? -29.261 -3.055  -38.049 1.00 38.08  ? 354 PHE B N   1 
ATOM   5866 C  CA  . PHE B 1 403 ? -30.516 -2.355  -37.767 1.00 41.81  ? 354 PHE B CA  1 
ATOM   5867 C  C   . PHE B 1 403 ? -31.706 -3.151  -38.277 1.00 42.69  ? 354 PHE B C   1 
ATOM   5868 O  O   . PHE B 1 403 ? -31.685 -3.651  -39.408 1.00 42.05  ? 354 PHE B O   1 
ATOM   5869 C  CB  . PHE B 1 403 ? -30.568 -0.956  -38.426 1.00 41.88  ? 354 PHE B CB  1 
ATOM   5870 C  CG  . PHE B 1 403 ? -29.594 0.040   -37.856 1.00 43.61  ? 354 PHE B CG  1 
ATOM   5871 C  CD1 . PHE B 1 403 ? -28.263 0.034   -38.239 1.00 43.08  ? 354 PHE B CD1 1 
ATOM   5872 C  CD2 . PHE B 1 403 ? -30.021 1.024   -36.966 1.00 43.49  ? 354 PHE B CD2 1 
ATOM   5873 C  CE1 . PHE B 1 403 ? -27.363 0.965   -37.719 1.00 43.48  ? 354 PHE B CE1 1 
ATOM   5874 C  CE2 . PHE B 1 403 ? -29.131 1.956   -36.445 1.00 41.88  ? 354 PHE B CE2 1 
ATOM   5875 C  CZ  . PHE B 1 403 ? -27.797 1.930   -36.824 1.00 43.21  ? 354 PHE B CZ  1 
ATOM   5876 N  N   . ALA B 1 404 ? -32.741 -3.231  -37.434 1.00 43.62  ? 355 ALA B N   1 
ATOM   5877 C  CA  . ALA B 1 404 ? -34.065 -3.715  -37.803 1.00 43.03  ? 355 ALA B CA  1 
ATOM   5878 C  C   . ALA B 1 404 ? -35.127 -2.854  -37.136 1.00 44.94  ? 355 ALA B C   1 
ATOM   5879 O  O   . ALA B 1 404 ? -34.878 -2.275  -36.082 1.00 44.60  ? 355 ALA B O   1 
ATOM   5880 C  CB  . ALA B 1 404 ? -34.240 -5.157  -37.374 1.00 41.65  ? 355 ALA B CB  1 
ATOM   5881 N  N   . VAL B 1 405 ? -36.304 -2.776  -37.761 1.00 46.19  ? 356 VAL B N   1 
ATOM   5882 C  CA  . VAL B 1 405 ? -37.468 -2.083  -37.205 1.00 44.62  ? 356 VAL B CA  1 
ATOM   5883 C  C   . VAL B 1 405 ? -37.795 -2.681  -35.839 1.00 43.63  ? 356 VAL B C   1 
ATOM   5884 O  O   . VAL B 1 405 ? -37.935 -3.894  -35.703 1.00 44.88  ? 356 VAL B O   1 
ATOM   5885 C  CB  . VAL B 1 405 ? -38.686 -2.243  -38.145 1.00 44.62  ? 356 VAL B CB  1 
ATOM   5886 C  CG1 . VAL B 1 405 ? -39.966 -1.746  -37.486 1.00 40.98  ? 356 VAL B CG1 1 
ATOM   5887 C  CG2 . VAL B 1 405 ? -38.427 -1.572  -39.489 1.00 41.33  ? 356 VAL B CG2 1 
ATOM   5888 N  N   . SER B 1 406 ? -37.902 -1.846  -34.818 1.00 41.40  ? 357 SER B N   1 
ATOM   5889 C  CA  . SER B 1 406 ? -38.222 -2.378  -33.499 1.00 42.60  ? 357 SER B CA  1 
ATOM   5890 C  C   . SER B 1 406 ? -39.682 -2.792  -33.351 1.00 43.72  ? 357 SER B C   1 
ATOM   5891 O  O   . SER B 1 406 ? -40.584 -2.025  -33.703 1.00 42.53  ? 357 SER B O   1 
ATOM   5892 C  CB  . SER B 1 406 ? -37.903 -1.374  -32.428 1.00 40.56  ? 357 SER B CB  1 
ATOM   5893 O  OG  . SER B 1 406 ? -37.927 -2.031  -31.200 1.00 45.59  ? 357 SER B OG  1 
ATOM   5894 N  N   . ALA B 1 407 ? -39.898 -3.992  -32.804 1.00 44.15  ? 358 ALA B N   1 
ATOM   5895 C  CA  . ALA B 1 407 ? -41.243 -4.465  -32.421 1.00 48.28  ? 358 ALA B CA  1 
ATOM   5896 C  C   . ALA B 1 407 ? -41.948 -3.549  -31.401 1.00 48.43  ? 358 ALA B C   1 
ATOM   5897 O  O   . ALA B 1 407 ? -43.167 -3.586  -31.268 1.00 52.10  ? 358 ALA B O   1 
ATOM   5898 C  CB  . ALA B 1 407 ? -41.198 -5.912  -31.917 1.00 45.99  ? 358 ALA B CB  1 
ATOM   5899 N  N   . CYS B 1 408 ? -41.181 -2.712  -30.709 1.00 50.10  ? 359 CYS B N   1 
ATOM   5900 C  CA  . CYS B 1 408 ? -41.741 -1.766  -29.752 1.00 49.86  ? 359 CYS B CA  1 
ATOM   5901 C  C   . CYS B 1 408 ? -41.724 -0.283  -30.198 1.00 50.06  ? 359 CYS B C   1 
ATOM   5902 O  O   . CYS B 1 408 ? -41.956 0.599   -29.369 1.00 56.93  ? 359 CYS B O   1 
ATOM   5903 C  CB  . CYS B 1 408 ? -41.066 -1.929  -28.371 1.00 51.61  ? 359 CYS B CB  1 
ATOM   5904 S  SG  . CYS B 1 408 ? -39.394 -1.227  -28.188 1.00 55.41  ? 359 CYS B SG  1 
ATOM   5905 N  N   . HIS B 1 409 ? -41.488 0.013   -31.479 1.00 45.43  ? 360 HIS B N   1 
ATOM   5906 C  CA  . HIS B 1 409 ? -41.410 1.432   -31.896 1.00 43.30  ? 360 HIS B CA  1 
ATOM   5907 C  C   . HIS B 1 409 ? -42.783 2.092   -31.970 1.00 45.54  ? 360 HIS B C   1 
ATOM   5908 O  O   . HIS B 1 409 ? -43.748 1.441   -32.369 1.00 44.17  ? 360 HIS B O   1 
ATOM   5909 C  CB  . HIS B 1 409 ? -40.615 1.619   -33.204 1.00 40.72  ? 360 HIS B CB  1 
ATOM   5910 C  CG  . HIS B 1 409 ? -41.395 1.375   -34.458 1.00 40.16  ? 360 HIS B CG  1 
ATOM   5911 N  ND1 . HIS B 1 409 ? -41.645 0.110   -34.947 1.00 43.72  ? 360 HIS B ND1 1 
ATOM   5912 C  CD2 . HIS B 1 409 ? -41.945 2.237   -35.351 1.00 40.78  ? 360 HIS B CD2 1 
ATOM   5913 C  CE1 . HIS B 1 409 ? -42.322 0.202   -36.083 1.00 45.95  ? 360 HIS B CE1 1 
ATOM   5914 N  NE2 . HIS B 1 409 ? -42.508 1.483   -36.355 1.00 44.54  ? 360 HIS B NE2 1 
ATOM   5915 N  N   . VAL B 1 410 ? -42.870 3.368   -31.575 1.00 45.96  ? 361 VAL B N   1 
ATOM   5916 C  CA  . VAL B 1 410 ? -44.130 4.123   -31.641 1.00 44.77  ? 361 VAL B CA  1 
ATOM   5917 C  C   . VAL B 1 410 ? -44.408 4.552   -33.090 1.00 48.06  ? 361 VAL B C   1 
ATOM   5918 O  O   . VAL B 1 410 ? -43.512 5.041   -33.780 1.00 46.39  ? 361 VAL B O   1 
ATOM   5919 C  CB  . VAL B 1 410 ? -44.121 5.353   -30.705 1.00 47.77  ? 361 VAL B CB  1 
ATOM   5920 C  CG1 . VAL B 1 410 ? -45.494 6.026   -30.659 1.00 46.14  ? 361 VAL B CG1 1 
ATOM   5921 C  CG2 . VAL B 1 410 ? -43.667 4.959   -29.300 1.00 47.49  ? 361 VAL B CG2 1 
ATOM   5922 N  N   . HIS B 1 411 ? -45.642 4.326   -33.547 1.00 47.14  ? 362 HIS B N   1 
ATOM   5923 C  CA  . HIS B 1 411 ? -46.064 4.693   -34.902 1.00 47.79  ? 362 HIS B CA  1 
ATOM   5924 C  C   . HIS B 1 411 ? -47.568 4.998   -34.925 1.00 47.01  ? 362 HIS B C   1 
ATOM   5925 O  O   . HIS B 1 411 ? -48.192 5.064   -33.870 1.00 44.60  ? 362 HIS B O   1 
ATOM   5926 C  CB  . HIS B 1 411 ? -45.681 3.606   -35.918 1.00 46.69  ? 362 HIS B CB  1 
ATOM   5927 C  CG  . HIS B 1 411 ? -46.330 2.272   -35.684 1.00 52.36  ? 362 HIS B CG  1 
ATOM   5928 N  ND1 . HIS B 1 411 ? -47.472 1.870   -36.347 1.00 53.25  ? 362 HIS B ND1 1 
ATOM   5929 C  CD2 . HIS B 1 411 ? -45.973 1.230   -34.894 1.00 52.66  ? 362 HIS B CD2 1 
ATOM   5930 C  CE1 . HIS B 1 411 ? -47.797 0.646   -35.965 1.00 53.09  ? 362 HIS B CE1 1 
ATOM   5931 N  NE2 . HIS B 1 411 ? -46.907 0.236   -35.081 1.00 55.12  ? 362 HIS B NE2 1 
ATOM   5932 N  N   . ASP B 1 412 ? -48.139 5.220   -36.110 1.00 50.35  ? 363 ASP B N   1 
ATOM   5933 C  CA  . ASP B 1 412 ? -49.607 5.379   -36.257 1.00 52.66  ? 363 ASP B CA  1 
ATOM   5934 C  C   . ASP B 1 412 ? -50.129 4.371   -37.269 1.00 52.25  ? 363 ASP B C   1 
ATOM   5935 O  O   . ASP B 1 412 ? -49.375 3.514   -37.725 1.00 53.60  ? 363 ASP B O   1 
ATOM   5936 C  CB  . ASP B 1 412 ? -50.005 6.811   -36.646 1.00 49.45  ? 363 ASP B CB  1 
ATOM   5937 C  CG  . ASP B 1 412 ? -49.253 7.318   -37.855 1.00 51.75  ? 363 ASP B CG  1 
ATOM   5938 O  OD1 . ASP B 1 412 ? -49.265 6.647   -38.901 1.00 54.97  ? 363 ASP B OD1 1 
ATOM   5939 O  OD2 . ASP B 1 412 ? -48.642 8.397   -37.762 1.00 52.81  ? 363 ASP B OD2 1 
ATOM   5940 N  N   . GLU B 1 413 ? -51.406 4.462   -37.626 1.00 53.54  ? 364 GLU B N   1 
ATOM   5941 C  CA  . GLU B 1 413 ? -51.980 3.474   -38.545 1.00 53.84  ? 364 GLU B CA  1 
ATOM   5942 C  C   . GLU B 1 413 ? -51.559 3.650   -40.015 1.00 48.78  ? 364 GLU B C   1 
ATOM   5943 O  O   . GLU B 1 413 ? -51.696 2.717   -40.815 1.00 46.59  ? 364 GLU B O   1 
ATOM   5944 C  CB  . GLU B 1 413 ? -53.504 3.394   -38.406 1.00 58.51  ? 364 GLU B CB  1 
ATOM   5945 C  CG  . GLU B 1 413 ? -54.263 4.673   -38.717 1.00 64.95  ? 364 GLU B CG  1 
ATOM   5946 C  CD  . GLU B 1 413 ? -55.715 4.404   -39.132 1.00 79.15  ? 364 GLU B CD  1 
ATOM   5947 O  OE1 . GLU B 1 413 ? -55.978 3.396   -39.854 1.00 69.22  ? 364 GLU B OE1 1 
ATOM   5948 O  OE2 . GLU B 1 413 ? -56.598 5.214   -38.738 1.00 82.32  ? 364 GLU B OE2 1 
ATOM   5949 N  N   . PHE B 1 414 ? -51.022 4.831   -40.338 1.00 43.03  ? 365 PHE B N   1 
ATOM   5950 C  CA  . PHE B 1 414 ? -50.643 5.211   -41.707 1.00 41.98  ? 365 PHE B CA  1 
ATOM   5951 C  C   . PHE B 1 414 ? -49.157 5.041   -42.122 1.00 42.32  ? 365 PHE B C   1 
ATOM   5952 O  O   . PHE B 1 414 ? -48.871 4.916   -43.317 1.00 42.84  ? 365 PHE B O   1 
ATOM   5953 C  CB  . PHE B 1 414 ? -51.114 6.649   -41.976 1.00 44.73  ? 365 PHE B CB  1 
ATOM   5954 C  CG  . PHE B 1 414 ? -52.581 6.841   -41.738 1.00 47.27  ? 365 PHE B CG  1 
ATOM   5955 C  CD1 . PHE B 1 414 ? -53.515 6.205   -42.551 1.00 44.55  ? 365 PHE B CD1 1 
ATOM   5956 C  CD2 . PHE B 1 414 ? -53.037 7.634   -40.677 1.00 49.94  ? 365 PHE B CD2 1 
ATOM   5957 C  CE1 . PHE B 1 414 ? -54.873 6.359   -42.313 1.00 48.80  ? 365 PHE B CE1 1 
ATOM   5958 C  CE2 . PHE B 1 414 ? -54.401 7.803   -40.439 1.00 46.64  ? 365 PHE B CE2 1 
ATOM   5959 C  CZ  . PHE B 1 414 ? -55.317 7.164   -41.261 1.00 48.22  ? 365 PHE B CZ  1 
ATOM   5960 N  N   . ARG B 1 415 ? -48.230 5.079   -41.150 1.00 41.48  ? 366 ARG B N   1 
ATOM   5961 C  CA  . ARG B 1 415 ? -46.790 5.018   -41.400 1.00 39.90  ? 366 ARG B CA  1 
ATOM   5962 C  C   . ARG B 1 415 ? -46.124 4.233   -40.307 1.00 40.99  ? 366 ARG B C   1 
ATOM   5963 O  O   . ARG B 1 415 ? -46.589 4.206   -39.151 1.00 42.16  ? 366 ARG B O   1 
ATOM   5964 C  CB  . ARG B 1 415 ? -46.125 6.413   -41.383 1.00 38.80  ? 366 ARG B CB  1 
ATOM   5965 C  CG  . ARG B 1 415 ? -46.537 7.363   -42.486 1.00 43.20  ? 366 ARG B CG  1 
ATOM   5966 C  CD  . ARG B 1 415 ? -45.638 8.596   -42.605 1.00 41.10  ? 366 ARG B CD  1 
ATOM   5967 N  NE  . ARG B 1 415 ? -45.671 9.427   -41.413 1.00 39.37  ? 366 ARG B NE  1 
ATOM   5968 C  CZ  . ARG B 1 415 ? -45.500 10.749  -41.400 1.00 41.71  ? 366 ARG B CZ  1 
ATOM   5969 N  NH1 . ARG B 1 415 ? -45.278 11.412  -42.531 1.00 37.06  ? 366 ARG B NH1 1 
ATOM   5970 N  NH2 . ARG B 1 415 ? -45.566 11.408  -40.242 1.00 40.31  ? 366 ARG B NH2 1 
ATOM   5971 N  N   . THR B 1 416 ? -44.986 3.643   -40.662 1.00 40.17  ? 367 THR B N   1 
ATOM   5972 C  CA  A THR B 1 416 ? -44.163 2.898   -39.719 0.50 39.12  ? 367 THR B CA  1 
ATOM   5973 C  CA  B THR B 1 416 ? -44.165 2.940   -39.695 0.50 41.01  ? 367 THR B CA  1 
ATOM   5974 C  C   . THR B 1 416 ? -42.704 3.218   -39.985 1.00 40.16  ? 367 THR B C   1 
ATOM   5975 O  O   . THR B 1 416 ? -42.339 3.498   -41.128 1.00 43.44  ? 367 THR B O   1 
ATOM   5976 C  CB  A THR B 1 416 ? -44.348 1.362   -39.876 0.50 37.21  ? 367 THR B CB  1 
ATOM   5977 C  CB  B THR B 1 416 ? -44.437 1.411   -39.707 0.50 41.19  ? 367 THR B CB  1 
ATOM   5978 O  OG1 A THR B 1 416 ? -43.848 0.938   -41.155 0.50 34.35  ? 367 THR B OG1 1 
ATOM   5979 O  OG1 B THR B 1 416 ? -43.357 0.728   -39.052 0.50 41.20  ? 367 THR B OG1 1 
ATOM   5980 C  CG2 A THR B 1 416 ? -45.809 0.948   -39.720 0.50 34.38  ? 367 THR B CG2 1 
ATOM   5981 C  CG2 B THR B 1 416 ? -44.575 0.883   -41.137 0.50 40.29  ? 367 THR B CG2 1 
ATOM   5982 N  N   . ALA B 1 417 ? -41.867 3.133   -38.947 1.00 39.94  ? 368 ALA B N   1 
ATOM   5983 C  CA  . ALA B 1 417 ? -40.415 3.184   -39.137 1.00 38.75  ? 368 ALA B CA  1 
ATOM   5984 C  C   . ALA B 1 417 ? -40.002 2.056   -40.097 1.00 38.94  ? 368 ALA B C   1 
ATOM   5985 O  O   . ALA B 1 417 ? -40.730 1.069   -40.243 1.00 44.11  ? 368 ALA B O   1 
ATOM   5986 C  CB  . ALA B 1 417 ? -39.694 3.056   -37.799 1.00 37.85  ? 368 ALA B CB  1 
ATOM   5987 N  N   . ALA B 1 418 ? -38.850 2.181   -40.748 1.00 37.61  ? 369 ALA B N   1 
ATOM   5988 C  CA  . ALA B 1 418 ? -38.448 1.174   -41.747 1.00 38.82  ? 369 ALA B CA  1 
ATOM   5989 C  C   . ALA B 1 418 ? -36.953 0.983   -41.893 1.00 38.39  ? 369 ALA B C   1 
ATOM   5990 O  O   . ALA B 1 418 ? -36.166 1.912   -41.667 1.00 39.56  ? 369 ALA B O   1 
ATOM   5991 C  CB  . ALA B 1 418 ? -39.056 1.468   -43.119 1.00 35.34  ? 369 ALA B CB  1 
ATOM   5992 N  N   . VAL B 1 419 ? -36.567 -0.225  -42.290 1.00 35.98  ? 370 VAL B N   1 
ATOM   5993 C  CA  . VAL B 1 419 ? -35.180 -0.491  -42.666 1.00 37.27  ? 370 VAL B CA  1 
ATOM   5994 C  C   . VAL B 1 419 ? -35.218 -1.216  -43.997 1.00 40.89  ? 370 VAL B C   1 
ATOM   5995 O  O   . VAL B 1 419 ? -35.691 -2.362  -44.070 1.00 41.22  ? 370 VAL B O   1 
ATOM   5996 C  CB  . VAL B 1 419 ? -34.452 -1.352  -41.624 1.00 33.28  ? 370 VAL B CB  1 
ATOM   5997 C  CG1 . VAL B 1 419 ? -33.031 -1.597  -42.057 1.00 32.87  ? 370 VAL B CG1 1 
ATOM   5998 C  CG2 . VAL B 1 419 ? -34.482 -0.687  -40.256 1.00 34.12  ? 370 VAL B CG2 1 
ATOM   5999 N  N   . GLU B 1 420 ? -34.727 -0.549  -45.041 1.00 43.82  ? 371 GLU B N   1 
ATOM   6000 C  CA  . GLU B 1 420 ? -34.840 -1.055  -46.414 1.00 46.30  ? 371 GLU B CA  1 
ATOM   6001 C  C   . GLU B 1 420 ? -33.562 -0.942  -47.225 1.00 46.58  ? 371 GLU B C   1 
ATOM   6002 O  O   . GLU B 1 420 ? -32.781 -0.014  -47.033 1.00 49.77  ? 371 GLU B O   1 
ATOM   6003 C  CB  . GLU B 1 420 ? -35.952 -0.317  -47.149 1.00 47.23  ? 371 GLU B CB  1 
ATOM   6004 C  CG  . GLU B 1 420 ? -37.211 -0.178  -46.321 1.00 52.82  ? 371 GLU B CG  1 
ATOM   6005 C  CD  . GLU B 1 420 ? -38.227 0.752   -46.936 1.00 56.45  ? 371 GLU B CD  1 
ATOM   6006 O  OE1 . GLU B 1 420 ? -39.250 0.226   -47.403 1.00 60.54  ? 371 GLU B OE1 1 
ATOM   6007 O  OE2 . GLU B 1 420 ? -38.016 1.990   -46.940 1.00 59.94  ? 371 GLU B OE2 1 
ATOM   6008 N  N   . GLY B 1 421 ? -33.373 -1.886  -48.142 1.00 50.82  ? 372 GLY B N   1 
ATOM   6009 C  CA  . GLY B 1 421 ? -32.266 -1.860  -49.109 1.00 50.53  ? 372 GLY B CA  1 
ATOM   6010 C  C   . GLY B 1 421 ? -32.385 -2.974  -50.142 1.00 50.97  ? 372 GLY B C   1 
ATOM   6011 O  O   . GLY B 1 421 ? -33.319 -3.773  -50.070 1.00 49.18  ? 372 GLY B O   1 
ATOM   6012 N  N   . PRO B 1 422 ? -31.430 -3.069  -51.092 1.00 51.23  ? 373 PRO B N   1 
ATOM   6013 C  CA  . PRO B 1 422 ? -30.234 -2.262  -51.238 1.00 49.84  ? 373 PRO B CA  1 
ATOM   6014 C  C   . PRO B 1 422 ? -30.420 -1.098  -52.208 1.00 46.76  ? 373 PRO B C   1 
ATOM   6015 O  O   . PRO B 1 422 ? -31.341 -1.110  -53.019 1.00 48.53  ? 373 PRO B O   1 
ATOM   6016 C  CB  . PRO B 1 422 ? -29.242 -3.260  -51.824 1.00 50.00  ? 373 PRO B CB  1 
ATOM   6017 C  CG  . PRO B 1 422 ? -30.083 -4.115  -52.707 1.00 52.24  ? 373 PRO B CG  1 
ATOM   6018 C  CD  . PRO B 1 422 ? -31.469 -4.138  -52.110 1.00 53.47  ? 373 PRO B CD  1 
ATOM   6019 N  N   . PHE B 1 423 ? -29.550 -0.098  -52.092 1.00 45.30  ? 374 PHE B N   1 
ATOM   6020 C  CA  . PHE B 1 423 ? -29.432 0.993   -53.066 1.00 46.73  ? 374 PHE B CA  1 
ATOM   6021 C  C   . PHE B 1 423 ? -28.008 1.009   -53.585 1.00 49.45  ? 374 PHE B C   1 
ATOM   6022 O  O   . PHE B 1 423 ? -27.060 0.817   -52.820 1.00 55.32  ? 374 PHE B O   1 
ATOM   6023 C  CB  . PHE B 1 423 ? -29.786 2.360   -52.446 1.00 41.36  ? 374 PHE B CB  1 
ATOM   6024 C  CG  . PHE B 1 423 ? -31.101 2.364   -51.743 1.00 39.75  ? 374 PHE B CG  1 
ATOM   6025 C  CD1 . PHE B 1 423 ? -32.278 2.526   -52.453 1.00 40.64  ? 374 PHE B CD1 1 
ATOM   6026 C  CD2 . PHE B 1 423 ? -31.170 2.155   -50.371 1.00 39.75  ? 374 PHE B CD2 1 
ATOM   6027 C  CE1 . PHE B 1 423 ? -33.507 2.491   -51.796 1.00 39.60  ? 374 PHE B CE1 1 
ATOM   6028 C  CE2 . PHE B 1 423 ? -32.383 2.119   -49.712 1.00 39.00  ? 374 PHE B CE2 1 
ATOM   6029 C  CZ  . PHE B 1 423 ? -33.557 2.285   -50.429 1.00 41.06  ? 374 PHE B CZ  1 
ATOM   6030 N  N   . VAL B 1 424 ? -27.863 1.224   -54.885 1.00 51.88  ? 375 VAL B N   1 
ATOM   6031 C  CA  . VAL B 1 424 ? -26.552 1.361   -55.496 1.00 55.27  ? 375 VAL B CA  1 
ATOM   6032 C  C   . VAL B 1 424 ? -26.023 2.765   -55.207 1.00 60.76  ? 375 VAL B C   1 
ATOM   6033 O  O   . VAL B 1 424 ? -26.604 3.773   -55.637 1.00 59.46  ? 375 VAL B O   1 
ATOM   6034 C  CB  . VAL B 1 424 ? -26.603 1.112   -57.010 1.00 58.22  ? 375 VAL B CB  1 
ATOM   6035 C  CG1 . VAL B 1 424 ? -25.270 1.489   -57.641 1.00 55.99  ? 375 VAL B CG1 1 
ATOM   6036 C  CG2 . VAL B 1 424 ? -26.977 -0.347  -57.294 1.00 54.73  ? 375 VAL B CG2 1 
ATOM   6037 N  N   . THR B 1 425 ? -24.927 2.814   -54.456 1.00 59.94  ? 376 THR B N   1 
ATOM   6038 C  CA  . THR B 1 425 ? -24.348 4.067   -54.015 1.00 58.51  ? 376 THR B CA  1 
ATOM   6039 C  C   . THR B 1 425 ? -22.845 4.000   -54.238 1.00 60.79  ? 376 THR B C   1 
ATOM   6040 O  O   . THR B 1 425 ? -22.183 3.020   -53.852 1.00 58.70  ? 376 THR B O   1 
ATOM   6041 C  CB  . THR B 1 425 ? -24.681 4.334   -52.530 1.00 57.06  ? 376 THR B CB  1 
ATOM   6042 O  OG1 . THR B 1 425 ? -26.083 4.123   -52.313 1.00 56.15  ? 376 THR B OG1 1 
ATOM   6043 C  CG2 . THR B 1 425 ? -24.325 5.751   -52.131 1.00 55.99  ? 376 THR B CG2 1 
ATOM   6044 N  N   . LEU B 1 426 ? -22.321 5.049   -54.869 1.00 59.58  ? 377 LEU B N   1 
ATOM   6045 C  CA  . LEU B 1 426 ? -20.907 5.105   -55.230 1.00 60.29  ? 377 LEU B CA  1 
ATOM   6046 C  C   . LEU B 1 426 ? -20.088 5.996   -54.286 1.00 64.40  ? 377 LEU B C   1 
ATOM   6047 O  O   . LEU B 1 426 ? -20.646 6.834   -53.551 1.00 62.64  ? 377 LEU B O   1 
ATOM   6048 C  CB  . LEU B 1 426 ? -20.736 5.551   -56.697 1.00 56.28  ? 377 LEU B CB  1 
ATOM   6049 C  CG  . LEU B 1 426 ? -21.441 4.775   -57.833 1.00 57.69  ? 377 LEU B CG  1 
ATOM   6050 C  CD1 . LEU B 1 426 ? -21.100 5.408   -59.183 1.00 53.25  ? 377 LEU B CD1 1 
ATOM   6051 C  CD2 . LEU B 1 426 ? -21.123 3.272   -57.826 1.00 51.11  ? 377 LEU B CD2 1 
ATOM   6052 N  N   . ASP B 1 427 ? -18.767 5.769   -54.306 1.00 71.24  ? 378 ASP B N   1 
ATOM   6053 C  CA  . ASP B 1 427 ? -17.758 6.576   -53.600 1.00 70.03  ? 378 ASP B CA  1 
ATOM   6054 C  C   . ASP B 1 427 ? -18.076 6.772   -52.115 1.00 69.43  ? 378 ASP B C   1 
ATOM   6055 O  O   . ASP B 1 427 ? -17.990 7.881   -51.586 1.00 62.66  ? 378 ASP B O   1 
ATOM   6056 C  CB  . ASP B 1 427 ? -17.560 7.920   -54.318 1.00 76.12  ? 378 ASP B CB  1 
ATOM   6057 C  CG  . ASP B 1 427 ? -17.243 7.748   -55.803 1.00 82.18  ? 378 ASP B CG  1 
ATOM   6058 O  OD1 . ASP B 1 427 ? -16.270 7.029   -56.131 1.00 81.14  ? 378 ASP B OD1 1 
ATOM   6059 O  OD2 . ASP B 1 427 ? -17.973 8.327   -56.640 1.00 83.59  ? 378 ASP B OD2 1 
ATOM   6060 N  N   . MET B 1 428 ? -18.440 5.677   -51.453 1.00 68.22  ? 379 MET B N   1 
ATOM   6061 C  CA  . MET B 1 428 ? -18.982 5.757   -50.104 1.00 66.61  ? 379 MET B CA  1 
ATOM   6062 C  C   . MET B 1 428 ? -17.929 6.044   -49.029 1.00 71.96  ? 379 MET B C   1 
ATOM   6063 O  O   . MET B 1 428 ? -18.210 6.792   -48.076 1.00 69.86  ? 379 MET B O   1 
ATOM   6064 C  CB  . MET B 1 428 ? -19.804 4.515   -49.780 1.00 64.00  ? 379 MET B CB  1 
ATOM   6065 C  CG  . MET B 1 428 ? -21.102 4.456   -50.573 1.00 62.70  ? 379 MET B CG  1 
ATOM   6066 S  SD  . MET B 1 428 ? -22.219 3.155   -50.031 1.00 67.69  ? 379 MET B SD  1 
ATOM   6067 C  CE  . MET B 1 428 ? -21.257 1.633   -50.149 1.00 59.29  ? 379 MET B CE  1 
ATOM   6068 N  N   . GLU B 1 429 ? -16.726 5.480   -49.195 1.00 70.33  ? 380 GLU B N   1 
ATOM   6069 C  CA  . GLU B 1 429 ? -15.585 5.781   -48.316 1.00 72.02  ? 380 GLU B CA  1 
ATOM   6070 C  C   . GLU B 1 429 ? -15.195 7.266   -48.312 1.00 67.90  ? 380 GLU B C   1 
ATOM   6071 O  O   . GLU B 1 429 ? -14.618 7.748   -47.322 1.00 69.84  ? 380 GLU B O   1 
ATOM   6072 C  CB  . GLU B 1 429 ? -14.373 4.903   -48.647 1.00 75.50  ? 380 GLU B CB  1 
ATOM   6073 C  CG  . GLU B 1 429 ? -14.427 3.513   -48.016 1.00 82.81  ? 380 GLU B CG  1 
ATOM   6074 C  CD  . GLU B 1 429 ? -13.841 2.436   -48.923 1.00 91.34  ? 380 GLU B CD  1 
ATOM   6075 O  OE1 . GLU B 1 429 ? -12.935 2.763   -49.730 1.00 90.31  ? 380 GLU B OE1 1 
ATOM   6076 O  OE2 . GLU B 1 429 ? -14.293 1.262   -48.838 1.00 90.21  ? 380 GLU B OE2 1 
ATOM   6077 N  N   . ASP B 1 430 ? -15.524 7.982   -49.395 1.00 60.59  ? 381 ASP B N   1 
ATOM   6078 C  CA  . ASP B 1 430 ? -15.321 9.439   -49.473 1.00 62.57  ? 381 ASP B CA  1 
ATOM   6079 C  C   . ASP B 1 430 ? -16.158 10.227  -48.477 1.00 57.45  ? 381 ASP B C   1 
ATOM   6080 O  O   . ASP B 1 430 ? -15.801 11.344  -48.129 1.00 63.18  ? 381 ASP B O   1 
ATOM   6081 C  CB  . ASP B 1 430 ? -15.599 9.964   -50.880 1.00 67.50  ? 381 ASP B CB  1 
ATOM   6082 C  CG  . ASP B 1 430 ? -14.562 9.507   -51.888 1.00 77.65  ? 381 ASP B CG  1 
ATOM   6083 O  OD1 . ASP B 1 430 ? -13.520 8.944   -51.475 1.00 80.11  ? 381 ASP B OD1 1 
ATOM   6084 O  OD2 . ASP B 1 430 ? -14.788 9.718   -53.099 1.00 80.71  ? 381 ASP B OD2 1 
ATOM   6085 N  N   . CYS B 1 431 ? -17.267 9.639   -48.034 1.00 52.34  ? 382 CYS B N   1 
ATOM   6086 C  CA  . CYS B 1 431 ? -18.157 10.247  -47.058 1.00 50.80  ? 382 CYS B CA  1 
ATOM   6087 C  C   . CYS B 1 431 ? -17.552 10.285  -45.647 1.00 53.38  ? 382 CYS B C   1 
ATOM   6088 O  O   . CYS B 1 431 ? -18.011 11.055  -44.794 1.00 53.13  ? 382 CYS B O   1 
ATOM   6089 C  CB  . CYS B 1 431 ? -19.473 9.488   -47.030 1.00 52.60  ? 382 CYS B CB  1 
ATOM   6090 S  SG  . CYS B 1 431 ? -20.263 9.298   -48.645 1.00 54.19  ? 382 CYS B SG  1 
ATOM   6091 N  N   . GLY B 1 432 ? -16.546 9.444   -45.395 1.00 52.38  ? 383 GLY B N   1 
ATOM   6092 C  CA  . GLY B 1 432 ? -15.836 9.460   -44.120 1.00 54.78  ? 383 GLY B CA  1 
ATOM   6093 C  C   . GLY B 1 432 ? -14.951 10.689  -44.054 1.00 59.46  ? 383 GLY B C   1 
ATOM   6094 O  O   . GLY B 1 432 ? -14.391 11.119  -45.075 1.00 63.70  ? 383 GLY B O   1 
ATOM   6095 N  N   . TYR B 1 433 ? -14.844 11.269  -42.864 1.00 58.69  ? 384 TYR B N   1 
ATOM   6096 C  CA  . TYR B 1 433 ? -13.958 12.395  -42.636 1.00 63.06  ? 384 TYR B CA  1 
ATOM   6097 C  C   . TYR B 1 433 ? -12.627 11.920  -42.049 1.00 65.37  ? 384 TYR B C   1 
ATOM   6098 O  O   . TYR B 1 433 ? -12.602 11.008  -41.218 1.00 62.18  ? 384 TYR B O   1 
ATOM   6099 C  CB  . TYR B 1 433 ? -14.619 13.389  -41.688 1.00 68.12  ? 384 TYR B CB  1 
ATOM   6100 C  CG  . TYR B 1 433 ? -13.808 14.643  -41.420 1.00 73.20  ? 384 TYR B CG  1 
ATOM   6101 C  CD1 . TYR B 1 433 ? -13.661 15.628  -42.423 1.00 73.03  ? 384 TYR B CD1 1 
ATOM   6102 C  CD2 . TYR B 1 433 ? -13.202 14.860  -40.156 1.00 74.98  ? 384 TYR B CD2 1 
ATOM   6103 C  CE1 . TYR B 1 433 ? -12.927 16.782  -42.184 1.00 75.82  ? 384 TYR B CE1 1 
ATOM   6104 C  CE2 . TYR B 1 433 ? -12.463 16.014  -39.906 1.00 73.48  ? 384 TYR B CE2 1 
ATOM   6105 C  CZ  . TYR B 1 433 ? -12.328 16.970  -40.924 1.00 78.30  ? 384 TYR B CZ  1 
ATOM   6106 O  OH  . TYR B 1 433 ? -11.598 18.121  -40.705 1.00 83.39  ? 384 TYR B OH  1 
ATOM   6107 N  N   . ASN B 1 434 ? -11.530 12.541  -42.489 1.00 66.58  ? 385 ASN B N   1 
ATOM   6108 C  CA  . ASN B 1 434 ? -10.190 12.238  -41.977 1.00 66.11  ? 385 ASN B CA  1 
ATOM   6109 C  C   . ASN B 1 434 ? -9.593  13.364  -41.126 1.00 63.49  ? 385 ASN B C   1 
ATOM   6110 O  O   . ASN B 1 434 ? -9.566  14.521  -41.571 1.00 70.13  ? 385 ASN B O   1 
ATOM   6111 C  CB  . ASN B 1 434 ? -9.266  11.885  -43.142 1.00 62.19  ? 385 ASN B CB  1 
ATOM   6112 C  CG  . ASN B 1 434 ? -9.771  10.697  -43.931 1.00 66.76  ? 385 ASN B CG  1 
ATOM   6113 O  OD1 . ASN B 1 434 ? -9.911  9.588   -43.399 1.00 65.68  ? 385 ASN B OD1 1 
ATOM   6114 N  ND2 . ASN B 1 434 ? -10.070 10.923  -45.205 1.00 67.84  ? 385 ASN B ND2 1 
HETATM 6115 C  C7  . 4RX C 2 .   ? 18.983  -10.793 -9.734  1.00 49.91  ? 401 4RX A C7  1 
HETATM 6116 C  C6  . 4RX C 2 .   ? 19.516  -11.409 -8.453  1.00 48.24  ? 401 4RX A C6  1 
HETATM 6117 C  C5  . 4RX C 2 .   ? 21.034  -11.369 -8.443  1.00 48.95  ? 401 4RX A C5  1 
HETATM 6118 C  C4  . 4RX C 2 .   ? 21.602  -9.969  -8.656  1.00 51.00  ? 401 4RX A C4  1 
HETATM 6119 C  C2  . 4RX C 2 .   ? 21.001  -9.348  -6.385  1.00 46.72  ? 401 4RX A C2  1 
HETATM 6120 C  C15 . 4RX C 2 .   ? 12.964  -11.347 -9.970  1.00 57.12  ? 401 4RX A C15 1 
HETATM 6121 C  C14 . 4RX C 2 .   ? 14.239  -11.437 -10.492 1.00 51.36  ? 401 4RX A C14 1 
HETATM 6122 C  C16 . 4RX C 2 .   ? 12.682  -10.496 -8.920  1.00 54.66  ? 401 4RX A C16 1 
HETATM 6123 C  C18 . 4RX C 2 .   ? 14.973  -9.791  -8.901  1.00 54.48  ? 401 4RX A C18 1 
HETATM 6124 C  C13 . 4RX C 2 .   ? 15.236  -10.659 -9.950  1.00 53.91  ? 401 4RX A C13 1 
HETATM 6125 C  C17 . 4RX C 2 .   ? 13.689  -9.720  -8.393  1.00 57.21  ? 401 4RX A C17 1 
HETATM 6126 C  C11 . 4RX C 2 .   ? 16.596  -10.774 -10.508 1.00 51.91  ? 401 4RX A C11 1 
HETATM 6127 C  C8  . 4RX C 2 .   ? 19.590  -9.430  -10.038 1.00 49.15  ? 401 4RX A C8  1 
HETATM 6128 C  C9  . 4RX C 2 .   ? 21.101  -9.422  -9.986  1.00 48.42  ? 401 4RX A C9  1 
HETATM 6129 C  C21 . 4RX C 2 .   ? 23.136  -11.980 -7.361  1.00 49.11  ? 401 4RX A C21 1 
HETATM 6130 C  C23 . 4RX C 2 .   ? 23.124  -10.050 -8.724  1.00 48.52  ? 401 4RX A C23 1 
HETATM 6131 C  C20 . 4RX C 2 .   ? 21.615  -11.968 -7.184  1.00 51.17  ? 401 4RX A C20 1 
HETATM 6132 N  N3  . 4RX C 2 .   ? 21.212  -8.985  -7.615  1.00 45.42  ? 401 4RX A N3  1 
HETATM 6133 N  N24 . 4RX C 2 .   ? 20.661  -8.428  -5.433  1.00 44.76  ? 401 4RX A N24 1 
HETATM 6134 N  N10 . 4RX C 2 .   ? 17.565  -10.629 -9.543  1.00 52.28  ? 401 4RX A N10 1 
HETATM 6135 O  O12 . 4RX C 2 .   ? 16.766  -10.997 -11.699 1.00 56.89  ? 401 4RX A O12 1 
HETATM 6136 O  O22 . 4RX C 2 .   ? 23.652  -10.664 -7.542  1.00 52.17  ? 401 4RX A O22 1 
HETATM 6137 S  S1  . 4RX C 2 .   ? 21.087  -10.992 -5.733  1.00 47.88  ? 401 4RX A S1  1 
HETATM 6138 CL CL1 . 4RX C 2 .   ? 13.309  -8.652  -7.096  1.00 56.72  ? 401 4RX A CL1 1 
HETATM 6139 C  C7  . 4RX D 2 .   ? -24.076 11.072  -20.056 1.00 45.16  ? 401 4RX B C7  1 
HETATM 6140 C  C6  . 4RX D 2 .   ? -23.560 11.749  -21.297 1.00 45.26  ? 401 4RX B C6  1 
HETATM 6141 C  C5  . 4RX D 2 .   ? -22.052 11.750  -21.337 1.00 46.60  ? 401 4RX B C5  1 
HETATM 6142 C  C4  . 4RX D 2 .   ? -21.452 10.373  -21.136 1.00 48.89  ? 401 4RX B C4  1 
HETATM 6143 C  C2  . 4RX D 2 .   ? -22.061 9.698   -23.378 1.00 43.87  ? 401 4RX B C2  1 
HETATM 6144 C  C15 . 4RX D 2 .   ? -30.120 11.523  -19.703 1.00 51.29  ? 401 4RX B C15 1 
HETATM 6145 C  C14 . 4RX D 2 .   ? -28.831 11.670  -19.240 1.00 48.10  ? 401 4RX B C14 1 
HETATM 6146 C  C16 . 4RX D 2 .   ? -30.418 10.664  -20.734 1.00 50.42  ? 401 4RX B C16 1 
HETATM 6147 C  C18 . 4RX D 2 .   ? -28.111 10.066  -20.863 1.00 51.82  ? 401 4RX B C18 1 
HETATM 6148 C  C13 . 4RX D 2 .   ? -27.825 10.941  -19.826 1.00 49.99  ? 401 4RX B C13 1 
HETATM 6149 C  C17 . 4RX D 2 .   ? -29.411 9.929   -21.315 1.00 53.36  ? 401 4RX B C17 1 
HETATM 6150 C  C11 . 4RX D 2 .   ? -26.450 11.117  -19.307 1.00 47.91  ? 401 4RX B C11 1 
HETATM 6151 C  C8  . 4RX D 2 .   ? -23.438 9.723   -19.848 1.00 45.89  ? 401 4RX B C8  1 
HETATM 6152 C  C9  . 4RX D 2 .   ? -21.937 9.810   -19.817 1.00 48.37  ? 401 4RX B C9  1 
HETATM 6153 C  C21 . 4RX D 2 .   ? -19.987 12.381  -22.542 1.00 46.71  ? 401 4RX B C21 1 
HETATM 6154 C  C23 . 4RX D 2 .   ? -19.945 10.541  -21.061 1.00 46.76  ? 401 4RX B C23 1 
HETATM 6155 C  C20 . 4RX D 2 .   ? -21.510 12.336  -22.617 1.00 46.85  ? 401 4RX B C20 1 
HETATM 6156 N  N3  . 4RX D 2 .   ? -21.811 9.358   -22.152 1.00 43.46  ? 401 4RX B N3  1 
HETATM 6157 N  N24 . 4RX D 2 .   ? -22.375 8.762   -24.320 1.00 38.29  ? 401 4RX B N24 1 
HETATM 6158 N  N10 . 4RX D 2 .   ? -25.485 10.846  -20.247 1.00 50.33  ? 401 4RX B N10 1 
HETATM 6159 O  O12 . 4RX D 2 .   ? -26.251 11.474  -18.152 1.00 47.60  ? 401 4RX B O12 1 
HETATM 6160 O  O22 . 4RX D 2 .   ? -19.419 11.109  -22.261 1.00 48.60  ? 401 4RX B O22 1 
HETATM 6161 S  S1  . 4RX D 2 .   ? -22.052 11.344  -24.039 1.00 46.73  ? 401 4RX B S1  1 
HETATM 6162 CL CL1 . 4RX D 2 .   ? -29.836 8.838   -22.593 1.00 49.39  ? 401 4RX B CL1 1 
HETATM 6163 C  C1  . GOL E 3 .   ? -9.787  -9.445  -3.175  1.00 62.43  ? 402 GOL B C1  1 
HETATM 6164 O  O1  . GOL E 3 .   ? -10.231 -10.448 -4.119  1.00 62.11  ? 402 GOL B O1  1 
HETATM 6165 C  C2  . GOL E 3 .   ? -8.315  -9.617  -2.780  1.00 63.55  ? 402 GOL B C2  1 
HETATM 6166 O  O2  . GOL E 3 .   ? -7.447  -9.821  -3.908  1.00 55.06  ? 402 GOL B O2  1 
HETATM 6167 C  C3  . GOL E 3 .   ? -7.873  -8.369  -2.026  1.00 59.74  ? 402 GOL B C3  1 
HETATM 6168 O  O3  . GOL E 3 .   ? -7.072  -8.825  -0.938  1.00 61.20  ? 402 GOL B O3  1 
HETATM 6169 C  C1  . GOL F 3 .   ? -52.676 9.582   -26.880 1.00 67.15  ? 403 GOL B C1  1 
HETATM 6170 O  O1  . GOL F 3 .   ? -53.231 10.606  -26.030 1.00 65.68  ? 403 GOL B O1  1 
HETATM 6171 C  C2  . GOL F 3 .   ? -51.175 9.815   -27.067 1.00 66.86  ? 403 GOL B C2  1 
HETATM 6172 O  O2  . GOL F 3 .   ? -50.617 10.312  -25.851 1.00 61.70  ? 403 GOL B O2  1 
HETATM 6173 C  C3  . GOL F 3 .   ? -50.505 8.493   -27.409 1.00 64.29  ? 403 GOL B C3  1 
HETATM 6174 O  O3  . GOL F 3 .   ? -50.435 8.396   -28.828 1.00 59.95  ? 403 GOL B O3  1 
HETATM 6175 O  O   . HOH G 4 .   ? 32.379  12.566  -20.425 1.00 51.17  ? 501 HOH A O   1 
HETATM 6176 O  O   . HOH G 4 .   ? -8.816  -13.151 -0.158  1.00 43.67  ? 502 HOH A O   1 
HETATM 6177 O  O   . HOH G 4 .   ? 22.461  -4.433  -0.107  1.00 41.22  ? 503 HOH A O   1 
HETATM 6178 O  O   . HOH G 4 .   ? 29.875  4.670   -12.531 1.00 38.98  ? 504 HOH A O   1 
HETATM 6179 O  O   . HOH G 4 .   ? 26.614  -18.122 18.306  1.00 49.95  ? 505 HOH A O   1 
HETATM 6180 O  O   . HOH G 4 .   ? 32.339  1.231   5.724   1.00 53.29  ? 506 HOH A O   1 
HETATM 6181 O  O   . HOH G 4 .   ? 15.337  -13.407 19.455  1.00 47.81  ? 507 HOH A O   1 
HETATM 6182 O  O   . HOH G 4 .   ? -15.361 -13.543 -0.028  1.00 52.85  ? 508 HOH A O   1 
HETATM 6183 O  O   . HOH G 4 .   ? -5.119  -11.347 -3.103  1.00 53.02  ? 509 HOH A O   1 
HETATM 6184 O  O   . HOH G 4 .   ? 31.597  -1.750  -23.900 1.00 55.73  ? 510 HOH A O   1 
HETATM 6185 O  O   . HOH G 4 .   ? 6.520   5.078   10.546  1.00 47.60  ? 511 HOH A O   1 
HETATM 6186 O  O   . HOH G 4 .   ? 14.746  11.474  8.538   1.00 47.53  ? 512 HOH A O   1 
HETATM 6187 O  O   . HOH G 4 .   ? 10.688  -22.204 16.485  1.00 53.34  ? 513 HOH A O   1 
HETATM 6188 O  O   . HOH G 4 .   ? 2.081   -1.901  -9.717  1.00 48.98  ? 514 HOH A O   1 
HETATM 6189 O  O   . HOH G 4 .   ? 3.400   -3.595  -7.836  1.00 42.86  ? 515 HOH A O   1 
HETATM 6190 O  O   . HOH G 4 .   ? -13.259 -17.772 -5.584  1.00 57.77  ? 516 HOH A O   1 
HETATM 6191 O  O   . HOH G 4 .   ? 32.209  12.966  -23.221 1.00 52.04  ? 517 HOH A O   1 
HETATM 6192 O  O   . HOH G 4 .   ? 5.785   -9.309  17.048  1.00 55.56  ? 518 HOH A O   1 
HETATM 6193 O  O   . HOH G 4 .   ? 25.436  -13.299 20.075  1.00 62.77  ? 519 HOH A O   1 
HETATM 6194 O  O   . HOH G 4 .   ? 24.886  -5.091  -10.372 1.00 40.06  ? 520 HOH A O   1 
HETATM 6195 O  O   . HOH G 4 .   ? 24.473  -0.056  22.025  1.00 58.70  ? 521 HOH A O   1 
HETATM 6196 O  O   . HOH G 4 .   ? -0.401  -10.120 -0.140  1.00 45.66  ? 522 HOH A O   1 
HETATM 6197 O  O   . HOH G 4 .   ? 27.544  5.401   3.027   1.00 57.13  ? 523 HOH A O   1 
HETATM 6198 O  O   . HOH G 4 .   ? 3.286   -2.332  -0.690  1.00 39.83  ? 524 HOH A O   1 
HETATM 6199 O  O   . HOH G 4 .   ? 22.136  -1.863  11.818  1.00 47.33  ? 525 HOH A O   1 
HETATM 6200 O  O   . HOH G 4 .   ? 28.787  -9.672  8.183   1.00 53.79  ? 526 HOH A O   1 
HETATM 6201 O  O   . HOH G 4 .   ? 21.858  12.370  4.931   1.00 45.29  ? 527 HOH A O   1 
HETATM 6202 O  O   . HOH G 4 .   ? 33.891  7.354   -6.012  1.00 59.28  ? 528 HOH A O   1 
HETATM 6203 O  O   . HOH G 4 .   ? -3.078  -9.320  8.886   1.00 43.27  ? 529 HOH A O   1 
HETATM 6204 O  O   . HOH G 4 .   ? 15.743  -4.173  28.444  1.00 67.95  ? 530 HOH A O   1 
HETATM 6205 O  O   . HOH G 4 .   ? 35.280  2.671   -7.351  1.00 55.71  ? 531 HOH A O   1 
HETATM 6206 O  O   . HOH G 4 .   ? 24.868  -8.200  9.555   1.00 44.47  ? 532 HOH A O   1 
HETATM 6207 O  O   . HOH G 4 .   ? 10.570  -2.547  -22.372 1.00 51.93  ? 533 HOH A O   1 
HETATM 6208 O  O   . HOH G 4 .   ? 5.083   10.942  9.044   1.00 65.65  ? 534 HOH A O   1 
HETATM 6209 O  O   . HOH G 4 .   ? 35.996  3.384   -15.280 1.00 52.72  ? 535 HOH A O   1 
HETATM 6210 O  O   . HOH G 4 .   ? 22.532  6.091   -29.323 1.00 53.91  ? 536 HOH A O   1 
HETATM 6211 O  O   . HOH G 4 .   ? 39.210  -8.655  -20.272 1.00 59.82  ? 537 HOH A O   1 
HETATM 6212 O  O   . HOH G 4 .   ? 10.843  5.639   -14.620 1.00 55.71  ? 538 HOH A O   1 
HETATM 6213 O  O   . HOH G 4 .   ? 4.803   -21.309 -1.387  1.00 42.73  ? 539 HOH A O   1 
HETATM 6214 O  O   . HOH G 4 .   ? 17.342  4.437   15.712  1.00 55.32  ? 540 HOH A O   1 
HETATM 6215 O  O   . HOH G 4 .   ? -2.664  -14.283 14.167  1.00 37.67  ? 541 HOH A O   1 
HETATM 6216 O  O   . HOH G 4 .   ? 12.811  7.646   -15.011 1.00 41.76  ? 542 HOH A O   1 
HETATM 6217 O  O   . HOH G 4 .   ? 26.287  -2.587  -28.474 1.00 51.79  ? 543 HOH A O   1 
HETATM 6218 O  O   . HOH G 4 .   ? 26.936  2.595   -4.957  1.00 46.56  ? 544 HOH A O   1 
HETATM 6219 O  O   . HOH G 4 .   ? 22.327  -12.250 -22.999 1.00 52.25  ? 545 HOH A O   1 
HETATM 6220 O  O   . HOH G 4 .   ? 9.332   -6.241  -13.467 1.00 51.09  ? 546 HOH A O   1 
HETATM 6221 O  O   . HOH G 4 .   ? 8.153   -15.864 -3.458  1.00 41.66  ? 547 HOH A O   1 
HETATM 6222 O  O   . HOH G 4 .   ? 32.718  -1.883  -28.422 1.00 50.02  ? 548 HOH A O   1 
HETATM 6223 O  O   . HOH G 4 .   ? 18.065  -13.257 21.087  1.00 57.04  ? 549 HOH A O   1 
HETATM 6224 O  O   . HOH G 4 .   ? 19.200  12.110  -14.246 1.00 62.45  ? 550 HOH A O   1 
HETATM 6225 O  O   . HOH G 4 .   ? 4.667   -9.072  -2.895  1.00 39.18  ? 551 HOH A O   1 
HETATM 6226 O  O   . HOH G 4 .   ? 3.378   -10.206 -0.653  1.00 38.14  ? 552 HOH A O   1 
HETATM 6227 O  O   . HOH G 4 .   ? 26.703  -18.799 5.758   1.00 68.18  ? 553 HOH A O   1 
HETATM 6228 O  O   . HOH G 4 .   ? 27.883  8.215   -3.327  1.00 46.31  ? 554 HOH A O   1 
HETATM 6229 O  O   . HOH G 4 .   ? 28.041  2.546   -13.160 1.00 55.63  ? 555 HOH A O   1 
HETATM 6230 O  O   . HOH G 4 .   ? 22.558  -11.880 3.204   1.00 55.69  ? 556 HOH A O   1 
HETATM 6231 O  O   . HOH G 4 .   ? 6.810   0.817   0.117   1.00 38.75  ? 557 HOH A O   1 
HETATM 6232 O  O   . HOH G 4 .   ? -9.974  -17.390 12.778  1.00 44.89  ? 558 HOH A O   1 
HETATM 6233 O  O   . HOH G 4 .   ? 35.521  3.157   -12.384 1.00 54.65  ? 559 HOH A O   1 
HETATM 6234 O  O   . HOH G 4 .   ? 22.013  -20.206 -1.315  1.00 64.99  ? 560 HOH A O   1 
HETATM 6235 O  O   . HOH G 4 .   ? -9.465  -0.303  10.573  1.00 57.49  ? 561 HOH A O   1 
HETATM 6236 O  O   . HOH G 4 .   ? -0.143  -24.176 9.553   1.00 53.67  ? 562 HOH A O   1 
HETATM 6237 O  O   . HOH G 4 .   ? -10.893 -12.746 -6.257  1.00 59.00  ? 563 HOH A O   1 
HETATM 6238 O  O   . HOH G 4 .   ? 25.464  2.770   -7.425  1.00 46.58  ? 564 HOH A O   1 
HETATM 6239 O  O   . HOH G 4 .   ? 26.435  0.579   -10.297 1.00 46.14  ? 565 HOH A O   1 
HETATM 6240 O  O   . HOH G 4 .   ? 40.601  -1.039  -18.850 1.00 60.66  ? 566 HOH A O   1 
HETATM 6241 O  O   . HOH G 4 .   ? 30.549  -0.557  -10.691 1.00 53.19  ? 567 HOH A O   1 
HETATM 6242 O  O   . HOH G 4 .   ? 35.081  7.658   -19.494 1.00 52.02  ? 568 HOH A O   1 
HETATM 6243 O  O   . HOH G 4 .   ? -10.154 -12.229 3.797   1.00 56.59  ? 569 HOH A O   1 
HETATM 6244 O  O   . HOH G 4 .   ? 3.953   -1.570  -12.308 1.00 51.47  ? 570 HOH A O   1 
HETATM 6245 O  O   . HOH G 4 .   ? 10.619  -21.643 1.598   1.00 49.20  ? 571 HOH A O   1 
HETATM 6246 O  O   . HOH G 4 .   ? 10.471  0.036   -0.054  1.00 45.79  ? 572 HOH A O   1 
HETATM 6247 O  O   . HOH G 4 .   ? 29.730  -1.016  -22.126 1.00 54.60  ? 573 HOH A O   1 
HETATM 6248 O  O   . HOH G 4 .   ? 5.104   -26.310 14.323  1.00 47.64  ? 574 HOH A O   1 
HETATM 6249 O  O   . HOH G 4 .   ? 16.623  -9.168  -28.554 1.00 54.24  ? 575 HOH A O   1 
HETATM 6250 O  O   . HOH G 4 .   ? 12.475  -14.873 25.636  1.00 52.97  ? 576 HOH A O   1 
HETATM 6251 O  O   . HOH G 4 .   ? 18.085  4.295   18.730  1.00 55.66  ? 577 HOH A O   1 
HETATM 6252 O  O   . HOH G 4 .   ? 2.087   5.065   10.739  1.00 51.07  ? 578 HOH A O   1 
HETATM 6253 O  O   . HOH G 4 .   ? 26.680  -10.190 10.815  1.00 52.22  ? 579 HOH A O   1 
HETATM 6254 O  O   . HOH G 4 .   ? 13.613  -4.530  -7.777  1.00 52.81  ? 580 HOH A O   1 
HETATM 6255 O  O   . HOH G 4 .   ? 9.433   2.411   -14.010 1.00 53.03  ? 581 HOH A O   1 
HETATM 6256 O  O   . HOH G 4 .   ? 30.887  -6.511  8.127   1.00 57.40  ? 582 HOH A O   1 
HETATM 6257 O  O   . HOH G 4 .   ? 10.424  2.622   -21.118 1.00 52.49  ? 583 HOH A O   1 
HETATM 6258 O  O   . HOH G 4 .   ? 32.836  10.046  -11.238 1.00 56.26  ? 584 HOH A O   1 
HETATM 6259 O  O   . HOH G 4 .   ? 27.698  2.745   10.906  1.00 51.47  ? 585 HOH A O   1 
HETATM 6260 O  O   . HOH G 4 .   ? -3.095  -9.491  -0.285  1.00 47.22  ? 586 HOH A O   1 
HETATM 6261 O  O   . HOH G 4 .   ? 28.054  -6.275  -8.231  1.00 42.73  ? 587 HOH A O   1 
HETATM 6262 O  O   . HOH G 4 .   ? 4.447   -7.450  -5.633  1.00 38.62  ? 588 HOH A O   1 
HETATM 6263 O  O   . HOH G 4 .   ? 30.196  -13.554 -8.685  1.00 68.45  ? 589 HOH A O   1 
HETATM 6264 O  O   . HOH G 4 .   ? 32.347  0.177   9.196   1.00 58.82  ? 590 HOH A O   1 
HETATM 6265 O  O   . HOH G 4 .   ? -1.653  -16.772 14.224  1.00 40.80  ? 591 HOH A O   1 
HETATM 6266 O  O   . HOH G 4 .   ? 8.513   -17.932 18.079  1.00 51.38  ? 592 HOH A O   1 
HETATM 6267 O  O   . HOH G 4 .   ? 24.671  7.032   21.781  1.00 62.66  ? 593 HOH A O   1 
HETATM 6268 O  O   . HOH G 4 .   ? -0.511  -1.021  -2.665  1.00 52.60  ? 594 HOH A O   1 
HETATM 6269 O  O   . HOH G 4 .   ? 6.243   -9.788  23.247  1.00 58.45  ? 595 HOH A O   1 
HETATM 6270 O  O   . HOH G 4 .   ? 24.260  5.108   13.352  1.00 60.16  ? 596 HOH A O   1 
HETATM 6271 O  O   . HOH G 4 .   ? 2.588   -7.277  -0.315  1.00 55.93  ? 597 HOH A O   1 
HETATM 6272 O  O   . HOH G 4 .   ? 16.010  2.278   -26.803 1.00 50.80  ? 598 HOH A O   1 
HETATM 6273 O  O   . HOH G 4 .   ? 36.012  3.884   -27.303 1.00 49.04  ? 599 HOH A O   1 
HETATM 6274 O  O   . HOH G 4 .   ? 23.351  -18.095 6.211   1.00 51.42  ? 600 HOH A O   1 
HETATM 6275 O  O   . HOH G 4 .   ? 8.263   -18.419 -2.822  1.00 49.33  ? 601 HOH A O   1 
HETATM 6276 O  O   . HOH G 4 .   ? 13.890  -25.158 2.834   1.00 53.33  ? 602 HOH A O   1 
HETATM 6277 O  O   . HOH G 4 .   ? 16.316  6.531   14.591  1.00 44.25  ? 603 HOH A O   1 
HETATM 6278 O  O   . HOH G 4 .   ? 5.052   -11.161 -7.741  1.00 47.08  ? 604 HOH A O   1 
HETATM 6279 O  O   . HOH G 4 .   ? 0.567   -26.645 11.111  1.00 51.90  ? 605 HOH A O   1 
HETATM 6280 O  O   . HOH G 4 .   ? 25.487  9.139   -32.425 1.00 62.86  ? 606 HOH A O   1 
HETATM 6281 O  O   . HOH G 4 .   ? -6.581  -10.080 10.086  1.00 48.95  ? 607 HOH A O   1 
HETATM 6282 O  O   . HOH G 4 .   ? -4.539  -2.865  2.027   1.00 52.21  ? 608 HOH A O   1 
HETATM 6283 O  O   . HOH G 4 .   ? 21.803  -20.987 10.038  1.00 55.75  ? 609 HOH A O   1 
HETATM 6284 O  O   . HOH G 4 .   ? -4.222  -21.193 13.621  1.00 50.56  ? 610 HOH A O   1 
HETATM 6285 O  O   . HOH G 4 .   ? 1.378   -8.531  -8.036  1.00 46.49  ? 611 HOH A O   1 
HETATM 6286 O  O   . HOH G 4 .   ? 31.147  3.125   -3.258  1.00 49.61  ? 612 HOH A O   1 
HETATM 6287 O  O   . HOH G 4 .   ? 1.308   -0.819  -7.053  1.00 51.33  ? 613 HOH A O   1 
HETATM 6288 O  O   . HOH G 4 .   ? 2.412   -4.715  0.933   1.00 47.26  ? 614 HOH A O   1 
HETATM 6289 O  O   . HOH G 4 .   ? 10.378  -26.069 10.539  1.00 62.14  ? 615 HOH A O   1 
HETATM 6290 O  O   . HOH G 4 .   ? 28.568  6.637   0.295   1.00 47.66  ? 616 HOH A O   1 
HETATM 6291 O  O   . HOH G 4 .   ? 35.239  -3.836  -23.310 1.00 59.49  ? 617 HOH A O   1 
HETATM 6292 O  O   . HOH G 4 .   ? 26.761  15.772  -4.527  1.00 70.36  ? 618 HOH A O   1 
HETATM 6293 O  O   . HOH G 4 .   ? 4.118   -17.377 17.772  1.00 44.80  ? 619 HOH A O   1 
HETATM 6294 O  O   . HOH G 4 .   ? 30.548  7.520   4.039   1.00 54.56  ? 620 HOH A O   1 
HETATM 6295 O  O   . HOH G 4 .   ? 28.016  -15.141 2.089   1.00 71.78  ? 621 HOH A O   1 
HETATM 6296 O  O   . HOH G 4 .   ? 7.731   10.335  -12.209 1.00 59.36  ? 622 HOH A O   1 
HETATM 6297 O  O   . HOH G 4 .   ? 30.357  -11.307 -1.432  1.00 55.82  ? 623 HOH A O   1 
HETATM 6298 O  O   . HOH G 4 .   ? -5.882  -7.650  3.232   1.00 34.35  ? 624 HOH A O   1 
HETATM 6299 O  O   . HOH G 4 .   ? 2.732   -4.302  20.665  1.00 56.86  ? 625 HOH A O   1 
HETATM 6300 O  O   . HOH G 4 .   ? 17.983  11.437  12.972  1.00 63.61  ? 626 HOH A O   1 
HETATM 6301 O  O   . HOH G 4 .   ? 7.436   -28.267 5.562   1.00 66.70  ? 627 HOH A O   1 
HETATM 6302 O  O   . HOH G 4 .   ? 15.209  4.874   -27.259 1.00 47.98  ? 628 HOH A O   1 
HETATM 6303 O  O   . HOH G 4 .   ? 29.115  -2.047  -14.343 1.00 39.91  ? 629 HOH A O   1 
HETATM 6304 O  O   . HOH G 4 .   ? 30.763  -9.276  -6.034  1.00 56.93  ? 630 HOH A O   1 
HETATM 6305 O  O   . HOH G 4 .   ? 1.436   -7.699  -3.162  1.00 53.80  ? 631 HOH A O   1 
HETATM 6306 O  O   . HOH G 4 .   ? 2.790   -10.225 -6.299  1.00 56.74  ? 632 HOH A O   1 
HETATM 6307 O  O   . HOH G 4 .   ? 2.185   -11.941 -9.367  1.00 58.66  ? 633 HOH A O   1 
HETATM 6308 O  O   . HOH G 4 .   ? 3.697   -19.920 17.118  1.00 51.65  ? 634 HOH A O   1 
HETATM 6309 O  O   . HOH G 4 .   ? 41.053  0.043   -5.656  1.00 66.85  ? 635 HOH A O   1 
HETATM 6310 O  O   . HOH G 4 .   ? 19.986  -8.971  21.453  1.00 65.14  ? 636 HOH A O   1 
HETATM 6311 O  O   . HOH G 4 .   ? 2.941   -32.339 2.268   1.00 58.15  ? 637 HOH A O   1 
HETATM 6312 O  O   . HOH G 4 .   ? 2.416   6.944   -1.495  1.00 59.86  ? 638 HOH A O   1 
HETATM 6313 O  O   . HOH G 4 .   ? 12.851  -7.370  -21.229 1.00 61.27  ? 639 HOH A O   1 
HETATM 6314 O  O   . HOH G 4 .   ? 3.961   1.837   13.439  1.00 46.04  ? 640 HOH A O   1 
HETATM 6315 O  O   . HOH G 4 .   ? 22.336  -9.561  -23.911 1.00 52.93  ? 641 HOH A O   1 
HETATM 6316 O  O   . HOH G 4 .   ? 22.698  -12.770 -29.770 1.00 63.34  ? 642 HOH A O   1 
HETATM 6317 O  O   . HOH G 4 .   ? 0.037   -16.549 18.005  1.00 43.56  ? 643 HOH A O   1 
HETATM 6318 O  O   . HOH G 4 .   ? 3.223   1.897   16.322  1.00 50.06  ? 644 HOH A O   1 
HETATM 6319 O  O   . HOH G 4 .   ? 28.340  -3.865  14.911  1.00 68.30  ? 645 HOH A O   1 
HETATM 6320 O  O   . HOH G 4 .   ? -3.842  -13.213 -5.109  1.00 55.42  ? 646 HOH A O   1 
HETATM 6321 O  O   . HOH G 4 .   ? 2.552   -6.180  -7.152  1.00 37.70  ? 647 HOH A O   1 
HETATM 6322 O  O   . HOH G 4 .   ? -1.310  1.804   3.340   1.00 57.05  ? 648 HOH A O   1 
HETATM 6323 O  O   . HOH G 4 .   ? 22.832  -12.494 0.446   1.00 46.06  ? 649 HOH A O   1 
HETATM 6324 O  O   . HOH G 4 .   ? 17.288  -2.368  -29.424 1.00 52.81  ? 650 HOH A O   1 
HETATM 6325 O  O   . HOH G 4 .   ? 8.473   -18.476 -5.983  1.00 64.31  ? 651 HOH A O   1 
HETATM 6326 O  O   . HOH G 4 .   ? 15.789  -10.291 22.857  1.00 56.44  ? 652 HOH A O   1 
HETATM 6327 O  O   . HOH G 4 .   ? 5.622   6.166   14.372  1.00 59.42  ? 653 HOH A O   1 
HETATM 6328 O  O   . HOH G 4 .   ? 30.406  5.796   -1.229  1.00 58.66  ? 654 HOH A O   1 
HETATM 6329 O  O   . HOH G 4 .   ? -5.821  -4.154  -21.046 1.00 54.50  ? 655 HOH A O   1 
HETATM 6330 O  O   . HOH G 4 .   ? 5.879   -7.857  21.425  1.00 46.29  ? 656 HOH A O   1 
HETATM 6331 O  O   . HOH G 4 .   ? 28.848  0.190   -12.774 1.00 43.64  ? 657 HOH A O   1 
HETATM 6332 O  O   . HOH G 4 .   ? 24.151  -2.597  22.598  1.00 55.16  ? 658 HOH A O   1 
HETATM 6333 O  O   . HOH G 4 .   ? 29.432  -12.767 1.973   1.00 67.71  ? 659 HOH A O   1 
HETATM 6334 O  O   . HOH G 4 .   ? 18.995  14.541  12.559  1.00 60.00  ? 660 HOH A O   1 
HETATM 6335 O  O   . HOH G 4 .   ? 29.472  1.629   -22.468 1.00 63.91  ? 661 HOH A O   1 
HETATM 6336 O  O   . HOH G 4 .   ? 1.285   1.926   11.508  1.00 63.21  ? 662 HOH A O   1 
HETATM 6337 O  O   . HOH G 4 .   ? 5.424   -22.843 -9.532  1.00 55.74  ? 663 HOH A O   1 
HETATM 6338 O  O   . HOH G 4 .   ? 0.612   -26.323 7.940   1.00 58.54  ? 664 HOH A O   1 
HETATM 6339 O  O   . HOH G 4 .   ? 13.233  -22.540 1.708   1.00 45.01  ? 665 HOH A O   1 
HETATM 6340 O  O   . HOH G 4 .   ? 27.102  6.715   -33.622 1.00 52.90  ? 666 HOH A O   1 
HETATM 6341 O  O   . HOH G 4 .   ? 32.973  0.365   -0.980  1.00 55.98  ? 667 HOH A O   1 
HETATM 6342 O  O   . HOH G 4 .   ? 10.147  11.073  11.007  1.00 56.57  ? 668 HOH A O   1 
HETATM 6343 O  O   . HOH G 4 .   ? 37.290  4.847   -9.850  1.00 63.60  ? 669 HOH A O   1 
HETATM 6344 O  O   . HOH G 4 .   ? 27.002  -11.015 -28.126 1.00 63.52  ? 670 HOH A O   1 
HETATM 6345 O  O   . HOH G 4 .   ? 7.089   3.923   18.337  1.00 47.35  ? 671 HOH A O   1 
HETATM 6346 O  O   . HOH G 4 .   ? 13.791  -15.061 -3.309  1.00 48.78  ? 672 HOH A O   1 
HETATM 6347 O  O   . HOH G 4 .   ? 11.367  6.249   -25.053 1.00 58.56  ? 673 HOH A O   1 
HETATM 6348 O  O   . HOH G 4 .   ? -5.887  -7.808  14.678  1.00 43.52  ? 674 HOH A O   1 
HETATM 6349 O  O   . HOH G 4 .   ? -2.320  3.521   -0.930  1.00 58.17  ? 675 HOH A O   1 
HETATM 6350 O  O   . HOH G 4 .   ? 30.853  8.893   -4.464  1.00 64.81  ? 676 HOH A O   1 
HETATM 6351 O  O   . HOH G 4 .   ? 17.872  15.622  -6.403  1.00 65.77  ? 677 HOH A O   1 
HETATM 6352 O  O   . HOH G 4 .   ? 18.469  -6.566  26.322  1.00 68.07  ? 678 HOH A O   1 
HETATM 6353 O  O   . HOH G 4 .   ? 22.843  -20.670 7.494   1.00 54.96  ? 679 HOH A O   1 
HETATM 6354 O  O   . HOH G 4 .   ? 5.501   -21.663 18.745  1.00 60.30  ? 680 HOH A O   1 
HETATM 6355 O  O   . HOH G 4 .   ? 18.982  -21.932 -0.462  1.00 67.41  ? 681 HOH A O   1 
HETATM 6356 O  O   . HOH G 4 .   ? 23.775  -15.985 -24.170 1.00 57.20  ? 682 HOH A O   1 
HETATM 6357 O  O   . HOH G 4 .   ? 32.717  -2.738  9.856   1.00 54.42  ? 683 HOH A O   1 
HETATM 6358 O  O   . HOH G 4 .   ? 20.962  -20.265 18.787  1.00 67.94  ? 684 HOH A O   1 
HETATM 6359 O  O   . HOH G 4 .   ? -1.224  -10.108 15.633  1.00 64.64  ? 685 HOH A O   1 
HETATM 6360 O  O   . HOH G 4 .   ? -1.451  -20.672 17.501  1.00 63.17  ? 686 HOH A O   1 
HETATM 6361 O  O   . HOH G 4 .   ? -9.293  -26.638 12.549  1.00 66.98  ? 687 HOH A O   1 
HETATM 6362 O  O   . HOH G 4 .   ? 19.129  2.261   -30.323 1.00 59.75  ? 688 HOH A O   1 
HETATM 6363 O  O   . HOH G 4 .   ? -11.017 -13.282 6.287   1.00 46.01  ? 689 HOH A O   1 
HETATM 6364 O  O   . HOH G 4 .   ? 6.955   -31.494 7.730   1.00 61.61  ? 690 HOH A O   1 
HETATM 6365 O  O   . HOH G 4 .   ? 27.940  -4.180  -30.695 1.00 67.54  ? 691 HOH A O   1 
HETATM 6366 O  O   . HOH G 4 .   ? 16.711  9.805   -29.128 1.00 62.74  ? 692 HOH A O   1 
HETATM 6367 O  O   . HOH G 4 .   ? -3.298  -22.392 16.227  1.00 62.00  ? 693 HOH A O   1 
HETATM 6368 O  O   . HOH G 4 .   ? 1.973   10.735  9.904   1.00 49.27  ? 694 HOH A O   1 
HETATM 6369 O  O   . HOH G 4 .   ? 42.937  -4.782  -27.916 1.00 59.45  ? 695 HOH A O   1 
HETATM 6370 O  O   . HOH G 4 .   ? -8.743  -11.803 8.457   1.00 47.32  ? 696 HOH A O   1 
HETATM 6371 O  O   . HOH G 4 .   ? 29.671  18.970  -8.145  1.00 64.29  ? 697 HOH A O   1 
HETATM 6372 O  O   . HOH G 4 .   ? 14.862  -13.482 -6.497  1.00 46.37  ? 698 HOH A O   1 
HETATM 6373 O  O   . HOH G 4 .   ? 9.327   -19.783 19.768  1.00 47.82  ? 699 HOH A O   1 
HETATM 6374 O  O   . HOH G 4 .   ? 29.579  6.494   -33.695 1.00 60.69  ? 700 HOH A O   1 
HETATM 6375 O  O   . HOH G 4 .   ? 35.801  -6.381  -23.707 1.00 63.75  ? 701 HOH A O   1 
HETATM 6376 O  O   . HOH G 4 .   ? 25.405  -7.638  -10.699 1.00 49.04  ? 702 HOH A O   1 
HETATM 6377 O  O   . HOH G 4 .   ? 21.668  -11.862 -1.924  1.00 56.42  ? 703 HOH A O   1 
HETATM 6378 O  O   . HOH G 4 .   ? 1.370   -3.294  18.194  1.00 51.72  ? 704 HOH A O   1 
HETATM 6379 O  O   . HOH G 4 .   ? 20.197  5.063   -30.881 1.00 52.67  ? 705 HOH A O   1 
HETATM 6380 O  O   . HOH G 4 .   ? 2.291   -27.100 13.575  1.00 51.33  ? 706 HOH A O   1 
HETATM 6381 O  O   . HOH G 4 .   ? 25.869  3.795   15.944  1.00 64.37  ? 707 HOH A O   1 
HETATM 6382 O  O   . HOH G 4 .   ? 32.344  -5.409  9.974   1.00 49.49  ? 708 HOH A O   1 
HETATM 6383 O  O   . HOH G 4 .   ? 33.681  4.384   -5.703  1.00 54.73  ? 709 HOH A O   1 
HETATM 6384 O  O   . HOH G 4 .   ? 11.921  -20.322 -2.679  1.00 69.22  ? 710 HOH A O   1 
HETATM 6385 O  O   . HOH G 4 .   ? 11.242  -21.942 -5.073  1.00 73.70  ? 711 HOH A O   1 
HETATM 6386 O  O   . HOH G 4 .   ? 30.884  -0.924  -30.349 1.00 52.93  ? 712 HOH A O   1 
HETATM 6387 O  O   . HOH G 4 .   ? 29.694  12.037  -1.220  1.00 54.93  ? 713 HOH A O   1 
HETATM 6388 O  O   . HOH G 4 .   ? 12.816  13.888  7.799   1.00 60.31  ? 714 HOH A O   1 
HETATM 6389 O  O   . HOH G 4 .   ? 4.383   4.291   12.364  1.00 44.86  ? 715 HOH A O   1 
HETATM 6390 O  O   . HOH G 4 .   ? 32.247  4.701   0.416   1.00 65.19  ? 716 HOH A O   1 
HETATM 6391 O  O   . HOH G 4 .   ? 30.059  10.093  3.190   1.00 62.57  ? 717 HOH A O   1 
HETATM 6392 O  O   . HOH G 4 .   ? -3.765  1.674   -13.657 1.00 56.89  ? 718 HOH A O   1 
HETATM 6393 O  O   . HOH G 4 .   ? 37.811  -2.174  0.862   1.00 62.62  ? 719 HOH A O   1 
HETATM 6394 O  O   . HOH G 4 .   ? 20.519  -16.956 23.816  1.00 65.91  ? 720 HOH A O   1 
HETATM 6395 O  O   . HOH G 4 .   ? 3.479   -7.146  20.292  1.00 45.83  ? 721 HOH A O   1 
HETATM 6396 O  O   . HOH G 4 .   ? 26.984  -8.695  -8.717  1.00 54.03  ? 722 HOH A O   1 
HETATM 6397 O  O   . HOH G 4 .   ? 28.095  19.247  -3.663  1.00 68.40  ? 723 HOH A O   1 
HETATM 6398 O  O   . HOH G 4 .   ? 39.766  2.373   -6.607  1.00 59.39  ? 724 HOH A O   1 
HETATM 6399 O  O   . HOH G 4 .   ? -8.568  -7.602  3.820   1.00 54.80  ? 725 HOH A O   1 
HETATM 6400 O  O   . HOH G 4 .   ? 3.385   -7.621  17.515  1.00 50.80  ? 726 HOH A O   1 
HETATM 6401 O  O   . HOH G 4 .   ? -1.794  6.512   9.618   1.00 57.80  ? 727 HOH A O   1 
HETATM 6402 O  O   . HOH G 4 .   ? 36.781  2.821   -3.634  1.00 64.43  ? 728 HOH A O   1 
HETATM 6403 O  O   . HOH G 4 .   ? 15.891  -2.154  -31.414 1.00 56.91  ? 729 HOH A O   1 
HETATM 6404 O  O   . HOH G 4 .   ? 6.986   0.795   21.809  1.00 60.89  ? 730 HOH A O   1 
HETATM 6405 O  O   . HOH G 4 .   ? 1.616   -28.686 8.741   1.00 55.87  ? 731 HOH A O   1 
HETATM 6406 O  O   . HOH G 4 .   ? 6.554   -28.446 12.600  1.00 56.82  ? 732 HOH A O   1 
HETATM 6407 O  O   . HOH G 4 .   ? -13.101 -9.022  3.709   1.00 58.58  ? 733 HOH A O   1 
HETATM 6408 O  O   . HOH G 4 .   ? 20.401  6.413   -33.133 1.00 54.19  ? 734 HOH A O   1 
HETATM 6409 O  O   . HOH G 4 .   ? -10.080 -8.911  7.521   1.00 65.27  ? 735 HOH A O   1 
HETATM 6410 O  O   . HOH G 4 .   ? 33.583  3.363   -1.800  1.00 65.24  ? 736 HOH A O   1 
HETATM 6411 O  O   . HOH G 4 .   ? 23.449  14.515  5.873   1.00 53.44  ? 737 HOH A O   1 
HETATM 6412 O  O   . HOH G 4 .   ? 27.600  13.628  1.994   1.00 56.43  ? 738 HOH A O   1 
HETATM 6413 O  O   . HOH G 4 .   ? 27.554  -6.246  -33.260 1.00 60.15  ? 739 HOH A O   1 
HETATM 6414 O  O   . HOH H 4 .   ? -24.204 -7.753  -44.319 1.00 51.40  ? 501 HOH B O   1 
HETATM 6415 O  O   . HOH H 4 .   ? -27.627 -7.172  -50.161 1.00 60.97  ? 502 HOH B O   1 
HETATM 6416 O  O   . HOH H 4 .   ? -10.525 -12.322 -9.206  1.00 56.17  ? 503 HOH B O   1 
HETATM 6417 O  O   . HOH H 4 .   ? -15.288 -1.858  -40.615 1.00 53.20  ? 504 HOH B O   1 
HETATM 6418 O  O   . HOH H 4 .   ? -41.037 -9.546  -18.904 1.00 63.15  ? 505 HOH B O   1 
HETATM 6419 O  O   . HOH H 4 .   ? -27.652 13.214  -49.086 1.00 41.68  ? 506 HOH B O   1 
HETATM 6420 O  O   . HOH H 4 .   ? -43.400 10.328  -29.798 1.00 45.69  ? 507 HOH B O   1 
HETATM 6421 O  O   . HOH H 4 .   ? -13.084 -4.432  -17.171 1.00 41.12  ? 508 HOH B O   1 
HETATM 6422 O  O   . HOH H 4 .   ? -0.733  -0.725  -5.348  1.00 57.23  ? 509 HOH B O   1 
HETATM 6423 O  O   . HOH H 4 .   ? -11.431 1.965   -5.549  1.00 51.94  ? 510 HOH B O   1 
HETATM 6424 O  O   . HOH H 4 .   ? -16.419 -4.516  -40.735 1.00 44.90  ? 511 HOH B O   1 
HETATM 6425 O  O   . HOH H 4 .   ? -36.121 -0.676  -30.007 1.00 33.15  ? 512 HOH B O   1 
HETATM 6426 O  O   . HOH H 4 .   ? -36.426 -4.834  -40.305 1.00 47.40  ? 513 HOH B O   1 
HETATM 6427 O  O   . HOH H 4 .   ? -17.931 5.719   -19.319 1.00 37.97  ? 514 HOH B O   1 
HETATM 6428 O  O   . HOH H 4 .   ? -8.438  6.891   -23.958 1.00 50.00  ? 515 HOH B O   1 
HETATM 6429 O  O   . HOH H 4 .   ? -44.946 16.866  -43.964 1.00 45.43  ? 516 HOH B O   1 
HETATM 6430 O  O   . HOH H 4 .   ? -32.383 22.807  -46.114 1.00 60.45  ? 517 HOH B O   1 
HETATM 6431 O  O   . HOH H 4 .   ? -51.934 13.294  -29.565 1.00 47.30  ? 518 HOH B O   1 
HETATM 6432 O  O   . HOH H 4 .   ? -15.395 -4.709  -32.980 1.00 49.42  ? 519 HOH B O   1 
HETATM 6433 O  O   . HOH H 4 .   ? -56.133 18.021  -24.048 1.00 58.44  ? 520 HOH B O   1 
HETATM 6434 O  O   . HOH H 4 .   ? -17.553 8.328   -18.912 1.00 47.95  ? 521 HOH B O   1 
HETATM 6435 O  O   . HOH H 4 .   ? -20.786 2.444   -41.495 1.00 38.67  ? 522 HOH B O   1 
HETATM 6436 O  O   . HOH H 4 .   ? -39.238 20.112  -46.763 1.00 46.01  ? 523 HOH B O   1 
HETATM 6437 O  O   . HOH H 4 .   ? -38.397 9.271   -26.618 1.00 43.50  ? 524 HOH B O   1 
HETATM 6438 O  O   . HOH H 4 .   ? -42.439 26.533  -37.117 1.00 55.94  ? 525 HOH B O   1 
HETATM 6439 O  O   . HOH H 4 .   ? -55.542 0.840   -39.603 1.00 48.51  ? 526 HOH B O   1 
HETATM 6440 O  O   . HOH H 4 .   ? -20.454 4.908   -29.781 1.00 48.96  ? 527 HOH B O   1 
HETATM 6441 O  O   . HOH H 4 .   ? -45.763 14.137  -43.828 1.00 34.76  ? 528 HOH B O   1 
HETATM 6442 O  O   . HOH H 4 .   ? -5.390  9.423   -13.816 1.00 61.77  ? 529 HOH B O   1 
HETATM 6443 O  O   . HOH H 4 .   ? -29.924 -7.330  -14.440 1.00 55.50  ? 530 HOH B O   1 
HETATM 6444 O  O   . HOH H 4 .   ? -26.207 26.641  -43.207 1.00 62.19  ? 531 HOH B O   1 
HETATM 6445 O  O   . HOH H 4 .   ? -39.157 1.927   -17.397 1.00 51.91  ? 532 HOH B O   1 
HETATM 6446 O  O   . HOH H 4 .   ? -34.898 16.149  -26.251 1.00 46.97  ? 533 HOH B O   1 
HETATM 6447 O  O   . HOH H 4 .   ? -16.070 -2.344  -24.807 1.00 41.67  ? 534 HOH B O   1 
HETATM 6448 O  O   . HOH H 4 .   ? -37.925 26.322  -43.714 1.00 50.73  ? 535 HOH B O   1 
HETATM 6449 O  O   . HOH H 4 .   ? -37.131 9.271   -47.018 1.00 44.13  ? 536 HOH B O   1 
HETATM 6450 O  O   . HOH H 4 .   ? -7.644  -2.072  -22.558 1.00 59.13  ? 537 HOH B O   1 
HETATM 6451 O  O   . HOH H 4 .   ? -44.287 -1.092  -32.849 1.00 51.21  ? 538 HOH B O   1 
HETATM 6452 O  O   . HOH H 4 .   ? -32.751 -2.451  -8.907  1.00 57.90  ? 539 HOH B O   1 
HETATM 6453 O  O   . HOH H 4 .   ? -29.470 5.116   -22.126 1.00 46.66  ? 540 HOH B O   1 
HETATM 6454 O  O   . HOH H 4 .   ? -36.155 -0.490  -11.358 1.00 63.56  ? 541 HOH B O   1 
HETATM 6455 O  O   . HOH H 4 .   ? -7.091  -3.431  -14.324 1.00 46.40  ? 542 HOH B O   1 
HETATM 6456 O  O   . HOH H 4 .   ? -48.277 8.155   -30.346 1.00 38.62  ? 543 HOH B O   1 
HETATM 6457 O  O   . HOH H 4 .   ? -46.066 9.219   -38.315 1.00 43.76  ? 544 HOH B O   1 
HETATM 6458 O  O   . HOH H 4 .   ? -33.874 6.901   -16.246 1.00 52.87  ? 545 HOH B O   1 
HETATM 6459 O  O   . HOH H 4 .   ? -25.389 -4.156  -45.550 1.00 44.51  ? 546 HOH B O   1 
HETATM 6460 O  O   . HOH H 4 .   ? -20.452 -5.940  -0.608  1.00 53.46  ? 547 HOH B O   1 
HETATM 6461 O  O   . HOH H 4 .   ? -39.723 2.374   -29.028 1.00 46.25  ? 548 HOH B O   1 
HETATM 6462 O  O   . HOH H 4 .   ? -6.314  4.289   -2.690  1.00 55.87  ? 549 HOH B O   1 
HETATM 6463 O  O   . HOH H 4 .   ? -12.898 11.589  -28.163 1.00 57.54  ? 550 HOH B O   1 
HETATM 6464 O  O   . HOH H 4 .   ? -32.051 2.808   -7.456  1.00 59.07  ? 551 HOH B O   1 
HETATM 6465 O  O   . HOH H 4 .   ? -26.631 24.022  -44.286 1.00 55.38  ? 552 HOH B O   1 
HETATM 6466 O  O   . HOH H 4 .   ? -17.933 8.648   -39.356 1.00 42.93  ? 553 HOH B O   1 
HETATM 6467 O  O   . HOH H 4 .   ? -8.156  -10.711 0.628   1.00 43.71  ? 554 HOH B O   1 
HETATM 6468 O  O   . HOH H 4 .   ? -56.050 19.820  -20.648 1.00 70.28  ? 555 HOH B O   1 
HETATM 6469 O  O   . HOH H 4 .   ? -24.807 -4.041  -48.305 1.00 46.05  ? 556 HOH B O   1 
HETATM 6470 O  O   . HOH H 4 .   ? -7.847  -7.167  -10.300 1.00 46.33  ? 557 HOH B O   1 
HETATM 6471 O  O   . HOH H 4 .   ? -52.898 17.363  -42.433 1.00 38.03  ? 558 HOH B O   1 
HETATM 6472 O  O   . HOH H 4 .   ? -19.691 18.381  -35.956 1.00 61.45  ? 559 HOH B O   1 
HETATM 6473 O  O   . HOH H 4 .   ? -37.559 -11.030 -39.077 1.00 58.32  ? 560 HOH B O   1 
HETATM 6474 O  O   . HOH H 4 .   ? -10.396 -0.653  -35.568 1.00 53.73  ? 561 HOH B O   1 
HETATM 6475 O  O   . HOH H 4 .   ? -15.884 -15.158 -25.540 1.00 60.05  ? 562 HOH B O   1 
HETATM 6476 O  O   . HOH H 4 .   ? -20.557 12.238  -6.326  1.00 65.16  ? 563 HOH B O   1 
HETATM 6477 O  O   . HOH H 4 .   ? -11.908 -2.465  -26.124 1.00 44.10  ? 564 HOH B O   1 
HETATM 6478 O  O   . HOH H 4 .   ? -9.180  -6.447  -23.686 1.00 56.51  ? 565 HOH B O   1 
HETATM 6479 O  O   . HOH H 4 .   ? -26.890 13.469  -53.135 1.00 48.83  ? 566 HOH B O   1 
HETATM 6480 O  O   . HOH H 4 .   ? -40.688 2.404   -19.813 1.00 55.68  ? 567 HOH B O   1 
HETATM 6481 O  O   . HOH H 4 .   ? -27.744 -4.106  -2.736  1.00 51.24  ? 568 HOH B O   1 
HETATM 6482 O  O   . HOH H 4 .   ? -41.405 -0.900  -42.023 1.00 55.22  ? 569 HOH B O   1 
HETATM 6483 O  O   . HOH H 4 .   ? -37.036 4.139   -14.001 1.00 52.41  ? 570 HOH B O   1 
HETATM 6484 O  O   . HOH H 4 .   ? -26.834 -1.447  -3.154  1.00 49.20  ? 571 HOH B O   1 
HETATM 6485 O  O   . HOH H 4 .   ? -16.715 4.001   1.289   1.00 62.17  ? 572 HOH B O   1 
HETATM 6486 O  O   . HOH H 4 .   ? -38.304 21.528  -28.305 1.00 55.99  ? 573 HOH B O   1 
HETATM 6487 O  O   . HOH H 4 .   ? -32.483 21.920  -31.497 1.00 51.33  ? 574 HOH B O   1 
HETATM 6488 O  O   . HOH H 4 .   ? -14.819 -8.199  -26.749 1.00 51.21  ? 575 HOH B O   1 
HETATM 6489 O  O   . HOH H 4 .   ? -32.505 0.220   -29.492 1.00 36.04  ? 576 HOH B O   1 
HETATM 6490 O  O   . HOH H 4 .   ? -21.244 19.195  -41.434 1.00 51.63  ? 577 HOH B O   1 
HETATM 6491 O  O   . HOH H 4 .   ? -14.966 6.350   -21.422 1.00 50.26  ? 578 HOH B O   1 
HETATM 6492 O  O   . HOH H 4 .   ? -42.616 26.489  -41.102 1.00 52.54  ? 579 HOH B O   1 
HETATM 6493 O  O   . HOH H 4 .   ? -13.806 2.442   -15.247 1.00 49.37  ? 580 HOH B O   1 
HETATM 6494 O  O   . HOH H 4 .   ? -39.654 4.217   -21.929 1.00 45.91  ? 581 HOH B O   1 
HETATM 6495 O  O   . HOH H 4 .   ? -12.480 0.926   -18.972 1.00 36.85  ? 582 HOH B O   1 
HETATM 6496 O  O   . HOH H 4 .   ? -14.128 10.061  -37.911 1.00 41.83  ? 583 HOH B O   1 
HETATM 6497 O  O   . HOH H 4 .   ? -38.706 7.802   -24.212 1.00 46.06  ? 584 HOH B O   1 
HETATM 6498 O  O   . HOH H 4 .   ? -16.639 -0.367  -19.288 1.00 43.62  ? 585 HOH B O   1 
HETATM 6499 O  O   . HOH H 4 .   ? -34.512 18.501  -27.246 1.00 49.14  ? 586 HOH B O   1 
HETATM 6500 O  O   . HOH H 4 .   ? -26.558 -6.095  -44.429 1.00 45.70  ? 587 HOH B O   1 
HETATM 6501 O  O   . HOH H 4 .   ? -36.605 9.931   -53.082 1.00 55.91  ? 588 HOH B O   1 
HETATM 6502 O  O   . HOH H 4 .   ? -32.006 11.837  -55.331 1.00 50.94  ? 589 HOH B O   1 
HETATM 6503 O  O   . HOH H 4 .   ? -43.317 23.697  -47.649 1.00 68.26  ? 590 HOH B O   1 
HETATM 6504 O  O   . HOH H 4 .   ? -14.812 -10.911 -31.461 1.00 45.52  ? 591 HOH B O   1 
HETATM 6505 O  O   . HOH H 4 .   ? -17.709 3.413   -55.671 1.00 52.71  ? 592 HOH B O   1 
HETATM 6506 O  O   . HOH H 4 .   ? -43.410 1.209   -27.050 1.00 59.63  ? 593 HOH B O   1 
HETATM 6507 O  O   . HOH H 4 .   ? -17.402 -2.344  -22.391 1.00 47.51  ? 594 HOH B O   1 
HETATM 6508 O  O   . HOH H 4 .   ? -13.269 1.195   -7.572  1.00 42.73  ? 595 HOH B O   1 
HETATM 6509 O  O   . HOH H 4 .   ? -27.432 10.202  -52.941 1.00 57.65  ? 596 HOH B O   1 
HETATM 6510 O  O   . HOH H 4 .   ? -14.955 -2.368  -16.557 1.00 39.58  ? 597 HOH B O   1 
HETATM 6511 O  O   . HOH H 4 .   ? -32.831 14.781  -21.556 1.00 62.86  ? 598 HOH B O   1 
HETATM 6512 O  O   . HOH H 4 .   ? -14.359 0.265   -17.039 1.00 31.40  ? 599 HOH B O   1 
HETATM 6513 O  O   . HOH H 4 .   ? -43.282 24.475  -38.938 1.00 58.24  ? 600 HOH B O   1 
HETATM 6514 O  O   . HOH H 4 .   ? -39.529 10.432  -28.889 1.00 42.13  ? 601 HOH B O   1 
HETATM 6515 O  O   . HOH H 4 .   ? -23.143 9.459   -51.263 1.00 64.96  ? 602 HOH B O   1 
HETATM 6516 O  O   . HOH H 4 .   ? -5.356  -6.732  -0.081  1.00 57.94  ? 603 HOH B O   1 
HETATM 6517 O  O   . HOH H 4 .   ? -17.898 -14.226 -30.380 1.00 57.37  ? 604 HOH B O   1 
HETATM 6518 O  O   . HOH H 4 .   ? -36.901 -5.703  -43.967 1.00 56.45  ? 605 HOH B O   1 
HETATM 6519 O  O   . HOH H 4 .   ? -29.826 22.519  -31.424 1.00 52.64  ? 606 HOH B O   1 
HETATM 6520 O  O   . HOH H 4 .   ? -6.932  -3.655  -2.502  1.00 49.21  ? 607 HOH B O   1 
HETATM 6521 O  O   . HOH H 4 .   ? -44.401 3.280   -43.421 1.00 54.19  ? 608 HOH B O   1 
HETATM 6522 O  O   . HOH H 4 .   ? -20.027 5.810   3.138   1.00 60.28  ? 609 HOH B O   1 
HETATM 6523 O  O   . HOH H 4 .   ? -46.036 9.288   -29.527 1.00 55.36  ? 610 HOH B O   1 
HETATM 6524 O  O   . HOH H 4 .   ? -20.877 9.655   -5.466  1.00 57.15  ? 611 HOH B O   1 
HETATM 6525 O  O   . HOH H 4 .   ? -30.779 14.942  -55.355 1.00 54.68  ? 612 HOH B O   1 
HETATM 6526 O  O   . HOH H 4 .   ? -41.679 7.857   -26.696 1.00 65.77  ? 613 HOH B O   1 
HETATM 6527 O  O   . HOH H 4 .   ? -40.458 7.415   -29.379 1.00 52.00  ? 614 HOH B O   1 
HETATM 6528 O  O   . HOH H 4 .   ? -33.476 -1.971  -15.394 1.00 48.90  ? 615 HOH B O   1 
HETATM 6529 O  O   . HOH H 4 .   ? -49.556 9.975   -39.992 1.00 44.29  ? 616 HOH B O   1 
HETATM 6530 O  O   . HOH H 4 .   ? -4.871  5.756   -24.454 1.00 62.41  ? 617 HOH B O   1 
HETATM 6531 O  O   . HOH H 4 .   ? -13.742 -1.436  -7.183  1.00 42.82  ? 618 HOH B O   1 
HETATM 6532 O  O   . HOH H 4 .   ? -16.817 2.956   -1.502  1.00 48.87  ? 619 HOH B O   1 
HETATM 6533 O  O   . HOH H 4 .   ? -17.472 -8.559  2.666   1.00 50.07  ? 620 HOH B O   1 
HETATM 6534 O  O   . HOH H 4 .   ? -32.011 -5.605  -15.131 1.00 52.71  ? 621 HOH B O   1 
HETATM 6535 O  O   . HOH H 4 .   ? -39.010 17.617  -47.621 1.00 45.67  ? 622 HOH B O   1 
HETATM 6536 O  O   . HOH H 4 .   ? -12.074 6.503   -38.192 1.00 54.93  ? 623 HOH B O   1 
HETATM 6537 O  O   . HOH H 4 .   ? -47.444 3.109   -31.620 1.00 48.89  ? 624 HOH B O   1 
HETATM 6538 O  O   . HOH H 4 .   ? -9.994  -9.985  -18.478 1.00 52.05  ? 625 HOH B O   1 
HETATM 6539 O  O   . HOH H 4 .   ? -25.968 -8.912  -0.604  1.00 62.91  ? 626 HOH B O   1 
HETATM 6540 O  O   . HOH H 4 .   ? -7.451  -3.222  -17.206 1.00 54.70  ? 627 HOH B O   1 
HETATM 6541 O  O   . HOH H 4 .   ? -20.383 11.935  -32.886 1.00 52.32  ? 628 HOH B O   1 
HETATM 6542 O  O   . HOH H 4 .   ? -33.019 8.813   -8.200  1.00 63.84  ? 629 HOH B O   1 
HETATM 6543 O  O   . HOH H 4 .   ? -20.021 12.762  -0.356  1.00 57.85  ? 630 HOH B O   1 
HETATM 6544 O  O   . HOH H 4 .   ? -12.175 -8.795  -24.937 1.00 53.66  ? 631 HOH B O   1 
HETATM 6545 O  O   . HOH H 4 .   ? -17.595 13.257  -50.452 1.00 60.54  ? 632 HOH B O   1 
HETATM 6546 O  O   . HOH H 4 .   ? -27.557 6.495   -53.205 1.00 53.66  ? 633 HOH B O   1 
HETATM 6547 O  O   . HOH H 4 .   ? -38.041 11.656  -22.213 1.00 49.15  ? 634 HOH B O   1 
HETATM 6548 O  O   . HOH H 4 .   ? -21.116 -12.470 -34.760 1.00 50.09  ? 635 HOH B O   1 
HETATM 6549 O  O   . HOH H 4 .   ? -48.936 7.860   -33.004 1.00 51.21  ? 636 HOH B O   1 
HETATM 6550 O  O   . HOH H 4 .   ? -18.787 1.624   -52.007 1.00 53.44  ? 637 HOH B O   1 
HETATM 6551 O  O   . HOH H 4 .   ? -11.933 9.680   -23.611 1.00 54.74  ? 638 HOH B O   1 
HETATM 6552 O  O   . HOH H 4 .   ? -41.763 8.862   -21.471 1.00 51.43  ? 639 HOH B O   1 
HETATM 6553 O  O   . HOH H 4 .   ? -42.667 -3.547  -35.957 1.00 56.36  ? 640 HOH B O   1 
HETATM 6554 O  O   . HOH H 4 .   ? -46.393 22.386  -45.854 1.00 58.96  ? 641 HOH B O   1 
HETATM 6555 O  O   . HOH H 4 .   ? -25.067 13.176  -50.895 1.00 50.66  ? 642 HOH B O   1 
HETATM 6556 O  O   . HOH H 4 .   ? -34.557 3.851   -8.671  1.00 67.72  ? 643 HOH B O   1 
HETATM 6557 O  O   . HOH H 4 .   ? -40.589 6.591   -22.588 1.00 38.40  ? 644 HOH B O   1 
HETATM 6558 O  O   . HOH H 4 .   ? -19.264 -17.121 -13.438 1.00 58.76  ? 645 HOH B O   1 
HETATM 6559 O  O   . HOH H 4 .   ? -26.444 8.947   -0.981  1.00 63.45  ? 646 HOH B O   1 
HETATM 6560 O  O   . HOH H 4 .   ? -12.235 -5.089  -28.548 1.00 57.69  ? 647 HOH B O   1 
HETATM 6561 O  O   . HOH H 4 .   ? -44.320 -3.233  -34.008 1.00 55.06  ? 648 HOH B O   1 
HETATM 6562 O  O   . HOH H 4 .   ? -34.209 27.302  -36.357 1.00 58.15  ? 649 HOH B O   1 
HETATM 6563 O  O   . HOH H 4 .   ? -38.916 -1.935  -43.042 1.00 47.60  ? 650 HOH B O   1 
HETATM 6564 O  O   . HOH H 4 .   ? -18.312 -8.759  -41.171 1.00 61.50  ? 651 HOH B O   1 
HETATM 6565 O  O   . HOH H 4 .   ? -46.863 13.313  -24.750 1.00 52.93  ? 652 HOH B O   1 
HETATM 6566 O  O   . HOH H 4 .   ? -10.040 0.417   -28.961 1.00 59.01  ? 653 HOH B O   1 
HETATM 6567 O  O   . HOH H 4 .   ? -20.368 12.984  -30.222 1.00 53.67  ? 654 HOH B O   1 
HETATM 6568 O  O   . HOH H 4 .   ? -51.686 12.632  -37.747 1.00 47.03  ? 655 HOH B O   1 
HETATM 6569 O  O   . HOH H 4 .   ? -44.095 10.252  -45.228 1.00 56.11  ? 656 HOH B O   1 
HETATM 6570 O  O   . HOH H 4 .   ? -40.439 4.901   -30.566 1.00 50.75  ? 657 HOH B O   1 
HETATM 6571 O  O   . HOH H 4 .   ? -29.287 15.067  -26.320 1.00 45.67  ? 658 HOH B O   1 
HETATM 6572 O  O   . HOH H 4 .   ? -35.845 -3.654  -48.366 1.00 48.30  ? 659 HOH B O   1 
HETATM 6573 O  O   . HOH H 4 .   ? -21.257 21.213  -39.664 1.00 54.16  ? 660 HOH B O   1 
HETATM 6574 O  O   . HOH H 4 .   ? -0.610  4.936   -2.606  1.00 62.94  ? 661 HOH B O   1 
HETATM 6575 O  O   . HOH H 4 .   ? -39.971 -10.967 -26.130 1.00 56.63  ? 662 HOH B O   1 
HETATM 6576 O  O   . HOH H 4 .   ? -40.321 10.347  -23.262 1.00 46.67  ? 663 HOH B O   1 
HETATM 6577 O  O   . HOH H 4 .   ? -7.763  4.465   -6.487  1.00 57.59  ? 664 HOH B O   1 
HETATM 6578 O  O   . HOH H 4 .   ? -4.918  1.555   -16.108 1.00 44.32  ? 665 HOH B O   1 
HETATM 6579 O  O   . HOH H 4 .   ? -13.188 -8.895  -34.147 1.00 55.71  ? 666 HOH B O   1 
HETATM 6580 O  O   . HOH H 4 .   ? -48.017 24.840  -26.706 1.00 55.71  ? 667 HOH B O   1 
HETATM 6581 O  O   . HOH H 4 .   ? -35.141 19.779  -23.156 1.00 68.04  ? 668 HOH B O   1 
HETATM 6582 O  O   . HOH H 4 .   ? -14.433 -5.962  -30.277 1.00 60.81  ? 669 HOH B O   1 
HETATM 6583 O  O   . HOH H 4 .   ? -33.620 19.777  -49.721 1.00 53.96  ? 670 HOH B O   1 
HETATM 6584 O  O   . HOH H 4 .   ? -49.217 23.915  -30.884 1.00 57.78  ? 671 HOH B O   1 
HETATM 6585 O  O   . HOH H 4 .   ? -33.109 -11.161 -40.244 1.00 54.33  ? 672 HOH B O   1 
HETATM 6586 O  O   . HOH H 4 .   ? -54.042 19.433  -34.162 1.00 61.44  ? 673 HOH B O   1 
HETATM 6587 O  O   . HOH H 4 .   ? -51.332 10.837  -30.579 1.00 48.25  ? 674 HOH B O   1 
HETATM 6588 O  O   . HOH H 4 .   ? -40.367 4.690   -50.577 1.00 54.02  ? 675 HOH B O   1 
HETATM 6589 O  O   . HOH H 4 .   ? -17.077 9.551   -23.986 1.00 61.39  ? 676 HOH B O   1 
HETATM 6590 O  O   . HOH H 4 .   ? -30.185 -18.883 -26.875 1.00 65.54  ? 677 HOH B O   1 
HETATM 6591 O  O   . HOH H 4 .   ? -17.603 -4.778  -45.540 1.00 54.39  ? 678 HOH B O   1 
HETATM 6592 O  O   . HOH H 4 .   ? -24.552 27.948  -34.057 1.00 62.35  ? 679 HOH B O   1 
HETATM 6593 O  O   . HOH H 4 .   ? -54.111 16.984  -40.016 1.00 49.01  ? 680 HOH B O   1 
HETATM 6594 O  O   . HOH H 4 .   ? -17.700 -11.105 2.532   1.00 55.49  ? 681 HOH B O   1 
HETATM 6595 O  O   . HOH H 4 .   ? -39.781 -2.577  -45.806 1.00 56.56  ? 682 HOH B O   1 
HETATM 6596 O  O   . HOH H 4 .   ? -20.202 20.849  -37.063 1.00 56.85  ? 683 HOH B O   1 
HETATM 6597 O  O   . HOH H 4 .   ? -35.445 -9.469  -17.207 1.00 63.11  ? 684 HOH B O   1 
HETATM 6598 O  O   . HOH H 4 .   ? -40.836 -6.509  -27.520 1.00 51.02  ? 685 HOH B O   1 
HETATM 6599 O  O   . HOH H 4 .   ? -40.387 32.706  -31.281 1.00 58.58  ? 686 HOH B O   1 
HETATM 6600 O  O   . HOH H 4 .   ? -41.671 -10.716 -23.094 1.00 65.26  ? 687 HOH B O   1 
HETATM 6601 O  O   . HOH H 4 .   ? -44.306 20.682  -47.342 1.00 60.26  ? 688 HOH B O   1 
HETATM 6602 O  O   . HOH H 4 .   ? -45.073 17.840  -46.610 1.00 49.14  ? 689 HOH B O   1 
HETATM 6603 O  O   . HOH H 4 .   ? -51.462 2.936   -34.598 1.00 63.95  ? 690 HOH B O   1 
HETATM 6604 O  O   . HOH H 4 .   ? -41.335 -10.232 -39.598 1.00 61.29  ? 691 HOH B O   1 
HETATM 6605 O  O   . HOH H 4 .   ? -54.373 14.000  -36.011 1.00 56.14  ? 692 HOH B O   1 
HETATM 6606 O  O   . HOH H 4 .   ? -30.683 10.149  -0.426  1.00 61.19  ? 693 HOH B O   1 
HETATM 6607 O  O   . HOH H 4 .   ? -41.132 -4.023  -40.853 1.00 59.70  ? 694 HOH B O   1 
HETATM 6608 O  O   . HOH H 4 .   ? -16.029 9.028   -21.075 1.00 57.96  ? 695 HOH B O   1 
HETATM 6609 O  O   . HOH H 4 .   ? -20.697 18.646  -28.034 1.00 63.86  ? 696 HOH B O   1 
HETATM 6610 O  O   . HOH H 4 .   ? -12.129 -14.870 -25.726 1.00 61.74  ? 697 HOH B O   1 
HETATM 6611 O  O   . HOH H 4 .   ? -42.695 0.740   -44.437 1.00 63.14  ? 698 HOH B O   1 
HETATM 6612 O  O   . HOH H 4 .   ? -49.020 5.337   -29.971 1.00 56.25  ? 699 HOH B O   1 
HETATM 6613 O  O   . HOH H 4 .   ? -41.524 2.889   -48.083 1.00 58.31  ? 700 HOH B O   1 
HETATM 6614 O  O   . HOH H 4 .   ? -47.440 24.997  -22.062 1.00 59.57  ? 701 HOH B O   1 
HETATM 6615 O  O   . HOH H 4 .   ? -16.989 -2.774  -48.914 1.00 57.40  ? 702 HOH B O   1 
HETATM 6616 O  O   . HOH H 4 .   ? -22.713 -4.858  0.882   1.00 53.39  ? 703 HOH B O   1 
HETATM 6617 O  O   . HOH H 4 .   ? -16.351 3.895   -57.896 1.00 62.69  ? 704 HOH B O   1 
HETATM 6618 O  O   . HOH H 4 .   ? -42.993 10.380  -47.899 1.00 53.68  ? 705 HOH B O   1 
HETATM 6619 O  O   . HOH H 4 .   ? -29.053 25.016  -32.434 1.00 60.81  ? 706 HOH B O   1 
HETATM 6620 O  O   . HOH H 4 .   ? -22.618 19.226  -25.564 1.00 65.94  ? 707 HOH B O   1 
HETATM 6621 O  O   . HOH H 4 .   ? -9.451  -3.785  -23.973 1.00 56.94  ? 708 HOH B O   1 
HETATM 6622 O  O   . HOH H 4 .   ? -23.537 -16.492 -11.251 1.00 58.12  ? 709 HOH B O   1 
HETATM 6623 O  O   . HOH H 4 .   ? -48.561 1.257   -42.549 1.00 61.09  ? 710 HOH B O   1 
HETATM 6624 O  O   . HOH H 4 .   ? -13.435 -6.349  3.577   1.00 54.07  ? 711 HOH B O   1 
HETATM 6625 O  O   . HOH H 4 .   ? -29.803 26.749  -37.168 1.00 53.58  ? 712 HOH B O   1 
HETATM 6626 O  O   . HOH H 4 .   ? -22.929 22.994  -30.801 1.00 65.27  ? 713 HOH B O   1 
HETATM 6627 O  O   . HOH H 4 .   ? -51.828 10.227  -38.736 1.00 48.29  ? 714 HOH B O   1 
HETATM 6628 O  O   . HOH H 4 .   ? -40.380 -8.365  -25.755 1.00 53.64  ? 715 HOH B O   1 
HETATM 6629 O  O   . HOH H 4 .   ? -42.597 5.161   -7.324  1.00 58.14  ? 716 HOH B O   1 
HETATM 6630 O  O   . HOH H 4 .   ? -38.524 -4.253  -42.134 1.00 46.55  ? 717 HOH B O   1 
HETATM 6631 O  O   . HOH H 4 .   ? -51.725 8.076   -33.575 1.00 45.35  ? 718 HOH B O   1 
HETATM 6632 O  O   . HOH H 4 .   ? -10.692 4.643   -40.074 1.00 52.87  ? 719 HOH B O   1 
HETATM 6633 O  O   . HOH H 4 .   ? -30.059 -13.267 -37.589 1.00 63.79  ? 720 HOH B O   1 
HETATM 6634 O  O   . HOH H 4 .   ? -16.127 -2.246  -57.257 1.00 55.15  ? 721 HOH B O   1 
HETATM 6635 O  O   . HOH H 4 .   ? -39.526 7.341   -50.194 1.00 46.52  ? 722 HOH B O   1 
HETATM 6636 O  O   . HOH H 4 .   ? -38.333 -10.812 -43.226 1.00 61.88  ? 723 HOH B O   1 
HETATM 6637 O  O   . HOH H 4 .   ? -27.745 -10.599 -43.023 1.00 60.56  ? 724 HOH B O   1 
HETATM 6638 O  O   . HOH H 4 .   ? -39.493 7.898   -47.286 1.00 49.16  ? 725 HOH B O   1 
HETATM 6639 O  O   . HOH H 4 .   ? -12.089 1.676   0.243   1.00 61.24  ? 726 HOH B O   1 
HETATM 6640 O  O   . HOH H 4 .   ? -18.559 22.515  -35.830 1.00 58.78  ? 727 HOH B O   1 
HETATM 6641 O  O   . HOH H 4 .   ? -46.074 1.222   -28.902 1.00 53.61  ? 728 HOH B O   1 
HETATM 6642 O  O   . HOH H 4 .   ? -21.277 21.150  -27.236 1.00 61.02  ? 729 HOH B O   1 
HETATM 6643 O  O   . HOH H 4 .   ? -39.380 -13.849 -25.200 1.00 66.34  ? 730 HOH B O   1 
HETATM 6644 O  O   . HOH H 4 .   ? -43.006 -10.561 -27.825 1.00 60.17  ? 731 HOH B O   1 
HETATM 6645 O  O   . HOH H 4 .   ? -17.620 -8.113  -45.510 1.00 63.54  ? 732 HOH B O   1 
HETATM 6646 O  O   . HOH H 4 .   ? -30.116 -7.480  -50.770 1.00 52.29  ? 733 HOH B O   1 
HETATM 6647 O  O   . HOH H 4 .   ? -14.571 3.297   -44.687 1.00 59.76  ? 734 HOH B O   1 
HETATM 6648 O  O   . HOH H 4 .   ? -29.982 26.934  -34.335 1.00 60.32  ? 735 HOH B O   1 
HETATM 6649 O  O   . HOH H 4 .   ? -16.548 -14.177 -36.904 1.00 61.05  ? 736 HOH B O   1 
HETATM 6650 O  O   . HOH H 4 .   ? -25.391 6.220   -59.265 1.00 54.12  ? 737 HOH B O   1 
HETATM 6651 O  O   . HOH H 4 .   ? -41.638 27.523  -45.371 1.00 56.40  ? 738 HOH B O   1 
HETATM 6652 O  O   . HOH H 4 .   ? -19.408 12.774  -26.868 1.00 59.86  ? 739 HOH B O   1 
HETATM 6653 O  O   . HOH H 4 .   ? -15.475 -13.575 -31.529 1.00 48.45  ? 740 HOH B O   1 
HETATM 6654 O  O   . HOH H 4 .   ? -41.477 5.320   -46.948 1.00 61.88  ? 741 HOH B O   1 
HETATM 6655 O  O   . HOH H 4 .   ? -19.079 -14.018 -35.553 1.00 58.67  ? 742 HOH B O   1 
HETATM 6656 O  O   . HOH H 4 .   ? -15.557 -0.157  -43.695 1.00 60.92  ? 743 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -48 ?   ?   ?   A . n 
A 1 2   ALA 2   -47 ?   ?   ?   A . n 
A 1 3   GLY 3   -46 ?   ?   ?   A . n 
A 1 4   VAL 4   -45 ?   ?   ?   A . n 
A 1 5   LEU 5   -44 ?   ?   ?   A . n 
A 1 6   PRO 6   -43 ?   ?   ?   A . n 
A 1 7   ALA 7   -42 ?   ?   ?   A . n 
A 1 8   HIS 8   -41 ?   ?   ?   A . n 
A 1 9   GLY 9   -40 ?   ?   ?   A . n 
A 1 10  THR 10  -39 ?   ?   ?   A . n 
A 1 11  GLN 11  -38 ?   ?   ?   A . n 
A 1 12  HIS 12  -37 ?   ?   ?   A . n 
A 1 13  GLY 13  -36 ?   ?   ?   A . n 
A 1 14  ILE 14  -35 ?   ?   ?   A . n 
A 1 15  ARG 15  -34 ?   ?   ?   A . n 
A 1 16  LEU 16  -33 ?   ?   ?   A . n 
A 1 17  PRO 17  -32 ?   ?   ?   A . n 
A 1 18  LEU 18  -31 ?   ?   ?   A . n 
A 1 19  ARG 19  -30 ?   ?   ?   A . n 
A 1 20  SER 20  -29 ?   ?   ?   A . n 
A 1 21  GLY 21  -28 ?   ?   ?   A . n 
A 1 22  LEU 22  -27 ?   ?   ?   A . n 
A 1 23  GLY 23  -26 ?   ?   ?   A . n 
A 1 24  GLY 24  -25 ?   ?   ?   A . n 
A 1 25  ALA 25  -24 ?   ?   ?   A . n 
A 1 26  PRO 26  -23 ?   ?   ?   A . n 
A 1 27  LEU 27  -22 ?   ?   ?   A . n 
A 1 28  GLY 28  -21 ?   ?   ?   A . n 
A 1 29  LEU 29  -20 ?   ?   ?   A . n 
A 1 30  ARG 30  -19 ?   ?   ?   A . n 
A 1 31  LEU 31  -18 ?   ?   ?   A . n 
A 1 32  PRO 32  -17 ?   ?   ?   A . n 
A 1 33  ARG 33  -16 ?   ?   ?   A . n 
A 1 34  GLU 34  -15 ?   ?   ?   A . n 
A 1 35  THR 35  -14 ?   ?   ?   A . n 
A 1 36  ASP 36  -13 ?   ?   ?   A . n 
A 1 37  GLU 37  -12 ?   ?   ?   A . n 
A 1 38  GLU 38  -11 ?   ?   ?   A . n 
A 1 39  PRO 39  -10 ?   ?   ?   A . n 
A 1 40  GLU 40  -9  ?   ?   ?   A . n 
A 1 41  GLU 41  -8  ?   ?   ?   A . n 
A 1 42  PRO 42  -7  ?   ?   ?   A . n 
A 1 43  GLY 43  -6  ?   ?   ?   A . n 
A 1 44  ARG 44  -5  ?   ?   ?   A . n 
A 1 45  ARG 45  -4  ?   ?   ?   A . n 
A 1 46  GLY 46  -3  -3  GLY GLY A . n 
A 1 47  SER 47  -2  -2  SER SER A . n 
A 1 48  PHE 48  -1  -1  PHE PHE A . n 
A 1 49  VAL 49  0   0   VAL VAL A . n 
A 1 50  GLU 50  1   1   GLU GLU A . n 
A 1 51  MET 51  2   2   MET MET A . n 
A 1 52  VAL 52  3   3   VAL VAL A . n 
A 1 53  ASP 53  4   4   ASP ASP A . n 
A 1 54  ASN 54  5   5   ASN ASN A . n 
A 1 55  LEU 55  6   6   LEU LEU A . n 
A 1 56  ARG 56  7   7   ARG ARG A . n 
A 1 57  GLY 57  8   8   GLY GLY A . n 
A 1 58  LYS 58  9   9   LYS LYS A . n 
A 1 59  SER 59  10  10  SER SER A . n 
A 1 60  GLY 60  11  11  GLY GLY A . n 
A 1 61  GLN 61  12  12  GLN GLN A . n 
A 1 62  GLY 62  13  13  GLY GLY A . n 
A 1 63  TYR 63  14  14  TYR TYR A . n 
A 1 64  TYR 64  15  15  TYR TYR A . n 
A 1 65  VAL 65  16  16  VAL VAL A . n 
A 1 66  GLU 66  17  17  GLU GLU A . n 
A 1 67  MET 67  18  18  MET MET A . n 
A 1 68  THR 68  19  19  THR THR A . n 
A 1 69  VAL 69  20  20  VAL VAL A . n 
A 1 70  GLY 70  21  21  GLY GLY A . n 
A 1 71  SER 71  22  22  SER SER A . n 
A 1 72  PRO 72  23  23  PRO PRO A . n 
A 1 73  PRO 73  24  24  PRO PRO A . n 
A 1 74  GLN 74  25  25  GLN GLN A . n 
A 1 75  THR 75  26  26  THR THR A . n 
A 1 76  LEU 76  27  27  LEU LEU A . n 
A 1 77  ASN 77  28  28  ASN ASN A . n 
A 1 78  ILE 78  29  29  ILE ILE A . n 
A 1 79  LEU 79  30  30  LEU LEU A . n 
A 1 80  VAL 80  31  31  VAL VAL A . n 
A 1 81  ASP 81  32  32  ASP ASP A . n 
A 1 82  THR 82  33  33  THR THR A . n 
A 1 83  GLY 83  34  34  GLY GLY A . n 
A 1 84  SER 84  35  35  SER SER A . n 
A 1 85  SER 85  36  36  SER SER A . n 
A 1 86  ASN 86  37  37  ASN ASN A . n 
A 1 87  PHE 87  38  38  PHE PHE A . n 
A 1 88  ALA 88  39  39  ALA ALA A . n 
A 1 89  VAL 89  40  40  VAL VAL A . n 
A 1 90  GLY 90  41  41  GLY GLY A . n 
A 1 91  ALA 91  42  42  ALA ALA A . n 
A 1 92  ALA 92  43  43  ALA ALA A . n 
A 1 93  PRO 93  44  44  PRO PRO A . n 
A 1 94  HIS 94  45  45  HIS HIS A . n 
A 1 95  PRO 95  46  46  PRO PRO A . n 
A 1 96  PHE 96  47  47  PHE PHE A . n 
A 1 97  LEU 97  48  48  LEU LEU A . n 
A 1 98  HIS 98  49  49  HIS HIS A . n 
A 1 99  ARG 99  50  50  ARG ARG A . n 
A 1 100 TYR 100 51  51  TYR TYR A . n 
A 1 101 TYR 101 52  52  TYR TYR A . n 
A 1 102 GLN 102 53  53  GLN GLN A . n 
A 1 103 ARG 103 54  54  ARG ARG A . n 
A 1 104 GLN 104 55  55  GLN GLN A . n 
A 1 105 LEU 105 56  56  LEU LEU A . n 
A 1 106 SER 106 57  57  SER SER A . n 
A 1 107 SER 107 58  58  SER SER A . n 
A 1 108 THR 108 59  59  THR THR A . n 
A 1 109 TYR 109 60  60  TYR TYR A . n 
A 1 110 ARG 110 61  61  ARG ARG A . n 
A 1 111 ASP 111 62  62  ASP ASP A . n 
A 1 112 LEU 112 63  63  LEU LEU A . n 
A 1 113 ARG 113 64  64  ARG ARG A . n 
A 1 114 LYS 114 65  65  LYS LYS A . n 
A 1 115 GLY 115 66  66  GLY GLY A . n 
A 1 116 VAL 116 67  67  VAL VAL A . n 
A 1 117 TYR 117 68  68  TYR TYR A . n 
A 1 118 VAL 118 69  69  VAL VAL A . n 
A 1 119 PRO 119 70  70  PRO PRO A . n 
A 1 120 TYR 120 71  71  TYR TYR A . n 
A 1 121 THR 121 72  72  THR THR A . n 
A 1 122 GLN 122 73  73  GLN GLN A . n 
A 1 123 GLY 123 74  74  GLY GLY A . n 
A 1 124 LYS 124 75  75  LYS LYS A . n 
A 1 125 TRP 125 76  76  TRP TRP A . n 
A 1 126 GLU 126 77  77  GLU GLU A . n 
A 1 127 GLY 127 78  78  GLY GLY A . n 
A 1 128 GLU 128 79  79  GLU GLU A . n 
A 1 129 LEU 129 80  80  LEU LEU A . n 
A 1 130 GLY 130 81  81  GLY GLY A . n 
A 1 131 THR 131 82  82  THR THR A . n 
A 1 132 ASP 132 83  83  ASP ASP A . n 
A 1 133 LEU 133 84  84  LEU LEU A . n 
A 1 134 VAL 134 85  85  VAL VAL A . n 
A 1 135 SER 135 86  86  SER SER A . n 
A 1 136 ILE 136 87  87  ILE ILE A . n 
A 1 137 PRO 137 88  88  PRO PRO A . n 
A 1 138 HIS 138 89  89  HIS HIS A . n 
A 1 139 GLY 139 90  90  GLY GLY A . n 
A 1 140 PRO 140 91  91  PRO PRO A . n 
A 1 141 ASN 141 92  92  ASN ASN A . n 
A 1 142 VAL 142 93  93  VAL VAL A . n 
A 1 143 THR 143 94  94  THR THR A . n 
A 1 144 VAL 144 95  95  VAL VAL A . n 
A 1 145 ARG 145 96  96  ARG ARG A . n 
A 1 146 ALA 146 97  97  ALA ALA A . n 
A 1 147 ASN 147 98  98  ASN ASN A . n 
A 1 148 ILE 148 99  99  ILE ILE A . n 
A 1 149 ALA 149 100 100 ALA ALA A . n 
A 1 150 ALA 150 101 101 ALA ALA A . n 
A 1 151 ILE 151 102 102 ILE ILE A . n 
A 1 152 THR 152 103 103 THR THR A . n 
A 1 153 GLU 153 104 104 GLU GLU A . n 
A 1 154 SER 154 105 105 SER SER A . n 
A 1 155 ASP 155 106 106 ASP ASP A . n 
A 1 156 LYS 156 107 107 LYS LYS A . n 
A 1 157 PHE 157 108 108 PHE PHE A . n 
A 1 158 PHE 158 109 109 PHE PHE A . n 
A 1 159 ILE 159 110 110 ILE ILE A . n 
A 1 160 ASN 160 111 111 ASN ASN A . n 
A 1 161 GLY 161 112 112 GLY GLY A . n 
A 1 162 SER 162 113 113 SER SER A . n 
A 1 163 ASN 163 114 114 ASN ASN A . n 
A 1 164 TRP 164 115 115 TRP TRP A . n 
A 1 165 GLU 165 116 116 GLU GLU A . n 
A 1 166 GLY 166 117 117 GLY GLY A . n 
A 1 167 ILE 167 118 118 ILE ILE A . n 
A 1 168 LEU 168 119 119 LEU LEU A . n 
A 1 169 GLY 169 120 120 GLY GLY A . n 
A 1 170 LEU 170 121 121 LEU LEU A . n 
A 1 171 ALA 171 122 122 ALA ALA A . n 
A 1 172 TYR 172 123 123 TYR TYR A . n 
A 1 173 ALA 173 124 124 ALA ALA A . n 
A 1 174 GLU 174 125 125 GLU GLU A . n 
A 1 175 ILE 175 126 126 ILE ILE A . n 
A 1 176 ALA 176 127 127 ALA ALA A . n 
A 1 177 ARG 177 128 128 ARG ARG A . n 
A 1 178 PRO 178 129 129 PRO PRO A . n 
A 1 179 ASP 179 130 130 ASP ASP A . n 
A 1 180 ASP 180 131 131 ASP ASP A . n 
A 1 181 SER 181 132 132 SER SER A . n 
A 1 182 LEU 182 133 133 LEU LEU A . n 
A 1 183 GLU 183 134 134 GLU GLU A . n 
A 1 184 PRO 184 135 135 PRO PRO A . n 
A 1 185 PHE 185 136 136 PHE PHE A . n 
A 1 186 PHE 186 137 137 PHE PHE A . n 
A 1 187 ASP 187 138 138 ASP ASP A . n 
A 1 188 SER 188 139 139 SER SER A . n 
A 1 189 LEU 189 140 140 LEU LEU A . n 
A 1 190 VAL 190 141 141 VAL VAL A . n 
A 1 191 LYS 191 142 142 LYS LYS A . n 
A 1 192 GLN 192 143 143 GLN GLN A . n 
A 1 193 THR 193 144 144 THR THR A . n 
A 1 194 HIS 194 145 145 HIS HIS A . n 
A 1 195 VAL 195 146 146 VAL VAL A . n 
A 1 196 PRO 196 147 147 PRO PRO A . n 
A 1 197 ASN 197 148 148 ASN ASN A . n 
A 1 198 LEU 198 149 149 LEU LEU A . n 
A 1 199 PHE 199 150 150 PHE PHE A . n 
A 1 200 SER 200 151 151 SER SER A . n 
A 1 201 LEU 201 152 152 LEU LEU A . n 
A 1 202 GLN 202 153 153 GLN GLN A . n 
A 1 203 LEU 203 154 154 LEU LEU A . n 
A 1 204 CYS 204 155 155 CYS CYS A . n 
A 1 205 GLY 205 156 156 GLY GLY A . n 
A 1 206 ALA 206 157 157 ALA ALA A . n 
A 1 207 GLY 207 158 158 GLY GLY A . n 
A 1 208 PHE 208 159 159 PHE PHE A . n 
A 1 209 PRO 209 160 160 PRO PRO A . n 
A 1 210 LEU 210 161 161 LEU LEU A . n 
A 1 211 ASN 211 162 162 ASN ASN A . n 
A 1 212 GLN 212 163 163 GLN GLN A . n 
A 1 213 SER 213 164 164 SER SER A . n 
A 1 214 GLU 214 165 165 GLU GLU A . n 
A 1 215 VAL 215 166 166 VAL VAL A . n 
A 1 216 LEU 216 167 167 LEU LEU A . n 
A 1 217 ALA 217 168 168 ALA ALA A . n 
A 1 218 SER 218 169 169 SER SER A . n 
A 1 219 VAL 219 170 170 VAL VAL A . n 
A 1 220 GLY 220 171 171 GLY GLY A . n 
A 1 221 GLY 221 172 172 GLY GLY A . n 
A 1 222 SER 222 173 173 SER SER A . n 
A 1 223 MET 223 174 174 MET MET A . n 
A 1 224 ILE 224 175 175 ILE ILE A . n 
A 1 225 ILE 225 176 176 ILE ILE A . n 
A 1 226 GLY 226 177 177 GLY GLY A . n 
A 1 227 GLY 227 178 178 GLY GLY A . n 
A 1 228 ILE 228 179 179 ILE ILE A . n 
A 1 229 ASP 229 180 180 ASP ASP A . n 
A 1 230 HIS 230 181 181 HIS HIS A . n 
A 1 231 SER 231 182 182 SER SER A . n 
A 1 232 LEU 232 183 183 LEU LEU A . n 
A 1 233 TYR 233 184 184 TYR TYR A . n 
A 1 234 THR 234 185 185 THR THR A . n 
A 1 235 GLY 235 186 186 GLY GLY A . n 
A 1 236 SER 236 187 187 SER SER A . n 
A 1 237 LEU 237 188 188 LEU LEU A . n 
A 1 238 TRP 238 189 189 TRP TRP A . n 
A 1 239 TYR 239 190 190 TYR TYR A . n 
A 1 240 THR 240 191 191 THR THR A . n 
A 1 241 PRO 241 192 192 PRO PRO A . n 
A 1 242 ILE 242 193 193 ILE ILE A . n 
A 1 243 ARG 243 194 194 ARG ARG A . n 
A 1 244 ARG 244 195 195 ARG ARG A . n 
A 1 245 GLU 245 196 196 GLU GLU A . n 
A 1 246 TRP 246 197 197 TRP TRP A . n 
A 1 247 TYR 247 198 198 TYR TYR A . n 
A 1 248 TYR 248 199 199 TYR TYR A . n 
A 1 249 GLU 249 200 200 GLU GLU A . n 
A 1 250 VAL 250 201 201 VAL VAL A . n 
A 1 251 ILE 251 202 202 ILE ILE A . n 
A 1 252 ILE 252 203 203 ILE ILE A . n 
A 1 253 VAL 253 204 204 VAL VAL A . n 
A 1 254 ARG 254 205 205 ARG ARG A . n 
A 1 255 VAL 255 206 206 VAL VAL A . n 
A 1 256 GLU 256 207 207 GLU GLU A . n 
A 1 257 ILE 257 208 208 ILE ILE A . n 
A 1 258 ASN 258 209 209 ASN ASN A . n 
A 1 259 GLY 259 210 210 GLY GLY A . n 
A 1 260 GLN 260 211 211 GLN GLN A . n 
A 1 261 ASP 261 212 212 ASP ASP A . n 
A 1 262 LEU 262 213 213 LEU LEU A . n 
A 1 263 LYS 263 214 214 LYS LYS A . n 
A 1 264 MET 264 215 215 MET MET A . n 
A 1 265 ASP 265 216 216 ASP ASP A . n 
A 1 266 CYS 266 217 217 CYS CYS A . n 
A 1 267 LYS 267 218 218 LYS LYS A . n 
A 1 268 GLU 268 219 219 GLU GLU A . n 
A 1 269 TYR 269 220 220 TYR TYR A . n 
A 1 270 ASN 270 221 221 ASN ASN A . n 
A 1 271 TYR 271 222 222 TYR TYR A . n 
A 1 272 ASP 272 223 223 ASP ASP A . n 
A 1 273 LYS 273 224 224 LYS LYS A . n 
A 1 274 SER 274 225 225 SER SER A . n 
A 1 275 ILE 275 226 226 ILE ILE A . n 
A 1 276 VAL 276 227 227 VAL VAL A . n 
A 1 277 ASP 277 228 228 ASP ASP A . n 
A 1 278 SER 278 229 229 SER SER A . n 
A 1 279 GLY 279 230 230 GLY GLY A . n 
A 1 280 THR 280 231 231 THR THR A . n 
A 1 281 THR 281 232 232 THR THR A . n 
A 1 282 ASN 282 233 233 ASN ASN A . n 
A 1 283 LEU 283 234 234 LEU LEU A . n 
A 1 284 ARG 284 235 235 ARG ARG A . n 
A 1 285 LEU 285 236 236 LEU LEU A . n 
A 1 286 PRO 286 237 237 PRO PRO A . n 
A 1 287 LYS 287 238 238 LYS LYS A . n 
A 1 288 LYS 288 239 239 LYS LYS A . n 
A 1 289 VAL 289 240 240 VAL VAL A . n 
A 1 290 PHE 290 241 241 PHE PHE A . n 
A 1 291 GLU 291 242 242 GLU GLU A . n 
A 1 292 ALA 292 243 243 ALA ALA A . n 
A 1 293 ALA 293 244 244 ALA ALA A . n 
A 1 294 VAL 294 245 245 VAL VAL A . n 
A 1 295 LYS 295 246 246 LYS LYS A . n 
A 1 296 SER 296 247 247 SER SER A . n 
A 1 297 ILE 297 248 248 ILE ILE A . n 
A 1 298 LYS 298 249 249 LYS LYS A . n 
A 1 299 ALA 299 250 250 ALA ALA A . n 
A 1 300 ALA 300 251 251 ALA ALA A . n 
A 1 301 SER 301 252 252 SER SER A . n 
A 1 302 SER 302 253 253 SER SER A . n 
A 1 303 THR 303 254 254 THR THR A . n 
A 1 304 GLU 304 255 255 GLU GLU A . n 
A 1 305 LYS 305 256 256 LYS LYS A . n 
A 1 306 PHE 306 257 257 PHE PHE A . n 
A 1 307 PRO 307 258 258 PRO PRO A . n 
A 1 308 ASP 308 259 259 ASP ASP A . n 
A 1 309 GLY 309 260 260 GLY GLY A . n 
A 1 310 PHE 310 261 261 PHE PHE A . n 
A 1 311 TRP 311 262 262 TRP TRP A . n 
A 1 312 LEU 312 263 263 LEU LEU A . n 
A 1 313 GLY 313 264 264 GLY GLY A . n 
A 1 314 GLU 314 265 265 GLU GLU A . n 
A 1 315 GLN 315 266 266 GLN GLN A . n 
A 1 316 LEU 316 267 267 LEU LEU A . n 
A 1 317 VAL 317 268 268 VAL VAL A . n 
A 1 318 CYS 318 269 269 CYS CYS A . n 
A 1 319 TRP 319 270 270 TRP TRP A . n 
A 1 320 GLN 320 271 271 GLN GLN A . n 
A 1 321 ALA 321 272 272 ALA ALA A . n 
A 1 322 GLY 322 273 273 GLY GLY A . n 
A 1 323 THR 323 274 274 THR THR A . n 
A 1 324 THR 324 275 275 THR THR A . n 
A 1 325 PRO 325 276 276 PRO PRO A . n 
A 1 326 TRP 326 277 277 TRP TRP A . n 
A 1 327 ASN 327 278 278 ASN ASN A . n 
A 1 328 ILE 328 279 279 ILE ILE A . n 
A 1 329 PHE 329 280 280 PHE PHE A . n 
A 1 330 PRO 330 281 281 PRO PRO A . n 
A 1 331 VAL 331 282 282 VAL VAL A . n 
A 1 332 ILE 332 283 283 ILE ILE A . n 
A 1 333 SER 333 284 284 SER SER A . n 
A 1 334 LEU 334 285 285 LEU LEU A . n 
A 1 335 TYR 335 286 286 TYR TYR A . n 
A 1 336 LEU 336 287 287 LEU LEU A . n 
A 1 337 MET 337 288 288 MET MET A . n 
A 1 338 GLY 338 289 289 GLY GLY A . n 
A 1 339 GLU 339 290 290 GLU GLU A . n 
A 1 340 VAL 340 291 291 VAL VAL A . n 
A 1 341 THR 341 292 292 THR THR A . n 
A 1 342 ASN 342 293 293 ASN ASN A . n 
A 1 343 GLN 343 294 294 GLN GLN A . n 
A 1 344 SER 344 295 295 SER SER A . n 
A 1 345 PHE 345 296 296 PHE PHE A . n 
A 1 346 ARG 346 297 297 ARG ARG A . n 
A 1 347 ILE 347 298 298 ILE ILE A . n 
A 1 348 THR 348 299 299 THR THR A . n 
A 1 349 ILE 349 300 300 ILE ILE A . n 
A 1 350 LEU 350 301 301 LEU LEU A . n 
A 1 351 PRO 351 302 302 PRO PRO A . n 
A 1 352 GLN 352 303 303 GLN GLN A . n 
A 1 353 GLN 353 304 304 GLN GLN A . n 
A 1 354 TYR 354 305 305 TYR TYR A . n 
A 1 355 LEU 355 306 306 LEU LEU A . n 
A 1 356 ARG 356 307 307 ARG ARG A . n 
A 1 357 PRO 357 308 308 PRO PRO A . n 
A 1 358 VAL 358 309 309 VAL VAL A . n 
A 1 359 GLU 359 310 310 GLU GLU A . n 
A 1 360 ASP 360 311 311 ASP ASP A . n 
A 1 361 VAL 361 312 312 VAL VAL A . n 
A 1 362 ALA 362 313 313 ALA ALA A . n 
A 1 363 THR 363 314 314 THR THR A . n 
A 1 364 SER 364 315 315 SER SER A . n 
A 1 365 GLN 365 316 316 GLN GLN A . n 
A 1 366 ASP 366 317 317 ASP ASP A . n 
A 1 367 ASP 367 318 318 ASP ASP A . n 
A 1 368 CYS 368 319 319 CYS CYS A . n 
A 1 369 TYR 369 320 320 TYR TYR A . n 
A 1 370 LYS 370 321 321 LYS LYS A . n 
A 1 371 PHE 371 322 322 PHE PHE A . n 
A 1 372 ALA 372 323 323 ALA ALA A . n 
A 1 373 ILE 373 324 324 ILE ILE A . n 
A 1 374 SER 374 325 325 SER SER A . n 
A 1 375 GLN 375 326 326 GLN GLN A . n 
A 1 376 SER 376 327 327 SER SER A . n 
A 1 377 SER 377 328 328 SER SER A . n 
A 1 378 THR 378 329 329 THR THR A . n 
A 1 379 GLY 379 330 330 GLY GLY A . n 
A 1 380 THR 380 331 331 THR THR A . n 
A 1 381 VAL 381 332 332 VAL VAL A . n 
A 1 382 MET 382 333 333 MET MET A . n 
A 1 383 GLY 383 334 334 GLY GLY A . n 
A 1 384 ALA 384 335 335 ALA ALA A . n 
A 1 385 VAL 385 336 336 VAL VAL A . n 
A 1 386 ILE 386 337 337 ILE ILE A . n 
A 1 387 MET 387 338 338 MET MET A . n 
A 1 388 GLU 388 339 339 GLU GLU A . n 
A 1 389 GLY 389 340 340 GLY GLY A . n 
A 1 390 PHE 390 341 341 PHE PHE A . n 
A 1 391 TYR 391 342 342 TYR TYR A . n 
A 1 392 VAL 392 343 343 VAL VAL A . n 
A 1 393 VAL 393 344 344 VAL VAL A . n 
A 1 394 PHE 394 345 345 PHE PHE A . n 
A 1 395 ASP 395 346 346 ASP ASP A . n 
A 1 396 ARG 396 347 347 ARG ARG A . n 
A 1 397 ALA 397 348 348 ALA ALA A . n 
A 1 398 ARG 398 349 349 ARG ARG A . n 
A 1 399 LYS 399 350 350 LYS LYS A . n 
A 1 400 ARG 400 351 351 ARG ARG A . n 
A 1 401 ILE 401 352 352 ILE ILE A . n 
A 1 402 GLY 402 353 353 GLY GLY A . n 
A 1 403 PHE 403 354 354 PHE PHE A . n 
A 1 404 ALA 404 355 355 ALA ALA A . n 
A 1 405 VAL 405 356 356 VAL VAL A . n 
A 1 406 SER 406 357 357 SER SER A . n 
A 1 407 ALA 407 358 358 ALA ALA A . n 
A 1 408 CYS 408 359 359 CYS CYS A . n 
A 1 409 HIS 409 360 360 HIS HIS A . n 
A 1 410 VAL 410 361 361 VAL VAL A . n 
A 1 411 HIS 411 362 362 HIS HIS A . n 
A 1 412 ASP 412 363 363 ASP ASP A . n 
A 1 413 GLU 413 364 364 GLU GLU A . n 
A 1 414 PHE 414 365 365 PHE PHE A . n 
A 1 415 ARG 415 366 366 ARG ARG A . n 
A 1 416 THR 416 367 367 THR THR A . n 
A 1 417 ALA 417 368 368 ALA ALA A . n 
A 1 418 ALA 418 369 369 ALA ALA A . n 
A 1 419 VAL 419 370 370 VAL VAL A . n 
A 1 420 GLU 420 371 371 GLU GLU A . n 
A 1 421 GLY 421 372 372 GLY GLY A . n 
A 1 422 PRO 422 373 373 PRO PRO A . n 
A 1 423 PHE 423 374 374 PHE PHE A . n 
A 1 424 VAL 424 375 375 VAL VAL A . n 
A 1 425 THR 425 376 376 THR THR A . n 
A 1 426 LEU 426 377 377 LEU LEU A . n 
A 1 427 ASP 427 378 378 ASP ASP A . n 
A 1 428 MET 428 379 379 MET MET A . n 
A 1 429 GLU 429 380 380 GLU GLU A . n 
A 1 430 ASP 430 381 381 ASP ASP A . n 
A 1 431 CYS 431 382 382 CYS CYS A . n 
A 1 432 GLY 432 383 383 GLY GLY A . n 
A 1 433 TYR 433 384 384 TYR TYR A . n 
A 1 434 ASN 434 385 385 ASN ASN A . n 
A 1 435 ILE 435 386 ?   ?   ?   A . n 
A 1 436 PRO 436 387 ?   ?   ?   A . n 
A 1 437 GLN 437 388 ?   ?   ?   A . n 
A 1 438 THR 438 389 ?   ?   ?   A . n 
A 1 439 ASP 439 390 ?   ?   ?   A . n 
A 1 440 GLU 440 391 ?   ?   ?   A . n 
A 1 441 SER 441 392 ?   ?   ?   A . n 
A 1 442 THR 442 393 ?   ?   ?   A . n 
B 1 1   MET 1   -48 ?   ?   ?   B . n 
B 1 2   ALA 2   -47 ?   ?   ?   B . n 
B 1 3   GLY 3   -46 ?   ?   ?   B . n 
B 1 4   VAL 4   -45 ?   ?   ?   B . n 
B 1 5   LEU 5   -44 ?   ?   ?   B . n 
B 1 6   PRO 6   -43 ?   ?   ?   B . n 
B 1 7   ALA 7   -42 ?   ?   ?   B . n 
B 1 8   HIS 8   -41 ?   ?   ?   B . n 
B 1 9   GLY 9   -40 ?   ?   ?   B . n 
B 1 10  THR 10  -39 ?   ?   ?   B . n 
B 1 11  GLN 11  -38 ?   ?   ?   B . n 
B 1 12  HIS 12  -37 ?   ?   ?   B . n 
B 1 13  GLY 13  -36 ?   ?   ?   B . n 
B 1 14  ILE 14  -35 ?   ?   ?   B . n 
B 1 15  ARG 15  -34 ?   ?   ?   B . n 
B 1 16  LEU 16  -33 ?   ?   ?   B . n 
B 1 17  PRO 17  -32 ?   ?   ?   B . n 
B 1 18  LEU 18  -31 ?   ?   ?   B . n 
B 1 19  ARG 19  -30 ?   ?   ?   B . n 
B 1 20  SER 20  -29 ?   ?   ?   B . n 
B 1 21  GLY 21  -28 ?   ?   ?   B . n 
B 1 22  LEU 22  -27 ?   ?   ?   B . n 
B 1 23  GLY 23  -26 ?   ?   ?   B . n 
B 1 24  GLY 24  -25 ?   ?   ?   B . n 
B 1 25  ALA 25  -24 ?   ?   ?   B . n 
B 1 26  PRO 26  -23 ?   ?   ?   B . n 
B 1 27  LEU 27  -22 ?   ?   ?   B . n 
B 1 28  GLY 28  -21 ?   ?   ?   B . n 
B 1 29  LEU 29  -20 ?   ?   ?   B . n 
B 1 30  ARG 30  -19 ?   ?   ?   B . n 
B 1 31  LEU 31  -18 ?   ?   ?   B . n 
B 1 32  PRO 32  -17 ?   ?   ?   B . n 
B 1 33  ARG 33  -16 ?   ?   ?   B . n 
B 1 34  GLU 34  -15 ?   ?   ?   B . n 
B 1 35  THR 35  -14 ?   ?   ?   B . n 
B 1 36  ASP 36  -13 ?   ?   ?   B . n 
B 1 37  GLU 37  -12 ?   ?   ?   B . n 
B 1 38  GLU 38  -11 ?   ?   ?   B . n 
B 1 39  PRO 39  -10 ?   ?   ?   B . n 
B 1 40  GLU 40  -9  ?   ?   ?   B . n 
B 1 41  GLU 41  -8  ?   ?   ?   B . n 
B 1 42  PRO 42  -7  ?   ?   ?   B . n 
B 1 43  GLY 43  -6  ?   ?   ?   B . n 
B 1 44  ARG 44  -5  ?   ?   ?   B . n 
B 1 45  ARG 45  -4  ?   ?   ?   B . n 
B 1 46  GLY 46  -3  -3  GLY GLY B . n 
B 1 47  SER 47  -2  -2  SER SER B . n 
B 1 48  PHE 48  -1  -1  PHE PHE B . n 
B 1 49  VAL 49  0   0   VAL VAL B . n 
B 1 50  GLU 50  1   1   GLU GLU B . n 
B 1 51  MET 51  2   2   MET MET B . n 
B 1 52  VAL 52  3   3   VAL VAL B . n 
B 1 53  ASP 53  4   4   ASP ASP B . n 
B 1 54  ASN 54  5   5   ASN ASN B . n 
B 1 55  LEU 55  6   6   LEU LEU B . n 
B 1 56  ARG 56  7   7   ARG ARG B . n 
B 1 57  GLY 57  8   8   GLY GLY B . n 
B 1 58  LYS 58  9   9   LYS LYS B . n 
B 1 59  SER 59  10  10  SER SER B . n 
B 1 60  GLY 60  11  11  GLY GLY B . n 
B 1 61  GLN 61  12  12  GLN GLN B . n 
B 1 62  GLY 62  13  13  GLY GLY B . n 
B 1 63  TYR 63  14  14  TYR TYR B . n 
B 1 64  TYR 64  15  15  TYR TYR B . n 
B 1 65  VAL 65  16  16  VAL VAL B . n 
B 1 66  GLU 66  17  17  GLU GLU B . n 
B 1 67  MET 67  18  18  MET MET B . n 
B 1 68  THR 68  19  19  THR THR B . n 
B 1 69  VAL 69  20  20  VAL VAL B . n 
B 1 70  GLY 70  21  21  GLY GLY B . n 
B 1 71  SER 71  22  22  SER SER B . n 
B 1 72  PRO 72  23  23  PRO PRO B . n 
B 1 73  PRO 73  24  24  PRO PRO B . n 
B 1 74  GLN 74  25  25  GLN GLN B . n 
B 1 75  THR 75  26  26  THR THR B . n 
B 1 76  LEU 76  27  27  LEU LEU B . n 
B 1 77  ASN 77  28  28  ASN ASN B . n 
B 1 78  ILE 78  29  29  ILE ILE B . n 
B 1 79  LEU 79  30  30  LEU LEU B . n 
B 1 80  VAL 80  31  31  VAL VAL B . n 
B 1 81  ASP 81  32  32  ASP ASP B . n 
B 1 82  THR 82  33  33  THR THR B . n 
B 1 83  GLY 83  34  34  GLY GLY B . n 
B 1 84  SER 84  35  35  SER SER B . n 
B 1 85  SER 85  36  36  SER SER B . n 
B 1 86  ASN 86  37  37  ASN ASN B . n 
B 1 87  PHE 87  38  38  PHE PHE B . n 
B 1 88  ALA 88  39  39  ALA ALA B . n 
B 1 89  VAL 89  40  40  VAL VAL B . n 
B 1 90  GLY 90  41  41  GLY GLY B . n 
B 1 91  ALA 91  42  42  ALA ALA B . n 
B 1 92  ALA 92  43  43  ALA ALA B . n 
B 1 93  PRO 93  44  44  PRO PRO B . n 
B 1 94  HIS 94  45  45  HIS HIS B . n 
B 1 95  PRO 95  46  46  PRO PRO B . n 
B 1 96  PHE 96  47  47  PHE PHE B . n 
B 1 97  LEU 97  48  48  LEU LEU B . n 
B 1 98  HIS 98  49  49  HIS HIS B . n 
B 1 99  ARG 99  50  50  ARG ARG B . n 
B 1 100 TYR 100 51  51  TYR TYR B . n 
B 1 101 TYR 101 52  52  TYR TYR B . n 
B 1 102 GLN 102 53  53  GLN GLN B . n 
B 1 103 ARG 103 54  54  ARG ARG B . n 
B 1 104 GLN 104 55  55  GLN GLN B . n 
B 1 105 LEU 105 56  56  LEU LEU B . n 
B 1 106 SER 106 57  57  SER SER B . n 
B 1 107 SER 107 58  58  SER SER B . n 
B 1 108 THR 108 59  59  THR THR B . n 
B 1 109 TYR 109 60  60  TYR TYR B . n 
B 1 110 ARG 110 61  61  ARG ARG B . n 
B 1 111 ASP 111 62  62  ASP ASP B . n 
B 1 112 LEU 112 63  63  LEU LEU B . n 
B 1 113 ARG 113 64  64  ARG ARG B . n 
B 1 114 LYS 114 65  65  LYS LYS B . n 
B 1 115 GLY 115 66  66  GLY GLY B . n 
B 1 116 VAL 116 67  67  VAL VAL B . n 
B 1 117 TYR 117 68  68  TYR TYR B . n 
B 1 118 VAL 118 69  69  VAL VAL B . n 
B 1 119 PRO 119 70  70  PRO PRO B . n 
B 1 120 TYR 120 71  71  TYR TYR B . n 
B 1 121 THR 121 72  72  THR THR B . n 
B 1 122 GLN 122 73  73  GLN GLN B . n 
B 1 123 GLY 123 74  74  GLY GLY B . n 
B 1 124 LYS 124 75  75  LYS LYS B . n 
B 1 125 TRP 125 76  76  TRP TRP B . n 
B 1 126 GLU 126 77  77  GLU GLU B . n 
B 1 127 GLY 127 78  78  GLY GLY B . n 
B 1 128 GLU 128 79  79  GLU GLU B . n 
B 1 129 LEU 129 80  80  LEU LEU B . n 
B 1 130 GLY 130 81  81  GLY GLY B . n 
B 1 131 THR 131 82  82  THR THR B . n 
B 1 132 ASP 132 83  83  ASP ASP B . n 
B 1 133 LEU 133 84  84  LEU LEU B . n 
B 1 134 VAL 134 85  85  VAL VAL B . n 
B 1 135 SER 135 86  86  SER SER B . n 
B 1 136 ILE 136 87  87  ILE ILE B . n 
B 1 137 PRO 137 88  88  PRO PRO B . n 
B 1 138 HIS 138 89  89  HIS HIS B . n 
B 1 139 GLY 139 90  90  GLY GLY B . n 
B 1 140 PRO 140 91  91  PRO PRO B . n 
B 1 141 ASN 141 92  92  ASN ASN B . n 
B 1 142 VAL 142 93  93  VAL VAL B . n 
B 1 143 THR 143 94  94  THR THR B . n 
B 1 144 VAL 144 95  95  VAL VAL B . n 
B 1 145 ARG 145 96  96  ARG ARG B . n 
B 1 146 ALA 146 97  97  ALA ALA B . n 
B 1 147 ASN 147 98  98  ASN ASN B . n 
B 1 148 ILE 148 99  99  ILE ILE B . n 
B 1 149 ALA 149 100 100 ALA ALA B . n 
B 1 150 ALA 150 101 101 ALA ALA B . n 
B 1 151 ILE 151 102 102 ILE ILE B . n 
B 1 152 THR 152 103 103 THR THR B . n 
B 1 153 GLU 153 104 104 GLU GLU B . n 
B 1 154 SER 154 105 105 SER SER B . n 
B 1 155 ASP 155 106 106 ASP ASP B . n 
B 1 156 LYS 156 107 107 LYS LYS B . n 
B 1 157 PHE 157 108 108 PHE PHE B . n 
B 1 158 PHE 158 109 109 PHE PHE B . n 
B 1 159 ILE 159 110 110 ILE ILE B . n 
B 1 160 ASN 160 111 111 ASN ASN B . n 
B 1 161 GLY 161 112 112 GLY GLY B . n 
B 1 162 SER 162 113 113 SER SER B . n 
B 1 163 ASN 163 114 114 ASN ASN B . n 
B 1 164 TRP 164 115 115 TRP TRP B . n 
B 1 165 GLU 165 116 116 GLU GLU B . n 
B 1 166 GLY 166 117 117 GLY GLY B . n 
B 1 167 ILE 167 118 118 ILE ILE B . n 
B 1 168 LEU 168 119 119 LEU LEU B . n 
B 1 169 GLY 169 120 120 GLY GLY B . n 
B 1 170 LEU 170 121 121 LEU LEU B . n 
B 1 171 ALA 171 122 122 ALA ALA B . n 
B 1 172 TYR 172 123 123 TYR TYR B . n 
B 1 173 ALA 173 124 124 ALA ALA B . n 
B 1 174 GLU 174 125 125 GLU GLU B . n 
B 1 175 ILE 175 126 126 ILE ILE B . n 
B 1 176 ALA 176 127 127 ALA ALA B . n 
B 1 177 ARG 177 128 128 ARG ARG B . n 
B 1 178 PRO 178 129 129 PRO PRO B . n 
B 1 179 ASP 179 130 130 ASP ASP B . n 
B 1 180 ASP 180 131 131 ASP ASP B . n 
B 1 181 SER 181 132 132 SER SER B . n 
B 1 182 LEU 182 133 133 LEU LEU B . n 
B 1 183 GLU 183 134 134 GLU GLU B . n 
B 1 184 PRO 184 135 135 PRO PRO B . n 
B 1 185 PHE 185 136 136 PHE PHE B . n 
B 1 186 PHE 186 137 137 PHE PHE B . n 
B 1 187 ASP 187 138 138 ASP ASP B . n 
B 1 188 SER 188 139 139 SER SER B . n 
B 1 189 LEU 189 140 140 LEU LEU B . n 
B 1 190 VAL 190 141 141 VAL VAL B . n 
B 1 191 LYS 191 142 142 LYS LYS B . n 
B 1 192 GLN 192 143 143 GLN GLN B . n 
B 1 193 THR 193 144 144 THR THR B . n 
B 1 194 HIS 194 145 145 HIS HIS B . n 
B 1 195 VAL 195 146 146 VAL VAL B . n 
B 1 196 PRO 196 147 147 PRO PRO B . n 
B 1 197 ASN 197 148 148 ASN ASN B . n 
B 1 198 LEU 198 149 149 LEU LEU B . n 
B 1 199 PHE 199 150 150 PHE PHE B . n 
B 1 200 SER 200 151 151 SER SER B . n 
B 1 201 LEU 201 152 152 LEU LEU B . n 
B 1 202 GLN 202 153 153 GLN GLN B . n 
B 1 203 LEU 203 154 154 LEU LEU B . n 
B 1 204 CYS 204 155 155 CYS CYS B . n 
B 1 205 GLY 205 156 156 GLY GLY B . n 
B 1 206 ALA 206 157 157 ALA ALA B . n 
B 1 207 GLY 207 158 158 GLY GLY B . n 
B 1 208 PHE 208 159 159 PHE PHE B . n 
B 1 209 PRO 209 160 160 PRO PRO B . n 
B 1 210 LEU 210 161 161 LEU LEU B . n 
B 1 211 ASN 211 162 162 ASN ASN B . n 
B 1 212 GLN 212 163 163 GLN GLN B . n 
B 1 213 SER 213 164 164 SER SER B . n 
B 1 214 GLU 214 165 165 GLU GLU B . n 
B 1 215 VAL 215 166 166 VAL VAL B . n 
B 1 216 LEU 216 167 167 LEU LEU B . n 
B 1 217 ALA 217 168 168 ALA ALA B . n 
B 1 218 SER 218 169 169 SER SER B . n 
B 1 219 VAL 219 170 170 VAL VAL B . n 
B 1 220 GLY 220 171 171 GLY GLY B . n 
B 1 221 GLY 221 172 172 GLY GLY B . n 
B 1 222 SER 222 173 173 SER SER B . n 
B 1 223 MET 223 174 174 MET MET B . n 
B 1 224 ILE 224 175 175 ILE ILE B . n 
B 1 225 ILE 225 176 176 ILE ILE B . n 
B 1 226 GLY 226 177 177 GLY GLY B . n 
B 1 227 GLY 227 178 178 GLY GLY B . n 
B 1 228 ILE 228 179 179 ILE ILE B . n 
B 1 229 ASP 229 180 180 ASP ASP B . n 
B 1 230 HIS 230 181 181 HIS HIS B . n 
B 1 231 SER 231 182 182 SER SER B . n 
B 1 232 LEU 232 183 183 LEU LEU B . n 
B 1 233 TYR 233 184 184 TYR TYR B . n 
B 1 234 THR 234 185 185 THR THR B . n 
B 1 235 GLY 235 186 186 GLY GLY B . n 
B 1 236 SER 236 187 187 SER SER B . n 
B 1 237 LEU 237 188 188 LEU LEU B . n 
B 1 238 TRP 238 189 189 TRP TRP B . n 
B 1 239 TYR 239 190 190 TYR TYR B . n 
B 1 240 THR 240 191 191 THR THR B . n 
B 1 241 PRO 241 192 192 PRO PRO B . n 
B 1 242 ILE 242 193 193 ILE ILE B . n 
B 1 243 ARG 243 194 194 ARG ARG B . n 
B 1 244 ARG 244 195 195 ARG ARG B . n 
B 1 245 GLU 245 196 196 GLU GLU B . n 
B 1 246 TRP 246 197 197 TRP TRP B . n 
B 1 247 TYR 247 198 198 TYR TYR B . n 
B 1 248 TYR 248 199 199 TYR TYR B . n 
B 1 249 GLU 249 200 200 GLU GLU B . n 
B 1 250 VAL 250 201 201 VAL VAL B . n 
B 1 251 ILE 251 202 202 ILE ILE B . n 
B 1 252 ILE 252 203 203 ILE ILE B . n 
B 1 253 VAL 253 204 204 VAL VAL B . n 
B 1 254 ARG 254 205 205 ARG ARG B . n 
B 1 255 VAL 255 206 206 VAL VAL B . n 
B 1 256 GLU 256 207 207 GLU GLU B . n 
B 1 257 ILE 257 208 208 ILE ILE B . n 
B 1 258 ASN 258 209 209 ASN ASN B . n 
B 1 259 GLY 259 210 210 GLY GLY B . n 
B 1 260 GLN 260 211 211 GLN GLN B . n 
B 1 261 ASP 261 212 212 ASP ASP B . n 
B 1 262 LEU 262 213 213 LEU LEU B . n 
B 1 263 LYS 263 214 214 LYS LYS B . n 
B 1 264 MET 264 215 215 MET MET B . n 
B 1 265 ASP 265 216 216 ASP ASP B . n 
B 1 266 CYS 266 217 217 CYS CYS B . n 
B 1 267 LYS 267 218 218 LYS LYS B . n 
B 1 268 GLU 268 219 219 GLU GLU B . n 
B 1 269 TYR 269 220 220 TYR TYR B . n 
B 1 270 ASN 270 221 221 ASN ASN B . n 
B 1 271 TYR 271 222 222 TYR TYR B . n 
B 1 272 ASP 272 223 223 ASP ASP B . n 
B 1 273 LYS 273 224 224 LYS LYS B . n 
B 1 274 SER 274 225 225 SER SER B . n 
B 1 275 ILE 275 226 226 ILE ILE B . n 
B 1 276 VAL 276 227 227 VAL VAL B . n 
B 1 277 ASP 277 228 228 ASP ASP B . n 
B 1 278 SER 278 229 229 SER SER B . n 
B 1 279 GLY 279 230 230 GLY GLY B . n 
B 1 280 THR 280 231 231 THR THR B . n 
B 1 281 THR 281 232 232 THR THR B . n 
B 1 282 ASN 282 233 233 ASN ASN B . n 
B 1 283 LEU 283 234 234 LEU LEU B . n 
B 1 284 ARG 284 235 235 ARG ARG B . n 
B 1 285 LEU 285 236 236 LEU LEU B . n 
B 1 286 PRO 286 237 237 PRO PRO B . n 
B 1 287 LYS 287 238 238 LYS LYS B . n 
B 1 288 LYS 288 239 239 LYS LYS B . n 
B 1 289 VAL 289 240 240 VAL VAL B . n 
B 1 290 PHE 290 241 241 PHE PHE B . n 
B 1 291 GLU 291 242 242 GLU GLU B . n 
B 1 292 ALA 292 243 243 ALA ALA B . n 
B 1 293 ALA 293 244 244 ALA ALA B . n 
B 1 294 VAL 294 245 245 VAL VAL B . n 
B 1 295 LYS 295 246 246 LYS LYS B . n 
B 1 296 SER 296 247 247 SER SER B . n 
B 1 297 ILE 297 248 248 ILE ILE B . n 
B 1 298 LYS 298 249 249 LYS LYS B . n 
B 1 299 ALA 299 250 250 ALA ALA B . n 
B 1 300 ALA 300 251 251 ALA ALA B . n 
B 1 301 SER 301 252 252 SER SER B . n 
B 1 302 SER 302 253 253 SER SER B . n 
B 1 303 THR 303 254 254 THR THR B . n 
B 1 304 GLU 304 255 255 GLU GLU B . n 
B 1 305 LYS 305 256 256 LYS LYS B . n 
B 1 306 PHE 306 257 257 PHE PHE B . n 
B 1 307 PRO 307 258 258 PRO PRO B . n 
B 1 308 ASP 308 259 259 ASP ASP B . n 
B 1 309 GLY 309 260 260 GLY GLY B . n 
B 1 310 PHE 310 261 261 PHE PHE B . n 
B 1 311 TRP 311 262 262 TRP TRP B . n 
B 1 312 LEU 312 263 263 LEU LEU B . n 
B 1 313 GLY 313 264 264 GLY GLY B . n 
B 1 314 GLU 314 265 265 GLU GLU B . n 
B 1 315 GLN 315 266 266 GLN GLN B . n 
B 1 316 LEU 316 267 267 LEU LEU B . n 
B 1 317 VAL 317 268 268 VAL VAL B . n 
B 1 318 CYS 318 269 269 CYS CYS B . n 
B 1 319 TRP 319 270 270 TRP TRP B . n 
B 1 320 GLN 320 271 271 GLN GLN B . n 
B 1 321 ALA 321 272 272 ALA ALA B . n 
B 1 322 GLY 322 273 273 GLY GLY B . n 
B 1 323 THR 323 274 274 THR THR B . n 
B 1 324 THR 324 275 275 THR THR B . n 
B 1 325 PRO 325 276 276 PRO PRO B . n 
B 1 326 TRP 326 277 277 TRP TRP B . n 
B 1 327 ASN 327 278 278 ASN ASN B . n 
B 1 328 ILE 328 279 279 ILE ILE B . n 
B 1 329 PHE 329 280 280 PHE PHE B . n 
B 1 330 PRO 330 281 281 PRO PRO B . n 
B 1 331 VAL 331 282 282 VAL VAL B . n 
B 1 332 ILE 332 283 283 ILE ILE B . n 
B 1 333 SER 333 284 284 SER SER B . n 
B 1 334 LEU 334 285 285 LEU LEU B . n 
B 1 335 TYR 335 286 286 TYR TYR B . n 
B 1 336 LEU 336 287 287 LEU LEU B . n 
B 1 337 MET 337 288 288 MET MET B . n 
B 1 338 GLY 338 289 289 GLY GLY B . n 
B 1 339 GLU 339 290 290 GLU GLU B . n 
B 1 340 VAL 340 291 291 VAL VAL B . n 
B 1 341 THR 341 292 292 THR THR B . n 
B 1 342 ASN 342 293 293 ASN ASN B . n 
B 1 343 GLN 343 294 294 GLN GLN B . n 
B 1 344 SER 344 295 295 SER SER B . n 
B 1 345 PHE 345 296 296 PHE PHE B . n 
B 1 346 ARG 346 297 297 ARG ARG B . n 
B 1 347 ILE 347 298 298 ILE ILE B . n 
B 1 348 THR 348 299 299 THR THR B . n 
B 1 349 ILE 349 300 300 ILE ILE B . n 
B 1 350 LEU 350 301 301 LEU LEU B . n 
B 1 351 PRO 351 302 302 PRO PRO B . n 
B 1 352 GLN 352 303 303 GLN GLN B . n 
B 1 353 GLN 353 304 304 GLN GLN B . n 
B 1 354 TYR 354 305 305 TYR TYR B . n 
B 1 355 LEU 355 306 306 LEU LEU B . n 
B 1 356 ARG 356 307 307 ARG ARG B . n 
B 1 357 PRO 357 308 308 PRO PRO B . n 
B 1 358 VAL 358 309 309 VAL VAL B . n 
B 1 359 GLU 359 310 310 GLU GLU B . n 
B 1 360 ASP 360 311 311 ASP ASP B . n 
B 1 361 VAL 361 312 312 VAL VAL B . n 
B 1 362 ALA 362 313 313 ALA ALA B . n 
B 1 363 THR 363 314 314 THR THR B . n 
B 1 364 SER 364 315 315 SER SER B . n 
B 1 365 GLN 365 316 316 GLN GLN B . n 
B 1 366 ASP 366 317 317 ASP ASP B . n 
B 1 367 ASP 367 318 318 ASP ASP B . n 
B 1 368 CYS 368 319 319 CYS CYS B . n 
B 1 369 TYR 369 320 320 TYR TYR B . n 
B 1 370 LYS 370 321 321 LYS LYS B . n 
B 1 371 PHE 371 322 322 PHE PHE B . n 
B 1 372 ALA 372 323 323 ALA ALA B . n 
B 1 373 ILE 373 324 324 ILE ILE B . n 
B 1 374 SER 374 325 325 SER SER B . n 
B 1 375 GLN 375 326 326 GLN GLN B . n 
B 1 376 SER 376 327 327 SER SER B . n 
B 1 377 SER 377 328 328 SER SER B . n 
B 1 378 THR 378 329 329 THR THR B . n 
B 1 379 GLY 379 330 330 GLY GLY B . n 
B 1 380 THR 380 331 331 THR THR B . n 
B 1 381 VAL 381 332 332 VAL VAL B . n 
B 1 382 MET 382 333 333 MET MET B . n 
B 1 383 GLY 383 334 334 GLY GLY B . n 
B 1 384 ALA 384 335 335 ALA ALA B . n 
B 1 385 VAL 385 336 336 VAL VAL B . n 
B 1 386 ILE 386 337 337 ILE ILE B . n 
B 1 387 MET 387 338 338 MET MET B . n 
B 1 388 GLU 388 339 339 GLU GLU B . n 
B 1 389 GLY 389 340 340 GLY GLY B . n 
B 1 390 PHE 390 341 341 PHE PHE B . n 
B 1 391 TYR 391 342 342 TYR TYR B . n 
B 1 392 VAL 392 343 343 VAL VAL B . n 
B 1 393 VAL 393 344 344 VAL VAL B . n 
B 1 394 PHE 394 345 345 PHE PHE B . n 
B 1 395 ASP 395 346 346 ASP ASP B . n 
B 1 396 ARG 396 347 347 ARG ARG B . n 
B 1 397 ALA 397 348 348 ALA ALA B . n 
B 1 398 ARG 398 349 349 ARG ARG B . n 
B 1 399 LYS 399 350 350 LYS LYS B . n 
B 1 400 ARG 400 351 351 ARG ARG B . n 
B 1 401 ILE 401 352 352 ILE ILE B . n 
B 1 402 GLY 402 353 353 GLY GLY B . n 
B 1 403 PHE 403 354 354 PHE PHE B . n 
B 1 404 ALA 404 355 355 ALA ALA B . n 
B 1 405 VAL 405 356 356 VAL VAL B . n 
B 1 406 SER 406 357 357 SER SER B . n 
B 1 407 ALA 407 358 358 ALA ALA B . n 
B 1 408 CYS 408 359 359 CYS CYS B . n 
B 1 409 HIS 409 360 360 HIS HIS B . n 
B 1 410 VAL 410 361 361 VAL VAL B . n 
B 1 411 HIS 411 362 362 HIS HIS B . n 
B 1 412 ASP 412 363 363 ASP ASP B . n 
B 1 413 GLU 413 364 364 GLU GLU B . n 
B 1 414 PHE 414 365 365 PHE PHE B . n 
B 1 415 ARG 415 366 366 ARG ARG B . n 
B 1 416 THR 416 367 367 THR THR B . n 
B 1 417 ALA 417 368 368 ALA ALA B . n 
B 1 418 ALA 418 369 369 ALA ALA B . n 
B 1 419 VAL 419 370 370 VAL VAL B . n 
B 1 420 GLU 420 371 371 GLU GLU B . n 
B 1 421 GLY 421 372 372 GLY GLY B . n 
B 1 422 PRO 422 373 373 PRO PRO B . n 
B 1 423 PHE 423 374 374 PHE PHE B . n 
B 1 424 VAL 424 375 375 VAL VAL B . n 
B 1 425 THR 425 376 376 THR THR B . n 
B 1 426 LEU 426 377 377 LEU LEU B . n 
B 1 427 ASP 427 378 378 ASP ASP B . n 
B 1 428 MET 428 379 379 MET MET B . n 
B 1 429 GLU 429 380 380 GLU GLU B . n 
B 1 430 ASP 430 381 381 ASP ASP B . n 
B 1 431 CYS 431 382 382 CYS CYS B . n 
B 1 432 GLY 432 383 383 GLY GLY B . n 
B 1 433 TYR 433 384 384 TYR TYR B . n 
B 1 434 ASN 434 385 385 ASN ASN B . n 
B 1 435 ILE 435 386 ?   ?   ?   B . n 
B 1 436 PRO 436 387 ?   ?   ?   B . n 
B 1 437 GLN 437 388 ?   ?   ?   B . n 
B 1 438 THR 438 389 ?   ?   ?   B . n 
B 1 439 ASP 439 390 ?   ?   ?   B . n 
B 1 440 GLU 440 391 ?   ?   ?   B . n 
B 1 441 SER 441 392 ?   ?   ?   B . n 
B 1 442 THR 442 393 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 4RX 1   401 1   4RX SX1 A . 
D 2 4RX 1   401 2   4RX SX1 B . 
E 3 GOL 1   402 1   GOL GOL B . 
F 3 GOL 1   403 2   GOL GOL B . 
G 4 HOH 1   501 161 HOH HOH A . 
G 4 HOH 2   502 345 HOH HOH A . 
G 4 HOH 3   503 14  HOH HOH A . 
G 4 HOH 4   504 102 HOH HOH A . 
G 4 HOH 5   505 482 HOH HOH A . 
G 4 HOH 6   506 405 HOH HOH A . 
G 4 HOH 7   507 76  HOH HOH A . 
G 4 HOH 8   508 157 HOH HOH A . 
G 4 HOH 9   509 223 HOH HOH A . 
G 4 HOH 10  510 305 HOH HOH A . 
G 4 HOH 11  511 12  HOH HOH A . 
G 4 HOH 12  512 354 HOH HOH A . 
G 4 HOH 13  513 133 HOH HOH A . 
G 4 HOH 14  514 481 HOH HOH A . 
G 4 HOH 15  515 390 HOH HOH A . 
G 4 HOH 16  516 41  HOH HOH A . 
G 4 HOH 17  517 138 HOH HOH A . 
G 4 HOH 18  518 180 HOH HOH A . 
G 4 HOH 19  519 176 HOH HOH A . 
G 4 HOH 20  520 6   HOH HOH A . 
G 4 HOH 21  521 433 HOH HOH A . 
G 4 HOH 22  522 107 HOH HOH A . 
G 4 HOH 23  523 65  HOH HOH A . 
G 4 HOH 24  524 33  HOH HOH A . 
G 4 HOH 25  525 36  HOH HOH A . 
G 4 HOH 26  526 205 HOH HOH A . 
G 4 HOH 27  527 50  HOH HOH A . 
G 4 HOH 28  528 461 HOH HOH A . 
G 4 HOH 29  529 142 HOH HOH A . 
G 4 HOH 30  530 116 HOH HOH A . 
G 4 HOH 31  531 168 HOH HOH A . 
G 4 HOH 32  532 90  HOH HOH A . 
G 4 HOH 33  533 240 HOH HOH A . 
G 4 HOH 34  534 351 HOH HOH A . 
G 4 HOH 35  535 83  HOH HOH A . 
G 4 HOH 36  536 32  HOH HOH A . 
G 4 HOH 37  537 226 HOH HOH A . 
G 4 HOH 38  538 319 HOH HOH A . 
G 4 HOH 39  539 2   HOH HOH A . 
G 4 HOH 40  540 9   HOH HOH A . 
G 4 HOH 41  541 428 HOH HOH A . 
G 4 HOH 42  542 13  HOH HOH A . 
G 4 HOH 43  543 222 HOH HOH A . 
G 4 HOH 44  544 236 HOH HOH A . 
G 4 HOH 45  545 327 HOH HOH A . 
G 4 HOH 46  546 39  HOH HOH A . 
G 4 HOH 47  547 82  HOH HOH A . 
G 4 HOH 48  548 42  HOH HOH A . 
G 4 HOH 49  549 233 HOH HOH A . 
G 4 HOH 50  550 384 HOH HOH A . 
G 4 HOH 51  551 118 HOH HOH A . 
G 4 HOH 52  552 92  HOH HOH A . 
G 4 HOH 53  553 239 HOH HOH A . 
G 4 HOH 54  554 146 HOH HOH A . 
G 4 HOH 55  555 329 HOH HOH A . 
G 4 HOH 56  556 75  HOH HOH A . 
G 4 HOH 57  557 5   HOH HOH A . 
G 4 HOH 58  558 149 HOH HOH A . 
G 4 HOH 59  559 173 HOH HOH A . 
G 4 HOH 60  560 191 HOH HOH A . 
G 4 HOH 61  561 435 HOH HOH A . 
G 4 HOH 62  562 93  HOH HOH A . 
G 4 HOH 63  563 170 HOH HOH A . 
G 4 HOH 64  564 321 HOH HOH A . 
G 4 HOH 65  565 29  HOH HOH A . 
G 4 HOH 66  566 478 HOH HOH A . 
G 4 HOH 67  567 331 HOH HOH A . 
G 4 HOH 68  568 393 HOH HOH A . 
G 4 HOH 69  569 432 HOH HOH A . 
G 4 HOH 70  570 110 HOH HOH A . 
G 4 HOH 71  571 174 HOH HOH A . 
G 4 HOH 72  572 79  HOH HOH A . 
G 4 HOH 73  573 193 HOH HOH A . 
G 4 HOH 74  574 71  HOH HOH A . 
G 4 HOH 75  575 95  HOH HOH A . 
G 4 HOH 76  576 323 HOH HOH A . 
G 4 HOH 77  577 48  HOH HOH A . 
G 4 HOH 78  578 94  HOH HOH A . 
G 4 HOH 79  579 58  HOH HOH A . 
G 4 HOH 80  580 480 HOH HOH A . 
G 4 HOH 81  581 40  HOH HOH A . 
G 4 HOH 82  582 96  HOH HOH A . 
G 4 HOH 83  583 283 HOH HOH A . 
G 4 HOH 84  584 210 HOH HOH A . 
G 4 HOH 85  585 145 HOH HOH A . 
G 4 HOH 86  586 135 HOH HOH A . 
G 4 HOH 87  587 20  HOH HOH A . 
G 4 HOH 88  588 332 HOH HOH A . 
G 4 HOH 89  589 396 HOH HOH A . 
G 4 HOH 90  590 403 HOH HOH A . 
G 4 HOH 91  591 427 HOH HOH A . 
G 4 HOH 92  592 254 HOH HOH A . 
G 4 HOH 93  593 220 HOH HOH A . 
G 4 HOH 94  594 104 HOH HOH A . 
G 4 HOH 95  595 339 HOH HOH A . 
G 4 HOH 96  596 192 HOH HOH A . 
G 4 HOH 97  597 258 HOH HOH A . 
G 4 HOH 98  598 391 HOH HOH A . 
G 4 HOH 99  599 129 HOH HOH A . 
G 4 HOH 100 600 72  HOH HOH A . 
G 4 HOH 101 601 316 HOH HOH A . 
G 4 HOH 102 602 85  HOH HOH A . 
G 4 HOH 103 603 248 HOH HOH A . 
G 4 HOH 104 604 88  HOH HOH A . 
G 4 HOH 105 605 109 HOH HOH A . 
G 4 HOH 106 606 151 HOH HOH A . 
G 4 HOH 107 607 31  HOH HOH A . 
G 4 HOH 108 608 208 HOH HOH A . 
G 4 HOH 109 609 268 HOH HOH A . 
G 4 HOH 110 610 429 HOH HOH A . 
G 4 HOH 111 611 290 HOH HOH A . 
G 4 HOH 112 612 66  HOH HOH A . 
G 4 HOH 113 613 231 HOH HOH A . 
G 4 HOH 114 614 73  HOH HOH A . 
G 4 HOH 115 615 188 HOH HOH A . 
G 4 HOH 116 616 286 HOH HOH A . 
G 4 HOH 117 617 263 HOH HOH A . 
G 4 HOH 118 618 211 HOH HOH A . 
G 4 HOH 119 619 111 HOH HOH A . 
G 4 HOH 120 620 214 HOH HOH A . 
G 4 HOH 121 621 115 HOH HOH A . 
G 4 HOH 122 622 47  HOH HOH A . 
G 4 HOH 123 623 144 HOH HOH A . 
G 4 HOH 124 624 19  HOH HOH A . 
G 4 HOH 125 625 360 HOH HOH A . 
G 4 HOH 126 626 256 HOH HOH A . 
G 4 HOH 127 627 477 HOH HOH A . 
G 4 HOH 128 628 156 HOH HOH A . 
G 4 HOH 129 629 119 HOH HOH A . 
G 4 HOH 130 630 22  HOH HOH A . 
G 4 HOH 131 631 183 HOH HOH A . 
G 4 HOH 132 632 165 HOH HOH A . 
G 4 HOH 133 633 244 HOH HOH A . 
G 4 HOH 134 634 420 HOH HOH A . 
G 4 HOH 135 635 400 HOH HOH A . 
G 4 HOH 136 636 148 HOH HOH A . 
G 4 HOH 137 637 160 HOH HOH A . 
G 4 HOH 138 638 97  HOH HOH A . 
G 4 HOH 139 639 68  HOH HOH A . 
G 4 HOH 140 640 318 HOH HOH A . 
G 4 HOH 141 641 59  HOH HOH A . 
G 4 HOH 142 642 392 HOH HOH A . 
G 4 HOH 143 643 51  HOH HOH A . 
G 4 HOH 144 644 143 HOH HOH A . 
G 4 HOH 145 645 355 HOH HOH A . 
G 4 HOH 146 646 69  HOH HOH A . 
G 4 HOH 147 647 333 HOH HOH A . 
G 4 HOH 148 648 87  HOH HOH A . 
G 4 HOH 149 649 356 HOH HOH A . 
G 4 HOH 150 650 24  HOH HOH A . 
G 4 HOH 151 651 217 HOH HOH A . 
G 4 HOH 152 652 128 HOH HOH A . 
G 4 HOH 153 653 277 HOH HOH A . 
G 4 HOH 154 654 398 HOH HOH A . 
G 4 HOH 155 655 410 HOH HOH A . 
G 4 HOH 156 656 338 HOH HOH A . 
G 4 HOH 157 657 330 HOH HOH A . 
G 4 HOH 158 658 114 HOH HOH A . 
G 4 HOH 159 659 225 HOH HOH A . 
G 4 HOH 160 660 434 HOH HOH A . 
G 4 HOH 161 661 127 HOH HOH A . 
G 4 HOH 162 662 294 HOH HOH A . 
G 4 HOH 163 663 246 HOH HOH A . 
G 4 HOH 164 664 147 HOH HOH A . 
G 4 HOH 165 665 4   HOH HOH A . 
G 4 HOH 166 666 189 HOH HOH A . 
G 4 HOH 167 667 56  HOH HOH A . 
G 4 HOH 168 668 203 HOH HOH A . 
G 4 HOH 169 669 401 HOH HOH A . 
G 4 HOH 170 670 186 HOH HOH A . 
G 4 HOH 171 671 74  HOH HOH A . 
G 4 HOH 172 672 37  HOH HOH A . 
G 4 HOH 173 673 385 HOH HOH A . 
G 4 HOH 174 674 123 HOH HOH A . 
G 4 HOH 175 675 251 HOH HOH A . 
G 4 HOH 176 676 207 HOH HOH A . 
G 4 HOH 177 677 383 HOH HOH A . 
G 4 HOH 178 678 235 HOH HOH A . 
G 4 HOH 179 679 422 HOH HOH A . 
G 4 HOH 180 680 271 HOH HOH A . 
G 4 HOH 181 681 425 HOH HOH A . 
G 4 HOH 182 682 397 HOH HOH A . 
G 4 HOH 183 683 404 HOH HOH A . 
G 4 HOH 184 684 243 HOH HOH A . 
G 4 HOH 185 685 167 HOH HOH A . 
G 4 HOH 186 686 197 HOH HOH A . 
G 4 HOH 187 687 430 HOH HOH A . 
G 4 HOH 188 688 241 HOH HOH A . 
G 4 HOH 189 689 255 HOH HOH A . 
G 4 HOH 190 690 426 HOH HOH A . 
G 4 HOH 191 691 281 HOH HOH A . 
G 4 HOH 192 692 386 HOH HOH A . 
G 4 HOH 193 693 431 HOH HOH A . 
G 4 HOH 194 694 352 HOH HOH A . 
G 4 HOH 195 695 394 HOH HOH A . 
G 4 HOH 196 696 54  HOH HOH A . 
G 4 HOH 197 697 408 HOH HOH A . 
G 4 HOH 198 698 357 HOH HOH A . 
G 4 HOH 199 699 121 HOH HOH A . 
G 4 HOH 200 700 387 HOH HOH A . 
G 4 HOH 201 701 395 HOH HOH A . 
G 4 HOH 202 702 367 HOH HOH A . 
G 4 HOH 203 703 311 HOH HOH A . 
G 4 HOH 204 704 172 HOH HOH A . 
G 4 HOH 205 705 282 HOH HOH A . 
G 4 HOH 206 706 184 HOH HOH A . 
G 4 HOH 207 707 379 HOH HOH A . 
G 4 HOH 208 708 300 HOH HOH A . 
G 4 HOH 209 709 238 HOH HOH A . 
G 4 HOH 210 710 423 HOH HOH A . 
G 4 HOH 211 711 424 HOH HOH A . 
G 4 HOH 212 712 322 HOH HOH A . 
G 4 HOH 213 713 406 HOH HOH A . 
G 4 HOH 214 714 353 HOH HOH A . 
G 4 HOH 215 715 46  HOH HOH A . 
G 4 HOH 216 716 312 HOH HOH A . 
G 4 HOH 217 717 295 HOH HOH A . 
G 4 HOH 218 718 460 HOH HOH A . 
G 4 HOH 219 719 402 HOH HOH A . 
G 4 HOH 220 720 421 HOH HOH A . 
G 4 HOH 221 721 337 HOH HOH A . 
G 4 HOH 222 722 213 HOH HOH A . 
G 4 HOH 223 723 269 HOH HOH A . 
G 4 HOH 224 724 314 HOH HOH A . 
G 4 HOH 225 725 249 HOH HOH A . 
G 4 HOH 226 726 341 HOH HOH A . 
G 4 HOH 227 727 389 HOH HOH A . 
G 4 HOH 228 728 399 HOH HOH A . 
G 4 HOH 229 729 371 HOH HOH A . 
G 4 HOH 230 730 358 HOH HOH A . 
G 4 HOH 231 731 463 HOH HOH A . 
G 4 HOH 232 732 342 HOH HOH A . 
G 4 HOH 233 733 362 HOH HOH A . 
G 4 HOH 234 734 307 HOH HOH A . 
G 4 HOH 235 735 166 HOH HOH A . 
G 4 HOH 236 736 462 HOH HOH A . 
G 4 HOH 237 737 181 HOH HOH A . 
G 4 HOH 238 738 407 HOH HOH A . 
G 4 HOH 239 739 218 HOH HOH A . 
H 4 HOH 1   501 292 HOH HOH B . 
H 4 HOH 2   502 310 HOH HOH B . 
H 4 HOH 3   503 202 HOH HOH B . 
H 4 HOH 4   504 187 HOH HOH B . 
H 4 HOH 5   505 198 HOH HOH B . 
H 4 HOH 6   506 28  HOH HOH B . 
H 4 HOH 7   507 195 HOH HOH B . 
H 4 HOH 8   508 451 HOH HOH B . 
H 4 HOH 9   509 245 HOH HOH B . 
H 4 HOH 10  510 301 HOH HOH B . 
H 4 HOH 11  511 169 HOH HOH B . 
H 4 HOH 12  512 7   HOH HOH B . 
H 4 HOH 13  513 1   HOH HOH B . 
H 4 HOH 14  514 10  HOH HOH B . 
H 4 HOH 15  515 164 HOH HOH B . 
H 4 HOH 16  516 34  HOH HOH B . 
H 4 HOH 17  517 108 HOH HOH B . 
H 4 HOH 18  518 21  HOH HOH B . 
H 4 HOH 19  519 11  HOH HOH B . 
H 4 HOH 20  520 43  HOH HOH B . 
H 4 HOH 21  521 266 HOH HOH B . 
H 4 HOH 22  522 45  HOH HOH B . 
H 4 HOH 23  523 260 HOH HOH B . 
H 4 HOH 24  524 91  HOH HOH B . 
H 4 HOH 25  525 296 HOH HOH B . 
H 4 HOH 26  526 459 HOH HOH B . 
H 4 HOH 27  527 57  HOH HOH B . 
H 4 HOH 28  528 77  HOH HOH B . 
H 4 HOH 29  529 448 HOH HOH B . 
H 4 HOH 30  530 99  HOH HOH B . 
H 4 HOH 31  531 453 HOH HOH B . 
H 4 HOH 32  532 60  HOH HOH B . 
H 4 HOH 33  533 25  HOH HOH B . 
H 4 HOH 34  534 445 HOH HOH B . 
H 4 HOH 35  535 228 HOH HOH B . 
H 4 HOH 36  536 126 HOH HOH B . 
H 4 HOH 37  537 370 HOH HOH B . 
H 4 HOH 38  538 125 HOH HOH B . 
H 4 HOH 39  539 466 HOH HOH B . 
H 4 HOH 40  540 259 HOH HOH B . 
H 4 HOH 41  541 465 HOH HOH B . 
H 4 HOH 42  542 124 HOH HOH B . 
H 4 HOH 43  543 155 HOH HOH B . 
H 4 HOH 44  544 86  HOH HOH B . 
H 4 HOH 45  545 227 HOH HOH B . 
H 4 HOH 46  546 267 HOH HOH B . 
H 4 HOH 47  547 35  HOH HOH B . 
H 4 HOH 48  548 67  HOH HOH B . 
H 4 HOH 49  549 237 HOH HOH B . 
H 4 HOH 50  550 158 HOH HOH B . 
H 4 HOH 51  551 440 HOH HOH B . 
H 4 HOH 52  552 185 HOH HOH B . 
H 4 HOH 53  553 81  HOH HOH B . 
H 4 HOH 54  554 346 HOH HOH B . 
H 4 HOH 55  555 117 HOH HOH B . 
H 4 HOH 56  556 313 HOH HOH B . 
H 4 HOH 57  557 103 HOH HOH B . 
H 4 HOH 58  558 53  HOH HOH B . 
H 4 HOH 59  559 44  HOH HOH B . 
H 4 HOH 60  560 152 HOH HOH B . 
H 4 HOH 61  561 105 HOH HOH B . 
H 4 HOH 62  562 137 HOH HOH B . 
H 4 HOH 63  563 447 HOH HOH B . 
H 4 HOH 64  564 23  HOH HOH B . 
H 4 HOH 65  565 450 HOH HOH B . 
H 4 HOH 66  566 247 HOH HOH B . 
H 4 HOH 67  567 375 HOH HOH B . 
H 4 HOH 68  568 366 HOH HOH B . 
H 4 HOH 69  569 350 HOH HOH B . 
H 4 HOH 70  570 30  HOH HOH B . 
H 4 HOH 71  571 284 HOH HOH B . 
H 4 HOH 72  572 61  HOH HOH B . 
H 4 HOH 73  573 15  HOH HOH B . 
H 4 HOH 74  574 3   HOH HOH B . 
H 4 HOH 75  575 171 HOH HOH B . 
H 4 HOH 76  576 64  HOH HOH B . 
H 4 HOH 77  577 454 HOH HOH B . 
H 4 HOH 78  578 122 HOH HOH B . 
H 4 HOH 79  579 190 HOH HOH B . 
H 4 HOH 80  580 324 HOH HOH B . 
H 4 HOH 81  581 374 HOH HOH B . 
H 4 HOH 82  582 326 HOH HOH B . 
H 4 HOH 83  583 112 HOH HOH B . 
H 4 HOH 84  584 287 HOH HOH B . 
H 4 HOH 85  585 55  HOH HOH B . 
H 4 HOH 86  586 372 HOH HOH B . 
H 4 HOH 87  587 275 HOH HOH B . 
H 4 HOH 88  588 206 HOH HOH B . 
H 4 HOH 89  589 344 HOH HOH B . 
H 4 HOH 90  590 464 HOH HOH B . 
H 4 HOH 91  591 179 HOH HOH B . 
H 4 HOH 92  592 113 HOH HOH B . 
H 4 HOH 93  593 26  HOH HOH B . 
H 4 HOH 94  594 446 HOH HOH B . 
H 4 HOH 95  595 257 HOH HOH B . 
H 4 HOH 96  596 194 HOH HOH B . 
H 4 HOH 97  597 274 HOH HOH B . 
H 4 HOH 98  598 309 HOH HOH B . 
H 4 HOH 99  599 325 HOH HOH B . 
H 4 HOH 100 600 343 HOH HOH B . 
H 4 HOH 101 601 150 HOH HOH B . 
H 4 HOH 102 602 381 HOH HOH B . 
H 4 HOH 103 603 409 HOH HOH B . 
H 4 HOH 104 604 413 HOH HOH B . 
H 4 HOH 105 605 199 HOH HOH B . 
H 4 HOH 106 606 317 HOH HOH B . 
H 4 HOH 107 607 70  HOH HOH B . 
H 4 HOH 108 608 469 HOH HOH B . 
H 4 HOH 109 609 467 HOH HOH B . 
H 4 HOH 110 610 153 HOH HOH B . 
H 4 HOH 111 611 221 HOH HOH B . 
H 4 HOH 112 612 382 HOH HOH B . 
H 4 HOH 113 613 134 HOH HOH B . 
H 4 HOH 114 614 262 HOH HOH B . 
H 4 HOH 115 615 49  HOH HOH B . 
H 4 HOH 116 616 340 HOH HOH B . 
H 4 HOH 117 617 361 HOH HOH B . 
H 4 HOH 118 618 8   HOH HOH B . 
H 4 HOH 119 619 131 HOH HOH B . 
H 4 HOH 120 620 163 HOH HOH B . 
H 4 HOH 121 621 242 HOH HOH B . 
H 4 HOH 122 622 196 HOH HOH B . 
H 4 HOH 123 623 16  HOH HOH B . 
H 4 HOH 124 624 27  HOH HOH B . 
H 4 HOH 125 625 130 HOH HOH B . 
H 4 HOH 126 626 216 HOH HOH B . 
H 4 HOH 127 627 136 HOH HOH B . 
H 4 HOH 128 628 89  HOH HOH B . 
H 4 HOH 129 629 441 HOH HOH B . 
H 4 HOH 130 630 250 HOH HOH B . 
H 4 HOH 131 631 411 HOH HOH B . 
H 4 HOH 132 632 455 HOH HOH B . 
H 4 HOH 133 633 154 HOH HOH B . 
H 4 HOH 134 634 373 HOH HOH B . 
H 4 HOH 135 635 80  HOH HOH B . 
H 4 HOH 136 636 175 HOH HOH B . 
H 4 HOH 137 637 84  HOH HOH B . 
H 4 HOH 138 638 101 HOH HOH B . 
H 4 HOH 139 639 140 HOH HOH B . 
H 4 HOH 140 640 182 HOH HOH B . 
H 4 HOH 141 641 291 HOH HOH B . 
H 4 HOH 142 642 201 HOH HOH B . 
H 4 HOH 143 643 439 HOH HOH B . 
H 4 HOH 144 644 289 HOH HOH B . 
H 4 HOH 145 645 449 HOH HOH B . 
H 4 HOH 146 646 278 HOH HOH B . 
H 4 HOH 147 647 412 HOH HOH B . 
H 4 HOH 148 648 378 HOH HOH B . 
H 4 HOH 149 649 479 HOH HOH B . 
H 4 HOH 150 650 315 HOH HOH B . 
H 4 HOH 151 651 178 HOH HOH B . 
H 4 HOH 152 652 18  HOH HOH B . 
H 4 HOH 153 653 139 HOH HOH B . 
H 4 HOH 154 654 212 HOH HOH B . 
H 4 HOH 155 655 215 HOH HOH B . 
H 4 HOH 156 656 335 HOH HOH B . 
H 4 HOH 157 657 38  HOH HOH B . 
H 4 HOH 158 658 17  HOH HOH B . 
H 4 HOH 159 659 100 HOH HOH B . 
H 4 HOH 160 660 63  HOH HOH B . 
H 4 HOH 161 661 388 HOH HOH B . 
H 4 HOH 162 662 437 HOH HOH B . 
H 4 HOH 163 663 120 HOH HOH B . 
H 4 HOH 164 664 279 HOH HOH B . 
H 4 HOH 165 665 209 HOH HOH B . 
H 4 HOH 166 666 415 HOH HOH B . 
H 4 HOH 167 667 457 HOH HOH B . 
H 4 HOH 168 668 456 HOH HOH B . 
H 4 HOH 169 669 336 HOH HOH B . 
H 4 HOH 170 670 204 HOH HOH B . 
H 4 HOH 171 671 52  HOH HOH B . 
H 4 HOH 172 672 419 HOH HOH B . 
H 4 HOH 173 673 224 HOH HOH B . 
H 4 HOH 174 674 320 HOH HOH B . 
H 4 HOH 175 675 473 HOH HOH B . 
H 4 HOH 176 676 444 HOH HOH B . 
H 4 HOH 177 677 253 HOH HOH B . 
H 4 HOH 178 678 285 HOH HOH B . 
H 4 HOH 179 679 349 HOH HOH B . 
H 4 HOH 180 680 98  HOH HOH B . 
H 4 HOH 181 681 364 HOH HOH B . 
H 4 HOH 182 682 232 HOH HOH B . 
H 4 HOH 183 683 200 HOH HOH B . 
H 4 HOH 184 684 230 HOH HOH B . 
H 4 HOH 185 685 132 HOH HOH B . 
H 4 HOH 186 686 162 HOH HOH B . 
H 4 HOH 187 687 252 HOH HOH B . 
H 4 HOH 188 688 273 HOH HOH B . 
H 4 HOH 189 689 452 HOH HOH B . 
H 4 HOH 190 690 380 HOH HOH B . 
H 4 HOH 191 691 304 HOH HOH B . 
H 4 HOH 192 692 471 HOH HOH B . 
H 4 HOH 193 693 293 HOH HOH B . 
H 4 HOH 194 694 106 HOH HOH B . 
H 4 HOH 195 695 280 HOH HOH B . 
H 4 HOH 196 696 276 HOH HOH B . 
H 4 HOH 197 697 414 HOH HOH B . 
H 4 HOH 198 698 475 HOH HOH B . 
H 4 HOH 199 699 368 HOH HOH B . 
H 4 HOH 200 700 359 HOH HOH B . 
H 4 HOH 201 701 458 HOH HOH B . 
H 4 HOH 202 702 229 HOH HOH B . 
H 4 HOH 203 703 442 HOH HOH B . 
H 4 HOH 204 704 234 HOH HOH B . 
H 4 HOH 205 705 334 HOH HOH B . 
H 4 HOH 206 706 177 HOH HOH B . 
H 4 HOH 207 707 302 HOH HOH B . 
H 4 HOH 208 708 369 HOH HOH B . 
H 4 HOH 209 709 78  HOH HOH B . 
H 4 HOH 210 710 62  HOH HOH B . 
H 4 HOH 211 711 363 HOH HOH B . 
H 4 HOH 212 712 141 HOH HOH B . 
H 4 HOH 213 713 270 HOH HOH B . 
H 4 HOH 214 714 303 HOH HOH B . 
H 4 HOH 215 715 376 HOH HOH B . 
H 4 HOH 216 716 468 HOH HOH B . 
H 4 HOH 217 717 297 HOH HOH B . 
H 4 HOH 218 718 299 HOH HOH B . 
H 4 HOH 219 719 347 HOH HOH B . 
H 4 HOH 220 720 418 HOH HOH B . 
H 4 HOH 221 721 474 HOH HOH B . 
H 4 HOH 222 722 159 HOH HOH B . 
H 4 HOH 223 723 476 HOH HOH B . 
H 4 HOH 224 724 306 HOH HOH B . 
H 4 HOH 225 725 261 HOH HOH B . 
H 4 HOH 226 726 328 HOH HOH B . 
H 4 HOH 227 727 470 HOH HOH B . 
H 4 HOH 228 728 377 HOH HOH B . 
H 4 HOH 229 729 265 HOH HOH B . 
H 4 HOH 230 730 436 HOH HOH B . 
H 4 HOH 231 731 438 HOH HOH B . 
H 4 HOH 232 732 417 HOH HOH B . 
H 4 HOH 233 733 288 HOH HOH B . 
H 4 HOH 234 734 264 HOH HOH B . 
H 4 HOH 235 735 272 HOH HOH B . 
H 4 HOH 236 736 348 HOH HOH B . 
H 4 HOH 237 737 365 HOH HOH B . 
H 4 HOH 238 738 308 HOH HOH B . 
H 4 HOH 239 739 443 HOH HOH B . 
H 4 HOH 240 740 219 HOH HOH B . 
H 4 HOH 241 741 472 HOH HOH B . 
H 4 HOH 242 742 298 HOH HOH B . 
H 4 HOH 243 743 416 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,G     
2 1 B,D,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-06-10 
2 'Structure model' 1 1 2015-06-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0069 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA  ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? .        4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OD1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    130 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OG 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   SER 
_pdbx_validate_close_contact.auth_seq_id_2    132 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A -1  ? ? -117.60 69.31   
2  1 HIS A 89  ? ? -105.84 58.58   
3  1 ASN A 114 ? ? 83.23   -5.88   
4  1 LEU A 149 ? ? -170.46 132.80  
5  1 TRP A 197 ? ? -136.31 -88.34  
6  1 ASN A 209 ? ? 36.09   49.42   
7  1 ALA A 272 ? ? -39.70  118.55  
8  1 ALA A 313 ? ? -88.92  -145.72 
9  1 GLN B 73  ? ? -95.98  36.52   
10 1 HIS B 89  ? ? -98.24  55.58   
11 1 PHE B 108 ? ? -98.11  -60.98  
12 1 ASN B 114 ? ? 88.06   -1.36   
13 1 LEU B 149 ? ? -175.56 136.15  
14 1 TRP B 197 ? ? -136.26 -87.01  
15 1 LYS B 238 ? ? -29.09  -56.04  
16 1 ALA B 313 ? ? -85.96  -153.20 
17 1 ALA B 323 ? ? -99.51  33.99   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET -48 ? A MET 1   
2   1 Y 1 A ALA -47 ? A ALA 2   
3   1 Y 1 A GLY -46 ? A GLY 3   
4   1 Y 1 A VAL -45 ? A VAL 4   
5   1 Y 1 A LEU -44 ? A LEU 5   
6   1 Y 1 A PRO -43 ? A PRO 6   
7   1 Y 1 A ALA -42 ? A ALA 7   
8   1 Y 1 A HIS -41 ? A HIS 8   
9   1 Y 1 A GLY -40 ? A GLY 9   
10  1 Y 1 A THR -39 ? A THR 10  
11  1 Y 1 A GLN -38 ? A GLN 11  
12  1 Y 1 A HIS -37 ? A HIS 12  
13  1 Y 1 A GLY -36 ? A GLY 13  
14  1 Y 1 A ILE -35 ? A ILE 14  
15  1 Y 1 A ARG -34 ? A ARG 15  
16  1 Y 1 A LEU -33 ? A LEU 16  
17  1 Y 1 A PRO -32 ? A PRO 17  
18  1 Y 1 A LEU -31 ? A LEU 18  
19  1 Y 1 A ARG -30 ? A ARG 19  
20  1 Y 1 A SER -29 ? A SER 20  
21  1 Y 1 A GLY -28 ? A GLY 21  
22  1 Y 1 A LEU -27 ? A LEU 22  
23  1 Y 1 A GLY -26 ? A GLY 23  
24  1 Y 1 A GLY -25 ? A GLY 24  
25  1 Y 1 A ALA -24 ? A ALA 25  
26  1 Y 1 A PRO -23 ? A PRO 26  
27  1 Y 1 A LEU -22 ? A LEU 27  
28  1 Y 1 A GLY -21 ? A GLY 28  
29  1 Y 1 A LEU -20 ? A LEU 29  
30  1 Y 1 A ARG -19 ? A ARG 30  
31  1 Y 1 A LEU -18 ? A LEU 31  
32  1 Y 1 A PRO -17 ? A PRO 32  
33  1 Y 1 A ARG -16 ? A ARG 33  
34  1 Y 1 A GLU -15 ? A GLU 34  
35  1 Y 1 A THR -14 ? A THR 35  
36  1 Y 1 A ASP -13 ? A ASP 36  
37  1 Y 1 A GLU -12 ? A GLU 37  
38  1 Y 1 A GLU -11 ? A GLU 38  
39  1 Y 1 A PRO -10 ? A PRO 39  
40  1 Y 1 A GLU -9  ? A GLU 40  
41  1 Y 1 A GLU -8  ? A GLU 41  
42  1 Y 1 A PRO -7  ? A PRO 42  
43  1 Y 1 A GLY -6  ? A GLY 43  
44  1 Y 1 A ARG -5  ? A ARG 44  
45  1 Y 1 A ARG -4  ? A ARG 45  
46  1 Y 1 A ILE 386 ? A ILE 435 
47  1 Y 1 A PRO 387 ? A PRO 436 
48  1 Y 1 A GLN 388 ? A GLN 437 
49  1 Y 1 A THR 389 ? A THR 438 
50  1 Y 1 A ASP 390 ? A ASP 439 
51  1 Y 1 A GLU 391 ? A GLU 440 
52  1 Y 1 A SER 392 ? A SER 441 
53  1 Y 1 A THR 393 ? A THR 442 
54  1 Y 1 B MET -48 ? B MET 1   
55  1 Y 1 B ALA -47 ? B ALA 2   
56  1 Y 1 B GLY -46 ? B GLY 3   
57  1 Y 1 B VAL -45 ? B VAL 4   
58  1 Y 1 B LEU -44 ? B LEU 5   
59  1 Y 1 B PRO -43 ? B PRO 6   
60  1 Y 1 B ALA -42 ? B ALA 7   
61  1 Y 1 B HIS -41 ? B HIS 8   
62  1 Y 1 B GLY -40 ? B GLY 9   
63  1 Y 1 B THR -39 ? B THR 10  
64  1 Y 1 B GLN -38 ? B GLN 11  
65  1 Y 1 B HIS -37 ? B HIS 12  
66  1 Y 1 B GLY -36 ? B GLY 13  
67  1 Y 1 B ILE -35 ? B ILE 14  
68  1 Y 1 B ARG -34 ? B ARG 15  
69  1 Y 1 B LEU -33 ? B LEU 16  
70  1 Y 1 B PRO -32 ? B PRO 17  
71  1 Y 1 B LEU -31 ? B LEU 18  
72  1 Y 1 B ARG -30 ? B ARG 19  
73  1 Y 1 B SER -29 ? B SER 20  
74  1 Y 1 B GLY -28 ? B GLY 21  
75  1 Y 1 B LEU -27 ? B LEU 22  
76  1 Y 1 B GLY -26 ? B GLY 23  
77  1 Y 1 B GLY -25 ? B GLY 24  
78  1 Y 1 B ALA -24 ? B ALA 25  
79  1 Y 1 B PRO -23 ? B PRO 26  
80  1 Y 1 B LEU -22 ? B LEU 27  
81  1 Y 1 B GLY -21 ? B GLY 28  
82  1 Y 1 B LEU -20 ? B LEU 29  
83  1 Y 1 B ARG -19 ? B ARG 30  
84  1 Y 1 B LEU -18 ? B LEU 31  
85  1 Y 1 B PRO -17 ? B PRO 32  
86  1 Y 1 B ARG -16 ? B ARG 33  
87  1 Y 1 B GLU -15 ? B GLU 34  
88  1 Y 1 B THR -14 ? B THR 35  
89  1 Y 1 B ASP -13 ? B ASP 36  
90  1 Y 1 B GLU -12 ? B GLU 37  
91  1 Y 1 B GLU -11 ? B GLU 38  
92  1 Y 1 B PRO -10 ? B PRO 39  
93  1 Y 1 B GLU -9  ? B GLU 40  
94  1 Y 1 B GLU -8  ? B GLU 41  
95  1 Y 1 B PRO -7  ? B PRO 42  
96  1 Y 1 B GLY -6  ? B GLY 43  
97  1 Y 1 B ARG -5  ? B ARG 44  
98  1 Y 1 B ARG -4  ? B ARG 45  
99  1 Y 1 B ILE 386 ? B ILE 435 
100 1 Y 1 B PRO 387 ? B PRO 436 
101 1 Y 1 B GLN 388 ? B GLN 437 
102 1 Y 1 B THR 389 ? B THR 438 
103 1 Y 1 B ASP 390 ? B ASP 439 
104 1 Y 1 B GLU 391 ? B GLU 440 
105 1 Y 1 B SER 392 ? B SER 441 
106 1 Y 1 B THR 393 ? B THR 442 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'N-[(4S,4aS,6S,8aR)-10-aminohexahydro-3H-4,8a-(epithiomethenoazeno)isochromen-6(1H)-yl]-3-chlorobenzamide' 4RX 
3 GLYCEROL                                                                                                   GOL 
4 water                                                                                                      HOH 
#