data_4ZTF
# 
_entry.id   4ZTF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ZTF         
WWPDB D_1000209869 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4ZTF 
_pdbx_database_status.recvd_initial_deposition_date   2015-05-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Klein, D.J.' 1 
'Patel, S.'   2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_id_ASTM           JMCMAR 
_citation.journal_id_CSD            0151 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            58 
_citation.language                  ? 
_citation.page_first                8154 
_citation.page_last                 8165 
_citation.title                     
'Discovery of 2-Pyridinone Aminals: A Prodrug Strategy to Advance a Second Generation of HIV-1 Integrase Strand Transfer Inhibitors.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.jmedchem.5b01037 
_citation.pdbx_database_id_PubMed   26397965 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Raheem, I.T.'     1  
primary 'Walji, A.M.'      2  
primary 'Klein, D.'        3  
primary 'Sanders, J.M.'    4  
primary 'Powell, D.A.'     5  
primary 'Abeywickrema, P.' 6  
primary 'Barbe, G.'        7  
primary 'Bennet, A.'       8  
primary 'Clas, S.D.'       9  
primary 'Dubost, D.'       10 
primary 'Embrey, M.'       11 
primary 'Grobler, J.'      12 
primary 'Hafey, M.J.'      13 
primary 'Hartingh, T.J.'   14 
primary 'Hazuda, D.J.'     15 
primary 'Miller, M.D.'     16 
primary 'Moore, K.P.'      17 
primary 'Pajkovic, N.'     18 
primary 'Patel, S.'        19 
primary 'Rada, V.'         20 
primary 'Rearden, P.'      21 
primary 'Schreier, J.D.'   22 
primary 'Sisko, J.'        23 
primary 'Steele, T.G.'     24 
primary 'Truchon, J.F.'    25 
primary 'Wai, J.'          26 
primary 'Xu, M.'           27 
primary 'Coleman, P.J.'    28 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4ZTF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     159.450 
_cell.length_a_esd                 ? 
_cell.length_b                     159.450 
_cell.length_b_esd                 ? 
_cell.length_c                     124.090 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4ZTF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Integrase 44456.695 2   ? ? ? ? 
2 polymer     syn '19 NUCLEOTIDE PREPROCESSED PFV DONOR DNA (NON-TRANSFERRED STRAND)' 5834.794  1   ? ? ? ? 
3 polymer     syn '17 NUCLEOTIDE PREPROCESSED PFV DONOR DNA (TRANSFERRED STRAND)' 5195.399  1   ? ? ? ? 
4 non-polymer syn 'ZINC ION' 65.409    1   ? ? ? ? 
5 non-polymer syn GLYCEROL 92.094    4   ? ? ? ? 
6 non-polymer syn 
;(1R,2R,5S)-8'-(3-chloro-4-fluorobenzyl)-6'-hydroxy-2'-[(2S)-2-hydroxypropyl]-9',10'-dihydro-2'H-spiro[bicyclo[3.1.0]hexane-2,3'-imidazo[5,1-a][2,6]naphthyridine]-1',5',7'(8'H)-trione
;
501.935   1   ? ? ? ? 
7 non-polymer syn 'MAGNESIUM ION' 24.305    3   ? ? ? ? 
8 non-polymer syn 'SULFATE ION' 96.063    3   ? ? ? ? 
9 water       nat water 18.015    159 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Pr125Pol 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
A,B ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DT)(DG)(DT)(DC)(DA)(DT)(DG)(DG)(DA)(DA)(DT)(DT)(DT)(DC)(DG)(DC)(DA)' ATTGTCATGGAATTTCGCA 
C   ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DC)(DG)(DA)(DA)(DA)(DT)(DT)(DC)(DC)(DA)(DT)(DG)(DA)(DC)(DA)' TGCGAAATTCCATGACA D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   CYS n 
1 5   ASN n 
1 6   THR n 
1 7   LYS n 
1 8   LYS n 
1 9   PRO n 
1 10  ASN n 
1 11  LEU n 
1 12  ASP n 
1 13  ALA n 
1 14  GLU n 
1 15  LEU n 
1 16  ASP n 
1 17  GLN n 
1 18  LEU n 
1 19  LEU n 
1 20  GLN n 
1 21  GLY n 
1 22  HIS n 
1 23  TYR n 
1 24  ILE n 
1 25  LYS n 
1 26  GLY n 
1 27  TYR n 
1 28  PRO n 
1 29  LYS n 
1 30  GLN n 
1 31  TYR n 
1 32  THR n 
1 33  TYR n 
1 34  PHE n 
1 35  LEU n 
1 36  GLU n 
1 37  ASP n 
1 38  GLY n 
1 39  LYS n 
1 40  VAL n 
1 41  LYS n 
1 42  VAL n 
1 43  SER n 
1 44  ARG n 
1 45  PRO n 
1 46  GLU n 
1 47  GLY n 
1 48  VAL n 
1 49  LYS n 
1 50  ILE n 
1 51  ILE n 
1 52  PRO n 
1 53  PRO n 
1 54  GLN n 
1 55  SER n 
1 56  ASP n 
1 57  ARG n 
1 58  GLN n 
1 59  LYS n 
1 60  ILE n 
1 61  VAL n 
1 62  LEU n 
1 63  GLN n 
1 64  ALA n 
1 65  HIS n 
1 66  ASN n 
1 67  LEU n 
1 68  ALA n 
1 69  HIS n 
1 70  THR n 
1 71  GLY n 
1 72  ARG n 
1 73  GLU n 
1 74  ALA n 
1 75  THR n 
1 76  LEU n 
1 77  LEU n 
1 78  LYS n 
1 79  ILE n 
1 80  ALA n 
1 81  ASN n 
1 82  LEU n 
1 83  TYR n 
1 84  TRP n 
1 85  TRP n 
1 86  PRO n 
1 87  ASN n 
1 88  MET n 
1 89  ARG n 
1 90  LYS n 
1 91  ASP n 
1 92  VAL n 
1 93  VAL n 
1 94  LYS n 
1 95  GLN n 
1 96  LEU n 
1 97  GLY n 
1 98  ARG n 
1 99  CYS n 
1 100 GLN n 
1 101 GLN n 
1 102 CYS n 
1 103 LEU n 
1 104 ILE n 
1 105 THR n 
1 106 ASN n 
1 107 ALA n 
1 108 SER n 
1 109 ASN n 
1 110 LYS n 
1 111 ALA n 
1 112 SER n 
1 113 GLY n 
1 114 PRO n 
1 115 ILE n 
1 116 LEU n 
1 117 ARG n 
1 118 PRO n 
1 119 ASP n 
1 120 ARG n 
1 121 PRO n 
1 122 GLN n 
1 123 LYS n 
1 124 PRO n 
1 125 PHE n 
1 126 ASP n 
1 127 LYS n 
1 128 PHE n 
1 129 PHE n 
1 130 ILE n 
1 131 ASP n 
1 132 TYR n 
1 133 ILE n 
1 134 GLY n 
1 135 PRO n 
1 136 LEU n 
1 137 PRO n 
1 138 PRO n 
1 139 SER n 
1 140 GLN n 
1 141 GLY n 
1 142 TYR n 
1 143 LEU n 
1 144 TYR n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 VAL n 
1 149 VAL n 
1 150 ASP n 
1 151 GLY n 
1 152 MET n 
1 153 THR n 
1 154 GLY n 
1 155 PHE n 
1 156 THR n 
1 157 TRP n 
1 158 LEU n 
1 159 TYR n 
1 160 PRO n 
1 161 THR n 
1 162 LYS n 
1 163 ALA n 
1 164 PRO n 
1 165 SER n 
1 166 THR n 
1 167 SER n 
1 168 ALA n 
1 169 THR n 
1 170 VAL n 
1 171 LYS n 
1 172 SER n 
1 173 LEU n 
1 174 ASN n 
1 175 VAL n 
1 176 LEU n 
1 177 THR n 
1 178 SER n 
1 179 ILE n 
1 180 ALA n 
1 181 ILE n 
1 182 PRO n 
1 183 LYS n 
1 184 VAL n 
1 185 ILE n 
1 186 HIS n 
1 187 SER n 
1 188 ASP n 
1 189 GLN n 
1 190 GLY n 
1 191 ALA n 
1 192 ALA n 
1 193 PHE n 
1 194 THR n 
1 195 SER n 
1 196 SER n 
1 197 THR n 
1 198 PHE n 
1 199 ALA n 
1 200 GLU n 
1 201 TRP n 
1 202 ALA n 
1 203 LYS n 
1 204 GLU n 
1 205 ARG n 
1 206 GLY n 
1 207 ILE n 
1 208 HIS n 
1 209 LEU n 
1 210 GLU n 
1 211 PHE n 
1 212 SER n 
1 213 THR n 
1 214 PRO n 
1 215 TYR n 
1 216 HIS n 
1 217 PRO n 
1 218 GLN n 
1 219 SER n 
1 220 SER n 
1 221 GLY n 
1 222 LYS n 
1 223 VAL n 
1 224 GLU n 
1 225 ARG n 
1 226 LYS n 
1 227 ASN n 
1 228 SER n 
1 229 ASP n 
1 230 ILE n 
1 231 LYS n 
1 232 ARG n 
1 233 LEU n 
1 234 LEU n 
1 235 THR n 
1 236 LYS n 
1 237 LEU n 
1 238 LEU n 
1 239 VAL n 
1 240 GLY n 
1 241 ARG n 
1 242 PRO n 
1 243 THR n 
1 244 LYS n 
1 245 TRP n 
1 246 TYR n 
1 247 ASP n 
1 248 LEU n 
1 249 LEU n 
1 250 PRO n 
1 251 VAL n 
1 252 VAL n 
1 253 GLN n 
1 254 LEU n 
1 255 ALA n 
1 256 LEU n 
1 257 ASN n 
1 258 ASN n 
1 259 THR n 
1 260 TYR n 
1 261 SER n 
1 262 PRO n 
1 263 VAL n 
1 264 LEU n 
1 265 LYS n 
1 266 TYR n 
1 267 THR n 
1 268 PRO n 
1 269 HIS n 
1 270 GLN n 
1 271 LEU n 
1 272 LEU n 
1 273 PHE n 
1 274 GLY n 
1 275 ILE n 
1 276 ASP n 
1 277 SER n 
1 278 ASN n 
1 279 THR n 
1 280 PRO n 
1 281 PHE n 
1 282 ALA n 
1 283 ASN n 
1 284 GLN n 
1 285 ASP n 
1 286 THR n 
1 287 LEU n 
1 288 ASP n 
1 289 LEU n 
1 290 THR n 
1 291 ARG n 
1 292 GLU n 
1 293 GLU n 
1 294 GLU n 
1 295 LEU n 
1 296 SER n 
1 297 LEU n 
1 298 LEU n 
1 299 GLN n 
1 300 GLU n 
1 301 ILE n 
1 302 ARG n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 TYR n 
1 307 HIS n 
1 308 PRO n 
1 309 SER n 
1 310 THR n 
1 311 PRO n 
1 312 PRO n 
1 313 ALA n 
1 314 SER n 
1 315 SER n 
1 316 ARG n 
1 317 SER n 
1 318 TRP n 
1 319 SER n 
1 320 PRO n 
1 321 VAL n 
1 322 VAL n 
1 323 GLY n 
1 324 GLN n 
1 325 LEU n 
1 326 VAL n 
1 327 GLN n 
1 328 GLU n 
1 329 ARG n 
1 330 VAL n 
1 331 ALA n 
1 332 ARG n 
1 333 PRO n 
1 334 ALA n 
1 335 SER n 
1 336 LEU n 
1 337 ARG n 
1 338 PRO n 
1 339 ARG n 
1 340 TRP n 
1 341 HIS n 
1 342 LYS n 
1 343 PRO n 
1 344 SER n 
1 345 THR n 
1 346 VAL n 
1 347 LEU n 
1 348 LYS n 
1 349 VAL n 
1 350 LEU n 
1 351 ASN n 
1 352 PRO n 
1 353 ARG n 
1 354 THR n 
1 355 VAL n 
1 356 VAL n 
1 357 ILE n 
1 358 LEU n 
1 359 ASP n 
1 360 HIS n 
1 361 LEU n 
1 362 GLY n 
1 363 ASN n 
1 364 ASN n 
1 365 ARG n 
1 366 THR n 
1 367 VAL n 
1 368 SER n 
1 369 ILE n 
1 370 ASP n 
1 371 ASN n 
1 372 LEU n 
1 373 LYS n 
1 374 PRO n 
1 375 THR n 
1 376 SER n 
1 377 HIS n 
1 378 GLN n 
1 379 ASN n 
1 380 GLY n 
1 381 THR n 
1 382 THR n 
1 383 ASN n 
1 384 ASP n 
1 385 THR n 
1 386 ALA n 
1 387 THR n 
1 388 MET n 
1 389 ASP n 
1 390 HIS n 
1 391 LEU n 
1 392 GLU n 
1 393 LYS n 
1 394 ASN n 
1 395 GLU n 
2 1   DA  n 
2 2   DT  n 
2 3   DT  n 
2 4   DG  n 
2 5   DT  n 
2 6   DC  n 
2 7   DA  n 
2 8   DT  n 
2 9   DG  n 
2 10  DG  n 
2 11  DA  n 
2 12  DA  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DC  n 
2 17  DG  n 
2 18  DC  n 
2 19  DA  n 
3 1   DT  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DA  n 
3 6   DA  n 
3 7   DA  n 
3 8   DT  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DA  n 
3 13  DT  n 
3 14  DG  n 
3 15  DA  n 
3 16  DC  n 
3 17  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   395 
_entity_src_gen.gene_src_common_name               'SFVcpz(hu)' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 pol 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human spumaretrovirus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11963 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 19 'Human spumaretrovirus' ? 11963 ? 
3 1 sample 1 17 'Human spumaretrovirus' ? 11963 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POL_FOAMV P14350 ? 1 
;CNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLY
WWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKA
PSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPT
KWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVG
QLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
752 
2 PDB 4ZTF      4ZTF   ? 2 ? 1   
3 PDB 4ZTF      4ZTF   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ZTF A 4 ? 395 ? P14350 752 ? 1143 ? 1 392 
2 1 4ZTF B 4 ? 395 ? P14350 752 ? 1143 ? 1 392 
3 2 4ZTF C 1 ? 19  ? 4ZTF   1   ? 19   ? 1 19  
4 3 4ZTF D 1 ? 17  ? 4ZTF   1   ? 17   ? 1 17  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ZTF GLY A 1   ? UNP P14350 ?   ?   'expression tag'      -2  1  
1 4ZTF PRO A 2   ? UNP P14350 ?   ?   'expression tag'      -1  2  
1 4ZTF GLY A 3   ? UNP P14350 ?   ?   'expression tag'      0   3  
1 4ZTF SER A 220 ? UNP P14350 GLY 968 'engineered mutation' 217 4  
1 4ZTF GLY A 221 ? UNP P14350 SER 969 'engineered mutation' 218 5  
2 4ZTF GLY B 1   ? UNP P14350 ?   ?   'expression tag'      -2  6  
2 4ZTF PRO B 2   ? UNP P14350 ?   ?   'expression tag'      -1  7  
2 4ZTF GLY B 3   ? UNP P14350 ?   ?   'expression tag'      0   8  
2 4ZTF SER B 220 ? UNP P14350 GLY 968 'engineered mutation' 217 9  
2 4ZTF GLY B 221 ? UNP P14350 SER 969 'engineered mutation' 218 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'       121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'    331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ?                               'C9 H14 N3 O7 P'     307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'    347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ?                               'C10 H15 N2 O8 P'    322.208 
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'         75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'           92.094  
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER ?                               'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'      149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                               'Mg 2'               24.305  
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'         105.093 
SO4 non-polymer         . 'SULFATE ION' ?                               'O4 S -2'            96.063  
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'        117.146 
X2P non-polymer         . 
;(1R,2R,5S)-8'-(3-chloro-4-fluorobenzyl)-6'-hydroxy-2'-[(2S)-2-hydroxypropyl]-9',10'-dihydro-2'H-spiro[bicyclo[3.1.0]hexane-2,3'-imidazo[5,1-a][2,6]naphthyridine]-1',5',7'(8'H)-trione
;
?                               'C25 H25 Cl F N3 O5' 501.935 
ZN  non-polymer         . 'ZINC ION' ?                               'Zn 2'               65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4ZTF 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.95 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.83 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'1.25 M AMMONIUM SULFATE, 25% (V/V) GLYCEROL, 4.8% (V/V) 1,6-HEXANEDIOL, 50 MM MES-NAOH, 1MM EDTA, PH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-01-09 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9795  1.0 
2 0.97949 1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97949 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_synchrotron_site       CLSI 
# 
_reflns.B_iso_Wilson_estimate            84.020 
_reflns.entry_id                         4ZTF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.700 
_reflns.d_resolution_low                 48.858 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       44469 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  11.000 
_reflns.pdbx_Rmerge_I_obs                0.107 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         489046 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.700  2.709  ? ? 4686 ? ? 423 ? 100.000 ? ? ? ? 0.977 ? ? ? ? ? ? ? ? 11.100 ? ? ? ? ? ? 0 1 1 ? ? 
12.463 48.858 ? ? 4997 ? ? 528 ? 100.000 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 9.500  ? ? ? ? ? ? 0 2 1 ? ? 
# 
_refine.aniso_B[1][1]                            -8.6547 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -8.6547 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            17.3095 
_refine.B_iso_max                                164.210 
_refine.B_iso_mean                               71.6200 
_refine.B_iso_min                                35.360 
_refine.correlation_coeff_Fo_to_Fc               0.9355 
_refine.correlation_coeff_Fo_to_Fc_free          0.9257 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4ZTF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.7000 
_refine.ls_d_res_low                             48.858 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     44406 
_refine.ls_number_reflns_R_free                  2239 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9800 
_refine.ls_percent_reflns_R_free                 5.0400 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1922 
_refine.ls_R_factor_R_free                       0.2146 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1911 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.1990 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.1990 
_refine.pdbx_overall_SU_R_Blow_DPI               0.2490 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.2460 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        4ZTF 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.339 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.7000 
_refine_hist.d_res_low                        48.858 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             159 
_refine_hist.number_atoms_total               5301 
_refine_hist.pdbx_number_residues_total       588 
_refine_hist.pdbx_B_iso_mean_ligand           81.98 
_refine_hist.pdbx_B_iso_mean_solvent          62.58 
_refine_hist.pdbx_number_atoms_protein        4332 
_refine_hist.pdbx_number_atoms_nucleic_acid   732 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? ?      ? 1674 ? t_dihedral_angle_d        2.000  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?      ? 92   ? t_trig_c_planes           8.000  HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 702  ? t_gen_planes              8.000  HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 5344 ? t_it                      20.000 HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 1    ? t_nbd                     5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_improper_torsion        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_pseud_angle             ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 702  ? t_chiral_improper_torsion 5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_sum_occupancies         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_utility_distance        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_utility_angle           ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_utility_torsion         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 6056 ? t_ideal_dist_contact      4.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 0.010  ? 5344 ? t_bond_d                  2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 1.100  ? 7453 ? t_angle_deg               2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 2.180  ? ?    ? t_omega_torsion           ?      ?            
'X-RAY DIFFRACTION' ? 20.970 ? ?    ? t_other_torsion           ?      ?            
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.7000 
_refine_ls_shell.d_res_low                        2.7700 
_refine_ls_shell.number_reflns_all                3203 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             153 
_refine_ls_shell.number_reflns_R_work             3050 
_refine_ls_shell.percent_reflns_obs               99.9800 
_refine_ls_shell.percent_reflns_R_free            4.7800 
_refine_ls_shell.R_factor_all                     0.2378 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2577 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2368 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     4ZTF 
_struct.title                        'Crystal Structure of the Prototype Foamy Virus Intasome with a 2-Pyridinone Aminal Inhibitor' 
_struct.pdbx_descriptor              'Integrase/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4ZTF 
_struct_keywords.text            
'TRANSFERASE-DNA COMPLEX, DNA INTEGRATION, VIRAL PROTEIN, RECOMBINATION-INHIBITOR-DNA COMPLEX, Transferase-DNA-Inhibitor complex' 
_struct_keywords.pdbx_keywords   Transferase/DNA/Inhibitor 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 8 ? 
L N N 8 ? 
M N N 5 ? 
N N N 8 ? 
O N N 7 ? 
P N N 5 ? 
Q N N 9 ? 
R N N 9 ? 
S N N 9 ? 
T N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LEU A 11  ? GLY A 21  ? LEU A 8   GLY A 18  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 53  ? LEU A 67  ? PRO A 50  LEU A 64  1 ? 15 
HELX_P HELX_P3  AA3 GLY A 71  ? ALA A 80  ? GLY A 68  ALA A 77  1 ? 10 
HELX_P HELX_P4  AA4 ASN A 87  ? GLY A 97  ? ASN A 84  GLY A 94  1 ? 11 
HELX_P HELX_P5  AA5 CYS A 99  ? ASN A 106 ? CYS A 96  ASN A 103 1 ? 8  
HELX_P HELX_P6  AA6 SER A 165 ? THR A 177 ? SER A 162 THR A 174 1 ? 13 
HELX_P HELX_P7  AA7 GLY A 190 ? SER A 195 ? GLY A 187 SER A 192 1 ? 6  
HELX_P HELX_P8  AA8 SER A 195 ? GLU A 204 ? SER A 192 GLU A 201 1 ? 10 
HELX_P HELX_P9  AA9 HIS A 216 ? SER A 219 ? HIS A 213 SER A 216 5 ? 4  
HELX_P HELX_P10 AB1 SER A 220 ? LEU A 238 ? SER A 217 LEU A 235 1 ? 19 
HELX_P HELX_P11 AB2 LEU A 248 ? ASN A 258 ? LEU A 245 ASN A 255 1 ? 11 
HELX_P HELX_P12 AB3 THR A 267 ? GLY A 274 ? THR A 264 GLY A 271 1 ? 8  
HELX_P HELX_P13 AB4 THR A 290 ? SER A 304 ? THR A 287 SER A 301 1 ? 15 
HELX_P HELX_P14 AB5 SER B 165 ? THR B 177 ? SER B 162 THR B 174 1 ? 13 
HELX_P HELX_P15 AB6 GLY B 190 ? SER B 195 ? GLY B 187 SER B 192 1 ? 6  
HELX_P HELX_P16 AB7 SER B 195 ? ARG B 205 ? SER B 192 ARG B 202 1 ? 11 
HELX_P HELX_P17 AB8 SER B 220 ? VAL B 239 ? SER B 217 VAL B 236 1 ? 20 
HELX_P HELX_P18 AB9 LYS B 244 ? ASN B 258 ? LYS B 241 ASN B 255 1 ? 15 
HELX_P HELX_P19 AC1 THR B 267 ? GLY B 274 ? THR B 264 GLY B 271 1 ? 8  
HELX_P HELX_P20 AC2 THR B 290 ? ILE B 301 ? THR B 287 ILE B 298 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 65  NE2 ? ? ? 1_555 E ZN  .  ZN ? ? A HIS 62  A ZN  401 1_555 ? ? ? ? ? ? ?            1.980 ? 
metalc2  metalc ? ? A HIS 69  ND1 ? ? ? 1_555 E ZN  .  ZN ? ? A HIS 66  A ZN  401 1_555 ? ? ? ? ? ? ?            2.079 ? 
metalc3  metalc ? ? A CYS 99  SG  ? ? ? 1_555 E ZN  .  ZN ? ? A CYS 96  A ZN  401 1_555 ? ? ? ? ? ? ?            2.284 ? 
metalc4  metalc ? ? A CYS 102 SG  ? ? ? 1_555 E ZN  .  ZN ? ? A CYS 99  A ZN  401 1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc5  metalc ? ? A ASP 131 OD1 ? ? ? 1_555 I MG  .  MG ? ? A ASP 128 A MG  405 1_555 ? ? ? ? ? ? ?            2.095 ? 
metalc6  metalc ? ? A ASP 131 OD2 ? ? ? 1_555 J MG  .  MG ? ? A ASP 128 A MG  406 1_555 ? ? ? ? ? ? ?            2.138 ? 
metalc7  metalc ? ? A ASP 188 OD2 ? ? ? 1_555 I MG  .  MG ? ? A ASP 185 A MG  405 1_555 ? ? ? ? ? ? ?            2.114 ? 
metalc8  metalc ? ? A GLU 224 OE1 ? ? ? 1_555 J MG  .  MG ? ? A GLU 221 A MG  406 1_555 ? ? ? ? ? ? ?            2.061 ? 
metalc9  metalc ? ? A GLU 224 OE2 ? ? ? 1_555 J MG  .  MG ? ? A GLU 221 A MG  406 1_555 ? ? ? ? ? ? ?            1.991 ? 
metalc10 metalc ? ? B ASP 188 OD2 ? ? ? 1_555 O MG  .  MG ? ? B ASP 185 B MG  402 1_555 ? ? ? ? ? ? ?            2.844 ? 
metalc11 metalc ? ? H X2P .   O4  ? ? ? 1_555 J MG  .  MG ? ? A X2P 404 A MG  406 1_555 ? ? ? ? ? ? ?            1.981 ? 
metalc12 metalc ? ? H X2P .   O   ? ? ? 1_555 I MG  .  MG ? ? A X2P 404 A MG  405 1_555 ? ? ? ? ? ? ?            2.307 ? 
metalc13 metalc ? ? H X2P .   O   ? ? ? 1_555 J MG  .  MG ? ? A X2P 404 A MG  406 1_555 ? ? ? ? ? ? ?            2.147 ? 
metalc14 metalc ? ? H X2P .   O1  ? ? ? 1_555 I MG  .  MG ? ? A X2P 404 A MG  405 1_555 ? ? ? ? ? ? ?            1.911 ? 
metalc15 metalc ? ? I MG  .   MG  ? ? ? 1_555 Q HOH .  O  ? ? A MG  405 A HOH 521 1_555 ? ? ? ? ? ? ?            2.128 ? 
metalc16 metalc ? ? I MG  .   MG  ? ? ? 1_555 Q HOH .  O  ? ? A MG  405 A HOH 549 1_555 ? ? ? ? ? ? ?            2.192 ? 
metalc17 metalc ? ? J MG  .   MG  ? ? ? 1_555 T HOH .  O  ? ? A MG  406 D HOH 101 1_555 ? ? ? ? ? ? ?            2.188 ? 
hydrog1  hydrog ? ? C DG  4   N1  ? ? ? 1_555 D DC  16 N3 ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? C DG  4   N2  ? ? ? 1_555 D DC  16 O2 ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? C DG  4   O6  ? ? ? 1_555 D DC  16 N4 ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? C DT  5   N3  ? ? ? 1_555 D DA  15 N1 ? ? C DT  5   D DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? C DT  5   O4  ? ? ? 1_555 D DA  15 N6 ? ? C DT  5   D DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? C DC  6   N3  ? ? ? 1_555 D DG  14 N1 ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? C DC  6   N4  ? ? ? 1_555 D DG  14 O6 ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? C DC  6   O2  ? ? ? 1_555 D DG  14 N2 ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? C DA  7   N1  ? ? ? 1_555 D DT  13 N3 ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? C DA  7   N6  ? ? ? 1_555 D DT  13 O4 ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? C DT  8   N3  ? ? ? 1_555 D DA  12 N1 ? ? C DT  8   D DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? C DT  8   O4  ? ? ? 1_555 D DA  12 N6 ? ? C DT  8   D DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? C DG  9   N1  ? ? ? 1_555 D DC  11 N3 ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? C DG  9   N2  ? ? ? 1_555 D DC  11 O2 ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? C DG  9   O6  ? ? ? 1_555 D DC  11 N4 ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? C DG  10  N1  ? ? ? 1_555 D DC  10 N3 ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? C DG  10  N2  ? ? ? 1_555 D DC  10 O2 ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? C DG  10  O6  ? ? ? 1_555 D DC  10 N4 ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? C DA  11  N1  ? ? ? 1_555 D DT  9  N3 ? ? C DA  11  D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? C DA  11  N6  ? ? ? 1_555 D DT  9  O4 ? ? C DA  11  D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? C DA  12  N1  ? ? ? 1_555 D DT  8  N3 ? ? C DA  12  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? C DA  12  N6  ? ? ? 1_555 D DT  8  O4 ? ? C DA  12  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? C DT  13  N3  ? ? ? 1_555 D DA  7  N1 ? ? C DT  13  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? C DT  13  O4  ? ? ? 1_555 D DA  7  N6 ? ? C DT  13  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? C DT  14  N3  ? ? ? 1_555 D DA  6  N1 ? ? C DT  14  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? C DT  14  O4  ? ? ? 1_555 D DA  6  N6 ? ? C DT  14  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? C DT  15  N3  ? ? ? 1_555 D DA  5  N1 ? ? C DT  15  D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? C DT  15  O4  ? ? ? 1_555 D DA  5  N6 ? ? C DT  15  D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? C DC  16  N3  ? ? ? 1_555 D DG  4  N1 ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? C DC  16  N4  ? ? ? 1_555 D DG  4  O6 ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? C DC  16  O2  ? ? ? 1_555 D DG  4  N2 ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? C DG  17  N1  ? ? ? 1_555 D DC  3  N3 ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? C DG  17  N2  ? ? ? 1_555 D DC  3  O2 ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? C DG  17  O6  ? ? ? 1_555 D DC  3  N4 ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? C DC  18  N3  ? ? ? 1_555 D DG  2  N1 ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? C DC  18  N4  ? ? ? 1_555 D DG  2  O6 ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? C DC  18  O2  ? ? ? 1_555 D DG  2  N2 ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DA  19  N1  ? ? ? 1_555 D DT  1  N3 ? ? C DA  19  D DT  1   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 134 A . ? GLY 131 A PRO 135 A ? PRO 132 A 1 0.66 
2 GLY 134 B . ? GLY 131 B PRO 135 B ? PRO 132 B 1 2.52 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 5 ? 
AA4 ? 5 ? 
AA5 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 33  ? GLU A 36  ? TYR A 30  GLU A 33  
AA1 2 LYS A 39  ? ARG A 44  ? LYS A 36  ARG A 41  
AA1 3 GLY A 47  ? ILE A 50  ? GLY A 44  ILE A 47  
AA2 1 ALA A 111 ? SER A 112 ? ALA A 108 SER A 109 
AA2 2 SER A 317 ? TRP A 318 ? SER A 314 TRP A 315 
AA3 1 THR A 156 ? THR A 161 ? THR A 153 THR A 158 
AA3 2 TYR A 144 ? ASP A 150 ? TYR A 141 ASP A 147 
AA3 3 LYS A 127 ? ILE A 133 ? LYS A 124 ILE A 130 
AA3 4 VAL A 184 ? SER A 187 ? VAL A 181 SER A 184 
AA3 5 HIS A 208 ? PHE A 211 ? HIS A 205 PHE A 208 
AA4 1 ASN A 364 ? SER A 368 ? ASN A 361 SER A 365 
AA4 2 THR A 354 ? LEU A 358 ? THR A 351 LEU A 355 
AA4 3 SER A 344 ? ASN A 351 ? SER A 341 ASN A 348 
AA4 4 LEU A 325 ? GLU A 328 ? LEU A 322 GLU A 325 
AA4 5 LEU A 372 ? PRO A 374 ? LEU A 369 PRO A 371 
AA5 1 THR B 156 ? THR B 161 ? THR B 153 THR B 158 
AA5 2 TYR B 144 ? ASP B 150 ? TYR B 141 ASP B 147 
AA5 3 PHE B 128 ? ILE B 133 ? PHE B 125 ILE B 130 
AA5 4 VAL B 184 ? SER B 187 ? VAL B 181 SER B 184 
AA5 5 HIS B 208 ? PHE B 211 ? HIS B 205 PHE B 208 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 34  ? N PHE A 31  O LYS A 41  ? O LYS A 38  
AA1 2 3 N ARG A 44  ? N ARG A 41  O GLY A 47  ? O GLY A 44  
AA2 1 2 N ALA A 111 ? N ALA A 108 O TRP A 318 ? O TRP A 315 
AA3 1 2 O THR A 161 ? O THR A 158 N TYR A 144 ? N TYR A 141 
AA3 2 3 O VAL A 147 ? O VAL A 144 N ASP A 131 ? N ASP A 128 
AA3 3 4 N PHE A 128 ? N PHE A 125 O HIS A 186 ? O HIS A 183 
AA3 4 5 N ILE A 185 ? N ILE A 182 O GLU A 210 ? O GLU A 207 
AA4 1 2 O VAL A 367 ? O VAL A 364 N VAL A 355 ? N VAL A 352 
AA4 2 3 O VAL A 356 ? O VAL A 353 N LYS A 348 ? N LYS A 345 
AA4 3 4 O SER A 344 ? O SER A 341 N VAL A 326 ? N VAL A 323 
AA4 4 5 N GLN A 327 ? N GLN A 324 O LYS A 373 ? O LYS A 370 
AA5 1 2 O TYR B 159 ? O TYR B 156 N LEU B 146 ? N LEU B 143 
AA5 2 3 O VAL B 147 ? O VAL B 144 N ASP B 131 ? N ASP B 128 
AA5 3 4 N PHE B 128 ? N PHE B 125 O HIS B 186 ? O HIS B 183 
AA5 4 5 N ILE B 185 ? N ILE B 182 O HIS B 208 ? O HIS B 205 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  401 ? 4  'binding site for residue ZN A 401'  
AC2 Software A GOL 402 ? 4  'binding site for residue GOL A 402' 
AC3 Software A GOL 403 ? 4  'binding site for residue GOL A 403' 
AC4 Software A X2P 404 ? 13 'binding site for residue X2P A 404' 
AC5 Software A MG  405 ? 5  'binding site for residue MG A 405'  
AC6 Software A MG  406 ? 4  'binding site for residue MG A 406'  
AC7 Software A SO4 407 ? 6  'binding site for residue SO4 A 407' 
AC8 Software A SO4 408 ? 4  'binding site for residue SO4 A 408' 
AC9 Software A GOL 409 ? 3  'binding site for residue GOL A 409' 
AD1 Software B SO4 401 ? 5  'binding site for residue SO4 B 401' 
AD2 Software B MG  402 ? 3  'binding site for residue MG B 402'  
AD3 Software C GOL 101 ? 8  'binding site for residue GOL C 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  HIS A 65  ? HIS A 62  . ? 1_555 ? 
2  AC1 4  HIS A 69  ? HIS A 66  . ? 1_555 ? 
3  AC1 4  CYS A 99  ? CYS A 96  . ? 1_555 ? 
4  AC1 4  CYS A 102 ? CYS A 99  . ? 1_555 ? 
5  AC2 4  SER A 165 ? SER A 162 . ? 1_555 ? 
6  AC2 4  THR A 166 ? THR A 163 . ? 1_555 ? 
7  AC2 4  SER A 167 ? SER A 164 . ? 1_555 ? 
8  AC2 4  HOH Q .   ? HOH A 506 . ? 1_555 ? 
9  AC3 4  PRO A 138 ? PRO A 135 . ? 1_555 ? 
10 AC3 4  SER A 139 ? SER A 136 . ? 1_555 ? 
11 AC3 4  GLN A 140 ? GLN A 137 . ? 1_555 ? 
12 AC3 4  LYS A 244 ? LYS A 241 . ? 1_555 ? 
13 AC4 13 ASP A 131 ? ASP A 128 . ? 1_555 ? 
14 AC4 13 ASP A 188 ? ASP A 185 . ? 1_555 ? 
15 AC4 13 GLY A 190 ? GLY A 187 . ? 1_555 ? 
16 AC4 13 PRO A 217 ? PRO A 214 . ? 1_555 ? 
17 AC4 13 GLN A 218 ? GLN A 215 . ? 1_555 ? 
18 AC4 13 GLU A 224 ? GLU A 221 . ? 1_555 ? 
19 AC4 13 MG  I .   ? MG  A 405 . ? 1_555 ? 
20 AC4 13 MG  J .   ? MG  A 406 . ? 1_555 ? 
21 AC4 13 HOH Q .   ? HOH A 549 . ? 1_555 ? 
22 AC4 13 DG  C 4   ? DG  C 4   . ? 1_555 ? 
23 AC4 13 DC  D 16  ? DC  D 16  . ? 1_555 ? 
24 AC4 13 DA  D 17  ? DA  D 17  . ? 1_555 ? 
25 AC4 13 HOH T .   ? HOH D 101 . ? 1_555 ? 
26 AC5 5  ASP A 131 ? ASP A 128 . ? 1_555 ? 
27 AC5 5  ASP A 188 ? ASP A 185 . ? 1_555 ? 
28 AC5 5  X2P H .   ? X2P A 404 . ? 1_555 ? 
29 AC5 5  HOH Q .   ? HOH A 521 . ? 1_555 ? 
30 AC5 5  HOH Q .   ? HOH A 549 . ? 1_555 ? 
31 AC6 4  ASP A 131 ? ASP A 128 . ? 1_555 ? 
32 AC6 4  GLU A 224 ? GLU A 221 . ? 1_555 ? 
33 AC6 4  X2P H .   ? X2P A 404 . ? 1_555 ? 
34 AC6 4  HOH T .   ? HOH D 101 . ? 1_555 ? 
35 AC7 6  LYS A 231 ? LYS A 228 . ? 8_555 ? 
36 AC7 6  SER A 335 ? SER A 332 . ? 1_555 ? 
37 AC7 6  LEU A 336 ? LEU A 333 . ? 1_555 ? 
38 AC7 6  ARG A 339 ? ARG A 336 . ? 1_555 ? 
39 AC7 6  HOH Q .   ? HOH A 518 . ? 1_555 ? 
40 AC7 6  DA  D 17  ? DA  D 17  . ? 8_555 ? 
41 AC8 4  HIS A 341 ? HIS A 338 . ? 1_555 ? 
42 AC8 4  LYS A 342 ? LYS A 339 . ? 1_555 ? 
43 AC8 4  HIS A 360 ? HIS A 357 . ? 1_555 ? 
44 AC8 4  HOH Q .   ? HOH A 544 . ? 1_555 ? 
45 AC9 3  LEU A 295 ? LEU A 292 . ? 1_555 ? 
46 AC9 3  GLN A 299 ? GLN A 296 . ? 1_555 ? 
47 AC9 3  TYR B 266 ? TYR B 263 . ? 1_555 ? 
48 AD1 5  LYS B 222 ? LYS B 219 . ? 1_555 ? 
49 AD1 5  ARG B 225 ? ARG B 222 . ? 1_555 ? 
50 AD1 5  SER B 261 ? SER B 258 . ? 1_555 ? 
51 AD1 5  PRO B 262 ? PRO B 259 . ? 1_555 ? 
52 AD1 5  VAL B 263 ? VAL B 260 . ? 1_555 ? 
53 AD2 3  ASP B 131 ? ASP B 128 . ? 1_555 ? 
54 AD2 3  ASP B 188 ? ASP B 185 . ? 1_555 ? 
55 AD2 3  DA  C 19  ? DA  C 19  . ? 4_554 ? 
56 AD3 8  TYR A 306 ? TYR A 303 . ? 1_555 ? 
57 AD3 8  DC  C 6   ? DC  C 6   . ? 1_555 ? 
58 AD3 8  DA  C 7   ? DA  C 7   . ? 1_555 ? 
59 AD3 8  DT  C 8   ? DT  C 8   . ? 1_555 ? 
60 AD3 8  HOH S .   ? HOH C 203 . ? 1_555 ? 
61 AD3 8  HOH S .   ? HOH C 212 . ? 1_555 ? 
62 AD3 8  HOH S .   ? HOH C 216 . ? 1_555 ? 
63 AD3 8  DC  D 11  ? DC  D 11  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4ZTF 
_atom_sites.fract_transf_matrix[1][1]   0.006272 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006272 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008059 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
F  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LEU A 1 11  ? 16.661 -76.121 57.131  1.00 140.87 ? 8   LEU A N     1 
ATOM   2    C  CA    . LEU A 1 11  ? 16.828 -77.557 57.334  1.00 140.87 ? 8   LEU A CA    1 
ATOM   3    C  C     . LEU A 1 11  ? 17.377 -77.918 58.741  1.00 140.87 ? 8   LEU A C     1 
ATOM   4    O  O     . LEU A 1 11  ? 18.590 -78.095 58.918  1.00 140.87 ? 8   LEU A O     1 
ATOM   5    C  CB    . LEU A 1 11  ? 17.678 -78.173 56.208  1.00 140.90 ? 8   LEU A CB    1 
ATOM   6    N  N     . ASP A 1 12  ? 16.456 -78.022 59.737  1.00 137.99 ? 9   ASP A N     1 
ATOM   7    C  CA    . ASP A 1 12  ? 16.740 -78.380 61.139  1.00 137.99 ? 9   ASP A CA    1 
ATOM   8    C  C     . ASP A 1 12  ? 16.896 -79.914 61.261  1.00 137.99 ? 9   ASP A C     1 
ATOM   9    O  O     . ASP A 1 12  ? 17.392 -80.406 62.279  1.00 137.99 ? 9   ASP A O     1 
ATOM   10   C  CB    . ASP A 1 12  ? 15.628 -77.852 62.078  1.00 140.03 ? 9   ASP A CB    1 
ATOM   11   C  CG    . ASP A 1 12  ? 16.042 -77.640 63.531  1.00 140.03 ? 9   ASP A CG    1 
ATOM   12   O  OD1   . ASP A 1 12  ? 16.038 -78.628 64.304  1.00 140.03 ? 9   ASP A OD1   1 
ATOM   13   O  OD2   . ASP A 1 12  ? 16.350 -76.483 63.900  1.00 140.03 ? 9   ASP A OD2   1 
ATOM   14   N  N     . ALA A 1 13  ? 16.478 -80.660 60.210  1.00 134.40 ? 10  ALA A N     1 
ATOM   15   C  CA    . ALA A 1 13  ? 16.581 -82.118 60.120  1.00 134.50 ? 10  ALA A CA    1 
ATOM   16   C  C     . ALA A 1 13  ? 18.049 -82.488 59.890  1.00 134.52 ? 10  ALA A C     1 
ATOM   17   O  O     . ALA A 1 13  ? 18.570 -83.368 60.573  1.00 134.54 ? 10  ALA A O     1 
ATOM   18   C  CB    . ALA A 1 13  ? 15.723 -82.633 58.975  1.00 135.23 ? 10  ALA A CB    1 
ATOM   19   N  N     . GLU A 1 14  ? 18.716 -81.783 58.942  1.00 130.85 ? 11  GLU A N     1 
ATOM   20   C  CA    . GLU A 1 14  ? 20.131 -81.930 58.575  1.00 130.83 ? 11  GLU A CA    1 
ATOM   21   C  C     . GLU A 1 14  ? 21.023 -81.653 59.802  1.00 130.55 ? 11  GLU A C     1 
ATOM   22   O  O     . GLU A 1 14  ? 21.995 -82.373 60.031  1.00 130.38 ? 11  GLU A O     1 
ATOM   23   C  CB    . GLU A 1 14  ? 20.461 -80.954 57.422  1.00 132.17 ? 11  GLU A CB    1 
ATOM   24   C  CG    . GLU A 1 14  ? 21.923 -80.882 56.996  1.00 132.73 ? 11  GLU A CG    1 
ATOM   25   C  CD    . GLU A 1 14  ? 22.266 -79.706 56.099  1.00 133.66 ? 11  GLU A CD    1 
ATOM   26   O  OE1   . GLU A 1 14  ? 22.726 -79.945 54.958  1.00 133.62 ? 11  GLU A OE1   1 
ATOM   27   O  OE2   . GLU A 1 14  ? 22.076 -78.545 56.532  1.00 133.91 ? 11  GLU A OE2   1 
ATOM   28   N  N     . LEU A 1 15  ? 20.674 -80.619 60.588  1.00 126.98 ? 12  LEU A N     1 
ATOM   29   C  CA    . LEU A 1 15  ? 21.407 -80.222 61.791  1.00 126.75 ? 12  LEU A CA    1 
ATOM   30   C  C     . LEU A 1 15  ? 21.227 -81.198 62.961  1.00 126.57 ? 12  LEU A C     1 
ATOM   31   O  O     . LEU A 1 15  ? 22.086 -81.233 63.842  1.00 126.49 ? 12  LEU A O     1 
ATOM   32   C  CB    . LEU A 1 15  ? 21.048 -78.784 62.226  1.00 126.04 ? 12  LEU A CB    1 
ATOM   33   C  CG    . LEU A 1 15  ? 21.370 -77.617 61.278  1.00 126.10 ? 12  LEU A CG    1 
ATOM   34   C  CD1   . LEU A 1 15  ? 21.007 -76.312 61.923  1.00 126.62 ? 12  LEU A CD1   1 
ATOM   35   C  CD2   . LEU A 1 15  ? 22.837 -77.586 60.897  1.00 125.59 ? 12  LEU A CD2   1 
ATOM   36   N  N     . ASP A 1 16  ? 20.122 -81.984 62.978  1.00 125.74 ? 13  ASP A N     1 
ATOM   37   C  CA    . ASP A 1 16  ? 19.847 -82.958 64.039  1.00 125.37 ? 13  ASP A CA    1 
ATOM   38   C  C     . ASP A 1 16  ? 20.870 -84.098 64.044  1.00 125.01 ? 13  ASP A C     1 
ATOM   39   O  O     . ASP A 1 16  ? 21.437 -84.381 65.101  1.00 124.81 ? 13  ASP A O     1 
ATOM   40   C  CB    . ASP A 1 16  ? 18.408 -83.494 63.955  1.00 127.11 ? 13  ASP A CB    1 
ATOM   41   C  CG    . ASP A 1 16  ? 17.610 -83.296 65.231  1.00 127.11 ? 13  ASP A CG    1 
ATOM   42   O  OD1   . ASP A 1 16  ? 17.941 -83.950 66.250  1.00 127.56 ? 13  ASP A OD1   1 
ATOM   43   O  OD2   . ASP A 1 16  ? 16.652 -82.493 65.213  1.00 127.30 ? 13  ASP A OD2   1 
ATOM   44   N  N     . GLN A 1 17  ? 21.132 -84.717 62.858  1.00 125.25 ? 14  GLN A N     1 
ATOM   45   C  CA    . GLN A 1 17  ? 22.096 -85.818 62.656  1.00 125.02 ? 14  GLN A CA    1 
ATOM   46   C  C     . GLN A 1 17  ? 23.507 -85.431 63.101  1.00 124.58 ? 14  GLN A C     1 
ATOM   47   O  O     . GLN A 1 17  ? 24.274 -86.280 63.571  1.00 124.64 ? 14  GLN A O     1 
ATOM   48   C  CB    . GLN A 1 17  ? 22.154 -86.241 61.179  1.00 126.77 ? 14  GLN A CB    1 
ATOM   49   C  CG    . GLN A 1 17  ? 21.000 -87.121 60.716  1.00 127.58 ? 14  GLN A CG    1 
ATOM   50   C  CD    . GLN A 1 17  ? 19.830 -86.315 60.203  1.00 128.68 ? 14  GLN A CD    1 
ATOM   51   O  OE1   . GLN A 1 17  ? 18.769 -86.250 60.837  1.00 129.77 ? 14  GLN A OE1   1 
ATOM   52   N  NE2   . GLN A 1 17  ? 19.991 -85.684 59.039  1.00 128.94 ? 14  GLN A NE2   1 
ATOM   53   N  N     . LEU A 1 18  ? 23.832 -84.140 62.931  1.00 123.04 ? 15  LEU A N     1 
ATOM   54   C  CA    . LEU A 1 18  ? 25.099 -83.502 63.266  1.00 122.35 ? 15  LEU A CA    1 
ATOM   55   C  C     . LEU A 1 18  ? 25.293 -83.460 64.788  1.00 121.97 ? 15  LEU A C     1 
ATOM   56   O  O     . LEU A 1 18  ? 26.378 -83.801 65.274  1.00 121.77 ? 15  LEU A O     1 
ATOM   57   C  CB    . LEU A 1 18  ? 25.067 -82.081 62.675  1.00 122.16 ? 15  LEU A CB    1 
ATOM   58   C  CG    . LEU A 1 18  ? 26.373 -81.339 62.490  1.00 121.58 ? 15  LEU A CG    1 
ATOM   59   C  CD1   . LEU A 1 18  ? 27.146 -81.881 61.307  1.00 121.18 ? 15  LEU A CD1   1 
ATOM   60   C  CD2   . LEU A 1 18  ? 26.099 -79.878 62.263  1.00 121.26 ? 15  LEU A CD2   1 
ATOM   61   N  N     . LEU A 1 19  ? 24.234 -83.058 65.532  1.00 120.49 ? 16  LEU A N     1 
ATOM   62   C  CA    . LEU A 1 19  ? 24.223 -82.964 66.997  1.00 120.22 ? 16  LEU A CA    1 
ATOM   63   C  C     . LEU A 1 19  ? 24.458 -84.331 67.639  1.00 120.14 ? 16  LEU A C     1 
ATOM   64   O  O     . LEU A 1 19  ? 25.133 -84.411 68.672  1.00 120.13 ? 16  LEU A O     1 
ATOM   65   C  CB    . LEU A 1 19  ? 22.904 -82.356 67.491  1.00 119.94 ? 16  LEU A CB    1 
ATOM   66   C  CG    . LEU A 1 19  ? 22.769 -80.844 67.356  1.00 119.44 ? 16  LEU A CG    1 
ATOM   67   C  CD1   . LEU A 1 19  ? 21.340 -80.454 67.072  1.00 118.81 ? 16  LEU A CD1   1 
ATOM   68   C  CD2   . LEU A 1 19  ? 23.267 -80.143 68.590  1.00 119.01 ? 16  LEU A CD2   1 
ATOM   69   N  N     . GLN A 1 20  ? 23.911 -85.405 67.005  1.00 119.95 ? 17  GLN A N     1 
ATOM   70   C  CA    . GLN A 1 20  ? 24.057 -86.803 67.424  1.00 119.58 ? 17  GLN A CA    1 
ATOM   71   C  C     . GLN A 1 20  ? 25.530 -87.203 67.327  1.00 119.07 ? 17  GLN A C     1 
ATOM   72   O  O     . GLN A 1 20  ? 26.044 -87.872 68.225  1.00 119.13 ? 17  GLN A O     1 
ATOM   73   C  CB    . GLN A 1 20  ? 23.187 -87.724 66.560  1.00 120.77 ? 17  GLN A CB    1 
ATOM   74   C  CG    . GLN A 1 20  ? 21.778 -87.893 67.118  1.00 121.46 ? 17  GLN A CG    1 
ATOM   75   C  CD    . GLN A 1 20  ? 20.723 -88.064 66.047  1.00 122.42 ? 17  GLN A CD    1 
ATOM   76   O  OE1   . GLN A 1 20  ? 20.921 -88.749 65.031  1.00 123.03 ? 17  GLN A OE1   1 
ATOM   77   N  NE2   . GLN A 1 20  ? 19.563 -87.443 66.257  1.00 122.47 ? 17  GLN A NE2   1 
ATOM   78   N  N     . GLY A 1 21  ? 26.191 -86.757 66.258  1.00 117.70 ? 18  GLY A N     1 
ATOM   79   C  CA    . GLY A 1 21  ? 27.603 -87.014 66.021  1.00 116.75 ? 18  GLY A CA    1 
ATOM   80   C  C     . GLY A 1 21  ? 27.938 -87.695 64.713  1.00 116.11 ? 18  GLY A C     1 
ATOM   81   O  O     . GLY A 1 21  ? 29.111 -88.006 64.491  1.00 116.13 ? 18  GLY A O     1 
ATOM   82   N  N     . HIS A 1 22  ? 26.935 -87.936 63.831  1.00 115.44 ? 19  HIS A N     1 
ATOM   83   C  CA    . HIS A 1 22  ? 27.228 -88.594 62.557  1.00 114.85 ? 19  HIS A CA    1 
ATOM   84   C  C     . HIS A 1 22  ? 27.445 -87.606 61.401  1.00 114.00 ? 19  HIS A C     1 
ATOM   85   O  O     . HIS A 1 22  ? 26.689 -86.646 61.240  1.00 113.99 ? 19  HIS A O     1 
ATOM   86   C  CB    . HIS A 1 22  ? 26.210 -89.682 62.196  1.00 116.44 ? 19  HIS A CB    1 
ATOM   87   C  CG    . HIS A 1 22  ? 26.870 -91.007 61.919  1.00 117.84 ? 19  HIS A CG    1 
ATOM   88   N  ND1   . HIS A 1 22  ? 27.479 -91.274 60.700  1.00 118.46 ? 19  HIS A ND1   1 
ATOM   89   C  CD2   . HIS A 1 22  ? 27.024 -92.086 62.725  1.00 118.65 ? 19  HIS A CD2   1 
ATOM   90   C  CE1   . HIS A 1 22  ? 27.965 -92.501 60.803  1.00 118.73 ? 19  HIS A CE1   1 
ATOM   91   N  NE2   . HIS A 1 22  ? 27.715 -93.030 62.000  1.00 119.39 ? 19  HIS A NE2   1 
ATOM   92   N  N     . TYR A 1 23  ? 28.507 -87.870 60.608  1.00 111.29 ? 20  TYR A N     1 
ATOM   93   C  CA    . TYR A 1 23  ? 29.006 -87.098 59.466  1.00 109.99 ? 20  TYR A CA    1 
ATOM   94   C  C     . TYR A 1 23  ? 27.987 -86.757 58.374  1.00 109.06 ? 20  TYR A C     1 
ATOM   95   O  O     . TYR A 1 23  ? 27.242 -87.627 57.924  1.00 108.99 ? 20  TYR A O     1 
ATOM   96   C  CB    . TYR A 1 23  ? 30.218 -87.814 58.826  1.00 111.54 ? 20  TYR A CB    1 
ATOM   97   C  CG    . TYR A 1 23  ? 30.785 -87.103 57.613  1.00 111.89 ? 20  TYR A CG    1 
ATOM   98   C  CD1   . TYR A 1 23  ? 31.574 -85.962 57.752  1.00 112.24 ? 20  TYR A CD1   1 
ATOM   99   C  CD2   . TYR A 1 23  ? 30.512 -87.554 56.322  1.00 111.97 ? 20  TYR A CD2   1 
ATOM   100  C  CE1   . TYR A 1 23  ? 32.084 -85.292 56.639  1.00 112.40 ? 20  TYR A CE1   1 
ATOM   101  C  CE2   . TYR A 1 23  ? 31.014 -86.890 55.200  1.00 112.27 ? 20  TYR A CE2   1 
ATOM   102  C  CZ    . TYR A 1 23  ? 31.804 -85.761 55.364  1.00 112.19 ? 20  TYR A CZ    1 
ATOM   103  O  OH    . TYR A 1 23  ? 32.313 -85.090 54.276  1.00 111.95 ? 20  TYR A OH    1 
ATOM   104  N  N     . ILE A 1 24  ? 28.020 -85.474 57.921  1.00 106.42 ? 21  ILE A N     1 
ATOM   105  C  CA    . ILE A 1 24  ? 27.224 -84.881 56.833  1.00 105.04 ? 21  ILE A CA    1 
ATOM   106  C  C     . ILE A 1 24  ? 28.237 -84.217 55.886  1.00 103.97 ? 21  ILE A C     1 
ATOM   107  O  O     . ILE A 1 24  ? 29.112 -83.494 56.367  1.00 103.61 ? 21  ILE A O     1 
ATOM   108  C  CB    . ILE A 1 24  ? 26.146 -83.882 57.360  1.00 108.00 ? 21  ILE A CB    1 
ATOM   109  C  CG1   . ILE A 1 24  ? 25.060 -84.624 58.164  1.00 108.22 ? 21  ILE A CG1   1 
ATOM   110  C  CG2   . ILE A 1 24  ? 25.493 -83.084 56.215  1.00 107.89 ? 21  ILE A CG2   1 
ATOM   111  C  CD1   . ILE A 1 24  ? 24.795 -84.077 59.476  1.00 108.52 ? 21  ILE A CD1   1 
ATOM   112  N  N     . LYS A 1 25  ? 28.142 -84.478 54.558  1.00 101.90 ? 22  LYS A N     1 
ATOM   113  C  CA    . LYS A 1 25  ? 29.058 -83.904 53.558  1.00 100.62 ? 22  LYS A CA    1 
ATOM   114  C  C     . LYS A 1 25  ? 29.038 -82.384 53.611  1.00 99.70  ? 22  LYS A C     1 
ATOM   115  O  O     . LYS A 1 25  ? 27.977 -81.766 53.449  1.00 99.56  ? 22  LYS A O     1 
ATOM   116  C  CB    . LYS A 1 25  ? 28.757 -84.402 52.133  1.00 102.27 ? 22  LYS A CB    1 
ATOM   117  N  N     . GLY A 1 26  ? 30.212 -81.813 53.873  1.00 97.88  ? 23  GLY A N     1 
ATOM   118  C  CA    . GLY A 1 26  ? 30.411 -80.374 53.982  1.00 96.57  ? 23  GLY A CA    1 
ATOM   119  C  C     . GLY A 1 26  ? 30.845 -79.934 55.363  1.00 95.69  ? 23  GLY A C     1 
ATOM   120  O  O     . GLY A 1 26  ? 31.588 -78.960 55.491  1.00 95.70  ? 23  GLY A O     1 
ATOM   121  N  N     . TYR A 1 27  ? 30.376 -80.641 56.407  1.00 93.46  ? 24  TYR A N     1 
ATOM   122  C  CA    . TYR A 1 27  ? 30.693 -80.349 57.801  1.00 92.51  ? 24  TYR A CA    1 
ATOM   123  C  C     . TYR A 1 27  ? 31.903 -81.176 58.225  1.00 92.71  ? 24  TYR A C     1 
ATOM   124  O  O     . TYR A 1 27  ? 31.782 -82.401 58.316  1.00 92.91  ? 24  TYR A O     1 
ATOM   125  C  CB    . TYR A 1 27  ? 29.494 -80.667 58.710  1.00 91.79  ? 24  TYR A CB    1 
ATOM   126  C  CG    . TYR A 1 27  ? 28.250 -79.851 58.435  1.00 89.34  ? 24  TYR A CG    1 
ATOM   127  C  CD1   . TYR A 1 27  ? 27.359 -80.218 57.432  1.00 87.55  ? 24  TYR A CD1   1 
ATOM   128  C  CD2   . TYR A 1 27  ? 27.944 -78.729 59.200  1.00 86.67  ? 24  TYR A CD2   1 
ATOM   129  C  CE1   . TYR A 1 27  ? 26.207 -79.478 57.182  1.00 85.84  ? 24  TYR A CE1   1 
ATOM   130  C  CE2   . TYR A 1 27  ? 26.797 -77.975 58.956  1.00 84.94  ? 24  TYR A CE2   1 
ATOM   131  C  CZ    . TYR A 1 27  ? 25.927 -78.357 57.948  1.00 85.17  ? 24  TYR A CZ    1 
ATOM   132  O  OH    . TYR A 1 27  ? 24.783 -77.631 57.701  1.00 84.83  ? 24  TYR A OH    1 
ATOM   133  N  N     . PRO A 1 28  ? 33.079 -80.549 58.486  1.00 94.65  ? 25  PRO A N     1 
ATOM   134  C  CA    . PRO A 1 28  ? 34.256 -81.340 58.914  1.00 94.79  ? 25  PRO A CA    1 
ATOM   135  C  C     . PRO A 1 28  ? 33.993 -82.139 60.197  1.00 94.88  ? 25  PRO A C     1 
ATOM   136  O  O     . PRO A 1 28  ? 33.491 -81.575 61.170  1.00 94.58  ? 25  PRO A O     1 
ATOM   137  C  CB    . PRO A 1 28  ? 35.349 -80.281 59.114  1.00 96.43  ? 25  PRO A CB    1 
ATOM   138  C  CG    . PRO A 1 28  ? 34.882 -79.087 58.377  1.00 96.32  ? 25  PRO A CG    1 
ATOM   139  C  CD    . PRO A 1 28  ? 33.393 -79.107 58.419  1.00 96.05  ? 25  PRO A CD    1 
ATOM   140  N  N     . LYS A 1 29  ? 34.310 -83.455 60.190  1.00 96.72  ? 26  LYS A N     1 
ATOM   141  C  CA    . LYS A 1 29  ? 34.081 -84.348 61.339  1.00 97.16  ? 26  LYS A CA    1 
ATOM   142  C  C     . LYS A 1 29  ? 34.921 -84.014 62.574  1.00 97.23  ? 26  LYS A C     1 
ATOM   143  O  O     . LYS A 1 29  ? 34.467 -84.260 63.697  1.00 97.20  ? 26  LYS A O     1 
ATOM   144  C  CB    . LYS A 1 29  ? 34.252 -85.827 60.954  1.00 101.25 ? 26  LYS A CB    1 
ATOM   145  C  CG    . LYS A 1 29  ? 33.252 -86.757 61.662  1.00 102.16 ? 26  LYS A CG    1 
ATOM   146  C  CD    . LYS A 1 29  ? 33.875 -87.517 62.856  1.00 103.94 ? 26  LYS A CD    1 
ATOM   147  C  CE    . LYS A 1 29  ? 32.895 -88.413 63.594  1.00 104.45 ? 26  LYS A CE    1 
ATOM   148  N  NZ    . LYS A 1 29  ? 32.011 -87.657 64.522  1.00 104.73 ? 26  LYS A NZ    1 
ATOM   149  N  N     . GLN A 1 30  ? 36.122 -83.438 62.366  1.00 96.81  ? 27  GLN A N     1 
ATOM   150  C  CA    . GLN A 1 30  ? 37.077 -83.051 63.416  1.00 97.43  ? 27  GLN A CA    1 
ATOM   151  C  C     . GLN A 1 30  ? 36.596 -81.923 64.377  1.00 97.64  ? 27  GLN A C     1 
ATOM   152  O  O     . GLN A 1 30  ? 37.281 -81.629 65.363  1.00 97.61  ? 27  GLN A O     1 
ATOM   153  C  CB    . GLN A 1 30  ? 38.441 -82.688 62.796  1.00 98.95  ? 27  GLN A CB    1 
ATOM   154  C  CG    . GLN A 1 30  ? 38.443 -81.465 61.882  1.00 99.60  ? 27  GLN A CG    1 
ATOM   155  C  CD    . GLN A 1 30  ? 39.855 -81.063 61.549  1.00 100.88 ? 27  GLN A CD    1 
ATOM   156  O  OE1   . GLN A 1 30  ? 40.396 -81.431 60.501  1.00 102.27 ? 27  GLN A OE1   1 
ATOM   157  N  NE2   . GLN A 1 30  ? 40.494 -80.306 62.438  1.00 100.61 ? 27  GLN A NE2   1 
ATOM   158  N  N     . TYR A 1 31  ? 35.439 -81.302 64.092  1.00 98.00  ? 28  TYR A N     1 
ATOM   159  C  CA    . TYR A 1 31  ? 34.917 -80.224 64.928  1.00 98.37  ? 28  TYR A CA    1 
ATOM   160  C  C     . TYR A 1 31  ? 33.829 -80.685 65.876  1.00 98.59  ? 28  TYR A C     1 
ATOM   161  O  O     . TYR A 1 31  ? 33.188 -81.708 65.639  1.00 98.77  ? 28  TYR A O     1 
ATOM   162  C  CB    . TYR A 1 31  ? 34.473 -79.016 64.074  1.00 99.35  ? 28  TYR A CB    1 
ATOM   163  C  CG    . TYR A 1 31  ? 35.662 -78.287 63.492  1.00 99.08  ? 28  TYR A CG    1 
ATOM   164  C  CD1   . TYR A 1 31  ? 36.390 -77.378 64.256  1.00 98.80  ? 28  TYR A CD1   1 
ATOM   165  C  CD2   . TYR A 1 31  ? 36.097 -78.547 62.198  1.00 98.16  ? 28  TYR A CD2   1 
ATOM   166  C  CE1   . TYR A 1 31  ? 37.512 -76.734 63.738  1.00 98.77  ? 28  TYR A CE1   1 
ATOM   167  C  CE2   . TYR A 1 31  ? 37.215 -77.909 61.668  1.00 97.85  ? 28  TYR A CE2   1 
ATOM   168  C  CZ    . TYR A 1 31  ? 37.922 -77.005 62.443  1.00 98.34  ? 28  TYR A CZ    1 
ATOM   169  O  OH    . TYR A 1 31  ? 39.027 -76.382 61.923  1.00 98.18  ? 28  TYR A OH    1 
ATOM   170  N  N     . THR A 1 32  ? 33.641 -79.929 66.962  1.00 98.67  ? 29  THR A N     1 
ATOM   171  C  CA    . THR A 1 32  ? 32.644 -80.225 67.985  1.00 99.06  ? 29  THR A CA    1 
ATOM   172  C  C     . THR A 1 32  ? 31.368 -79.384 67.795  1.00 99.06  ? 29  THR A C     1 
ATOM   173  O  O     . THR A 1 32  ? 31.341 -78.192 68.126  1.00 99.04  ? 29  THR A O     1 
ATOM   174  C  CB    . THR A 1 32  ? 33.261 -80.116 69.395  1.00 113.73 ? 29  THR A CB    1 
ATOM   175  O  OG1   . THR A 1 32  ? 34.109 -78.960 69.459  1.00 114.27 ? 29  THR A OG1   1 
ATOM   176  C  CG2   . THR A 1 32  ? 34.044 -81.374 69.789  1.00 113.38 ? 29  THR A CG2   1 
ATOM   177  N  N     . TYR A 1 33  ? 30.313 -80.032 67.257  1.00 97.30  ? 30  TYR A N     1 
ATOM   178  C  CA    . TYR A 1 33  ? 28.995 -79.449 66.995  1.00 97.45  ? 30  TYR A CA    1 
ATOM   179  C  C     . TYR A 1 33  ? 28.087 -79.686 68.199  1.00 97.78  ? 30  TYR A C     1 
ATOM   180  O  O     . TYR A 1 33  ? 27.877 -80.837 68.589  1.00 98.01  ? 30  TYR A O     1 
ATOM   181  C  CB    . TYR A 1 33  ? 28.375 -80.083 65.743  1.00 97.97  ? 30  TYR A CB    1 
ATOM   182  C  CG    . TYR A 1 33  ? 29.245 -79.978 64.514  1.00 97.58  ? 30  TYR A CG    1 
ATOM   183  C  CD1   . TYR A 1 33  ? 29.200 -78.853 63.699  1.00 96.34  ? 30  TYR A CD1   1 
ATOM   184  C  CD2   . TYR A 1 33  ? 30.120 -81.002 64.167  1.00 96.87  ? 30  TYR A CD2   1 
ATOM   185  C  CE1   . TYR A 1 33  ? 29.991 -78.754 62.557  1.00 96.18  ? 30  TYR A CE1   1 
ATOM   186  C  CE2   . TYR A 1 33  ? 30.929 -80.908 63.036  1.00 96.51  ? 30  TYR A CE2   1 
ATOM   187  C  CZ    . TYR A 1 33  ? 30.860 -79.782 62.233  1.00 95.86  ? 30  TYR A CZ    1 
ATOM   188  O  OH    . TYR A 1 33  ? 31.641 -79.679 61.112  1.00 94.21  ? 30  TYR A OH    1 
ATOM   189  N  N     . PHE A 1 34  ? 27.543 -78.608 68.781  1.00 97.09  ? 31  PHE A N     1 
ATOM   190  C  CA    . PHE A 1 34  ? 26.678 -78.698 69.954  1.00 97.21  ? 31  PHE A CA    1 
ATOM   191  C  C     . PHE A 1 34  ? 25.445 -77.808 69.905  1.00 97.52  ? 31  PHE A C     1 
ATOM   192  O  O     . PHE A 1 34  ? 25.221 -77.115 68.914  1.00 97.63  ? 31  PHE A O     1 
ATOM   193  C  CB    . PHE A 1 34  ? 27.494 -78.409 71.219  1.00 97.95  ? 31  PHE A CB    1 
ATOM   194  C  CG    . PHE A 1 34  ? 28.109 -77.033 71.341  1.00 98.00  ? 31  PHE A CG    1 
ATOM   195  C  CD1   . PHE A 1 34  ? 29.327 -76.741 70.736  1.00 98.28  ? 31  PHE A CD1   1 
ATOM   196  C  CD2   . PHE A 1 34  ? 27.512 -76.055 72.125  1.00 97.63  ? 31  PHE A CD2   1 
ATOM   197  C  CE1   . PHE A 1 34  ? 29.915 -75.481 70.883  1.00 97.57  ? 31  PHE A CE1   1 
ATOM   198  C  CE2   . PHE A 1 34  ? 28.104 -74.796 72.272  1.00 97.67  ? 31  PHE A CE2   1 
ATOM   199  C  CZ    . PHE A 1 34  ? 29.302 -74.520 71.653  1.00 97.25  ? 31  PHE A CZ    1 
ATOM   200  N  N     . LEU A 1 35  ? 24.628 -77.853 70.972  1.00 99.39  ? 32  LEU A N     1 
ATOM   201  C  CA    . LEU A 1 35  ? 23.428 -77.034 71.120  1.00 99.45  ? 32  LEU A CA    1 
ATOM   202  C  C     . LEU A 1 35  ? 23.619 -76.152 72.344  1.00 99.38  ? 32  LEU A C     1 
ATOM   203  O  O     . LEU A 1 35  ? 24.159 -76.604 73.359  1.00 99.52  ? 32  LEU A O     1 
ATOM   204  C  CB    . LEU A 1 35  ? 22.150 -77.870 71.244  1.00 99.17  ? 32  LEU A CB    1 
ATOM   205  C  CG    . LEU A 1 35  ? 20.868 -77.161 70.796  1.00 99.53  ? 32  LEU A CG    1 
ATOM   206  C  CD1   . LEU A 1 35  ? 20.503 -77.532 69.374  1.00 99.00  ? 32  LEU A CD1   1 
ATOM   207  C  CD2   . LEU A 1 35  ? 19.714 -77.493 71.710  1.00 99.46  ? 32  LEU A CD2   1 
ATOM   208  N  N     . GLU A 1 36  ? 23.205 -74.886 72.225  1.00 101.32 ? 33  GLU A N     1 
ATOM   209  C  CA    . GLU A 1 36  ? 23.304 -73.850 73.252  1.00 101.30 ? 33  GLU A CA    1 
ATOM   210  C  C     . GLU A 1 36  ? 22.308 -72.756 72.875  1.00 101.16 ? 33  GLU A C     1 
ATOM   211  O  O     . GLU A 1 36  ? 22.103 -72.524 71.685  1.00 101.18 ? 33  GLU A O     1 
ATOM   212  C  CB    . GLU A 1 36  ? 24.738 -73.285 73.270  1.00 102.77 ? 33  GLU A CB    1 
ATOM   213  C  CG    . GLU A 1 36  ? 25.091 -72.456 74.490  1.00 104.07 ? 33  GLU A CG    1 
ATOM   214  C  CD    . GLU A 1 36  ? 26.503 -71.898 74.472  1.00 105.77 ? 33  GLU A CD    1 
ATOM   215  O  OE1   . GLU A 1 36  ? 26.663 -70.692 74.171  1.00 105.77 ? 33  GLU A OE1   1 
ATOM   216  O  OE2   . GLU A 1 36  ? 27.451 -72.667 74.760  1.00 106.60 ? 33  GLU A OE2   1 
ATOM   217  N  N     . ASP A 1 37  ? 21.669 -72.106 73.873  1.00 103.47 ? 34  ASP A N     1 
ATOM   218  C  CA    . ASP A 1 37  ? 20.690 -71.012 73.694  1.00 103.16 ? 34  ASP A CA    1 
ATOM   219  C  C     . ASP A 1 37  ? 19.610 -71.288 72.615  1.00 102.56 ? 34  ASP A C     1 
ATOM   220  O  O     . ASP A 1 37  ? 19.046 -70.351 72.032  1.00 102.56 ? 34  ASP A O     1 
ATOM   221  C  CB    . ASP A 1 37  ? 21.415 -69.670 73.420  1.00 106.94 ? 34  ASP A CB    1 
ATOM   222  C  CG    . ASP A 1 37  ? 22.015 -68.999 74.649  1.00 108.03 ? 34  ASP A CG    1 
ATOM   223  O  OD1   . ASP A 1 37  ? 21.234 -68.516 75.507  1.00 108.91 ? 34  ASP A OD1   1 
ATOM   224  O  OD2   . ASP A 1 37  ? 23.268 -68.940 74.747  1.00 108.56 ? 34  ASP A OD2   1 
ATOM   225  N  N     . GLY A 1 38  ? 19.344 -72.571 72.372  1.00 99.87  ? 35  GLY A N     1 
ATOM   226  C  CA    . GLY A 1 38  ? 18.371 -73.027 71.387  1.00 98.88  ? 35  GLY A CA    1 
ATOM   227  C  C     . GLY A 1 38  ? 18.849 -72.889 69.955  1.00 98.23  ? 35  GLY A C     1 
ATOM   228  O  O     . GLY A 1 38  ? 18.043 -72.614 69.061  1.00 98.41  ? 35  GLY A O     1 
ATOM   229  N  N     . LYS A 1 39  ? 20.168 -73.074 69.722  1.00 94.49  ? 36  LYS A N     1 
ATOM   230  C  CA    . LYS A 1 39  ? 20.786 -72.973 68.391  1.00 93.63  ? 36  LYS A CA    1 
ATOM   231  C  C     . LYS A 1 39  ? 22.044 -73.843 68.255  1.00 92.57  ? 36  LYS A C     1 
ATOM   232  O  O     . LYS A 1 39  ? 22.809 -73.982 69.213  1.00 92.53  ? 36  LYS A O     1 
ATOM   233  C  CB    . LYS A 1 39  ? 21.054 -71.503 67.975  1.00 95.31  ? 36  LYS A CB    1 
ATOM   234  C  CG    . LYS A 1 39  ? 21.486 -70.566 69.103  1.00 95.90  ? 36  LYS A CG    1 
ATOM   235  C  CD    . LYS A 1 39  ? 21.664 -69.126 68.644  1.00 96.40  ? 36  LYS A CD    1 
ATOM   236  C  CE    . LYS A 1 39  ? 20.422 -68.274 68.771  1.00 96.88  ? 36  LYS A CE    1 
ATOM   237  N  NZ    . LYS A 1 39  ? 20.530 -67.048 67.933  1.00 97.20  ? 36  LYS A NZ    1 
ATOM   238  N  N     . VAL A 1 40  ? 22.241 -74.446 67.064  1.00 90.06  ? 37  VAL A N     1 
ATOM   239  C  CA    . VAL A 1 40  ? 23.399 -75.310 66.786  1.00 89.04  ? 37  VAL A CA    1 
ATOM   240  C  C     . VAL A 1 40  ? 24.650 -74.433 66.689  1.00 88.58  ? 37  VAL A C     1 
ATOM   241  O  O     . VAL A 1 40  ? 24.647 -73.474 65.924  1.00 88.40  ? 37  VAL A O     1 
ATOM   242  C  CB    . VAL A 1 40  ? 23.204 -76.189 65.516  1.00 91.92  ? 37  VAL A CB    1 
ATOM   243  C  CG1   . VAL A 1 40  ? 24.395 -77.116 65.284  1.00 91.47  ? 37  VAL A CG1   1 
ATOM   244  C  CG2   . VAL A 1 40  ? 21.915 -76.991 65.597  1.00 91.67  ? 37  VAL A CG2   1 
ATOM   245  N  N     . LYS A 1 41  ? 25.692 -74.744 67.476  1.00 86.24  ? 38  LYS A N     1 
ATOM   246  C  CA    . LYS A 1 41  ? 26.953 -73.999 67.486  1.00 85.55  ? 38  LYS A CA    1 
ATOM   247  C  C     . LYS A 1 41  ? 28.117 -74.912 67.110  1.00 85.64  ? 38  LYS A C     1 
ATOM   248  O  O     . LYS A 1 41  ? 27.957 -76.131 67.051  1.00 85.91  ? 38  LYS A O     1 
ATOM   249  C  CB    . LYS A 1 41  ? 27.194 -73.311 68.846  1.00 86.43  ? 38  LYS A CB    1 
ATOM   250  C  CG    . LYS A 1 41  ? 26.141 -72.269 69.195  1.00 85.48  ? 38  LYS A CG    1 
ATOM   251  C  CD    . LYS A 1 41  ? 26.531 -71.352 70.328  1.00 83.83  ? 38  LYS A CD    1 
ATOM   252  C  CE    . LYS A 1 41  ? 25.388 -70.396 70.601  1.00 83.48  ? 38  LYS A CE    1 
ATOM   253  N  NZ    . LYS A 1 41  ? 25.648 -69.498 71.762  1.00 83.40  ? 38  LYS A NZ    1 
ATOM   254  N  N     . VAL A 1 42  ? 29.279 -74.319 66.823  1.00 86.47  ? 39  VAL A N     1 
ATOM   255  C  CA    . VAL A 1 42  ? 30.494 -75.038 66.446  1.00 86.46  ? 39  VAL A CA    1 
ATOM   256  C  C     . VAL A 1 42  ? 31.706 -74.269 66.946  1.00 86.53  ? 39  VAL A C     1 
ATOM   257  O  O     . VAL A 1 42  ? 31.739 -73.044 66.828  1.00 86.56  ? 39  VAL A O     1 
ATOM   258  C  CB    . VAL A 1 42  ? 30.573 -75.395 64.926  1.00 89.78  ? 39  VAL A CB    1 
ATOM   259  C  CG1   . VAL A 1 42  ? 30.591 -74.153 64.028  1.00 89.90  ? 39  VAL A CG1   1 
ATOM   260  C  CG2   . VAL A 1 42  ? 31.763 -76.308 64.623  1.00 89.98  ? 39  VAL A CG2   1 
ATOM   261  N  N     . SER A 1 43  ? 32.685 -74.970 67.529  1.00 89.35  ? 40  SER A N     1 
ATOM   262  C  CA    . SER A 1 43  ? 33.873 -74.285 67.999  1.00 89.72  ? 40  SER A CA    1 
ATOM   263  C  C     . SER A 1 43  ? 34.918 -74.340 66.906  1.00 89.90  ? 40  SER A C     1 
ATOM   264  O  O     . SER A 1 43  ? 35.546 -75.373 66.673  1.00 89.94  ? 40  SER A O     1 
ATOM   265  C  CB    . SER A 1 43  ? 34.385 -74.864 69.307  1.00 94.26  ? 40  SER A CB    1 
ATOM   266  O  OG    . SER A 1 43  ? 35.350 -73.958 69.815  1.00 94.94  ? 40  SER A OG    1 
ATOM   267  N  N     . ARG A 1 44  ? 35.061 -73.229 66.202  1.00 89.90  ? 41  ARG A N     1 
ATOM   268  C  CA    . ARG A 1 44  ? 36.003 -73.095 65.105  1.00 89.94  ? 41  ARG A CA    1 
ATOM   269  C  C     . ARG A 1 44  ? 37.226 -72.294 65.543  1.00 89.91  ? 41  ARG A C     1 
ATOM   270  O  O     . ARG A 1 44  ? 37.136 -71.591 66.557  1.00 90.02  ? 41  ARG A O     1 
ATOM   271  C  CB    . ARG A 1 44  ? 35.303 -72.493 63.891  1.00 90.32  ? 41  ARG A CB    1 
ATOM   272  C  CG    . ARG A 1 44  ? 34.454 -73.532 63.187  1.00 91.06  ? 41  ARG A CG    1 
ATOM   273  C  CD    . ARG A 1 44  ? 34.191 -73.175 61.758  1.00 90.87  ? 41  ARG A CD    1 
ATOM   274  N  NE    . ARG A 1 44  ? 35.345 -73.413 60.893  1.00 91.81  ? 41  ARG A NE    1 
ATOM   275  C  CZ    . ARG A 1 44  ? 35.587 -74.561 60.269  1.00 92.00  ? 41  ARG A CZ    1 
ATOM   276  N  NH1   . ARG A 1 44  ? 34.769 -75.598 60.426  1.00 92.69  ? 41  ARG A NH1   1 
ATOM   277  N  NH2   . ARG A 1 44  ? 36.647 -74.684 59.486  1.00 91.43  ? 41  ARG A NH2   1 
ATOM   278  N  N     . PRO A 1 45  ? 38.388 -72.402 64.845  1.00 89.87  ? 42  PRO A N     1 
ATOM   279  C  CA    . PRO A 1 45  ? 39.580 -71.656 65.290  1.00 89.57  ? 42  PRO A CA    1 
ATOM   280  C  C     . PRO A 1 45  ? 39.307 -70.189 65.599  1.00 89.31  ? 42  PRO A C     1 
ATOM   281  O  O     . PRO A 1 45  ? 39.710 -69.705 66.655  1.00 89.49  ? 42  PRO A O     1 
ATOM   282  C  CB    . PRO A 1 45  ? 40.561 -71.843 64.133  1.00 91.25  ? 42  PRO A CB    1 
ATOM   283  C  CG    . PRO A 1 45  ? 40.173 -73.165 63.536  1.00 91.22  ? 42  PRO A CG    1 
ATOM   284  C  CD    . PRO A 1 45  ? 38.681 -73.210 63.638  1.00 91.42  ? 42  PRO A CD    1 
ATOM   285  N  N     . GLU A 1 46  ? 38.570 -69.511 64.702  1.00 89.59  ? 43  GLU A N     1 
ATOM   286  C  CA    . GLU A 1 46  ? 38.172 -68.114 64.804  1.00 88.87  ? 43  GLU A CA    1 
ATOM   287  C  C     . GLU A 1 46  ? 37.394 -67.819 66.113  1.00 88.27  ? 43  GLU A C     1 
ATOM   288  O  O     . GLU A 1 46  ? 37.593 -66.764 66.729  1.00 88.69  ? 43  GLU A O     1 
ATOM   289  C  CB    . GLU A 1 46  ? 37.338 -67.748 63.569  1.00 90.20  ? 43  GLU A CB    1 
ATOM   290  N  N     . GLY A 1 47  ? 36.542 -68.761 66.523  1.00 86.45  ? 44  GLY A N     1 
ATOM   291  C  CA    . GLY A 1 47  ? 35.708 -68.674 67.719  1.00 84.61  ? 44  GLY A CA    1 
ATOM   292  C  C     . GLY A 1 47  ? 34.468 -69.534 67.588  1.00 83.35  ? 44  GLY A C     1 
ATOM   293  O  O     . GLY A 1 47  ? 34.371 -70.345 66.665  1.00 83.46  ? 44  GLY A O     1 
ATOM   294  N  N     . VAL A 1 48  ? 33.502 -69.368 68.492  1.00 82.35  ? 45  VAL A N     1 
ATOM   295  C  CA    . VAL A 1 48  ? 32.281 -70.168 68.434  1.00 80.49  ? 45  VAL A CA    1 
ATOM   296  C  C     . VAL A 1 48  ? 31.240 -69.488 67.556  1.00 79.47  ? 45  VAL A C     1 
ATOM   297  O  O     . VAL A 1 48  ? 30.737 -68.420 67.912  1.00 79.21  ? 45  VAL A O     1 
ATOM   298  C  CB    . VAL A 1 48  ? 31.752 -70.557 69.838  1.00 83.88  ? 45  VAL A CB    1 
ATOM   299  C  CG1   . VAL A 1 48  ? 30.415 -71.296 69.752  1.00 82.65  ? 45  VAL A CG1   1 
ATOM   300  C  CG2   . VAL A 1 48  ? 32.785 -71.400 70.578  1.00 83.89  ? 45  VAL A CG2   1 
ATOM   301  N  N     . LYS A 1 49  ? 30.917 -70.108 66.412  1.00 76.89  ? 46  LYS A N     1 
ATOM   302  C  CA    . LYS A 1 49  ? 29.941 -69.557 65.477  1.00 75.72  ? 46  LYS A CA    1 
ATOM   303  C  C     . LYS A 1 49  ? 28.650 -70.363 65.502  1.00 75.72  ? 46  LYS A C     1 
ATOM   304  O  O     . LYS A 1 49  ? 28.666 -71.546 65.845  1.00 75.47  ? 46  LYS A O     1 
ATOM   305  C  CB    . LYS A 1 49  ? 30.511 -69.487 64.041  1.00 76.35  ? 46  LYS A CB    1 
ATOM   306  C  CG    . LYS A 1 49  ? 31.913 -68.899 63.911  1.00 73.88  ? 46  LYS A CG    1 
ATOM   307  C  CD    . LYS A 1 49  ? 31.974 -67.416 64.204  1.00 72.33  ? 46  LYS A CD    1 
ATOM   308  C  CE    . LYS A 1 49  ? 33.398 -66.932 64.277  1.00 71.28  ? 46  LYS A CE    1 
ATOM   309  N  NZ    . LYS A 1 49  ? 33.447 -65.448 64.429  1.00 68.91  ? 46  LYS A NZ    1 
ATOM   310  N  N     . ILE A 1 50  ? 27.538 -69.721 65.135  1.00 73.26  ? 47  ILE A N     1 
ATOM   311  C  CA    . ILE A 1 50  ? 26.230 -70.345 65.076  1.00 72.89  ? 47  ILE A CA    1 
ATOM   312  C  C     . ILE A 1 50  ? 26.090 -70.997 63.692  1.00 73.39  ? 47  ILE A C     1 
ATOM   313  O  O     . ILE A 1 50  ? 26.486 -70.395 62.694  1.00 74.12  ? 47  ILE A O     1 
ATOM   314  C  CB    . ILE A 1 50  ? 25.124 -69.272 65.319  1.00 74.07  ? 47  ILE A CB    1 
ATOM   315  C  CG1   . ILE A 1 50  ? 25.135 -68.752 66.766  1.00 73.94  ? 47  ILE A CG1   1 
ATOM   316  C  CG2   . ILE A 1 50  ? 23.732 -69.755 64.908  1.00 72.99  ? 47  ILE A CG2   1 
ATOM   317  C  CD1   . ILE A 1 50  ? 24.502 -67.340 66.939  1.00 72.52  ? 47  ILE A CD1   1 
ATOM   318  N  N     . ILE A 1 51  ? 25.531 -72.217 63.627  1.00 75.71  ? 48  ILE A N     1 
ATOM   319  C  CA    . ILE A 1 51  ? 25.281 -72.867 62.351  1.00 75.81  ? 48  ILE A CA    1 
ATOM   320  C  C     . ILE A 1 51  ? 23.790 -72.674 62.072  1.00 76.38  ? 48  ILE A C     1 
ATOM   321  O  O     . ILE A 1 51  ? 22.969 -73.391 62.658  1.00 77.39  ? 48  ILE A O     1 
ATOM   322  C  CB    . ILE A 1 51  ? 25.692 -74.347 62.251  1.00 77.79  ? 48  ILE A CB    1 
ATOM   323  C  CG1   . ILE A 1 51  ? 27.154 -74.552 62.645  1.00 77.34  ? 48  ILE A CG1   1 
ATOM   324  C  CG2   . ILE A 1 51  ? 25.421 -74.850 60.826  1.00 76.66  ? 48  ILE A CG2   1 
ATOM   325  C  CD1   . ILE A 1 51  ? 27.593 -75.968 62.646  1.00 77.21  ? 48  ILE A CD1   1 
ATOM   326  N  N     . PRO A 1 52  ? 23.392 -71.704 61.220  1.00 77.35  ? 49  PRO A N     1 
ATOM   327  C  CA    . PRO A 1 52  ? 21.958 -71.549 60.953  1.00 77.29  ? 49  PRO A CA    1 
ATOM   328  C  C     . PRO A 1 52  ? 21.421 -72.667 60.045  1.00 77.80  ? 49  PRO A C     1 
ATOM   329  O  O     . PRO A 1 52  ? 22.167 -73.166 59.196  1.00 77.59  ? 49  PRO A O     1 
ATOM   330  C  CB    . PRO A 1 52  ? 21.879 -70.179 60.276  1.00 78.40  ? 49  PRO A CB    1 
ATOM   331  C  CG    . PRO A 1 52  ? 23.179 -70.020 59.605  1.00 77.97  ? 49  PRO A CG    1 
ATOM   332  C  CD    . PRO A 1 52  ? 24.196 -70.745 60.432  1.00 78.30  ? 49  PRO A CD    1 
ATOM   333  N  N     . PRO A 1 53  ? 20.143 -73.081 60.179  1.00 80.20  ? 50  PRO A N     1 
ATOM   334  C  CA    . PRO A 1 53  ? 19.622 -74.120 59.268  1.00 80.71  ? 50  PRO A CA    1 
ATOM   335  C  C     . PRO A 1 53  ? 19.639 -73.619 57.824  1.00 81.19  ? 50  PRO A C     1 
ATOM   336  O  O     . PRO A 1 53  ? 19.484 -72.413 57.611  1.00 81.67  ? 50  PRO A O     1 
ATOM   337  C  CB    . PRO A 1 53  ? 18.188 -74.340 59.765  1.00 82.27  ? 50  PRO A CB    1 
ATOM   338  C  CG    . PRO A 1 53  ? 17.827 -73.082 60.494  1.00 82.43  ? 50  PRO A CG    1 
ATOM   339  C  CD    . PRO A 1 53  ? 19.104 -72.609 61.121  1.00 82.01  ? 50  PRO A CD    1 
ATOM   340  N  N     . GLN A 1 54  ? 19.837 -74.523 56.842  1.00 82.99  ? 51  GLN A N     1 
ATOM   341  C  CA    . GLN A 1 54  ? 19.879 -74.173 55.417  1.00 83.37  ? 51  GLN A CA    1 
ATOM   342  C  C     . GLN A 1 54  ? 18.735 -73.202 55.019  1.00 82.75  ? 51  GLN A C     1 
ATOM   343  O  O     . GLN A 1 54  ? 18.962 -72.267 54.243  1.00 82.71  ? 51  GLN A O     1 
ATOM   344  C  CB    . GLN A 1 54  ? 19.933 -75.455 54.551  1.00 85.96  ? 51  GLN A CB    1 
ATOM   345  C  CG    . GLN A 1 54  ? 19.582 -75.310 53.063  1.00 89.41  ? 51  GLN A CG    1 
ATOM   346  C  CD    . GLN A 1 54  ? 20.606 -74.552 52.240  1.00 93.85  ? 51  GLN A CD    1 
ATOM   347  O  OE1   . GLN A 1 54  ? 21.813 -74.849 52.267  1.00 95.50  ? 51  GLN A OE1   1 
ATOM   348  N  NE2   . GLN A 1 54  ? 20.144 -73.554 51.475  1.00 95.01  ? 51  GLN A NE2   1 
ATOM   349  N  N     . SER A 1 55  ? 17.534 -73.386 55.608  1.00 82.97  ? 52  SER A N     1 
ATOM   350  C  CA    . SER A 1 55  ? 16.336 -72.564 55.360  1.00 82.24  ? 52  SER A CA    1 
ATOM   351  C  C     . SER A 1 55  ? 16.446 -71.099 55.822  1.00 81.98  ? 52  SER A C     1 
ATOM   352  O  O     . SER A 1 55  ? 15.588 -70.288 55.478  1.00 81.94  ? 52  SER A O     1 
ATOM   353  C  CB    . SER A 1 55  ? 15.109 -73.215 55.995  1.00 86.18  ? 52  SER A CB    1 
ATOM   354  O  OG    . SER A 1 55  ? 15.081 -73.052 57.405  1.00 84.95  ? 52  SER A OG    1 
ATOM   355  N  N     . ASP A 1 56  ? 17.471 -70.774 56.610  1.00 80.30  ? 53  ASP A N     1 
ATOM   356  C  CA    . ASP A 1 56  ? 17.692 -69.438 57.147  1.00 80.53  ? 53  ASP A CA    1 
ATOM   357  C  C     . ASP A 1 56  ? 18.815 -68.646 56.469  1.00 79.77  ? 53  ASP A C     1 
ATOM   358  O  O     . ASP A 1 56  ? 18.811 -67.415 56.533  1.00 80.02  ? 53  ASP A O     1 
ATOM   359  C  CB    . ASP A 1 56  ? 17.999 -69.545 58.645  1.00 82.78  ? 53  ASP A CB    1 
ATOM   360  C  CG    . ASP A 1 56  ? 16.793 -69.600 59.550  1.00 84.32  ? 53  ASP A CG    1 
ATOM   361  O  OD1   . ASP A 1 56  ? 15.658 -69.429 59.043  1.00 86.17  ? 53  ASP A OD1   1 
ATOM   362  O  OD2   . ASP A 1 56  ? 16.980 -69.804 60.768  1.00 86.25  ? 53  ASP A OD2   1 
ATOM   363  N  N     . ARG A 1 57  ? 19.774 -69.351 55.852  1.00 78.17  ? 54  ARG A N     1 
ATOM   364  C  CA    . ARG A 1 57  ? 20.973 -68.819 55.210  1.00 77.80  ? 54  ARG A CA    1 
ATOM   365  C  C     . ARG A 1 57  ? 20.731 -67.742 54.164  1.00 77.51  ? 54  ARG A C     1 
ATOM   366  O  O     . ARG A 1 57  ? 21.424 -66.728 54.210  1.00 77.33  ? 54  ARG A O     1 
ATOM   367  C  CB    . ARG A 1 57  ? 21.819 -69.947 54.642  1.00 72.89  ? 54  ARG A CB    1 
ATOM   368  C  CG    . ARG A 1 57  ? 22.244 -70.876 55.765  1.00 73.16  ? 54  ARG A CG    1 
ATOM   369  C  CD    . ARG A 1 57  ? 23.054 -72.051 55.299  1.00 72.50  ? 54  ARG A CD    1 
ATOM   370  N  NE    . ARG A 1 57  ? 23.255 -72.996 56.390  1.00 72.84  ? 54  ARG A NE    1 
ATOM   371  C  CZ    . ARG A 1 57  ? 23.685 -74.239 56.229  1.00 72.91  ? 54  ARG A CZ    1 
ATOM   372  N  NH1   . ARG A 1 57  ? 23.991 -74.691 55.017  1.00 71.95  ? 54  ARG A NH1   1 
ATOM   373  N  NH2   . ARG A 1 57  ? 23.827 -75.038 57.275  1.00 71.92  ? 54  ARG A NH2   1 
ATOM   374  N  N     . GLN A 1 58  ? 19.767 -67.923 53.254  1.00 77.59  ? 55  GLN A N     1 
ATOM   375  C  CA    . GLN A 1 58  ? 19.477 -66.923 52.225  1.00 77.57  ? 55  GLN A CA    1 
ATOM   376  C  C     . GLN A 1 58  ? 19.212 -65.549 52.824  1.00 76.78  ? 55  GLN A C     1 
ATOM   377  O  O     . GLN A 1 58  ? 19.787 -64.573 52.345  1.00 76.82  ? 55  GLN A O     1 
ATOM   378  C  CB    . GLN A 1 58  ? 18.330 -67.370 51.307  1.00 80.04  ? 55  GLN A CB    1 
ATOM   379  C  CG    . GLN A 1 58  ? 17.684 -66.221 50.521  1.00 83.07  ? 55  GLN A CG    1 
ATOM   380  C  CD    . GLN A 1 58  ? 17.023 -66.638 49.231  1.00 87.44  ? 55  GLN A CD    1 
ATOM   381  O  OE1   . GLN A 1 58  ? 17.298 -67.712 48.662  1.00 87.88  ? 55  GLN A OE1   1 
ATOM   382  N  NE2   . GLN A 1 58  ? 16.138 -65.782 48.731  1.00 89.45  ? 55  GLN A NE2   1 
ATOM   383  N  N     . LYS A 1 59  ? 18.363 -65.487 53.877  1.00 74.42  ? 56  LYS A N     1 
ATOM   384  C  CA    . LYS A 1 59  ? 17.964 -64.278 54.612  1.00 73.46  ? 56  LYS A CA    1 
ATOM   385  C  C     . LYS A 1 59  ? 19.152 -63.604 55.288  1.00 71.89  ? 56  LYS A C     1 
ATOM   386  O  O     . LYS A 1 59  ? 19.209 -62.377 55.321  1.00 71.52  ? 56  LYS A O     1 
ATOM   387  C  CB    . LYS A 1 59  ? 16.901 -64.608 55.673  1.00 76.69  ? 56  LYS A CB    1 
ATOM   388  C  CG    . LYS A 1 59  ? 15.992 -63.435 55.987  1.00 79.49  ? 56  LYS A CG    1 
ATOM   389  C  CD    . LYS A 1 59  ? 15.448 -63.461 57.409  1.00 83.78  ? 56  LYS A CD    1 
ATOM   390  C  CE    . LYS A 1 59  ? 14.299 -62.469 57.566  1.00 86.14  ? 56  LYS A CE    1 
ATOM   391  N  NZ    . LYS A 1 59  ? 14.000 -62.139 58.996  1.00 88.28  ? 56  LYS A NZ    1 
ATOM   392  N  N     . ILE A 1 60  ? 20.075 -64.397 55.850  1.00 67.83  ? 57  ILE A N     1 
ATOM   393  C  CA    . ILE A 1 60  ? 21.275 -63.907 56.534  1.00 66.25  ? 57  ILE A CA    1 
ATOM   394  C  C     . ILE A 1 60  ? 22.202 -63.212 55.522  1.00 65.30  ? 57  ILE A C     1 
ATOM   395  O  O     . ILE A 1 60  ? 22.663 -62.085 55.776  1.00 64.61  ? 57  ILE A O     1 
ATOM   396  C  CB    . ILE A 1 60  ? 21.966 -65.064 57.304  1.00 67.01  ? 57  ILE A CB    1 
ATOM   397  C  CG1   . ILE A 1 60  ? 21.146 -65.419 58.546  1.00 67.85  ? 57  ILE A CG1   1 
ATOM   398  C  CG2   . ILE A 1 60  ? 23.426 -64.741 57.666  1.00 66.62  ? 57  ILE A CG2   1 
ATOM   399  C  CD1   . ILE A 1 60  ? 21.252 -66.779 58.971  1.00 65.37  ? 57  ILE A CD1   1 
ATOM   400  N  N     . VAL A 1 61  ? 22.443 -63.884 54.372  1.00 63.59  ? 58  VAL A N     1 
ATOM   401  C  CA    . VAL A 1 61  ? 23.307 -63.387 53.307  1.00 63.01  ? 58  VAL A CA    1 
ATOM   402  C  C     . VAL A 1 61  ? 22.746 -62.093 52.775  1.00 62.96  ? 58  VAL A C     1 
ATOM   403  O  O     . VAL A 1 61  ? 23.482 -61.128 52.602  1.00 62.19  ? 58  VAL A O     1 
ATOM   404  C  CB    . VAL A 1 61  ? 23.572 -64.430 52.193  1.00 64.71  ? 58  VAL A CB    1 
ATOM   405  C  CG1   . VAL A 1 61  ? 24.499 -63.863 51.129  1.00 64.64  ? 58  VAL A CG1   1 
ATOM   406  C  CG2   . VAL A 1 61  ? 24.160 -65.714 52.764  1.00 65.12  ? 58  VAL A CG2   1 
ATOM   407  N  N     . LEU A 1 62  ? 21.438 -62.062 52.565  1.00 65.50  ? 59  LEU A N     1 
ATOM   408  C  CA    . LEU A 1 62  ? 20.732 -60.902 52.070  1.00 66.22  ? 59  LEU A CA    1 
ATOM   409  C  C     . LEU A 1 62  ? 20.816 -59.763 53.082  1.00 66.14  ? 59  LEU A C     1 
ATOM   410  O  O     . LEU A 1 62  ? 21.046 -58.630 52.674  1.00 67.49  ? 59  LEU A O     1 
ATOM   411  C  CB    . LEU A 1 62  ? 19.286 -61.291 51.734  1.00 67.11  ? 59  LEU A CB    1 
ATOM   412  C  CG    . LEU A 1 62  ? 18.381 -60.210 51.153  1.00 69.82  ? 59  LEU A CG    1 
ATOM   413  C  CD1   . LEU A 1 62  ? 18.876 -59.717 49.782  1.00 70.02  ? 59  LEU A CD1   1 
ATOM   414  C  CD2   . LEU A 1 62  ? 16.946 -60.696 51.072  1.00 70.51  ? 59  LEU A CD2   1 
ATOM   415  N  N     . GLN A 1 63  ? 20.677 -60.059 54.384  1.00 66.25  ? 60  GLN A N     1 
ATOM   416  C  CA    . GLN A 1 63  ? 20.771 -59.053 55.429  1.00 65.88  ? 60  GLN A CA    1 
ATOM   417  C  C     . GLN A 1 63  ? 22.183 -58.486 55.515  1.00 64.39  ? 60  GLN A C     1 
ATOM   418  O  O     . GLN A 1 63  ? 22.329 -57.270 55.634  1.00 64.77  ? 60  GLN A O     1 
ATOM   419  C  CB    . GLN A 1 63  ? 20.349 -59.620 56.784  1.00 69.80  ? 60  GLN A CB    1 
ATOM   420  C  CG    . GLN A 1 63  ? 18.842 -59.558 57.024  1.00 74.41  ? 60  GLN A CG    1 
ATOM   421  C  CD    . GLN A 1 63  ? 18.358 -60.385 58.213  1.00 79.11  ? 60  GLN A CD    1 
ATOM   422  O  OE1   . GLN A 1 63  ? 19.135 -61.058 58.940  1.00 81.42  ? 60  GLN A OE1   1 
ATOM   423  N  NE2   . GLN A 1 63  ? 17.044 -60.348 58.431  1.00 80.62  ? 60  GLN A NE2   1 
ATOM   424  N  N     . ALA A 1 64  ? 23.220 -59.354 55.467  1.00 60.70  ? 61  ALA A N     1 
ATOM   425  C  CA    . ALA A 1 64  ? 24.609 -58.918 55.534  1.00 59.85  ? 61  ALA A CA    1 
ATOM   426  C  C     . ALA A 1 64  ? 24.927 -58.040 54.336  1.00 59.17  ? 61  ALA A C     1 
ATOM   427  O  O     . ALA A 1 64  ? 25.406 -56.918 54.517  1.00 58.50  ? 61  ALA A O     1 
ATOM   428  C  CB    . ALA A 1 64  ? 25.531 -60.105 55.568  1.00 60.05  ? 61  ALA A CB    1 
ATOM   429  N  N     . HIS A 1 65  ? 24.607 -58.514 53.122  1.00 57.92  ? 62  HIS A N     1 
ATOM   430  C  CA    . HIS A 1 65  ? 24.839 -57.772 51.891  1.00 57.13  ? 62  HIS A CA    1 
ATOM   431  C  C     . HIS A 1 65  ? 24.160 -56.423 51.850  1.00 57.31  ? 62  HIS A C     1 
ATOM   432  O  O     . HIS A 1 65  ? 24.776 -55.463 51.400  1.00 56.34  ? 62  HIS A O     1 
ATOM   433  C  CB    . HIS A 1 65  ? 24.429 -58.594 50.657  1.00 58.54  ? 62  HIS A CB    1 
ATOM   434  C  CG    . HIS A 1 65  ? 24.439 -57.806 49.383  1.00 58.10  ? 62  HIS A CG    1 
ATOM   435  N  ND1   . HIS A 1 65  ? 25.604 -57.620 48.663  1.00 56.36  ? 62  HIS A ND1   1 
ATOM   436  C  CD2   . HIS A 1 65  ? 23.428 -57.154 48.753  1.00 56.17  ? 62  HIS A CD2   1 
ATOM   437  C  CE1   . HIS A 1 65  ? 25.265 -56.887 47.613  1.00 58.50  ? 62  HIS A CE1   1 
ATOM   438  N  NE2   . HIS A 1 65  ? 23.969 -56.579 47.621  1.00 54.93  ? 62  HIS A NE2   1 
ATOM   439  N  N     . ASN A 1 66  ? 22.895 -56.345 52.288  1.00 57.19  ? 63  ASN A N     1 
ATOM   440  C  CA    . ASN A 1 66  ? 22.084 -55.125 52.217  1.00 57.62  ? 63  ASN A CA    1 
ATOM   441  C  C     . ASN A 1 66  ? 22.543 -53.955 53.083  1.00 57.52  ? 63  ASN A C     1 
ATOM   442  O  O     . ASN A 1 66  ? 22.128 -52.827 52.804  1.00 57.86  ? 63  ASN A O     1 
ATOM   443  C  CB    . ASN A 1 66  ? 20.624 -55.434 52.481  1.00 60.39  ? 63  ASN A CB    1 
ATOM   444  C  CG    . ASN A 1 66  ? 19.884 -55.966 51.282  1.00 63.23  ? 63  ASN A CG    1 
ATOM   445  O  OD1   . ASN A 1 66  ? 20.426 -56.148 50.175  1.00 64.68  ? 63  ASN A OD1   1 
ATOM   446  N  ND2   . ASN A 1 66  ? 18.612 -56.232 51.485  1.00 64.50  ? 63  ASN A ND2   1 
ATOM   447  N  N     . LEU A 1 67  ? 23.403 -54.194 54.097  1.00 54.45  ? 64  LEU A N     1 
ATOM   448  C  CA    . LEU A 1 67  ? 23.926 -53.131 54.978  1.00 54.32  ? 64  LEU A CA    1 
ATOM   449  C  C     . LEU A 1 67  ? 24.566 -52.005 54.167  1.00 53.91  ? 64  LEU A C     1 
ATOM   450  O  O     . LEU A 1 67  ? 24.142 -50.863 54.315  1.00 53.42  ? 64  LEU A O     1 
ATOM   451  C  CB    . LEU A 1 67  ? 24.889 -53.701 56.012  1.00 52.80  ? 64  LEU A CB    1 
ATOM   452  C  CG    . LEU A 1 67  ? 24.314 -54.813 56.922  1.00 52.79  ? 64  LEU A CG    1 
ATOM   453  C  CD1   . LEU A 1 67  ? 25.431 -55.540 57.633  1.00 49.60  ? 64  LEU A CD1   1 
ATOM   454  C  CD2   . LEU A 1 67  ? 23.247 -54.276 57.877  1.00 51.43  ? 64  LEU A CD2   1 
ATOM   455  N  N     . ALA A 1 68  ? 25.507 -52.327 53.250  1.00 52.86  ? 65  ALA A N     1 
ATOM   456  C  CA    . ALA A 1 68  ? 26.143 -51.335 52.376  1.00 52.48  ? 65  ALA A CA    1 
ATOM   457  C  C     . ALA A 1 68  ? 26.243 -51.825 50.910  1.00 51.77  ? 65  ALA A C     1 
ATOM   458  O  O     . ALA A 1 68  ? 27.028 -51.269 50.133  1.00 51.01  ? 65  ALA A O     1 
ATOM   459  C  CB    . ALA A 1 68  ? 27.517 -50.984 52.906  1.00 52.65  ? 65  ALA A CB    1 
ATOM   460  N  N     . HIS A 1 69  ? 25.456 -52.874 50.544  1.00 52.58  ? 66  HIS A N     1 
ATOM   461  C  CA    . HIS A 1 69  ? 25.448 -53.486 49.220  1.00 53.02  ? 66  HIS A CA    1 
ATOM   462  C  C     . HIS A 1 69  ? 26.885 -53.870 48.807  1.00 53.39  ? 66  HIS A C     1 
ATOM   463  O  O     . HIS A 1 69  ? 27.382 -53.558 47.698  1.00 52.82  ? 66  HIS A O     1 
ATOM   464  C  CB    . HIS A 1 69  ? 24.711 -52.611 48.211  1.00 52.97  ? 66  HIS A CB    1 
ATOM   465  C  CG    . HIS A 1 69  ? 23.226 -52.746 48.286  1.00 53.99  ? 66  HIS A CG    1 
ATOM   466  N  ND1   . HIS A 1 69  ? 22.548 -53.691 47.524  1.00 51.67  ? 66  HIS A ND1   1 
ATOM   467  C  CD2   . HIS A 1 69  ? 22.328 -52.051 49.030  1.00 52.80  ? 66  HIS A CD2   1 
ATOM   468  C  CE1   . HIS A 1 69  ? 21.263 -53.524 47.811  1.00 53.58  ? 66  HIS A CE1   1 
ATOM   469  N  NE2   . HIS A 1 69  ? 21.079 -52.558 48.722  1.00 55.02  ? 66  HIS A NE2   1 
ATOM   470  N  N     . THR A 1 70  ? 27.550 -54.556 49.756  1.00 55.79  ? 67  THR A N     1 
ATOM   471  C  CA    . THR A 1 70  ? 28.942 -54.998 49.670  1.00 56.24  ? 67  THR A CA    1 
ATOM   472  C  C     . THR A 1 70  ? 29.143 -56.213 48.783  1.00 56.52  ? 67  THR A C     1 
ATOM   473  O  O     . THR A 1 70  ? 28.242 -57.049 48.649  1.00 57.47  ? 67  THR A O     1 
ATOM   474  C  CB    . THR A 1 70  ? 29.513 -55.231 51.078  1.00 57.79  ? 67  THR A CB    1 
ATOM   475  O  OG1   . THR A 1 70  ? 28.660 -56.112 51.814  1.00 57.83  ? 67  THR A OG1   1 
ATOM   476  C  CG2   . THR A 1 70  ? 29.689 -53.954 51.846  1.00 55.33  ? 67  THR A CG2   1 
ATOM   477  N  N     . GLY A 1 71  ? 30.347 -56.302 48.213  1.00 55.07  ? 68  GLY A N     1 
ATOM   478  C  CA    . GLY A 1 71  ? 30.783 -57.389 47.354  1.00 54.11  ? 68  GLY A CA    1 
ATOM   479  C  C     . GLY A 1 71  ? 31.046 -58.636 48.155  1.00 55.12  ? 68  GLY A C     1 
ATOM   480  O  O     . GLY A 1 71  ? 30.654 -58.716 49.317  1.00 54.90  ? 68  GLY A O     1 
ATOM   481  N  N     . ARG A 1 72  ? 31.754 -59.591 47.562  1.00 55.35  ? 69  ARG A N     1 
ATOM   482  C  CA    . ARG A 1 72  ? 32.044 -60.900 48.128  1.00 55.36  ? 69  ARG A CA    1 
ATOM   483  C  C     . ARG A 1 72  ? 32.700 -60.908 49.498  1.00 55.63  ? 69  ARG A C     1 
ATOM   484  O  O     . ARG A 1 72  ? 32.074 -61.388 50.437  1.00 55.80  ? 69  ARG A O     1 
ATOM   485  C  CB    . ARG A 1 72  ? 32.870 -61.727 47.144  1.00 52.59  ? 69  ARG A CB    1 
ATOM   486  C  CG    . ARG A 1 72  ? 32.801 -63.230 47.401  1.00 54.32  ? 69  ARG A CG    1 
ATOM   487  C  CD    . ARG A 1 72  ? 34.166 -63.853 47.297  1.00 56.36  ? 69  ARG A CD    1 
ATOM   488  N  NE    . ARG A 1 72  ? 34.785 -63.476 46.036  1.00 58.44  ? 69  ARG A NE    1 
ATOM   489  C  CZ    . ARG A 1 72  ? 36.074 -63.227 45.853  1.00 58.24  ? 69  ARG A CZ    1 
ATOM   490  N  NH1   . ARG A 1 72  ? 36.928 -63.317 46.863  1.00 57.24  ? 69  ARG A NH1   1 
ATOM   491  N  NH2   . ARG A 1 72  ? 36.518 -62.876 44.669  1.00 58.46  ? 69  ARG A NH2   1 
ATOM   492  N  N     . GLU A 1 73  ? 33.944 -60.426 49.623  1.00 56.01  ? 70  GLU A N     1 
ATOM   493  C  CA    . GLU A 1 73  ? 34.688 -60.452 50.876  1.00 56.05  ? 70  GLU A CA    1 
ATOM   494  C  C     . GLU A 1 73  ? 34.100 -59.571 51.963  1.00 56.60  ? 70  GLU A C     1 
ATOM   495  O  O     . GLU A 1 73  ? 34.019 -60.008 53.118  1.00 56.15  ? 70  GLU A O     1 
ATOM   496  C  CB    . GLU A 1 73  ? 36.164 -60.140 50.628  1.00 57.19  ? 70  GLU A CB    1 
ATOM   497  C  CG    . GLU A 1 73  ? 36.865 -61.196 49.777  1.00 57.59  ? 70  GLU A CG    1 
ATOM   498  C  CD    . GLU A 1 73  ? 36.668 -62.632 50.243  1.00 61.94  ? 70  GLU A CD    1 
ATOM   499  O  OE1   . GLU A 1 73  ? 37.031 -62.934 51.404  1.00 61.39  ? 70  GLU A OE1   1 
ATOM   500  O  OE2   . GLU A 1 73  ? 36.125 -63.444 49.458  1.00 59.86  ? 70  GLU A OE2   1 
ATOM   501  N  N     . ALA A 1 74  ? 33.670 -58.358 51.615  1.00 58.11  ? 71  ALA A N     1 
ATOM   502  C  CA    . ALA A 1 74  ? 33.081 -57.466 52.605  1.00 58.60  ? 71  ALA A CA    1 
ATOM   503  C  C     . ALA A 1 74  ? 31.752 -58.025 53.151  1.00 59.29  ? 71  ALA A C     1 
ATOM   504  O  O     . ALA A 1 74  ? 31.462 -57.799 54.322  1.00 59.53  ? 71  ALA A O     1 
ATOM   505  C  CB    . ALA A 1 74  ? 32.912 -56.067 52.037  1.00 59.20  ? 71  ALA A CB    1 
ATOM   506  N  N     . THR A 1 75  ? 30.965 -58.778 52.336  1.00 58.21  ? 72  THR A N     1 
ATOM   507  C  CA    . THR A 1 75  ? 29.708 -59.395 52.804  1.00 58.65  ? 72  THR A CA    1 
ATOM   508  C  C     . THR A 1 75  ? 30.122 -60.581 53.674  1.00 58.97  ? 72  THR A C     1 
ATOM   509  O  O     . THR A 1 75  ? 29.618 -60.717 54.782  1.00 58.90  ? 72  THR A O     1 
ATOM   510  C  CB    . THR A 1 75  ? 28.771 -59.828 51.636  1.00 57.43  ? 72  THR A CB    1 
ATOM   511  O  OG1   . THR A 1 75  ? 28.476 -58.709 50.795  1.00 57.34  ? 72  THR A OG1   1 
ATOM   512  C  CG2   . THR A 1 75  ? 27.465 -60.452 52.126  1.00 56.76  ? 72  THR A CG2   1 
ATOM   513  N  N     . LEU A 1 76  ? 31.063 -61.410 53.202  1.00 59.38  ? 73  LEU A N     1 
ATOM   514  C  CA    . LEU A 1 76  ? 31.512 -62.553 53.984  1.00 60.51  ? 73  LEU A CA    1 
ATOM   515  C  C     . LEU A 1 76  ? 31.992 -62.180 55.388  1.00 60.71  ? 73  LEU A C     1 
ATOM   516  O  O     . LEU A 1 76  ? 31.524 -62.772 56.361  1.00 60.60  ? 73  LEU A O     1 
ATOM   517  C  CB    . LEU A 1 76  ? 32.570 -63.410 53.267  1.00 61.39  ? 73  LEU A CB    1 
ATOM   518  C  CG    . LEU A 1 76  ? 32.993 -64.594 54.126  1.00 63.99  ? 73  LEU A CG    1 
ATOM   519  C  CD1   . LEU A 1 76  ? 32.477 -65.901 53.603  1.00 63.16  ? 73  LEU A CD1   1 
ATOM   520  C  CD2   . LEU A 1 76  ? 34.449 -64.525 54.528  1.00 65.75  ? 73  LEU A CD2   1 
ATOM   521  N  N     . LEU A 1 77  ? 32.930 -61.213 55.481  1.00 59.23  ? 74  LEU A N     1 
ATOM   522  C  CA    . LEU A 1 77  ? 33.510 -60.735 56.739  1.00 59.33  ? 74  LEU A CA    1 
ATOM   523  C  C     . LEU A 1 77  ? 32.444 -60.366 57.772  1.00 60.11  ? 74  LEU A C     1 
ATOM   524  O  O     . LEU A 1 77  ? 32.655 -60.620 58.954  1.00 59.96  ? 74  LEU A O     1 
ATOM   525  C  CB    . LEU A 1 77  ? 34.509 -59.598 56.494  1.00 57.95  ? 74  LEU A CB    1 
ATOM   526  C  CG    . LEU A 1 77  ? 35.879 -60.036 55.943  1.00 58.70  ? 74  LEU A CG    1 
ATOM   527  C  CD1   . LEU A 1 77  ? 36.548 -58.925 55.179  1.00 55.93  ? 74  LEU A CD1   1 
ATOM   528  C  CD2   . LEU A 1 77  ? 36.772 -60.554 57.045  1.00 57.77  ? 74  LEU A CD2   1 
ATOM   529  N  N     . LYS A 1 78  ? 31.283 -59.853 57.334  1.00 58.05  ? 75  LYS A N     1 
ATOM   530  C  CA    . LYS A 1 78  ? 30.193 -59.551 58.248  1.00 59.04  ? 75  LYS A CA    1 
ATOM   531  C  C     . LYS A 1 78  ? 29.563 -60.852 58.700  1.00 59.33  ? 75  LYS A C     1 
ATOM   532  O  O     . LYS A 1 78  ? 29.455 -61.070 59.900  1.00 59.64  ? 75  LYS A O     1 
ATOM   533  C  CB    . LYS A 1 78  ? 29.117 -58.689 57.580  1.00 60.33  ? 75  LYS A CB    1 
ATOM   534  C  CG    . LYS A 1 78  ? 29.448 -57.231 57.551  1.00 61.55  ? 75  LYS A CG    1 
ATOM   535  C  CD    . LYS A 1 78  ? 28.996 -56.504 58.778  1.00 62.01  ? 75  LYS A CD    1 
ATOM   536  C  CE    . LYS A 1 78  ? 29.981 -55.407 59.031  1.00 63.03  ? 75  LYS A CE    1 
ATOM   537  N  NZ    . LYS A 1 78  ? 29.630 -54.613 60.234  1.00 63.70  ? 75  LYS A NZ    1 
ATOM   538  N  N     . ILE A 1 79  ? 29.130 -61.716 57.748  1.00 60.43  ? 76  ILE A N     1 
ATOM   539  C  CA    . ILE A 1 79  ? 28.472 -62.999 58.062  1.00 60.62  ? 76  ILE A CA    1 
ATOM   540  C  C     . ILE A 1 79  ? 29.316 -63.808 59.056  1.00 61.18  ? 76  ILE A C     1 
ATOM   541  O  O     . ILE A 1 79  ? 28.812 -64.161 60.128  1.00 61.27  ? 76  ILE A O     1 
ATOM   542  C  CB    . ILE A 1 79  ? 28.042 -63.823 56.808  1.00 63.09  ? 76  ILE A CB    1 
ATOM   543  C  CG1   . ILE A 1 79  ? 27.198 -62.976 55.831  1.00 61.92  ? 76  ILE A CG1   1 
ATOM   544  C  CG2   . ILE A 1 79  ? 27.247 -65.062 57.241  1.00 63.52  ? 76  ILE A CG2   1 
ATOM   545  C  CD1   . ILE A 1 79  ? 26.973 -63.597 54.423  1.00 59.92  ? 76  ILE A CD1   1 
ATOM   546  N  N     . ALA A 1 80  ? 30.617 -64.020 58.725  1.00 62.08  ? 77  ALA A N     1 
ATOM   547  C  CA    . ALA A 1 80  ? 31.601 -64.742 59.536  1.00 62.29  ? 77  ALA A CA    1 
ATOM   548  C  C     . ALA A 1 80  ? 31.724 -64.246 60.980  1.00 62.69  ? 77  ALA A C     1 
ATOM   549  O  O     . ALA A 1 80  ? 32.243 -64.972 61.819  1.00 63.07  ? 77  ALA A O     1 
ATOM   550  C  CB    . ALA A 1 80  ? 32.954 -64.720 58.858  1.00 62.64  ? 77  ALA A CB    1 
ATOM   551  N  N     . ASN A 1 81  ? 31.245 -63.039 61.281  1.00 63.32  ? 78  ASN A N     1 
ATOM   552  C  CA    . ASN A 1 81  ? 31.298 -62.507 62.634  1.00 63.72  ? 78  ASN A CA    1 
ATOM   553  C  C     . ASN A 1 81  ? 30.393 -63.298 63.593  1.00 64.44  ? 78  ASN A C     1 
ATOM   554  O  O     . ASN A 1 81  ? 30.743 -63.481 64.762  1.00 64.21  ? 78  ASN A O     1 
ATOM   555  C  CB    . ASN A 1 81  ? 30.918 -61.034 62.643  1.00 63.76  ? 78  ASN A CB    1 
ATOM   556  C  CG    . ASN A 1 81  ? 32.077 -60.114 62.402  1.00 64.24  ? 78  ASN A CG    1 
ATOM   557  O  OD1   . ASN A 1 81  ? 33.251 -60.516 62.437  1.00 64.61  ? 78  ASN A OD1   1 
ATOM   558  N  ND2   . ASN A 1 81  ? 31.777 -58.852 62.156  1.00 62.06  ? 78  ASN A ND2   1 
ATOM   559  N  N     . LEU A 1 82  ? 29.246 -63.778 63.087  1.00 63.60  ? 79  LEU A N     1 
ATOM   560  C  CA    . LEU A 1 82  ? 28.278 -64.523 63.874  1.00 64.41  ? 79  LEU A CA    1 
ATOM   561  C  C     . LEU A 1 82  ? 28.101 -65.967 63.479  1.00 65.21  ? 79  LEU A C     1 
ATOM   562  O  O     . LEU A 1 82  ? 27.918 -66.801 64.367  1.00 66.02  ? 79  LEU A O     1 
ATOM   563  C  CB    . LEU A 1 82  ? 26.904 -63.832 63.825  1.00 63.05  ? 79  LEU A CB    1 
ATOM   564  C  CG    . LEU A 1 82  ? 26.811 -62.413 64.362  1.00 64.09  ? 79  LEU A CG    1 
ATOM   565  C  CD1   . LEU A 1 82  ? 25.421 -61.903 64.231  1.00 64.88  ? 79  LEU A CD1   1 
ATOM   566  C  CD2   . LEU A 1 82  ? 27.284 -62.317 65.787  1.00 64.24  ? 79  LEU A CD2   1 
ATOM   567  N  N     . TYR A 1 83  ? 28.119 -66.271 62.169  1.00 67.20  ? 80  TYR A N     1 
ATOM   568  C  CA    . TYR A 1 83  ? 27.840 -67.618 61.680  1.00 67.49  ? 80  TYR A CA    1 
ATOM   569  C  C     . TYR A 1 83  ? 28.938 -68.349 60.968  1.00 68.04  ? 80  TYR A C     1 
ATOM   570  O  O     . TYR A 1 83  ? 29.977 -67.788 60.636  1.00 68.30  ? 80  TYR A O     1 
ATOM   571  C  CB    . TYR A 1 83  ? 26.620 -67.581 60.742  1.00 69.22  ? 80  TYR A CB    1 
ATOM   572  C  CG    . TYR A 1 83  ? 25.468 -66.757 61.272  1.00 69.30  ? 80  TYR A CG    1 
ATOM   573  C  CD1   . TYR A 1 83  ? 24.559 -67.297 62.176  1.00 70.01  ? 80  TYR A CD1   1 
ATOM   574  C  CD2   . TYR A 1 83  ? 25.295 -65.429 60.881  1.00 69.05  ? 80  TYR A CD2   1 
ATOM   575  C  CE1   . TYR A 1 83  ? 23.503 -66.540 62.678  1.00 69.54  ? 80  TYR A CE1   1 
ATOM   576  C  CE2   . TYR A 1 83  ? 24.242 -64.663 61.371  1.00 69.94  ? 80  TYR A CE2   1 
ATOM   577  C  CZ    . TYR A 1 83  ? 23.344 -65.223 62.271  1.00 70.37  ? 80  TYR A CZ    1 
ATOM   578  O  OH    . TYR A 1 83  ? 22.289 -64.483 62.760  1.00 70.11  ? 80  TYR A OH    1 
ATOM   579  N  N     . TRP A 1 84  ? 28.675 -69.638 60.745  1.00 69.87  ? 81  TRP A N     1 
ATOM   580  C  CA    . TRP A 1 84  ? 29.483 -70.578 59.998  1.00 70.37  ? 81  TRP A CA    1 
ATOM   581  C  C     . TRP A 1 84  ? 28.572 -71.619 59.394  1.00 70.64  ? 81  TRP A C     1 
ATOM   582  O  O     . TRP A 1 84  ? 27.660 -72.107 60.061  1.00 71.26  ? 81  TRP A O     1 
ATOM   583  C  CB    . TRP A 1 84  ? 30.614 -71.263 60.797  1.00 70.65  ? 81  TRP A CB    1 
ATOM   584  C  CG    . TRP A 1 84  ? 31.455 -72.115 59.876  1.00 72.27  ? 81  TRP A CG    1 
ATOM   585  C  CD1   . TRP A 1 84  ? 32.504 -71.696 59.110  1.00 72.01  ? 81  TRP A CD1   1 
ATOM   586  C  CD2   . TRP A 1 84  ? 31.205 -73.484 59.496  1.00 73.36  ? 81  TRP A CD2   1 
ATOM   587  N  NE1   . TRP A 1 84  ? 32.963 -72.729 58.324  1.00 74.23  ? 81  TRP A NE1   1 
ATOM   588  C  CE2   . TRP A 1 84  ? 32.169 -73.831 58.521  1.00 73.92  ? 81  TRP A CE2   1 
ATOM   589  C  CE3   . TRP A 1 84  ? 30.251 -74.450 59.879  1.00 74.20  ? 81  TRP A CE3   1 
ATOM   590  C  CZ2   . TRP A 1 84  ? 32.213 -75.099 57.930  1.00 74.12  ? 81  TRP A CZ2   1 
ATOM   591  C  CZ3   . TRP A 1 84  ? 30.294 -75.704 59.289  1.00 74.21  ? 81  TRP A CZ3   1 
ATOM   592  C  CH2   . TRP A 1 84  ? 31.270 -76.021 58.332  1.00 75.05  ? 81  TRP A CH2   1 
ATOM   593  N  N     . TRP A 1 85  ? 28.845 -71.969 58.132  1.00 68.75  ? 82  TRP A N     1 
ATOM   594  C  CA    . TRP A 1 85  ? 28.162 -73.001 57.372  1.00 68.74  ? 82  TRP A CA    1 
ATOM   595  C  C     . TRP A 1 85  ? 29.026 -73.443 56.166  1.00 68.91  ? 82  TRP A C     1 
ATOM   596  O  O     . TRP A 1 85  ? 29.920 -72.695 55.779  1.00 69.82  ? 82  TRP A O     1 
ATOM   597  C  CB    . TRP A 1 85  ? 26.722 -72.627 57.027  1.00 66.63  ? 82  TRP A CB    1 
ATOM   598  C  CG    . TRP A 1 85  ? 26.498 -71.600 55.958  1.00 66.48  ? 82  TRP A CG    1 
ATOM   599  C  CD1   . TRP A 1 85  ? 26.532 -71.797 54.607  1.00 65.97  ? 82  TRP A CD1   1 
ATOM   600  C  CD2   . TRP A 1 85  ? 26.011 -70.270 56.158  1.00 64.96  ? 82  TRP A CD2   1 
ATOM   601  N  NE1   . TRP A 1 85  ? 26.151 -70.653 53.953  1.00 66.05  ? 82  TRP A NE1   1 
ATOM   602  C  CE2   . TRP A 1 85  ? 25.826 -69.697 54.881  1.00 65.10  ? 82  TRP A CE2   1 
ATOM   603  C  CE3   . TRP A 1 85  ? 25.737 -69.495 57.297  1.00 65.21  ? 82  TRP A CE3   1 
ATOM   604  C  CZ2   . TRP A 1 85  ? 25.381 -68.383 54.713  1.00 63.66  ? 82  TRP A CZ2   1 
ATOM   605  C  CZ3   . TRP A 1 85  ? 25.282 -68.201 57.130  1.00 63.86  ? 82  TRP A CZ3   1 
ATOM   606  C  CH2   . TRP A 1 85  ? 25.102 -67.658 55.851  1.00 63.54  ? 82  TRP A CH2   1 
ATOM   607  N  N     . PRO A 1 86  ? 28.856 -74.660 55.593  1.00 72.03  ? 83  PRO A N     1 
ATOM   608  C  CA    . PRO A 1 86  ? 29.739 -75.064 54.493  1.00 71.52  ? 83  PRO A CA    1 
ATOM   609  C  C     . PRO A 1 86  ? 29.513 -74.243 53.248  1.00 70.81  ? 83  PRO A C     1 
ATOM   610  O  O     . PRO A 1 86  ? 28.353 -74.009 52.861  1.00 70.51  ? 83  PRO A O     1 
ATOM   611  C  CB    . PRO A 1 86  ? 29.388 -76.543 54.264  1.00 72.78  ? 83  PRO A CB    1 
ATOM   612  C  CG    . PRO A 1 86  ? 28.638 -76.962 55.455  1.00 74.11  ? 83  PRO A CG    1 
ATOM   613  C  CD    . PRO A 1 86  ? 27.895 -75.737 55.901  1.00 73.83  ? 83  PRO A CD    1 
ATOM   614  N  N     . ASN A 1 87  ? 30.634 -73.796 52.642  1.00 71.18  ? 84  ASN A N     1 
ATOM   615  C  CA    . ASN A 1 87  ? 30.693 -73.014 51.410  1.00 70.72  ? 84  ASN A CA    1 
ATOM   616  C  C     . ASN A 1 87  ? 29.822 -71.754 51.466  1.00 69.93  ? 84  ASN A C     1 
ATOM   617  O  O     . ASN A 1 87  ? 28.871 -71.614 50.689  1.00 70.21  ? 84  ASN A O     1 
ATOM   618  C  CB    . ASN A 1 87  ? 30.369 -73.907 50.202  1.00 73.13  ? 84  ASN A CB    1 
ATOM   619  C  CG    . ASN A 1 87  ? 31.079 -75.243 50.259  1.00 75.35  ? 84  ASN A CG    1 
ATOM   620  O  OD1   . ASN A 1 87  ? 32.313 -75.324 50.215  1.00 77.66  ? 84  ASN A OD1   1 
ATOM   621  N  ND2   . ASN A 1 87  ? 30.315 -76.326 50.377  1.00 78.54  ? 84  ASN A ND2   1 
ATOM   622  N  N     . MET A 1 88  ? 30.153 -70.847 52.404  1.00 67.13  ? 85  MET A N     1 
ATOM   623  C  CA    . MET A 1 88  ? 29.476 -69.575 52.644  1.00 66.25  ? 85  MET A CA    1 
ATOM   624  C  C     . MET A 1 88  ? 29.539 -68.624 51.440  1.00 65.57  ? 85  MET A C     1 
ATOM   625  O  O     . MET A 1 88  ? 28.512 -68.055 51.049  1.00 65.12  ? 85  MET A O     1 
ATOM   626  C  CB    . MET A 1 88  ? 30.036 -68.903 53.905  1.00 68.52  ? 85  MET A CB    1 
ATOM   627  C  CG    . MET A 1 88  ? 29.396 -69.401 55.172  1.00 69.15  ? 85  MET A CG    1 
ATOM   628  S  SD    . MET A 1 88  ? 30.394 -69.065 56.632  1.00 72.01  ? 85  MET A SD    1 
ATOM   629  C  CE    . MET A 1 88  ? 29.616 -67.635 57.230  1.00 68.82  ? 85  MET A CE    1 
ATOM   630  N  N     . ARG A 1 89  ? 30.738 -68.464 50.846  1.00 64.11  ? 86  ARG A N     1 
ATOM   631  C  CA    . ARG A 1 89  ? 30.956 -67.606 49.679  1.00 64.53  ? 86  ARG A CA    1 
ATOM   632  C  C     . ARG A 1 89  ? 30.139 -68.056 48.471  1.00 65.01  ? 86  ARG A C     1 
ATOM   633  O  O     . ARG A 1 89  ? 29.756 -67.211 47.661  1.00 65.71  ? 86  ARG A O     1 
ATOM   634  C  CB    . ARG A 1 89  ? 32.442 -67.523 49.325  1.00 62.87  ? 86  ARG A CB    1 
ATOM   635  C  CG    . ARG A 1 89  ? 33.243 -66.571 50.190  1.00 60.84  ? 86  ARG A CG    1 
ATOM   636  C  CD    . ARG A 1 89  ? 34.686 -66.767 49.876  1.00 60.13  ? 86  ARG A CD    1 
ATOM   637  N  NE    . ARG A 1 89  ? 35.603 -65.937 50.654  1.00 58.47  ? 86  ARG A NE    1 
ATOM   638  C  CZ    . ARG A 1 89  ? 36.092 -66.260 51.847  1.00 58.46  ? 86  ARG A CZ    1 
ATOM   639  N  NH1   . ARG A 1 89  ? 35.712 -67.379 52.448  1.00 57.19  ? 86  ARG A NH1   1 
ATOM   640  N  NH2   . ARG A 1 89  ? 36.948 -65.458 52.458  1.00 55.15  ? 86  ARG A NH2   1 
ATOM   641  N  N     . LYS A 1 90  ? 29.844 -69.380 48.355  1.00 65.17  ? 87  LYS A N     1 
ATOM   642  C  CA    . LYS A 1 90  ? 29.016 -69.902 47.258  1.00 65.59  ? 87  LYS A CA    1 
ATOM   643  C  C     . LYS A 1 90  ? 27.631 -69.254 47.393  1.00 65.76  ? 87  LYS A C     1 
ATOM   644  O  O     . LYS A 1 90  ? 27.068 -68.808 46.391  1.00 66.59  ? 87  LYS A O     1 
ATOM   645  C  CB    . LYS A 1 90  ? 28.940 -71.449 47.263  1.00 66.89  ? 87  LYS A CB    1 
ATOM   646  N  N     . ASP A 1 91  ? 27.129 -69.143 48.645  1.00 65.52  ? 88  ASP A N     1 
ATOM   647  C  CA    . ASP A 1 91  ? 25.845 -68.521 48.953  1.00 65.60  ? 88  ASP A CA    1 
ATOM   648  C  C     . ASP A 1 91  ? 25.905 -66.991 48.842  1.00 64.93  ? 88  ASP A C     1 
ATOM   649  O  O     . ASP A 1 91  ? 24.888 -66.369 48.521  1.00 65.28  ? 88  ASP A O     1 
ATOM   650  C  CB    . ASP A 1 91  ? 25.344 -68.943 50.348  1.00 68.71  ? 88  ASP A CB    1 
ATOM   651  C  CG    . ASP A 1 91  ? 24.883 -70.390 50.448  1.00 70.43  ? 88  ASP A CG    1 
ATOM   652  O  OD1   . ASP A 1 91  ? 24.025 -70.802 49.635  1.00 72.78  ? 88  ASP A OD1   1 
ATOM   653  O  OD2   . ASP A 1 91  ? 25.368 -71.102 51.344  1.00 73.32  ? 88  ASP A OD2   1 
ATOM   654  N  N     . VAL A 1 92  ? 27.086 -66.387 49.118  1.00 61.83  ? 89  VAL A N     1 
ATOM   655  C  CA    . VAL A 1 92  ? 27.290 -64.940 49.031  1.00 61.26  ? 89  VAL A CA    1 
ATOM   656  C  C     . VAL A 1 92  ? 27.209 -64.546 47.557  1.00 60.90  ? 89  VAL A C     1 
ATOM   657  O  O     . VAL A 1 92  ? 26.453 -63.636 47.197  1.00 60.37  ? 89  VAL A O     1 
ATOM   658  C  CB    . VAL A 1 92  ? 28.605 -64.485 49.734  1.00 63.31  ? 89  VAL A CB    1 
ATOM   659  C  CG1   . VAL A 1 92  ? 28.991 -63.056 49.364  1.00 62.67  ? 89  VAL A CG1   1 
ATOM   660  C  CG2   . VAL A 1 92  ? 28.481 -64.617 51.243  1.00 61.98  ? 89  VAL A CG2   1 
ATOM   661  N  N     . VAL A 1 93  ? 27.942 -65.277 46.705  1.00 61.02  ? 90  VAL A N     1 
ATOM   662  C  CA    . VAL A 1 93  ? 27.980 -65.044 45.267  1.00 61.42  ? 90  VAL A CA    1 
ATOM   663  C  C     . VAL A 1 93  ? 26.603 -65.237 44.626  1.00 62.06  ? 90  VAL A C     1 
ATOM   664  O  O     . VAL A 1 93  ? 26.275 -64.479 43.707  1.00 62.62  ? 90  VAL A O     1 
ATOM   665  C  CB    . VAL A 1 93  ? 29.094 -65.850 44.597  1.00 63.56  ? 90  VAL A CB    1 
ATOM   666  C  CG1   . VAL A 1 93  ? 29.021 -65.754 43.086  1.00 63.44  ? 90  VAL A CG1   1 
ATOM   667  C  CG2   . VAL A 1 93  ? 30.448 -65.357 45.092  1.00 61.46  ? 90  VAL A CG2   1 
ATOM   668  N  N     . LYS A 1 94  ? 25.772 -66.190 45.136  1.00 64.40  ? 91  LYS A N     1 
ATOM   669  C  CA    . LYS A 1 94  ? 24.422 -66.391 44.610  1.00 64.28  ? 91  LYS A CA    1 
ATOM   670  C  C     . LYS A 1 94  ? 23.631 -65.111 44.808  1.00 64.02  ? 91  LYS A C     1 
ATOM   671  O  O     . LYS A 1 94  ? 23.019 -64.659 43.854  1.00 64.20  ? 91  LYS A O     1 
ATOM   672  C  CB    . LYS A 1 94  ? 23.717 -67.609 45.224  1.00 66.40  ? 91  LYS A CB    1 
ATOM   673  N  N     . GLN A 1 95  ? 23.716 -64.481 46.000  1.00 66.63  ? 92  GLN A N     1 
ATOM   674  C  CA    . GLN A 1 95  ? 23.037 -63.219 46.321  1.00 66.69  ? 92  GLN A CA    1 
ATOM   675  C  C     . GLN A 1 95  ? 23.545 -62.037 45.520  1.00 65.79  ? 92  GLN A C     1 
ATOM   676  O  O     . GLN A 1 95  ? 22.742 -61.223 45.069  1.00 64.88  ? 92  GLN A O     1 
ATOM   677  C  CB    . GLN A 1 95  ? 23.120 -62.892 47.814  1.00 70.09  ? 92  GLN A CB    1 
ATOM   678  C  CG    . GLN A 1 95  ? 21.966 -63.486 48.631  1.00 74.71  ? 92  GLN A CG    1 
ATOM   679  C  CD    . GLN A 1 95  ? 20.611 -63.056 48.115  1.00 77.66  ? 92  GLN A CD    1 
ATOM   680  O  OE1   . GLN A 1 95  ? 20.293 -61.839 48.051  1.00 79.47  ? 92  GLN A OE1   1 
ATOM   681  N  NE2   . GLN A 1 95  ? 19.806 -64.060 47.712  1.00 78.12  ? 92  GLN A NE2   1 
ATOM   682  N  N     . LEU A 1 96  ? 24.878 -61.935 45.329  1.00 64.90  ? 93  LEU A N     1 
ATOM   683  C  CA    . LEU A 1 96  ? 25.482 -60.840 44.555  1.00 65.39  ? 93  LEU A CA    1 
ATOM   684  C  C     . LEU A 1 96  ? 24.995 -60.857 43.104  1.00 65.25  ? 93  LEU A C     1 
ATOM   685  O  O     . LEU A 1 96  ? 24.726 -59.792 42.551  1.00 65.13  ? 93  LEU A O     1 
ATOM   686  C  CB    . LEU A 1 96  ? 27.025 -60.878 44.601  1.00 63.69  ? 93  LEU A CB    1 
ATOM   687  C  CG    . LEU A 1 96  ? 27.701 -60.898 45.965  1.00 63.55  ? 93  LEU A CG    1 
ATOM   688  C  CD1   . LEU A 1 96  ? 29.181 -61.035 45.818  1.00 62.29  ? 93  LEU A CD1   1 
ATOM   689  C  CD2   . LEU A 1 96  ? 27.274 -59.738 46.831  1.00 62.90  ? 93  LEU A CD2   1 
ATOM   690  N  N     . GLY A 1 97  ? 24.875 -62.057 42.528  1.00 63.88  ? 94  GLY A N     1 
ATOM   691  C  CA    . GLY A 1 97  ? 24.412 -62.261 41.165  1.00 64.26  ? 94  GLY A CA    1 
ATOM   692  C  C     . GLY A 1 97  ? 22.939 -61.960 40.938  1.00 64.97  ? 94  GLY A C     1 
ATOM   693  O  O     . GLY A 1 97  ? 22.532 -61.848 39.775  1.00 65.45  ? 94  GLY A O     1 
ATOM   694  N  N     . ARG A 1 98  ? 22.124 -61.843 42.043  1.00 67.41  ? 95  ARG A N     1 
ATOM   695  C  CA    . ARG A 1 98  ? 20.672 -61.554 42.037  1.00 68.44  ? 95  ARG A CA    1 
ATOM   696  C  C     . ARG A 1 98  ? 20.349 -60.125 42.496  1.00 67.51  ? 95  ARG A C     1 
ATOM   697  O  O     . ARG A 1 98  ? 19.174 -59.732 42.481  1.00 67.39  ? 95  ARG A O     1 
ATOM   698  C  CB    . ARG A 1 98  ? 19.870 -62.518 42.946  1.00 79.77  ? 95  ARG A CB    1 
ATOM   699  C  CG    . ARG A 1 98  ? 20.229 -63.998 42.877  1.00 85.31  ? 95  ARG A CG    1 
ATOM   700  C  CD    . ARG A 1 98  ? 19.460 -64.809 41.850  1.00 91.46  ? 95  ARG A CD    1 
ATOM   701  N  NE    . ARG A 1 98  ? 20.133 -66.087 41.562  1.00 97.04  ? 95  ARG A NE    1 
ATOM   702  C  CZ    . ARG A 1 98  ? 19.933 -67.225 42.233  1.00 99.54  ? 95  ARG A CZ    1 
ATOM   703  N  NH1   . ARG A 1 98  ? 19.069 -67.267 43.248  1.00 100.05 ? 95  ARG A NH1   1 
ATOM   704  N  NH2   . ARG A 1 98  ? 20.598 -68.327 41.897  1.00 99.94  ? 95  ARG A NH2   1 
ATOM   705  N  N     . CYS A 1 99  ? 21.362 -59.348 42.940  1.00 65.04  ? 96  CYS A N     1 
ATOM   706  C  CA    . CYS A 1 99  ? 21.095 -57.982 43.377  1.00 63.92  ? 96  CYS A CA    1 
ATOM   707  C  C     . CYS A 1 99  ? 21.095 -57.055 42.171  1.00 63.99  ? 96  CYS A C     1 
ATOM   708  O  O     . CYS A 1 99  ? 22.142 -56.722 41.636  1.00 64.16  ? 96  CYS A O     1 
ATOM   709  C  CB    . CYS A 1 99  ? 22.065 -57.524 44.458  1.00 62.91  ? 96  CYS A CB    1 
ATOM   710  S  SG    . CYS A 1 99  ? 21.671 -55.900 45.147  1.00 62.09  ? 96  CYS A SG    1 
ATOM   711  N  N     . GLN A 1 100 ? 19.913 -56.669 41.719  1.00 64.43  ? 97  GLN A N     1 
ATOM   712  C  CA    . GLN A 1 100 ? 19.771 -55.815 40.562  1.00 64.93  ? 97  GLN A CA    1 
ATOM   713  C  C     . GLN A 1 100 ? 20.460 -54.490 40.797  1.00 63.48  ? 97  GLN A C     1 
ATOM   714  O  O     . GLN A 1 100 ? 21.089 -53.984 39.875  1.00 63.19  ? 97  GLN A O     1 
ATOM   715  C  CB    . GLN A 1 100 ? 18.291 -55.638 40.201  1.00 67.40  ? 97  GLN A CB    1 
ATOM   716  C  CG    . GLN A 1 100 ? 18.014 -55.519 38.689  1.00 73.59  ? 97  GLN A CG    1 
ATOM   717  C  CD    . GLN A 1 100 ? 18.256 -56.770 37.837  1.00 80.82  ? 97  GLN A CD    1 
ATOM   718  O  OE1   . GLN A 1 100 ? 18.486 -57.904 38.325  1.00 83.00  ? 97  GLN A OE1   1 
ATOM   719  N  NE2   . GLN A 1 100 ? 18.203 -56.576 36.518  1.00 83.24  ? 97  GLN A NE2   1 
ATOM   720  N  N     . GLN A 1 101 ? 20.405 -53.958 42.039  1.00 60.39  ? 98  GLN A N     1 
ATOM   721  C  CA    . GLN A 1 101 ? 21.044 -52.683 42.377  1.00 59.22  ? 98  GLN A CA    1 
ATOM   722  C  C     . GLN A 1 101 ? 22.542 -52.747 42.231  1.00 58.37  ? 98  GLN A C     1 
ATOM   723  O  O     . GLN A 1 101 ? 23.142 -51.821 41.686  1.00 56.99  ? 98  GLN A O     1 
ATOM   724  C  CB    . GLN A 1 101 ? 20.670 -52.216 43.767  1.00 60.27  ? 98  GLN A CB    1 
ATOM   725  C  CG    . GLN A 1 101 ? 19.207 -51.897 43.887  1.00 61.98  ? 98  GLN A CG    1 
ATOM   726  C  CD    . GLN A 1 101 ? 18.506 -52.988 44.642  1.00 66.57  ? 98  GLN A CD    1 
ATOM   727  O  OE1   . GLN A 1 101 ? 18.402 -54.150 44.186  1.00 67.14  ? 98  GLN A OE1   1 
ATOM   728  N  NE2   . GLN A 1 101 ? 18.010 -52.618 45.814  1.00 66.38  ? 98  GLN A NE2   1 
ATOM   729  N  N     . CYS A 1 102 ? 23.150 -53.837 42.684  1.00 56.01  ? 99  CYS A N     1 
ATOM   730  C  CA    . CYS A 1 102 ? 24.582 -53.973 42.557  1.00 56.33  ? 99  CYS A CA    1 
ATOM   731  C  C     . CYS A 1 102 ? 24.983 -54.137 41.114  1.00 55.74  ? 99  CYS A C     1 
ATOM   732  O  O     . CYS A 1 102 ? 25.850 -53.397 40.655  1.00 55.41  ? 99  CYS A O     1 
ATOM   733  C  CB    . CYS A 1 102 ? 25.119 -55.092 43.431  1.00 56.13  ? 99  CYS A CB    1 
ATOM   734  S  SG    . CYS A 1 102 ? 25.356 -54.608 45.157  1.00 56.04  ? 99  CYS A SG    1 
ATOM   735  N  N     . LEU A 1 103 ? 24.310 -55.043 40.371  1.00 57.12  ? 100 LEU A N     1 
ATOM   736  C  CA    . LEU A 1 103 ? 24.638 -55.301 38.966  1.00 56.35  ? 100 LEU A CA    1 
ATOM   737  C  C     . LEU A 1 103 ? 24.588 -54.059 38.056  1.00 55.24  ? 100 LEU A C     1 
ATOM   738  O  O     . LEU A 1 103 ? 25.400 -53.961 37.134  1.00 54.43  ? 100 LEU A O     1 
ATOM   739  C  CB    . LEU A 1 103 ? 23.786 -56.434 38.364  1.00 54.94  ? 100 LEU A CB    1 
ATOM   740  C  CG    . LEU A 1 103 ? 23.734 -57.795 39.077  1.00 55.82  ? 100 LEU A CG    1 
ATOM   741  C  CD1   . LEU A 1 103 ? 22.515 -58.579 38.607  1.00 55.14  ? 100 LEU A CD1   1 
ATOM   742  C  CD2   . LEU A 1 103 ? 24.981 -58.616 38.870  1.00 51.85  ? 100 LEU A CD2   1 
ATOM   743  N  N     . ILE A 1 104 ? 23.657 -53.124 38.308  1.00 53.80  ? 101 ILE A N     1 
ATOM   744  C  CA    . ILE A 1 104 ? 23.512 -51.947 37.464  1.00 53.38  ? 101 ILE A CA    1 
ATOM   745  C  C     . ILE A 1 104 ? 24.316 -50.735 37.978  1.00 53.67  ? 101 ILE A C     1 
ATOM   746  O  O     . ILE A 1 104 ? 24.593 -49.827 37.199  1.00 54.10  ? 101 ILE A O     1 
ATOM   747  C  CB    . ILE A 1 104 ? 22.018 -51.615 37.195  1.00 55.55  ? 101 ILE A CB    1 
ATOM   748  C  CG1   . ILE A 1 104 ? 21.281 -51.155 38.461  1.00 55.05  ? 101 ILE A CG1   1 
ATOM   749  C  CG2   . ILE A 1 104 ? 21.313 -52.801 36.507  1.00 53.99  ? 101 ILE A CG2   1 
ATOM   750  C  CD1   . ILE A 1 104 ? 19.774 -50.763 38.254  1.00 54.83  ? 101 ILE A CD1   1 
ATOM   751  N  N     . THR A 1 105 ? 24.727 -50.732 39.258  1.00 56.26  ? 102 THR A N     1 
ATOM   752  C  CA    . THR A 1 105 ? 25.501 -49.629 39.836  1.00 55.56  ? 102 THR A CA    1 
ATOM   753  C  C     . THR A 1 105 ? 27.015 -49.891 39.876  1.00 55.67  ? 102 THR A C     1 
ATOM   754  O  O     . THR A 1 105 ? 27.792 -48.969 39.587  1.00 55.86  ? 102 THR A O     1 
ATOM   755  C  CB    . THR A 1 105 ? 24.956 -49.239 41.193  1.00 57.38  ? 102 THR A CB    1 
ATOM   756  O  OG1   . THR A 1 105 ? 23.534 -49.076 41.093  1.00 56.86  ? 102 THR A OG1   1 
ATOM   757  C  CG2   . THR A 1 105 ? 25.586 -47.972 41.716  1.00 56.18  ? 102 THR A CG2   1 
ATOM   758  N  N     . ASN A 1 106 ? 27.440 -51.110 40.217  1.00 52.99  ? 103 ASN A N     1 
ATOM   759  C  CA    . ASN A 1 106 ? 28.867 -51.400 40.284  1.00 52.64  ? 103 ASN A CA    1 
ATOM   760  C  C     . ASN A 1 106 ? 29.609 -51.223 38.960  1.00 53.17  ? 103 ASN A C     1 
ATOM   761  O  O     . ASN A 1 106 ? 29.021 -51.281 37.886  1.00 53.96  ? 103 ASN A O     1 
ATOM   762  C  CB    . ASN A 1 106 ? 29.144 -52.785 40.870  1.00 53.34  ? 103 ASN A CB    1 
ATOM   763  C  CG    . ASN A 1 106 ? 28.910 -52.924 42.352  1.00 54.23  ? 103 ASN A CG    1 
ATOM   764  O  OD1   . ASN A 1 106 ? 28.588 -51.948 43.075  1.00 53.63  ? 103 ASN A OD1   1 
ATOM   765  N  ND2   . ASN A 1 106 ? 29.087 -54.157 42.829  1.00 52.04  ? 103 ASN A ND2   1 
ATOM   766  N  N     . ALA A 1 107 ? 30.914 -50.989 39.059  1.00 54.46  ? 104 ALA A N     1 
ATOM   767  C  CA    . ALA A 1 107 ? 31.805 -50.788 37.928  1.00 55.48  ? 104 ALA A CA    1 
ATOM   768  C  C     . ALA A 1 107 ? 32.370 -52.137 37.525  1.00 55.81  ? 104 ALA A C     1 
ATOM   769  O  O     . ALA A 1 107 ? 32.358 -53.075 38.311  1.00 56.08  ? 104 ALA A O     1 
ATOM   770  C  CB    . ALA A 1 107 ? 32.938 -49.838 38.327  1.00 55.05  ? 104 ALA A CB    1 
ATOM   771  N  N     . SER A 1 108 ? 32.870 -52.230 36.312  1.00 56.80  ? 105 SER A N     1 
ATOM   772  C  CA    . SER A 1 108 ? 33.480 -53.429 35.789  1.00 56.89  ? 105 SER A CA    1 
ATOM   773  C  C     . SER A 1 108 ? 34.919 -53.448 36.283  1.00 56.72  ? 105 SER A C     1 
ATOM   774  O  O     . SER A 1 108 ? 35.451 -52.420 36.679  1.00 56.93  ? 105 SER A O     1 
ATOM   775  C  CB    . SER A 1 108 ? 33.466 -53.366 34.262  1.00 60.89  ? 105 SER A CB    1 
ATOM   776  O  OG    . SER A 1 108 ? 34.053 -54.507 33.653  1.00 60.75  ? 105 SER A OG    1 
ATOM   777  N  N     . ASN A 1 109 ? 35.552 -54.599 36.268  1.00 57.39  ? 106 ASN A N     1 
ATOM   778  C  CA    . ASN A 1 109 ? 36.947 -54.670 36.637  1.00 58.73  ? 106 ASN A CA    1 
ATOM   779  C  C     . ASN A 1 109 ? 37.672 -55.540 35.634  1.00 59.97  ? 106 ASN A C     1 
ATOM   780  O  O     . ASN A 1 109 ? 38.734 -56.077 35.920  1.00 60.26  ? 106 ASN A O     1 
ATOM   781  C  CB    . ASN A 1 109 ? 37.172 -55.044 38.089  1.00 63.05  ? 106 ASN A CB    1 
ATOM   782  C  CG    . ASN A 1 109 ? 36.576 -56.335 38.510  1.00 65.01  ? 106 ASN A CG    1 
ATOM   783  O  OD1   . ASN A 1 109 ? 36.052 -57.109 37.698  1.00 65.57  ? 106 ASN A OD1   1 
ATOM   784  N  ND2   . ASN A 1 109 ? 36.641 -56.589 39.811  1.00 63.02  ? 106 ASN A ND2   1 
ATOM   785  N  N     . LYS A 1 110 ? 37.075 -55.672 34.437  1.00 60.31  ? 107 LYS A N     1 
ATOM   786  C  CA    . LYS A 1 110 ? 37.635 -56.413 33.319  1.00 61.40  ? 107 LYS A CA    1 
ATOM   787  C  C     . LYS A 1 110 ? 37.715 -55.394 32.168  1.00 60.70  ? 107 LYS A C     1 
ATOM   788  O  O     . LYS A 1 110 ? 36.717 -54.747 31.822  1.00 60.88  ? 107 LYS A O     1 
ATOM   789  C  CB    . LYS A 1 110 ? 36.801 -57.667 32.900  1.00 63.71  ? 107 LYS A CB    1 
ATOM   790  C  CG    . LYS A 1 110 ? 36.180 -58.546 34.005  1.00 67.21  ? 107 LYS A CG    1 
ATOM   791  C  CD    . LYS A 1 110 ? 37.107 -59.515 34.723  1.00 70.31  ? 107 LYS A CD    1 
ATOM   792  C  CE    . LYS A 1 110 ? 36.355 -60.011 35.953  1.00 72.09  ? 107 LYS A CE    1 
ATOM   793  N  NZ    . LYS A 1 110 ? 37.147 -59.957 37.236  1.00 76.30  ? 107 LYS A NZ    1 
ATOM   794  N  N     . ALA A 1 111 ? 38.907 -55.223 31.615  1.00 59.70  ? 108 ALA A N     1 
ATOM   795  C  CA    . ALA A 1 111 ? 39.126 -54.305 30.511  1.00 59.24  ? 108 ALA A CA    1 
ATOM   796  C  C     . ALA A 1 111 ? 38.653 -54.965 29.202  1.00 58.93  ? 108 ALA A C     1 
ATOM   797  O  O     . ALA A 1 111 ? 38.570 -56.190 29.131  1.00 59.01  ? 108 ALA A O     1 
ATOM   798  C  CB    . ALA A 1 111 ? 40.615 -53.988 30.414  1.00 59.49  ? 108 ALA A CB    1 
ATOM   799  N  N     . SER A 1 112 ? 38.371 -54.160 28.164  1.00 58.73  ? 109 SER A N     1 
ATOM   800  C  CA    . SER A 1 112 ? 37.990 -54.639 26.832  1.00 58.40  ? 109 SER A CA    1 
ATOM   801  C  C     . SER A 1 112 ? 39.196 -55.329 26.191  1.00 57.83  ? 109 SER A C     1 
ATOM   802  O  O     . SER A 1 112 ? 40.351 -55.086 26.597  1.00 57.13  ? 109 SER A O     1 
ATOM   803  C  CB    . SER A 1 112 ? 37.669 -53.451 25.944  1.00 59.54  ? 109 SER A CB    1 
ATOM   804  O  OG    . SER A 1 112 ? 36.512 -52.774 26.383  1.00 61.49  ? 109 SER A OG    1 
ATOM   805  N  N     . GLY A 1 113 ? 38.937 -56.142 25.165  1.00 58.11  ? 110 GLY A N     1 
ATOM   806  C  CA    . GLY A 1 113 ? 40.003 -56.814 24.427  1.00 57.90  ? 110 GLY A CA    1 
ATOM   807  C  C     . GLY A 1 113 ? 40.764 -55.800 23.586  1.00 58.33  ? 110 GLY A C     1 
ATOM   808  O  O     . GLY A 1 113 ? 40.288 -54.668 23.396  1.00 58.24  ? 110 GLY A O     1 
ATOM   809  N  N     . PRO A 1 114 ? 41.950 -56.161 23.053  1.00 59.84  ? 111 PRO A N     1 
ATOM   810  C  CA    . PRO A 1 114 ? 42.725 -55.188 22.252  1.00 59.21  ? 111 PRO A CA    1 
ATOM   811  C  C     . PRO A 1 114 ? 41.992 -54.646 21.028  1.00 58.90  ? 111 PRO A C     1 
ATOM   812  O  O     . PRO A 1 114 ? 41.231 -55.377 20.393  1.00 58.62  ? 111 PRO A O     1 
ATOM   813  C  CB    . PRO A 1 114 ? 43.980 -55.959 21.852  1.00 60.58  ? 111 PRO A CB    1 
ATOM   814  C  CG    . PRO A 1 114 ? 43.678 -57.381 22.088  1.00 60.94  ? 111 PRO A CG    1 
ATOM   815  C  CD    . PRO A 1 114 ? 42.647 -57.455 23.162  1.00 61.27  ? 111 PRO A CD    1 
ATOM   816  N  N     . ILE A 1 115 ? 42.207 -53.363 20.710  1.00 57.46  ? 112 ILE A N     1 
ATOM   817  C  CA    . ILE A 1 115 ? 41.561 -52.698 19.582  1.00 57.39  ? 112 ILE A CA    1 
ATOM   818  C  C     . ILE A 1 115 ? 41.920 -53.357 18.264  1.00 57.17  ? 112 ILE A C     1 
ATOM   819  O  O     . ILE A 1 115 ? 42.967 -53.995 18.141  1.00 56.60  ? 112 ILE A O     1 
ATOM   820  C  CB    . ILE A 1 115 ? 41.877 -51.162 19.530  1.00 58.56  ? 112 ILE A CB    1 
ATOM   821  C  CG1   . ILE A 1 115 ? 43.394 -50.882 19.604  1.00 58.85  ? 112 ILE A CG1   1 
ATOM   822  C  CG2   . ILE A 1 115 ? 41.095 -50.387 20.579  1.00 59.06  ? 112 ILE A CG2   1 
ATOM   823  C  CD1   . ILE A 1 115 ? 43.844 -49.570 19.064  1.00 53.98  ? 112 ILE A CD1   1 
ATOM   824  N  N     . LEU A 1 116 ? 41.056 -53.186 17.279  1.00 58.66  ? 113 LEU A N     1 
ATOM   825  C  CA    . LEU A 1 116 ? 41.281 -53.676 15.935  1.00 59.63  ? 113 LEU A CA    1 
ATOM   826  C  C     . LEU A 1 116 ? 41.921 -52.532 15.147  1.00 59.37  ? 113 LEU A C     1 
ATOM   827  O  O     . LEU A 1 116 ? 41.677 -51.364 15.448  1.00 60.02  ? 113 LEU A O     1 
ATOM   828  C  CB    . LEU A 1 116 ? 39.929 -54.041 15.293  1.00 59.03  ? 113 LEU A CB    1 
ATOM   829  C  CG    . LEU A 1 116 ? 39.274 -55.337 15.795  1.00 61.48  ? 113 LEU A CG    1 
ATOM   830  C  CD1   . LEU A 1 116 ? 37.857 -55.471 15.273  1.00 62.40  ? 113 LEU A CD1   1 
ATOM   831  C  CD2   . LEU A 1 116 ? 40.086 -56.546 15.419  1.00 59.09  ? 113 LEU A CD2   1 
ATOM   832  N  N     . ARG A 1 117 ? 42.738 -52.844 14.156  1.00 58.24  ? 114 ARG A N     1 
ATOM   833  C  CA    . ARG A 1 117 ? 43.320 -51.793 13.330  1.00 58.75  ? 114 ARG A CA    1 
ATOM   834  C  C     . ARG A 1 117 ? 42.757 -52.072 11.936  1.00 59.12  ? 114 ARG A C     1 
ATOM   835  O  O     . ARG A 1 117 ? 43.399 -52.782 11.165  1.00 59.11  ? 114 ARG A O     1 
ATOM   836  C  CB    . ARG A 1 117 ? 44.864 -51.796 13.389  1.00 60.90  ? 114 ARG A CB    1 
ATOM   837  C  CG    . ARG A 1 117 ? 45.449 -51.583 14.792  1.00 60.97  ? 114 ARG A CG    1 
ATOM   838  C  CD    . ARG A 1 117 ? 44.844 -50.430 15.612  1.00 58.02  ? 114 ARG A CD    1 
ATOM   839  N  NE    . ARG A 1 117 ? 44.835 -49.156 14.889  1.00 57.20  ? 114 ARG A NE    1 
ATOM   840  C  CZ    . ARG A 1 117 ? 45.810 -48.251 14.930  1.00 57.48  ? 114 ARG A CZ    1 
ATOM   841  N  NH1   . ARG A 1 117 ? 46.890 -48.457 15.682  1.00 55.32  ? 114 ARG A NH1   1 
ATOM   842  N  NH2   . ARG A 1 117 ? 45.716 -47.133 14.217  1.00 56.04  ? 114 ARG A NH2   1 
ATOM   843  N  N     . PRO A 1 118 ? 41.519 -51.604 11.625  1.00 59.83  ? 115 PRO A N     1 
ATOM   844  C  CA    . PRO A 1 118 ? 40.920 -51.911 10.322  1.00 60.45  ? 115 PRO A CA    1 
ATOM   845  C  C     . PRO A 1 118 ? 41.853 -51.618 9.170   1.00 61.06  ? 115 PRO A C     1 
ATOM   846  O  O     . PRO A 1 118 ? 42.605 -50.644 9.248   1.00 61.78  ? 115 PRO A O     1 
ATOM   847  C  CB    . PRO A 1 118 ? 39.713 -50.979 10.264  1.00 61.23  ? 115 PRO A CB    1 
ATOM   848  C  CG    . PRO A 1 118 ? 39.351 -50.730 11.633  1.00 61.94  ? 115 PRO A CG    1 
ATOM   849  C  CD    . PRO A 1 118 ? 40.616 -50.753 12.427  1.00 60.58  ? 115 PRO A CD    1 
ATOM   850  N  N     . ASP A 1 119 ? 41.816 -52.444 8.106   1.00 66.78  ? 116 ASP A N     1 
ATOM   851  C  CA    . ASP A 1 119 ? 42.663 -52.204 6.938   1.00 67.52  ? 116 ASP A CA    1 
ATOM   852  C  C     . ASP A 1 119 ? 42.350 -50.830 6.364   1.00 66.41  ? 116 ASP A C     1 
ATOM   853  O  O     . ASP A 1 119 ? 41.182 -50.396 6.377   1.00 65.60  ? 116 ASP A O     1 
ATOM   854  C  CB    . ASP A 1 119 ? 42.425 -53.264 5.858   1.00 71.95  ? 116 ASP A CB    1 
ATOM   855  C  CG    . ASP A 1 119 ? 43.145 -54.565 6.099   1.00 74.98  ? 116 ASP A CG    1 
ATOM   856  O  OD1   . ASP A 1 119 ? 44.303 -54.528 6.630   1.00 78.57  ? 116 ASP A OD1   1 
ATOM   857  O  OD2   . ASP A 1 119 ? 42.569 -55.629 5.754   1.00 79.07  ? 116 ASP A OD2   1 
ATOM   858  N  N     . ARG A 1 120 ? 43.390 -50.149 5.888   1.00 63.64  ? 117 ARG A N     1 
ATOM   859  C  CA    . ARG A 1 120 ? 43.269 -48.832 5.303   1.00 63.17  ? 117 ARG A CA    1 
ATOM   860  C  C     . ARG A 1 120 ? 42.503 -48.986 3.975   1.00 63.16  ? 117 ARG A C     1 
ATOM   861  O  O     . ARG A 1 120 ? 42.799 -49.928 3.223   1.00 63.29  ? 117 ARG A O     1 
ATOM   862  C  CB    . ARG A 1 120 ? 44.683 -48.263 5.062   1.00 63.79  ? 117 ARG A CB    1 
ATOM   863  C  CG    . ARG A 1 120 ? 44.739 -46.888 4.372   1.00 61.21  ? 117 ARG A CG    1 
ATOM   864  C  CD    . ARG A 1 120 ? 46.161 -46.398 4.038   1.00 62.59  ? 117 ARG A CD    1 
ATOM   865  N  NE    . ARG A 1 120 ? 46.955 -46.102 5.234   1.00 62.95  ? 117 ARG A NE    1 
ATOM   866  C  CZ    . ARG A 1 120 ? 47.013 -44.914 5.832   1.00 63.49  ? 117 ARG A CZ    1 
ATOM   867  N  NH1   . ARG A 1 120 ? 46.325 -43.884 5.351   1.00 61.30  ? 117 ARG A NH1   1 
ATOM   868  N  NH2   . ARG A 1 120 ? 47.754 -44.749 6.926   1.00 63.06  ? 117 ARG A NH2   1 
ATOM   869  N  N     . PRO A 1 121 ? 41.515 -48.106 3.651   1.00 60.70  ? 118 PRO A N     1 
ATOM   870  C  CA    . PRO A 1 121 ? 40.832 -48.223 2.347   1.00 60.65  ? 118 PRO A CA    1 
ATOM   871  C  C     . PRO A 1 121 ? 41.877 -48.298 1.233   1.00 61.42  ? 118 PRO A C     1 
ATOM   872  O  O     . PRO A 1 121 ? 42.927 -47.651 1.320   1.00 61.15  ? 118 PRO A O     1 
ATOM   873  C  CB    . PRO A 1 121 ? 39.999 -46.946 2.282   1.00 62.06  ? 118 PRO A CB    1 
ATOM   874  C  CG    . PRO A 1 121 ? 39.697 -46.655 3.734   1.00 62.16  ? 118 PRO A CG    1 
ATOM   875  C  CD    . PRO A 1 121 ? 40.995 -46.951 4.419   1.00 61.24  ? 118 PRO A CD    1 
ATOM   876  N  N     . GLN A 1 122 ? 41.638 -49.146 0.228   1.00 63.66  ? 119 GLN A N     1 
ATOM   877  C  CA    . GLN A 1 122 ? 42.609 -49.351 -0.845  1.00 64.82  ? 119 GLN A CA    1 
ATOM   878  C  C     . GLN A 1 122 ? 42.840 -48.159 -1.749  1.00 63.91  ? 119 GLN A C     1 
ATOM   879  O  O     . GLN A 1 122 ? 43.988 -47.854 -2.098  1.00 62.50  ? 119 GLN A O     1 
ATOM   880  C  CB    . GLN A 1 122 ? 42.227 -50.560 -1.677  1.00 67.26  ? 119 GLN A CB    1 
ATOM   881  C  CG    . GLN A 1 122 ? 42.725 -51.873 -1.095  1.00 72.53  ? 119 GLN A CG    1 
ATOM   882  C  CD    . GLN A 1 122 ? 42.279 -53.051 -1.930  1.00 79.98  ? 119 GLN A CD    1 
ATOM   883  O  OE1   . GLN A 1 122 ? 42.195 -52.978 -3.186  1.00 83.00  ? 119 GLN A OE1   1 
ATOM   884  N  NE2   . GLN A 1 122 ? 41.985 -54.162 -1.246  1.00 81.34  ? 119 GLN A NE2   1 
ATOM   885  N  N     . LYS A 1 123 ? 41.762 -47.491 -2.125  1.00 62.68  ? 120 LYS A N     1 
ATOM   886  C  CA    . LYS A 1 123 ? 41.845 -46.373 -3.034  1.00 63.66  ? 120 LYS A CA    1 
ATOM   887  C  C     . LYS A 1 123 ? 41.272 -45.091 -2.444  1.00 62.86  ? 120 LYS A C     1 
ATOM   888  O  O     . LYS A 1 123 ? 40.375 -45.164 -1.596  1.00 62.91  ? 120 LYS A O     1 
ATOM   889  C  CB    . LYS A 1 123 ? 41.030 -46.727 -4.318  1.00 68.92  ? 120 LYS A CB    1 
ATOM   890  C  CG    . LYS A 1 123 ? 41.628 -47.845 -5.191  1.00 72.44  ? 120 LYS A CG    1 
ATOM   891  C  CD    . LYS A 1 123 ? 40.797 -48.138 -6.436  1.00 77.08  ? 120 LYS A CD    1 
ATOM   892  C  CE    . LYS A 1 123 ? 39.756 -49.222 -6.232  1.00 80.91  ? 120 LYS A CE    1 
ATOM   893  N  NZ    . LYS A 1 123 ? 39.000 -49.530 -7.489  1.00 83.01  ? 120 LYS A NZ    1 
ATOM   894  N  N     . PRO A 1 124 ? 41.687 -43.888 -2.936  1.00 59.84  ? 121 PRO A N     1 
ATOM   895  C  CA    . PRO A 1 124 ? 41.008 -42.671 -2.487  1.00 59.05  ? 121 PRO A CA    1 
ATOM   896  C  C     . PRO A 1 124 ? 39.566 -42.824 -2.960  1.00 59.02  ? 121 PRO A C     1 
ATOM   897  O  O     . PRO A 1 124 ? 39.309 -43.503 -3.961  1.00 59.11  ? 121 PRO A O     1 
ATOM   898  C  CB    . PRO A 1 124 ? 41.667 -41.560 -3.310  1.00 60.30  ? 121 PRO A CB    1 
ATOM   899  C  CG    . PRO A 1 124 ? 42.896 -42.128 -3.821  1.00 60.82  ? 121 PRO A CG    1 
ATOM   900  C  CD    . PRO A 1 124 ? 42.694 -43.585 -3.971  1.00 61.05  ? 121 PRO A CD    1 
ATOM   901  N  N     . PHE A 1 125 ? 38.640 -42.220 -2.232  1.00 57.08  ? 122 PHE A N     1 
ATOM   902  C  CA    . PHE A 1 125 ? 37.200 -42.189 -2.475  1.00 57.01  ? 122 PHE A CA    1 
ATOM   903  C  C     . PHE A 1 125 ? 36.479 -43.515 -2.138  1.00 56.74  ? 122 PHE A C     1 
ATOM   904  O  O     . PHE A 1 125 ? 35.253 -43.563 -2.234  1.00 56.65  ? 122 PHE A O     1 
ATOM   905  C  CB    . PHE A 1 125 ? 36.867 -41.675 -3.871  1.00 56.89  ? 122 PHE A CB    1 
ATOM   906  C  CG    . PHE A 1 125 ? 37.449 -40.302 -4.126  1.00 57.34  ? 122 PHE A CG    1 
ATOM   907  C  CD1   . PHE A 1 125 ? 36.955 -39.179 -3.456  1.00 57.19  ? 122 PHE A CD1   1 
ATOM   908  C  CD2   . PHE A 1 125 ? 38.491 -40.127 -5.029  1.00 56.24  ? 122 PHE A CD2   1 
ATOM   909  C  CE1   . PHE A 1 125 ? 37.494 -37.907 -3.685  1.00 58.21  ? 122 PHE A CE1   1 
ATOM   910  C  CE2   . PHE A 1 125 ? 39.016 -38.852 -5.278  1.00 57.53  ? 122 PHE A CE2   1 
ATOM   911  C  CZ    . PHE A 1 125 ? 38.514 -37.748 -4.602  1.00 55.79  ? 122 PHE A CZ    1 
ATOM   912  N  N     . ASP A 1 126 ? 37.204 -44.544 -1.639  1.00 58.42  ? 123 ASP A N     1 
ATOM   913  C  CA    . ASP A 1 126 ? 36.571 -45.792 -1.213  1.00 58.87  ? 123 ASP A CA    1 
ATOM   914  C  C     . ASP A 1 126 ? 35.737 -45.491 0.028   1.00 58.82  ? 123 ASP A C     1 
ATOM   915  O  O     . ASP A 1 126 ? 34.550 -45.824 0.053   1.00 59.35  ? 123 ASP A O     1 
ATOM   916  C  CB    . ASP A 1 126 ? 37.611 -46.874 -0.905  1.00 60.78  ? 123 ASP A CB    1 
ATOM   917  C  CG    . ASP A 1 126 ? 38.145 -47.625 -2.106  1.00 63.22  ? 123 ASP A CG    1 
ATOM   918  O  OD1   . ASP A 1 126 ? 37.648 -47.382 -3.231  1.00 65.28  ? 123 ASP A OD1   1 
ATOM   919  O  OD2   . ASP A 1 126 ? 39.066 -48.460 -1.925  1.00 64.06  ? 123 ASP A OD2   1 
ATOM   920  N  N     . LYS A 1 127 ? 36.345 -44.826 1.052   1.00 59.31  ? 124 LYS A N     1 
ATOM   921  C  CA    . LYS A 1 127 ? 35.646 -44.487 2.294   1.00 59.47  ? 124 LYS A CA    1 
ATOM   922  C  C     . LYS A 1 127 ? 35.979 -43.111 2.822   1.00 59.32  ? 124 LYS A C     1 
ATOM   923  O  O     . LYS A 1 127 ? 37.155 -42.792 3.023   1.00 60.09  ? 124 LYS A O     1 
ATOM   924  C  CB    . LYS A 1 127 ? 35.933 -45.522 3.396   1.00 57.71  ? 124 LYS A CB    1 
ATOM   925  C  CG    . LYS A 1 127 ? 34.857 -45.543 4.469   1.00 60.39  ? 124 LYS A CG    1 
ATOM   926  C  CD    . LYS A 1 127 ? 35.117 -46.575 5.542   1.00 61.02  ? 124 LYS A CD    1 
ATOM   927  C  CE    . LYS A 1 127 ? 34.759 -47.978 5.135   1.00 61.23  ? 124 LYS A CE    1 
ATOM   928  N  NZ    . LYS A 1 127 ? 34.796 -48.892 6.291   1.00 62.01  ? 124 LYS A NZ    1 
ATOM   929  N  N     . PHE A 1 128 ? 34.942 -42.324 3.097   1.00 58.09  ? 125 PHE A N     1 
ATOM   930  C  CA    . PHE A 1 128 ? 35.045 -41.003 3.689   1.00 57.20  ? 125 PHE A CA    1 
ATOM   931  C  C     . PHE A 1 128 ? 34.644 -41.138 5.157   1.00 57.17  ? 125 PHE A C     1 
ATOM   932  O  O     . PHE A 1 128 ? 33.749 -41.915 5.466   1.00 57.50  ? 125 PHE A O     1 
ATOM   933  C  CB    . PHE A 1 128 ? 34.053 -40.038 3.030   1.00 57.92  ? 125 PHE A CB    1 
ATOM   934  C  CG    . PHE A 1 128 ? 34.511 -39.308 1.792   1.00 56.23  ? 125 PHE A CG    1 
ATOM   935  C  CD1   . PHE A 1 128 ? 35.757 -39.568 1.228   1.00 54.71  ? 125 PHE A CD1   1 
ATOM   936  C  CD2   . PHE A 1 128 ? 33.685 -38.383 1.170   1.00 57.10  ? 125 PHE A CD2   1 
ATOM   937  C  CE1   . PHE A 1 128 ? 36.176 -38.897 0.084   1.00 55.54  ? 125 PHE A CE1   1 
ATOM   938  C  CE2   . PHE A 1 128 ? 34.102 -37.710 0.018   1.00 55.18  ? 125 PHE A CE2   1 
ATOM   939  C  CZ    . PHE A 1 128 ? 35.347 -37.971 -0.514  1.00 55.28  ? 125 PHE A CZ    1 
ATOM   940  N  N     . PHE A 1 129 ? 35.294 -40.389 6.057   1.00 58.54  ? 126 PHE A N     1 
ATOM   941  C  CA    . PHE A 1 129 ? 34.943 -40.363 7.478   1.00 58.05  ? 126 PHE A CA    1 
ATOM   942  C  C     . PHE A 1 129 ? 34.482 -38.919 7.688   1.00 58.16  ? 126 PHE A C     1 
ATOM   943  O  O     . PHE A 1 129 ? 35.183 -37.975 7.278   1.00 58.21  ? 126 PHE A O     1 
ATOM   944  C  CB    . PHE A 1 129 ? 36.125 -40.772 8.383   1.00 58.58  ? 126 PHE A CB    1 
ATOM   945  C  CG    . PHE A 1 129 ? 36.386 -42.262 8.357   1.00 58.80  ? 126 PHE A CG    1 
ATOM   946  C  CD1   . PHE A 1 129 ? 37.148 -42.836 7.341   1.00 59.63  ? 126 PHE A CD1   1 
ATOM   947  C  CD2   . PHE A 1 129 ? 35.839 -43.100 9.328   1.00 59.21  ? 126 PHE A CD2   1 
ATOM   948  C  CE1   . PHE A 1 129 ? 37.366 -44.218 7.301   1.00 58.94  ? 126 PHE A CE1   1 
ATOM   949  C  CE2   . PHE A 1 129 ? 36.057 -44.482 9.288   1.00 61.34  ? 126 PHE A CE2   1 
ATOM   950  C  CZ    . PHE A 1 129 ? 36.820 -45.031 8.273   1.00 58.81  ? 126 PHE A CZ    1 
ATOM   951  N  N     . ILE A 1 130 ? 33.262 -38.740 8.205   1.00 56.43  ? 127 ILE A N     1 
ATOM   952  C  CA    . ILE A 1 130 ? 32.720 -37.399 8.394   1.00 56.53  ? 127 ILE A CA    1 
ATOM   953  C  C     . ILE A 1 130 ? 32.320 -37.184 9.840   1.00 56.16  ? 127 ILE A C     1 
ATOM   954  O  O     . ILE A 1 130 ? 31.934 -38.130 10.531  1.00 54.92  ? 127 ILE A O     1 
ATOM   955  C  CB    . ILE A 1 130 ? 31.602 -37.000 7.385   1.00 59.75  ? 127 ILE A CB    1 
ATOM   956  C  CG1   . ILE A 1 130 ? 30.322 -37.870 7.517   1.00 60.69  ? 127 ILE A CG1   1 
ATOM   957  C  CG2   . ILE A 1 130 ? 32.134 -36.991 5.952   1.00 60.06  ? 127 ILE A CG2   1 
ATOM   958  C  CD1   . ILE A 1 130 ? 29.077 -37.300 6.736   1.00 61.56  ? 127 ILE A CD1   1 
ATOM   959  N  N     . ASP A 1 131 ? 32.434 -35.930 10.296  1.00 53.39  ? 128 ASP A N     1 
ATOM   960  C  CA    . ASP A 1 131 ? 32.119 -35.536 11.656  1.00 53.61  ? 128 ASP A CA    1 
ATOM   961  C  C     . ASP A 1 131 ? 32.041 -34.041 11.749  1.00 54.08  ? 128 ASP A C     1 
ATOM   962  O  O     . ASP A 1 131 ? 32.535 -33.334 10.854  1.00 54.12  ? 128 ASP A O     1 
ATOM   963  C  CB    . ASP A 1 131 ? 33.207 -36.034 12.615  1.00 55.47  ? 128 ASP A CB    1 
ATOM   964  C  CG    . ASP A 1 131 ? 32.782 -36.049 14.058  1.00 56.02  ? 128 ASP A CG    1 
ATOM   965  O  OD1   . ASP A 1 131 ? 31.578 -36.236 14.320  1.00 55.54  ? 128 ASP A OD1   1 
ATOM   966  O  OD2   . ASP A 1 131 ? 33.647 -35.859 14.926  1.00 56.69  ? 128 ASP A OD2   1 
ATOM   967  N  N     . TYR A 1 132 ? 31.427 -33.564 12.854  1.00 54.40  ? 129 TYR A N     1 
ATOM   968  C  CA    . TYR A 1 132 ? 31.281 -32.162 13.179  1.00 54.72  ? 129 TYR A CA    1 
ATOM   969  C  C     . TYR A 1 132 ? 32.164 -31.770 14.374  1.00 55.32  ? 129 TYR A C     1 
ATOM   970  O  O     . TYR A 1 132 ? 32.377 -32.568 15.295  1.00 54.97  ? 129 TYR A O     1 
ATOM   971  C  CB    . TYR A 1 132 ? 29.811 -31.825 13.476  1.00 55.05  ? 129 TYR A CB    1 
ATOM   972  C  CG    . TYR A 1 132 ? 29.033 -31.449 12.239  1.00 56.53  ? 129 TYR A CG    1 
ATOM   973  C  CD1   . TYR A 1 132 ? 29.192 -30.199 11.643  1.00 55.47  ? 129 TYR A CD1   1 
ATOM   974  C  CD2   . TYR A 1 132 ? 28.141 -32.344 11.652  1.00 56.45  ? 129 TYR A CD2   1 
ATOM   975  C  CE1   . TYR A 1 132 ? 28.484 -29.853 10.489  1.00 58.66  ? 129 TYR A CE1   1 
ATOM   976  C  CE2   . TYR A 1 132 ? 27.433 -32.014 10.494  1.00 57.59  ? 129 TYR A CE2   1 
ATOM   977  C  CZ    . TYR A 1 132 ? 27.603 -30.766 9.919   1.00 58.79  ? 129 TYR A CZ    1 
ATOM   978  O  OH    . TYR A 1 132 ? 26.927 -30.446 8.767   1.00 59.06  ? 129 TYR A OH    1 
ATOM   979  N  N     . ILE A 1 133 ? 32.684 -30.541 14.339  1.00 57.13  ? 130 ILE A N     1 
ATOM   980  C  CA    . ILE A 1 133 ? 33.477 -29.923 15.402  1.00 58.29  ? 130 ILE A CA    1 
ATOM   981  C  C     . ILE A 1 133 ? 32.610 -28.719 15.792  1.00 59.02  ? 130 ILE A C     1 
ATOM   982  O  O     . ILE A 1 133 ? 32.118 -28.000 14.910  1.00 58.23  ? 130 ILE A O     1 
ATOM   983  C  CB    . ILE A 1 133 ? 34.886 -29.447 14.943  1.00 61.51  ? 130 ILE A CB    1 
ATOM   984  C  CG1   . ILE A 1 133 ? 35.829 -30.603 14.652  1.00 62.31  ? 130 ILE A CG1   1 
ATOM   985  C  CG2   . ILE A 1 133 ? 35.521 -28.511 15.962  1.00 61.63  ? 130 ILE A CG2   1 
ATOM   986  C  CD1   . ILE A 1 133 ? 37.146 -30.079 13.932  1.00 64.24  ? 130 ILE A CD1   1 
ATOM   987  N  N     . GLY A 1 134 ? 32.438 -28.504 17.091  1.00 60.16  ? 131 GLY A N     1 
ATOM   988  C  CA    . GLY A 1 134 ? 31.660 -27.378 17.575  1.00 61.13  ? 131 GLY A CA    1 
ATOM   989  C  C     . GLY A 1 134 ? 30.721 -27.722 18.703  1.00 61.76  ? 131 GLY A C     1 
ATOM   990  O  O     . GLY A 1 134 ? 30.587 -28.898 19.064  1.00 62.34  ? 131 GLY A O     1 
ATOM   991  N  N     . PRO A 1 135 ? 30.037 -26.705 19.270  1.00 61.50  ? 132 PRO A N     1 
ATOM   992  C  CA    . PRO A 1 135 ? 30.096 -25.277 18.896  1.00 61.99  ? 132 PRO A CA    1 
ATOM   993  C  C     . PRO A 1 135 ? 31.425 -24.623 19.210  1.00 62.58  ? 132 PRO A C     1 
ATOM   994  O  O     . PRO A 1 135 ? 32.063 -24.913 20.229  1.00 63.46  ? 132 PRO A O     1 
ATOM   995  C  CB    . PRO A 1 135 ? 28.916 -24.666 19.659  1.00 62.76  ? 132 PRO A CB    1 
ATOM   996  C  CG    . PRO A 1 135 ? 28.764 -25.543 20.853  1.00 63.18  ? 132 PRO A CG    1 
ATOM   997  C  CD    . PRO A 1 135 ? 29.082 -26.933 20.371  1.00 62.65  ? 132 PRO A CD    1 
ATOM   998  N  N     . LEU A 1 136 ? 31.858 -23.788 18.288  1.00 61.53  ? 133 LEU A N     1 
ATOM   999  C  CA    . LEU A 1 136 ? 33.094 -23.020 18.365  1.00 61.99  ? 133 LEU A CA    1 
ATOM   1000 C  C     . LEU A 1 136 ? 32.675 -21.559 18.656  1.00 62.66  ? 133 LEU A C     1 
ATOM   1001 O  O     . LEU A 1 136 ? 31.486 -21.240 18.492  1.00 63.21  ? 133 LEU A O     1 
ATOM   1002 C  CB    . LEU A 1 136 ? 33.828 -23.081 17.003  1.00 60.35  ? 133 LEU A CB    1 
ATOM   1003 C  CG    . LEU A 1 136 ? 34.403 -24.424 16.534  1.00 60.60  ? 133 LEU A CG    1 
ATOM   1004 C  CD1   . LEU A 1 136 ? 35.187 -24.251 15.254  1.00 59.05  ? 133 LEU A CD1   1 
ATOM   1005 C  CD2   . LEU A 1 136 ? 35.314 -25.047 17.580  1.00 59.05  ? 133 LEU A CD2   1 
ATOM   1006 N  N     . PRO A 1 137 ? 33.581 -20.631 19.080  1.00 65.86  ? 134 PRO A N     1 
ATOM   1007 C  CA    . PRO A 1 137 ? 33.138 -19.241 19.279  1.00 67.00  ? 134 PRO A CA    1 
ATOM   1008 C  C     . PRO A 1 137 ? 32.497 -18.768 17.967  1.00 67.81  ? 134 PRO A C     1 
ATOM   1009 O  O     . PRO A 1 137 ? 32.996 -19.155 16.911  1.00 67.45  ? 134 PRO A O     1 
ATOM   1010 C  CB    . PRO A 1 137 ? 34.451 -18.499 19.540  1.00 68.06  ? 134 PRO A CB    1 
ATOM   1011 C  CG    . PRO A 1 137 ? 35.340 -19.522 20.117  1.00 67.67  ? 134 PRO A CG    1 
ATOM   1012 C  CD    . PRO A 1 137 ? 35.031 -20.760 19.342  1.00 67.47  ? 134 PRO A CD    1 
ATOM   1013 N  N     . PRO A 1 138 ? 31.387 -18.001 17.960  1.00 67.66  ? 135 PRO A N     1 
ATOM   1014 C  CA    . PRO A 1 138 ? 30.813 -17.587 16.670  1.00 67.92  ? 135 PRO A CA    1 
ATOM   1015 C  C     . PRO A 1 138 ? 31.801 -16.770 15.836  1.00 68.08  ? 135 PRO A C     1 
ATOM   1016 O  O     . PRO A 1 138 ? 32.506 -15.898 16.358  1.00 68.26  ? 135 PRO A O     1 
ATOM   1017 C  CB    . PRO A 1 138 ? 29.571 -16.779 17.066  1.00 69.28  ? 135 PRO A CB    1 
ATOM   1018 C  CG    . PRO A 1 138 ? 29.302 -17.130 18.473  1.00 69.88  ? 135 PRO A CG    1 
ATOM   1019 C  CD    . PRO A 1 138 ? 30.628 -17.432 19.090  1.00 69.30  ? 135 PRO A CD    1 
ATOM   1020 N  N     . SER A 1 139 ? 31.871 -17.100 14.544  1.00 68.21  ? 136 SER A N     1 
ATOM   1021 C  CA    . SER A 1 139 ? 32.736 -16.463 13.559  1.00 68.78  ? 136 SER A CA    1 
ATOM   1022 C  C     . SER A 1 139 ? 31.916 -16.331 12.289  1.00 69.41  ? 136 SER A C     1 
ATOM   1023 O  O     . SER A 1 139 ? 31.538 -17.345 11.707  1.00 69.39  ? 136 SER A O     1 
ATOM   1024 C  CB    . SER A 1 139 ? 33.988 -17.304 13.325  1.00 71.21  ? 136 SER A CB    1 
ATOM   1025 O  OG    . SER A 1 139 ? 34.923 -16.626 12.504  1.00 71.39  ? 136 SER A OG    1 
ATOM   1026 N  N     . GLN A 1 140 ? 31.563 -15.087 11.908  1.00 70.10  ? 137 GLN A N     1 
ATOM   1027 C  CA    . GLN A 1 140 ? 30.754 -14.744 10.734  1.00 70.91  ? 137 GLN A CA    1 
ATOM   1028 C  C     . GLN A 1 140 ? 29.364 -15.428 10.746  1.00 70.48  ? 137 GLN A C     1 
ATOM   1029 O  O     . GLN A 1 140 ? 28.778 -15.691 9.681   1.00 71.05  ? 137 GLN A O     1 
ATOM   1030 C  CB    . GLN A 1 140 ? 31.516 -15.079 9.438   1.00 73.67  ? 137 GLN A CB    1 
ATOM   1031 C  CG    . GLN A 1 140 ? 32.898 -14.463 9.326   1.00 76.49  ? 137 GLN A CG    1 
ATOM   1032 C  CD    . GLN A 1 140 ? 32.846 -13.203 8.522   1.00 79.54  ? 137 GLN A CD    1 
ATOM   1033 O  OE1   . GLN A 1 140 ? 32.699 -13.235 7.288   1.00 83.25  ? 137 GLN A OE1   1 
ATOM   1034 N  NE2   . GLN A 1 140 ? 32.965 -12.068 9.203   1.00 80.02  ? 137 GLN A NE2   1 
ATOM   1035 N  N     . GLY A 1 141 ? 28.859 -15.714 11.944  1.00 70.20  ? 138 GLY A N     1 
ATOM   1036 C  CA    . GLY A 1 141 ? 27.574 -16.382 12.141  1.00 69.79  ? 138 GLY A CA    1 
ATOM   1037 C  C     . GLY A 1 141 ? 27.676 -17.897 12.141  1.00 69.59  ? 138 GLY A C     1 
ATOM   1038 O  O     . GLY A 1 141 ? 26.675 -18.588 12.348  1.00 70.04  ? 138 GLY A O     1 
ATOM   1039 N  N     . TYR A 1 142 ? 28.891 -18.426 11.909  1.00 70.02  ? 139 TYR A N     1 
ATOM   1040 C  CA    . TYR A 1 142 ? 29.170 -19.850 11.871  1.00 69.08  ? 139 TYR A CA    1 
ATOM   1041 C  C     . TYR A 1 142 ? 29.632 -20.337 13.235  1.00 68.24  ? 139 TYR A C     1 
ATOM   1042 O  O     . TYR A 1 142 ? 30.339 -19.614 13.954  1.00 67.14  ? 139 TYR A O     1 
ATOM   1043 C  CB    . TYR A 1 142 ? 30.191 -20.160 10.768  1.00 71.10  ? 139 TYR A CB    1 
ATOM   1044 C  CG    . TYR A 1 142 ? 29.618 -19.918 9.394   1.00 72.63  ? 139 TYR A CG    1 
ATOM   1045 C  CD1   . TYR A 1 142 ? 29.637 -18.650 8.822   1.00 73.79  ? 139 TYR A CD1   1 
ATOM   1046 C  CD2   . TYR A 1 142 ? 28.999 -20.943 8.686   1.00 73.57  ? 139 TYR A CD2   1 
ATOM   1047 C  CE1   . TYR A 1 142 ? 29.067 -18.410 7.573   1.00 73.63  ? 139 TYR A CE1   1 
ATOM   1048 C  CE2   . TYR A 1 142 ? 28.438 -20.719 7.431   1.00 73.37  ? 139 TYR A CE2   1 
ATOM   1049 C  CZ    . TYR A 1 142 ? 28.475 -19.450 6.878   1.00 73.71  ? 139 TYR A CZ    1 
ATOM   1050 O  OH    . TYR A 1 142 ? 27.922 -19.218 5.644   1.00 73.80  ? 139 TYR A OH    1 
ATOM   1051 N  N     . LEU A 1 143 ? 29.233 -21.563 13.587  1.00 66.21  ? 140 LEU A N     1 
ATOM   1052 C  CA    . LEU A 1 143 ? 29.560 -22.167 14.872  1.00 65.55  ? 140 LEU A CA    1 
ATOM   1053 C  C     . LEU A 1 143 ? 30.187 -23.552 14.742  1.00 64.96  ? 140 LEU A C     1 
ATOM   1054 O  O     . LEU A 1 143 ? 30.903 -23.981 15.652  1.00 65.16  ? 140 LEU A O     1 
ATOM   1055 C  CB    . LEU A 1 143 ? 28.275 -22.283 15.720  1.00 65.44  ? 140 LEU A CB    1 
ATOM   1056 C  CG    . LEU A 1 143 ? 27.648 -20.999 16.213  1.00 66.40  ? 140 LEU A CG    1 
ATOM   1057 C  CD1   . LEU A 1 143 ? 26.177 -21.138 16.294  1.00 66.55  ? 140 LEU A CD1   1 
ATOM   1058 C  CD2   . LEU A 1 143 ? 28.193 -20.631 17.552  1.00 66.18  ? 140 LEU A CD2   1 
ATOM   1059 N  N     . TYR A 1 144 ? 29.888 -24.279 13.645  1.00 63.40  ? 141 TYR A N     1 
ATOM   1060 C  CA    . TYR A 1 144 ? 30.424 -25.636 13.468  1.00 62.25  ? 141 TYR A CA    1 
ATOM   1061 C  C     . TYR A 1 144 ? 31.317 -25.799 12.243  1.00 61.74  ? 141 TYR A C     1 
ATOM   1062 O  O     . TYR A 1 144 ? 31.357 -24.919 11.384  1.00 61.93  ? 141 TYR A O     1 
ATOM   1063 C  CB    . TYR A 1 144 ? 29.299 -26.678 13.462  1.00 61.59  ? 141 TYR A CB    1 
ATOM   1064 C  CG    . TYR A 1 144 ? 28.498 -26.715 14.742  1.00 61.80  ? 141 TYR A CG    1 
ATOM   1065 C  CD1   . TYR A 1 144 ? 27.549 -25.733 15.024  1.00 62.88  ? 141 TYR A CD1   1 
ATOM   1066 C  CD2   . TYR A 1 144 ? 28.650 -27.756 15.651  1.00 61.66  ? 141 TYR A CD2   1 
ATOM   1067 C  CE1   . TYR A 1 144 ? 26.806 -25.762 16.202  1.00 62.38  ? 141 TYR A CE1   1 
ATOM   1068 C  CE2   . TYR A 1 144 ? 27.910 -27.799 16.831  1.00 62.28  ? 141 TYR A CE2   1 
ATOM   1069 C  CZ    . TYR A 1 144 ? 26.989 -26.797 17.103  1.00 63.86  ? 141 TYR A CZ    1 
ATOM   1070 O  OH    . TYR A 1 144 ? 26.248 -26.837 18.253  1.00 64.65  ? 141 TYR A OH    1 
ATOM   1071 N  N     . VAL A 1 145 ? 32.047 -26.923 12.183  1.00 58.92  ? 142 VAL A N     1 
ATOM   1072 C  CA    . VAL A 1 145 ? 32.923 -27.283 11.076  1.00 57.26  ? 142 VAL A CA    1 
ATOM   1073 C  C     . VAL A 1 145 ? 32.604 -28.722 10.690  1.00 57.49  ? 142 VAL A C     1 
ATOM   1074 O  O     . VAL A 1 145 ? 32.661 -29.614 11.543  1.00 57.13  ? 142 VAL A O     1 
ATOM   1075 C  CB    . VAL A 1 145 ? 34.448 -27.093 11.374  1.00 59.88  ? 142 VAL A CB    1 
ATOM   1076 C  CG1   . VAL A 1 145 ? 35.315 -27.633 10.239  1.00 57.82  ? 142 VAL A CG1   1 
ATOM   1077 C  CG2   . VAL A 1 145 ? 34.784 -25.634 11.626  1.00 58.11  ? 142 VAL A CG2   1 
ATOM   1078 N  N     . LEU A 1 146 ? 32.266 -28.950 9.407   1.00 56.20  ? 143 LEU A N     1 
ATOM   1079 C  CA    . LEU A 1 146 ? 32.035 -30.299 8.899   1.00 55.37  ? 143 LEU A CA    1 
ATOM   1080 C  C     . LEU A 1 146 ? 33.402 -30.728 8.362   1.00 54.41  ? 143 LEU A C     1 
ATOM   1081 O  O     . LEU A 1 146 ? 33.986 -30.058 7.497   1.00 54.07  ? 143 LEU A O     1 
ATOM   1082 C  CB    . LEU A 1 146 ? 30.938 -30.381 7.815   1.00 54.64  ? 143 LEU A CB    1 
ATOM   1083 C  CG    . LEU A 1 146 ? 30.806 -31.755 7.119   1.00 54.74  ? 143 LEU A CG    1 
ATOM   1084 C  CD1   . LEU A 1 146 ? 30.205 -32.806 8.036   1.00 54.20  ? 143 LEU A CD1   1 
ATOM   1085 C  CD2   . LEU A 1 146 ? 30.024 -31.659 5.853   1.00 56.33  ? 143 LEU A CD2   1 
ATOM   1086 N  N     . VAL A 1 147 ? 33.913 -31.823 8.919   1.00 56.30  ? 144 VAL A N     1 
ATOM   1087 C  CA    . VAL A 1 147 ? 35.207 -32.401 8.573   1.00 55.22  ? 144 VAL A CA    1 
ATOM   1088 C  C     . VAL A 1 147 ? 34.989 -33.672 7.755   1.00 55.76  ? 144 VAL A C     1 
ATOM   1089 O  O     . VAL A 1 147 ? 34.303 -34.601 8.209   1.00 55.74  ? 144 VAL A O     1 
ATOM   1090 C  CB    . VAL A 1 147 ? 36.059 -32.672 9.841   1.00 58.22  ? 144 VAL A CB    1 
ATOM   1091 C  CG1   . VAL A 1 147 ? 37.439 -33.188 9.469   1.00 56.64  ? 144 VAL A CG1   1 
ATOM   1092 C  CG2   . VAL A 1 147 ? 36.178 -31.414 10.695  1.00 56.97  ? 144 VAL A CG2   1 
ATOM   1093 N  N     . VAL A 1 148 ? 35.585 -33.707 6.552   1.00 55.44  ? 145 VAL A N     1 
ATOM   1094 C  CA    . VAL A 1 148 ? 35.496 -34.860 5.659   1.00 55.33  ? 145 VAL A CA    1 
ATOM   1095 C  C     . VAL A 1 148 ? 36.899 -35.402 5.427   1.00 55.58  ? 145 VAL A C     1 
ATOM   1096 O  O     . VAL A 1 148 ? 37.738 -34.698 4.865   1.00 56.00  ? 145 VAL A O     1 
ATOM   1097 C  CB    . VAL A 1 148 ? 34.802 -34.536 4.320   1.00 58.51  ? 145 VAL A CB    1 
ATOM   1098 C  CG1   . VAL A 1 148 ? 34.614 -35.809 3.513   1.00 58.37  ? 145 VAL A CG1   1 
ATOM   1099 C  CG2   . VAL A 1 148 ? 33.467 -33.821 4.536   1.00 58.20  ? 145 VAL A CG2   1 
ATOM   1100 N  N     . VAL A 1 149 ? 37.159 -36.643 5.848   1.00 54.05  ? 146 VAL A N     1 
ATOM   1101 C  CA    . VAL A 1 149 ? 38.478 -37.255 5.684   1.00 54.45  ? 146 VAL A CA    1 
ATOM   1102 C  C     . VAL A 1 149 ? 38.438 -38.462 4.741   1.00 55.21  ? 146 VAL A C     1 
ATOM   1103 O  O     . VAL A 1 149 ? 37.726 -39.438 5.004   1.00 55.45  ? 146 VAL A O     1 
ATOM   1104 C  CB    . VAL A 1 149 ? 39.154 -37.613 7.055   1.00 54.87  ? 146 VAL A CB    1 
ATOM   1105 C  CG1   . VAL A 1 149 ? 40.563 -38.172 6.868   1.00 53.93  ? 146 VAL A CG1   1 
ATOM   1106 C  CG2   . VAL A 1 149 ? 39.196 -36.404 7.974   1.00 53.52  ? 146 VAL A CG2   1 
ATOM   1107 N  N     . ASP A 1 150 ? 39.226 -38.419 3.678   1.00 55.98  ? 147 ASP A N     1 
ATOM   1108 C  CA    . ASP A 1 150 ? 39.305 -39.583 2.835   1.00 55.99  ? 147 ASP A CA    1 
ATOM   1109 C  C     . ASP A 1 150 ? 40.167 -40.591 3.628   1.00 56.45  ? 147 ASP A C     1 
ATOM   1110 O  O     . ASP A 1 150 ? 41.238 -40.239 4.108   1.00 57.16  ? 147 ASP A O     1 
ATOM   1111 C  CB    . ASP A 1 150 ? 39.946 -39.257 1.493   1.00 58.73  ? 147 ASP A CB    1 
ATOM   1112 C  CG    . ASP A 1 150 ? 40.125 -40.502 0.663   1.00 59.30  ? 147 ASP A CG    1 
ATOM   1113 O  OD1   . ASP A 1 150 ? 39.094 -41.112 0.273   1.00 57.63  ? 147 ASP A OD1   1 
ATOM   1114 O  OD2   . ASP A 1 150 ? 41.280 -40.887 0.425   1.00 59.94  ? 147 ASP A OD2   1 
ATOM   1115 N  N     . GLY A 1 151 ? 39.668 -41.808 3.795   1.00 57.00  ? 148 GLY A N     1 
ATOM   1116 C  CA    . GLY A 1 151 ? 40.351 -42.833 4.564   1.00 56.21  ? 148 GLY A CA    1 
ATOM   1117 C  C     . GLY A 1 151 ? 41.709 -43.254 4.058   1.00 56.23  ? 148 GLY A C     1 
ATOM   1118 O  O     . GLY A 1 151 ? 42.629 -43.459 4.849   1.00 55.86  ? 148 GLY A O     1 
ATOM   1119 N  N     . MET A 1 152 ? 41.845 -43.428 2.755   1.00 54.46  ? 149 MET A N     1 
ATOM   1120 C  CA    . MET A 1 152 ? 43.108 -43.880 2.189   1.00 54.18  ? 149 MET A CA    1 
ATOM   1121 C  C     . MET A 1 152 ? 44.195 -42.831 2.330   1.00 53.91  ? 149 MET A C     1 
ATOM   1122 O  O     . MET A 1 152 ? 45.258 -43.102 2.890   1.00 54.12  ? 149 MET A O     1 
ATOM   1123 C  CB    . MET A 1 152 ? 42.914 -44.283 0.716   1.00 55.36  ? 149 MET A CB    1 
ATOM   1124 C  CG    . MET A 1 152 ? 44.122 -44.953 0.108   1.00 56.38  ? 149 MET A CG    1 
ATOM   1125 S  SD    . MET A 1 152 ? 45.405 -43.837 -0.518  1.00 60.22  ? 149 MET A SD    1 
ATOM   1126 C  CE    . MET A 1 152 ? 46.803 -44.478 0.273   1.00 55.20  ? 149 MET A CE    1 
ATOM   1127 N  N     . THR A 1 153 ? 43.921 -41.646 1.799   1.00 54.73  ? 150 THR A N     1 
ATOM   1128 C  CA    . THR A 1 153 ? 44.836 -40.533 1.731   1.00 54.90  ? 150 THR A CA    1 
ATOM   1129 C  C     . THR A 1 153 ? 44.977 -39.696 2.991   1.00 55.12  ? 150 THR A C     1 
ATOM   1130 O  O     . THR A 1 153 ? 46.084 -39.206 3.266   1.00 55.14  ? 150 THR A O     1 
ATOM   1131 C  CB    . THR A 1 153 ? 44.439 -39.622 0.563   1.00 47.89  ? 150 THR A CB    1 
ATOM   1132 O  OG1   . THR A 1 153 ? 43.181 -39.021 0.865   1.00 47.35  ? 150 THR A OG1   1 
ATOM   1133 C  CG2   . THR A 1 153 ? 44.379 -40.360 -0.792  1.00 48.74  ? 150 THR A CG2   1 
ATOM   1134 N  N     . GLY A 1 154 ? 43.873 -39.499 3.711   1.00 53.74  ? 151 GLY A N     1 
ATOM   1135 C  CA    . GLY A 1 154 ? 43.833 -38.616 4.861   1.00 54.34  ? 151 GLY A CA    1 
ATOM   1136 C  C     . GLY A 1 154 ? 43.514 -37.191 4.413   1.00 54.38  ? 151 GLY A C     1 
ATOM   1137 O  O     . GLY A 1 154 ? 43.496 -36.267 5.232   1.00 54.85  ? 151 GLY A O     1 
ATOM   1138 N  N     . PHE A 1 155 ? 43.265 -36.985 3.099   1.00 53.07  ? 152 PHE A N     1 
ATOM   1139 C  CA    . PHE A 1 155 ? 42.932 -35.685 2.514   1.00 52.07  ? 152 PHE A CA    1 
ATOM   1140 C  C     . PHE A 1 155 ? 41.603 -35.220 3.106   1.00 52.09  ? 152 PHE A C     1 
ATOM   1141 O  O     . PHE A 1 155 ? 40.618 -35.957 3.076   1.00 51.93  ? 152 PHE A O     1 
ATOM   1142 C  CB    . PHE A 1 155 ? 42.879 -35.782 0.987   1.00 52.60  ? 152 PHE A CB    1 
ATOM   1143 C  CG    . PHE A 1 155 ? 43.037 -34.472 0.267   1.00 49.55  ? 152 PHE A CG    1 
ATOM   1144 C  CD1   . PHE A 1 155 ? 41.931 -33.665 0.005   1.00 48.08  ? 152 PHE A CD1   1 
ATOM   1145 C  CD2   . PHE A 1 155 ? 44.288 -34.042 -0.159  1.00 48.05  ? 152 PHE A CD2   1 
ATOM   1146 C  CE1   . PHE A 1 155 ? 42.081 -32.447 -0.660  1.00 51.90  ? 152 PHE A CE1   1 
ATOM   1147 C  CE2   . PHE A 1 155 ? 44.434 -32.822 -0.828  1.00 49.04  ? 152 PHE A CE2   1 
ATOM   1148 C  CZ    . PHE A 1 155 ? 43.331 -32.038 -1.076  1.00 50.70  ? 152 PHE A CZ    1 
ATOM   1149 N  N     . THR A 1 156 ? 41.600 -33.999 3.663   1.00 52.23  ? 153 THR A N     1 
ATOM   1150 C  CA    . THR A 1 156 ? 40.497 -33.375 4.380   1.00 52.57  ? 153 THR A CA    1 
ATOM   1151 C  C     . THR A 1 156 ? 39.904 -32.179 3.684   1.00 52.75  ? 153 THR A C     1 
ATOM   1152 O  O     . THR A 1 156 ? 40.621 -31.373 3.090   1.00 53.42  ? 153 THR A O     1 
ATOM   1153 C  CB    . THR A 1 156 ? 41.026 -32.993 5.789   1.00 55.86  ? 153 THR A CB    1 
ATOM   1154 O  OG1   . THR A 1 156 ? 41.594 -34.154 6.379   1.00 57.49  ? 153 THR A OG1   1 
ATOM   1155 C  CG2   . THR A 1 156 ? 39.968 -32.455 6.718   1.00 55.86  ? 153 THR A CG2   1 
ATOM   1156 N  N     . TRP A 1 157 ? 38.585 -32.051 3.796   1.00 53.74  ? 154 TRP A N     1 
ATOM   1157 C  CA    . TRP A 1 157 ? 37.794 -30.947 3.267   1.00 54.61  ? 154 TRP A CA    1 
ATOM   1158 C  C     . TRP A 1 157 ? 37.059 -30.358 4.476   1.00 54.91  ? 154 TRP A C     1 
ATOM   1159 O  O     . TRP A 1 157 ? 36.463 -31.114 5.245   1.00 54.80  ? 154 TRP A O     1 
ATOM   1160 C  CB    . TRP A 1 157 ? 36.782 -31.450 2.229   1.00 53.67  ? 154 TRP A CB    1 
ATOM   1161 C  CG    . TRP A 1 157 ? 37.362 -31.863 0.909   1.00 55.02  ? 154 TRP A CG    1 
ATOM   1162 C  CD1   . TRP A 1 157 ? 37.501 -31.083 -0.198  1.00 56.89  ? 154 TRP A CD1   1 
ATOM   1163 C  CD2   . TRP A 1 157 ? 37.776 -33.184 0.525   1.00 55.01  ? 154 TRP A CD2   1 
ATOM   1164 N  NE1   . TRP A 1 157 ? 38.015 -31.822 -1.236  1.00 55.16  ? 154 TRP A NE1   1 
ATOM   1165 C  CE2   . TRP A 1 157 ? 38.206 -33.113 -0.817  1.00 56.36  ? 154 TRP A CE2   1 
ATOM   1166 C  CE3   . TRP A 1 157 ? 37.824 -34.422 1.185   1.00 55.71  ? 154 TRP A CE3   1 
ATOM   1167 C  CZ2   . TRP A 1 157 ? 38.686 -34.233 -1.512  1.00 55.39  ? 154 TRP A CZ2   1 
ATOM   1168 C  CZ3   . TRP A 1 157 ? 38.326 -35.528 0.504   1.00 57.56  ? 154 TRP A CZ3   1 
ATOM   1169 C  CH2   . TRP A 1 157 ? 38.758 -35.426 -0.824  1.00 56.05  ? 154 TRP A CH2   1 
ATOM   1170 N  N     . LEU A 1 158 ? 37.119 -29.020 4.649   1.00 56.36  ? 155 LEU A N     1 
ATOM   1171 C  CA    . LEU A 1 158 ? 36.507 -28.306 5.775   1.00 57.51  ? 155 LEU A CA    1 
ATOM   1172 C  C     . LEU A 1 158 ? 35.394 -27.375 5.345   1.00 58.24  ? 155 LEU A C     1 
ATOM   1173 O  O     . LEU A 1 158 ? 35.564 -26.615 4.389   1.00 57.91  ? 155 LEU A O     1 
ATOM   1174 C  CB    . LEU A 1 158 ? 37.571 -27.527 6.562   1.00 57.08  ? 155 LEU A CB    1 
ATOM   1175 C  CG    . LEU A 1 158 ? 38.736 -28.334 7.110   1.00 56.82  ? 155 LEU A CG    1 
ATOM   1176 C  CD1   . LEU A 1 158 ? 39.765 -27.422 7.770   1.00 57.13  ? 155 LEU A CD1   1 
ATOM   1177 C  CD2   . LEU A 1 158 ? 38.251 -29.407 8.050   1.00 55.82  ? 155 LEU A CD2   1 
ATOM   1178 N  N     . TYR A 1 159 ? 34.249 -27.426 6.055   1.00 59.81  ? 156 TYR A N     1 
ATOM   1179 C  CA    . TYR A 1 159 ? 33.083 -26.601 5.733   1.00 60.85  ? 156 TYR A CA    1 
ATOM   1180 C  C     . TYR A 1 159 ? 32.502 -25.940 6.969   1.00 61.46  ? 156 TYR A C     1 
ATOM   1181 O  O     . TYR A 1 159 ? 32.059 -26.646 7.890   1.00 61.61  ? 156 TYR A O     1 
ATOM   1182 C  CB    . TYR A 1 159 ? 31.986 -27.416 5.009   1.00 60.56  ? 156 TYR A CB    1 
ATOM   1183 C  CG    . TYR A 1 159 ? 32.482 -28.115 3.763   1.00 62.31  ? 156 TYR A CG    1 
ATOM   1184 C  CD1   . TYR A 1 159 ? 33.007 -29.408 3.824   1.00 62.16  ? 156 TYR A CD1   1 
ATOM   1185 C  CD2   . TYR A 1 159 ? 32.421 -27.491 2.519   1.00 62.14  ? 156 TYR A CD2   1 
ATOM   1186 C  CE1   . TYR A 1 159 ? 33.472 -30.052 2.681   1.00 63.33  ? 156 TYR A CE1   1 
ATOM   1187 C  CE2   . TYR A 1 159 ? 32.880 -28.129 1.367   1.00 60.45  ? 156 TYR A CE2   1 
ATOM   1188 C  CZ    . TYR A 1 159 ? 33.415 -29.405 1.456   1.00 63.20  ? 156 TYR A CZ    1 
ATOM   1189 O  OH    . TYR A 1 159 ? 33.890 -30.016 0.324   1.00 65.75  ? 156 TYR A OH    1 
ATOM   1190 N  N     . PRO A 1 160 ? 32.477 -24.580 7.006   1.00 62.75  ? 157 PRO A N     1 
ATOM   1191 C  CA    . PRO A 1 160 ? 31.860 -23.896 8.158   1.00 63.09  ? 157 PRO A CA    1 
ATOM   1192 C  C     . PRO A 1 160 ? 30.328 -24.031 8.082   1.00 63.93  ? 157 PRO A C     1 
ATOM   1193 O  O     . PRO A 1 160 ? 29.744 -23.868 6.995   1.00 64.14  ? 157 PRO A O     1 
ATOM   1194 C  CB    . PRO A 1 160 ? 32.303 -22.441 7.977   1.00 64.52  ? 157 PRO A CB    1 
ATOM   1195 C  CG    . PRO A 1 160 ? 32.470 -22.294 6.485   1.00 64.01  ? 157 PRO A CG    1 
ATOM   1196 C  CD    . PRO A 1 160 ? 32.951 -23.617 5.985   1.00 63.28  ? 157 PRO A CD    1 
ATOM   1197 N  N     . THR A 1 161 ? 29.673 -24.359 9.211   1.00 64.91  ? 158 THR A N     1 
ATOM   1198 C  CA    . THR A 1 161 ? 28.214 -24.480 9.239   1.00 65.12  ? 158 THR A CA    1 
ATOM   1199 C  C     . THR A 1 161 ? 27.638 -23.711 10.432  1.00 65.62  ? 158 THR A C     1 
ATOM   1200 O  O     . THR A 1 161 ? 28.353 -23.440 11.410  1.00 65.28  ? 158 THR A O     1 
ATOM   1201 C  CB    . THR A 1 161 ? 27.734 -25.950 9.226   1.00 65.57  ? 158 THR A CB    1 
ATOM   1202 O  OG1   . THR A 1 161 ? 27.946 -26.532 10.503  1.00 65.10  ? 158 THR A OG1   1 
ATOM   1203 C  CG2   . THR A 1 161 ? 28.371 -26.801 8.119   1.00 66.22  ? 158 THR A CG2   1 
ATOM   1204 N  N     . LYS A 1 162 ? 26.342 -23.381 10.364  1.00 66.78  ? 159 LYS A N     1 
ATOM   1205 C  CA    . LYS A 1 162 ? 25.653 -22.684 11.450  1.00 67.63  ? 159 LYS A CA    1 
ATOM   1206 C  C     . LYS A 1 162 ? 25.070 -23.687 12.477  1.00 67.75  ? 159 LYS A C     1 
ATOM   1207 O  O     . LYS A 1 162 ? 24.730 -23.302 13.602  1.00 68.30  ? 159 LYS A O     1 
ATOM   1208 C  CB    . LYS A 1 162 ? 24.598 -21.713 10.891  1.00 71.58  ? 159 LYS A CB    1 
ATOM   1209 C  CG    . LYS A 1 162 ? 25.231 -20.557 10.109  1.00 73.31  ? 159 LYS A CG    1 
ATOM   1210 C  CD    . LYS A 1 162 ? 24.228 -19.659 9.409   1.00 77.20  ? 159 LYS A CD    1 
ATOM   1211 C  CE    . LYS A 1 162 ? 24.909 -18.444 8.813   1.00 79.11  ? 159 LYS A CE    1 
ATOM   1212 N  NZ    . LYS A 1 162 ? 23.963 -17.610 8.023   1.00 82.33  ? 159 LYS A NZ    1 
ATOM   1213 N  N     . ALA A 1 163 ? 25.006 -24.984 12.106  1.00 64.61  ? 160 ALA A N     1 
ATOM   1214 C  CA    . ALA A 1 163 ? 24.488 -26.065 12.949  1.00 64.87  ? 160 ALA A CA    1 
ATOM   1215 C  C     . ALA A 1 163 ? 24.936 -27.426 12.423  1.00 65.04  ? 160 ALA A C     1 
ATOM   1216 O  O     . ALA A 1 163 ? 25.124 -27.553 11.210  1.00 64.92  ? 160 ALA A O     1 
ATOM   1217 C  CB    . ALA A 1 163 ? 22.963 -26.021 12.967  1.00 65.34  ? 160 ALA A CB    1 
ATOM   1218 N  N     . PRO A 1 164 ? 25.053 -28.475 13.281  1.00 62.53  ? 161 PRO A N     1 
ATOM   1219 C  CA    . PRO A 1 164 ? 25.405 -29.808 12.763  1.00 62.70  ? 161 PRO A CA    1 
ATOM   1220 C  C     . PRO A 1 164 ? 24.126 -30.506 12.219  1.00 62.67  ? 161 PRO A C     1 
ATOM   1221 O  O     . PRO A 1 164 ? 23.684 -31.544 12.739  1.00 62.37  ? 161 PRO A O     1 
ATOM   1222 C  CB    . PRO A 1 164 ? 25.983 -30.507 13.998  1.00 63.25  ? 161 PRO A CB    1 
ATOM   1223 C  CG    . PRO A 1 164 ? 25.264 -29.885 15.149  1.00 62.40  ? 161 PRO A CG    1 
ATOM   1224 C  CD    . PRO A 1 164 ? 24.842 -28.508 14.747  1.00 63.30  ? 161 PRO A CD    1 
ATOM   1225 N  N     . SER A 1 165 ? 23.531 -29.902 11.163  1.00 64.38  ? 162 SER A N     1 
ATOM   1226 C  CA    . SER A 1 165 ? 22.292 -30.307 10.493  1.00 64.71  ? 162 SER A CA    1 
ATOM   1227 C  C     . SER A 1 165 ? 22.485 -31.136 9.235   1.00 64.69  ? 162 SER A C     1 
ATOM   1228 O  O     . SER A 1 165 ? 23.545 -31.083 8.613   1.00 64.45  ? 162 SER A O     1 
ATOM   1229 C  CB    . SER A 1 165 ? 21.468 -29.069 10.138  1.00 66.02  ? 162 SER A CB    1 
ATOM   1230 O  OG    . SER A 1 165 ? 22.142 -28.227 9.215   1.00 67.27  ? 162 SER A OG    1 
ATOM   1231 N  N     . THR A 1 166 ? 21.427 -31.881 8.845   1.00 66.21  ? 163 THR A N     1 
ATOM   1232 C  CA    . THR A 1 166 ? 21.404 -32.694 7.634   1.00 66.38  ? 163 THR A CA    1 
ATOM   1233 C  C     . THR A 1 166 ? 21.510 -31.725 6.474   1.00 66.85  ? 163 THR A C     1 
ATOM   1234 O  O     . THR A 1 166 ? 22.310 -31.959 5.571   1.00 67.22  ? 163 THR A O     1 
ATOM   1235 C  CB    . THR A 1 166 ? 20.115 -33.522 7.560   1.00 66.93  ? 163 THR A CB    1 
ATOM   1236 O  OG1   . THR A 1 166 ? 20.074 -34.431 8.664   1.00 66.20  ? 163 THR A OG1   1 
ATOM   1237 C  CG2   . THR A 1 166 ? 19.982 -34.284 6.248   1.00 66.41  ? 163 THR A CG2   1 
ATOM   1238 N  N     . SER A 1 167 ? 20.740 -30.616 6.518   1.00 66.97  ? 164 SER A N     1 
ATOM   1239 C  CA    . SER A 1 167 ? 20.744 -29.613 5.468   1.00 67.00  ? 164 SER A CA    1 
ATOM   1240 C  C     . SER A 1 167 ? 22.120 -29.032 5.188   1.00 66.80  ? 164 SER A C     1 
ATOM   1241 O  O     . SER A 1 167 ? 22.482 -28.897 4.015   1.00 67.62  ? 164 SER A O     1 
ATOM   1242 C  CB    . SER A 1 167 ? 19.731 -28.518 5.751   1.00 70.93  ? 164 SER A CB    1 
ATOM   1243 O  OG    . SER A 1 167 ? 20.088 -27.820 6.926   1.00 72.86  ? 164 SER A OG    1 
ATOM   1244 N  N     . ALA A 1 168 ? 22.902 -28.702 6.235   1.00 66.26  ? 165 ALA A N     1 
ATOM   1245 C  CA    . ALA A 1 168 ? 24.247 -28.145 6.021   1.00 65.30  ? 165 ALA A CA    1 
ATOM   1246 C  C     . ALA A 1 168 ? 25.237 -29.232 5.543   1.00 64.95  ? 165 ALA A C     1 
ATOM   1247 O  O     . ALA A 1 168 ? 26.169 -28.915 4.789   1.00 64.88  ? 165 ALA A O     1 
ATOM   1248 C  CB    . ALA A 1 168 ? 24.748 -27.440 7.264   1.00 65.47  ? 165 ALA A CB    1 
ATOM   1249 N  N     . THR A 1 169 ? 25.005 -30.515 5.933   1.00 64.01  ? 166 THR A N     1 
ATOM   1250 C  CA    . THR A 1 169 ? 25.840 -31.633 5.502   1.00 64.18  ? 166 THR A CA    1 
ATOM   1251 C  C     . THR A 1 169 ? 25.634 -31.864 4.004   1.00 64.32  ? 166 THR A C     1 
ATOM   1252 O  O     . THR A 1 169 ? 26.607 -31.968 3.264   1.00 63.73  ? 166 THR A O     1 
ATOM   1253 C  CB    . THR A 1 169 ? 25.543 -32.880 6.308   1.00 65.90  ? 166 THR A CB    1 
ATOM   1254 O  OG1   . THR A 1 169 ? 25.561 -32.545 7.691   1.00 66.56  ? 166 THR A OG1   1 
ATOM   1255 C  CG2   . THR A 1 169 ? 26.545 -33.978 6.044   1.00 64.45  ? 166 THR A CG2   1 
ATOM   1256 N  N     . VAL A 1 170 ? 24.365 -31.915 3.564   1.00 64.76  ? 167 VAL A N     1 
ATOM   1257 C  CA    . VAL A 1 170 ? 23.956 -32.109 2.176   1.00 64.81  ? 167 VAL A CA    1 
ATOM   1258 C  C     . VAL A 1 170 ? 24.542 -30.991 1.294   1.00 65.41  ? 167 VAL A C     1 
ATOM   1259 O  O     . VAL A 1 170 ? 25.172 -31.302 0.289   1.00 65.58  ? 167 VAL A O     1 
ATOM   1260 C  CB    . VAL A 1 170 ? 22.407 -32.228 2.089   1.00 67.46  ? 167 VAL A CB    1 
ATOM   1261 C  CG1   . VAL A 1 170 ? 21.890 -31.974 0.676   1.00 65.44  ? 167 VAL A CG1   1 
ATOM   1262 C  CG2   . VAL A 1 170 ? 21.930 -33.582 2.618   1.00 65.80  ? 167 VAL A CG2   1 
ATOM   1263 N  N     . LYS A 1 171 ? 24.369 -29.711 1.686   1.00 66.56  ? 168 LYS A N     1 
ATOM   1264 C  CA    . LYS A 1 171 ? 24.893 -28.561 0.945   1.00 67.32  ? 168 LYS A CA    1 
ATOM   1265 C  C     . LYS A 1 171 ? 26.410 -28.687 0.730   1.00 67.23  ? 168 LYS A C     1 
ATOM   1266 O  O     . LYS A 1 171 ? 26.881 -28.516 -0.394  1.00 67.76  ? 168 LYS A O     1 
ATOM   1267 C  CB    . LYS A 1 171 ? 24.561 -27.233 1.661   1.00 71.82  ? 168 LYS A CB    1 
ATOM   1268 C  CG    . LYS A 1 171 ? 23.095 -26.817 1.559   1.00 75.02  ? 168 LYS A CG    1 
ATOM   1269 C  CD    . LYS A 1 171 ? 22.773 -25.577 2.419   1.00 78.86  ? 168 LYS A CD    1 
ATOM   1270 C  CE    . LYS A 1 171 ? 21.293 -25.216 2.410   1.00 80.91  ? 168 LYS A CE    1 
ATOM   1271 N  NZ    . LYS A 1 171 ? 20.978 -24.040 3.282   1.00 81.93  ? 168 LYS A NZ    1 
ATOM   1272 N  N     . SER A 1 172 ? 27.166 -29.005 1.810   1.00 66.63  ? 169 SER A N     1 
ATOM   1273 C  CA    . SER A 1 172 ? 28.623 -29.159 1.800   1.00 66.42  ? 169 SER A CA    1 
ATOM   1274 C  C     . SER A 1 172 ? 29.039 -30.323 0.935   1.00 66.09  ? 169 SER A C     1 
ATOM   1275 O  O     . SER A 1 172 ? 29.934 -30.153 0.110   1.00 65.84  ? 169 SER A O     1 
ATOM   1276 C  CB    . SER A 1 172 ? 29.164 -29.371 3.217   1.00 69.92  ? 169 SER A CB    1 
ATOM   1277 O  OG    . SER A 1 172 ? 28.781 -28.350 4.125   1.00 70.91  ? 169 SER A OG    1 
ATOM   1278 N  N     . LEU A 1 173 ? 28.404 -31.514 1.128   1.00 63.37  ? 170 LEU A N     1 
ATOM   1279 C  CA    . LEU A 1 173 ? 28.733 -32.736 0.389   1.00 63.55  ? 170 LEU A CA    1 
ATOM   1280 C  C     . LEU A 1 173 ? 28.383 -32.634 -1.099  1.00 64.13  ? 170 LEU A C     1 
ATOM   1281 O  O     . LEU A 1 173 ? 29.069 -33.257 -1.899  1.00 64.37  ? 170 LEU A O     1 
ATOM   1282 C  CB    . LEU A 1 173 ? 28.159 -34.012 1.041   1.00 63.20  ? 170 LEU A CB    1 
ATOM   1283 C  CG    . LEU A 1 173 ? 28.781 -34.430 2.400   1.00 62.58  ? 170 LEU A CG    1 
ATOM   1284 C  CD1   . LEU A 1 173 ? 28.059 -35.616 2.977   1.00 59.96  ? 170 LEU A CD1   1 
ATOM   1285 C  CD2   . LEU A 1 173 ? 30.256 -34.817 2.263   1.00 60.40  ? 170 LEU A CD2   1 
ATOM   1286 N  N     . ASN A 1 174 ? 27.389 -31.809 -1.480  1.00 61.17  ? 171 ASN A N     1 
ATOM   1287 C  CA    . ASN A 1 174 ? 27.048 -31.589 -2.884  1.00 61.87  ? 171 ASN A CA    1 
ATOM   1288 C  C     . ASN A 1 174 ? 28.183 -30.819 -3.580  1.00 61.82  ? 171 ASN A C     1 
ATOM   1289 O  O     . ASN A 1 174 ? 28.411 -31.029 -4.777  1.00 62.15  ? 171 ASN A O     1 
ATOM   1290 C  CB    . ASN A 1 174 ? 25.723 -30.870 -3.030  1.00 60.64  ? 171 ASN A CB    1 
ATOM   1291 C  CG    . ASN A 1 174 ? 24.520 -31.779 -2.907  1.00 60.11  ? 171 ASN A CG    1 
ATOM   1292 O  OD1   . ASN A 1 174 ? 24.600 -33.004 -3.082  1.00 61.29  ? 171 ASN A OD1   1 
ATOM   1293 N  ND2   . ASN A 1 174 ? 23.371 -31.193 -2.615  1.00 59.04  ? 171 ASN A ND2   1 
ATOM   1294 N  N     . VAL A 1 175 ? 28.928 -29.977 -2.817  1.00 59.55  ? 172 VAL A N     1 
ATOM   1295 C  CA    . VAL A 1 175 ? 30.093 -29.218 -3.303  1.00 59.53  ? 172 VAL A CA    1 
ATOM   1296 C  C     . VAL A 1 175 ? 31.279 -30.199 -3.417  1.00 59.60  ? 172 VAL A C     1 
ATOM   1297 O  O     . VAL A 1 175 ? 31.952 -30.236 -4.439  1.00 59.85  ? 172 VAL A O     1 
ATOM   1298 C  CB    . VAL A 1 175 ? 30.436 -27.984 -2.411  1.00 61.58  ? 172 VAL A CB    1 
ATOM   1299 C  CG1   . VAL A 1 175 ? 31.746 -27.328 -2.829  1.00 61.43  ? 172 VAL A CG1   1 
ATOM   1300 C  CG2   . VAL A 1 175 ? 29.311 -26.963 -2.416  1.00 60.94  ? 172 VAL A CG2   1 
ATOM   1301 N  N     . LEU A 1 176 ? 31.527 -30.987 -2.378  1.00 60.07  ? 173 LEU A N     1 
ATOM   1302 C  CA    . LEU A 1 176 ? 32.616 -31.955 -2.369  1.00 59.82  ? 173 LEU A CA    1 
ATOM   1303 C  C     . LEU A 1 176 ? 32.462 -32.975 -3.487  1.00 59.88  ? 173 LEU A C     1 
ATOM   1304 O  O     . LEU A 1 176 ? 33.412 -33.146 -4.263  1.00 59.38  ? 173 LEU A O     1 
ATOM   1305 C  CB    . LEU A 1 176 ? 32.671 -32.643 -0.989  1.00 58.55  ? 173 LEU A CB    1 
ATOM   1306 C  CG    . LEU A 1 176 ? 33.664 -33.780 -0.632  1.00 58.73  ? 173 LEU A CG    1 
ATOM   1307 C  CD1   . LEU A 1 176 ? 34.883 -33.828 -1.480  1.00 59.94  ? 173 LEU A CD1   1 
ATOM   1308 C  CD2   . LEU A 1 176 ? 34.062 -33.667 0.797   1.00 59.44  ? 173 LEU A CD2   1 
ATOM   1309 N  N     . THR A 1 177 ? 31.265 -33.629 -3.584  1.00 62.84  ? 174 THR A N     1 
ATOM   1310 C  CA    . THR A 1 177 ? 30.979 -34.690 -4.567  1.00 63.58  ? 174 THR A CA    1 
ATOM   1311 C  C     . THR A 1 177 ? 30.962 -34.194 -6.022  1.00 64.06  ? 174 THR A C     1 
ATOM   1312 O  O     . THR A 1 177 ? 30.703 -34.985 -6.904  1.00 64.31  ? 174 THR A O     1 
ATOM   1313 C  CB    . THR A 1 177 ? 29.721 -35.509 -4.209  1.00 67.77  ? 174 THR A CB    1 
ATOM   1314 O  OG1   . THR A 1 177 ? 28.562 -34.686 -4.274  1.00 68.13  ? 174 THR A OG1   1 
ATOM   1315 C  CG2   . THR A 1 177 ? 29.825 -36.205 -2.845  1.00 67.98  ? 174 THR A CG2   1 
ATOM   1316 N  N     . SER A 1 178 ? 31.290 -32.927 -6.284  1.00 64.05  ? 175 SER A N     1 
ATOM   1317 C  CA    . SER A 1 178 ? 31.394 -32.386 -7.638  1.00 64.04  ? 175 SER A CA    1 
ATOM   1318 C  C     . SER A 1 178 ? 32.746 -32.837 -8.178  1.00 63.54  ? 175 SER A C     1 
ATOM   1319 O  O     . SER A 1 178 ? 32.975 -32.757 -9.389  1.00 63.74  ? 175 SER A O     1 
ATOM   1320 C  CB    . SER A 1 178 ? 31.396 -30.861 -7.621  1.00 65.38  ? 175 SER A CB    1 
ATOM   1321 O  OG    . SER A 1 178 ? 30.266 -30.301 -6.982  1.00 68.39  ? 175 SER A OG    1 
ATOM   1322 N  N     . ILE A 1 179 ? 33.659 -33.265 -7.278  1.00 62.71  ? 176 ILE A N     1 
ATOM   1323 C  CA    . ILE A 1 179 ? 35.007 -33.716 -7.621  1.00 62.35  ? 176 ILE A CA    1 
ATOM   1324 C  C     . ILE A 1 179 ? 34.956 -35.209 -7.916  1.00 61.59  ? 176 ILE A C     1 
ATOM   1325 O  O     . ILE A 1 179 ? 35.346 -35.639 -9.006  1.00 60.65  ? 176 ILE A O     1 
ATOM   1326 C  CB    . ILE A 1 179 ? 36.080 -33.312 -6.543  1.00 65.01  ? 176 ILE A CB    1 
ATOM   1327 C  CG1   . ILE A 1 179 ? 36.125 -31.780 -6.301  1.00 66.74  ? 176 ILE A CG1   1 
ATOM   1328 C  CG2   . ILE A 1 179 ? 37.485 -33.812 -6.864  1.00 64.27  ? 176 ILE A CG2   1 
ATOM   1329 C  CD1   . ILE A 1 179 ? 35.949 -30.765 -7.564  1.00 67.36  ? 176 ILE A CD1   1 
ATOM   1330 N  N     . ALA A 1 180 ? 34.472 -35.993 -6.946  1.00 60.57  ? 177 ALA A N     1 
ATOM   1331 C  CA    . ALA A 1 180 ? 34.341 -37.439 -7.037  1.00 59.99  ? 177 ALA A CA    1 
ATOM   1332 C  C     . ALA A 1 180 ? 33.334 -37.890 -6.005  1.00 60.35  ? 177 ALA A C     1 
ATOM   1333 O  O     . ALA A 1 180 ? 33.132 -37.204 -4.997  1.00 60.66  ? 177 ALA A O     1 
ATOM   1334 C  CB    . ALA A 1 180 ? 35.686 -38.124 -6.803  1.00 60.17  ? 177 ALA A CB    1 
ATOM   1335 N  N     . ILE A 1 181 ? 32.687 -39.034 -6.275  1.00 60.90  ? 178 ILE A N     1 
ATOM   1336 C  CA    . ILE A 1 181 ? 31.696 -39.634 -5.403  1.00 61.12  ? 178 ILE A CA    1 
ATOM   1337 C  C     . ILE A 1 181 ? 32.324 -40.811 -4.647  1.00 60.55  ? 178 ILE A C     1 
ATOM   1338 O  O     . ILE A 1 181 ? 32.994 -41.654 -5.268  1.00 61.34  ? 178 ILE A O     1 
ATOM   1339 C  CB    . ILE A 1 181 ? 30.375 -39.960 -6.167  1.00 64.27  ? 178 ILE A CB    1 
ATOM   1340 C  CG1   . ILE A 1 181 ? 29.506 -38.682 -6.258  1.00 66.14  ? 178 ILE A CG1   1 
ATOM   1341 C  CG2   . ILE A 1 181 ? 29.595 -41.154 -5.569  1.00 64.10  ? 178 ILE A CG2   1 
ATOM   1342 C  CD1   . ILE A 1 181 ? 28.193 -38.812 -6.938  1.00 68.34  ? 178 ILE A CD1   1 
ATOM   1343 N  N     . PRO A 1 182 ? 32.138 -40.858 -3.295  1.00 60.91  ? 179 PRO A N     1 
ATOM   1344 C  CA    . PRO A 1 182 ? 32.712 -41.967 -2.513  1.00 60.67  ? 179 PRO A CA    1 
ATOM   1345 C  C     . PRO A 1 182 ? 31.856 -43.239 -2.575  1.00 60.94  ? 179 PRO A C     1 
ATOM   1346 O  O     . PRO A 1 182 ? 30.651 -43.131 -2.821  1.00 60.68  ? 179 PRO A O     1 
ATOM   1347 C  CB    . PRO A 1 182 ? 32.733 -41.394 -1.097  1.00 61.91  ? 179 PRO A CB    1 
ATOM   1348 C  CG    . PRO A 1 182 ? 31.504 -40.540 -1.048  1.00 61.95  ? 179 PRO A CG    1 
ATOM   1349 C  CD    . PRO A 1 182 ? 31.383 -39.926 -2.422  1.00 61.73  ? 179 PRO A CD    1 
ATOM   1350 N  N     . LYS A 1 183 ? 32.444 -44.436 -2.327  1.00 59.31  ? 180 LYS A N     1 
ATOM   1351 C  CA    . LYS A 1 183 ? 31.642 -45.670 -2.317  1.00 59.95  ? 180 LYS A CA    1 
ATOM   1352 C  C     . LYS A 1 183 ? 30.849 -45.674 -1.001  1.00 59.77  ? 180 LYS A C     1 
ATOM   1353 O  O     . LYS A 1 183 ? 29.635 -45.914 -0.987  1.00 59.91  ? 180 LYS A O     1 
ATOM   1354 C  CB    . LYS A 1 183 ? 32.511 -46.945 -2.365  1.00 60.54  ? 180 LYS A CB    1 
ATOM   1355 C  CG    . LYS A 1 183 ? 33.292 -47.201 -3.630  1.00 62.50  ? 180 LYS A CG    1 
ATOM   1356 C  CD    . LYS A 1 183 ? 34.255 -48.380 -3.398  1.00 64.85  ? 180 LYS A CD    1 
ATOM   1357 C  CE    . LYS A 1 183 ? 34.763 -49.069 -4.654  1.00 67.42  ? 180 LYS A CE    1 
ATOM   1358 N  NZ    . LYS A 1 183 ? 35.804 -48.282 -5.362  1.00 68.44  ? 180 LYS A NZ    1 
ATOM   1359 N  N     . VAL A 1 184 ? 31.560 -45.404 0.105   1.00 58.90  ? 181 VAL A N     1 
ATOM   1360 C  CA    . VAL A 1 184 ? 31.026 -45.379 1.465   1.00 58.12  ? 181 VAL A CA    1 
ATOM   1361 C  C     . VAL A 1 184 ? 31.368 -44.043 2.131   1.00 58.10  ? 181 VAL A C     1 
ATOM   1362 O  O     . VAL A 1 184 ? 32.420 -43.450 1.846   1.00 58.10  ? 181 VAL A O     1 
ATOM   1363 C  CB    . VAL A 1 184 ? 31.652 -46.542 2.303   1.00 60.44  ? 181 VAL A CB    1 
ATOM   1364 C  CG1   . VAL A 1 184 ? 31.079 -46.609 3.709   1.00 60.20  ? 181 VAL A CG1   1 
ATOM   1365 C  CG2   . VAL A 1 184 ? 31.538 -47.890 1.599   1.00 59.13  ? 181 VAL A CG2   1 
ATOM   1366 N  N     . ILE A 1 185 ? 30.473 -43.610 3.037   1.00 57.41  ? 182 ILE A N     1 
ATOM   1367 C  CA    . ILE A 1 185 ? 30.584 -42.471 3.916   1.00 57.62  ? 182 ILE A CA    1 
ATOM   1368 C  C     . ILE A 1 185 ? 30.360 -43.070 5.312   1.00 58.10  ? 182 ILE A C     1 
ATOM   1369 O  O     . ILE A 1 185 ? 29.269 -43.603 5.591   1.00 58.93  ? 182 ILE A O     1 
ATOM   1370 C  CB    . ILE A 1 185 ? 29.602 -41.323 3.604   1.00 59.22  ? 182 ILE A CB    1 
ATOM   1371 C  CG1   . ILE A 1 185 ? 30.133 -40.472 2.439   1.00 58.24  ? 182 ILE A CG1   1 
ATOM   1372 C  CG2   . ILE A 1 185 ? 29.393 -40.449 4.851   1.00 57.77  ? 182 ILE A CG2   1 
ATOM   1373 C  CD1   . ILE A 1 185 ? 29.233 -39.385 1.940   1.00 60.02  ? 182 ILE A CD1   1 
ATOM   1374 N  N     . HIS A 1 186 ? 31.400 -43.031 6.172   1.00 57.89  ? 183 HIS A N     1 
ATOM   1375 C  CA    . HIS A 1 186 ? 31.317 -43.525 7.544   1.00 57.41  ? 183 HIS A CA    1 
ATOM   1376 C  C     . HIS A 1 186 ? 31.090 -42.322 8.446   1.00 57.39  ? 183 HIS A C     1 
ATOM   1377 O  O     . HIS A 1 186 ? 31.806 -41.319 8.350   1.00 57.38  ? 183 HIS A O     1 
ATOM   1378 C  CB    . HIS A 1 186 ? 32.584 -44.292 7.988   1.00 57.18  ? 183 HIS A CB    1 
ATOM   1379 C  CG    . HIS A 1 186 ? 32.478 -44.879 9.369   1.00 58.33  ? 183 HIS A CG    1 
ATOM   1380 N  ND1   . HIS A 1 186 ? 32.515 -46.244 9.574   1.00 57.97  ? 183 HIS A ND1   1 
ATOM   1381 C  CD2   . HIS A 1 186 ? 32.323 -44.268 10.572  1.00 57.12  ? 183 HIS A CD2   1 
ATOM   1382 C  CE1   . HIS A 1 186 ? 32.399 -46.419 10.882  1.00 57.70  ? 183 HIS A CE1   1 
ATOM   1383 N  NE2   . HIS A 1 186 ? 32.265 -45.262 11.522  1.00 58.70  ? 183 HIS A NE2   1 
ATOM   1384 N  N     . SER A 1 187 ? 30.113 -42.424 9.329   1.00 56.18  ? 184 SER A N     1 
ATOM   1385 C  CA    . SER A 1 187 ? 29.851 -41.355 10.256  1.00 57.12  ? 184 SER A CA    1 
ATOM   1386 C  C     . SER A 1 187 ? 29.377 -41.925 11.575  1.00 57.37  ? 184 SER A C     1 
ATOM   1387 O  O     . SER A 1 187 ? 29.077 -43.125 11.660  1.00 57.65  ? 184 SER A O     1 
ATOM   1388 C  CB    . SER A 1 187 ? 28.821 -40.397 9.683   1.00 59.74  ? 184 SER A CB    1 
ATOM   1389 O  OG    . SER A 1 187 ? 27.507 -40.848 9.959   1.00 60.91  ? 184 SER A OG    1 
ATOM   1390 N  N     . ASP A 1 188 ? 29.314 -41.060 12.616  1.00 59.67  ? 185 ASP A N     1 
ATOM   1391 C  CA    . ASP A 1 188 ? 28.816 -41.451 13.933  1.00 59.85  ? 185 ASP A CA    1 
ATOM   1392 C  C     . ASP A 1 188 ? 27.273 -41.413 13.875  1.00 60.44  ? 185 ASP A C     1 
ATOM   1393 O  O     . ASP A 1 188 ? 26.715 -41.265 12.778  1.00 59.74  ? 185 ASP A O     1 
ATOM   1394 C  CB    . ASP A 1 188 ? 29.430 -40.609 15.093  1.00 63.06  ? 185 ASP A CB    1 
ATOM   1395 C  CG    . ASP A 1 188 ? 29.292 -39.085 15.067  1.00 62.19  ? 185 ASP A CG    1 
ATOM   1396 O  OD1   . ASP A 1 188 ? 28.271 -38.583 14.551  1.00 59.97  ? 185 ASP A OD1   1 
ATOM   1397 O  OD2   . ASP A 1 188 ? 30.191 -38.400 15.594  1.00 61.56  ? 185 ASP A OD2   1 
ATOM   1398 N  N     . GLN A 1 189 ? 26.586 -41.544 15.020  1.00 59.70  ? 186 GLN A N     1 
ATOM   1399 C  CA    . GLN A 1 189 ? 25.123 -41.540 14.989  1.00 59.87  ? 186 GLN A CA    1 
ATOM   1400 C  C     . GLN A 1 189 ? 24.511 -40.163 15.360  1.00 60.48  ? 186 GLN A C     1 
ATOM   1401 O  O     . GLN A 1 189 ? 23.412 -40.078 15.921  1.00 61.39  ? 186 GLN A O     1 
ATOM   1402 C  CB    . GLN A 1 189 ? 24.543 -42.702 15.800  1.00 60.61  ? 186 GLN A CB    1 
ATOM   1403 C  CG    . GLN A 1 189 ? 24.978 -44.061 15.225  1.00 60.62  ? 186 GLN A CG    1 
ATOM   1404 C  CD    . GLN A 1 189 ? 24.288 -45.249 15.842  1.00 60.66  ? 186 GLN A CD    1 
ATOM   1405 O  OE1   . GLN A 1 189 ? 23.205 -45.144 16.452  1.00 62.86  ? 186 GLN A OE1   1 
ATOM   1406 N  NE2   . GLN A 1 189 ? 24.897 -46.418 15.689  1.00 60.87  ? 186 GLN A NE2   1 
ATOM   1407 N  N     . GLY A 1 190 ? 25.214 -39.101 14.977  1.00 61.85  ? 187 GLY A N     1 
ATOM   1408 C  CA    . GLY A 1 190 ? 24.741 -37.746 15.179  1.00 62.54  ? 187 GLY A CA    1 
ATOM   1409 C  C     . GLY A 1 190 ? 23.500 -37.522 14.343  1.00 63.33  ? 187 GLY A C     1 
ATOM   1410 O  O     . GLY A 1 190 ? 23.404 -38.025 13.213  1.00 63.32  ? 187 GLY A O     1 
ATOM   1411 N  N     . ALA A 1 191 ? 22.524 -36.784 14.906  1.00 66.87  ? 188 ALA A N     1 
ATOM   1412 C  CA    . ALA A 1 191 ? 21.251 -36.444 14.253  1.00 66.72  ? 188 ALA A CA    1 
ATOM   1413 C  C     . ALA A 1 191 ? 21.405 -36.111 12.757  1.00 66.45  ? 188 ALA A C     1 
ATOM   1414 O  O     . ALA A 1 191 ? 20.649 -36.642 11.958  1.00 67.51  ? 188 ALA A O     1 
ATOM   1415 C  CB    . ALA A 1 191 ? 20.594 -35.284 14.982  1.00 67.30  ? 188 ALA A CB    1 
ATOM   1416 N  N     . ALA A 1 192 ? 22.395 -35.273 12.384  1.00 65.67  ? 189 ALA A N     1 
ATOM   1417 C  CA    . ALA A 1 192 ? 22.677 -34.850 11.006  1.00 65.48  ? 189 ALA A CA    1 
ATOM   1418 C  C     . ALA A 1 192 ? 22.832 -35.956 9.967   1.00 65.66  ? 189 ALA A C     1 
ATOM   1419 O  O     . ALA A 1 192 ? 22.471 -35.739 8.810   1.00 65.49  ? 189 ALA A O     1 
ATOM   1420 C  CB    . ALA A 1 192 ? 23.918 -33.981 10.974  1.00 66.09  ? 189 ALA A CB    1 
ATOM   1421 N  N     . PHE A 1 193 ? 23.371 -37.121 10.367  1.00 65.32  ? 190 PHE A N     1 
ATOM   1422 C  CA    . PHE A 1 193 ? 23.689 -38.249 9.480   1.00 65.27  ? 190 PHE A CA    1 
ATOM   1423 C  C     . PHE A 1 193 ? 22.732 -39.447 9.527   1.00 66.16  ? 190 PHE A C     1 
ATOM   1424 O  O     . PHE A 1 193 ? 22.747 -40.270 8.603   1.00 66.82  ? 190 PHE A O     1 
ATOM   1425 C  CB    . PHE A 1 193 ? 25.135 -38.732 9.764   1.00 65.58  ? 190 PHE A CB    1 
ATOM   1426 C  CG    . PHE A 1 193 ? 26.173 -37.655 10.035  1.00 65.22  ? 190 PHE A CG    1 
ATOM   1427 C  CD1   . PHE A 1 193 ? 26.401 -36.630 9.117   1.00 64.02  ? 190 PHE A CD1   1 
ATOM   1428 C  CD2   . PHE A 1 193 ? 26.934 -37.678 11.194  1.00 65.86  ? 190 PHE A CD2   1 
ATOM   1429 C  CE1   . PHE A 1 193 ? 27.340 -35.632 9.380   1.00 65.99  ? 190 PHE A CE1   1 
ATOM   1430 C  CE2   . PHE A 1 193 ? 27.897 -36.689 11.439  1.00 64.26  ? 190 PHE A CE2   1 
ATOM   1431 C  CZ    . PHE A 1 193 ? 28.092 -35.678 10.531  1.00 64.79  ? 190 PHE A CZ    1 
ATOM   1432 N  N     . THR A 1 194 ? 21.926 -39.560 10.600  1.00 67.90  ? 191 THR A N     1 
ATOM   1433 C  CA    . THR A 1 194 ? 20.977 -40.660 10.784  1.00 68.17  ? 191 THR A CA    1 
ATOM   1434 C  C     . THR A 1 194 ? 19.576 -40.317 10.245  1.00 68.58  ? 191 THR A C     1 
ATOM   1435 O  O     . THR A 1 194 ? 18.695 -41.182 10.232  1.00 69.00  ? 191 THR A O     1 
ATOM   1436 C  CB    . THR A 1 194 ? 20.956 -41.129 12.249  1.00 66.85  ? 191 THR A CB    1 
ATOM   1437 O  OG1   . THR A 1 194 ? 20.641 -40.027 13.088  1.00 68.19  ? 191 THR A OG1   1 
ATOM   1438 C  CG2   . THR A 1 194 ? 22.259 -41.776 12.684  1.00 65.78  ? 191 THR A CG2   1 
ATOM   1439 N  N     . SER A 1 195 ? 19.374 -39.073 9.788   1.00 69.35  ? 192 SER A N     1 
ATOM   1440 C  CA    . SER A 1 195 ? 18.090 -38.633 9.248   1.00 70.02  ? 192 SER A CA    1 
ATOM   1441 C  C     . SER A 1 195 ? 17.731 -39.369 7.946   1.00 70.57  ? 192 SER A C     1 
ATOM   1442 O  O     . SER A 1 195 ? 18.626 -39.834 7.219   1.00 70.36  ? 192 SER A O     1 
ATOM   1443 C  CB    . SER A 1 195 ? 18.102 -37.130 9.000   1.00 71.26  ? 192 SER A CB    1 
ATOM   1444 O  OG    . SER A 1 195 ? 18.943 -36.818 7.903   1.00 73.35  ? 192 SER A OG    1 
ATOM   1445 N  N     . SER A 1 196 ? 16.417 -39.458 7.651   1.00 70.85  ? 193 SER A N     1 
ATOM   1446 C  CA    . SER A 1 196 ? 15.904 -40.098 6.437   1.00 71.28  ? 193 SER A CA    1 
ATOM   1447 C  C     . SER A 1 196 ? 16.323 -39.277 5.208   1.00 70.97  ? 193 SER A C     1 
ATOM   1448 O  O     . SER A 1 196 ? 16.618 -39.863 4.158   1.00 70.97  ? 193 SER A O     1 
ATOM   1449 C  CB    . SER A 1 196 ? 14.386 -40.265 6.503   1.00 77.26  ? 193 SER A CB    1 
ATOM   1450 O  OG    . SER A 1 196 ? 13.774 -39.497 7.533   1.00 79.97  ? 193 SER A OG    1 
ATOM   1451 N  N     . THR A 1 197 ? 16.382 -37.922 5.361   1.00 67.49  ? 194 THR A N     1 
ATOM   1452 C  CA    . THR A 1 197 ? 16.785 -36.961 4.320   1.00 67.87  ? 194 THR A CA    1 
ATOM   1453 C  C     . THR A 1 197 ? 18.219 -37.225 3.868   1.00 68.61  ? 194 THR A C     1 
ATOM   1454 O  O     . THR A 1 197 ? 18.521 -37.092 2.688   1.00 69.19  ? 194 THR A O     1 
ATOM   1455 C  CB    . THR A 1 197 ? 16.605 -35.520 4.816   1.00 73.54  ? 194 THR A CB    1 
ATOM   1456 O  OG1   . THR A 1 197 ? 15.286 -35.355 5.338   1.00 74.63  ? 194 THR A OG1   1 
ATOM   1457 C  CG2   . THR A 1 197 ? 16.849 -34.486 3.727   1.00 73.28  ? 194 THR A CG2   1 
ATOM   1458 N  N     . PHE A 1 198 ? 19.098 -37.607 4.809   1.00 68.58  ? 195 PHE A N     1 
ATOM   1459 C  CA    . PHE A 1 198 ? 20.486 -37.919 4.506   1.00 68.05  ? 195 PHE A CA    1 
ATOM   1460 C  C     . PHE A 1 198 ? 20.582 -39.286 3.837   1.00 68.34  ? 195 PHE A C     1 
ATOM   1461 O  O     . PHE A 1 198 ? 21.353 -39.424 2.891   1.00 68.32  ? 195 PHE A O     1 
ATOM   1462 C  CB    . PHE A 1 198 ? 21.393 -37.800 5.750   1.00 67.93  ? 195 PHE A CB    1 
ATOM   1463 C  CG    . PHE A 1 198 ? 22.869 -37.820 5.423   1.00 66.37  ? 195 PHE A CG    1 
ATOM   1464 C  CD1   . PHE A 1 198 ? 23.459 -36.768 4.727   1.00 65.72  ? 195 PHE A CD1   1 
ATOM   1465 C  CD2   . PHE A 1 198 ? 23.665 -38.903 5.786   1.00 66.29  ? 195 PHE A CD2   1 
ATOM   1466 C  CE1   . PHE A 1 198 ? 24.824 -36.798 4.410   1.00 64.75  ? 195 PHE A CE1   1 
ATOM   1467 C  CE2   . PHE A 1 198 ? 25.026 -38.927 5.472   1.00 66.43  ? 195 PHE A CE2   1 
ATOM   1468 C  CZ    . PHE A 1 198 ? 25.599 -37.874 4.791   1.00 64.54  ? 195 PHE A CZ    1 
ATOM   1469 N  N     . ALA A 1 199 ? 19.795 -40.282 4.295   1.00 69.54  ? 196 ALA A N     1 
ATOM   1470 C  CA    . ALA A 1 199 ? 19.781 -41.629 3.706   1.00 70.30  ? 196 ALA A CA    1 
ATOM   1471 C  C     . ALA A 1 199 ? 19.339 -41.578 2.224   1.00 70.95  ? 196 ALA A C     1 
ATOM   1472 O  O     . ALA A 1 199 ? 19.910 -42.277 1.388   1.00 70.68  ? 196 ALA A O     1 
ATOM   1473 C  CB    . ALA A 1 199 ? 18.858 -42.528 4.501   1.00 70.50  ? 196 ALA A CB    1 
ATOM   1474 N  N     . GLU A 1 200 ? 18.330 -40.728 1.922   1.00 75.01  ? 197 GLU A N     1 
ATOM   1475 C  CA    . GLU A 1 200 ? 17.728 -40.463 0.609   1.00 76.59  ? 197 GLU A CA    1 
ATOM   1476 C  C     . GLU A 1 200 ? 18.790 -39.835 -0.291  1.00 75.75  ? 197 GLU A C     1 
ATOM   1477 O  O     . GLU A 1 200 ? 18.966 -40.265 -1.437  1.00 75.71  ? 197 GLU A O     1 
ATOM   1478 C  CB    . GLU A 1 200 ? 16.471 -39.553 0.790   1.00 79.66  ? 197 GLU A CB    1 
ATOM   1479 C  CG    . GLU A 1 200 ? 16.105 -38.601 -0.349  1.00 85.64  ? 197 GLU A CG    1 
ATOM   1480 C  CD    . GLU A 1 200 ? 15.494 -37.266 0.074   1.00 92.58  ? 197 GLU A CD    1 
ATOM   1481 O  OE1   . GLU A 1 200 ? 16.199 -36.228 -0.013  1.00 94.45  ? 197 GLU A OE1   1 
ATOM   1482 O  OE2   . GLU A 1 200 ? 14.311 -37.258 0.492   1.00 95.27  ? 197 GLU A OE2   1 
ATOM   1483 N  N     . TRP A 1 201 ? 19.508 -38.834 0.244   1.00 72.31  ? 198 TRP A N     1 
ATOM   1484 C  CA    . TRP A 1 201 ? 20.583 -38.123 -0.440  1.00 71.50  ? 198 TRP A CA    1 
ATOM   1485 C  C     . TRP A 1 201 ? 21.706 -39.103 -0.889  1.00 71.93  ? 198 TRP A C     1 
ATOM   1486 O  O     . TRP A 1 201 ? 22.238 -38.943 -1.990  1.00 72.26  ? 198 TRP A O     1 
ATOM   1487 C  CB    . TRP A 1 201 ? 21.120 -36.975 0.448   1.00 69.37  ? 198 TRP A CB    1 
ATOM   1488 C  CG    . TRP A 1 201 ? 22.287 -36.267 -0.160  1.00 66.67  ? 198 TRP A CG    1 
ATOM   1489 C  CD1   . TRP A 1 201 ? 22.248 -35.189 -0.994  1.00 65.07  ? 198 TRP A CD1   1 
ATOM   1490 C  CD2   . TRP A 1 201 ? 23.667 -36.649 -0.058  1.00 63.58  ? 198 TRP A CD2   1 
ATOM   1491 N  NE1   . TRP A 1 201 ? 23.519 -34.884 -1.431  1.00 62.15  ? 198 TRP A NE1   1 
ATOM   1492 C  CE2   . TRP A 1 201 ? 24.407 -35.770 -0.877  1.00 63.25  ? 198 TRP A CE2   1 
ATOM   1493 C  CE3   . TRP A 1 201 ? 24.348 -37.673 0.625   1.00 63.41  ? 198 TRP A CE3   1 
ATOM   1494 C  CZ2   . TRP A 1 201 ? 25.793 -35.864 -1.008  1.00 63.13  ? 198 TRP A CZ2   1 
ATOM   1495 C  CZ3   . TRP A 1 201 ? 25.721 -37.770 0.486   1.00 64.00  ? 198 TRP A CZ3   1 
ATOM   1496 C  CH2   . TRP A 1 201 ? 26.428 -36.873 -0.321  1.00 62.40  ? 198 TRP A CH2   1 
ATOM   1497 N  N     . ALA A 1 202 ? 22.043 -40.108 -0.055  1.00 69.88  ? 199 ALA A N     1 
ATOM   1498 C  CA    . ALA A 1 202 ? 23.086 -41.101 -0.339  1.00 70.50  ? 199 ALA A CA    1 
ATOM   1499 C  C     . ALA A 1 202 ? 22.649 -42.165 -1.353  1.00 70.90  ? 199 ALA A C     1 
ATOM   1500 O  O     . ALA A 1 202 ? 23.444 -42.536 -2.230  1.00 70.98  ? 199 ALA A O     1 
ATOM   1501 C  CB    . ALA A 1 202 ? 23.548 -41.764 0.948   1.00 70.71  ? 199 ALA A CB    1 
ATOM   1502 N  N     . LYS A 1 203 ? 21.389 -42.665 -1.217  1.00 71.55  ? 200 LYS A N     1 
ATOM   1503 C  CA    . LYS A 1 203 ? 20.764 -43.673 -2.081  1.00 72.35  ? 200 LYS A CA    1 
ATOM   1504 C  C     . LYS A 1 203 ? 20.781 -43.131 -3.513  1.00 71.94  ? 200 LYS A C     1 
ATOM   1505 O  O     . LYS A 1 203 ? 21.254 -43.807 -4.430  1.00 72.20  ? 200 LYS A O     1 
ATOM   1506 C  CB    . LYS A 1 203 ? 19.325 -43.950 -1.609  1.00 74.94  ? 200 LYS A CB    1 
ATOM   1507 C  CG    . LYS A 1 203 ? 18.789 -45.333 -1.965  1.00 77.60  ? 200 LYS A CG    1 
ATOM   1508 C  CD    . LYS A 1 203 ? 17.262 -45.409 -1.767  1.00 81.93  ? 200 LYS A CD    1 
ATOM   1509 C  CE    . LYS A 1 203 ? 16.625 -46.624 -2.416  1.00 84.40  ? 200 LYS A CE    1 
ATOM   1510 N  NZ    . LYS A 1 203 ? 16.463 -47.776 -1.473  1.00 87.01  ? 200 LYS A NZ    1 
ATOM   1511 N  N     . GLU A 1 204 ? 20.332 -41.876 -3.675  1.00 71.31  ? 201 GLU A N     1 
ATOM   1512 C  CA    . GLU A 1 204 ? 20.293 -41.147 -4.928  1.00 71.11  ? 201 GLU A CA    1 
ATOM   1513 C  C     . GLU A 1 204 ? 21.633 -41.129 -5.635  1.00 70.32  ? 201 GLU A C     1 
ATOM   1514 O  O     . GLU A 1 204 ? 21.654 -40.943 -6.851  1.00 70.77  ? 201 GLU A O     1 
ATOM   1515 C  CB    . GLU A 1 204 ? 19.941 -39.697 -4.636  1.00 73.52  ? 201 GLU A CB    1 
ATOM   1516 C  CG    . GLU A 1 204 ? 18.463 -39.415 -4.639  1.00 77.58  ? 201 GLU A CG    1 
ATOM   1517 C  CD    . GLU A 1 204 ? 18.093 -37.959 -4.420  1.00 83.00  ? 201 GLU A CD    1 
ATOM   1518 O  OE1   . GLU A 1 204 ? 18.899 -37.064 -4.775  1.00 83.90  ? 201 GLU A OE1   1 
ATOM   1519 O  OE2   . GLU A 1 204 ? 16.981 -37.715 -3.891  1.00 85.71  ? 201 GLU A OE2   1 
ATOM   1520 N  N     . ARG A 1 205 ? 22.751 -41.285 -4.890  1.00 67.04  ? 202 ARG A N     1 
ATOM   1521 C  CA    . ARG A 1 205 ? 24.115 -41.195 -5.429  1.00 65.87  ? 202 ARG A CA    1 
ATOM   1522 C  C     . ARG A 1 205 ? 24.936 -42.493 -5.411  1.00 65.44  ? 202 ARG A C     1 
ATOM   1523 O  O     . ARG A 1 205 ? 26.106 -42.478 -5.809  1.00 65.62  ? 202 ARG A O     1 
ATOM   1524 C  CB    . ARG A 1 205 ? 24.886 -40.077 -4.692  1.00 64.57  ? 202 ARG A CB    1 
ATOM   1525 C  CG    . ARG A 1 205 ? 24.487 -38.675 -5.098  1.00 63.42  ? 202 ARG A CG    1 
ATOM   1526 C  CD    . ARG A 1 205 ? 24.656 -37.649 -3.996  1.00 61.20  ? 202 ARG A CD    1 
ATOM   1527 N  NE    . ARG A 1 205 ? 24.164 -36.342 -4.441  1.00 60.70  ? 202 ARG A NE    1 
ATOM   1528 C  CZ    . ARG A 1 205 ? 22.881 -35.978 -4.424  1.00 61.10  ? 202 ARG A CZ    1 
ATOM   1529 N  NH1   . ARG A 1 205 ? 21.954 -36.801 -3.949  1.00 60.94  ? 202 ARG A NH1   1 
ATOM   1530 N  NH2   . ARG A 1 205 ? 22.519 -34.786 -4.872  1.00 61.64  ? 202 ARG A NH2   1 
ATOM   1531 N  N     . GLY A 1 206 ? 24.338 -43.595 -4.986  1.00 62.33  ? 203 GLY A N     1 
ATOM   1532 C  CA    . GLY A 1 206 ? 25.032 -44.876 -4.934  1.00 62.09  ? 203 GLY A CA    1 
ATOM   1533 C  C     . GLY A 1 206 ? 25.975 -44.994 -3.755  1.00 62.09  ? 203 GLY A C     1 
ATOM   1534 O  O     . GLY A 1 206 ? 26.748 -45.953 -3.665  1.00 62.16  ? 203 GLY A O     1 
ATOM   1535 N  N     . ILE A 1 207 ? 25.901 -44.023 -2.827  1.00 64.84  ? 204 ILE A N     1 
ATOM   1536 C  CA    . ILE A 1 207 ? 26.753 -43.946 -1.645  1.00 63.79  ? 204 ILE A CA    1 
ATOM   1537 C  C     . ILE A 1 207 ? 26.189 -44.815 -0.523  1.00 63.49  ? 204 ILE A C     1 
ATOM   1538 O  O     . ILE A 1 207 ? 25.018 -44.655 -0.167  1.00 63.08  ? 204 ILE A O     1 
ATOM   1539 C  CB    . ILE A 1 207 ? 26.960 -42.446 -1.210  1.00 66.34  ? 204 ILE A CB    1 
ATOM   1540 C  CG1   . ILE A 1 207 ? 27.543 -41.585 -2.365  1.00 64.76  ? 204 ILE A CG1   1 
ATOM   1541 C  CG2   . ILE A 1 207 ? 27.812 -42.328 0.063   1.00 65.05  ? 204 ILE A CG2   1 
ATOM   1542 C  CD1   . ILE A 1 207 ? 27.551 -40.069 -2.127  1.00 61.78  ? 204 ILE A CD1   1 
ATOM   1543 N  N     . HIS A 1 208 ? 27.016 -45.727 0.035   1.00 63.72  ? 205 HIS A N     1 
ATOM   1544 C  CA    . HIS A 1 208 ? 26.594 -46.559 1.159   1.00 64.23  ? 205 HIS A CA    1 
ATOM   1545 C  C     . HIS A 1 208 ? 26.936 -45.852 2.496   1.00 63.91  ? 205 HIS A C     1 
ATOM   1546 O  O     . HIS A 1 208 ? 28.067 -45.428 2.702   1.00 63.67  ? 205 HIS A O     1 
ATOM   1547 C  CB    . HIS A 1 208 ? 27.205 -47.985 1.126   1.00 66.43  ? 205 HIS A CB    1 
ATOM   1548 C  CG    . HIS A 1 208 ? 26.727 -48.836 2.281   1.00 70.72  ? 205 HIS A CG    1 
ATOM   1549 N  ND1   . HIS A 1 208 ? 27.575 -49.179 3.335   1.00 72.87  ? 205 HIS A ND1   1 
ATOM   1550 C  CD2   . HIS A 1 208 ? 25.486 -49.319 2.553   1.00 72.21  ? 205 HIS A CD2   1 
ATOM   1551 C  CE1   . HIS A 1 208 ? 26.834 -49.886 4.184   1.00 73.44  ? 205 HIS A CE1   1 
ATOM   1552 N  NE2   . HIS A 1 208 ? 25.574 -49.996 3.761   1.00 73.04  ? 205 HIS A NE2   1 
ATOM   1553 N  N     . LEU A 1 209 ? 25.959 -45.726 3.379   1.00 60.98  ? 206 LEU A N     1 
ATOM   1554 C  CA    . LEU A 1 209 ? 26.170 -45.115 4.687   1.00 61.20  ? 206 LEU A CA    1 
ATOM   1555 C  C     . LEU A 1 209 ? 26.499 -46.223 5.664   1.00 61.50  ? 206 LEU A C     1 
ATOM   1556 O  O     . LEU A 1 209 ? 25.780 -47.226 5.762   1.00 62.18  ? 206 LEU A O     1 
ATOM   1557 C  CB    . LEU A 1 209 ? 24.965 -44.304 5.201   1.00 58.76  ? 206 LEU A CB    1 
ATOM   1558 C  CG    . LEU A 1 209 ? 24.494 -43.109 4.388   1.00 59.56  ? 206 LEU A CG    1 
ATOM   1559 C  CD1   . LEU A 1 209 ? 23.437 -42.389 5.113   1.00 58.54  ? 206 LEU A CD1   1 
ATOM   1560 C  CD2   . LEU A 1 209 ? 25.632 -42.152 4.020   1.00 57.74  ? 206 LEU A CD2   1 
ATOM   1561 N  N     . GLU A 1 210 ? 27.609 -46.047 6.362   1.00 63.31  ? 207 GLU A N     1 
ATOM   1562 C  CA    . GLU A 1 210 ? 28.108 -46.973 7.358   1.00 63.06  ? 207 GLU A CA    1 
ATOM   1563 C  C     . GLU A 1 210 ? 28.132 -46.125 8.600   1.00 62.20  ? 207 GLU A C     1 
ATOM   1564 O  O     . GLU A 1 210 ? 28.557 -44.971 8.527   1.00 61.47  ? 207 GLU A O     1 
ATOM   1565 C  CB    . GLU A 1 210 ? 29.505 -47.411 6.951   1.00 64.40  ? 207 GLU A CB    1 
ATOM   1566 C  CG    . GLU A 1 210 ? 30.160 -48.388 7.880   1.00 66.33  ? 207 GLU A CG    1 
ATOM   1567 C  CD    . GLU A 1 210 ? 31.493 -48.764 7.295   1.00 69.94  ? 207 GLU A CD    1 
ATOM   1568 O  OE1   . GLU A 1 210 ? 31.572 -49.839 6.658   1.00 73.09  ? 207 GLU A OE1   1 
ATOM   1569 O  OE2   . GLU A 1 210 ? 32.452 -47.975 7.445   1.00 72.62  ? 207 GLU A OE2   1 
ATOM   1570 N  N     . PHE A 1 211 ? 27.615 -46.660 9.711   1.00 61.54  ? 208 PHE A N     1 
ATOM   1571 C  CA    . PHE A 1 211 ? 27.517 -45.957 10.986  1.00 60.29  ? 208 PHE A CA    1 
ATOM   1572 C  C     . PHE A 1 211 ? 28.352 -46.584 12.084  1.00 59.23  ? 208 PHE A C     1 
ATOM   1573 O  O     . PHE A 1 211 ? 28.461 -47.806 12.150  1.00 58.74  ? 208 PHE A O     1 
ATOM   1574 C  CB    . PHE A 1 211 ? 26.052 -45.861 11.424  1.00 60.76  ? 208 PHE A CB    1 
ATOM   1575 C  CG    . PHE A 1 211 ? 25.213 -44.992 10.523  1.00 61.35  ? 208 PHE A CG    1 
ATOM   1576 C  CD1   . PHE A 1 211 ? 25.205 -43.605 10.675  1.00 60.00  ? 208 PHE A CD1   1 
ATOM   1577 C  CD2   . PHE A 1 211 ? 24.435 -45.553 9.513   1.00 61.37  ? 208 PHE A CD2   1 
ATOM   1578 C  CE1   . PHE A 1 211 ? 24.425 -42.797 9.825   1.00 62.12  ? 208 PHE A CE1   1 
ATOM   1579 C  CE2   . PHE A 1 211 ? 23.662 -44.743 8.664   1.00 59.71  ? 208 PHE A CE2   1 
ATOM   1580 C  CZ    . PHE A 1 211 ? 23.672 -43.375 8.816   1.00 60.61  ? 208 PHE A CZ    1 
ATOM   1581 N  N     . SER A 1 212 ? 28.957 -45.752 12.946  1.00 60.45  ? 209 SER A N     1 
ATOM   1582 C  CA    . SER A 1 212 ? 29.767 -46.230 14.083  1.00 59.46  ? 209 SER A CA    1 
ATOM   1583 C  C     . SER A 1 212 ? 28.811 -46.803 15.123  1.00 58.24  ? 209 SER A C     1 
ATOM   1584 O  O     . SER A 1 212 ? 27.632 -46.426 15.127  1.00 56.62  ? 209 SER A O     1 
ATOM   1585 C  CB    . SER A 1 212 ? 30.479 -45.054 14.751  1.00 62.35  ? 209 SER A CB    1 
ATOM   1586 O  OG    . SER A 1 212 ? 31.651 -44.619 14.090  1.00 64.61  ? 209 SER A OG    1 
ATOM   1587 N  N     . THR A 1 213 ? 29.314 -47.662 16.036  1.00 57.98  ? 210 THR A N     1 
ATOM   1588 C  CA    . THR A 1 213 ? 28.506 -48.183 17.147  1.00 58.11  ? 210 THR A CA    1 
ATOM   1589 C  C     . THR A 1 213 ? 28.204 -46.931 18.007  1.00 58.27  ? 210 THR A C     1 
ATOM   1590 O  O     . THR A 1 213 ? 29.000 -45.986 17.954  1.00 57.26  ? 210 THR A O     1 
ATOM   1591 C  CB    . THR A 1 213 ? 29.215 -49.334 17.843  1.00 60.36  ? 210 THR A CB    1 
ATOM   1592 O  OG1   . THR A 1 213 ? 30.566 -48.965 18.134  1.00 60.10  ? 210 THR A OG1   1 
ATOM   1593 C  CG2   . THR A 1 213 ? 29.182 -50.611 17.011  1.00 60.16  ? 210 THR A CG2   1 
ATOM   1594 N  N     . PRO A 1 214 ? 27.064 -46.786 18.712  1.00 59.46  ? 211 PRO A N     1 
ATOM   1595 C  CA    . PRO A 1 214 ? 26.818 -45.494 19.392  1.00 59.11  ? 211 PRO A CA    1 
ATOM   1596 C  C     . PRO A 1 214 ? 27.741 -45.197 20.564  1.00 58.76  ? 211 PRO A C     1 
ATOM   1597 O  O     . PRO A 1 214 ? 28.189 -46.121 21.258  1.00 58.18  ? 211 PRO A O     1 
ATOM   1598 C  CB    . PRO A 1 214 ? 25.350 -45.574 19.795  1.00 60.12  ? 211 PRO A CB    1 
ATOM   1599 C  CG    . PRO A 1 214 ? 25.088 -47.043 19.918  1.00 61.48  ? 211 PRO A CG    1 
ATOM   1600 C  CD    . PRO A 1 214 ? 25.946 -47.730 18.912  1.00 60.84  ? 211 PRO A CD    1 
ATOM   1601 N  N     . TYR A 1 215 ? 28.029 -43.886 20.765  1.00 58.22  ? 212 TYR A N     1 
ATOM   1602 C  CA    . TYR A 1 215 ? 28.877 -43.339 21.843  1.00 59.63  ? 212 TYR A CA    1 
ATOM   1603 C  C     . TYR A 1 215 ? 30.251 -44.009 21.923  1.00 60.21  ? 212 TYR A C     1 
ATOM   1604 O  O     . TYR A 1 215 ? 30.702 -44.408 22.999  1.00 60.67  ? 212 TYR A O     1 
ATOM   1605 C  CB    . TYR A 1 215 ? 28.151 -43.377 23.191  1.00 63.00  ? 212 TYR A CB    1 
ATOM   1606 C  CG    . TYR A 1 215 ? 26.738 -42.849 23.131  1.00 63.12  ? 212 TYR A CG    1 
ATOM   1607 C  CD1   . TYR A 1 215 ? 26.480 -41.483 23.191  1.00 62.06  ? 212 TYR A CD1   1 
ATOM   1608 C  CD2   . TYR A 1 215 ? 25.655 -43.717 23.018  1.00 60.80  ? 212 TYR A CD2   1 
ATOM   1609 C  CE1   . TYR A 1 215 ? 25.177 -40.990 23.164  1.00 61.22  ? 212 TYR A CE1   1 
ATOM   1610 C  CE2   . TYR A 1 215 ? 24.346 -43.239 22.973  1.00 61.11  ? 212 TYR A CE2   1 
ATOM   1611 C  CZ    . TYR A 1 215 ? 24.109 -41.872 23.046  1.00 64.74  ? 212 TYR A CZ    1 
ATOM   1612 O  OH    . TYR A 1 215 ? 22.805 -41.402 23.005  1.00 68.34  ? 212 TYR A OH    1 
ATOM   1613 N  N     . HIS A 1 216 ? 30.894 -44.144 20.755  1.00 55.64  ? 213 HIS A N     1 
ATOM   1614 C  CA    . HIS A 1 216 ? 32.198 -44.759 20.593  1.00 55.66  ? 213 HIS A CA    1 
ATOM   1615 C  C     . HIS A 1 216 ? 32.930 -43.996 19.479  1.00 55.80  ? 213 HIS A C     1 
ATOM   1616 O  O     . HIS A 1 216 ? 33.050 -44.497 18.357  1.00 56.08  ? 213 HIS A O     1 
ATOM   1617 C  CB    . HIS A 1 216 ? 32.051 -46.262 20.282  1.00 54.92  ? 213 HIS A CB    1 
ATOM   1618 C  CG    . HIS A 1 216 ? 33.333 -46.999 20.404  1.00 54.37  ? 213 HIS A CG    1 
ATOM   1619 N  ND1   . HIS A 1 216 ? 33.947 -47.542 19.301  1.00 52.82  ? 213 HIS A ND1   1 
ATOM   1620 C  CD2   . HIS A 1 216 ? 34.105 -47.217 21.495  1.00 51.81  ? 213 HIS A CD2   1 
ATOM   1621 C  CE1   . HIS A 1 216 ? 35.057 -48.105 19.748  1.00 51.04  ? 213 HIS A CE1   1 
ATOM   1622 N  NE2   . HIS A 1 216 ? 35.204 -47.911 21.063  1.00 53.47  ? 213 HIS A NE2   1 
ATOM   1623 N  N     . PRO A 1 217 ? 33.416 -42.756 19.775  1.00 54.93  ? 214 PRO A N     1 
ATOM   1624 C  CA    . PRO A 1 217 ? 34.063 -41.954 18.724  1.00 54.49  ? 214 PRO A CA    1 
ATOM   1625 C  C     . PRO A 1 217 ? 35.379 -42.529 18.174  1.00 54.66  ? 214 PRO A C     1 
ATOM   1626 O  O     . PRO A 1 217 ? 35.816 -42.101 17.111  1.00 54.90  ? 214 PRO A O     1 
ATOM   1627 C  CB    . PRO A 1 217 ? 34.202 -40.587 19.362  1.00 56.43  ? 214 PRO A CB    1 
ATOM   1628 C  CG    . PRO A 1 217 ? 34.172 -40.835 20.836  1.00 55.01  ? 214 PRO A CG    1 
ATOM   1629 C  CD    . PRO A 1 217 ? 33.323 -42.011 21.051  1.00 55.45  ? 214 PRO A CD    1 
ATOM   1630 N  N     . GLN A 1 218 ? 35.959 -43.544 18.832  1.00 53.65  ? 215 GLN A N     1 
ATOM   1631 C  CA    . GLN A 1 218 ? 37.161 -44.241 18.367  1.00 54.30  ? 215 GLN A CA    1 
ATOM   1632 C  C     . GLN A 1 218 ? 36.867 -44.912 17.023  1.00 54.52  ? 215 GLN A C     1 
ATOM   1633 O  O     . GLN A 1 218 ? 37.793 -45.159 16.235  1.00 54.42  ? 215 GLN A O     1 
ATOM   1634 C  CB    . GLN A 1 218 ? 37.550 -45.347 19.354  1.00 54.44  ? 215 GLN A CB    1 
ATOM   1635 C  CG    . GLN A 1 218 ? 38.039 -44.827 20.690  1.00 57.01  ? 215 GLN A CG    1 
ATOM   1636 C  CD    . GLN A 1 218 ? 36.958 -44.712 21.728  1.00 59.49  ? 215 GLN A CD    1 
ATOM   1637 O  OE1   . GLN A 1 218 ? 35.943 -44.029 21.561  1.00 59.62  ? 215 GLN A OE1   1 
ATOM   1638 N  NE2   . GLN A 1 218 ? 37.170 -45.375 22.848  1.00 65.66  ? 215 GLN A NE2   1 
ATOM   1639 N  N     . SER A 1 219 ? 35.575 -45.244 16.777  1.00 54.67  ? 216 SER A N     1 
ATOM   1640 C  CA    . SER A 1 219 ? 35.114 -45.904 15.554  1.00 54.44  ? 216 SER A CA    1 
ATOM   1641 C  C     . SER A 1 219 ? 35.291 -44.977 14.374  1.00 54.54  ? 216 SER A C     1 
ATOM   1642 O  O     . SER A 1 219 ? 35.692 -45.424 13.299  1.00 54.10  ? 216 SER A O     1 
ATOM   1643 C  CB    . SER A 1 219 ? 33.692 -46.398 15.717  1.00 52.48  ? 216 SER A CB    1 
ATOM   1644 O  OG    . SER A 1 219 ? 33.714 -47.479 16.629  1.00 50.80  ? 216 SER A OG    1 
ATOM   1645 N  N     . SER A 1 220 ? 35.086 -43.668 14.604  1.00 54.63  ? 217 SER A N     1 
ATOM   1646 C  CA    . SER A 1 220 ? 35.326 -42.611 13.623  1.00 54.33  ? 217 SER A CA    1 
ATOM   1647 C  C     . SER A 1 220 ? 36.787 -42.046 13.802  1.00 54.44  ? 217 SER A C     1 
ATOM   1648 O  O     . SER A 1 220 ? 37.083 -40.949 13.339  1.00 54.64  ? 217 SER A O     1 
ATOM   1649 C  CB    . SER A 1 220 ? 34.306 -41.501 13.808  1.00 55.52  ? 217 SER A CB    1 
ATOM   1650 O  OG    . SER A 1 220 ? 33.114 -41.864 13.150  1.00 57.18  ? 217 SER A OG    1 
ATOM   1651 N  N     . GLY A 1 221 ? 37.662 -42.827 14.448  1.00 56.40  ? 218 GLY A N     1 
ATOM   1652 C  CA    . GLY A 1 221 ? 39.056 -42.512 14.757  1.00 56.82  ? 218 GLY A CA    1 
ATOM   1653 C  C     . GLY A 1 221 ? 39.793 -41.681 13.733  1.00 57.57  ? 218 GLY A C     1 
ATOM   1654 O  O     . GLY A 1 221 ? 40.458 -40.704 14.093  1.00 57.02  ? 218 GLY A O     1 
ATOM   1655 N  N     . LYS A 1 222 ? 39.650 -42.053 12.437  1.00 57.51  ? 219 LYS A N     1 
ATOM   1656 C  CA    . LYS A 1 222 ? 40.255 -41.359 11.314  1.00 57.21  ? 219 LYS A CA    1 
ATOM   1657 C  C     . LYS A 1 222 ? 39.900 -39.872 11.274  1.00 56.17  ? 219 LYS A C     1 
ATOM   1658 O  O     . LYS A 1 222 ? 40.807 -39.057 11.199  1.00 55.77  ? 219 LYS A O     1 
ATOM   1659 C  CB    . LYS A 1 222 ? 39.931 -42.069 9.999   1.00 58.41  ? 219 LYS A CB    1 
ATOM   1660 C  CG    . LYS A 1 222 ? 41.050 -42.975 9.579   1.00 60.44  ? 219 LYS A CG    1 
ATOM   1661 C  CD    . LYS A 1 222 ? 41.526 -42.599 8.204   1.00 63.37  ? 219 LYS A CD    1 
ATOM   1662 C  CE    . LYS A 1 222 ? 42.978 -42.962 7.938   1.00 66.70  ? 219 LYS A CE    1 
ATOM   1663 N  NZ    . LYS A 1 222 ? 43.219 -44.426 7.882   1.00 63.13  ? 219 LYS A NZ    1 
ATOM   1664 N  N     . VAL A 1 223 ? 38.615 -39.514 11.323  1.00 56.09  ? 220 VAL A N     1 
ATOM   1665 C  CA    . VAL A 1 223 ? 38.196 -38.101 11.292  1.00 55.34  ? 220 VAL A CA    1 
ATOM   1666 C  C     . VAL A 1 223 ? 38.441 -37.418 12.652  1.00 54.92  ? 220 VAL A C     1 
ATOM   1667 O  O     . VAL A 1 223 ? 38.796 -36.235 12.689  1.00 55.44  ? 220 VAL A O     1 
ATOM   1668 C  CB    . VAL A 1 223 ? 36.735 -37.909 10.774  1.00 57.36  ? 220 VAL A CB    1 
ATOM   1669 C  CG1   . VAL A 1 223 ? 35.699 -38.572 11.682  1.00 56.74  ? 220 VAL A CG1   1 
ATOM   1670 C  CG2   . VAL A 1 223 ? 36.396 -36.444 10.534  1.00 56.97  ? 220 VAL A CG2   1 
ATOM   1671 N  N     . GLU A 1 224 ? 38.242 -38.165 13.772  1.00 55.61  ? 221 GLU A N     1 
ATOM   1672 C  CA    . GLU A 1 224 ? 38.400 -37.636 15.115  1.00 54.85  ? 221 GLU A CA    1 
ATOM   1673 C  C     . GLU A 1 224 ? 39.779 -37.104 15.267  1.00 54.70  ? 221 GLU A C     1 
ATOM   1674 O  O     . GLU A 1 224 ? 39.952 -35.949 15.658  1.00 54.59  ? 221 GLU A O     1 
ATOM   1675 C  CB    . GLU A 1 224 ? 38.079 -38.683 16.181  1.00 56.65  ? 221 GLU A CB    1 
ATOM   1676 C  CG    . GLU A 1 224 ? 36.607 -39.015 16.341  1.00 54.75  ? 221 GLU A CG    1 
ATOM   1677 C  CD    . GLU A 1 224 ? 35.611 -37.879 16.472  1.00 56.42  ? 221 GLU A CD    1 
ATOM   1678 O  OE1   . GLU A 1 224 ? 36.016 -36.696 16.583  1.00 57.09  ? 221 GLU A OE1   1 
ATOM   1679 O  OE2   . GLU A 1 224 ? 34.399 -38.184 16.457  1.00 57.60  ? 221 GLU A OE2   1 
ATOM   1680 N  N     . ARG A 1 225 ? 40.766 -37.923 14.867  1.00 53.22  ? 222 ARG A N     1 
ATOM   1681 C  CA    . ARG A 1 225 ? 42.170 -37.563 14.908  1.00 52.75  ? 222 ARG A CA    1 
ATOM   1682 C  C     . ARG A 1 225 ? 42.479 -36.330 14.069  1.00 53.41  ? 222 ARG A C     1 
ATOM   1683 O  O     . ARG A 1 225 ? 43.311 -35.518 14.472  1.00 53.73  ? 222 ARG A O     1 
ATOM   1684 C  CB    . ARG A 1 225 ? 43.032 -38.736 14.500  1.00 48.17  ? 222 ARG A CB    1 
ATOM   1685 C  CG    . ARG A 1 225 ? 44.482 -38.511 14.793  1.00 47.76  ? 222 ARG A CG    1 
ATOM   1686 C  CD    . ARG A 1 225 ? 44.740 -37.969 16.192  1.00 49.42  ? 222 ARG A CD    1 
ATOM   1687 N  NE    . ARG A 1 225 ? 46.179 -37.907 16.362  1.00 47.97  ? 222 ARG A NE    1 
ATOM   1688 C  CZ    . ARG A 1 225 ? 46.929 -36.906 15.933  1.00 48.74  ? 222 ARG A CZ    1 
ATOM   1689 N  NH1   . ARG A 1 225 ? 46.369 -35.840 15.376  1.00 49.01  ? 222 ARG A NH1   1 
ATOM   1690 N  NH2   . ARG A 1 225 ? 48.242 -36.944 16.089  1.00 48.58  ? 222 ARG A NH2   1 
ATOM   1691 N  N     . LYS A 1 226 ? 41.801 -36.171 12.936  1.00 51.74  ? 223 LYS A N     1 
ATOM   1692 C  CA    . LYS A 1 226 ? 42.007 -35.004 12.106  1.00 52.27  ? 223 LYS A CA    1 
ATOM   1693 C  C     . LYS A 1 226 ? 41.429 -33.767 12.812  1.00 52.16  ? 223 LYS A C     1 
ATOM   1694 O  O     . LYS A 1 226 ? 41.996 -32.685 12.653  1.00 52.01  ? 223 LYS A O     1 
ATOM   1695 C  CB    . LYS A 1 226 ? 41.444 -35.200 10.689  1.00 53.10  ? 223 LYS A CB    1 
ATOM   1696 C  CG    . LYS A 1 226 ? 41.946 -34.168 9.674   1.00 54.99  ? 223 LYS A CG    1 
ATOM   1697 C  CD    . LYS A 1 226 ? 43.437 -34.266 9.320   1.00 54.03  ? 223 LYS A CD    1 
ATOM   1698 C  CE    . LYS A 1 226 ? 43.744 -35.474 8.474   1.00 53.73  ? 223 LYS A CE    1 
ATOM   1699 N  NZ    . LYS A 1 226 ? 45.013 -35.341 7.690   1.00 54.77  ? 223 LYS A NZ    1 
ATOM   1700 N  N     . ASN A 1 227 ? 40.345 -33.937 13.635  1.00 53.57  ? 224 ASN A N     1 
ATOM   1701 C  CA    . ASN A 1 227 ? 39.733 -32.849 14.397  1.00 53.66  ? 224 ASN A CA    1 
ATOM   1702 C  C     . ASN A 1 227 ? 40.749 -32.208 15.367  1.00 54.13  ? 224 ASN A C     1 
ATOM   1703 O  O     . ASN A 1 227 ? 40.740 -30.984 15.571  1.00 54.80  ? 224 ASN A O     1 
ATOM   1704 C  CB    . ASN A 1 227 ? 38.503 -33.339 15.151  1.00 54.51  ? 224 ASN A CB    1 
ATOM   1705 C  CG    . ASN A 1 227 ? 37.341 -33.713 14.265  1.00 54.68  ? 224 ASN A CG    1 
ATOM   1706 O  OD1   . ASN A 1 227 ? 37.305 -33.428 13.077  1.00 55.22  ? 224 ASN A OD1   1 
ATOM   1707 N  ND2   . ASN A 1 227 ? 36.351 -34.355 14.837  1.00 52.53  ? 224 ASN A ND2   1 
ATOM   1708 N  N     . SER A 1 228 ? 41.643 -33.044 15.929  1.00 53.94  ? 225 SER A N     1 
ATOM   1709 C  CA    . SER A 1 228 ? 42.698 -32.645 16.840  1.00 54.03  ? 225 SER A CA    1 
ATOM   1710 C  C     . SER A 1 228 ? 43.690 -31.719 16.103  1.00 54.19  ? 225 SER A C     1 
ATOM   1711 O  O     . SER A 1 228 ? 43.992 -30.633 16.596  1.00 54.57  ? 225 SER A O     1 
ATOM   1712 C  CB    . SER A 1 228 ? 43.381 -33.883 17.415  1.00 57.10  ? 225 SER A CB    1 
ATOM   1713 O  OG    . SER A 1 228 ? 44.366 -33.554 18.378  1.00 57.59  ? 225 SER A OG    1 
ATOM   1714 N  N     . ASP A 1 229 ? 44.154 -32.119 14.926  1.00 52.42  ? 226 ASP A N     1 
ATOM   1715 C  CA    . ASP A 1 229 ? 45.093 -31.317 14.155  1.00 52.61  ? 226 ASP A CA    1 
ATOM   1716 C  C     . ASP A 1 229 ? 44.505 -29.973 13.696  1.00 52.40  ? 226 ASP A C     1 
ATOM   1717 O  O     . ASP A 1 229 ? 45.219 -28.972 13.684  1.00 52.47  ? 226 ASP A O     1 
ATOM   1718 C  CB    . ASP A 1 229 ? 45.596 -32.105 12.944  1.00 54.05  ? 226 ASP A CB    1 
ATOM   1719 C  CG    . ASP A 1 229 ? 46.462 -33.313 13.250  1.00 56.36  ? 226 ASP A CG    1 
ATOM   1720 O  OD1   . ASP A 1 229 ? 47.018 -33.382 14.366  1.00 55.68  ? 226 ASP A OD1   1 
ATOM   1721 O  OD2   . ASP A 1 229 ? 46.598 -34.187 12.360  1.00 57.39  ? 226 ASP A OD2   1 
ATOM   1722 N  N     . ILE A 1 230 ? 43.215 -29.965 13.293  1.00 54.00  ? 227 ILE A N     1 
ATOM   1723 C  CA    . ILE A 1 230 ? 42.480 -28.796 12.822  1.00 54.66  ? 227 ILE A CA    1 
ATOM   1724 C  C     . ILE A 1 230 ? 42.408 -27.784 13.975  1.00 55.41  ? 227 ILE A C     1 
ATOM   1725 O  O     . ILE A 1 230 ? 42.764 -26.616 13.793  1.00 55.56  ? 227 ILE A O     1 
ATOM   1726 C  CB    . ILE A 1 230 ? 41.064 -29.195 12.289  1.00 56.48  ? 227 ILE A CB    1 
ATOM   1727 C  CG1   . ILE A 1 230 ? 41.163 -30.070 11.031  1.00 55.73  ? 227 ILE A CG1   1 
ATOM   1728 C  CG2   . ILE A 1 230 ? 40.181 -27.953 12.043  1.00 55.96  ? 227 ILE A CG2   1 
ATOM   1729 C  CD1   . ILE A 1 230 ? 39.999 -30.898 10.753  1.00 51.45  ? 227 ILE A CD1   1 
ATOM   1730 N  N     . LYS A 1 231 ? 41.960 -28.238 15.152  1.00 54.37  ? 228 LYS A N     1 
ATOM   1731 C  CA    . LYS A 1 231 ? 41.827 -27.407 16.336  1.00 54.56  ? 228 LYS A CA    1 
ATOM   1732 C  C     . LYS A 1 231 ? 43.179 -26.936 16.848  1.00 55.03  ? 228 LYS A C     1 
ATOM   1733 O  O     . LYS A 1 231 ? 43.286 -25.782 17.253  1.00 55.46  ? 228 LYS A O     1 
ATOM   1734 C  CB    . LYS A 1 231 ? 41.091 -28.165 17.433  1.00 56.25  ? 228 LYS A CB    1 
ATOM   1735 C  CG    . LYS A 1 231 ? 39.589 -28.215 17.258  1.00 57.82  ? 228 LYS A CG    1 
ATOM   1736 C  CD    . LYS A 1 231 ? 38.994 -28.829 18.514  1.00 60.29  ? 228 LYS A CD    1 
ATOM   1737 C  CE    . LYS A 1 231 ? 37.793 -28.082 18.985  1.00 58.90  ? 228 LYS A CE    1 
ATOM   1738 N  NZ    . LYS A 1 231 ? 37.318 -28.641 20.271  1.00 58.23  ? 228 LYS A NZ    1 
ATOM   1739 N  N     . ARG A 1 232 ? 44.203 -27.820 16.849  1.00 55.78  ? 229 ARG A N     1 
ATOM   1740 C  CA    . ARG A 1 232 ? 45.549 -27.478 17.320  1.00 56.42  ? 229 ARG A CA    1 
ATOM   1741 C  C     . ARG A 1 232 ? 46.130 -26.343 16.478  1.00 57.01  ? 229 ARG A C     1 
ATOM   1742 O  O     . ARG A 1 232 ? 46.672 -25.394 17.054  1.00 57.25  ? 229 ARG A O     1 
ATOM   1743 C  CB    . ARG A 1 232 ? 46.474 -28.707 17.329  1.00 51.42  ? 229 ARG A CB    1 
ATOM   1744 C  CG    . ARG A 1 232 ? 47.891 -28.444 17.827  1.00 51.92  ? 229 ARG A CG    1 
ATOM   1745 C  CD    . ARG A 1 232 ? 48.606 -29.703 18.294  1.00 50.19  ? 229 ARG A CD    1 
ATOM   1746 N  NE    . ARG A 1 232 ? 48.674 -30.730 17.248  1.00 50.24  ? 229 ARG A NE    1 
ATOM   1747 C  CZ    . ARG A 1 232 ? 49.734 -30.977 16.478  1.00 52.30  ? 229 ARG A CZ    1 
ATOM   1748 N  NH1   . ARG A 1 232 ? 50.855 -30.272 16.628  1.00 50.19  ? 229 ARG A NH1   1 
ATOM   1749 N  NH2   . ARG A 1 232 ? 49.680 -31.925 15.549  1.00 53.19  ? 229 ARG A NH2   1 
ATOM   1750 N  N     . LEU A 1 233 ? 45.982 -26.424 15.130  1.00 58.43  ? 230 LEU A N     1 
ATOM   1751 C  CA    . LEU A 1 233 ? 46.479 -25.425 14.185  1.00 57.67  ? 230 LEU A CA    1 
ATOM   1752 C  C     . LEU A 1 233 ? 45.703 -24.124 14.278  1.00 57.26  ? 230 LEU A C     1 
ATOM   1753 O  O     . LEU A 1 233 ? 46.328 -23.063 14.273  1.00 57.19  ? 230 LEU A O     1 
ATOM   1754 C  CB    . LEU A 1 233 ? 46.538 -25.958 12.747  1.00 57.08  ? 230 LEU A CB    1 
ATOM   1755 C  CG    . LEU A 1 233 ? 47.180 -25.024 11.675  1.00 57.22  ? 230 LEU A CG    1 
ATOM   1756 C  CD1   . LEU A 1 233 ? 48.590 -24.518 12.098  1.00 54.19  ? 230 LEU A CD1   1 
ATOM   1757 C  CD2   . LEU A 1 233 ? 47.202 -25.698 10.291  1.00 56.20  ? 230 LEU A CD2   1 
ATOM   1758 N  N     . LEU A 1 234 ? 44.351 -24.189 14.383  1.00 57.16  ? 231 LEU A N     1 
ATOM   1759 C  CA    . LEU A 1 234 ? 43.527 -22.991 14.539  1.00 56.98  ? 231 LEU A CA    1 
ATOM   1760 C  C     . LEU A 1 234 ? 43.947 -22.288 15.835  1.00 57.24  ? 231 LEU A C     1 
ATOM   1761 O  O     . LEU A 1 234 ? 44.110 -21.074 15.830  1.00 57.65  ? 231 LEU A O     1 
ATOM   1762 C  CB    . LEU A 1 234 ? 42.034 -23.326 14.590  1.00 56.36  ? 231 LEU A CB    1 
ATOM   1763 C  CG    . LEU A 1 234 ? 41.361 -23.684 13.280  1.00 56.30  ? 231 LEU A CG    1 
ATOM   1764 C  CD1   . LEU A 1 234 ? 39.997 -24.314 13.546  1.00 51.54  ? 231 LEU A CD1   1 
ATOM   1765 C  CD2   . LEU A 1 234 ? 41.221 -22.473 12.368  1.00 55.65  ? 231 LEU A CD2   1 
ATOM   1766 N  N     . THR A 1 235 ? 44.165 -23.056 16.926  1.00 57.99  ? 232 THR A N     1 
ATOM   1767 C  CA    . THR A 1 235 ? 44.600 -22.520 18.214  1.00 57.72  ? 232 THR A CA    1 
ATOM   1768 C  C     . THR A 1 235 ? 45.879 -21.679 18.043  1.00 57.87  ? 232 THR A C     1 
ATOM   1769 O  O     . THR A 1 235 ? 45.886 -20.536 18.488  1.00 56.79  ? 232 THR A O     1 
ATOM   1770 C  CB    . THR A 1 235 ? 44.788 -23.647 19.241  1.00 62.87  ? 232 THR A CB    1 
ATOM   1771 O  OG1   . THR A 1 235 ? 43.533 -24.253 19.492  1.00 64.22  ? 232 THR A OG1   1 
ATOM   1772 C  CG2   . THR A 1 235 ? 45.348 -23.154 20.545  1.00 61.35  ? 232 THR A CG2   1 
ATOM   1773 N  N     . LYS A 1 236 ? 46.938 -22.247 17.401  1.00 57.13  ? 233 LYS A N     1 
ATOM   1774 C  CA    . LYS A 1 236 ? 48.246 -21.617 17.167  1.00 57.55  ? 233 LYS A CA    1 
ATOM   1775 C  C     . LYS A 1 236 ? 48.158 -20.320 16.357  1.00 59.22  ? 233 LYS A C     1 
ATOM   1776 O  O     . LYS A 1 236 ? 48.824 -19.329 16.681  1.00 59.27  ? 233 LYS A O     1 
ATOM   1777 C  CB    . LYS A 1 236 ? 49.196 -22.595 16.453  1.00 57.50  ? 233 LYS A CB    1 
ATOM   1778 C  CG    . LYS A 1 236 ? 49.604 -23.768 17.313  1.00 54.89  ? 233 LYS A CG    1 
ATOM   1779 C  CD    . LYS A 1 236 ? 50.322 -24.834 16.542  1.00 50.06  ? 233 LYS A CD    1 
ATOM   1780 C  CE    . LYS A 1 236 ? 50.744 -25.931 17.483  1.00 51.57  ? 233 LYS A CE    1 
ATOM   1781 N  NZ    . LYS A 1 236 ? 51.449 -27.028 16.777  1.00 48.32  ? 233 LYS A NZ    1 
ATOM   1782 N  N     . LEU A 1 237 ? 47.354 -20.344 15.284  1.00 59.02  ? 234 LEU A N     1 
ATOM   1783 C  CA    . LEU A 1 237 ? 47.182 -19.216 14.391  1.00 60.15  ? 234 LEU A CA    1 
ATOM   1784 C  C     . LEU A 1 237 ? 46.409 -18.096 15.050  1.00 61.14  ? 234 LEU A C     1 
ATOM   1785 O  O     . LEU A 1 237 ? 46.558 -16.938 14.648  1.00 61.30  ? 234 LEU A O     1 
ATOM   1786 C  CB    . LEU A 1 237 ? 46.466 -19.662 13.096  1.00 59.27  ? 234 LEU A CB    1 
ATOM   1787 C  CG    . LEU A 1 237 ? 47.206 -20.630 12.177  1.00 59.36  ? 234 LEU A CG    1 
ATOM   1788 C  CD1   . LEU A 1 237 ? 46.396 -20.917 10.945  1.00 57.43  ? 234 LEU A CD1   1 
ATOM   1789 C  CD2   . LEU A 1 237 ? 48.592 -20.132 11.805  1.00 56.61  ? 234 LEU A CD2   1 
ATOM   1790 N  N     . LEU A 1 238 ? 45.566 -18.436 16.036  1.00 60.13  ? 235 LEU A N     1 
ATOM   1791 C  CA    . LEU A 1 238 ? 44.722 -17.473 16.730  1.00 60.86  ? 235 LEU A CA    1 
ATOM   1792 C  C     . LEU A 1 238 ? 45.327 -16.976 18.064  1.00 61.24  ? 235 LEU A C     1 
ATOM   1793 O  O     . LEU A 1 238 ? 44.676 -16.202 18.762  1.00 61.69  ? 235 LEU A O     1 
ATOM   1794 C  CB    . LEU A 1 238 ? 43.302 -18.045 16.915  1.00 60.80  ? 235 LEU A CB    1 
ATOM   1795 C  CG    . LEU A 1 238 ? 42.479 -18.292 15.646  1.00 61.06  ? 235 LEU A CG    1 
ATOM   1796 C  CD1   . LEU A 1 238 ? 41.272 -19.127 15.950  1.00 58.80  ? 235 LEU A CD1   1 
ATOM   1797 C  CD2   . LEU A 1 238 ? 42.018 -16.998 15.006  1.00 59.75  ? 235 LEU A CD2   1 
ATOM   1798 N  N     . VAL A 1 239 ? 46.581 -17.393 18.403  1.00 62.66  ? 236 VAL A N     1 
ATOM   1799 C  CA    . VAL A 1 239 ? 47.271 -16.960 19.629  1.00 64.08  ? 236 VAL A CA    1 
ATOM   1800 C  C     . VAL A 1 239 ? 47.335 -15.425 19.601  1.00 65.48  ? 236 VAL A C     1 
ATOM   1801 O  O     . VAL A 1 239 ? 47.721 -14.845 18.583  1.00 65.58  ? 236 VAL A O     1 
ATOM   1802 C  CB    . VAL A 1 239 ? 48.677 -17.605 19.801  1.00 65.23  ? 236 VAL A CB    1 
ATOM   1803 C  CG1   . VAL A 1 239 ? 49.496 -16.903 20.878  1.00 64.41  ? 236 VAL A CG1   1 
ATOM   1804 C  CG2   . VAL A 1 239 ? 48.568 -19.091 20.103  1.00 64.59  ? 236 VAL A CG2   1 
ATOM   1805 N  N     . GLY A 1 240 ? 46.893 -14.813 20.700  1.00 70.07  ? 237 GLY A N     1 
ATOM   1806 C  CA    . GLY A 1 240 ? 46.864 -13.370 20.926  1.00 71.21  ? 237 GLY A CA    1 
ATOM   1807 C  C     . GLY A 1 240 ? 46.046 -12.545 19.956  1.00 72.15  ? 237 GLY A C     1 
ATOM   1808 O  O     . GLY A 1 240 ? 46.370 -11.377 19.727  1.00 73.07  ? 237 GLY A O     1 
ATOM   1809 N  N     . ARG A 1 241 ? 44.992 -13.137 19.385  1.00 69.79  ? 238 ARG A N     1 
ATOM   1810 C  CA    . ARG A 1 241 ? 44.092 -12.503 18.429  1.00 70.11  ? 238 ARG A CA    1 
ATOM   1811 C  C     . ARG A 1 241 ? 42.688 -12.978 18.742  1.00 69.86  ? 238 ARG A C     1 
ATOM   1812 O  O     . ARG A 1 241 ? 42.542 -14.048 19.349  1.00 70.30  ? 238 ARG A O     1 
ATOM   1813 C  CB    . ARG A 1 241 ? 44.406 -13.000 17.013  1.00 73.08  ? 238 ARG A CB    1 
ATOM   1814 C  CG    . ARG A 1 241 ? 45.619 -12.400 16.362  1.00 75.63  ? 238 ARG A CG    1 
ATOM   1815 C  CD    . ARG A 1 241 ? 45.835 -13.027 15.001  1.00 80.81  ? 238 ARG A CD    1 
ATOM   1816 N  NE    . ARG A 1 241 ? 47.013 -12.483 14.319  1.00 87.07  ? 238 ARG A NE    1 
ATOM   1817 C  CZ    . ARG A 1 241 ? 48.261 -12.922 14.500  1.00 89.68  ? 238 ARG A CZ    1 
ATOM   1818 N  NH1   . ARG A 1 241 ? 48.511 -13.914 15.354  1.00 91.28  ? 238 ARG A NH1   1 
ATOM   1819 N  NH2   . ARG A 1 241 ? 49.268 -12.370 13.830  1.00 91.59  ? 238 ARG A NH2   1 
ATOM   1820 N  N     . PRO A 1 242 ? 41.621 -12.269 18.296  1.00 69.24  ? 239 PRO A N     1 
ATOM   1821 C  CA    . PRO A 1 242 ? 40.256 -12.790 18.523  1.00 68.90  ? 239 PRO A CA    1 
ATOM   1822 C  C     . PRO A 1 242 ? 40.069 -14.101 17.731  1.00 68.77  ? 239 PRO A C     1 
ATOM   1823 O  O     . PRO A 1 242 ? 40.701 -14.288 16.684  1.00 68.46  ? 239 PRO A O     1 
ATOM   1824 C  CB    . PRO A 1 242 ? 39.352 -11.659 18.005  1.00 70.24  ? 239 PRO A CB    1 
ATOM   1825 C  CG    . PRO A 1 242 ? 40.240 -10.470 17.904  1.00 70.97  ? 239 PRO A CG    1 
ATOM   1826 C  CD    . PRO A 1 242 ? 41.581 -10.997 17.554  1.00 70.97  ? 239 PRO A CD    1 
ATOM   1827 N  N     . THR A 1 243 ? 39.225 -15.011 18.237  1.00 69.10  ? 240 THR A N     1 
ATOM   1828 C  CA    . THR A 1 243 ? 39.014 -16.330 17.623  1.00 68.94  ? 240 THR A CA    1 
ATOM   1829 C  C     . THR A 1 243 ? 38.149 -16.301 16.353  1.00 69.06  ? 240 THR A C     1 
ATOM   1830 O  O     . THR A 1 243 ? 37.079 -16.918 16.304  1.00 68.52  ? 240 THR A O     1 
ATOM   1831 C  CB    . THR A 1 243 ? 38.497 -17.331 18.656  1.00 67.83  ? 240 THR A CB    1 
ATOM   1832 O  OG1   . THR A 1 243 ? 37.331 -16.791 19.268  1.00 67.04  ? 240 THR A OG1   1 
ATOM   1833 C  CG2   . THR A 1 243 ? 39.547 -17.685 19.712  1.00 66.74  ? 240 THR A CG2   1 
ATOM   1834 N  N     . LYS A 1 244 ? 38.657 -15.608 15.314  1.00 70.73  ? 241 LYS A N     1 
ATOM   1835 C  CA    . LYS A 1 244 ? 38.047 -15.455 13.996  1.00 70.94  ? 241 LYS A CA    1 
ATOM   1836 C  C     . LYS A 1 244 ? 38.573 -16.606 13.133  1.00 69.91  ? 241 LYS A C     1 
ATOM   1837 O  O     . LYS A 1 244 ? 39.450 -16.395 12.294  1.00 69.76  ? 241 LYS A O     1 
ATOM   1838 C  CB    . LYS A 1 244 ? 38.471 -14.120 13.358  1.00 75.94  ? 241 LYS A CB    1 
ATOM   1839 C  CG    . LYS A 1 244 ? 38.217 -12.874 14.176  1.00 79.75  ? 241 LYS A CG    1 
ATOM   1840 C  CD    . LYS A 1 244 ? 38.605 -11.621 13.379  1.00 85.81  ? 241 LYS A CD    1 
ATOM   1841 C  CE    . LYS A 1 244 ? 38.356 -10.356 14.169  1.00 87.72  ? 241 LYS A CE    1 
ATOM   1842 N  NZ    . LYS A 1 244 ? 39.136 -9.205  13.630  1.00 91.60  ? 241 LYS A NZ    1 
ATOM   1843 N  N     . TRP A 1 245 ? 38.045 -17.820 13.350  1.00 68.43  ? 242 TRP A N     1 
ATOM   1844 C  CA    . TRP A 1 245 ? 38.448 -19.049 12.655  1.00 67.71  ? 242 TRP A CA    1 
ATOM   1845 C  C     . TRP A 1 245 ? 37.887 -19.230 11.240  1.00 67.50  ? 242 TRP A C     1 
ATOM   1846 O  O     . TRP A 1 245 ? 38.513 -19.943 10.456  1.00 67.53  ? 242 TRP A O     1 
ATOM   1847 C  CB    . TRP A 1 245 ? 38.122 -20.295 13.500  1.00 65.39  ? 242 TRP A CB    1 
ATOM   1848 C  CG    . TRP A 1 245 ? 36.683 -20.395 13.930  1.00 63.44  ? 242 TRP A CG    1 
ATOM   1849 C  CD1   . TRP A 1 245 ? 36.152 -19.942 15.100  1.00 62.34  ? 242 TRP A CD1   1 
ATOM   1850 C  CD2   . TRP A 1 245 ? 35.588 -20.976 13.191  1.00 63.45  ? 242 TRP A CD2   1 
ATOM   1851 N  NE1   . TRP A 1 245 ? 34.801 -20.184 15.133  1.00 62.99  ? 242 TRP A NE1   1 
ATOM   1852 C  CE2   . TRP A 1 245 ? 34.429 -20.832 13.982  1.00 62.43  ? 242 TRP A CE2   1 
ATOM   1853 C  CE3   . TRP A 1 245 ? 35.469 -21.581 11.926  1.00 62.31  ? 242 TRP A CE3   1 
ATOM   1854 C  CZ2   . TRP A 1 245 ? 33.166 -21.276 13.556  1.00 62.16  ? 242 TRP A CZ2   1 
ATOM   1855 C  CZ3   . TRP A 1 245 ? 34.217 -22.009 11.502  1.00 60.69  ? 242 TRP A CZ3   1 
ATOM   1856 C  CH2   . TRP A 1 245 ? 33.085 -21.861 12.313  1.00 61.69  ? 242 TRP A CH2   1 
ATOM   1857 N  N     . TYR A 1 246 ? 36.716 -18.640 10.921  1.00 67.59  ? 243 TYR A N     1 
ATOM   1858 C  CA    . TYR A 1 246 ? 36.050 -18.758 9.616   1.00 67.81  ? 243 TYR A CA    1 
ATOM   1859 C  C     . TYR A 1 246 ? 36.972 -18.567 8.394   1.00 67.37  ? 243 TYR A C     1 
ATOM   1860 O  O     . TYR A 1 246 ? 36.903 -19.356 7.442   1.00 67.85  ? 243 TYR A O     1 
ATOM   1861 C  CB    . TYR A 1 246 ? 34.857 -17.799 9.529   1.00 68.14  ? 243 TYR A CB    1 
ATOM   1862 C  CG    . TYR A 1 246 ? 34.126 -17.874 8.211   1.00 69.19  ? 243 TYR A CG    1 
ATOM   1863 C  CD1   . TYR A 1 246 ? 33.117 -18.809 8.007   1.00 69.26  ? 243 TYR A CD1   1 
ATOM   1864 C  CD2   . TYR A 1 246 ? 34.456 -17.025 7.155   1.00 70.00  ? 243 TYR A CD2   1 
ATOM   1865 C  CE1   . TYR A 1 246 ? 32.452 -18.899 6.789   1.00 70.90  ? 243 TYR A CE1   1 
ATOM   1866 C  CE2   . TYR A 1 246 ? 33.797 -17.107 5.930   1.00 70.47  ? 243 TYR A CE2   1 
ATOM   1867 C  CZ    . TYR A 1 246 ? 32.791 -18.046 5.756   1.00 71.52  ? 243 TYR A CZ    1 
ATOM   1868 O  OH    . TYR A 1 246 ? 32.105 -18.162 4.575   1.00 74.03  ? 243 TYR A OH    1 
ATOM   1869 N  N     . ASP A 1 247 ? 37.804 -17.517 8.412   1.00 68.06  ? 244 ASP A N     1 
ATOM   1870 C  CA    . ASP A 1 247 ? 38.721 -17.208 7.323   1.00 68.28  ? 244 ASP A CA    1 
ATOM   1871 C  C     . ASP A 1 247 ? 39.981 -18.053 7.331   1.00 67.35  ? 244 ASP A C     1 
ATOM   1872 O  O     . ASP A 1 247 ? 40.766 -17.994 6.379   1.00 67.78  ? 244 ASP A O     1 
ATOM   1873 C  CB    . ASP A 1 247 ? 39.068 -15.717 7.322   1.00 71.57  ? 244 ASP A CB    1 
ATOM   1874 C  CG    . ASP A 1 247 ? 37.932 -14.816 6.885   1.00 74.43  ? 244 ASP A CG    1 
ATOM   1875 O  OD1   . ASP A 1 247 ? 37.074 -15.274 6.069   1.00 76.95  ? 244 ASP A OD1   1 
ATOM   1876 O  OD2   . ASP A 1 247 ? 37.895 -13.650 7.342   1.00 78.78  ? 244 ASP A OD2   1 
ATOM   1877 N  N     . LEU A 1 248 ? 40.190 -18.829 8.393   1.00 63.96  ? 245 LEU A N     1 
ATOM   1878 C  CA    . LEU A 1 248 ? 41.358 -19.685 8.508   1.00 62.67  ? 245 LEU A CA    1 
ATOM   1879 C  C     . LEU A 1 248 ? 41.092 -21.103 8.028   1.00 61.48  ? 245 LEU A C     1 
ATOM   1880 O  O     . LEU A 1 248 ? 42.060 -21.800 7.715   1.00 61.56  ? 245 LEU A O     1 
ATOM   1881 C  CB    . LEU A 1 248 ? 41.903 -19.708 9.936   1.00 62.39  ? 245 LEU A CB    1 
ATOM   1882 C  CG    . LEU A 1 248 ? 42.576 -18.451 10.463  1.00 62.93  ? 245 LEU A CG    1 
ATOM   1883 C  CD1   . LEU A 1 248 ? 42.879 -18.630 11.911  1.00 61.11  ? 245 LEU A CD1   1 
ATOM   1884 C  CD2   . LEU A 1 248 ? 43.871 -18.151 9.714   1.00 61.12  ? 245 LEU A CD2   1 
ATOM   1885 N  N     . LEU A 1 249 ? 39.799 -21.542 7.954   1.00 60.02  ? 246 LEU A N     1 
ATOM   1886 C  CA    . LEU A 1 249 ? 39.475 -22.893 7.484   1.00 59.89  ? 246 LEU A CA    1 
ATOM   1887 C  C     . LEU A 1 249 ? 40.193 -23.226 6.179   1.00 59.34  ? 246 LEU A C     1 
ATOM   1888 O  O     . LEU A 1 249 ? 40.919 -24.232 6.173   1.00 59.75  ? 246 LEU A O     1 
ATOM   1889 C  CB    . LEU A 1 249 ? 37.972 -23.191 7.390   1.00 59.65  ? 246 LEU A CB    1 
ATOM   1890 C  CG    . LEU A 1 249 ? 37.200 -23.346 8.686   1.00 62.24  ? 246 LEU A CG    1 
ATOM   1891 C  CD1   . LEU A 1 249 ? 35.823 -23.838 8.401   1.00 62.17  ? 246 LEU A CD1   1 
ATOM   1892 C  CD2   . LEU A 1 249 ? 37.901 -24.301 9.665   1.00 59.93  ? 246 LEU A CD2   1 
ATOM   1893 N  N     . PRO A 1 250 ? 40.100 -22.374 5.107   1.00 59.11  ? 247 PRO A N     1 
ATOM   1894 C  CA    . PRO A 1 250 ? 40.828 -22.677 3.859   1.00 59.00  ? 247 PRO A CA    1 
ATOM   1895 C  C     . PRO A 1 250 ? 42.342 -22.860 4.042   1.00 58.54  ? 247 PRO A C     1 
ATOM   1896 O  O     . PRO A 1 250 ? 42.912 -23.797 3.479   1.00 58.48  ? 247 PRO A O     1 
ATOM   1897 C  CB    . PRO A 1 250 ? 40.509 -21.468 2.979   1.00 59.55  ? 247 PRO A CB    1 
ATOM   1898 C  CG    . PRO A 1 250 ? 39.235 -20.970 3.492   1.00 59.88  ? 247 PRO A CG    1 
ATOM   1899 C  CD    . PRO A 1 250 ? 39.314 -21.131 4.951   1.00 60.37  ? 247 PRO A CD    1 
ATOM   1900 N  N     . VAL A 1 251 ? 42.975 -21.985 4.855   1.00 58.03  ? 248 VAL A N     1 
ATOM   1901 C  CA    . VAL A 1 251 ? 44.407 -21.995 5.170   1.00 58.06  ? 248 VAL A CA    1 
ATOM   1902 C  C     . VAL A 1 251 ? 44.746 -23.308 5.906   1.00 57.74  ? 248 VAL A C     1 
ATOM   1903 O  O     . VAL A 1 251 ? 45.706 -23.995 5.523   1.00 57.39  ? 248 VAL A O     1 
ATOM   1904 C  CB    . VAL A 1 251 ? 44.790 -20.737 6.010   1.00 61.17  ? 248 VAL A CB    1 
ATOM   1905 C  CG1   . VAL A 1 251 ? 46.272 -20.714 6.345   1.00 61.30  ? 248 VAL A CG1   1 
ATOM   1906 C  CG2   . VAL A 1 251 ? 44.369 -19.445 5.307   1.00 60.94  ? 248 VAL A CG2   1 
ATOM   1907 N  N     . VAL A 1 252 ? 43.953 -23.653 6.947   1.00 53.45  ? 249 VAL A N     1 
ATOM   1908 C  CA    . VAL A 1 252 ? 44.138 -24.859 7.740   1.00 52.71  ? 249 VAL A CA    1 
ATOM   1909 C  C     . VAL A 1 252 ? 44.026 -26.096 6.842   1.00 52.33  ? 249 VAL A C     1 
ATOM   1910 O  O     . VAL A 1 252 ? 44.916 -26.964 6.886   1.00 51.42  ? 249 VAL A O     1 
ATOM   1911 C  CB    . VAL A 1 252 ? 43.218 -24.890 9.004   1.00 53.72  ? 249 VAL A CB    1 
ATOM   1912 C  CG1   . VAL A 1 252 ? 43.233 -26.251 9.701   1.00 51.28  ? 249 VAL A CG1   1 
ATOM   1913 C  CG2   . VAL A 1 252 ? 43.635 -23.807 9.981   1.00 53.24  ? 249 VAL A CG2   1 
ATOM   1914 N  N     . GLN A 1 253 ? 42.970 -26.152 5.998   1.00 53.11  ? 250 GLN A N     1 
ATOM   1915 C  CA    . GLN A 1 253 ? 42.734 -27.252 5.045   1.00 52.96  ? 250 GLN A CA    1 
ATOM   1916 C  C     . GLN A 1 253 ? 43.952 -27.485 4.172   1.00 52.39  ? 250 GLN A C     1 
ATOM   1917 O  O     . GLN A 1 253 ? 44.479 -28.590 4.164   1.00 51.67  ? 250 GLN A O     1 
ATOM   1918 C  CB    . GLN A 1 253 ? 41.538 -26.931 4.145   1.00 53.94  ? 250 GLN A CB    1 
ATOM   1919 C  CG    . GLN A 1 253 ? 41.015 -28.123 3.375   1.00 54.40  ? 250 GLN A CG    1 
ATOM   1920 C  CD    . GLN A 1 253 ? 39.995 -27.668 2.393   1.00 51.64  ? 250 GLN A CD    1 
ATOM   1921 O  OE1   . GLN A 1 253 ? 38.790 -27.700 2.651   1.00 53.23  ? 250 GLN A OE1   1 
ATOM   1922 N  NE2   . GLN A 1 253 ? 40.459 -27.214 1.248   1.00 54.20  ? 250 GLN A NE2   1 
ATOM   1923 N  N     . LEU A 1 254 ? 44.406 -26.445 3.452   1.00 53.25  ? 251 LEU A N     1 
ATOM   1924 C  CA    . LEU A 1 254 ? 45.570 -26.538 2.583   1.00 53.18  ? 251 LEU A CA    1 
ATOM   1925 C  C     . LEU A 1 254 ? 46.813 -26.933 3.398   1.00 53.40  ? 251 LEU A C     1 
ATOM   1926 O  O     . LEU A 1 254 ? 47.537 -27.832 2.976   1.00 53.94  ? 251 LEU A O     1 
ATOM   1927 C  CB    . LEU A 1 254 ? 45.769 -25.216 1.817   1.00 53.19  ? 251 LEU A CB    1 
ATOM   1928 C  CG    . LEU A 1 254 ? 46.956 -25.110 0.850   1.00 55.14  ? 251 LEU A CG    1 
ATOM   1929 C  CD1   . LEU A 1 254 ? 46.703 -25.859 -0.479  1.00 50.24  ? 251 LEU A CD1   1 
ATOM   1930 C  CD2   . LEU A 1 254 ? 47.267 -23.681 0.565   1.00 51.48  ? 251 LEU A CD2   1 
ATOM   1931 N  N     . ALA A 1 255 ? 47.032 -26.305 4.580   1.00 54.12  ? 252 ALA A N     1 
ATOM   1932 C  CA    . ALA A 1 255 ? 48.187 -26.598 5.441   1.00 53.23  ? 252 ALA A CA    1 
ATOM   1933 C  C     . ALA A 1 255 ? 48.287 -28.059 5.814   1.00 52.83  ? 252 ALA A C     1 
ATOM   1934 O  O     . ALA A 1 255 ? 49.345 -28.656 5.610   1.00 51.67  ? 252 ALA A O     1 
ATOM   1935 C  CB    . ALA A 1 255 ? 48.142 -25.754 6.701   1.00 54.09  ? 252 ALA A CB    1 
ATOM   1936 N  N     . LEU A 1 256 ? 47.189 -28.636 6.344   1.00 50.74  ? 253 LEU A N     1 
ATOM   1937 C  CA    . LEU A 1 256 ? 47.147 -30.034 6.785   1.00 51.84  ? 253 LEU A CA    1 
ATOM   1938 C  C     . LEU A 1 256 ? 47.232 -31.054 5.648   1.00 51.66  ? 253 LEU A C     1 
ATOM   1939 O  O     . LEU A 1 256 ? 47.921 -32.062 5.791   1.00 50.76  ? 253 LEU A O     1 
ATOM   1940 C  CB    . LEU A 1 256 ? 45.933 -30.286 7.669   1.00 50.78  ? 253 LEU A CB    1 
ATOM   1941 C  CG    . LEU A 1 256 ? 45.892 -29.503 8.986   1.00 52.81  ? 253 LEU A CG    1 
ATOM   1942 C  CD1   . LEU A 1 256 ? 44.698 -29.919 9.826   1.00 54.17  ? 253 LEU A CD1   1 
ATOM   1943 C  CD2   . LEU A 1 256 ? 47.205 -29.628 9.784   1.00 52.62  ? 253 LEU A CD2   1 
ATOM   1944 N  N     . ASN A 1 257 ? 46.566 -30.781 4.513   1.00 53.83  ? 254 ASN A N     1 
ATOM   1945 C  CA    . ASN A 1 257 ? 46.582 -31.654 3.339   1.00 54.39  ? 254 ASN A CA    1 
ATOM   1946 C  C     . ASN A 1 257 ? 47.987 -31.773 2.751   1.00 54.64  ? 254 ASN A C     1 
ATOM   1947 O  O     . ASN A 1 257 ? 48.268 -32.743 2.055   1.00 55.29  ? 254 ASN A O     1 
ATOM   1948 C  CB    . ASN A 1 257 ? 45.591 -31.147 2.293   1.00 55.22  ? 254 ASN A CB    1 
ATOM   1949 C  CG    . ASN A 1 257 ? 44.169 -31.522 2.635   1.00 54.30  ? 254 ASN A CG    1 
ATOM   1950 O  OD1   . ASN A 1 257 ? 43.916 -32.493 3.379   1.00 54.98  ? 254 ASN A OD1   1 
ATOM   1951 N  ND2   . ASN A 1 257 ? 43.200 -30.783 2.099   1.00 55.47  ? 254 ASN A ND2   1 
ATOM   1952 N  N     . ASN A 1 258 ? 48.871 -30.785 3.049   1.00 53.09  ? 255 ASN A N     1 
ATOM   1953 C  CA    . ASN A 1 258 ? 50.249 -30.742 2.568   1.00 53.28  ? 255 ASN A CA    1 
ATOM   1954 C  C     . ASN A 1 258 ? 51.310 -30.983 3.660   1.00 53.69  ? 255 ASN A C     1 
ATOM   1955 O  O     . ASN A 1 258 ? 52.475 -30.692 3.425   1.00 52.36  ? 255 ASN A O     1 
ATOM   1956 C  CB    . ASN A 1 258 ? 50.502 -29.441 1.833   1.00 51.38  ? 255 ASN A CB    1 
ATOM   1957 C  CG    . ASN A 1 258 ? 49.744 -29.353 0.550   1.00 53.75  ? 255 ASN A CG    1 
ATOM   1958 O  OD1   . ASN A 1 258 ? 50.172 -29.862 -0.497  1.00 54.86  ? 255 ASN A OD1   1 
ATOM   1959 N  ND2   . ASN A 1 258 ? 48.600 -28.696 0.601   1.00 50.62  ? 255 ASN A ND2   1 
ATOM   1960 N  N     . THR A 1 259 ? 50.919 -31.546 4.821   1.00 52.94  ? 256 THR A N     1 
ATOM   1961 C  CA    . THR A 1 259 ? 51.785 -31.854 5.956   1.00 52.96  ? 256 THR A CA    1 
ATOM   1962 C  C     . THR A 1 259 ? 52.209 -33.306 5.922   1.00 53.70  ? 256 THR A C     1 
ATOM   1963 O  O     . THR A 1 259 ? 51.366 -34.192 5.758   1.00 53.51  ? 256 THR A O     1 
ATOM   1964 C  CB    . THR A 1 259 ? 51.032 -31.508 7.248   1.00 60.88  ? 256 THR A CB    1 
ATOM   1965 O  OG1   . THR A 1 259 ? 50.807 -30.101 7.276   1.00 60.99  ? 256 THR A OG1   1 
ATOM   1966 C  CG2   . THR A 1 259 ? 51.759 -31.936 8.525   1.00 60.56  ? 256 THR A CG2   1 
ATOM   1967 N  N     . TYR A 1 260 ? 53.505 -33.569 6.117   1.00 55.22  ? 257 TYR A N     1 
ATOM   1968 C  CA    . TYR A 1 260 ? 54.016 -34.936 6.129   1.00 55.77  ? 257 TYR A CA    1 
ATOM   1969 C  C     . TYR A 1 260 ? 53.553 -35.717 7.322   1.00 56.13  ? 257 TYR A C     1 
ATOM   1970 O  O     . TYR A 1 260 ? 53.422 -35.157 8.397   1.00 55.71  ? 257 TYR A O     1 
ATOM   1971 C  CB    . TYR A 1 260 ? 55.559 -34.955 6.110   1.00 55.67  ? 257 TYR A CB    1 
ATOM   1972 C  CG    . TYR A 1 260 ? 56.100 -34.788 4.716   1.00 56.45  ? 257 TYR A CG    1 
ATOM   1973 C  CD1   . TYR A 1 260 ? 56.246 -35.882 3.869   1.00 54.96  ? 257 TYR A CD1   1 
ATOM   1974 C  CD2   . TYR A 1 260 ? 56.387 -33.522 4.206   1.00 56.18  ? 257 TYR A CD2   1 
ATOM   1975 C  CE1   . TYR A 1 260 ? 56.675 -35.724 2.554   1.00 55.97  ? 257 TYR A CE1   1 
ATOM   1976 C  CE2   . TYR A 1 260 ? 56.834 -33.354 2.902   1.00 56.32  ? 257 TYR A CE2   1 
ATOM   1977 C  CZ    . TYR A 1 260 ? 56.975 -34.458 2.079   1.00 57.32  ? 257 TYR A CZ    1 
ATOM   1978 O  OH    . TYR A 1 260 ? 57.408 -34.295 0.789   1.00 59.59  ? 257 TYR A OH    1 
ATOM   1979 N  N     . SER A 1 261 ? 53.321 -37.019 7.143   1.00 56.56  ? 258 SER A N     1 
ATOM   1980 C  CA    . SER A 1 261 ? 53.014 -37.903 8.244   1.00 56.54  ? 258 SER A CA    1 
ATOM   1981 C  C     . SER A 1 261 ? 54.372 -38.548 8.404   1.00 56.79  ? 258 SER A C     1 
ATOM   1982 O  O     . SER A 1 261 ? 54.777 -39.272 7.481   1.00 57.06  ? 258 SER A O     1 
ATOM   1983 C  CB    . SER A 1 261 ? 51.987 -38.958 7.860   1.00 61.18  ? 258 SER A CB    1 
ATOM   1984 O  OG    . SER A 1 261 ? 52.030 -39.978 8.847   1.00 59.43  ? 258 SER A OG    1 
ATOM   1985 N  N     . PRO A 1 262 ? 55.132 -38.268 9.509   1.00 55.71  ? 259 PRO A N     1 
ATOM   1986 C  CA    . PRO A 1 262 ? 56.477 -38.854 9.654   1.00 56.27  ? 259 PRO A CA    1 
ATOM   1987 C  C     . PRO A 1 262 ? 56.576 -40.370 9.470   1.00 56.73  ? 259 PRO A C     1 
ATOM   1988 O  O     . PRO A 1 262 ? 57.603 -40.839 8.977   1.00 57.13  ? 259 PRO A O     1 
ATOM   1989 C  CB    . PRO A 1 262 ? 56.886 -38.415 11.059  1.00 57.71  ? 259 PRO A CB    1 
ATOM   1990 C  CG    . PRO A 1 262 ? 56.203 -37.137 11.232  1.00 56.61  ? 259 PRO A CG    1 
ATOM   1991 C  CD    . PRO A 1 262 ? 54.836 -37.385 10.653  1.00 56.74  ? 259 PRO A CD    1 
ATOM   1992 N  N     . VAL A 1 263 ? 55.521 -41.132 9.835   1.00 55.56  ? 260 VAL A N     1 
ATOM   1993 C  CA    . VAL A 1 263 ? 55.521 -42.596 9.686   1.00 56.67  ? 260 VAL A CA    1 
ATOM   1994 C  C     . VAL A 1 263 ? 55.366 -43.016 8.221   1.00 56.90  ? 260 VAL A C     1 
ATOM   1995 O  O     . VAL A 1 263 ? 55.961 -44.019 7.834   1.00 57.14  ? 260 VAL A O     1 
ATOM   1996 C  CB    . VAL A 1 263 ? 54.523 -43.324 10.621  1.00 57.86  ? 260 VAL A CB    1 
ATOM   1997 C  CG1   . VAL A 1 263 ? 53.067 -43.124 10.183  1.00 57.59  ? 260 VAL A CG1   1 
ATOM   1998 C  CG2   . VAL A 1 263 ? 54.868 -44.803 10.755  1.00 62.23  ? 260 VAL A CG2   1 
ATOM   1999 N  N     . LEU A 1 264 ? 54.591 -42.268 7.407   1.00 56.59  ? 261 LEU A N     1 
ATOM   2000 C  CA    . LEU A 1 264 ? 54.390 -42.614 6.000   1.00 56.91  ? 261 LEU A CA    1 
ATOM   2001 C  C     . LEU A 1 264 ? 55.422 -41.989 5.107   1.00 57.02  ? 261 LEU A C     1 
ATOM   2002 O  O     . LEU A 1 264 ? 55.779 -42.592 4.106   1.00 57.14  ? 261 LEU A O     1 
ATOM   2003 C  CB    . LEU A 1 264 ? 52.994 -42.232 5.487   1.00 55.88  ? 261 LEU A CB    1 
ATOM   2004 C  CG    . LEU A 1 264 ? 51.757 -42.602 6.325   1.00 54.34  ? 261 LEU A CG    1 
ATOM   2005 C  CD1   . LEU A 1 264 ? 50.485 -42.048 5.665   1.00 48.09  ? 261 LEU A CD1   1 
ATOM   2006 C  CD2   . LEU A 1 264 ? 51.648 -44.116 6.543   1.00 52.16  ? 261 LEU A CD2   1 
ATOM   2007 N  N     . LYS A 1 265 ? 55.895 -40.779 5.440   1.00 57.03  ? 262 LYS A N     1 
ATOM   2008 C  CA    . LYS A 1 265 ? 56.872 -39.996 4.664   1.00 57.55  ? 262 LYS A CA    1 
ATOM   2009 C  C     . LYS A 1 265 ? 56.206 -39.458 3.374   1.00 57.02  ? 262 LYS A C     1 
ATOM   2010 O  O     . LYS A 1 265 ? 56.845 -39.276 2.335   1.00 57.28  ? 262 LYS A O     1 
ATOM   2011 C  CB    . LYS A 1 265 ? 58.204 -40.757 4.450   1.00 61.07  ? 262 LYS A CB    1 
ATOM   2012 C  CG    . LYS A 1 265 ? 58.789 -41.224 5.789   1.00 63.69  ? 262 LYS A CG    1 
ATOM   2013 C  CD    . LYS A 1 265 ? 60.280 -41.264 5.862   1.00 65.79  ? 262 LYS A CD    1 
ATOM   2014 C  CE    . LYS A 1 265 ? 60.758 -42.683 5.713   1.00 67.30  ? 262 LYS A CE    1 
ATOM   2015 N  NZ    . LYS A 1 265 ? 61.786 -42.790 4.631   1.00 69.93  ? 262 LYS A NZ    1 
ATOM   2016 N  N     . TYR A 1 266 ? 54.887 -39.197 3.486   1.00 55.79  ? 263 TYR A N     1 
ATOM   2017 C  CA    . TYR A 1 266 ? 53.983 -38.663 2.471   1.00 55.61  ? 263 TYR A CA    1 
ATOM   2018 C  C     . TYR A 1 266 ? 52.967 -37.773 3.103   1.00 55.18  ? 263 TYR A C     1 
ATOM   2019 O  O     . TYR A 1 266 ? 52.584 -37.979 4.254   1.00 55.02  ? 263 TYR A O     1 
ATOM   2020 C  CB    . TYR A 1 266 ? 53.243 -39.782 1.721   1.00 58.50  ? 263 TYR A CB    1 
ATOM   2021 C  CG    . TYR A 1 266 ? 54.194 -40.627 0.924   1.00 60.92  ? 263 TYR A CG    1 
ATOM   2022 C  CD1   . TYR A 1 266 ? 54.814 -40.124 -0.216  1.00 62.81  ? 263 TYR A CD1   1 
ATOM   2023 C  CD2   . TYR A 1 266 ? 54.558 -41.900 1.360   1.00 62.42  ? 263 TYR A CD2   1 
ATOM   2024 C  CE1   . TYR A 1 266 ? 55.757 -40.872 -0.911  1.00 64.24  ? 263 TYR A CE1   1 
ATOM   2025 C  CE2   . TYR A 1 266 ? 55.509 -42.653 0.680   1.00 64.30  ? 263 TYR A CE2   1 
ATOM   2026 C  CZ    . TYR A 1 266 ? 56.096 -42.140 -0.463  1.00 66.78  ? 263 TYR A CZ    1 
ATOM   2027 O  OH    . TYR A 1 266 ? 57.018 -42.884 -1.156  1.00 69.40  ? 263 TYR A OH    1 
ATOM   2028 N  N     . THR A 1 267 ? 52.501 -36.798 2.332   1.00 56.27  ? 264 THR A N     1 
ATOM   2029 C  CA    . THR A 1 267 ? 51.460 -35.850 2.739   1.00 55.75  ? 264 THR A CA    1 
ATOM   2030 C  C     . THR A 1 267 ? 50.125 -36.359 2.141   1.00 55.57  ? 264 THR A C     1 
ATOM   2031 O  O     . THR A 1 267 ? 50.154 -37.004 1.084   1.00 56.58  ? 264 THR A O     1 
ATOM   2032 C  CB    . THR A 1 267 ? 51.760 -34.439 2.176   1.00 60.36  ? 264 THR A CB    1 
ATOM   2033 O  OG1   . THR A 1 267 ? 51.430 -34.418 0.783   1.00 60.12  ? 264 THR A OG1   1 
ATOM   2034 C  CG2   . THR A 1 267 ? 53.200 -34.012 2.373   1.00 58.44  ? 264 THR A CG2   1 
ATOM   2035 N  N     . PRO A 1 268 ? 48.953 -36.046 2.743   1.00 55.99  ? 265 PRO A N     1 
ATOM   2036 C  CA    . PRO A 1 268 ? 47.674 -36.484 2.140   1.00 55.44  ? 265 PRO A CA    1 
ATOM   2037 C  C     . PRO A 1 268 ? 47.484 -36.052 0.665   1.00 55.54  ? 265 PRO A C     1 
ATOM   2038 O  O     . PRO A 1 268 ? 46.829 -36.763 -0.109  1.00 55.05  ? 265 PRO A O     1 
ATOM   2039 C  CB    . PRO A 1 268 ? 46.628 -35.864 3.068   1.00 56.62  ? 265 PRO A CB    1 
ATOM   2040 C  CG    . PRO A 1 268 ? 47.329 -35.716 4.370   1.00 55.33  ? 265 PRO A CG    1 
ATOM   2041 C  CD    . PRO A 1 268 ? 48.718 -35.304 3.997   1.00 56.51  ? 265 PRO A CD    1 
ATOM   2042 N  N     . HIS A 1 269 ? 48.087 -34.906 0.265   1.00 56.35  ? 266 HIS A N     1 
ATOM   2043 C  CA    . HIS A 1 269 ? 48.024 -34.385 -1.110  1.00 56.38  ? 266 HIS A CA    1 
ATOM   2044 C  C     . HIS A 1 269 ? 48.744 -35.368 -2.052  1.00 56.76  ? 266 HIS A C     1 
ATOM   2045 O  O     . HIS A 1 269 ? 48.191 -35.750 -3.080  1.00 56.09  ? 266 HIS A O     1 
ATOM   2046 C  CB    . HIS A 1 269 ? 48.655 -32.984 -1.203  1.00 56.12  ? 266 HIS A CB    1 
ATOM   2047 C  CG    . HIS A 1 269 ? 48.536 -32.358 -2.554  1.00 57.30  ? 266 HIS A CG    1 
ATOM   2048 N  ND1   . HIS A 1 269 ? 49.479 -32.582 -3.542  1.00 57.44  ? 266 HIS A ND1   1 
ATOM   2049 C  CD2   . HIS A 1 269 ? 47.589 -31.529 -3.039  1.00 55.67  ? 266 HIS A CD2   1 
ATOM   2050 C  CE1   . HIS A 1 269 ? 49.081 -31.873 -4.583  1.00 56.49  ? 266 HIS A CE1   1 
ATOM   2051 N  NE2   . HIS A 1 269 ? 47.946 -31.236 -4.333  1.00 57.79  ? 266 HIS A NE2   1 
ATOM   2052 N  N     . GLN A 1 270 ? 49.959 -35.791 -1.669  1.00 56.29  ? 267 GLN A N     1 
ATOM   2053 C  CA    . GLN A 1 270 ? 50.789 -36.742 -2.398  1.00 56.84  ? 267 GLN A CA    1 
ATOM   2054 C  C     . GLN A 1 270 ? 50.104 -38.069 -2.562  1.00 57.20  ? 267 GLN A C     1 
ATOM   2055 O  O     . GLN A 1 270 ? 50.149 -38.606 -3.647  1.00 57.39  ? 267 GLN A O     1 
ATOM   2056 C  CB    . GLN A 1 270 ? 52.136 -36.908 -1.718  1.00 58.11  ? 267 GLN A CB    1 
ATOM   2057 C  CG    . GLN A 1 270 ? 52.985 -35.664 -1.886  1.00 58.61  ? 267 GLN A CG    1 
ATOM   2058 C  CD    . GLN A 1 270 ? 54.087 -35.554 -0.889  1.00 58.50  ? 267 GLN A CD    1 
ATOM   2059 O  OE1   . GLN A 1 270 ? 54.222 -36.397 0.003   1.00 60.33  ? 267 GLN A OE1   1 
ATOM   2060 N  NE2   . GLN A 1 270 ? 54.913 -34.499 -1.019  1.00 59.91  ? 267 GLN A NE2   1 
ATOM   2061 N  N     . LEU A 1 271 ? 49.419 -38.587 -1.538  1.00 56.64  ? 268 LEU A N     1 
ATOM   2062 C  CA    . LEU A 1 271 ? 48.704 -39.864 -1.679  1.00 56.69  ? 268 LEU A CA    1 
ATOM   2063 C  C     . LEU A 1 271 ? 47.484 -39.727 -2.590  1.00 56.85  ? 268 LEU A C     1 
ATOM   2064 O  O     . LEU A 1 271 ? 47.111 -40.695 -3.254  1.00 57.18  ? 268 LEU A O     1 
ATOM   2065 C  CB    . LEU A 1 271 ? 48.308 -40.439 -0.321  1.00 55.69  ? 268 LEU A CB    1 
ATOM   2066 C  CG    . LEU A 1 271 ? 49.463 -40.652 0.666   1.00 56.41  ? 268 LEU A CG    1 
ATOM   2067 C  CD1   . LEU A 1 271 ? 48.952 -40.948 2.016   1.00 54.00  ? 268 LEU A CD1   1 
ATOM   2068 C  CD2   . LEU A 1 271 ? 50.375 -41.749 0.200   1.00 53.61  ? 268 LEU A CD2   1 
ATOM   2069 N  N     . LEU A 1 272 ? 46.883 -38.523 -2.662  1.00 55.65  ? 269 LEU A N     1 
ATOM   2070 C  CA    . LEU A 1 272 ? 45.724 -38.312 -3.518  1.00 55.62  ? 269 LEU A CA    1 
ATOM   2071 C  C     . LEU A 1 272 ? 46.083 -38.069 -4.986  1.00 56.09  ? 269 LEU A C     1 
ATOM   2072 O  O     . LEU A 1 272 ? 45.439 -38.634 -5.864  1.00 55.07  ? 269 LEU A O     1 
ATOM   2073 C  CB    . LEU A 1 272 ? 44.816 -37.192 -2.968  1.00 54.31  ? 269 LEU A CB    1 
ATOM   2074 C  CG    . LEU A 1 272 ? 43.507 -36.921 -3.723  1.00 53.71  ? 269 LEU A CG    1 
ATOM   2075 C  CD1   . LEU A 1 272 ? 42.610 -38.150 -3.742  1.00 52.65  ? 269 LEU A CD1   1 
ATOM   2076 C  CD2   . LEU A 1 272 ? 42.771 -35.751 -3.140  1.00 54.20  ? 269 LEU A CD2   1 
ATOM   2077 N  N     . PHE A 1 273 ? 47.100 -37.236 -5.259  1.00 55.45  ? 270 PHE A N     1 
ATOM   2078 C  CA    . PHE A 1 273 ? 47.482 -36.844 -6.618  1.00 56.32  ? 270 PHE A CA    1 
ATOM   2079 C  C     . PHE A 1 273 ? 48.812 -37.384 -7.150  1.00 56.79  ? 270 PHE A C     1 
ATOM   2080 O  O     . PHE A 1 273 ? 49.050 -37.287 -8.359  1.00 57.67  ? 270 PHE A O     1 
ATOM   2081 C  CB    . PHE A 1 273 ? 47.498 -35.305 -6.719  1.00 55.86  ? 270 PHE A CB    1 
ATOM   2082 C  CG    . PHE A 1 273 ? 46.239 -34.582 -6.309  1.00 55.82  ? 270 PHE A CG    1 
ATOM   2083 C  CD1   . PHE A 1 273 ? 45.125 -34.562 -7.142  1.00 55.39  ? 270 PHE A CD1   1 
ATOM   2084 C  CD2   . PHE A 1 273 ? 46.180 -33.879 -5.113  1.00 54.45  ? 270 PHE A CD2   1 
ATOM   2085 C  CE1   . PHE A 1 273 ? 43.962 -33.861 -6.771  1.00 55.57  ? 270 PHE A CE1   1 
ATOM   2086 C  CE2   . PHE A 1 273 ? 45.023 -33.167 -4.748  1.00 52.81  ? 270 PHE A CE2   1 
ATOM   2087 C  CZ    . PHE A 1 273 ? 43.921 -33.170 -5.576  1.00 54.92  ? 270 PHE A CZ    1 
ATOM   2088 N  N     . GLY A 1 274 ? 49.674 -37.897 -6.280  1.00 56.27  ? 271 GLY A N     1 
ATOM   2089 C  CA    . GLY A 1 274 ? 50.980 -38.399 -6.695  1.00 56.49  ? 271 GLY A CA    1 
ATOM   2090 C  C     . GLY A 1 274 ? 51.950 -37.313 -7.138  1.00 56.89  ? 271 GLY A C     1 
ATOM   2091 O  O     . GLY A 1 274 ? 52.995 -37.614 -7.730  1.00 57.14  ? 271 GLY A O     1 
ATOM   2092 N  N     . ILE A 1 275 ? 51.625 -36.043 -6.843  1.00 57.43  ? 272 ILE A N     1 
ATOM   2093 C  CA    . ILE A 1 275 ? 52.420 -34.867 -7.214  1.00 57.37  ? 272 ILE A CA    1 
ATOM   2094 C  C     . ILE A 1 275 ? 52.005 -33.640 -6.388  1.00 56.85  ? 272 ILE A C     1 
ATOM   2095 O  O     . ILE A 1 275 ? 50.808 -33.388 -6.243  1.00 56.72  ? 272 ILE A O     1 
ATOM   2096 C  CB    . ILE A 1 275 ? 52.313 -34.578 -8.759  1.00 59.63  ? 272 ILE A CB    1 
ATOM   2097 C  CG1   . ILE A 1 275 ? 53.196 -33.399 -9.174  1.00 60.16  ? 272 ILE A CG1   1 
ATOM   2098 C  CG2   . ILE A 1 275 ? 50.869 -34.408 -9.245  1.00 60.63  ? 272 ILE A CG2   1 
ATOM   2099 C  CD1   . ILE A 1 275 ? 53.357 -33.234 -10.602 1.00 61.94  ? 272 ILE A CD1   1 
ATOM   2100 N  N     . ASP A 1 276 ? 52.990 -32.864 -5.889  1.00 58.25  ? 273 ASP A N     1 
ATOM   2101 C  CA    . ASP A 1 276 ? 52.708 -31.647 -5.139  1.00 58.00  ? 273 ASP A CA    1 
ATOM   2102 C  C     . ASP A 1 276 ? 52.268 -30.554 -6.115  1.00 58.07  ? 273 ASP A C     1 
ATOM   2103 O  O     . ASP A 1 276 ? 52.691 -30.566 -7.272  1.00 58.36  ? 273 ASP A O     1 
ATOM   2104 C  CB    . ASP A 1 276 ? 53.933 -31.194 -4.342  1.00 60.49  ? 273 ASP A CB    1 
ATOM   2105 C  CG    . ASP A 1 276 ? 54.143 -31.913 -3.011  1.00 61.73  ? 273 ASP A CG    1 
ATOM   2106 O  OD1   . ASP A 1 276 ? 53.170 -32.513 -2.494  1.00 62.34  ? 273 ASP A OD1   1 
ATOM   2107 O  OD2   . ASP A 1 276 ? 55.283 -31.865 -2.478  1.00 65.01  ? 273 ASP A OD2   1 
ATOM   2108 N  N     . SER A 1 277 ? 51.386 -29.641 -5.671  1.00 56.79  ? 274 SER A N     1 
ATOM   2109 C  CA    . SER A 1 277 ? 50.950 -28.531 -6.513  1.00 56.69  ? 274 SER A CA    1 
ATOM   2110 C  C     . SER A 1 277 ? 51.922 -27.371 -6.210  1.00 56.76  ? 274 SER A C     1 
ATOM   2111 O  O     . SER A 1 277 ? 52.946 -27.582 -5.549  1.00 56.90  ? 274 SER A O     1 
ATOM   2112 C  CB    . SER A 1 277 ? 49.481 -28.164 -6.269  1.00 58.91  ? 274 SER A CB    1 
ATOM   2113 O  OG    . SER A 1 277 ? 49.209 -27.662 -4.969  1.00 59.20  ? 274 SER A OG    1 
ATOM   2114 N  N     . ASN A 1 278 ? 51.625 -26.160 -6.693  1.00 55.70  ? 275 ASN A N     1 
ATOM   2115 C  CA    . ASN A 1 278 ? 52.469 -24.992 -6.479  1.00 55.92  ? 275 ASN A CA    1 
ATOM   2116 C  C     . ASN A 1 278 ? 52.356 -24.471 -5.030  1.00 56.41  ? 275 ASN A C     1 
ATOM   2117 O  O     . ASN A 1 278 ? 51.930 -23.342 -4.793  1.00 56.26  ? 275 ASN A O     1 
ATOM   2118 C  CB    . ASN A 1 278 ? 52.160 -23.936 -7.550  1.00 53.76  ? 275 ASN A CB    1 
ATOM   2119 C  CG    . ASN A 1 278 ? 52.952 -22.661 -7.474  1.00 54.47  ? 275 ASN A CG    1 
ATOM   2120 O  OD1   . ASN A 1 278 ? 54.122 -22.647 -7.060  1.00 51.85  ? 275 ASN A OD1   1 
ATOM   2121 N  ND2   . ASN A 1 278 ? 52.314 -21.558 -7.855  1.00 51.81  ? 275 ASN A ND2   1 
ATOM   2122 N  N     . THR A 1 279 ? 52.740 -25.305 -4.056  1.00 55.38  ? 276 THR A N     1 
ATOM   2123 C  CA    . THR A 1 279 ? 52.734 -24.934 -2.634  1.00 56.02  ? 276 THR A CA    1 
ATOM   2124 C  C     . THR A 1 279 ? 54.205 -24.813 -2.178  1.00 56.30  ? 276 THR A C     1 
ATOM   2125 O  O     . THR A 1 279 ? 55.079 -25.362 -2.858  1.00 56.57  ? 276 THR A O     1 
ATOM   2126 C  CB    . THR A 1 279 ? 51.953 -25.941 -1.752  1.00 56.51  ? 276 THR A CB    1 
ATOM   2127 O  OG1   . THR A 1 279 ? 52.557 -27.242 -1.853  1.00 56.24  ? 276 THR A OG1   1 
ATOM   2128 C  CG2   . THR A 1 279 ? 50.451 -25.957 -2.033  1.00 56.50  ? 276 THR A CG2   1 
ATOM   2129 N  N     . PRO A 1 280 ? 54.513 -24.141 -1.040  1.00 54.57  ? 277 PRO A N     1 
ATOM   2130 C  CA    . PRO A 1 280 ? 55.909 -24.035 -0.617  1.00 54.68  ? 277 PRO A CA    1 
ATOM   2131 C  C     . PRO A 1 280 ? 56.555 -25.387 -0.379  1.00 55.30  ? 277 PRO A C     1 
ATOM   2132 O  O     . PRO A 1 280 ? 55.892 -26.303 0.107   1.00 55.25  ? 277 PRO A O     1 
ATOM   2133 C  CB    . PRO A 1 280 ? 55.813 -23.223 0.682   1.00 55.60  ? 277 PRO A CB    1 
ATOM   2134 C  CG    . PRO A 1 280 ? 54.551 -22.463 0.540   1.00 54.58  ? 277 PRO A CG    1 
ATOM   2135 C  CD    . PRO A 1 280 ? 53.629 -23.420 -0.103  1.00 55.18  ? 277 PRO A CD    1 
ATOM   2136 N  N     . PHE A 1 281 ? 57.852 -25.504 -0.729  1.00 56.57  ? 278 PHE A N     1 
ATOM   2137 C  CA    . PHE A 1 281 ? 58.658 -26.713 -0.569  1.00 57.28  ? 278 PHE A CA    1 
ATOM   2138 C  C     . PHE A 1 281 ? 58.093 -27.906 -1.287  1.00 58.73  ? 278 PHE A C     1 
ATOM   2139 O  O     . PHE A 1 281 ? 58.124 -29.011 -0.739  1.00 59.39  ? 278 PHE A O     1 
ATOM   2140 C  CB    . PHE A 1 281 ? 58.881 -27.031 0.909   1.00 58.23  ? 278 PHE A CB    1 
ATOM   2141 C  CG    . PHE A 1 281 ? 59.620 -25.943 1.635   1.00 56.70  ? 278 PHE A CG    1 
ATOM   2142 C  CD1   . PHE A 1 281 ? 58.940 -24.844 2.151   1.00 56.03  ? 278 PHE A CD1   1 
ATOM   2143 C  CD2   . PHE A 1 281 ? 60.996 -26.020 1.820   1.00 54.94  ? 278 PHE A CD2   1 
ATOM   2144 C  CE1   . PHE A 1 281 ? 59.625 -23.837 2.824   1.00 56.59  ? 278 PHE A CE1   1 
ATOM   2145 C  CE2   . PHE A 1 281 ? 61.678 -25.010 2.499   1.00 55.14  ? 278 PHE A CE2   1 
ATOM   2146 C  CZ    . PHE A 1 281 ? 60.989 -23.927 2.994   1.00 55.05  ? 278 PHE A CZ    1 
ATOM   2147 N  N     . ALA A 1 282 ? 57.568 -27.701 -2.503  1.00 61.42  ? 279 ALA A N     1 
ATOM   2148 C  CA    . ALA A 1 282 ? 56.994 -28.794 -3.289  1.00 62.36  ? 279 ALA A CA    1 
ATOM   2149 C  C     . ALA A 1 282 ? 58.096 -29.801 -3.650  1.00 63.27  ? 279 ALA A C     1 
ATOM   2150 O  O     . ALA A 1 282 ? 59.202 -29.395 -4.030  1.00 63.21  ? 279 ALA A O     1 
ATOM   2151 C  CB    . ALA A 1 282 ? 56.325 -28.254 -4.553  1.00 62.41  ? 279 ALA A CB    1 
ATOM   2152 N  N     . ASN A 1 283 ? 57.801 -31.105 -3.497  1.00 65.31  ? 280 ASN A N     1 
ATOM   2153 C  CA    . ASN A 1 283 ? 58.725 -32.184 -3.824  1.00 66.82  ? 280 ASN A CA    1 
ATOM   2154 C  C     . ASN A 1 283 ? 58.896 -32.226 -5.351  1.00 68.18  ? 280 ASN A C     1 
ATOM   2155 O  O     . ASN A 1 283 ? 57.903 -32.138 -6.063  1.00 67.59  ? 280 ASN A O     1 
ATOM   2156 C  CB    . ASN A 1 283 ? 58.200 -33.513 -3.284  1.00 66.19  ? 280 ASN A CB    1 
ATOM   2157 C  CG    . ASN A 1 283 ? 59.142 -34.663 -3.531  1.00 66.94  ? 280 ASN A CG    1 
ATOM   2158 O  OD1   . ASN A 1 283 ? 59.064 -35.344 -4.565  1.00 67.95  ? 280 ASN A OD1   1 
ATOM   2159 N  ND2   . ASN A 1 283 ? 60.060 -34.893 -2.591  1.00 65.65  ? 280 ASN A ND2   1 
ATOM   2160 N  N     . GLN A 1 284 ? 60.148 -32.340 -5.847  1.00 73.04  ? 281 GLN A N     1 
ATOM   2161 C  CA    . GLN A 1 284 ? 60.451 -32.347 -7.285  1.00 74.93  ? 281 GLN A CA    1 
ATOM   2162 C  C     . GLN A 1 284 ? 61.063 -33.661 -7.829  1.00 75.21  ? 281 GLN A C     1 
ATOM   2163 O  O     . GLN A 1 284 ? 61.557 -33.680 -8.960  1.00 75.88  ? 281 GLN A O     1 
ATOM   2164 C  CB    . GLN A 1 284 ? 61.377 -31.162 -7.612  1.00 77.60  ? 281 GLN A CB    1 
ATOM   2165 C  CG    . GLN A 1 284 ? 60.688 -29.799 -7.683  1.00 80.60  ? 281 GLN A CG    1 
ATOM   2166 C  CD    . GLN A 1 284 ? 61.684 -28.686 -7.972  1.00 85.67  ? 281 GLN A CD    1 
ATOM   2167 O  OE1   . GLN A 1 284 ? 62.773 -28.599 -7.362  1.00 88.40  ? 281 GLN A OE1   1 
ATOM   2168 N  NE2   . GLN A 1 284 ? 61.332 -27.802 -8.917  1.00 88.06  ? 281 GLN A NE2   1 
ATOM   2169 N  N     . ASP A 1 285 ? 61.016 -34.743 -7.045  1.00 74.95  ? 282 ASP A N     1 
ATOM   2170 C  CA    . ASP A 1 285 ? 61.597 -36.043 -7.381  1.00 75.36  ? 282 ASP A CA    1 
ATOM   2171 C  C     . ASP A 1 285 ? 61.048 -36.752 -8.641  1.00 75.54  ? 282 ASP A C     1 
ATOM   2172 O  O     . ASP A 1 285 ? 61.786 -37.540 -9.230  1.00 75.64  ? 282 ASP A O     1 
ATOM   2173 C  CB    . ASP A 1 285 ? 61.512 -37.000 -6.179  1.00 77.27  ? 282 ASP A CB    1 
ATOM   2174 C  CG    . ASP A 1 285 ? 62.222 -36.535 -4.915  1.00 77.45  ? 282 ASP A CG    1 
ATOM   2175 O  OD1   . ASP A 1 285 ? 62.954 -35.512 -4.982  1.00 77.33  ? 282 ASP A OD1   1 
ATOM   2176 O  OD2   . ASP A 1 285 ? 62.048 -37.196 -3.859  1.00 77.71  ? 282 ASP A OD2   1 
ATOM   2177 N  N     . THR A 1 286 ? 59.803 -36.497 -9.054  1.00 74.59  ? 283 THR A N     1 
ATOM   2178 C  CA    . THR A 1 286 ? 59.224 -37.162 -10.230 1.00 74.46  ? 283 THR A CA    1 
ATOM   2179 C  C     . THR A 1 286 ? 59.185 -36.272 -11.466 1.00 74.78  ? 283 THR A C     1 
ATOM   2180 O  O     . THR A 1 286 ? 58.469 -36.579 -12.426 1.00 74.89  ? 283 THR A O     1 
ATOM   2181 C  CB    . THR A 1 286 ? 57.841 -37.727 -9.889  1.00 78.05  ? 283 THR A CB    1 
ATOM   2182 O  OG1   . THR A 1 286 ? 57.011 -36.682 -9.362  1.00 77.57  ? 283 THR A OG1   1 
ATOM   2183 C  CG2   . THR A 1 286 ? 57.915 -38.883 -8.919  1.00 77.16  ? 283 THR A CG2   1 
ATOM   2184 N  N     . LEU A 1 287 ? 59.960 -35.179 -11.456 1.00 76.53  ? 284 LEU A N     1 
ATOM   2185 C  CA    . LEU A 1 287 ? 60.009 -34.209 -12.552 1.00 77.42  ? 284 LEU A CA    1 
ATOM   2186 C  C     . LEU A 1 287 ? 60.322 -34.790 -13.925 1.00 77.29  ? 284 LEU A C     1 
ATOM   2187 O  O     . LEU A 1 287 ? 59.744 -34.341 -14.911 1.00 77.56  ? 284 LEU A O     1 
ATOM   2188 C  CB    . LEU A 1 287 ? 60.985 -33.060 -12.246 1.00 78.11  ? 284 LEU A CB    1 
ATOM   2189 C  CG    . LEU A 1 287 ? 60.363 -31.761 -11.711 1.00 79.81  ? 284 LEU A CG    1 
ATOM   2190 C  CD1   . LEU A 1 287 ? 61.435 -30.718 -11.449 1.00 80.13  ? 284 LEU A CD1   1 
ATOM   2191 C  CD2   . LEU A 1 287 ? 59.287 -31.193 -12.678 1.00 81.03  ? 284 LEU A CD2   1 
ATOM   2192 N  N     . ASP A 1 288 ? 61.240 -35.766 -13.998 1.00 78.30  ? 285 ASP A N     1 
ATOM   2193 C  CA    . ASP A 1 288 ? 61.627 -36.374 -15.275 1.00 78.15  ? 285 ASP A CA    1 
ATOM   2194 C  C     . ASP A 1 288 ? 60.717 -37.557 -15.687 1.00 77.38  ? 285 ASP A C     1 
ATOM   2195 O  O     . ASP A 1 288 ? 60.832 -38.055 -16.809 1.00 77.31  ? 285 ASP A O     1 
ATOM   2196 C  CB    . ASP A 1 288 ? 63.114 -36.752 -15.262 1.00 80.34  ? 285 ASP A CB    1 
ATOM   2197 C  CG    . ASP A 1 288 ? 64.046 -35.565 -15.019 1.00 83.13  ? 285 ASP A CG    1 
ATOM   2198 O  OD1   . ASP A 1 288 ? 63.790 -34.471 -15.593 1.00 86.31  ? 285 ASP A OD1   1 
ATOM   2199 O  OD2   . ASP A 1 288 ? 65.031 -35.728 -14.259 1.00 84.71  ? 285 ASP A OD2   1 
ATOM   2200 N  N     . LEU A 1 289 ? 59.797 -37.984 -14.799 1.00 73.53  ? 286 LEU A N     1 
ATOM   2201 C  CA    . LEU A 1 289 ? 58.880 -39.073 -15.106 1.00 72.24  ? 286 LEU A CA    1 
ATOM   2202 C  C     . LEU A 1 289 ? 57.697 -38.529 -15.860 1.00 71.45  ? 286 LEU A C     1 
ATOM   2203 O  O     . LEU A 1 289 ? 57.356 -37.366 -15.690 1.00 71.70  ? 286 LEU A O     1 
ATOM   2204 C  CB    . LEU A 1 289 ? 58.369 -39.758 -13.825 1.00 71.35  ? 286 LEU A CB    1 
ATOM   2205 C  CG    . LEU A 1 289 ? 59.376 -40.479 -12.947 1.00 72.30  ? 286 LEU A CG    1 
ATOM   2206 C  CD1   . LEU A 1 289 ? 58.676 -41.102 -11.773 1.00 72.18  ? 286 LEU A CD1   1 
ATOM   2207 C  CD2   . LEU A 1 289 ? 60.124 -41.558 -13.720 1.00 73.38  ? 286 LEU A CD2   1 
ATOM   2208 N  N     . THR A 1 290 ? 57.043 -39.365 -16.672 1.00 71.41  ? 287 THR A N     1 
ATOM   2209 C  CA    . THR A 1 290 ? 55.842 -38.941 -17.385 1.00 71.01  ? 287 THR A CA    1 
ATOM   2210 C  C     . THR A 1 290 ? 54.721 -39.085 -16.350 1.00 70.80  ? 287 THR A C     1 
ATOM   2211 O  O     . THR A 1 290 ? 54.920 -39.766 -15.344 1.00 70.40  ? 287 THR A O     1 
ATOM   2212 C  CB    . THR A 1 290 ? 55.591 -39.837 -18.620 1.00 74.34  ? 287 THR A CB    1 
ATOM   2213 O  OG1   . THR A 1 290 ? 55.374 -41.194 -18.216 1.00 74.66  ? 287 THR A OG1   1 
ATOM   2214 C  CG2   . THR A 1 290 ? 56.703 -39.764 -19.634 1.00 74.02  ? 287 THR A CG2   1 
ATOM   2215 N  N     . ARG A 1 291 ? 53.553 -38.495 -16.581 1.00 70.05  ? 288 ARG A N     1 
ATOM   2216 C  CA    . ARG A 1 291 ? 52.453 -38.661 -15.641 1.00 70.22  ? 288 ARG A CA    1 
ATOM   2217 C  C     . ARG A 1 291 ? 52.155 -40.167 -15.415 1.00 70.86  ? 288 ARG A C     1 
ATOM   2218 O  O     . ARG A 1 291 ? 51.853 -40.559 -14.286 1.00 71.15  ? 288 ARG A O     1 
ATOM   2219 C  CB    . ARG A 1 291 ? 51.205 -37.899 -16.127 1.00 68.30  ? 288 ARG A CB    1 
ATOM   2220 C  CG    . ARG A 1 291 ? 49.988 -37.976 -15.218 1.00 66.98  ? 288 ARG A CG    1 
ATOM   2221 C  CD    . ARG A 1 291 ? 50.319 -37.571 -13.798 1.00 62.21  ? 288 ARG A CD    1 
ATOM   2222 N  NE    . ARG A 1 291 ? 49.125 -37.459 -12.964 1.00 64.05  ? 288 ARG A NE    1 
ATOM   2223 C  CZ    . ARG A 1 291 ? 49.149 -37.347 -11.641 1.00 63.38  ? 288 ARG A CZ    1 
ATOM   2224 N  NH1   . ARG A 1 291 ? 50.302 -37.373 -10.988 1.00 63.03  ? 288 ARG A NH1   1 
ATOM   2225 N  NH2   . ARG A 1 291 ? 48.014 -37.245 -10.958 1.00 60.70  ? 288 ARG A NH2   1 
ATOM   2226 N  N     . GLU A 1 292 ? 52.265 -41.003 -16.476 1.00 73.65  ? 289 GLU A N     1 
ATOM   2227 C  CA    . GLU A 1 292 ? 52.013 -42.445 -16.370 1.00 74.53  ? 289 GLU A CA    1 
ATOM   2228 C  C     . GLU A 1 292 ? 53.012 -43.140 -15.495 1.00 73.91  ? 289 GLU A C     1 
ATOM   2229 O  O     . GLU A 1 292 ? 52.611 -43.967 -14.678 1.00 74.08  ? 289 GLU A O     1 
ATOM   2230 C  CB    . GLU A 1 292 ? 51.892 -43.123 -17.729 1.00 77.99  ? 289 GLU A CB    1 
ATOM   2231 C  CG    . GLU A 1 292 ? 50.460 -43.077 -18.243 1.00 81.39  ? 289 GLU A CG    1 
ATOM   2232 C  CD    . GLU A 1 292 ? 50.113 -43.987 -19.409 1.00 86.92  ? 289 GLU A CD    1 
ATOM   2233 O  OE1   . GLU A 1 292 ? 49.248 -43.583 -20.226 1.00 87.57  ? 289 GLU A OE1   1 
ATOM   2234 O  OE2   . GLU A 1 292 ? 50.698 -45.096 -19.508 1.00 89.20  ? 289 GLU A OE2   1 
ATOM   2235 N  N     . GLU A 1 293 ? 54.302 -42.784 -15.624 1.00 71.54  ? 290 GLU A N     1 
ATOM   2236 C  CA    . GLU A 1 293 ? 55.365 -43.350 -14.796 1.00 71.84  ? 290 GLU A CA    1 
ATOM   2237 C  C     . GLU A 1 293 ? 55.118 -42.929 -13.338 1.00 71.35  ? 290 GLU A C     1 
ATOM   2238 O  O     . GLU A 1 293 ? 55.238 -43.745 -12.425 1.00 71.23  ? 290 GLU A O     1 
ATOM   2239 C  CB    . GLU A 1 293 ? 56.748 -42.901 -15.291 1.00 73.62  ? 290 GLU A CB    1 
ATOM   2240 C  CG    . GLU A 1 293 ? 57.067 -43.392 -16.697 1.00 76.59  ? 290 GLU A CG    1 
ATOM   2241 C  CD    . GLU A 1 293 ? 58.365 -42.912 -17.330 1.00 80.05  ? 290 GLU A CD    1 
ATOM   2242 O  OE1   . GLU A 1 293 ? 58.731 -41.727 -17.155 1.00 82.39  ? 290 GLU A OE1   1 
ATOM   2243 O  OE2   . GLU A 1 293 ? 59.015 -43.730 -18.020 1.00 82.74  ? 290 GLU A OE2   1 
ATOM   2244 N  N     . GLU A 1 294 ? 54.725 -41.659 -13.141 1.00 70.50  ? 291 GLU A N     1 
ATOM   2245 C  CA    . GLU A 1 294 ? 54.396 -41.037 -11.862 1.00 69.67  ? 291 GLU A CA    1 
ATOM   2246 C  C     . GLU A 1 294 ? 53.202 -41.753 -11.182 1.00 69.25  ? 291 GLU A C     1 
ATOM   2247 O  O     . GLU A 1 294 ? 53.301 -42.052 -9.992  1.00 68.23  ? 291 GLU A O     1 
ATOM   2248 C  CB    . GLU A 1 294 ? 54.065 -39.572 -12.122 1.00 71.04  ? 291 GLU A CB    1 
ATOM   2249 C  CG    . GLU A 1 294 ? 54.276 -38.622 -10.966 1.00 70.09  ? 291 GLU A CG    1 
ATOM   2250 C  CD    . GLU A 1 294 ? 54.074 -37.197 -11.441 1.00 70.13  ? 291 GLU A CD    1 
ATOM   2251 O  OE1   . GLU A 1 294 ? 52.926 -36.846 -11.798 1.00 68.76  ? 291 GLU A OE1   1 
ATOM   2252 O  OE2   . GLU A 1 294 ? 55.071 -36.440 -11.486 1.00 68.58  ? 291 GLU A OE2   1 
ATOM   2253 N  N     . LEU A 1 295 ? 52.095 -42.043 -11.936 1.00 67.57  ? 292 LEU A N     1 
ATOM   2254 C  CA    . LEU A 1 295 ? 50.890 -42.731 -11.437 1.00 68.00  ? 292 LEU A CA    1 
ATOM   2255 C  C     . LEU A 1 295 ? 51.139 -44.201 -11.103 1.00 68.74  ? 292 LEU A C     1 
ATOM   2256 O  O     . LEU A 1 295 ? 50.413 -44.788 -10.305 1.00 69.46  ? 292 LEU A O     1 
ATOM   2257 C  CB    . LEU A 1 295 ? 49.719 -42.621 -12.435 1.00 68.07  ? 292 LEU A CB    1 
ATOM   2258 C  CG    . LEU A 1 295 ? 49.049 -41.245 -12.580 1.00 68.35  ? 292 LEU A CG    1 
ATOM   2259 C  CD1   . LEU A 1 295 ? 47.913 -41.290 -13.583 1.00 66.10  ? 292 LEU A CD1   1 
ATOM   2260 C  CD2   . LEU A 1 295 ? 48.552 -40.710 -11.230 1.00 66.15  ? 292 LEU A CD2   1 
ATOM   2261 N  N     . SER A 1 296 ? 52.148 -44.795 -11.736 1.00 68.96  ? 293 SER A N     1 
ATOM   2262 C  CA    . SER A 1 296 ? 52.570 -46.179 -11.566 1.00 69.05  ? 293 SER A CA    1 
ATOM   2263 C  C     . SER A 1 296 ? 53.279 -46.297 -10.215 1.00 68.51  ? 293 SER A C     1 
ATOM   2264 O  O     . SER A 1 296 ? 53.040 -47.249 -9.465  1.00 68.29  ? 293 SER A O     1 
ATOM   2265 C  CB    . SER A 1 296 ? 53.506 -46.563 -12.712 1.00 72.80  ? 293 SER A CB    1 
ATOM   2266 O  OG    . SER A 1 296 ? 53.894 -47.923 -12.685 1.00 73.25  ? 293 SER A OG    1 
ATOM   2267 N  N     . LEU A 1 297 ? 54.142 -45.313 -9.905  1.00 68.56  ? 294 LEU A N     1 
ATOM   2268 C  CA    . LEU A 1 297 ? 54.892 -45.224 -8.660  1.00 68.62  ? 294 LEU A CA    1 
ATOM   2269 C  C     . LEU A 1 297 ? 53.928 -44.910 -7.505  1.00 68.76  ? 294 LEU A C     1 
ATOM   2270 O  O     . LEU A 1 297 ? 54.104 -45.446 -6.404  1.00 68.62  ? 294 LEU A O     1 
ATOM   2271 C  CB    . LEU A 1 297 ? 55.954 -44.142 -8.803  1.00 68.44  ? 294 LEU A CB    1 
ATOM   2272 C  CG    . LEU A 1 297 ? 56.713 -43.729 -7.562  1.00 69.52  ? 294 LEU A CG    1 
ATOM   2273 C  CD1   . LEU A 1 297 ? 57.481 -44.890 -6.958  1.00 68.46  ? 294 LEU A CD1   1 
ATOM   2274 C  CD2   . LEU A 1 297 ? 57.634 -42.575 -7.863  1.00 66.79  ? 294 LEU A CD2   1 
ATOM   2275 N  N     . LEU A 1 298 ? 52.895 -44.069 -7.765  1.00 67.92  ? 295 LEU A N     1 
ATOM   2276 C  CA    . LEU A 1 298 ? 51.882 -43.723 -6.774  1.00 68.18  ? 295 LEU A CA    1 
ATOM   2277 C  C     . LEU A 1 298 ? 51.057 -44.961 -6.408  1.00 69.12  ? 295 LEU A C     1 
ATOM   2278 O  O     . LEU A 1 298 ? 50.753 -45.163 -5.226  1.00 68.58  ? 295 LEU A O     1 
ATOM   2279 C  CB    . LEU A 1 298 ? 50.980 -42.565 -7.262  1.00 66.73  ? 295 LEU A CB    1 
ATOM   2280 C  CG    . LEU A 1 298 ? 49.683 -42.286 -6.477  1.00 64.91  ? 295 LEU A CG    1 
ATOM   2281 C  CD1   . LEU A 1 298 ? 49.973 -41.731 -5.086  1.00 63.46  ? 295 LEU A CD1   1 
ATOM   2282 C  CD2   . LEU A 1 298 ? 48.739 -41.416 -7.274  1.00 64.11  ? 295 LEU A CD2   1 
ATOM   2283 N  N     . GLN A 1 299 ? 50.710 -45.798 -7.411  1.00 72.98  ? 296 GLN A N     1 
ATOM   2284 C  CA    . GLN A 1 299 ? 49.933 -47.018 -7.185  1.00 74.51  ? 296 GLN A CA    1 
ATOM   2285 C  C     . GLN A 1 299 ? 50.693 -47.971 -6.297  1.00 74.18  ? 296 GLN A C     1 
ATOM   2286 O  O     . GLN A 1 299 ? 50.077 -48.607 -5.447  1.00 73.61  ? 296 GLN A O     1 
ATOM   2287 C  CB    . GLN A 1 299 ? 49.479 -47.655 -8.498  1.00 78.04  ? 296 GLN A CB    1 
ATOM   2288 C  CG    . GLN A 1 299 ? 48.336 -46.869 -9.170  1.00 82.60  ? 296 GLN A CG    1 
ATOM   2289 C  CD    . GLN A 1 299 ? 47.927 -47.453 -10.515 1.00 87.70  ? 296 GLN A CD    1 
ATOM   2290 O  OE1   . GLN A 1 299 ? 47.306 -48.534 -10.585 1.00 90.51  ? 296 GLN A OE1   1 
ATOM   2291 N  NE2   . GLN A 1 299 ? 48.261 -46.755 -11.618 1.00 88.24  ? 296 GLN A NE2   1 
ATOM   2292 N  N     . GLU A 1 300 ? 52.041 -48.003 -6.437  1.00 74.61  ? 297 GLU A N     1 
ATOM   2293 C  CA    . GLU A 1 300 ? 52.970 -48.813 -5.639  1.00 75.49  ? 297 GLU A CA    1 
ATOM   2294 C  C     . GLU A 1 300 ? 53.091 -48.266 -4.188  1.00 74.74  ? 297 GLU A C     1 
ATOM   2295 O  O     . GLU A 1 300 ? 53.051 -49.051 -3.237  1.00 75.11  ? 297 GLU A O     1 
ATOM   2296 C  CB    . GLU A 1 300 ? 54.346 -48.914 -6.349  1.00 78.20  ? 297 GLU A CB    1 
ATOM   2297 C  CG    . GLU A 1 300 ? 55.505 -49.524 -5.549  1.00 82.63  ? 297 GLU A CG    1 
ATOM   2298 C  CD    . GLU A 1 300 ? 55.332 -50.896 -4.898  1.00 89.42  ? 297 GLU A CD    1 
ATOM   2299 O  OE1   . GLU A 1 300 ? 54.579 -51.740 -5.446  1.00 92.09  ? 297 GLU A OE1   1 
ATOM   2300 O  OE2   . GLU A 1 300 ? 55.961 -51.125 -3.833  1.00 91.52  ? 297 GLU A OE2   1 
ATOM   2301 N  N     . ILE A 1 301 ? 53.245 -46.932 -4.030  1.00 71.44  ? 298 ILE A N     1 
ATOM   2302 C  CA    . ILE A 1 301 ? 53.348 -46.243 -2.740  1.00 70.71  ? 298 ILE A CA    1 
ATOM   2303 C  C     . ILE A 1 301 ? 52.090 -46.473 -1.896  1.00 70.15  ? 298 ILE A C     1 
ATOM   2304 O  O     . ILE A 1 301 ? 52.201 -46.794 -0.708  1.00 70.30  ? 298 ILE A O     1 
ATOM   2305 C  CB    . ILE A 1 301 ? 53.645 -44.735 -2.956  1.00 73.29  ? 298 ILE A CB    1 
ATOM   2306 C  CG1   . ILE A 1 301 ? 55.148 -44.521 -3.225  1.00 74.05  ? 298 ILE A CG1   1 
ATOM   2307 C  CG2   . ILE A 1 301 ? 53.145 -43.866 -1.781  1.00 73.40  ? 298 ILE A CG2   1 
ATOM   2308 C  CD1   . ILE A 1 301 ? 55.448 -43.341 -4.081  1.00 75.17  ? 298 ILE A CD1   1 
ATOM   2309 N  N     . ARG A 1 302 ? 50.902 -46.325 -2.522  1.00 68.67  ? 299 ARG A N     1 
ATOM   2310 C  CA    . ARG A 1 302 ? 49.606 -46.513 -1.879  1.00 68.39  ? 299 ARG A CA    1 
ATOM   2311 C  C     . ARG A 1 302 ? 49.439 -47.919 -1.276  1.00 68.68  ? 299 ARG A C     1 
ATOM   2312 O  O     . ARG A 1 302 ? 48.771 -48.058 -0.257  1.00 68.62  ? 299 ARG A O     1 
ATOM   2313 C  CB    . ARG A 1 302 ? 48.480 -46.234 -2.872  1.00 67.91  ? 299 ARG A CB    1 
ATOM   2314 C  CG    . ARG A 1 302 ? 48.222 -44.769 -3.141  1.00 66.89  ? 299 ARG A CG    1 
ATOM   2315 C  CD    . ARG A 1 302 ? 47.276 -44.614 -4.310  1.00 64.86  ? 299 ARG A CD    1 
ATOM   2316 N  NE    . ARG A 1 302 ? 46.798 -43.240 -4.451  1.00 62.65  ? 299 ARG A NE    1 
ATOM   2317 C  CZ    . ARG A 1 302 ? 46.135 -42.775 -5.509  1.00 61.97  ? 299 ARG A CZ    1 
ATOM   2318 N  NH1   . ARG A 1 302 ? 45.887 -43.566 -6.549  1.00 62.01  ? 299 ARG A NH1   1 
ATOM   2319 N  NH2   . ARG A 1 302 ? 45.748 -41.503 -5.553  1.00 57.27  ? 299 ARG A NH2   1 
ATOM   2320 N  N     . THR A 1 303 ? 50.040 -48.954 -1.893  1.00 68.92  ? 300 THR A N     1 
ATOM   2321 C  CA    . THR A 1 303 ? 49.916 -50.334 -1.408  1.00 69.29  ? 300 THR A CA    1 
ATOM   2322 C  C     . THR A 1 303 ? 50.961 -50.722 -0.367  1.00 68.82  ? 300 THR A C     1 
ATOM   2323 O  O     . THR A 1 303 ? 50.716 -51.652 0.407   1.00 69.66  ? 300 THR A O     1 
ATOM   2324 C  CB    . THR A 1 303 ? 49.896 -51.346 -2.566  1.00 73.82  ? 300 THR A CB    1 
ATOM   2325 O  OG1   . THR A 1 303 ? 51.124 -51.293 -3.286  1.00 75.81  ? 300 THR A OG1   1 
ATOM   2326 C  CG2   . THR A 1 303 ? 48.739 -51.135 -3.505  1.00 74.22  ? 300 THR A CG2   1 
ATOM   2327 N  N     . SER A 1 304 ? 52.115 -50.033 -0.345  1.00 66.61  ? 301 SER A N     1 
ATOM   2328 C  CA    . SER A 1 304 ? 53.190 -50.354 0.587   1.00 66.26  ? 301 SER A CA    1 
ATOM   2329 C  C     . SER A 1 304 ? 53.225 -49.502 1.879   1.00 65.42  ? 301 SER A C     1 
ATOM   2330 O  O     . SER A 1 304 ? 54.248 -49.484 2.573   1.00 65.43  ? 301 SER A O     1 
ATOM   2331 C  CB    . SER A 1 304 ? 54.523 -50.281 -0.137  1.00 70.75  ? 301 SER A CB    1 
ATOM   2332 O  OG    . SER A 1 304 ? 54.836 -48.922 -0.371  1.00 71.73  ? 301 SER A OG    1 
ATOM   2333 N  N     . LEU A 1 305 ? 52.113 -48.809 2.209   1.00 64.77  ? 302 LEU A N     1 
ATOM   2334 C  CA    . LEU A 1 305 ? 52.031 -47.969 3.405   1.00 63.96  ? 302 LEU A CA    1 
ATOM   2335 C  C     . LEU A 1 305 ? 51.981 -48.829 4.662   1.00 64.09  ? 302 LEU A C     1 
ATOM   2336 O  O     . LEU A 1 305 ? 51.374 -49.910 4.669   1.00 63.77  ? 302 LEU A O     1 
ATOM   2337 C  CB    . LEU A 1 305 ? 50.820 -47.022 3.367   1.00 61.43  ? 302 LEU A CB    1 
ATOM   2338 C  CG    . LEU A 1 305 ? 50.785 -45.931 2.299   1.00 59.99  ? 302 LEU A CG    1 
ATOM   2339 C  CD1   . LEU A 1 305 ? 49.510 -45.191 2.362   1.00 58.89  ? 302 LEU A CD1   1 
ATOM   2340 C  CD2   . LEU A 1 305 ? 51.922 -44.948 2.455   1.00 54.76  ? 302 LEU A CD2   1 
ATOM   2341 N  N     . TYR A 1 306 ? 52.630 -48.346 5.721   1.00 66.44  ? 303 TYR A N     1 
ATOM   2342 C  CA    . TYR A 1 306 ? 52.700 -48.993 7.012   1.00 67.44  ? 303 TYR A CA    1 
ATOM   2343 C  C     . TYR A 1 306 ? 51.325 -49.200 7.587   1.00 67.32  ? 303 TYR A C     1 
ATOM   2344 O  O     . TYR A 1 306 ? 50.507 -48.270 7.590   1.00 67.52  ? 303 TYR A O     1 
ATOM   2345 C  CB    . TYR A 1 306 ? 53.494 -48.095 7.945   1.00 67.68  ? 303 TYR A CB    1 
ATOM   2346 C  CG    . TYR A 1 306 ? 53.140 -48.230 9.405   1.00 70.04  ? 303 TYR A CG    1 
ATOM   2347 C  CD1   . TYR A 1 306 ? 53.677 -49.254 10.178  1.00 71.75  ? 303 TYR A CD1   1 
ATOM   2348 C  CD2   . TYR A 1 306 ? 52.296 -47.312 10.028  1.00 72.38  ? 303 TYR A CD2   1 
ATOM   2349 C  CE1   . TYR A 1 306 ? 53.376 -49.371 11.532  1.00 73.57  ? 303 TYR A CE1   1 
ATOM   2350 C  CE2   . TYR A 1 306 ? 51.975 -47.429 11.378  1.00 73.75  ? 303 TYR A CE2   1 
ATOM   2351 C  CZ    . TYR A 1 306 ? 52.525 -48.458 12.126  1.00 75.78  ? 303 TYR A CZ    1 
ATOM   2352 O  OH    . TYR A 1 306 ? 52.243 -48.591 13.462  1.00 80.03  ? 303 TYR A OH    1 
ATOM   2353 N  N     . HIS A 1 307 ? 51.070 -50.401 8.097   1.00 70.70  ? 304 HIS A N     1 
ATOM   2354 C  CA    . HIS A 1 307 ? 49.805 -50.673 8.743   1.00 70.92  ? 304 HIS A CA    1 
ATOM   2355 C  C     . HIS A 1 307 ? 50.043 -51.192 10.149  1.00 70.14  ? 304 HIS A C     1 
ATOM   2356 O  O     . HIS A 1 307 ? 50.739 -52.195 10.326  1.00 69.62  ? 304 HIS A O     1 
ATOM   2357 C  CB    . HIS A 1 307 ? 48.870 -51.583 7.940   1.00 73.41  ? 304 HIS A CB    1 
ATOM   2358 C  CG    . HIS A 1 307 ? 47.452 -51.470 8.434   1.00 75.90  ? 304 HIS A CG    1 
ATOM   2359 N  ND1   . HIS A 1 307 ? 46.660 -50.362 8.122   1.00 76.78  ? 304 HIS A ND1   1 
ATOM   2360 C  CD2   . HIS A 1 307 ? 46.753 -52.292 9.257   1.00 76.00  ? 304 HIS A CD2   1 
ATOM   2361 C  CE1   . HIS A 1 307 ? 45.513 -50.559 8.749   1.00 77.45  ? 304 HIS A CE1   1 
ATOM   2362 N  NE2   . HIS A 1 307 ? 45.519 -51.706 9.442   1.00 77.35  ? 304 HIS A NE2   1 
ATOM   2363 N  N     . PRO A 1 308 ? 49.493 -50.503 11.169  1.00 68.61  ? 305 PRO A N     1 
ATOM   2364 C  CA    . PRO A 1 308 ? 49.686 -50.963 12.555  1.00 68.58  ? 305 PRO A CA    1 
ATOM   2365 C  C     . PRO A 1 308 ? 48.956 -52.275 12.842  1.00 68.81  ? 305 PRO A C     1 
ATOM   2366 O  O     . PRO A 1 308 ? 47.981 -52.613 12.163  1.00 68.58  ? 305 PRO A O     1 
ATOM   2367 C  CB    . PRO A 1 308 ? 49.079 -49.826 13.372  1.00 69.31  ? 305 PRO A CB    1 
ATOM   2368 C  CG    . PRO A 1 308 ? 48.030 -49.262 12.478  1.00 69.16  ? 305 PRO A CG    1 
ATOM   2369 C  CD    . PRO A 1 308 ? 48.624 -49.312 11.115  1.00 68.67  ? 305 PRO A CD    1 
ATOM   2370 N  N     . SER A 1 309 ? 49.405 -53.004 13.858  1.00 72.48  ? 306 SER A N     1 
ATOM   2371 C  CA    . SER A 1 309 ? 48.747 -54.263 14.226  1.00 73.84  ? 306 SER A CA    1 
ATOM   2372 C  C     . SER A 1 309 ? 48.125 -54.132 15.611  1.00 74.02  ? 306 SER A C     1 
ATOM   2373 O  O     . SER A 1 309 ? 48.574 -53.279 16.399  1.00 74.18  ? 306 SER A O     1 
ATOM   2374 C  CB    . SER A 1 309 ? 49.730 -55.435 14.163  1.00 80.40  ? 306 SER A CB    1 
ATOM   2375 O  OG    . SER A 1 309 ? 50.937 -55.129 14.847  1.00 83.21  ? 306 SER A OG    1 
ATOM   2376 N  N     . THR A 1 310 ? 47.092 -54.970 15.909  1.00 71.60  ? 307 THR A N     1 
ATOM   2377 C  CA    . THR A 1 310 ? 46.397 -54.993 17.206  1.00 71.54  ? 307 THR A CA    1 
ATOM   2378 C  C     . THR A 1 310 ? 47.422 -55.077 18.351  1.00 70.87  ? 307 THR A C     1 
ATOM   2379 O  O     . THR A 1 310 ? 48.369 -55.860 18.262  1.00 70.40  ? 307 THR A O     1 
ATOM   2380 C  CB    . THR A 1 310 ? 45.376 -56.134 17.303  1.00 83.21  ? 307 THR A CB    1 
ATOM   2381 O  OG1   . THR A 1 310 ? 46.077 -57.374 17.297  1.00 86.54  ? 307 THR A OG1   1 
ATOM   2382 C  CG2   . THR A 1 310 ? 44.325 -56.091 16.207  1.00 81.93  ? 307 THR A CG2   1 
ATOM   2383 N  N     . PRO A 1 311 ? 47.281 -54.250 19.403  1.00 68.37  ? 308 PRO A N     1 
ATOM   2384 C  CA    . PRO A 1 311 ? 48.257 -54.297 20.496  1.00 68.37  ? 308 PRO A CA    1 
ATOM   2385 C  C     . PRO A 1 311 ? 48.033 -55.495 21.437  1.00 68.01  ? 308 PRO A C     1 
ATOM   2386 O  O     . PRO A 1 311 ? 46.986 -56.138 21.352  1.00 68.15  ? 308 PRO A O     1 
ATOM   2387 C  CB    . PRO A 1 311 ? 48.010 -52.969 21.212  1.00 69.44  ? 308 PRO A CB    1 
ATOM   2388 C  CG    . PRO A 1 311 ? 46.564 -52.719 21.027  1.00 69.08  ? 308 PRO A CG    1 
ATOM   2389 C  CD    . PRO A 1 311 ? 46.219 -53.253 19.670  1.00 69.24  ? 308 PRO A CD    1 
ATOM   2390 N  N     . PRO A 1 312 ? 48.974 -55.815 22.352  1.00 67.87  ? 309 PRO A N     1 
ATOM   2391 C  CA    . PRO A 1 312 ? 48.729 -56.937 23.278  1.00 67.83  ? 309 PRO A CA    1 
ATOM   2392 C  C     . PRO A 1 312 ? 47.519 -56.698 24.192  1.00 67.90  ? 309 PRO A C     1 
ATOM   2393 O  O     . PRO A 1 312 ? 47.257 -55.551 24.611  1.00 67.74  ? 309 PRO A O     1 
ATOM   2394 C  CB    . PRO A 1 312 ? 50.020 -57.006 24.107  1.00 68.75  ? 309 PRO A CB    1 
ATOM   2395 C  CG    . PRO A 1 312 ? 51.037 -56.266 23.303  1.00 68.86  ? 309 PRO A CG    1 
ATOM   2396 C  CD    . PRO A 1 312 ? 50.280 -55.182 22.617  1.00 68.74  ? 309 PRO A CD    1 
ATOM   2397 N  N     . ALA A 1 313 ? 46.770 -57.789 24.491  1.00 67.95  ? 310 ALA A N     1 
ATOM   2398 C  CA    . ALA A 1 313 ? 45.610 -57.764 25.377  1.00 68.65  ? 310 ALA A CA    1 
ATOM   2399 C  C     . ALA A 1 313 ? 46.110 -57.421 26.778  1.00 69.05  ? 310 ALA A C     1 
ATOM   2400 O  O     . ALA A 1 313 ? 47.247 -57.774 27.137  1.00 69.50  ? 310 ALA A O     1 
ATOM   2401 C  CB    . ALA A 1 313 ? 44.957 -59.125 25.404  1.00 68.74  ? 310 ALA A CB    1 
ATOM   2402 N  N     . SER A 1 314 ? 45.288 -56.728 27.573  1.00 67.58  ? 311 SER A N     1 
ATOM   2403 C  CA    . SER A 1 314 ? 45.718 -56.406 28.921  1.00 67.81  ? 311 SER A CA    1 
ATOM   2404 C  C     . SER A 1 314 ? 45.544 -57.671 29.775  1.00 67.58  ? 311 SER A C     1 
ATOM   2405 O  O     . SER A 1 314 ? 44.798 -58.580 29.382  1.00 67.38  ? 311 SER A O     1 
ATOM   2406 C  CB    . SER A 1 314 ? 44.938 -55.217 29.461  1.00 68.30  ? 311 SER A CB    1 
ATOM   2407 O  OG    . SER A 1 314 ? 43.594 -55.566 29.723  1.00 68.69  ? 311 SER A OG    1 
ATOM   2408 N  N     . SER A 1 315 ? 46.253 -57.755 30.914  1.00 69.22  ? 312 SER A N     1 
ATOM   2409 C  CA    . SER A 1 315 ? 46.196 -58.939 31.797  1.00 69.47  ? 312 SER A CA    1 
ATOM   2410 C  C     . SER A 1 315 ? 44.776 -59.399 32.119  1.00 68.79  ? 312 SER A C     1 
ATOM   2411 O  O     . SER A 1 315 ? 44.518 -60.598 32.172  1.00 69.05  ? 312 SER A O     1 
ATOM   2412 C  CB    . SER A 1 315 ? 46.973 -58.709 33.094  1.00 73.90  ? 312 SER A CB    1 
ATOM   2413 O  OG    . SER A 1 315 ? 47.570 -57.423 33.147  1.00 75.59  ? 312 SER A OG    1 
ATOM   2414 N  N     . ARG A 1 316 ? 43.853 -58.455 32.316  1.00 66.88  ? 313 ARG A N     1 
ATOM   2415 C  CA    . ARG A 1 316 ? 42.506 -58.819 32.684  1.00 66.33  ? 313 ARG A CA    1 
ATOM   2416 C  C     . ARG A 1 316 ? 41.443 -58.314 31.732  1.00 66.38  ? 313 ARG A C     1 
ATOM   2417 O  O     . ARG A 1 316 ? 40.572 -57.528 32.117  1.00 66.46  ? 313 ARG A O     1 
ATOM   2418 C  CB    . ARG A 1 316 ? 42.260 -58.375 34.109  1.00 63.38  ? 313 ARG A CB    1 
ATOM   2419 C  CG    . ARG A 1 316 ? 43.072 -59.218 35.049  1.00 62.79  ? 313 ARG A CG    1 
ATOM   2420 C  CD    . ARG A 1 316 ? 42.849 -58.719 36.403  1.00 59.54  ? 313 ARG A CD    1 
ATOM   2421 N  NE    . ARG A 1 316 ? 43.834 -59.214 37.349  1.00 56.59  ? 313 ARG A NE    1 
ATOM   2422 C  CZ    . ARG A 1 316 ? 43.720 -59.030 38.654  1.00 55.16  ? 313 ARG A CZ    1 
ATOM   2423 N  NH1   . ARG A 1 316 ? 42.677 -58.373 39.149  1.00 54.51  ? 313 ARG A NH1   1 
ATOM   2424 N  NH2   . ARG A 1 316 ? 44.645 -59.500 39.479  1.00 53.79  ? 313 ARG A NH2   1 
ATOM   2425 N  N     . SER A 1 317 ? 41.513 -58.781 30.475  1.00 67.32  ? 314 SER A N     1 
ATOM   2426 C  CA    . SER A 1 317 ? 40.549 -58.404 29.453  1.00 67.91  ? 314 SER A CA    1 
ATOM   2427 C  C     . SER A 1 317 ? 39.445 -59.462 29.305  1.00 68.34  ? 314 SER A C     1 
ATOM   2428 O  O     . SER A 1 317 ? 39.588 -60.603 29.764  1.00 68.51  ? 314 SER A O     1 
ATOM   2429 C  CB    . SER A 1 317 ? 41.231 -58.122 28.119  1.00 68.04  ? 314 SER A CB    1 
ATOM   2430 O  OG    . SER A 1 317 ? 42.054 -59.213 27.755  1.00 67.27  ? 314 SER A OG    1 
ATOM   2431 N  N     . TRP A 1 318 ? 38.336 -59.059 28.692  1.00 70.33  ? 315 TRP A N     1 
ATOM   2432 C  CA    . TRP A 1 318 ? 37.216 -59.938 28.444  1.00 70.89  ? 315 TRP A CA    1 
ATOM   2433 C  C     . TRP A 1 318 ? 36.855 -59.833 26.975  1.00 71.95  ? 315 TRP A C     1 
ATOM   2434 O  O     . TRP A 1 318 ? 37.001 -58.770 26.350  1.00 72.30  ? 315 TRP A O     1 
ATOM   2435 C  CB    . TRP A 1 318 ? 36.014 -59.614 29.361  1.00 69.18  ? 315 TRP A CB    1 
ATOM   2436 C  CG    . TRP A 1 318 ? 35.195 -58.430 28.934  1.00 67.93  ? 315 TRP A CG    1 
ATOM   2437 C  CD1   . TRP A 1 318 ? 35.509 -57.114 29.106  1.00 64.95  ? 315 TRP A CD1   1 
ATOM   2438 C  CD2   . TRP A 1 318 ? 33.928 -58.457 28.257  1.00 67.12  ? 315 TRP A CD2   1 
ATOM   2439 N  NE1   . TRP A 1 318 ? 34.525 -56.319 28.571  1.00 62.92  ? 315 TRP A NE1   1 
ATOM   2440 C  CE2   . TRP A 1 318 ? 33.537 -57.118 28.050  1.00 64.37  ? 315 TRP A CE2   1 
ATOM   2441 C  CE3   . TRP A 1 318 ? 33.076 -59.481 27.820  1.00 68.48  ? 315 TRP A CE3   1 
ATOM   2442 C  CZ2   . TRP A 1 318 ? 32.341 -56.780 27.407  1.00 64.62  ? 315 TRP A CZ2   1 
ATOM   2443 C  CZ3   . TRP A 1 318 ? 31.893 -59.143 27.193  1.00 67.88  ? 315 TRP A CZ3   1 
ATOM   2444 C  CH2   . TRP A 1 318 ? 31.544 -57.808 26.978  1.00 64.81  ? 315 TRP A CH2   1 
ATOM   2445 N  N     . SER A 1 319 ? 36.415 -60.945 26.405  1.00 75.60  ? 316 SER A N     1 
ATOM   2446 C  CA    . SER A 1 319 ? 35.993 -60.930 25.014  1.00 76.35  ? 316 SER A CA    1 
ATOM   2447 C  C     . SER A 1 319 ? 34.600 -61.561 24.919  1.00 76.39  ? 316 SER A C     1 
ATOM   2448 O  O     . SER A 1 319 ? 34.299 -62.500 25.674  1.00 76.58  ? 316 SER A O     1 
ATOM   2449 C  CB    . SER A 1 319 ? 37.053 -61.504 24.083  1.00 79.67  ? 316 SER A CB    1 
ATOM   2450 O  OG    . SER A 1 319 ? 38.057 -60.517 23.884  1.00 81.32  ? 316 SER A OG    1 
ATOM   2451 N  N     . PRO A 1 320 ? 33.705 -60.974 24.091  1.00 75.80  ? 317 PRO A N     1 
ATOM   2452 C  CA    . PRO A 1 320 ? 32.323 -61.473 24.032  1.00 75.85  ? 317 PRO A CA    1 
ATOM   2453 C  C     . PRO A 1 320 ? 32.135 -62.866 23.441  1.00 75.95  ? 317 PRO A C     1 
ATOM   2454 O  O     . PRO A 1 320 ? 32.841 -63.283 22.523  1.00 75.59  ? 317 PRO A O     1 
ATOM   2455 C  CB    . PRO A 1 320 ? 31.602 -60.406 23.217  1.00 77.41  ? 317 PRO A CB    1 
ATOM   2456 C  CG    . PRO A 1 320 ? 32.662 -59.841 22.338  1.00 77.50  ? 317 PRO A CG    1 
ATOM   2457 C  CD    . PRO A 1 320 ? 33.899 -59.830 23.174  1.00 77.73  ? 317 PRO A CD    1 
ATOM   2458 N  N     . VAL A 1 321 ? 31.151 -63.566 23.998  1.00 74.48  ? 318 VAL A N     1 
ATOM   2459 C  CA    . VAL A 1 321 ? 30.730 -64.918 23.658  1.00 74.34  ? 318 VAL A CA    1 
ATOM   2460 C  C     . VAL A 1 321 ? 29.196 -64.896 23.457  1.00 74.11  ? 318 VAL A C     1 
ATOM   2461 O  O     . VAL A 1 321 ? 28.491 -64.250 24.230  1.00 73.72  ? 318 VAL A O     1 
ATOM   2462 C  CB    . VAL A 1 321 ? 31.225 -65.881 24.781  1.00 77.30  ? 318 VAL A CB    1 
ATOM   2463 C  CG1   . VAL A 1 321 ? 30.246 -67.005 25.079  1.00 76.79  ? 318 VAL A CG1   1 
ATOM   2464 C  CG2   . VAL A 1 321 ? 32.603 -66.434 24.455  1.00 77.50  ? 318 VAL A CG2   1 
ATOM   2465 N  N     . VAL A 1 322 ? 28.690 -65.573 22.407  1.00 72.67  ? 319 VAL A N     1 
ATOM   2466 C  CA    . VAL A 1 322 ? 27.253 -65.654 22.109  1.00 72.53  ? 319 VAL A CA    1 
ATOM   2467 C  C     . VAL A 1 322 ? 26.541 -66.338 23.305  1.00 72.43  ? 319 VAL A C     1 
ATOM   2468 O  O     . VAL A 1 322 ? 27.015 -67.385 23.784  1.00 72.49  ? 319 VAL A O     1 
ATOM   2469 C  CB    . VAL A 1 322 ? 27.009 -66.396 20.767  1.00 75.26  ? 319 VAL A CB    1 
ATOM   2470 C  CG1   . VAL A 1 322 ? 25.520 -66.507 20.459  1.00 73.96  ? 319 VAL A CG1   1 
ATOM   2471 C  CG2   . VAL A 1 322 ? 27.738 -65.708 19.620  1.00 74.96  ? 319 VAL A CG2   1 
ATOM   2472 N  N     . GLY A 1 323 ? 25.461 -65.713 23.794  1.00 71.22  ? 320 GLY A N     1 
ATOM   2473 C  CA    . GLY A 1 323 ? 24.701 -66.216 24.937  1.00 70.82  ? 320 GLY A CA    1 
ATOM   2474 C  C     . GLY A 1 323 ? 25.065 -65.592 26.279  1.00 71.10  ? 320 GLY A C     1 
ATOM   2475 O  O     . GLY A 1 323 ? 24.283 -65.673 27.240  1.00 70.90  ? 320 GLY A O     1 
ATOM   2476 N  N     . GLN A 1 324 ? 26.264 -64.950 26.351  1.00 69.69  ? 321 GLN A N     1 
ATOM   2477 C  CA    . GLN A 1 324 ? 26.807 -64.270 27.529  1.00 69.27  ? 321 GLN A CA    1 
ATOM   2478 C  C     . GLN A 1 324 ? 25.895 -63.151 27.982  1.00 68.05  ? 321 GLN A C     1 
ATOM   2479 O  O     . GLN A 1 324 ? 25.331 -62.419 27.154  1.00 68.06  ? 321 GLN A O     1 
ATOM   2480 C  CB    . GLN A 1 324 ? 28.190 -63.691 27.192  1.00 70.21  ? 321 GLN A CB    1 
ATOM   2481 C  CG    . GLN A 1 324 ? 29.049 -63.220 28.359  1.00 71.90  ? 321 GLN A CG    1 
ATOM   2482 C  CD    . GLN A 1 324 ? 30.467 -62.855 27.941  1.00 74.54  ? 321 GLN A CD    1 
ATOM   2483 O  OE1   . GLN A 1 324 ? 30.749 -62.483 26.793  1.00 75.98  ? 321 GLN A OE1   1 
ATOM   2484 N  NE2   . GLN A 1 324 ? 31.403 -62.939 28.877  1.00 75.96  ? 321 GLN A NE2   1 
ATOM   2485 N  N     . LEU A 1 325 ? 25.738 -63.042 29.308  1.00 66.70  ? 322 LEU A N     1 
ATOM   2486 C  CA    . LEU A 1 325 ? 24.971 -61.992 29.959  1.00 65.47  ? 322 LEU A CA    1 
ATOM   2487 C  C     . LEU A 1 325 ? 25.964 -60.840 30.065  1.00 63.46  ? 322 LEU A C     1 
ATOM   2488 O  O     . LEU A 1 325 ? 27.072 -60.973 30.607  1.00 62.75  ? 322 LEU A O     1 
ATOM   2489 C  CB    . LEU A 1 325 ? 24.444 -62.452 31.316  1.00 65.90  ? 322 LEU A CB    1 
ATOM   2490 C  CG    . LEU A 1 325 ? 22.926 -62.412 31.486  1.00 68.57  ? 322 LEU A CG    1 
ATOM   2491 C  CD1   . LEU A 1 325 ? 22.206 -63.119 30.337  1.00 68.19  ? 322 LEU A CD1   1 
ATOM   2492 C  CD2   . LEU A 1 325 ? 22.525 -63.007 32.805  1.00 68.48  ? 322 LEU A CD2   1 
ATOM   2493 N  N     . VAL A 1 326 ? 25.582 -59.737 29.450  1.00 61.40  ? 323 VAL A N     1 
ATOM   2494 C  CA    . VAL A 1 326 ? 26.382 -58.544 29.268  1.00 60.30  ? 323 VAL A CA    1 
ATOM   2495 C  C     . VAL A 1 326 ? 25.549 -57.320 29.631  1.00 59.90  ? 323 VAL A C     1 
ATOM   2496 O  O     . VAL A 1 326 ? 24.340 -57.433 29.679  1.00 60.02  ? 323 VAL A O     1 
ATOM   2497 C  CB    . VAL A 1 326 ? 26.744 -58.656 27.768  1.00 61.96  ? 323 VAL A CB    1 
ATOM   2498 C  CG1   . VAL A 1 326 ? 26.285 -57.480 26.924  1.00 61.78  ? 323 VAL A CG1   1 
ATOM   2499 C  CG2   . VAL A 1 326 ? 28.196 -59.033 27.562  1.00 59.31  ? 323 VAL A CG2   1 
ATOM   2500 N  N     . GLN A 1 327 ? 26.171 -56.166 29.913  1.00 59.99  ? 324 GLN A N     1 
ATOM   2501 C  CA    . GLN A 1 327 ? 25.415 -54.959 30.275  1.00 59.30  ? 324 GLN A CA    1 
ATOM   2502 C  C     . GLN A 1 327 ? 25.891 -53.716 29.541  1.00 59.56  ? 324 GLN A C     1 
ATOM   2503 O  O     . GLN A 1 327 ? 27.084 -53.412 29.546  1.00 58.95  ? 324 GLN A O     1 
ATOM   2504 C  CB    . GLN A 1 327 ? 25.472 -54.720 31.782  1.00 60.05  ? 324 GLN A CB    1 
ATOM   2505 C  CG    . GLN A 1 327 ? 24.581 -55.639 32.564  1.00 58.85  ? 324 GLN A CG    1 
ATOM   2506 C  CD    . GLN A 1 327 ? 24.791 -55.493 34.024  1.00 56.87  ? 324 GLN A CD    1 
ATOM   2507 O  OE1   . GLN A 1 327 ? 25.374 -56.365 34.672  1.00 57.31  ? 324 GLN A OE1   1 
ATOM   2508 N  NE2   . GLN A 1 327 ? 24.307 -54.386 34.574  1.00 53.43  ? 324 GLN A NE2   1 
ATOM   2509 N  N     . GLU A 1 328 ? 24.961 -53.005 28.921  1.00 60.04  ? 325 GLU A N     1 
ATOM   2510 C  CA    . GLU A 1 328 ? 25.245 -51.786 28.177  1.00 60.92  ? 325 GLU A CA    1 
ATOM   2511 C  C     . GLU A 1 328 ? 25.341 -50.596 29.127  1.00 60.98  ? 325 GLU A C     1 
ATOM   2512 O  O     . GLU A 1 328 ? 24.572 -50.501 30.088  1.00 61.00  ? 325 GLU A O     1 
ATOM   2513 C  CB    . GLU A 1 328 ? 24.163 -51.527 27.125  1.00 62.43  ? 325 GLU A CB    1 
ATOM   2514 C  CG    . GLU A 1 328 ? 24.564 -50.507 26.080  1.00 64.19  ? 325 GLU A CG    1 
ATOM   2515 C  CD    . GLU A 1 328 ? 23.504 -50.119 25.072  1.00 66.11  ? 325 GLU A CD    1 
ATOM   2516 O  OE1   . GLU A 1 328 ? 22.348 -50.605 25.159  1.00 67.07  ? 325 GLU A OE1   1 
ATOM   2517 O  OE2   . GLU A 1 328 ? 23.849 -49.314 24.177  1.00 65.32  ? 325 GLU A OE2   1 
ATOM   2518 N  N     . ARG A 1 329 ? 26.278 -49.689 28.836  1.00 60.83  ? 326 ARG A N     1 
ATOM   2519 C  CA    . ARG A 1 329 ? 26.520 -48.502 29.623  1.00 61.57  ? 326 ARG A CA    1 
ATOM   2520 C  C     . ARG A 1 329 ? 25.447 -47.457 29.396  1.00 61.16  ? 326 ARG A C     1 
ATOM   2521 O  O     . ARG A 1 329 ? 25.127 -47.175 28.245  1.00 61.56  ? 326 ARG A O     1 
ATOM   2522 C  CB    . ARG A 1 329 ? 27.900 -47.948 29.259  1.00 64.41  ? 326 ARG A CB    1 
ATOM   2523 C  CG    . ARG A 1 329 ? 28.406 -46.893 30.223  1.00 67.11  ? 326 ARG A CG    1 
ATOM   2524 C  CD    . ARG A 1 329 ? 29.493 -46.044 29.597  1.00 69.70  ? 326 ARG A CD    1 
ATOM   2525 N  NE    . ARG A 1 329 ? 30.647 -46.846 29.180  1.00 72.54  ? 326 ARG A NE    1 
ATOM   2526 C  CZ    . ARG A 1 329 ? 31.625 -47.215 29.997  1.00 73.31  ? 326 ARG A CZ    1 
ATOM   2527 N  NH1   . ARG A 1 329 ? 31.600 -46.857 31.283  1.00 69.83  ? 326 ARG A NH1   1 
ATOM   2528 N  NH2   . ARG A 1 329 ? 32.630 -47.952 29.543  1.00 69.06  ? 326 ARG A NH2   1 
ATOM   2529 N  N     . VAL A 1 330 ? 24.902 -46.861 30.473  1.00 62.06  ? 327 VAL A N     1 
ATOM   2530 C  CA    . VAL A 1 330 ? 23.893 -45.799 30.321  1.00 61.81  ? 327 VAL A CA    1 
ATOM   2531 C  C     . VAL A 1 330 ? 24.571 -44.587 29.612  1.00 62.60  ? 327 VAL A C     1 
ATOM   2532 O  O     . VAL A 1 330 ? 25.650 -44.156 30.033  1.00 62.21  ? 327 VAL A O     1 
ATOM   2533 C  CB    . VAL A 1 330 ? 23.190 -45.444 31.660  1.00 63.31  ? 327 VAL A CB    1 
ATOM   2534 C  CG1   . VAL A 1 330 ? 22.255 -44.264 31.508  1.00 62.17  ? 327 VAL A CG1   1 
ATOM   2535 C  CG2   . VAL A 1 330 ? 22.422 -46.642 32.198  1.00 62.67  ? 327 VAL A CG2   1 
ATOM   2536 N  N     . ALA A 1 331 ? 23.969 -44.103 28.505  1.00 67.38  ? 328 ALA A N     1 
ATOM   2537 C  CA    . ALA A 1 331 ? 24.499 -42.994 27.696  1.00 68.36  ? 328 ALA A CA    1 
ATOM   2538 C  C     . ALA A 1 331 ? 24.668 -41.705 28.463  1.00 68.84  ? 328 ALA A C     1 
ATOM   2539 O  O     . ALA A 1 331 ? 25.793 -41.239 28.605  1.00 69.54  ? 328 ALA A O     1 
ATOM   2540 C  CB    . ALA A 1 331 ? 23.628 -42.755 26.475  1.00 69.21  ? 328 ALA A CB    1 
ATOM   2541 N  N     . ARG A 1 332 ? 23.576 -41.118 28.948  1.00 69.62  ? 329 ARG A N     1 
ATOM   2542 C  CA    . ARG A 1 332 ? 23.678 -39.860 29.690  1.00 70.08  ? 329 ARG A CA    1 
ATOM   2543 C  C     . ARG A 1 332 ? 23.121 -40.109 31.104  1.00 70.11  ? 329 ARG A C     1 
ATOM   2544 O  O     . ARG A 1 332 ? 21.968 -39.756 31.390  1.00 70.02  ? 329 ARG A O     1 
ATOM   2545 C  CB    . ARG A 1 332 ? 22.924 -38.740 28.936  1.00 73.17  ? 329 ARG A CB    1 
ATOM   2546 N  N     . PRO A 1 333 ? 23.903 -40.781 31.987  1.00 67.03  ? 330 PRO A N     1 
ATOM   2547 C  CA    . PRO A 1 333 ? 23.367 -41.098 33.318  1.00 66.25  ? 330 PRO A CA    1 
ATOM   2548 C  C     . PRO A 1 333 ? 23.097 -39.855 34.131  1.00 66.03  ? 330 PRO A C     1 
ATOM   2549 O  O     . PRO A 1 333 ? 23.900 -38.912 34.130  1.00 66.78  ? 330 PRO A O     1 
ATOM   2550 C  CB    . PRO A 1 333 ? 24.427 -42.007 33.936  1.00 67.68  ? 330 PRO A CB    1 
ATOM   2551 C  CG    . PRO A 1 333 ? 25.684 -41.661 33.226  1.00 68.24  ? 330 PRO A CG    1 
ATOM   2552 C  CD    . PRO A 1 333 ? 25.283 -41.287 31.828  1.00 67.83  ? 330 PRO A CD    1 
ATOM   2553 N  N     . ALA A 1 334 ? 21.932 -39.838 34.773  1.00 63.55  ? 331 ALA A N     1 
ATOM   2554 C  CA    . ALA A 1 334 ? 21.527 -38.726 35.597  1.00 63.65  ? 331 ALA A CA    1 
ATOM   2555 C  C     . ALA A 1 334 ? 22.242 -38.841 36.951  1.00 63.74  ? 331 ALA A C     1 
ATOM   2556 O  O     . ALA A 1 334 ? 22.817 -39.896 37.283  1.00 63.37  ? 331 ALA A O     1 
ATOM   2557 C  CB    . ALA A 1 334 ? 20.020 -38.735 35.777  1.00 63.78  ? 331 ALA A CB    1 
ATOM   2558 N  N     . SER A 1 335 ? 22.218 -37.742 37.720  1.00 60.94  ? 332 SER A N     1 
ATOM   2559 C  CA    . SER A 1 335 ? 22.825 -37.671 39.023  1.00 61.13  ? 332 SER A CA    1 
ATOM   2560 C  C     . SER A 1 335 ? 22.198 -38.708 39.928  1.00 60.53  ? 332 SER A C     1 
ATOM   2561 O  O     . SER A 1 335 ? 20.970 -38.839 39.962  1.00 60.83  ? 332 SER A O     1 
ATOM   2562 C  CB    . SER A 1 335 ? 22.653 -36.279 39.609  1.00 64.78  ? 332 SER A CB    1 
ATOM   2563 O  OG    . SER A 1 335 ? 23.354 -36.191 40.835  1.00 68.60  ? 332 SER A OG    1 
ATOM   2564 N  N     . LEU A 1 336 ? 23.043 -39.454 40.646  1.00 57.56  ? 333 LEU A N     1 
ATOM   2565 C  CA    . LEU A 1 336 ? 22.639 -40.506 41.586  1.00 56.67  ? 333 LEU A CA    1 
ATOM   2566 C  C     . LEU A 1 336 ? 21.853 -41.654 40.934  1.00 56.42  ? 333 LEU A C     1 
ATOM   2567 O  O     . LEU A 1 336 ? 21.066 -42.306 41.617  1.00 55.92  ? 333 LEU A O     1 
ATOM   2568 C  CB    . LEU A 1 336 ? 21.864 -39.941 42.802  1.00 55.96  ? 333 LEU A CB    1 
ATOM   2569 C  CG    . LEU A 1 336 ? 22.516 -38.844 43.665  1.00 54.94  ? 333 LEU A CG    1 
ATOM   2570 C  CD1   . LEU A 1 336 ? 21.567 -38.431 44.745  1.00 54.44  ? 333 LEU A CD1   1 
ATOM   2571 C  CD2   . LEU A 1 336 ? 23.838 -39.308 44.292  1.00 53.08  ? 333 LEU A CD2   1 
ATOM   2572 N  N     . ARG A 1 337 ? 22.082 -41.908 39.630  1.00 55.31  ? 334 ARG A N     1 
ATOM   2573 C  CA    . ARG A 1 337 ? 21.405 -42.979 38.906  1.00 55.28  ? 334 ARG A CA    1 
ATOM   2574 C  C     . ARG A 1 337 ? 22.422 -43.992 38.368  1.00 55.28  ? 334 ARG A C     1 
ATOM   2575 O  O     . ARG A 1 337 ? 23.557 -43.600 38.077  1.00 55.90  ? 334 ARG A O     1 
ATOM   2576 C  CB    . ARG A 1 337 ? 20.552 -42.401 37.751  1.00 56.10  ? 334 ARG A CB    1 
ATOM   2577 C  CG    . ARG A 1 337 ? 19.314 -41.622 38.185  1.00 55.79  ? 334 ARG A CG    1 
ATOM   2578 C  CD    . ARG A 1 337 ? 18.384 -42.469 39.023  1.00 59.80  ? 334 ARG A CD    1 
ATOM   2579 N  NE    . ARG A 1 337 ? 17.139 -41.764 39.302  1.00 61.85  ? 334 ARG A NE    1 
ATOM   2580 C  CZ    . ARG A 1 337 ? 16.279 -42.110 40.255  1.00 61.79  ? 334 ARG A CZ    1 
ATOM   2581 N  NH1   . ARG A 1 337 ? 16.532 -43.147 41.041  1.00 60.30  ? 334 ARG A NH1   1 
ATOM   2582 N  NH2   . ARG A 1 337 ? 15.166 -41.411 40.438  1.00 58.29  ? 334 ARG A NH2   1 
ATOM   2583 N  N     . PRO A 1 338 ? 22.046 -45.287 38.210  1.00 56.73  ? 335 PRO A N     1 
ATOM   2584 C  CA    . PRO A 1 338 ? 23.010 -46.289 37.699  1.00 57.07  ? 335 PRO A CA    1 
ATOM   2585 C  C     . PRO A 1 338 ? 23.681 -45.971 36.353  1.00 57.66  ? 335 PRO A C     1 
ATOM   2586 O  O     . PRO A 1 338 ? 23.065 -45.433 35.429  1.00 58.24  ? 335 PRO A O     1 
ATOM   2587 C  CB    . PRO A 1 338 ? 22.182 -47.577 37.618  1.00 58.48  ? 335 PRO A CB    1 
ATOM   2588 C  CG    . PRO A 1 338 ? 21.055 -47.366 38.555  1.00 58.42  ? 335 PRO A CG    1 
ATOM   2589 C  CD    . PRO A 1 338 ? 20.744 -45.911 38.525  1.00 58.28  ? 335 PRO A CD    1 
ATOM   2590 N  N     . ARG A 1 339 ? 24.961 -46.329 36.257  1.00 61.28  ? 336 ARG A N     1 
ATOM   2591 C  CA    . ARG A 1 339 ? 25.800 -46.128 35.075  1.00 61.37  ? 336 ARG A CA    1 
ATOM   2592 C  C     . ARG A 1 339 ? 25.626 -47.304 34.084  1.00 61.58  ? 336 ARG A C     1 
ATOM   2593 O  O     . ARG A 1 339 ? 26.123 -47.249 32.955  1.00 61.78  ? 336 ARG A O     1 
ATOM   2594 C  CB    . ARG A 1 339 ? 27.281 -45.939 35.515  1.00 66.39  ? 336 ARG A CB    1 
ATOM   2595 C  CG    . ARG A 1 339 ? 27.756 -44.480 35.773  1.00 66.96  ? 336 ARG A CG    1 
ATOM   2596 C  CD    . ARG A 1 339 ? 26.840 -43.606 36.644  1.00 71.89  ? 336 ARG A CD    1 
ATOM   2597 N  NE    . ARG A 1 339 ? 27.237 -42.183 36.730  1.00 72.85  ? 336 ARG A NE    1 
ATOM   2598 C  CZ    . ARG A 1 339 ? 26.416 -41.179 37.070  1.00 71.75  ? 336 ARG A CZ    1 
ATOM   2599 N  NH1   . ARG A 1 339 ? 25.135 -41.418 37.339  1.00 66.29  ? 336 ARG A NH1   1 
ATOM   2600 N  NH2   . ARG A 1 339 ? 26.865 -39.934 37.125  1.00 69.76  ? 336 ARG A NH2   1 
ATOM   2601 N  N     . TRP A 1 340 ? 24.893 -48.360 34.503  1.00 62.17  ? 337 TRP A N     1 
ATOM   2602 C  CA    . TRP A 1 340 ? 24.649 -49.542 33.667  1.00 62.98  ? 337 TRP A CA    1 
ATOM   2603 C  C     . TRP A 1 340 ? 23.189 -49.895 33.482  1.00 63.31  ? 337 TRP A C     1 
ATOM   2604 O  O     . TRP A 1 340 ? 22.366 -49.650 34.370  1.00 63.21  ? 337 TRP A O     1 
ATOM   2605 C  CB    . TRP A 1 340 ? 25.419 -50.753 34.192  1.00 61.40  ? 337 TRP A CB    1 
ATOM   2606 C  CG    . TRP A 1 340 ? 26.885 -50.493 34.269  1.00 62.22  ? 337 TRP A CG    1 
ATOM   2607 C  CD1   . TRP A 1 340 ? 27.583 -50.033 35.348  1.00 60.96  ? 337 TRP A CD1   1 
ATOM   2608 C  CD2   . TRP A 1 340 ? 27.829 -50.598 33.189  1.00 61.57  ? 337 TRP A CD2   1 
ATOM   2609 N  NE1   . TRP A 1 340 ? 28.910 -49.867 35.016  1.00 62.11  ? 337 TRP A NE1   1 
ATOM   2610 C  CE2   . TRP A 1 340 ? 29.088 -50.205 33.694  1.00 61.01  ? 337 TRP A CE2   1 
ATOM   2611 C  CE3   . TRP A 1 340 ? 27.736 -51.018 31.845  1.00 58.18  ? 337 TRP A CE3   1 
ATOM   2612 C  CZ2   . TRP A 1 340 ? 30.245 -50.218 32.907  1.00 59.11  ? 337 TRP A CZ2   1 
ATOM   2613 C  CZ3   . TRP A 1 340 ? 28.882 -51.016 31.064  1.00 58.83  ? 337 TRP A CZ3   1 
ATOM   2614 C  CH2   . TRP A 1 340 ? 30.121 -50.626 31.599  1.00 60.69  ? 337 TRP A CH2   1 
ATOM   2615 N  N     . HIS A 1 341 ? 22.879 -50.480 32.315  1.00 60.54  ? 338 HIS A N     1 
ATOM   2616 C  CA    . HIS A 1 341 ? 21.548 -50.971 31.972  1.00 61.23  ? 338 HIS A CA    1 
ATOM   2617 C  C     . HIS A 1 341 ? 21.430 -52.400 32.531  1.00 61.93  ? 338 HIS A C     1 
ATOM   2618 O  O     . HIS A 1 341 ? 22.447 -53.003 32.920  1.00 61.78  ? 338 HIS A O     1 
ATOM   2619 C  CB    . HIS A 1 341 ? 21.353 -50.998 30.447  1.00 60.86  ? 338 HIS A CB    1 
ATOM   2620 C  CG    . HIS A 1 341 ? 21.077 -49.659 29.850  1.00 60.78  ? 338 HIS A CG    1 
ATOM   2621 N  ND1   . HIS A 1 341 ? 20.050 -48.856 30.319  1.00 59.57  ? 338 HIS A ND1   1 
ATOM   2622 C  CD2   . HIS A 1 341 ? 21.691 -49.028 28.828  1.00 59.27  ? 338 HIS A CD2   1 
ATOM   2623 C  CE1   . HIS A 1 341 ? 20.081 -47.760 29.580  1.00 59.60  ? 338 HIS A CE1   1 
ATOM   2624 N  NE2   . HIS A 1 341 ? 21.046 -47.817 28.665  1.00 59.00  ? 338 HIS A NE2   1 
ATOM   2625 N  N     . LYS A 1 342 ? 20.202 -52.948 32.555  1.00 63.43  ? 339 LYS A N     1 
ATOM   2626 C  CA    . LYS A 1 342 ? 19.939 -54.314 33.034  1.00 64.57  ? 339 LYS A CA    1 
ATOM   2627 C  C     . LYS A 1 342 ? 20.621 -55.344 32.101  1.00 63.66  ? 339 LYS A C     1 
ATOM   2628 O  O     . LYS A 1 342 ? 20.854 -55.035 30.920  1.00 62.72  ? 339 LYS A O     1 
ATOM   2629 C  CB    . LYS A 1 342 ? 18.426 -54.571 33.126  1.00 69.99  ? 339 LYS A CB    1 
ATOM   2630 C  CG    . LYS A 1 342 ? 17.786 -53.879 34.331  1.00 73.84  ? 339 LYS A CG    1 
ATOM   2631 C  CD    . LYS A 1 342 ? 16.277 -53.681 34.127  1.00 78.28  ? 339 LYS A CD    1 
ATOM   2632 C  CE    . LYS A 1 342 ? 15.680 -52.619 35.035  1.00 80.38  ? 339 LYS A CE    1 
ATOM   2633 N  NZ    . LYS A 1 342 ? 14.290 -52.245 34.614  1.00 83.00  ? 339 LYS A NZ    1 
ATOM   2634 N  N     . PRO A 1 343 ? 20.980 -56.553 32.586  1.00 61.90  ? 340 PRO A N     1 
ATOM   2635 C  CA    . PRO A 1 343 ? 21.641 -57.518 31.681  1.00 62.42  ? 340 PRO A CA    1 
ATOM   2636 C  C     . PRO A 1 343 ? 20.892 -57.787 30.357  1.00 63.64  ? 340 PRO A C     1 
ATOM   2637 O  O     . PRO A 1 343 ? 19.650 -57.728 30.283  1.00 63.70  ? 340 PRO A O     1 
ATOM   2638 C  CB    . PRO A 1 343 ? 21.814 -58.767 32.544  1.00 63.16  ? 340 PRO A CB    1 
ATOM   2639 C  CG    . PRO A 1 343 ? 21.778 -58.251 33.973  1.00 62.24  ? 340 PRO A CG    1 
ATOM   2640 C  CD    . PRO A 1 343 ? 20.832 -57.094 33.955  1.00 61.73  ? 340 PRO A CD    1 
ATOM   2641 N  N     . SER A 1 344 ? 21.686 -58.025 29.296  1.00 63.68  ? 341 SER A N     1 
ATOM   2642 C  CA    . SER A 1 344 ? 21.315 -58.296 27.913  1.00 63.81  ? 341 SER A CA    1 
ATOM   2643 C  C     . SER A 1 344 ? 22.032 -59.554 27.515  1.00 64.10  ? 341 SER A C     1 
ATOM   2644 O  O     . SER A 1 344 ? 22.956 -59.982 28.215  1.00 63.61  ? 341 SER A O     1 
ATOM   2645 C  CB    . SER A 1 344 ? 21.819 -57.180 27.003  1.00 67.33  ? 341 SER A CB    1 
ATOM   2646 O  OG    . SER A 1 344 ? 21.179 -55.954 27.276  1.00 69.04  ? 341 SER A OG    1 
ATOM   2647 N  N     . THR A 1 345 ? 21.641 -60.133 26.365  1.00 65.73  ? 342 THR A N     1 
ATOM   2648 C  CA    . THR A 1 345 ? 22.270 -61.347 25.874  1.00 65.88  ? 342 THR A CA    1 
ATOM   2649 C  C     . THR A 1 345 ? 22.906 -61.042 24.536  1.00 65.65  ? 342 THR A C     1 
ATOM   2650 O  O     . THR A 1 345 ? 22.299 -60.358 23.701  1.00 65.66  ? 342 THR A O     1 
ATOM   2651 C  CB    . THR A 1 345 ? 21.269 -62.533 25.812  1.00 67.23  ? 342 THR A CB    1 
ATOM   2652 O  OG1   . THR A 1 345 ? 20.361 -62.487 26.919  1.00 68.59  ? 342 THR A OG1   1 
ATOM   2653 C  CG2   . THR A 1 345 ? 21.969 -63.871 25.805  1.00 66.96  ? 342 THR A CG2   1 
ATOM   2654 N  N     . VAL A 1 346 ? 24.126 -61.562 24.341  1.00 65.33  ? 343 VAL A N     1 
ATOM   2655 C  CA    . VAL A 1 346 ? 24.913 -61.405 23.129  1.00 65.89  ? 343 VAL A CA    1 
ATOM   2656 C  C     . VAL A 1 346 ? 24.309 -62.326 22.060  1.00 66.79  ? 343 VAL A C     1 
ATOM   2657 O  O     . VAL A 1 346 ? 24.428 -63.554 22.181  1.00 66.48  ? 343 VAL A O     1 
ATOM   2658 C  CB    . VAL A 1 346 ? 26.408 -61.736 23.415  1.00 68.93  ? 343 VAL A CB    1 
ATOM   2659 C  CG1   . VAL A 1 346 ? 27.261 -61.571 22.175  1.00 68.01  ? 343 VAL A CG1   1 
ATOM   2660 C  CG2   . VAL A 1 346 ? 26.966 -60.896 24.563  1.00 68.70  ? 343 VAL A CG2   1 
ATOM   2661 N  N     . LEU A 1 347 ? 23.660 -61.737 21.026  1.00 67.42  ? 344 LEU A N     1 
ATOM   2662 C  CA    . LEU A 1 347 ? 23.040 -62.470 19.911  1.00 67.93  ? 344 LEU A CA    1 
ATOM   2663 C  C     . LEU A 1 347 ? 24.112 -62.931 18.939  1.00 68.26  ? 344 LEU A C     1 
ATOM   2664 O  O     . LEU A 1 347 ? 24.240 -64.139 18.704  1.00 69.31  ? 344 LEU A O     1 
ATOM   2665 C  CB    . LEU A 1 347 ? 21.951 -61.657 19.177  1.00 66.72  ? 344 LEU A CB    1 
ATOM   2666 C  CG    . LEU A 1 347 ? 20.757 -61.155 20.013  1.00 68.52  ? 344 LEU A CG    1 
ATOM   2667 C  CD1   . LEU A 1 347 ? 19.783 -60.379 19.162  1.00 71.17  ? 344 LEU A CD1   1 
ATOM   2668 C  CD2   . LEU A 1 347 ? 20.025 -62.288 20.701  1.00 69.98  ? 344 LEU A CD2   1 
ATOM   2669 N  N     . LYS A 1 348 ? 24.901 -61.979 18.384  1.00 68.38  ? 345 LYS A N     1 
ATOM   2670 C  CA    . LYS A 1 348 ? 25.981 -62.273 17.440  1.00 67.71  ? 345 LYS A CA    1 
ATOM   2671 C  C     . LYS A 1 348 ? 27.225 -61.465 17.792  1.00 67.49  ? 345 LYS A C     1 
ATOM   2672 O  O     . LYS A 1 348 ? 27.113 -60.323 18.254  1.00 67.54  ? 345 LYS A O     1 
ATOM   2673 C  CB    . LYS A 1 348 ? 25.541 -61.991 15.985  1.00 68.33  ? 345 LYS A CB    1 
ATOM   2674 N  N     . VAL A 1 349 ? 28.405 -62.065 17.567  1.00 65.77  ? 346 VAL A N     1 
ATOM   2675 C  CA    . VAL A 1 349 ? 29.726 -61.475 17.777  1.00 65.36  ? 346 VAL A CA    1 
ATOM   2676 C  C     . VAL A 1 349 ? 30.226 -61.137 16.357  1.00 65.37  ? 346 VAL A C     1 
ATOM   2677 O  O     . VAL A 1 349 ? 30.752 -62.011 15.648  1.00 65.65  ? 346 VAL A O     1 
ATOM   2678 C  CB    . VAL A 1 349 ? 30.662 -62.445 18.560  1.00 66.75  ? 346 VAL A CB    1 
ATOM   2679 C  CG1   . VAL A 1 349 ? 32.088 -61.914 18.645  1.00 66.19  ? 346 VAL A CG1   1 
ATOM   2680 C  CG2   . VAL A 1 349 ? 30.108 -62.728 19.955  1.00 66.36  ? 346 VAL A CG2   1 
ATOM   2681 N  N     . LEU A 1 350 ? 30.012 -59.871 15.927  1.00 65.49  ? 347 LEU A N     1 
ATOM   2682 C  CA    . LEU A 1 350 ? 30.388 -59.367 14.596  1.00 64.38  ? 347 LEU A CA    1 
ATOM   2683 C  C     . LEU A 1 350 ? 31.884 -59.448 14.335  1.00 64.41  ? 347 LEU A C     1 
ATOM   2684 O  O     . LEU A 1 350 ? 32.304 -59.706 13.202  1.00 65.39  ? 347 LEU A O     1 
ATOM   2685 C  CB    . LEU A 1 350 ? 29.852 -57.946 14.363  1.00 63.55  ? 347 LEU A CB    1 
ATOM   2686 C  CG    . LEU A 1 350 ? 28.332 -57.762 14.476  1.00 64.40  ? 347 LEU A CG    1 
ATOM   2687 C  CD1   . LEU A 1 350 ? 27.923 -56.380 14.056  1.00 61.22  ? 347 LEU A CD1   1 
ATOM   2688 C  CD2   . LEU A 1 350 ? 27.571 -58.752 13.612  1.00 61.88  ? 347 LEU A CD2   1 
ATOM   2689 N  N     . ASN A 1 351 ? 32.678 -59.215 15.398  1.00 64.71  ? 348 ASN A N     1 
ATOM   2690 C  CA    . ASN A 1 351 ? 34.153 -59.255 15.492  1.00 63.75  ? 348 ASN A CA    1 
ATOM   2691 C  C     . ASN A 1 351 ? 34.504 -59.212 16.990  1.00 63.12  ? 348 ASN A C     1 
ATOM   2692 O  O     . ASN A 1 351 ? 33.570 -59.061 17.785  1.00 63.74  ? 348 ASN A O     1 
ATOM   2693 C  CB    . ASN A 1 351 ? 34.869 -58.167 14.648  1.00 67.83  ? 348 ASN A CB    1 
ATOM   2694 C  CG    . ASN A 1 351 ? 34.586 -56.714 14.980  1.00 68.23  ? 348 ASN A CG    1 
ATOM   2695 O  OD1   . ASN A 1 351 ? 34.494 -56.277 16.142  1.00 64.73  ? 348 ASN A OD1   1 
ATOM   2696 N  ND2   . ASN A 1 351 ? 34.486 -55.921 13.943  1.00 63.83  ? 348 ASN A ND2   1 
ATOM   2697 N  N     . PRO A 1 352 ? 35.765 -59.349 17.451  1.00 60.34  ? 349 PRO A N     1 
ATOM   2698 C  CA    . PRO A 1 352 ? 35.988 -59.361 18.910  1.00 60.43  ? 349 PRO A CA    1 
ATOM   2699 C  C     . PRO A 1 352 ? 35.684 -58.049 19.649  1.00 60.00  ? 349 PRO A C     1 
ATOM   2700 O  O     . PRO A 1 352 ? 35.641 -58.050 20.884  1.00 60.67  ? 349 PRO A O     1 
ATOM   2701 C  CB    . PRO A 1 352 ? 37.456 -59.787 19.047  1.00 61.29  ? 349 PRO A CB    1 
ATOM   2702 C  CG    . PRO A 1 352 ? 37.823 -60.351 17.711  1.00 60.78  ? 349 PRO A CG    1 
ATOM   2703 C  CD    . PRO A 1 352 ? 37.028 -59.577 16.724  1.00 61.03  ? 349 PRO A CD    1 
ATOM   2704 N  N     . ARG A 1 353 ? 35.436 -56.946 18.913  1.00 60.29  ? 350 ARG A N     1 
ATOM   2705 C  CA    . ARG A 1 353 ? 35.171 -55.638 19.504  1.00 59.71  ? 350 ARG A CA    1 
ATOM   2706 C  C     . ARG A 1 353 ? 33.769 -55.112 19.273  1.00 59.69  ? 350 ARG A C     1 
ATOM   2707 O  O     . ARG A 1 353 ? 33.411 -54.091 19.860  1.00 59.68  ? 350 ARG A O     1 
ATOM   2708 C  CB    . ARG A 1 353 ? 36.210 -54.626 19.000  1.00 58.36  ? 350 ARG A CB    1 
ATOM   2709 C  CG    . ARG A 1 353 ? 37.675 -55.026 19.262  1.00 58.01  ? 350 ARG A CG    1 
ATOM   2710 C  CD    . ARG A 1 353 ? 38.268 -54.306 20.454  1.00 56.30  ? 350 ARG A CD    1 
ATOM   2711 N  NE    . ARG A 1 353 ? 37.970 -52.866 20.451  1.00 54.44  ? 350 ARG A NE    1 
ATOM   2712 C  CZ    . ARG A 1 353 ? 37.777 -52.142 21.550  1.00 54.38  ? 350 ARG A CZ    1 
ATOM   2713 N  NH1   . ARG A 1 353 ? 37.862 -52.709 22.747  1.00 50.58  ? 350 ARG A NH1   1 
ATOM   2714 N  NH2   . ARG A 1 353 ? 37.475 -50.857 21.462  1.00 54.03  ? 350 ARG A NH2   1 
ATOM   2715 N  N     . THR A 1 354 ? 32.978 -55.776 18.407  1.00 58.78  ? 351 THR A N     1 
ATOM   2716 C  CA    . THR A 1 354 ? 31.599 -55.378 18.055  1.00 59.44  ? 351 THR A CA    1 
ATOM   2717 C  C     . THR A 1 354 ? 30.658 -56.535 18.300  1.00 60.74  ? 351 THR A C     1 
ATOM   2718 O  O     . THR A 1 354 ? 30.974 -57.688 17.974  1.00 61.72  ? 351 THR A O     1 
ATOM   2719 C  CB    . THR A 1 354 ? 31.516 -54.899 16.612  1.00 57.63  ? 351 THR A CB    1 
ATOM   2720 O  OG1   . THR A 1 354 ? 32.739 -54.252 16.281  1.00 55.80  ? 351 THR A OG1   1 
ATOM   2721 C  CG2   . THR A 1 354 ? 30.353 -53.967 16.375  1.00 56.31  ? 351 THR A CG2   1 
ATOM   2722 N  N     . VAL A 1 355 ? 29.491 -56.222 18.857  1.00 58.84  ? 352 VAL A N     1 
ATOM   2723 C  CA    . VAL A 1 355 ? 28.510 -57.226 19.214  1.00 59.27  ? 352 VAL A CA    1 
ATOM   2724 C  C     . VAL A 1 355 ? 27.071 -56.765 19.007  1.00 60.11  ? 352 VAL A C     1 
ATOM   2725 O  O     . VAL A 1 355 ? 26.780 -55.565 19.049  1.00 60.60  ? 352 VAL A O     1 
ATOM   2726 C  CB    . VAL A 1 355 ? 28.832 -57.630 20.678  1.00 62.54  ? 352 VAL A CB    1 
ATOM   2727 C  CG1   . VAL A 1 355 ? 27.656 -57.501 21.619  1.00 63.86  ? 352 VAL A CG1   1 
ATOM   2728 C  CG2   . VAL A 1 355 ? 29.467 -59.005 20.750  1.00 61.93  ? 352 VAL A CG2   1 
ATOM   2729 N  N     . VAL A 1 356 ? 26.165 -57.746 18.760  1.00 62.46  ? 353 VAL A N     1 
ATOM   2730 C  CA    . VAL A 1 356 ? 24.716 -57.508 18.619  1.00 62.88  ? 353 VAL A CA    1 
ATOM   2731 C  C     . VAL A 1 356 ? 24.105 -58.040 19.922  1.00 63.63  ? 353 VAL A C     1 
ATOM   2732 O  O     . VAL A 1 356 ? 24.406 -59.157 20.338  1.00 62.98  ? 353 VAL A O     1 
ATOM   2733 C  CB    . VAL A 1 356 ? 24.047 -58.106 17.340  1.00 65.30  ? 353 VAL A CB    1 
ATOM   2734 C  CG1   . VAL A 1 356 ? 22.562 -57.741 17.268  1.00 64.13  ? 353 VAL A CG1   1 
ATOM   2735 C  CG2   . VAL A 1 356 ? 24.766 -57.655 16.070  1.00 64.99  ? 353 VAL A CG2   1 
ATOM   2736 N  N     . ILE A 1 357 ? 23.301 -57.221 20.580  1.00 66.81  ? 354 ILE A N     1 
ATOM   2737 C  CA    . ILE A 1 357 ? 22.667 -57.609 21.841  1.00 68.34  ? 354 ILE A CA    1 
ATOM   2738 C  C     . ILE A 1 357 ? 21.158 -57.456 21.781  1.00 70.03  ? 354 ILE A C     1 
ATOM   2739 O  O     . ILE A 1 357 ? 20.640 -56.691 20.968  1.00 70.12  ? 354 ILE A O     1 
ATOM   2740 C  CB    . ILE A 1 357 ? 23.239 -56.835 23.083  1.00 69.95  ? 354 ILE A CB    1 
ATOM   2741 C  CG1   . ILE A 1 357 ? 23.068 -55.301 22.926  1.00 69.02  ? 354 ILE A CG1   1 
ATOM   2742 C  CG2   . ILE A 1 357 ? 24.678 -57.242 23.408  1.00 68.73  ? 354 ILE A CG2   1 
ATOM   2743 C  CD1   . ILE A 1 357 ? 23.053 -54.498 24.190  1.00 68.14  ? 354 ILE A CD1   1 
ATOM   2744 N  N     . LEU A 1 358 ? 20.473 -58.161 22.689  1.00 79.18  ? 355 LEU A N     1 
ATOM   2745 C  CA    . LEU A 1 358 ? 19.038 -58.098 22.880  1.00 81.48  ? 355 LEU A CA    1 
ATOM   2746 C  C     . LEU A 1 358 ? 18.819 -57.695 24.332  1.00 82.82  ? 355 LEU A C     1 
ATOM   2747 O  O     . LEU A 1 358 ? 19.147 -58.462 25.251  1.00 82.84  ? 355 LEU A O     1 
ATOM   2748 C  CB    . LEU A 1 358 ? 18.377 -59.455 22.602  1.00 81.87  ? 355 LEU A CB    1 
ATOM   2749 C  CG    . LEU A 1 358 ? 16.845 -59.441 22.592  1.00 82.88  ? 355 LEU A CG    1 
ATOM   2750 C  CD1   . LEU A 1 358 ? 16.326 -59.359 21.181  1.00 82.02  ? 355 LEU A CD1   1 
ATOM   2751 C  CD2   . LEU A 1 358 ? 16.297 -60.665 23.270  1.00 82.65  ? 355 LEU A CD2   1 
ATOM   2752 N  N     . ASP A 1 359 ? 18.281 -56.489 24.547  1.00 91.51  ? 356 ASP A N     1 
ATOM   2753 C  CA    . ASP A 1 359 ? 18.007 -56.018 25.904  1.00 93.85  ? 356 ASP A CA    1 
ATOM   2754 C  C     . ASP A 1 359 ? 16.732 -56.708 26.483  1.00 95.17  ? 356 ASP A C     1 
ATOM   2755 O  O     . ASP A 1 359 ? 16.203 -57.634 25.860  1.00 95.89  ? 356 ASP A O     1 
ATOM   2756 C  CB    . ASP A 1 359 ? 17.954 -54.467 25.968  1.00 96.73  ? 356 ASP A CB    1 
ATOM   2757 C  CG    . ASP A 1 359 ? 17.296 -53.760 24.798  1.00 98.59  ? 356 ASP A CG    1 
ATOM   2758 O  OD1   . ASP A 1 359 ? 16.175 -54.157 24.420  1.00 100.33 ? 356 ASP A OD1   1 
ATOM   2759 O  OD2   . ASP A 1 359 ? 17.899 -52.795 24.267  1.00 100.32 ? 356 ASP A OD2   1 
ATOM   2760 N  N     . HIS A 1 360 ? 16.255 -56.284 27.675  1.00 100.42 ? 357 HIS A N     1 
ATOM   2761 C  CA    . HIS A 1 360 ? 15.043 -56.855 28.281  1.00 101.31 ? 357 HIS A CA    1 
ATOM   2762 C  C     . HIS A 1 360 ? 13.765 -56.458 27.487  1.00 101.56 ? 357 HIS A C     1 
ATOM   2763 O  O     . HIS A 1 360 ? 12.781 -57.194 27.541  1.00 101.94 ? 357 HIS A O     1 
ATOM   2764 C  CB    . HIS A 1 360 ? 14.948 -56.531 29.796  1.00 102.51 ? 357 HIS A CB    1 
ATOM   2765 C  CG    . HIS A 1 360 ? 14.639 -55.101 30.139  1.00 102.92 ? 357 HIS A CG    1 
ATOM   2766 N  ND1   . HIS A 1 360 ? 15.253 -54.042 29.484  1.00 103.95 ? 357 HIS A ND1   1 
ATOM   2767 C  CD2   . HIS A 1 360 ? 13.807 -54.603 31.081  1.00 103.68 ? 357 HIS A CD2   1 
ATOM   2768 C  CE1   . HIS A 1 360 ? 14.757 -52.944 30.032  1.00 103.85 ? 357 HIS A CE1   1 
ATOM   2769 N  NE2   . HIS A 1 360 ? 13.888 -53.230 31.000  1.00 103.46 ? 357 HIS A NE2   1 
ATOM   2770 N  N     . LEU A 1 361 ? 13.806 -55.309 26.737  1.00 102.83 ? 358 LEU A N     1 
ATOM   2771 C  CA    . LEU A 1 361 ? 12.717 -54.787 25.886  1.00 103.06 ? 358 LEU A CA    1 
ATOM   2772 C  C     . LEU A 1 361 ? 12.488 -55.762 24.721  1.00 102.89 ? 358 LEU A C     1 
ATOM   2773 O  O     . LEU A 1 361 ? 11.348 -56.157 24.452  1.00 103.12 ? 358 LEU A O     1 
ATOM   2774 C  CB    . LEU A 1 361 ? 13.036 -53.377 25.289  1.00 103.40 ? 358 LEU A CB    1 
ATOM   2775 C  CG    . LEU A 1 361 ? 13.268 -52.138 26.197  1.00 104.37 ? 358 LEU A CG    1 
ATOM   2776 C  CD1   . LEU A 1 361 ? 12.369 -52.134 27.448  1.00 103.64 ? 358 LEU A CD1   1 
ATOM   2777 C  CD2   . LEU A 1 361 ? 14.741 -51.952 26.544  1.00 104.91 ? 358 LEU A CD2   1 
ATOM   2778 N  N     . GLY A 1 362 ? 13.582 -56.132 24.053  1.00 100.57 ? 359 GLY A N     1 
ATOM   2779 C  CA    . GLY A 1 362 ? 13.587 -57.042 22.915  1.00 100.07 ? 359 GLY A CA    1 
ATOM   2780 C  C     . GLY A 1 362 ? 14.183 -56.424 21.666  1.00 99.56  ? 359 GLY A C     1 
ATOM   2781 O  O     . GLY A 1 362 ? 14.008 -56.961 20.566  1.00 99.87  ? 359 GLY A O     1 
ATOM   2782 N  N     . ASN A 1 363 ? 14.898 -55.294 21.829  1.00 95.28  ? 360 ASN A N     1 
ATOM   2783 C  CA    . ASN A 1 363 ? 15.545 -54.579 20.733  1.00 94.32  ? 360 ASN A CA    1 
ATOM   2784 C  C     . ASN A 1 363 ? 16.940 -55.103 20.417  1.00 92.91  ? 360 ASN A C     1 
ATOM   2785 O  O     . ASN A 1 363 ? 17.695 -55.460 21.325  1.00 92.89  ? 360 ASN A O     1 
ATOM   2786 C  CB    . ASN A 1 363 ? 15.608 -53.100 21.031  1.00 98.58  ? 360 ASN A CB    1 
ATOM   2787 C  CG    . ASN A 1 363 ? 14.271 -52.449 20.928  1.00 100.98 ? 360 ASN A CG    1 
ATOM   2788 O  OD1   . ASN A 1 363 ? 13.883 -51.969 19.859  1.00 104.15 ? 360 ASN A OD1   1 
ATOM   2789 N  ND2   . ASN A 1 363 ? 13.535 -52.425 22.038  1.00 102.15 ? 360 ASN A ND2   1 
ATOM   2790 N  N     . ASN A 1 364 ? 17.263 -55.149 19.116  1.00 88.39  ? 361 ASN A N     1 
ATOM   2791 C  CA    . ASN A 1 364 ? 18.552 -55.578 18.592  1.00 86.55  ? 361 ASN A CA    1 
ATOM   2792 C  C     . ASN A 1 364 ? 19.425 -54.328 18.536  1.00 84.75  ? 361 ASN A C     1 
ATOM   2793 O  O     . ASN A 1 364 ? 19.021 -53.317 17.942  1.00 84.17  ? 361 ASN A O     1 
ATOM   2794 C  CB    . ASN A 1 364 ? 18.392 -56.193 17.195  1.00 90.68  ? 361 ASN A CB    1 
ATOM   2795 C  CG    . ASN A 1 364 ? 18.217 -57.696 17.177  1.00 92.55  ? 361 ASN A CG    1 
ATOM   2796 O  OD1   . ASN A 1 364 ? 17.426 -58.276 17.934  1.00 94.46  ? 361 ASN A OD1   1 
ATOM   2797 N  ND2   . ASN A 1 364 ? 18.952 -58.367 16.295  1.00 93.45  ? 361 ASN A ND2   1 
ATOM   2798 N  N     . ARG A 1 365 ? 20.598 -54.369 19.193  1.00 80.22  ? 362 ARG A N     1 
ATOM   2799 C  CA    . ARG A 1 365 ? 21.504 -53.217 19.216  1.00 78.04  ? 362 ARG A CA    1 
ATOM   2800 C  C     . ARG A 1 365 ? 22.904 -53.632 18.887  1.00 75.83  ? 362 ARG A C     1 
ATOM   2801 O  O     . ARG A 1 365 ? 23.402 -54.593 19.465  1.00 75.77  ? 362 ARG A O     1 
ATOM   2802 C  CB    . ARG A 1 365 ? 21.476 -52.508 20.581  1.00 81.45  ? 362 ARG A CB    1 
ATOM   2803 C  CG    . ARG A 1 365 ? 20.184 -51.759 20.871  1.00 83.13  ? 362 ARG A CG    1 
ATOM   2804 C  CD    . ARG A 1 365 ? 20.134 -51.096 22.255  1.00 85.26  ? 362 ARG A CD    1 
ATOM   2805 N  NE    . ARG A 1 365 ? 21.221 -50.132 22.483  1.00 85.13  ? 362 ARG A NE    1 
ATOM   2806 C  CZ    . ARG A 1 365 ? 21.347 -48.962 21.861  1.00 85.89  ? 362 ARG A CZ    1 
ATOM   2807 N  NH1   . ARG A 1 365 ? 20.459 -48.585 20.951  1.00 86.69  ? 362 ARG A NH1   1 
ATOM   2808 N  NH2   . ARG A 1 365 ? 22.365 -48.163 22.140  1.00 84.33  ? 362 ARG A NH2   1 
ATOM   2809 N  N     . THR A 1 366 ? 23.534 -52.931 17.940  1.00 72.22  ? 363 THR A N     1 
ATOM   2810 C  CA    . THR A 1 366 ? 24.929 -53.191 17.557  1.00 70.69  ? 363 THR A CA    1 
ATOM   2811 C  C     . THR A 1 366 ? 25.759 -52.226 18.425  1.00 69.08  ? 363 THR A C     1 
ATOM   2812 O  O     . THR A 1 366 ? 25.685 -50.998 18.261  1.00 68.27  ? 363 THR A O     1 
ATOM   2813 C  CB    . THR A 1 366 ? 25.157 -53.051 16.043  1.00 72.95  ? 363 THR A CB    1 
ATOM   2814 O  OG1   . THR A 1 366 ? 24.224 -53.873 15.354  1.00 75.83  ? 363 THR A OG1   1 
ATOM   2815 C  CG2   . THR A 1 366 ? 26.566 -53.446 15.632  1.00 72.86  ? 363 THR A CG2   1 
ATOM   2816 N  N     . VAL A 1 367 ? 26.493 -52.783 19.379  1.00 63.57  ? 364 VAL A N     1 
ATOM   2817 C  CA    . VAL A 1 367 ? 27.272 -51.997 20.320  1.00 62.06  ? 364 VAL A CA    1 
ATOM   2818 C  C     . VAL A 1 367 ? 28.751 -52.376 20.338  1.00 61.57  ? 364 VAL A C     1 
ATOM   2819 O  O     . VAL A 1 367 ? 29.123 -53.479 19.930  1.00 60.98  ? 364 VAL A O     1 
ATOM   2820 C  CB    . VAL A 1 367 ? 26.640 -52.079 21.743  1.00 65.10  ? 364 VAL A CB    1 
ATOM   2821 C  CG1   . VAL A 1 367 ? 25.266 -51.418 21.788  1.00 64.06  ? 364 VAL A CG1   1 
ATOM   2822 C  CG2   . VAL A 1 367 ? 26.554 -53.523 22.229  1.00 64.11  ? 364 VAL A CG2   1 
ATOM   2823 N  N     . SER A 1 368 ? 29.593 -51.452 20.836  1.00 60.85  ? 365 SER A N     1 
ATOM   2824 C  CA    . SER A 1 368 ? 31.039 -51.643 20.986  1.00 59.59  ? 365 SER A CA    1 
ATOM   2825 C  C     . SER A 1 368 ? 31.246 -52.308 22.339  1.00 59.48  ? 365 SER A C     1 
ATOM   2826 O  O     . SER A 1 368 ? 30.494 -52.014 23.261  1.00 59.04  ? 365 SER A O     1 
ATOM   2827 C  CB    . SER A 1 368 ? 31.750 -50.289 20.976  1.00 60.63  ? 365 SER A CB    1 
ATOM   2828 O  OG    . SER A 1 368 ? 33.097 -50.394 21.408  1.00 60.39  ? 365 SER A OG    1 
ATOM   2829 N  N     . ILE A 1 369 ? 32.270 -53.158 22.490  1.00 59.34  ? 366 ILE A N     1 
ATOM   2830 C  CA    . ILE A 1 369 ? 32.500 -53.782 23.794  1.00 60.03  ? 366 ILE A CA    1 
ATOM   2831 C  C     . ILE A 1 369 ? 32.973 -52.733 24.839  1.00 59.88  ? 366 ILE A C     1 
ATOM   2832 O  O     . ILE A 1 369 ? 32.897 -53.000 26.042  1.00 60.03  ? 366 ILE A O     1 
ATOM   2833 C  CB    . ILE A 1 369 ? 33.380 -55.055 23.759  1.00 62.95  ? 366 ILE A CB    1 
ATOM   2834 C  CG1   . ILE A 1 369 ? 34.816 -54.795 23.310  1.00 63.96  ? 366 ILE A CG1   1 
ATOM   2835 C  CG2   . ILE A 1 369 ? 32.718 -56.115 22.902  1.00 64.67  ? 366 ILE A CG2   1 
ATOM   2836 C  CD1   . ILE A 1 369 ? 35.774 -56.025 23.682  1.00 65.23  ? 366 ILE A CD1   1 
ATOM   2837 N  N     . ASP A 1 370 ? 33.417 -51.534 24.380  1.00 56.57  ? 367 ASP A N     1 
ATOM   2838 C  CA    . ASP A 1 370 ? 33.847 -50.447 25.250  1.00 55.90  ? 367 ASP A CA    1 
ATOM   2839 C  C     . ASP A 1 370 ? 32.643 -49.884 26.036  1.00 55.27  ? 367 ASP A C     1 
ATOM   2840 O  O     . ASP A 1 370 ? 32.832 -49.325 27.124  1.00 55.68  ? 367 ASP A O     1 
ATOM   2841 C  CB    . ASP A 1 370 ? 34.571 -49.348 24.453  1.00 56.51  ? 367 ASP A CB    1 
ATOM   2842 C  CG    . ASP A 1 370 ? 36.012 -49.639 24.030  1.00 57.97  ? 367 ASP A CG    1 
ATOM   2843 O  OD1   . ASP A 1 370 ? 36.583 -50.664 24.484  1.00 55.69  ? 367 ASP A OD1   1 
ATOM   2844 O  OD2   . ASP A 1 370 ? 36.567 -48.847 23.266  1.00 61.31  ? 367 ASP A OD2   1 
ATOM   2845 N  N     . ASN A 1 371 ? 31.414 -50.070 25.513  1.00 52.52  ? 368 ASN A N     1 
ATOM   2846 C  CA    . ASN A 1 371 ? 30.204 -49.636 26.167  1.00 52.07  ? 368 ASN A CA    1 
ATOM   2847 C  C     . ASN A 1 371 ? 29.454 -50.813 26.811  1.00 51.91  ? 368 ASN A C     1 
ATOM   2848 O  O     . ASN A 1 371 ? 28.261 -50.707 27.106  1.00 52.09  ? 368 ASN A O     1 
ATOM   2849 C  CB    . ASN A 1 371 ? 29.366 -48.836 25.214  1.00 52.96  ? 368 ASN A CB    1 
ATOM   2850 C  CG    . ASN A 1 371 ? 30.025 -47.533 24.843  1.00 54.74  ? 368 ASN A CG    1 
ATOM   2851 O  OD1   . ASN A 1 371 ? 30.641 -46.890 25.680  1.00 57.15  ? 368 ASN A OD1   1 
ATOM   2852 N  ND2   . ASN A 1 371 ? 29.910 -47.098 23.584  1.00 51.42  ? 368 ASN A ND2   1 
ATOM   2853 N  N     . LEU A 1 372 ? 30.178 -51.917 27.075  1.00 54.42  ? 369 LEU A N     1 
ATOM   2854 C  CA    . LEU A 1 372 ? 29.645 -53.130 27.708  1.00 55.55  ? 369 LEU A CA    1 
ATOM   2855 C  C     . LEU A 1 372 ? 30.520 -53.671 28.836  1.00 55.71  ? 369 LEU A C     1 
ATOM   2856 O  O     . LEU A 1 372 ? 31.742 -53.593 28.774  1.00 55.04  ? 369 LEU A O     1 
ATOM   2857 C  CB    . LEU A 1 372 ? 29.524 -54.304 26.696  1.00 55.46  ? 369 LEU A CB    1 
ATOM   2858 C  CG    . LEU A 1 372 ? 28.562 -54.249 25.520  1.00 57.43  ? 369 LEU A CG    1 
ATOM   2859 C  CD1   . LEU A 1 372 ? 28.701 -55.516 24.715  1.00 57.24  ? 369 LEU A CD1   1 
ATOM   2860 C  CD2   . LEU A 1 372 ? 27.127 -54.111 25.963  1.00 56.25  ? 369 LEU A CD2   1 
ATOM   2861 N  N     . LYS A 1 373 ? 29.897 -54.309 29.821  1.00 56.95  ? 370 LYS A N     1 
ATOM   2862 C  CA    . LYS A 1 373 ? 30.619 -55.002 30.883  1.00 57.34  ? 370 LYS A CA    1 
ATOM   2863 C  C     . LYS A 1 373 ? 30.012 -56.407 30.942  1.00 57.60  ? 370 LYS A C     1 
ATOM   2864 O  O     . LYS A 1 373 ? 28.808 -56.536 30.707  1.00 57.99  ? 370 LYS A O     1 
ATOM   2865 C  CB    . LYS A 1 373 ? 30.528 -54.279 32.249  1.00 56.96  ? 370 LYS A CB    1 
ATOM   2866 C  CG    . LYS A 1 373 ? 29.155 -54.213 32.932  1.00 57.12  ? 370 LYS A CG    1 
ATOM   2867 C  CD    . LYS A 1 373 ? 29.296 -54.137 34.444  1.00 57.50  ? 370 LYS A CD    1 
ATOM   2868 C  CE    . LYS A 1 373 ? 28.035 -53.680 35.127  1.00 57.58  ? 370 LYS A CE    1 
ATOM   2869 N  NZ    . LYS A 1 373 ? 28.152 -53.751 36.607  1.00 60.96  ? 370 LYS A NZ    1 
ATOM   2870 N  N     . PRO A 1 374 ? 30.769 -57.483 31.199  1.00 60.15  ? 371 PRO A N     1 
ATOM   2871 C  CA    . PRO A 1 374 ? 30.106 -58.789 31.327  1.00 60.77  ? 371 PRO A CA    1 
ATOM   2872 C  C     . PRO A 1 374 ? 29.437 -58.842 32.710  1.00 61.82  ? 371 PRO A C     1 
ATOM   2873 O  O     . PRO A 1 374 ? 30.084 -58.508 33.709  1.00 62.55  ? 371 PRO A O     1 
ATOM   2874 C  CB    . PRO A 1 374 ? 31.262 -59.782 31.226  1.00 62.24  ? 371 PRO A CB    1 
ATOM   2875 C  CG    . PRO A 1 374 ? 32.445 -59.041 31.811  1.00 63.03  ? 371 PRO A CG    1 
ATOM   2876 C  CD    . PRO A 1 374 ? 32.220 -57.568 31.494  1.00 62.08  ? 371 PRO A CD    1 
ATOM   2877 N  N     . THR A 1 375 ? 28.149 -59.227 32.788  1.00 63.17  ? 372 THR A N     1 
ATOM   2878 C  CA    . THR A 1 375 ? 27.442 -59.335 34.070  1.00 63.72  ? 372 THR A CA    1 
ATOM   2879 C  C     . THR A 1 375 ? 28.214 -60.265 35.030  1.00 63.87  ? 372 THR A C     1 
ATOM   2880 O  O     . THR A 1 375 ? 28.658 -61.350 34.648  1.00 63.64  ? 372 THR A O     1 
ATOM   2881 C  CB    . THR A 1 375 ? 25.989 -59.709 33.840  1.00 65.29  ? 372 THR A CB    1 
ATOM   2882 O  OG1   . THR A 1 375 ? 25.445 -58.779 32.897  1.00 65.60  ? 372 THR A OG1   1 
ATOM   2883 C  CG2   . THR A 1 375 ? 25.171 -59.714 35.122  1.00 64.99  ? 372 THR A CG2   1 
ATOM   2884 N  N     . SER A 1 376 ? 28.420 -59.794 36.258  1.00 66.40  ? 373 SER A N     1 
ATOM   2885 C  CA    . SER A 1 376 ? 29.168 -60.517 37.279  1.00 67.02  ? 373 SER A CA    1 
ATOM   2886 C  C     . SER A 1 376 ? 28.431 -61.681 37.892  1.00 67.29  ? 373 SER A C     1 
ATOM   2887 O  O     . SER A 1 376 ? 27.197 -61.678 37.958  1.00 66.23  ? 373 SER A O     1 
ATOM   2888 C  CB    . SER A 1 376 ? 29.583 -59.563 38.391  1.00 69.43  ? 373 SER A CB    1 
ATOM   2889 O  OG    . SER A 1 376 ? 30.765 -58.889 38.016  1.00 69.51  ? 373 SER A OG    1 
ATOM   2890 N  N     . HIS A 1 377 ? 29.217 -62.651 38.421  1.00 68.46  ? 374 HIS A N     1 
ATOM   2891 C  CA    . HIS A 1 377 ? 28.741 -63.836 39.138  1.00 70.03  ? 374 HIS A CA    1 
ATOM   2892 C  C     . HIS A 1 377 ? 27.822 -64.688 38.260  1.00 70.47  ? 374 HIS A C     1 
ATOM   2893 O  O     . HIS A 1 377 ? 26.773 -65.132 38.735  1.00 72.40  ? 374 HIS A O     1 
ATOM   2894 C  CB    . HIS A 1 377 ? 28.014 -63.402 40.435  1.00 68.68  ? 374 HIS A CB    1 
ATOM   2895 C  CG    . HIS A 1 377 ? 28.601 -62.199 41.112  1.00 68.44  ? 374 HIS A CG    1 
ATOM   2896 N  ND1   . HIS A 1 377 ? 29.830 -62.253 41.754  1.00 68.75  ? 374 HIS A ND1   1 
ATOM   2897 C  CD2   . HIS A 1 377 ? 28.101 -60.948 41.233  1.00 68.55  ? 374 HIS A CD2   1 
ATOM   2898 C  CE1   . HIS A 1 377 ? 30.028 -61.042 42.241  1.00 69.23  ? 374 HIS A CE1   1 
ATOM   2899 N  NE2   . HIS A 1 377 ? 29.021 -60.224 41.949  1.00 67.14  ? 374 HIS A NE2   1 
ATOM   2900 N  N     . GLN A 1 378 ? 28.205 -64.881 36.961  1.00 76.86  ? 375 GLN A N     1 
ATOM   2901 C  CA    . GLN A 1 378 ? 27.466 -65.631 35.921  1.00 76.86  ? 375 GLN A CA    1 
ATOM   2902 C  C     . GLN A 1 378 ? 26.009 -65.170 35.765  1.00 76.86  ? 375 GLN A C     1 
ATOM   2903 O  O     . GLN A 1 378 ? 25.752 -64.049 35.325  1.00 76.86  ? 375 GLN A O     1 
ATOM   2904 C  CB    . GLN A 1 378 ? 27.559 -67.149 36.147  1.00 80.80  ? 375 GLN A CB    1 
ATOM   2905 C  CG    . GLN A 1 378 ? 28.965 -67.676 35.920  1.00 80.80  ? 375 GLN A CG    1 
ATOM   2906 C  CD    . GLN A 1 378 ? 29.216 -69.019 36.581  1.00 80.80  ? 375 GLN A CD    1 
ATOM   2907 O  OE1   . GLN A 1 378 ? 28.769 -69.302 37.728  1.00 80.80  ? 375 GLN A OE1   1 
ATOM   2908 N  NE2   . GLN A 1 378 ? 29.967 -69.881 35.875  1.00 80.80  ? 375 GLN A NE2   1 
ATOM   2909 N  N     . ASP B 1 119 ? 63.241 -31.239 -22.107 1.00 102.54 ? 116 ASP B N     1 
ATOM   2910 C  CA    . ASP B 1 119 ? 62.042 -30.573 -21.592 1.00 102.44 ? 116 ASP B CA    1 
ATOM   2911 C  C     . ASP B 1 119 ? 61.141 -31.552 -20.802 1.00 101.01 ? 116 ASP B C     1 
ATOM   2912 O  O     . ASP B 1 119 ? 60.681 -32.566 -21.356 1.00 101.19 ? 116 ASP B O     1 
ATOM   2913 C  CB    . ASP B 1 119 ? 61.272 -29.857 -22.728 1.00 104.95 ? 116 ASP B CB    1 
ATOM   2914 C  CG    . ASP B 1 119 ? 60.445 -28.651 -22.297 1.00 107.93 ? 116 ASP B CG    1 
ATOM   2915 O  OD1   . ASP B 1 119 ? 60.920 -27.876 -21.426 1.00 109.92 ? 116 ASP B OD1   1 
ATOM   2916 O  OD2   . ASP B 1 119 ? 59.331 -28.471 -22.840 1.00 110.48 ? 116 ASP B OD2   1 
ATOM   2917 N  N     . ARG B 1 120 ? 60.912 -31.230 -19.497 1.00 93.28  ? 117 ARG B N     1 
ATOM   2918 C  CA    . ARG B 1 120 ? 60.127 -31.989 -18.512 1.00 90.85  ? 117 ARG B CA    1 
ATOM   2919 C  C     . ARG B 1 120 ? 58.683 -32.321 -18.962 1.00 88.85  ? 117 ARG B C     1 
ATOM   2920 O  O     . ARG B 1 120 ? 58.002 -31.439 -19.489 1.00 88.60  ? 117 ARG B O     1 
ATOM   2921 C  CB    . ARG B 1 120 ? 60.130 -31.264 -17.153 1.00 89.39  ? 117 ARG B CB    1 
ATOM   2922 N  N     . PRO B 1 121 ? 58.203 -33.581 -18.759 1.00 83.25  ? 118 PRO B N     1 
ATOM   2923 C  CA    . PRO B 1 121 ? 56.827 -33.933 -19.178 1.00 81.87  ? 118 PRO B CA    1 
ATOM   2924 C  C     . PRO B 1 121 ? 55.723 -33.132 -18.483 1.00 80.97  ? 118 PRO B C     1 
ATOM   2925 O  O     . PRO B 1 121 ? 55.853 -32.795 -17.312 1.00 80.80  ? 118 PRO B O     1 
ATOM   2926 C  CB    . PRO B 1 121 ? 56.713 -35.426 -18.832 1.00 82.88  ? 118 PRO B CB    1 
ATOM   2927 C  CG    . PRO B 1 121 ? 58.094 -35.904 -18.681 1.00 83.16  ? 118 PRO B CG    1 
ATOM   2928 C  CD    . PRO B 1 121 ? 58.884 -34.745 -18.157 1.00 83.81  ? 118 PRO B CD    1 
ATOM   2929 N  N     . GLN B 1 122 ? 54.637 -32.836 -19.211 1.00 79.19  ? 119 GLN B N     1 
ATOM   2930 C  CA    . GLN B 1 122 ? 53.475 -32.093 -18.724 1.00 78.23  ? 119 GLN B CA    1 
ATOM   2931 C  C     . GLN B 1 122 ? 52.847 -32.786 -17.489 1.00 76.22  ? 119 GLN B C     1 
ATOM   2932 O  O     . GLN B 1 122 ? 52.693 -34.005 -17.478 1.00 75.70  ? 119 GLN B O     1 
ATOM   2933 C  CB    . GLN B 1 122 ? 52.443 -31.988 -19.851 1.00 80.54  ? 119 GLN B CB    1 
ATOM   2934 C  CG    . GLN B 1 122 ? 51.772 -30.626 -19.939 1.00 86.31  ? 119 GLN B CG    1 
ATOM   2935 C  CD    . GLN B 1 122 ? 50.485 -30.636 -20.745 1.00 92.27  ? 119 GLN B CD    1 
ATOM   2936 O  OE1   . GLN B 1 122 ? 50.301 -31.416 -21.708 1.00 92.61  ? 119 GLN B OE1   1 
ATOM   2937 N  NE2   . GLN B 1 122 ? 49.561 -29.748 -20.365 1.00 92.99  ? 119 GLN B NE2   1 
ATOM   2938 N  N     . LYS B 1 123 ? 52.494 -32.009 -16.455 1.00 70.98  ? 120 LYS B N     1 
ATOM   2939 C  CA    . LYS B 1 123 ? 51.919 -32.541 -15.218 1.00 68.64  ? 120 LYS B CA    1 
ATOM   2940 C  C     . LYS B 1 123 ? 50.644 -31.802 -14.733 1.00 67.56  ? 120 LYS B C     1 
ATOM   2941 O  O     . LYS B 1 123 ? 50.427 -30.648 -15.135 1.00 67.34  ? 120 LYS B O     1 
ATOM   2942 C  CB    . LYS B 1 123 ? 52.982 -32.484 -14.100 1.00 68.95  ? 120 LYS B CB    1 
ATOM   2943 C  CG    . LYS B 1 123 ? 54.180 -33.385 -14.309 1.00 67.31  ? 120 LYS B CG    1 
ATOM   2944 C  CD    . LYS B 1 123 ? 53.826 -34.860 -14.248 1.00 64.61  ? 120 LYS B CD    1 
ATOM   2945 C  CE    . LYS B 1 123 ? 54.954 -35.709 -14.742 1.00 64.05  ? 120 LYS B CE    1 
ATOM   2946 N  NZ    . LYS B 1 123 ? 56.218 -35.447 -14.014 1.00 65.10  ? 120 LYS B NZ    1 
ATOM   2947 N  N     . PRO B 1 124 ? 49.801 -32.412 -13.838 1.00 61.65  ? 121 PRO B N     1 
ATOM   2948 C  CA    . PRO B 1 124 ? 48.644 -31.663 -13.314 1.00 60.47  ? 121 PRO B CA    1 
ATOM   2949 C  C     . PRO B 1 124 ? 49.167 -30.500 -12.482 1.00 59.17  ? 121 PRO B C     1 
ATOM   2950 O  O     . PRO B 1 124 ? 50.274 -30.595 -11.939 1.00 58.08  ? 121 PRO B O     1 
ATOM   2951 C  CB    . PRO B 1 124 ? 47.931 -32.680 -12.415 1.00 61.68  ? 121 PRO B CB    1 
ATOM   2952 C  CG    . PRO B 1 124 ? 48.504 -34.011 -12.792 1.00 62.02  ? 121 PRO B CG    1 
ATOM   2953 C  CD    . PRO B 1 124 ? 49.887 -33.759 -13.234 1.00 62.61  ? 121 PRO B CD    1 
ATOM   2954 N  N     . PHE B 1 125 ? 48.386 -29.392 -12.386 1.00 55.89  ? 122 PHE B N     1 
ATOM   2955 C  CA    . PHE B 1 125 ? 48.724 -28.169 -11.619 1.00 55.74  ? 122 PHE B CA    1 
ATOM   2956 C  C     . PHE B 1 125 ? 49.808 -27.312 -12.290 1.00 56.10  ? 122 PHE B C     1 
ATOM   2957 O  O     . PHE B 1 125 ? 50.221 -26.306 -11.720 1.00 56.27  ? 122 PHE B O     1 
ATOM   2958 C  CB    . PHE B 1 125 ? 49.093 -28.461 -10.137 1.00 54.88  ? 122 PHE B CB    1 
ATOM   2959 C  CG    . PHE B 1 125 ? 48.303 -29.554 -9.455  1.00 54.67  ? 122 PHE B CG    1 
ATOM   2960 C  CD1   . PHE B 1 125 ? 46.909 -29.532 -9.448  1.00 51.80  ? 122 PHE B CD1   1 
ATOM   2961 C  CD2   . PHE B 1 125 ? 48.950 -30.618 -8.833  1.00 53.00  ? 122 PHE B CD2   1 
ATOM   2962 C  CE1   . PHE B 1 125 ? 46.178 -30.560 -8.841  1.00 52.28  ? 122 PHE B CE1   1 
ATOM   2963 C  CE2   . PHE B 1 125 ? 48.209 -31.634 -8.199  1.00 52.85  ? 122 PHE B CE2   1 
ATOM   2964 C  CZ    . PHE B 1 125 ? 46.831 -31.586 -8.200  1.00 52.58  ? 122 PHE B CZ    1 
ATOM   2965 N  N     . ASP B 1 126 ? 50.266 -27.699 -13.492 1.00 58.56  ? 123 ASP B N     1 
ATOM   2966 C  CA    . ASP B 1 126 ? 51.271 -26.956 -14.247 1.00 59.44  ? 123 ASP B CA    1 
ATOM   2967 C  C     . ASP B 1 126 ? 50.655 -25.706 -14.864 1.00 58.89  ? 123 ASP B C     1 
ATOM   2968 O  O     . ASP B 1 126 ? 51.344 -24.694 -14.989 1.00 59.20  ? 123 ASP B O     1 
ATOM   2969 C  CB    . ASP B 1 126 ? 51.826 -27.821 -15.376 1.00 61.06  ? 123 ASP B CB    1 
ATOM   2970 C  CG    . ASP B 1 126 ? 53.083 -28.590 -15.060 1.00 63.26  ? 123 ASP B CG    1 
ATOM   2971 O  OD1   . ASP B 1 126 ? 53.634 -28.412 -13.941 1.00 64.89  ? 123 ASP B OD1   1 
ATOM   2972 O  OD2   . ASP B 1 126 ? 53.529 -29.362 -15.927 1.00 65.99  ? 123 ASP B OD2   1 
ATOM   2973 N  N     . LYS B 1 127 ? 49.377 -25.790 -15.276 1.00 58.34  ? 124 LYS B N     1 
ATOM   2974 C  CA    . LYS B 1 127 ? 48.659 -24.703 -15.911 1.00 58.72  ? 124 LYS B CA    1 
ATOM   2975 C  C     . LYS B 1 127 ? 47.153 -24.904 -15.768 1.00 58.19  ? 124 LYS B C     1 
ATOM   2976 O  O     . LYS B 1 127 ? 46.649 -25.961 -16.115 1.00 58.61  ? 124 LYS B O     1 
ATOM   2977 C  CB    . LYS B 1 127 ? 49.049 -24.646 -17.407 1.00 62.08  ? 124 LYS B CB    1 
ATOM   2978 C  CG    . LYS B 1 127 ? 48.593 -23.409 -18.176 1.00 64.54  ? 124 LYS B CG    1 
ATOM   2979 C  CD    . LYS B 1 127 ? 49.278 -23.304 -19.530 1.00 67.01  ? 124 LYS B CD    1 
ATOM   2980 C  CE    . LYS B 1 127 ? 50.597 -22.573 -19.474 1.00 69.65  ? 124 LYS B CE    1 
ATOM   2981 N  NZ    . LYS B 1 127 ? 51.321 -22.579 -20.781 1.00 73.15  ? 124 LYS B NZ    1 
ATOM   2982 N  N     . PHE B 1 128 ? 46.435 -23.904 -15.254 1.00 59.43  ? 125 PHE B N     1 
ATOM   2983 C  CA    . PHE B 1 128 ? 44.979 -23.972 -15.139 1.00 59.20  ? 125 PHE B CA    1 
ATOM   2984 C  C     . PHE B 1 128 ? 44.459 -22.933 -16.142 1.00 59.55  ? 125 PHE B C     1 
ATOM   2985 O  O     . PHE B 1 128 ? 44.971 -21.805 -16.191 1.00 59.24  ? 125 PHE B O     1 
ATOM   2986 C  CB    . PHE B 1 128 ? 44.484 -23.634 -13.708 1.00 60.92  ? 125 PHE B CB    1 
ATOM   2987 C  CG    . PHE B 1 128 ? 44.519 -24.685 -12.605 1.00 61.12  ? 125 PHE B CG    1 
ATOM   2988 C  CD1   . PHE B 1 128 ? 45.039 -25.951 -12.836 1.00 58.97  ? 125 PHE B CD1   1 
ATOM   2989 C  CD2   . PHE B 1 128 ? 44.039 -24.396 -11.333 1.00 59.19  ? 125 PHE B CD2   1 
ATOM   2990 C  CE1   . PHE B 1 128 ? 45.053 -26.914 -11.822 1.00 59.73  ? 125 PHE B CE1   1 
ATOM   2991 C  CE2   . PHE B 1 128 ? 44.062 -25.356 -10.318 1.00 58.45  ? 125 PHE B CE2   1 
ATOM   2992 C  CZ    . PHE B 1 128 ? 44.565 -26.608 -10.568 1.00 59.66  ? 125 PHE B CZ    1 
ATOM   2993 N  N     . PHE B 1 129 ? 43.479 -23.325 -16.975 1.00 59.30  ? 126 PHE B N     1 
ATOM   2994 C  CA    . PHE B 1 129 ? 42.897 -22.430 -17.965 1.00 60.06  ? 126 PHE B CA    1 
ATOM   2995 C  C     . PHE B 1 129 ? 41.569 -21.966 -17.400 1.00 60.47  ? 126 PHE B C     1 
ATOM   2996 O  O     . PHE B 1 129 ? 40.676 -22.785 -17.174 1.00 60.33  ? 126 PHE B O     1 
ATOM   2997 C  CB    . PHE B 1 129 ? 42.741 -23.125 -19.340 1.00 60.79  ? 126 PHE B CB    1 
ATOM   2998 C  CG    . PHE B 1 129 ? 44.044 -23.426 -20.040 1.00 60.80  ? 126 PHE B CG    1 
ATOM   2999 C  CD1   . PHE B 1 129 ? 44.740 -24.594 -19.776 1.00 60.56  ? 126 PHE B CD1   1 
ATOM   3000 C  CD2   . PHE B 1 129 ? 44.577 -22.538 -20.967 1.00 61.70  ? 126 PHE B CD2   1 
ATOM   3001 C  CE1   . PHE B 1 129 ? 45.949 -24.870 -20.429 1.00 63.18  ? 126 PHE B CE1   1 
ATOM   3002 C  CE2   . PHE B 1 129 ? 45.794 -22.811 -21.609 1.00 61.16  ? 126 PHE B CE2   1 
ATOM   3003 C  CZ    . PHE B 1 129 ? 46.454 -23.985 -21.356 1.00 61.56  ? 126 PHE B CZ    1 
ATOM   3004 N  N     . ILE B 1 130 ? 41.455 -20.664 -17.121 1.00 60.52  ? 127 ILE B N     1 
ATOM   3005 C  CA    . ILE B 1 130 ? 40.228 -20.089 -16.555 1.00 61.66  ? 127 ILE B CA    1 
ATOM   3006 C  C     . ILE B 1 130 ? 39.475 -19.246 -17.594 1.00 62.77  ? 127 ILE B C     1 
ATOM   3007 O  O     . ILE B 1 130 ? 40.103 -18.702 -18.519 1.00 62.43  ? 127 ILE B O     1 
ATOM   3008 C  CB    . ILE B 1 130 ? 40.493 -19.326 -15.225 1.00 63.63  ? 127 ILE B CB    1 
ATOM   3009 C  CG1   . ILE B 1 130 ? 41.259 -18.017 -15.462 1.00 63.84  ? 127 ILE B CG1   1 
ATOM   3010 C  CG2   . ILE B 1 130 ? 41.211 -20.226 -14.202 1.00 62.41  ? 127 ILE B CG2   1 
ATOM   3011 C  CD1   . ILE B 1 130 ? 41.251 -17.084 -14.345 1.00 65.51  ? 127 ILE B CD1   1 
ATOM   3012 N  N     . ASP B 1 131 ? 38.139 -19.149 -17.461 1.00 63.15  ? 128 ASP B N     1 
ATOM   3013 C  CA    . ASP B 1 131 ? 37.308 -18.356 -18.376 1.00 65.20  ? 128 ASP B CA    1 
ATOM   3014 C  C     . ASP B 1 131 ? 35.919 -18.242 -17.822 1.00 65.48  ? 128 ASP B C     1 
ATOM   3015 O  O     . ASP B 1 131 ? 35.565 -19.048 -16.973 1.00 65.98  ? 128 ASP B O     1 
ATOM   3016 C  CB    . ASP B 1 131 ? 37.259 -18.971 -19.790 1.00 69.04  ? 128 ASP B CB    1 
ATOM   3017 C  CG    . ASP B 1 131 ? 36.805 -18.010 -20.882 1.00 72.70  ? 128 ASP B CG    1 
ATOM   3018 O  OD1   . ASP B 1 131 ? 37.057 -16.784 -20.745 1.00 75.63  ? 128 ASP B OD1   1 
ATOM   3019 O  OD2   . ASP B 1 131 ? 36.201 -18.482 -21.876 1.00 75.92  ? 128 ASP B OD2   1 
ATOM   3020 N  N     . TYR B 1 132 ? 35.125 -17.267 -18.286 1.00 63.13  ? 129 TYR B N     1 
ATOM   3021 C  CA    . TYR B 1 132 ? 33.757 -17.094 -17.810 1.00 63.81  ? 129 TYR B CA    1 
ATOM   3022 C  C     . TYR B 1 132 ? 32.737 -17.459 -18.868 1.00 64.79  ? 129 TYR B C     1 
ATOM   3023 O  O     . TYR B 1 132 ? 32.902 -17.084 -20.035 1.00 65.35  ? 129 TYR B O     1 
ATOM   3024 C  CB    . TYR B 1 132 ? 33.502 -15.642 -17.349 1.00 63.41  ? 129 TYR B CB    1 
ATOM   3025 C  CG    . TYR B 1 132 ? 33.806 -15.380 -15.892 1.00 62.50  ? 129 TYR B CG    1 
ATOM   3026 C  CD1   . TYR B 1 132 ? 32.973 -15.869 -14.886 1.00 62.22  ? 129 TYR B CD1   1 
ATOM   3027 C  CD2   . TYR B 1 132 ? 34.914 -14.629 -15.515 1.00 61.29  ? 129 TYR B CD2   1 
ATOM   3028 C  CE1   . TYR B 1 132 ? 33.255 -15.642 -13.540 1.00 64.04  ? 129 TYR B CE1   1 
ATOM   3029 C  CE2   . TYR B 1 132 ? 35.196 -14.382 -14.176 1.00 63.73  ? 129 TYR B CE2   1 
ATOM   3030 C  CZ    . TYR B 1 132 ? 34.367 -14.897 -13.192 1.00 63.94  ? 129 TYR B CZ    1 
ATOM   3031 O  OH    . TYR B 1 132 ? 34.646 -14.684 -11.866 1.00 62.58  ? 129 TYR B OH    1 
ATOM   3032 N  N     . ILE B 1 133 ? 31.671 -18.164 -18.449 1.00 66.53  ? 130 ILE B N     1 
ATOM   3033 C  CA    . ILE B 1 133 ? 30.517 -18.556 -19.261 1.00 67.45  ? 130 ILE B CA    1 
ATOM   3034 C  C     . ILE B 1 133 ? 29.326 -17.717 -18.752 1.00 68.24  ? 130 ILE B C     1 
ATOM   3035 O  O     . ILE B 1 133 ? 29.001 -17.756 -17.560 1.00 68.25  ? 130 ILE B O     1 
ATOM   3036 C  CB    . ILE B 1 133 ? 30.244 -20.097 -19.224 1.00 70.48  ? 130 ILE B CB    1 
ATOM   3037 C  CG1   . ILE B 1 133 ? 31.149 -20.830 -20.214 1.00 69.90  ? 130 ILE B CG1   1 
ATOM   3038 C  CG2   . ILE B 1 133 ? 28.760 -20.448 -19.492 1.00 70.59  ? 130 ILE B CG2   1 
ATOM   3039 C  CD1   . ILE B 1 133 ? 31.018 -22.351 -20.176 1.00 70.72  ? 130 ILE B CD1   1 
ATOM   3040 N  N     . GLY B 1 134 ? 28.706 -16.960 -19.651 1.00 71.61  ? 131 GLY B N     1 
ATOM   3041 C  CA    . GLY B 1 134 ? 27.559 -16.129 -19.302 1.00 72.86  ? 131 GLY B CA    1 
ATOM   3042 C  C     . GLY B 1 134 ? 27.543 -14.727 -19.884 1.00 74.00  ? 131 GLY B C     1 
ATOM   3043 O  O     . GLY B 1 134 ? 28.426 -14.363 -20.672 1.00 73.69  ? 131 GLY B O     1 
ATOM   3044 N  N     . PRO B 1 135 ? 26.536 -13.899 -19.518 1.00 76.26  ? 132 PRO B N     1 
ATOM   3045 C  CA    . PRO B 1 135 ? 25.447 -14.170 -18.562 1.00 77.04  ? 132 PRO B CA    1 
ATOM   3046 C  C     . PRO B 1 135 ? 24.431 -15.223 -19.007 1.00 78.16  ? 132 PRO B C     1 
ATOM   3047 O  O     . PRO B 1 135 ? 23.986 -15.248 -20.150 1.00 78.48  ? 132 PRO B O     1 
ATOM   3048 C  CB    . PRO B 1 135 ? 24.824 -12.786 -18.338 1.00 78.67  ? 132 PRO B CB    1 
ATOM   3049 C  CG    . PRO B 1 135 ? 25.121 -12.031 -19.593 1.00 78.54  ? 132 PRO B CG    1 
ATOM   3050 C  CD    . PRO B 1 135 ? 26.475 -12.513 -20.026 1.00 78.06  ? 132 PRO B CD    1 
ATOM   3051 N  N     . LEU B 1 136 ? 24.100 -16.107 -18.070 1.00 79.59  ? 133 LEU B N     1 
ATOM   3052 C  CA    . LEU B 1 136 ? 23.148 -17.206 -18.188 1.00 80.42  ? 133 LEU B CA    1 
ATOM   3053 C  C     . LEU B 1 136 ? 21.830 -16.803 -17.480 1.00 81.12  ? 133 LEU B C     1 
ATOM   3054 O  O     . LEU B 1 136 ? 21.831 -15.802 -16.755 1.00 81.41  ? 133 LEU B O     1 
ATOM   3055 C  CB    . LEU B 1 136 ? 23.728 -18.457 -17.493 1.00 80.05  ? 133 LEU B CB    1 
ATOM   3056 C  CG    . LEU B 1 136 ? 25.010 -19.043 -18.042 1.00 80.45  ? 133 LEU B CG    1 
ATOM   3057 C  CD1   . LEU B 1 136 ? 25.587 -20.048 -17.068 1.00 80.57  ? 133 LEU B CD1   1 
ATOM   3058 C  CD2   . LEU B 1 136 ? 24.786 -19.700 -19.392 1.00 80.16  ? 133 LEU B CD2   1 
ATOM   3059 N  N     . PRO B 1 137 ? 20.697 -17.538 -17.640 1.00 84.07  ? 134 PRO B N     1 
ATOM   3060 C  CA    . PRO B 1 137 ? 19.478 -17.144 -16.915 1.00 84.70  ? 134 PRO B CA    1 
ATOM   3061 C  C     . PRO B 1 137 ? 19.738 -17.245 -15.409 1.00 85.08  ? 134 PRO B C     1 
ATOM   3062 O  O     . PRO B 1 137 ? 20.486 -18.141 -14.989 1.00 85.33  ? 134 PRO B O     1 
ATOM   3063 C  CB    . PRO B 1 137 ? 18.433 -18.167 -17.381 1.00 86.42  ? 134 PRO B CB    1 
ATOM   3064 C  CG    . PRO B 1 137 ? 18.980 -18.730 -18.635 1.00 86.22  ? 134 PRO B CG    1 
ATOM   3065 C  CD    . PRO B 1 137 ? 20.456 -18.755 -18.436 1.00 86.00  ? 134 PRO B CD    1 
ATOM   3066 N  N     . PRO B 1 138 ? 19.192 -16.331 -14.574 1.00 86.02  ? 135 PRO B N     1 
ATOM   3067 C  CA    . PRO B 1 138 ? 19.481 -16.412 -13.141 1.00 85.89  ? 135 PRO B CA    1 
ATOM   3068 C  C     . PRO B 1 138 ? 18.991 -17.701 -12.518 1.00 85.27  ? 135 PRO B C     1 
ATOM   3069 O  O     . PRO B 1 138 ? 17.845 -18.102 -12.721 1.00 85.68  ? 135 PRO B O     1 
ATOM   3070 C  CB    . PRO B 1 138 ? 18.793 -15.178 -12.553 1.00 88.02  ? 135 PRO B CB    1 
ATOM   3071 C  CG    . PRO B 1 138 ? 18.493 -14.295 -13.704 1.00 88.21  ? 135 PRO B CG    1 
ATOM   3072 C  CD    . PRO B 1 138 ? 18.300 -15.197 -14.876 1.00 87.90  ? 135 PRO B CD    1 
ATOM   3073 N  N     . SER B 1 139 ? 19.894 -18.363 -11.797 1.00 84.32  ? 136 SER B N     1 
ATOM   3074 C  CA    . SER B 1 139 ? 19.640 -19.602 -11.073 1.00 83.98  ? 136 SER B CA    1 
ATOM   3075 C  C     . SER B 1 139 ? 20.233 -19.411 -9.691  1.00 84.32  ? 136 SER B C     1 
ATOM   3076 O  O     . SER B 1 139 ? 21.453 -19.241 -9.569  1.00 84.25  ? 136 SER B O     1 
ATOM   3077 C  CB    . SER B 1 139 ? 20.279 -20.795 -11.773 1.00 85.78  ? 136 SER B CB    1 
ATOM   3078 O  OG    . SER B 1 139 ? 20.096 -21.984 -11.023 1.00 84.05  ? 136 SER B OG    1 
ATOM   3079 N  N     . GLN B 1 140 ? 19.367 -19.388 -8.653  1.00 84.96  ? 137 GLN B N     1 
ATOM   3080 C  CA    . GLN B 1 140 ? 19.754 -19.189 -7.253  1.00 85.32  ? 137 GLN B CA    1 
ATOM   3081 C  C     . GLN B 1 140 ? 20.537 -17.866 -7.063  1.00 84.75  ? 137 GLN B C     1 
ATOM   3082 O  O     . GLN B 1 140 ? 21.379 -17.755 -6.168  1.00 84.92  ? 137 GLN B O     1 
ATOM   3083 C  CB    . GLN B 1 140 ? 20.514 -20.421 -6.710  1.00 88.36  ? 137 GLN B CB    1 
ATOM   3084 C  CG    . GLN B 1 140 ? 19.627 -21.642 -6.467  1.00 91.35  ? 137 GLN B CG    1 
ATOM   3085 C  CD    . GLN B 1 140 ? 19.155 -21.687 -5.031  1.00 94.90  ? 137 GLN B CD    1 
ATOM   3086 O  OE1   . GLN B 1 140 ? 18.065 -21.182 -4.693  1.00 96.79  ? 137 GLN B OE1   1 
ATOM   3087 N  NE2   . GLN B 1 140 ? 19.966 -22.290 -4.144  1.00 95.63  ? 137 GLN B NE2   1 
ATOM   3088 N  N     . GLY B 1 141 ? 20.239 -16.888 -7.923  1.00 83.20  ? 138 GLY B N     1 
ATOM   3089 C  CA    . GLY B 1 141 ? 20.865 -15.570 -7.922  1.00 82.59  ? 138 GLY B CA    1 
ATOM   3090 C  C     . GLY B 1 141 ? 22.144 -15.453 -8.733  1.00 82.22  ? 138 GLY B C     1 
ATOM   3091 O  O     . GLY B 1 141 ? 22.654 -14.344 -8.925  1.00 82.83  ? 138 GLY B O     1 
ATOM   3092 N  N     . TYR B 1 142 ? 22.674 -16.598 -9.216  1.00 80.99  ? 139 TYR B N     1 
ATOM   3093 C  CA    . TYR B 1 142 ? 23.902 -16.678 -10.009 1.00 80.18  ? 139 TYR B CA    1 
ATOM   3094 C  C     . TYR B 1 142 ? 23.636 -16.512 -11.500 1.00 79.41  ? 139 TYR B C     1 
ATOM   3095 O  O     . TYR B 1 142 ? 22.605 -16.973 -11.994 1.00 79.31  ? 139 TYR B O     1 
ATOM   3096 C  CB    . TYR B 1 142 ? 24.658 -17.972 -9.691  1.00 81.08  ? 139 TYR B CB    1 
ATOM   3097 C  CG    . TYR B 1 142 ? 25.130 -18.024 -8.253  1.00 81.53  ? 139 TYR B CG    1 
ATOM   3098 C  CD1   . TYR B 1 142 ? 26.306 -17.393 -7.862  1.00 82.35  ? 139 TYR B CD1   1 
ATOM   3099 C  CD2   . TYR B 1 142 ? 24.385 -18.678 -7.276  1.00 81.98  ? 139 TYR B CD2   1 
ATOM   3100 C  CE1   . TYR B 1 142 ? 26.737 -17.422 -6.536  1.00 82.43  ? 139 TYR B CE1   1 
ATOM   3101 C  CE2   . TYR B 1 142 ? 24.807 -18.718 -5.949  1.00 82.95  ? 139 TYR B CE2   1 
ATOM   3102 C  CZ    . TYR B 1 142 ? 25.987 -18.092 -5.584  1.00 83.09  ? 139 TYR B CZ    1 
ATOM   3103 O  OH    . TYR B 1 142 ? 26.413 -18.120 -4.278  1.00 83.45  ? 139 TYR B OH    1 
ATOM   3104 N  N     . LEU B 1 143 ? 24.561 -15.837 -12.210 1.00 77.77  ? 140 LEU B N     1 
ATOM   3105 C  CA    . LEU B 1 143 ? 24.449 -15.555 -13.646 1.00 76.75  ? 140 LEU B CA    1 
ATOM   3106 C  C     . LEU B 1 143 ? 25.623 -16.041 -14.500 1.00 75.76  ? 140 LEU B C     1 
ATOM   3107 O  O     . LEU B 1 143 ? 25.494 -16.103 -15.719 1.00 75.72  ? 140 LEU B O     1 
ATOM   3108 C  CB    . LEU B 1 143 ? 24.284 -14.041 -13.856 1.00 77.17  ? 140 LEU B CB    1 
ATOM   3109 C  CG    . LEU B 1 143 ? 23.057 -13.401 -13.225 1.00 77.95  ? 140 LEU B CG    1 
ATOM   3110 C  CD1   . LEU B 1 143 ? 23.367 -11.999 -12.743 1.00 78.46  ? 140 LEU B CD1   1 
ATOM   3111 C  CD2   . LEU B 1 143 ? 21.875 -13.435 -14.174 1.00 78.71  ? 140 LEU B CD2   1 
ATOM   3112 N  N     . TYR B 1 144 ? 26.768 -16.345 -13.881 1.00 73.35  ? 141 TYR B N     1 
ATOM   3113 C  CA    . TYR B 1 144 ? 27.966 -16.779 -14.594 1.00 72.03  ? 141 TYR B CA    1 
ATOM   3114 C  C     . TYR B 1 144 ? 28.553 -18.060 -14.013 1.00 70.62  ? 141 TYR B C     1 
ATOM   3115 O  O     . TYR B 1 144 ? 28.190 -18.459 -12.909 1.00 70.81  ? 141 TYR B O     1 
ATOM   3116 C  CB    . TYR B 1 144 ? 29.027 -15.676 -14.535 1.00 73.75  ? 141 TYR B CB    1 
ATOM   3117 C  CG    . TYR B 1 144 ? 28.679 -14.408 -15.277 1.00 75.64  ? 141 TYR B CG    1 
ATOM   3118 C  CD1   . TYR B 1 144 ? 27.855 -13.441 -14.701 1.00 77.91  ? 141 TYR B CD1   1 
ATOM   3119 C  CD2   . TYR B 1 144 ? 29.215 -14.143 -16.533 1.00 76.98  ? 141 TYR B CD2   1 
ATOM   3120 C  CE1   . TYR B 1 144 ? 27.534 -12.268 -15.380 1.00 79.00  ? 141 TYR B CE1   1 
ATOM   3121 C  CE2   . TYR B 1 144 ? 28.914 -12.967 -17.215 1.00 77.61  ? 141 TYR B CE2   1 
ATOM   3122 C  CZ    . TYR B 1 144 ? 28.080 -12.028 -16.632 1.00 79.39  ? 141 TYR B CZ    1 
ATOM   3123 O  OH    . TYR B 1 144 ? 27.809 -10.858 -17.303 1.00 82.74  ? 141 TYR B OH    1 
ATOM   3124 N  N     . VAL B 1 145 ? 29.458 -18.708 -14.767 1.00 66.66  ? 142 VAL B N     1 
ATOM   3125 C  CA    . VAL B 1 145 ? 30.169 -19.907 -14.352 1.00 64.44  ? 142 VAL B CA    1 
ATOM   3126 C  C     . VAL B 1 145 ? 31.616 -19.639 -14.655 1.00 63.48  ? 142 VAL B C     1 
ATOM   3127 O  O     . VAL B 1 145 ? 31.938 -19.405 -15.810 1.00 63.25  ? 142 VAL B O     1 
ATOM   3128 C  CB    . VAL B 1 145 ? 29.727 -21.205 -15.082 1.00 66.99  ? 142 VAL B CB    1 
ATOM   3129 C  CG1   . VAL B 1 145 ? 30.592 -22.393 -14.654 1.00 66.82  ? 142 VAL B CG1   1 
ATOM   3130 C  CG2   . VAL B 1 145 ? 28.265 -21.517 -14.839 1.00 66.74  ? 142 VAL B CG2   1 
ATOM   3131 N  N     . LEU B 1 146 ? 32.496 -19.683 -13.658 1.00 61.34  ? 143 LEU B N     1 
ATOM   3132 C  CA    . LEU B 1 146 ? 33.930 -19.540 -13.905 1.00 60.32  ? 143 LEU B CA    1 
ATOM   3133 C  C     . LEU B 1 146 ? 34.361 -20.976 -14.208 1.00 59.57  ? 143 LEU B C     1 
ATOM   3134 O  O     . LEU B 1 146 ? 33.983 -21.891 -13.483 1.00 59.28  ? 143 LEU B O     1 
ATOM   3135 C  CB    . LEU B 1 146 ? 34.670 -18.985 -12.675 1.00 59.77  ? 143 LEU B CB    1 
ATOM   3136 C  CG    . LEU B 1 146 ? 36.205 -18.953 -12.728 1.00 60.18  ? 143 LEU B CG    1 
ATOM   3137 C  CD1   . LEU B 1 146 ? 36.710 -17.978 -13.770 1.00 59.42  ? 143 LEU B CD1   1 
ATOM   3138 C  CD2   . LEU B 1 146 ? 36.772 -18.646 -11.355 1.00 58.68  ? 143 LEU B CD2   1 
ATOM   3139 N  N     . VAL B 1 147 ? 35.085 -21.177 -15.295 1.00 60.42  ? 144 VAL B N     1 
ATOM   3140 C  CA    . VAL B 1 147 ? 35.506 -22.498 -15.718 1.00 59.47  ? 144 VAL B CA    1 
ATOM   3141 C  C     . VAL B 1 147 ? 36.990 -22.629 -15.520 1.00 58.74  ? 144 VAL B C     1 
ATOM   3142 O  O     . VAL B 1 147 ? 37.738 -21.781 -16.012 1.00 58.84  ? 144 VAL B O     1 
ATOM   3143 C  CB    . VAL B 1 147 ? 35.089 -22.796 -17.195 1.00 62.43  ? 144 VAL B CB    1 
ATOM   3144 C  CG1   . VAL B 1 147 ? 35.568 -24.175 -17.638 1.00 62.96  ? 144 VAL B CG1   1 
ATOM   3145 C  CG2   . VAL B 1 147 ? 33.576 -22.678 -17.383 1.00 62.12  ? 144 VAL B CG2   1 
ATOM   3146 N  N     . VAL B 1 148 ? 37.424 -23.684 -14.801 1.00 57.73  ? 145 VAL B N     1 
ATOM   3147 C  CA    . VAL B 1 148 ? 38.845 -23.949 -14.575 1.00 56.85  ? 145 VAL B CA    1 
ATOM   3148 C  C     . VAL B 1 148 ? 39.143 -25.349 -15.118 1.00 56.69  ? 145 VAL B C     1 
ATOM   3149 O  O     . VAL B 1 148 ? 38.526 -26.333 -14.691 1.00 56.95  ? 145 VAL B O     1 
ATOM   3150 C  CB    . VAL B 1 148 ? 39.307 -23.810 -13.107 1.00 58.68  ? 145 VAL B CB    1 
ATOM   3151 C  CG1   . VAL B 1 148 ? 40.825 -23.915 -13.025 1.00 57.16  ? 145 VAL B CG1   1 
ATOM   3152 C  CG2   . VAL B 1 148 ? 38.804 -22.516 -12.470 1.00 58.86  ? 145 VAL B CG2   1 
ATOM   3153 N  N     . VAL B 1 149 ? 40.069 -25.432 -16.065 1.00 55.99  ? 146 VAL B N     1 
ATOM   3154 C  CA    . VAL B 1 149 ? 40.446 -26.692 -16.684 1.00 55.89  ? 146 VAL B CA    1 
ATOM   3155 C  C     . VAL B 1 149 ? 41.946 -26.906 -16.476 1.00 56.07  ? 146 VAL B C     1 
ATOM   3156 O  O     . VAL B 1 149 ? 42.754 -26.054 -16.893 1.00 56.62  ? 146 VAL B O     1 
ATOM   3157 C  CB    . VAL B 1 149 ? 40.048 -26.759 -18.205 1.00 57.46  ? 146 VAL B CB    1 
ATOM   3158 C  CG1   . VAL B 1 149 ? 40.713 -27.945 -18.917 1.00 57.77  ? 146 VAL B CG1   1 
ATOM   3159 C  CG2   . VAL B 1 149 ? 38.540 -26.804 -18.391 1.00 55.72  ? 146 VAL B CG2   1 
ATOM   3160 N  N     . ASP B 1 150 ? 42.320 -28.046 -15.864 1.00 58.14  ? 147 ASP B N     1 
ATOM   3161 C  CA    . ASP B 1 150 ? 43.731 -28.362 -15.711 1.00 59.11  ? 147 ASP B CA    1 
ATOM   3162 C  C     . ASP B 1 150 ? 44.240 -28.752 -17.143 1.00 59.76  ? 147 ASP B C     1 
ATOM   3163 O  O     . ASP B 1 150 ? 43.600 -29.545 -17.839 1.00 59.83  ? 147 ASP B O     1 
ATOM   3164 C  CB    . ASP B 1 150 ? 43.940 -29.493 -14.697 1.00 61.35  ? 147 ASP B CB    1 
ATOM   3165 C  CG    . ASP B 1 150 ? 45.390 -29.935 -14.586 1.00 61.58  ? 147 ASP B CG    1 
ATOM   3166 O  OD1   . ASP B 1 150 ? 46.241 -29.093 -14.208 1.00 60.64  ? 147 ASP B OD1   1 
ATOM   3167 O  OD2   . ASP B 1 150 ? 45.679 -31.129 -14.889 1.00 59.30  ? 147 ASP B OD2   1 
ATOM   3168 N  N     . GLY B 1 151 ? 45.334 -28.133 -17.577 1.00 61.08  ? 148 GLY B N     1 
ATOM   3169 C  CA    . GLY B 1 151 ? 45.912 -28.349 -18.895 1.00 61.80  ? 148 GLY B CA    1 
ATOM   3170 C  C     . GLY B 1 151 ? 46.316 -29.774 -19.208 1.00 63.07  ? 148 GLY B C     1 
ATOM   3171 O  O     . GLY B 1 151 ? 46.005 -30.276 -20.293 1.00 62.99  ? 148 GLY B O     1 
ATOM   3172 N  N     . MET B 1 152 ? 47.019 -30.431 -18.271 1.00 62.55  ? 149 MET B N     1 
ATOM   3173 C  CA    . MET B 1 152 ? 47.498 -31.795 -18.459 1.00 62.90  ? 149 MET B CA    1 
ATOM   3174 C  C     . MET B 1 152 ? 46.380 -32.852 -18.461 1.00 62.95  ? 149 MET B C     1 
ATOM   3175 O  O     . MET B 1 152 ? 46.202 -33.534 -19.476 1.00 62.96  ? 149 MET B O     1 
ATOM   3176 C  CB    . MET B 1 152 ? 48.599 -32.130 -17.439 1.00 64.02  ? 149 MET B CB    1 
ATOM   3177 C  CG    . MET B 1 152 ? 49.358 -33.410 -17.750 1.00 65.83  ? 149 MET B CG    1 
ATOM   3178 S  SD    . MET B 1 152 ? 48.530 -34.866 -17.061 1.00 69.34  ? 149 MET B SD    1 
ATOM   3179 C  CE    . MET B 1 152 ? 48.869 -36.060 -18.298 1.00 67.50  ? 149 MET B CE    1 
ATOM   3180 N  N     . THR B 1 153 ? 45.660 -33.012 -17.332 1.00 62.84  ? 150 THR B N     1 
ATOM   3181 C  CA    . THR B 1 153 ? 44.599 -34.016 -17.146 1.00 61.64  ? 150 THR B CA    1 
ATOM   3182 C  C     . THR B 1 153 ? 43.288 -33.691 -17.865 1.00 61.21  ? 150 THR B C     1 
ATOM   3183 O  O     . THR B 1 153 ? 42.536 -34.614 -18.195 1.00 60.94  ? 150 THR B O     1 
ATOM   3184 C  CB    . THR B 1 153 ? 44.339 -34.272 -15.628 1.00 61.31  ? 150 THR B CB    1 
ATOM   3185 O  OG1   . THR B 1 153 ? 43.684 -33.151 -15.044 1.00 61.58  ? 150 THR B OG1   1 
ATOM   3186 C  CG2   . THR B 1 153 ? 45.602 -34.542 -14.846 1.00 60.25  ? 150 THR B CG2   1 
ATOM   3187 N  N     . GLY B 1 154 ? 43.001 -32.405 -18.079 1.00 58.65  ? 151 GLY B N     1 
ATOM   3188 C  CA    . GLY B 1 154 ? 41.742 -31.973 -18.681 1.00 57.73  ? 151 GLY B CA    1 
ATOM   3189 C  C     . GLY B 1 154 ? 40.619 -31.906 -17.647 1.00 57.33  ? 151 GLY B C     1 
ATOM   3190 O  O     . GLY B 1 154 ? 39.444 -31.795 -18.018 1.00 56.92  ? 151 GLY B O     1 
ATOM   3191 N  N     . PHE B 1 155 ? 40.966 -31.965 -16.312 1.00 56.91  ? 152 PHE B N     1 
ATOM   3192 C  CA    . PHE B 1 155 ? 39.995 -31.918 -15.209 1.00 56.89  ? 152 PHE B CA    1 
ATOM   3193 C  C     . PHE B 1 155 ? 39.336 -30.536 -15.112 1.00 57.12  ? 152 PHE B C     1 
ATOM   3194 O  O     . PHE B 1 155 ? 40.008 -29.511 -15.260 1.00 56.92  ? 152 PHE B O     1 
ATOM   3195 C  CB    . PHE B 1 155 ? 40.633 -32.356 -13.888 1.00 56.98  ? 152 PHE B CB    1 
ATOM   3196 C  CG    . PHE B 1 155 ? 39.676 -32.815 -12.808 1.00 57.02  ? 152 PHE B CG    1 
ATOM   3197 C  CD1   . PHE B 1 155 ? 39.124 -31.908 -11.909 1.00 55.69  ? 152 PHE B CD1   1 
ATOM   3198 C  CD2   . PHE B 1 155 ? 39.348 -34.157 -12.671 1.00 53.78  ? 152 PHE B CD2   1 
ATOM   3199 C  CE1   . PHE B 1 155 ? 38.245 -32.334 -10.905 1.00 56.29  ? 152 PHE B CE1   1 
ATOM   3200 C  CE2   . PHE B 1 155 ? 38.487 -34.580 -11.650 1.00 55.42  ? 152 PHE B CE2   1 
ATOM   3201 C  CZ    . PHE B 1 155 ? 37.947 -33.663 -10.772 1.00 54.38  ? 152 PHE B CZ    1 
ATOM   3202 N  N     . THR B 1 156 ? 38.017 -30.511 -14.886 1.00 59.72  ? 153 THR B N     1 
ATOM   3203 C  CA    . THR B 1 156 ? 37.234 -29.275 -14.822 1.00 60.70  ? 153 THR B CA    1 
ATOM   3204 C  C     . THR B 1 156 ? 36.605 -29.007 -13.464 1.00 61.21  ? 153 THR B C     1 
ATOM   3205 O  O     . THR B 1 156 ? 36.024 -29.908 -12.843 1.00 61.35  ? 153 THR B O     1 
ATOM   3206 C  CB    . THR B 1 156 ? 36.160 -29.258 -15.943 1.00 59.71  ? 153 THR B CB    1 
ATOM   3207 O  OG1   . THR B 1 156 ? 36.783 -29.541 -17.200 1.00 61.27  ? 153 THR B OG1   1 
ATOM   3208 C  CG2   . THR B 1 156 ? 35.408 -27.945 -16.026 1.00 59.98  ? 153 THR B CG2   1 
ATOM   3209 N  N     . TRP B 1 157 ? 36.705 -27.741 -13.032 1.00 59.52  ? 154 TRP B N     1 
ATOM   3210 C  CA    . TRP B 1 157 ? 36.128 -27.211 -11.823 1.00 59.90  ? 154 TRP B CA    1 
ATOM   3211 C  C     . TRP B 1 157 ? 35.253 -26.054 -12.304 1.00 60.34  ? 154 TRP B C     1 
ATOM   3212 O  O     . TRP B 1 157 ? 35.712 -25.211 -13.089 1.00 59.76  ? 154 TRP B O     1 
ATOM   3213 C  CB    . TRP B 1 157 ? 37.220 -26.701 -10.895 1.00 59.15  ? 154 TRP B CB    1 
ATOM   3214 C  CG    . TRP B 1 157 ? 38.039 -27.772 -10.240 1.00 58.96  ? 154 TRP B CG    1 
ATOM   3215 C  CD1   . TRP B 1 157 ? 37.735 -28.437 -9.093  1.00 60.01  ? 154 TRP B CD1   1 
ATOM   3216 C  CD2   . TRP B 1 157 ? 39.362 -28.212 -10.622 1.00 59.04  ? 154 TRP B CD2   1 
ATOM   3217 N  NE1   . TRP B 1 157 ? 38.753 -29.314 -8.764  1.00 60.25  ? 154 TRP B NE1   1 
ATOM   3218 C  CE2   . TRP B 1 157 ? 39.771 -29.182 -9.675  1.00 59.43  ? 154 TRP B CE2   1 
ATOM   3219 C  CE3   . TRP B 1 157 ? 40.244 -27.877 -11.672 1.00 57.32  ? 154 TRP B CE3   1 
ATOM   3220 C  CZ2   . TRP B 1 157 ? 41.020 -29.828 -9.747  1.00 58.25  ? 154 TRP B CZ2   1 
ATOM   3221 C  CZ3   . TRP B 1 157 ? 41.472 -28.522 -11.749 1.00 57.16  ? 154 TRP B CZ3   1 
ATOM   3222 C  CH2   . TRP B 1 157 ? 41.846 -29.490 -10.803 1.00 57.74  ? 154 TRP B CH2   1 
ATOM   3223 N  N     . LEU B 1 158 ? 33.989 -26.038 -11.876 1.00 59.67  ? 155 LEU B N     1 
ATOM   3224 C  CA    . LEU B 1 158 ? 33.025 -25.002 -12.236 1.00 60.92  ? 155 LEU B CA    1 
ATOM   3225 C  C     . LEU B 1 158 ? 32.591 -24.241 -10.959 1.00 62.19  ? 155 LEU B C     1 
ATOM   3226 O  O     . LEU B 1 158 ? 32.276 -24.866 -9.942  1.00 61.88  ? 155 LEU B O     1 
ATOM   3227 C  CB    . LEU B 1 158 ? 31.792 -25.616 -12.940 1.00 60.20  ? 155 LEU B CB    1 
ATOM   3228 C  CG    . LEU B 1 158 ? 32.021 -26.538 -14.155 1.00 60.95  ? 155 LEU B CG    1 
ATOM   3229 C  CD1   . LEU B 1 158 ? 30.739 -27.250 -14.544 1.00 60.12  ? 155 LEU B CD1   1 
ATOM   3230 C  CD2   . LEU B 1 158 ? 32.578 -25.780 -15.361 1.00 58.01  ? 155 LEU B CD2   1 
ATOM   3231 N  N     . TYR B 1 159 ? 32.586 -22.901 -11.013 1.00 64.02  ? 156 TYR B N     1 
ATOM   3232 C  CA    . TYR B 1 159 ? 32.182 -22.073 -9.884  1.00 65.07  ? 156 TYR B CA    1 
ATOM   3233 C  C     . TYR B 1 159 ? 31.166 -21.063 -10.345 1.00 65.67  ? 156 TYR B C     1 
ATOM   3234 O  O     . TYR B 1 159 ? 31.474 -20.254 -11.222 1.00 65.55  ? 156 TYR B O     1 
ATOM   3235 C  CB    . TYR B 1 159 ? 33.383 -21.362 -9.212  1.00 66.09  ? 156 TYR B CB    1 
ATOM   3236 C  CG    . TYR B 1 159 ? 34.373 -22.333 -8.618  1.00 67.53  ? 156 TYR B CG    1 
ATOM   3237 C  CD1   . TYR B 1 159 ? 34.118 -22.962 -7.401  1.00 67.44  ? 156 TYR B CD1   1 
ATOM   3238 C  CD2   . TYR B 1 159 ? 35.546 -22.666 -9.296  1.00 67.94  ? 156 TYR B CD2   1 
ATOM   3239 C  CE1   . TYR B 1 159 ? 35.003 -23.899 -6.875  1.00 67.98  ? 156 TYR B CE1   1 
ATOM   3240 C  CE2   . TYR B 1 159 ? 36.441 -23.599 -8.775  1.00 68.24  ? 156 TYR B CE2   1 
ATOM   3241 C  CZ    . TYR B 1 159 ? 36.161 -24.214 -7.567  1.00 69.72  ? 156 TYR B CZ    1 
ATOM   3242 O  OH    . TYR B 1 159 ? 37.015 -25.155 -7.057  1.00 72.75  ? 156 TYR B OH    1 
ATOM   3243 N  N     . PRO B 1 160 ? 29.948 -21.072 -9.770  1.00 66.76  ? 157 PRO B N     1 
ATOM   3244 C  CA    . PRO B 1 160 ? 28.956 -20.063 -10.173 1.00 67.12  ? 157 PRO B CA    1 
ATOM   3245 C  C     . PRO B 1 160 ? 29.238 -18.721 -9.487  1.00 67.50  ? 157 PRO B C     1 
ATOM   3246 O  O     . PRO B 1 160 ? 29.500 -18.691 -8.283  1.00 67.88  ? 157 PRO B O     1 
ATOM   3247 C  CB    . PRO B 1 160 ? 27.631 -20.676 -9.724  1.00 68.90  ? 157 PRO B CB    1 
ATOM   3248 C  CG    . PRO B 1 160 ? 28.007 -21.512 -8.522  1.00 69.26  ? 157 PRO B CG    1 
ATOM   3249 C  CD    . PRO B 1 160 ? 29.432 -21.955 -8.701  1.00 68.52  ? 157 PRO B CD    1 
ATOM   3250 N  N     . THR B 1 161 ? 29.233 -17.623 -10.260 1.00 68.07  ? 158 THR B N     1 
ATOM   3251 C  CA    . THR B 1 161 ? 29.462 -16.276 -9.738  1.00 68.06  ? 158 THR B CA    1 
ATOM   3252 C  C     . THR B 1 161 ? 28.248 -15.390 -10.057 1.00 68.84  ? 158 THR B C     1 
ATOM   3253 O  O     . THR B 1 161 ? 27.427 -15.746 -10.908 1.00 68.80  ? 158 THR B O     1 
ATOM   3254 C  CB    . THR B 1 161 ? 30.737 -15.649 -10.307 1.00 68.53  ? 158 THR B CB    1 
ATOM   3255 O  OG1   . THR B 1 161 ? 30.565 -15.384 -11.687 1.00 67.32  ? 158 THR B OG1   1 
ATOM   3256 C  CG2   . THR B 1 161 ? 31.986 -16.467 -10.060 1.00 67.98  ? 158 THR B CG2   1 
ATOM   3257 N  N     . LYS B 1 162 ? 28.130 -14.239 -9.376  1.00 72.51  ? 159 LYS B N     1 
ATOM   3258 C  CA    . LYS B 1 162 ? 27.026 -13.306 -9.629  1.00 73.36  ? 159 LYS B CA    1 
ATOM   3259 C  C     . LYS B 1 162 ? 27.445 -12.249 -10.664 1.00 72.75  ? 159 LYS B C     1 
ATOM   3260 O  O     . LYS B 1 162 ? 26.606 -11.487 -11.148 1.00 72.97  ? 159 LYS B O     1 
ATOM   3261 C  CB    . LYS B 1 162 ? 26.528 -12.680 -8.313  1.00 78.28  ? 159 LYS B CB    1 
ATOM   3262 C  CG    . LYS B 1 162 ? 25.587 -13.607 -7.534  1.00 81.93  ? 159 LYS B CG    1 
ATOM   3263 C  CD    . LYS B 1 162 ? 25.630 -13.383 -6.019  1.00 87.03  ? 159 LYS B CD    1 
ATOM   3264 C  CE    . LYS B 1 162 ? 24.655 -14.286 -5.296  1.00 88.99  ? 159 LYS B CE    1 
ATOM   3265 N  NZ    . LYS B 1 162 ? 25.007 -14.448 -3.857  1.00 91.59  ? 159 LYS B NZ    1 
ATOM   3266 N  N     . ALA B 1 163 ? 28.753 -12.240 -11.020 1.00 71.55  ? 160 ALA B N     1 
ATOM   3267 C  CA    . ALA B 1 163 ? 29.371 -11.310 -11.961 1.00 71.16  ? 160 ALA B CA    1 
ATOM   3268 C  C     . ALA B 1 163 ? 30.732 -11.811 -12.487 1.00 70.66  ? 160 ALA B C     1 
ATOM   3269 O  O     . ALA B 1 163 ? 31.423 -12.561 -11.791 1.00 70.55  ? 160 ALA B O     1 
ATOM   3270 C  CB    . ALA B 1 163 ? 29.586 -9.970  -11.264 1.00 71.70  ? 160 ALA B CB    1 
ATOM   3271 N  N     . PRO B 1 164 ? 31.187 -11.344 -13.673 1.00 69.80  ? 161 PRO B N     1 
ATOM   3272 C  CA    . PRO B 1 164 ? 32.520 -11.738 -14.142 1.00 69.41  ? 161 PRO B CA    1 
ATOM   3273 C  C     . PRO B 1 164 ? 33.539 -10.726 -13.598 1.00 69.13  ? 161 PRO B C     1 
ATOM   3274 O  O     . PRO B 1 164 ? 34.295 -10.127 -14.360 1.00 69.73  ? 161 PRO B O     1 
ATOM   3275 C  CB    . PRO B 1 164 ? 32.377 -11.651 -15.669 1.00 71.08  ? 161 PRO B CB    1 
ATOM   3276 C  CG    . PRO B 1 164 ? 31.320 -10.612 -15.898 1.00 71.02  ? 161 PRO B CG    1 
ATOM   3277 C  CD    . PRO B 1 164 ? 30.541 -10.419 -14.630 1.00 71.47  ? 161 PRO B CD    1 
ATOM   3278 N  N     . SER B 1 165 ? 33.543 -10.523 -12.276 1.00 67.82  ? 162 SER B N     1 
ATOM   3279 C  CA    . SER B 1 165 ? 34.402 -9.546  -11.612 1.00 67.06  ? 162 SER B CA    1 
ATOM   3280 C  C     . SER B 1 165 ? 35.607 -10.156 -10.949 1.00 66.64  ? 162 SER B C     1 
ATOM   3281 O  O     . SER B 1 165 ? 35.605 -11.357 -10.694 1.00 66.37  ? 162 SER B O     1 
ATOM   3282 C  CB    . SER B 1 165 ? 33.589 -8.783  -10.574 1.00 69.19  ? 162 SER B CB    1 
ATOM   3283 O  OG    . SER B 1 165 ? 33.043 -9.662  -9.605  1.00 69.65  ? 162 SER B OG    1 
ATOM   3284 N  N     . THR B 1 166 ? 36.635 -9.328  -10.637 1.00 66.46  ? 163 THR B N     1 
ATOM   3285 C  CA    . THR B 1 166 ? 37.845 -9.776  -9.946  1.00 67.00  ? 163 THR B CA    1 
ATOM   3286 C  C     . THR B 1 166 ? 37.450 -10.319 -8.587  1.00 67.11  ? 163 THR B C     1 
ATOM   3287 O  O     . THR B 1 166 ? 37.936 -11.371 -8.196  1.00 66.84  ? 163 THR B O     1 
ATOM   3288 C  CB    . THR B 1 166 ? 38.825 -8.640  -9.745  1.00 65.98  ? 163 THR B CB    1 
ATOM   3289 O  OG1   . THR B 1 166 ? 39.158 -8.069  -11.008 1.00 66.52  ? 163 THR B OG1   1 
ATOM   3290 C  CG2   . THR B 1 166 ? 40.090 -9.086  -9.002  1.00 66.29  ? 163 THR B CG2   1 
ATOM   3291 N  N     . SER B 1 167 ? 36.555 -9.618  -7.878  1.00 67.65  ? 164 SER B N     1 
ATOM   3292 C  CA    . SER B 1 167 ? 36.083 -10.029 -6.569  1.00 67.44  ? 164 SER B CA    1 
ATOM   3293 C  C     . SER B 1 167 ? 35.551 -11.465 -6.639  1.00 66.64  ? 164 SER B C     1 
ATOM   3294 O  O     . SER B 1 167 ? 36.013 -12.302 -5.868  1.00 66.69  ? 164 SER B O     1 
ATOM   3295 C  CB    . SER B 1 167 ? 35.034 -9.051  -6.054  1.00 70.78  ? 164 SER B CB    1 
ATOM   3296 O  OG    . SER B 1 167 ? 33.979 -9.696  -5.358  1.00 72.17  ? 164 SER B OG    1 
ATOM   3297 N  N     . ALA B 1 168 ? 34.617 -11.754 -7.586  1.00 66.62  ? 165 ALA B N     1 
ATOM   3298 C  CA    . ALA B 1 168 ? 34.011 -13.078 -7.768  1.00 65.50  ? 165 ALA B CA    1 
ATOM   3299 C  C     . ALA B 1 168 ? 35.041 -14.143 -8.189  1.00 65.06  ? 165 ALA B C     1 
ATOM   3300 O  O     . ALA B 1 168 ? 34.954 -15.293 -7.742  1.00 64.85  ? 165 ALA B O     1 
ATOM   3301 C  CB    . ALA B 1 168 ? 32.888 -12.998 -8.777  1.00 65.51  ? 165 ALA B CB    1 
ATOM   3302 N  N     . THR B 1 169 ? 36.018 -13.754 -9.036  1.00 64.44  ? 166 THR B N     1 
ATOM   3303 C  CA    . THR B 1 169 ? 37.075 -14.635 -9.515  1.00 63.99  ? 166 THR B CA    1 
ATOM   3304 C  C     . THR B 1 169 ? 37.909 -15.039 -8.314  1.00 64.31  ? 166 THR B C     1 
ATOM   3305 O  O     . THR B 1 169 ? 38.146 -16.228 -8.117  1.00 64.18  ? 166 THR B O     1 
ATOM   3306 C  CB    . THR B 1 169 ? 37.891 -13.943 -10.617 1.00 64.62  ? 166 THR B CB    1 
ATOM   3307 O  OG1   . THR B 1 169 ? 37.011 -13.532 -11.656 1.00 63.60  ? 166 THR B OG1   1 
ATOM   3308 C  CG2   . THR B 1 169 ? 38.947 -14.835 -11.206 1.00 63.61  ? 166 THR B CG2   1 
ATOM   3309 N  N     . VAL B 1 170 ? 38.319 -14.053 -7.494  1.00 62.91  ? 167 VAL B N     1 
ATOM   3310 C  CA    . VAL B 1 170 ? 39.121 -14.244 -6.287  1.00 62.38  ? 167 VAL B CA    1 
ATOM   3311 C  C     . VAL B 1 170 ? 38.351 -15.087 -5.251  1.00 63.01  ? 167 VAL B C     1 
ATOM   3312 O  O     . VAL B 1 170 ? 38.940 -16.009 -4.706  1.00 63.08  ? 167 VAL B O     1 
ATOM   3313 C  CB    . VAL B 1 170 ? 39.672 -12.897 -5.733  1.00 64.37  ? 167 VAL B CB    1 
ATOM   3314 C  CG1   . VAL B 1 170 ? 40.161 -13.023 -4.289  1.00 62.71  ? 167 VAL B CG1   1 
ATOM   3315 C  CG2   . VAL B 1 170 ? 40.786 -12.364 -6.630  1.00 62.94  ? 167 VAL B CG2   1 
ATOM   3316 N  N     . LYS B 1 171 ? 37.059 -14.810 -5.009  1.00 61.19  ? 168 LYS B N     1 
ATOM   3317 C  CA    . LYS B 1 171 ? 36.267 -15.581 -4.054  1.00 61.15  ? 168 LYS B CA    1 
ATOM   3318 C  C     . LYS B 1 171 ? 36.205 -17.059 -4.470  1.00 61.35  ? 168 LYS B C     1 
ATOM   3319 O  O     . LYS B 1 171 ? 36.430 -17.922 -3.623  1.00 61.30  ? 168 LYS B O     1 
ATOM   3320 C  CB    . LYS B 1 171 ? 34.867 -14.976 -3.838  1.00 62.11  ? 168 LYS B CB    1 
ATOM   3321 N  N     . SER B 1 172 ? 35.970 -17.337 -5.777  1.00 60.04  ? 169 SER B N     1 
ATOM   3322 C  CA    . SER B 1 172 ? 35.880 -18.675 -6.373  1.00 59.14  ? 169 SER B CA    1 
ATOM   3323 C  C     . SER B 1 172 ? 37.214 -19.395 -6.383  1.00 58.41  ? 169 SER B C     1 
ATOM   3324 O  O     . SER B 1 172 ? 37.302 -20.532 -5.907  1.00 58.33  ? 169 SER B O     1 
ATOM   3325 C  CB    . SER B 1 172 ? 35.361 -18.576 -7.797  1.00 63.72  ? 169 SER B CB    1 
ATOM   3326 O  OG    . SER B 1 172 ? 33.973 -18.302 -7.815  1.00 64.64  ? 169 SER B OG    1 
ATOM   3327 N  N     . LEU B 1 173 ? 38.261 -18.742 -6.915  1.00 58.01  ? 170 LEU B N     1 
ATOM   3328 C  CA    . LEU B 1 173 ? 39.596 -19.327 -6.975  1.00 57.48  ? 170 LEU B CA    1 
ATOM   3329 C  C     . LEU B 1 173 ? 40.210 -19.551 -5.593  1.00 57.44  ? 170 LEU B C     1 
ATOM   3330 O  O     . LEU B 1 173 ? 41.128 -20.352 -5.491  1.00 57.47  ? 170 LEU B O     1 
ATOM   3331 C  CB    . LEU B 1 173 ? 40.549 -18.544 -7.903  1.00 57.71  ? 170 LEU B CB    1 
ATOM   3332 C  CG    . LEU B 1 173 ? 40.277 -18.643 -9.418  1.00 59.00  ? 170 LEU B CG    1 
ATOM   3333 C  CD1   . LEU B 1 173 ? 41.279 -17.835 -10.189 1.00 57.44  ? 170 LEU B CD1   1 
ATOM   3334 C  CD2   . LEU B 1 173 ? 40.323 -20.090 -9.909  1.00 59.46  ? 170 LEU B CD2   1 
ATOM   3335 N  N     . ASN B 1 174 ? 39.696 -18.889 -4.525  1.00 59.36  ? 171 ASN B N     1 
ATOM   3336 C  CA    . ASN B 1 174 ? 40.192 -19.091 -3.156  1.00 58.97  ? 171 ASN B CA    1 
ATOM   3337 C  C     . ASN B 1 174 ? 39.735 -20.463 -2.649  1.00 58.60  ? 171 ASN B C     1 
ATOM   3338 O  O     . ASN B 1 174 ? 40.416 -21.076 -1.824  1.00 59.39  ? 171 ASN B O     1 
ATOM   3339 C  CB    . ASN B 1 174 ? 39.746 -17.983 -2.212  1.00 58.73  ? 171 ASN B CB    1 
ATOM   3340 C  CG    . ASN B 1 174 ? 40.709 -16.819 -2.134  1.00 58.94  ? 171 ASN B CG    1 
ATOM   3341 O  OD1   . ASN B 1 174 ? 41.868 -16.877 -2.573  1.00 57.83  ? 171 ASN B OD1   1 
ATOM   3342 N  ND2   . ASN B 1 174 ? 40.247 -15.725 -1.565  1.00 59.08  ? 171 ASN B ND2   1 
ATOM   3343 N  N     . VAL B 1 175 ? 38.598 -20.952 -3.167  1.00 56.48  ? 172 VAL B N     1 
ATOM   3344 C  CA    . VAL B 1 175 ? 38.072 -22.253 -2.826  1.00 56.45  ? 172 VAL B CA    1 
ATOM   3345 C  C     . VAL B 1 175 ? 38.945 -23.267 -3.557  1.00 56.97  ? 172 VAL B C     1 
ATOM   3346 O  O     . VAL B 1 175 ? 39.480 -24.165 -2.919  1.00 57.27  ? 172 VAL B O     1 
ATOM   3347 C  CB    . VAL B 1 175 ? 36.594 -22.369 -3.214  1.00 56.83  ? 172 VAL B CB    1 
ATOM   3348 C  CG1   . VAL B 1 175 ? 36.053 -23.761 -2.915  1.00 56.54  ? 172 VAL B CG1   1 
ATOM   3349 C  CG2   . VAL B 1 175 ? 35.767 -21.291 -2.523  1.00 54.36  ? 172 VAL B CG2   1 
ATOM   3350 N  N     . LEU B 1 176 ? 39.127 -23.111 -4.877  1.00 58.40  ? 173 LEU B N     1 
ATOM   3351 C  CA    . LEU B 1 176 ? 39.959 -24.037 -5.630  1.00 58.31  ? 173 LEU B CA    1 
ATOM   3352 C  C     . LEU B 1 176 ? 41.386 -24.100 -5.102  1.00 58.25  ? 173 LEU B C     1 
ATOM   3353 O  O     . LEU B 1 176 ? 41.864 -25.210 -4.865  1.00 58.28  ? 173 LEU B O     1 
ATOM   3354 C  CB    . LEU B 1 176 ? 39.917 -23.751 -7.145  1.00 57.36  ? 173 LEU B CB    1 
ATOM   3355 C  CG    . LEU B 1 176 ? 40.730 -24.664 -8.094  1.00 58.29  ? 173 LEU B CG    1 
ATOM   3356 C  CD1   . LEU B 1 176 ? 40.510 -26.139 -7.823  1.00 55.42  ? 173 LEU B CD1   1 
ATOM   3357 C  CD2   . LEU B 1 176 ? 40.380 -24.391 -9.528  1.00 58.98  ? 173 LEU B CD2   1 
ATOM   3358 N  N     . THR B 1 177 ? 42.055 -22.942 -4.880  1.00 58.71  ? 174 THR B N     1 
ATOM   3359 C  CA    . THR B 1 177 ? 43.452 -22.910 -4.423  1.00 59.21  ? 174 THR B CA    1 
ATOM   3360 C  C     . THR B 1 177 ? 43.643 -23.419 -2.965  1.00 60.63  ? 174 THR B C     1 
ATOM   3361 O  O     . THR B 1 177 ? 44.771 -23.380 -2.463  1.00 61.15  ? 174 THR B O     1 
ATOM   3362 C  CB    . THR B 1 177 ? 44.121 -21.536 -4.664  1.00 59.43  ? 174 THR B CB    1 
ATOM   3363 O  OG1   . THR B 1 177 ? 43.351 -20.500 -4.069  1.00 59.50  ? 174 THR B OG1   1 
ATOM   3364 C  CG2   . THR B 1 177 ? 44.351 -21.239 -6.145  1.00 58.56  ? 174 THR B CG2   1 
ATOM   3365 N  N     . SER B 1 178 ? 42.566 -23.917 -2.308  1.00 61.75  ? 175 SER B N     1 
ATOM   3366 C  CA    . SER B 1 178 ? 42.596 -24.509 -0.955  1.00 62.73  ? 175 SER B CA    1 
ATOM   3367 C  C     . SER B 1 178 ? 42.725 -26.026 -1.087  1.00 62.82  ? 175 SER B C     1 
ATOM   3368 O  O     . SER B 1 178 ? 42.885 -26.731 -0.091  1.00 62.87  ? 175 SER B O     1 
ATOM   3369 C  CB    . SER B 1 178 ? 41.332 -24.164 -0.186  1.00 69.36  ? 175 SER B CB    1 
ATOM   3370 O  OG    . SER B 1 178 ? 41.389 -22.773 0.081   1.00 72.87  ? 175 SER B OG    1 
ATOM   3371 N  N     . ILE B 1 179 ? 42.651 -26.514 -2.347  1.00 61.46  ? 176 ILE B N     1 
ATOM   3372 C  CA    . ILE B 1 179 ? 42.791 -27.907 -2.727  1.00 61.49  ? 176 ILE B CA    1 
ATOM   3373 C  C     . ILE B 1 179 ? 44.124 -28.023 -3.437  1.00 61.77  ? 176 ILE B C     1 
ATOM   3374 O  O     . ILE B 1 179 ? 44.948 -28.829 -3.039  1.00 62.45  ? 176 ILE B O     1 
ATOM   3375 C  CB    . ILE B 1 179 ? 41.630 -28.380 -3.628  1.00 63.75  ? 176 ILE B CB    1 
ATOM   3376 C  CG1   . ILE B 1 179 ? 40.252 -28.131 -2.969  1.00 63.16  ? 176 ILE B CG1   1 
ATOM   3377 C  CG2   . ILE B 1 179 ? 41.828 -29.845 -4.082  1.00 62.96  ? 176 ILE B CG2   1 
ATOM   3378 C  CD1   . ILE B 1 179 ? 39.930 -28.963 -1.734  1.00 66.88  ? 176 ILE B CD1   1 
ATOM   3379 N  N     . ALA B 1 180 ? 44.339 -27.229 -4.490  1.00 61.08  ? 177 ALA B N     1 
ATOM   3380 C  CA    . ALA B 1 180 ? 45.580 -27.283 -5.255  1.00 60.33  ? 177 ALA B CA    1 
ATOM   3381 C  C     . ALA B 1 180 ? 45.874 -25.953 -5.895  1.00 59.80  ? 177 ALA B C     1 
ATOM   3382 O  O     . ALA B 1 180 ? 44.963 -25.294 -6.390  1.00 59.41  ? 177 ALA B O     1 
ATOM   3383 C  CB    . ALA B 1 180 ? 45.484 -28.357 -6.323  1.00 60.79  ? 177 ALA B CB    1 
ATOM   3384 N  N     . ILE B 1 181 ? 47.146 -25.563 -5.892  1.00 59.48  ? 178 ILE B N     1 
ATOM   3385 C  CA    . ILE B 1 181 ? 47.591 -24.304 -6.482  1.00 58.86  ? 178 ILE B CA    1 
ATOM   3386 C  C     . ILE B 1 181 ? 48.286 -24.545 -7.851  1.00 58.98  ? 178 ILE B C     1 
ATOM   3387 O  O     . ILE B 1 181 ? 49.244 -25.327 -7.913  1.00 57.99  ? 178 ILE B O     1 
ATOM   3388 C  CB    . ILE B 1 181 ? 48.471 -23.482 -5.476  1.00 61.83  ? 178 ILE B CB    1 
ATOM   3389 C  CG1   . ILE B 1 181 ? 47.691 -23.204 -4.147  1.00 61.30  ? 178 ILE B CG1   1 
ATOM   3390 C  CG2   . ILE B 1 181 ? 48.981 -22.174 -6.124  1.00 60.79  ? 178 ILE B CG2   1 
ATOM   3391 C  CD1   . ILE B 1 181 ? 48.474 -22.393 -3.001  1.00 54.79  ? 178 ILE B CD1   1 
ATOM   3392 N  N     . PRO B 1 182 ? 47.830 -23.879 -8.948  1.00 58.73  ? 179 PRO B N     1 
ATOM   3393 C  CA    . PRO B 1 182 ? 48.505 -24.061 -10.240 1.00 58.79  ? 179 PRO B CA    1 
ATOM   3394 C  C     . PRO B 1 182 ? 49.800 -23.268 -10.270 1.00 59.34  ? 179 PRO B C     1 
ATOM   3395 O  O     . PRO B 1 182 ? 49.906 -22.265 -9.570  1.00 59.04  ? 179 PRO B O     1 
ATOM   3396 C  CB    . PRO B 1 182 ? 47.520 -23.437 -11.230 1.00 60.39  ? 179 PRO B CB    1 
ATOM   3397 C  CG    . PRO B 1 182 ? 46.840 -22.373 -10.459 1.00 60.14  ? 179 PRO B CG    1 
ATOM   3398 C  CD    . PRO B 1 182 ? 46.716 -22.908 -9.057  1.00 60.04  ? 179 PRO B CD    1 
ATOM   3399 N  N     . LYS B 1 183 ? 50.770 -23.681 -11.089 1.00 59.24  ? 180 LYS B N     1 
ATOM   3400 C  CA    . LYS B 1 183 ? 52.026 -22.941 -11.240 1.00 59.84  ? 180 LYS B CA    1 
ATOM   3401 C  C     . LYS B 1 183 ? 51.731 -21.739 -12.131 1.00 59.48  ? 180 LYS B C     1 
ATOM   3402 O  O     . LYS B 1 183 ? 52.321 -20.677 -11.945 1.00 59.63  ? 180 LYS B O     1 
ATOM   3403 C  CB    . LYS B 1 183 ? 53.094 -23.793 -11.905 1.00 61.52  ? 180 LYS B CB    1 
ATOM   3404 C  CG    . LYS B 1 183 ? 53.600 -24.918 -11.040 1.00 64.75  ? 180 LYS B CG    1 
ATOM   3405 C  CD    . LYS B 1 183 ? 54.762 -25.592 -11.736 1.00 69.02  ? 180 LYS B CD    1 
ATOM   3406 C  CE    . LYS B 1 183 ? 55.326 -26.697 -10.899 1.00 71.50  ? 180 LYS B CE    1 
ATOM   3407 N  NZ    . LYS B 1 183 ? 56.215 -27.572 -11.700 1.00 73.88  ? 180 LYS B NZ    1 
ATOM   3408 N  N     . VAL B 1 184 ? 50.812 -21.911 -13.098 1.00 57.18  ? 181 VAL B N     1 
ATOM   3409 C  CA    . VAL B 1 184 ? 50.415 -20.878 -14.052 1.00 56.65  ? 181 VAL B CA    1 
ATOM   3410 C  C     . VAL B 1 184 ? 48.894 -20.885 -14.230 1.00 56.87  ? 181 VAL B C     1 
ATOM   3411 O  O     . VAL B 1 184 ? 48.269 -21.956 -14.259 1.00 56.67  ? 181 VAL B O     1 
ATOM   3412 C  CB    . VAL B 1 184 ? 51.138 -21.075 -15.439 1.00 57.07  ? 181 VAL B CB    1 
ATOM   3413 C  CG1   . VAL B 1 184 ? 50.614 -20.122 -16.500 1.00 56.65  ? 181 VAL B CG1   1 
ATOM   3414 C  CG2   . VAL B 1 184 ? 52.652 -20.957 -15.328 1.00 55.16  ? 181 VAL B CG2   1 
ATOM   3415 N  N     . ILE B 1 185 ? 48.305 -19.677 -14.360 1.00 59.68  ? 182 ILE B N     1 
ATOM   3416 C  CA    . ILE B 1 185 ? 46.888 -19.480 -14.686 1.00 60.13  ? 182 ILE B CA    1 
ATOM   3417 C  C     . ILE B 1 185 ? 46.905 -18.859 -16.104 1.00 60.61  ? 182 ILE B C     1 
ATOM   3418 O  O     . ILE B 1 185 ? 47.696 -17.938 -16.357 1.00 60.37  ? 182 ILE B O     1 
ATOM   3419 C  CB    . ILE B 1 185 ? 46.056 -18.649 -13.676 1.00 61.35  ? 182 ILE B CB    1 
ATOM   3420 C  CG1   . ILE B 1 185 ? 45.778 -19.452 -12.405 1.00 61.31  ? 182 ILE B CG1   1 
ATOM   3421 C  CG2   . ILE B 1 185 ? 44.738 -18.208 -14.301 1.00 60.99  ? 182 ILE B CG2   1 
ATOM   3422 C  CD1   . ILE B 1 185 ? 45.117 -18.657 -11.245 1.00 59.61  ? 182 ILE B CD1   1 
ATOM   3423 N  N     . HIS B 1 186 ? 46.090 -19.398 -17.031 1.00 59.56  ? 183 HIS B N     1 
ATOM   3424 C  CA    . HIS B 1 186 ? 45.987 -18.882 -18.390 1.00 60.54  ? 183 HIS B CA    1 
ATOM   3425 C  C     . HIS B 1 186 ? 44.562 -18.413 -18.601 1.00 60.18  ? 183 HIS B C     1 
ATOM   3426 O  O     . HIS B 1 186 ? 43.601 -19.112 -18.261 1.00 60.78  ? 183 HIS B O     1 
ATOM   3427 C  CB    . HIS B 1 186 ? 46.404 -19.914 -19.460 1.00 59.78  ? 183 HIS B CB    1 
ATOM   3428 C  CG    . HIS B 1 186 ? 46.243 -19.414 -20.873 1.00 61.03  ? 183 HIS B CG    1 
ATOM   3429 N  ND1   . HIS B 1 186 ? 47.337 -19.139 -21.669 1.00 61.35  ? 183 HIS B ND1   1 
ATOM   3430 C  CD2   . HIS B 1 186 ? 45.112 -19.133 -21.574 1.00 60.19  ? 183 HIS B CD2   1 
ATOM   3431 C  CE1   . HIS B 1 186 ? 46.839 -18.704 -22.814 1.00 62.10  ? 183 HIS B CE1   1 
ATOM   3432 N  NE2   . HIS B 1 186 ? 45.506 -18.672 -22.796 1.00 62.47  ? 183 HIS B NE2   1 
ATOM   3433 N  N     . SER B 1 187 ? 44.428 -17.222 -19.167 1.00 62.21  ? 184 SER B N     1 
ATOM   3434 C  CA    . SER B 1 187 ? 43.127 -16.625 -19.452 1.00 62.87  ? 184 SER B CA    1 
ATOM   3435 C  C     . SER B 1 187 ? 43.271 -15.676 -20.622 1.00 63.13  ? 184 SER B C     1 
ATOM   3436 O  O     . SER B 1 187 ? 44.399 -15.398 -21.056 1.00 63.23  ? 184 SER B O     1 
ATOM   3437 C  CB    . SER B 1 187 ? 42.638 -15.842 -18.232 1.00 68.46  ? 184 SER B CB    1 
ATOM   3438 O  OG    . SER B 1 187 ? 43.555 -14.818 -17.868 1.00 66.75  ? 184 SER B OG    1 
ATOM   3439 N  N     . ASP B 1 188 ? 42.130 -15.164 -21.117 1.00 63.07  ? 185 ASP B N     1 
ATOM   3440 C  CA    . ASP B 1 188 ? 42.104 -14.147 -22.161 1.00 64.56  ? 185 ASP B CA    1 
ATOM   3441 C  C     . ASP B 1 188 ? 42.304 -12.770 -21.443 1.00 65.45  ? 185 ASP B C     1 
ATOM   3442 O  O     . ASP B 1 188 ? 42.608 -12.740 -20.240 1.00 65.51  ? 185 ASP B O     1 
ATOM   3443 C  CB    . ASP B 1 188 ? 40.799 -14.210 -22.977 1.00 65.97  ? 185 ASP B CB    1 
ATOM   3444 C  CG    . ASP B 1 188 ? 39.506 -14.050 -22.199 1.00 68.79  ? 185 ASP B CG    1 
ATOM   3445 O  OD1   . ASP B 1 188 ? 39.547 -13.522 -21.061 1.00 71.04  ? 185 ASP B OD1   1 
ATOM   3446 O  OD2   . ASP B 1 188 ? 38.450 -14.436 -22.729 1.00 69.67  ? 185 ASP B OD2   1 
ATOM   3447 N  N     . GLN B 1 189 ? 42.125 -11.649 -22.157 1.00 68.56  ? 186 GLN B N     1 
ATOM   3448 C  CA    . GLN B 1 189 ? 42.326 -10.315 -21.572 1.00 68.85  ? 186 GLN B CA    1 
ATOM   3449 C  C     . GLN B 1 189 ? 41.054 -9.720  -20.938 1.00 68.55  ? 186 GLN B C     1 
ATOM   3450 O  O     . GLN B 1 189 ? 40.845 -8.508  -20.986 1.00 69.12  ? 186 GLN B O     1 
ATOM   3451 C  CB    . GLN B 1 189 ? 42.954 -9.364  -22.592 1.00 69.25  ? 186 GLN B CB    1 
ATOM   3452 C  CG    . GLN B 1 189 ? 44.159 -9.972  -23.290 1.00 71.49  ? 186 GLN B CG    1 
ATOM   3453 C  CD    . GLN B 1 189 ? 45.412 -9.253  -22.936 1.00 73.57  ? 186 GLN B CD    1 
ATOM   3454 O  OE1   . GLN B 1 189 ? 45.380 -8.114  -22.470 1.00 76.53  ? 186 GLN B OE1   1 
ATOM   3455 N  NE2   . GLN B 1 189 ? 46.545 -9.887  -23.153 1.00 73.64  ? 186 GLN B NE2   1 
ATOM   3456 N  N     . GLY B 1 190 ? 40.228 -10.566 -20.336 1.00 69.38  ? 187 GLY B N     1 
ATOM   3457 C  CA    . GLY B 1 190 ? 39.016 -10.126 -19.667 1.00 69.22  ? 187 GLY B CA    1 
ATOM   3458 C  C     . GLY B 1 190 ? 39.377 -9.251  -18.483 1.00 69.32  ? 187 GLY B C     1 
ATOM   3459 O  O     . GLY B 1 190 ? 40.392 -9.496  -17.819 1.00 69.80  ? 187 GLY B O     1 
ATOM   3460 N  N     . ALA B 1 191 ? 38.568 -8.209  -18.227 1.00 71.15  ? 188 ALA B N     1 
ATOM   3461 C  CA    . ALA B 1 191 ? 38.762 -7.229  -17.153 1.00 71.12  ? 188 ALA B CA    1 
ATOM   3462 C  C     . ALA B 1 191 ? 39.121 -7.849  -15.804 1.00 70.59  ? 188 ALA B C     1 
ATOM   3463 O  O     . ALA B 1 191 ? 40.085 -7.406  -15.170 1.00 70.48  ? 188 ALA B O     1 
ATOM   3464 C  CB    . ALA B 1 191 ? 37.521 -6.369  -17.013 1.00 71.90  ? 188 ALA B CB    1 
ATOM   3465 N  N     . ALA B 1 192 ? 38.354 -8.886  -15.387 1.00 67.42  ? 189 ALA B N     1 
ATOM   3466 C  CA    . ALA B 1 192 ? 38.540 -9.609  -14.135 1.00 66.78  ? 189 ALA B CA    1 
ATOM   3467 C  C     . ALA B 1 192 ? 39.935 -10.211 -13.998 1.00 66.61  ? 189 ALA B C     1 
ATOM   3468 O  O     . ALA B 1 192 ? 40.483 -10.220 -12.898 1.00 66.70  ? 189 ALA B O     1 
ATOM   3469 C  CB    . ALA B 1 192 ? 37.490 -10.695 -14.010 1.00 67.17  ? 189 ALA B CB    1 
ATOM   3470 N  N     . PHE B 1 193 ? 40.528 -10.677 -15.106 1.00 64.21  ? 190 PHE B N     1 
ATOM   3471 C  CA    . PHE B 1 193 ? 41.846 -11.324 -15.073 1.00 63.80  ? 190 PHE B CA    1 
ATOM   3472 C  C     . PHE B 1 193 ? 43.009 -10.365 -15.281 1.00 64.45  ? 190 PHE B C     1 
ATOM   3473 O  O     . PHE B 1 193 ? 44.119 -10.661 -14.841 1.00 64.59  ? 190 PHE B O     1 
ATOM   3474 C  CB    . PHE B 1 193 ? 41.912 -12.521 -16.067 1.00 64.36  ? 190 PHE B CB    1 
ATOM   3475 C  CG    . PHE B 1 193 ? 40.643 -13.351 -16.216 1.00 63.36  ? 190 PHE B CG    1 
ATOM   3476 C  CD1   . PHE B 1 193 ? 40.000 -13.888 -15.100 1.00 63.62  ? 190 PHE B CD1   1 
ATOM   3477 C  CD2   . PHE B 1 193 ? 40.087 -13.587 -17.471 1.00 63.76  ? 190 PHE B CD2   1 
ATOM   3478 C  CE1   . PHE B 1 193 ? 38.812 -14.625 -15.236 1.00 64.57  ? 190 PHE B CE1   1 
ATOM   3479 C  CE2   . PHE B 1 193 ? 38.909 -14.339 -17.606 1.00 61.91  ? 190 PHE B CE2   1 
ATOM   3480 C  CZ    . PHE B 1 193 ? 38.281 -14.853 -16.487 1.00 65.14  ? 190 PHE B CZ    1 
ATOM   3481 N  N     . THR B 1 194 ? 42.762 -9.212  -15.925 1.00 65.55  ? 191 THR B N     1 
ATOM   3482 C  CA    . THR B 1 194 ? 43.829 -8.230  -16.216 1.00 66.18  ? 191 THR B CA    1 
ATOM   3483 C  C     . THR B 1 194 ? 43.985 -7.131  -15.127 1.00 66.40  ? 191 THR B C     1 
ATOM   3484 O  O     . THR B 1 194 ? 44.975 -6.391  -15.167 1.00 66.13  ? 191 THR B O     1 
ATOM   3485 C  CB    . THR B 1 194 ? 43.661 -7.633  -17.624 1.00 70.25  ? 191 THR B CB    1 
ATOM   3486 O  OG1   . THR B 1 194 ? 42.345 -7.092  -17.745 1.00 70.52  ? 191 THR B OG1   1 
ATOM   3487 C  CG2   . THR B 1 194 ? 43.901 -8.652  -18.712 1.00 70.94  ? 191 THR B CG2   1 
ATOM   3488 N  N     . SER B 1 195 ? 43.040 -7.061  -14.147 1.00 63.90  ? 192 SER B N     1 
ATOM   3489 C  CA    . SER B 1 195 ? 43.047 -6.111  -13.025 1.00 64.88  ? 192 SER B CA    1 
ATOM   3490 C  C     . SER B 1 195 ? 44.298 -6.249  -12.164 1.00 65.07  ? 192 SER B C     1 
ATOM   3491 O  O     . SER B 1 195 ? 44.856 -7.347  -12.059 1.00 65.99  ? 192 SER B O     1 
ATOM   3492 C  CB    . SER B 1 195 ? 41.801 -6.289  -12.165 1.00 65.51  ? 192 SER B CB    1 
ATOM   3493 O  OG    . SER B 1 195 ? 41.827 -7.458  -11.366 1.00 66.65  ? 192 SER B OG    1 
ATOM   3494 N  N     . SER B 1 196 ? 44.746 -5.138  -11.546 1.00 65.76  ? 193 SER B N     1 
ATOM   3495 C  CA    . SER B 1 196 ? 45.944 -5.140  -10.680 1.00 65.76  ? 193 SER B CA    1 
ATOM   3496 C  C     . SER B 1 196 ? 45.682 -5.921  -9.378  1.00 65.13  ? 193 SER B C     1 
ATOM   3497 O  O     . SER B 1 196 ? 46.627 -6.439  -8.781  1.00 64.77  ? 193 SER B O     1 
ATOM   3498 C  CB    . SER B 1 196 ? 46.406 -3.717  -10.383 1.00 70.21  ? 193 SER B CB    1 
ATOM   3499 O  OG    . SER B 1 196 ? 45.376 -3.002  -9.723  1.00 71.41  ? 193 SER B OG    1 
ATOM   3500 N  N     . THR B 1 197 ? 44.395 -6.018  -8.976  1.00 63.13  ? 194 THR B N     1 
ATOM   3501 C  CA    . THR B 1 197 ? 43.931 -6.753  -7.811  1.00 63.55  ? 194 THR B CA    1 
ATOM   3502 C  C     . THR B 1 197 ? 44.176 -8.250  -8.026  1.00 63.69  ? 194 THR B C     1 
ATOM   3503 O  O     . THR B 1 197 ? 44.764 -8.896  -7.148  1.00 63.61  ? 194 THR B O     1 
ATOM   3504 C  CB    . THR B 1 197 ? 42.461 -6.449  -7.539  1.00 76.35  ? 194 THR B CB    1 
ATOM   3505 O  OG1   . THR B 1 197 ? 42.334 -5.050  -7.325  1.00 77.27  ? 194 THR B OG1   1 
ATOM   3506 C  CG2   . THR B 1 197 ? 41.931 -7.172  -6.320  1.00 76.29  ? 194 THR B CG2   1 
ATOM   3507 N  N     . PHE B 1 198 ? 43.749 -8.788  -9.204  1.00 62.59  ? 195 PHE B N     1 
ATOM   3508 C  CA    . PHE B 1 198 ? 43.935 -10.188 -9.549  1.00 62.17  ? 195 PHE B CA    1 
ATOM   3509 C  C     . PHE B 1 198 ? 45.412 -10.491 -9.673  1.00 61.92  ? 195 PHE B C     1 
ATOM   3510 O  O     . PHE B 1 198 ? 45.846 -11.589 -9.320  1.00 61.34  ? 195 PHE B O     1 
ATOM   3511 C  CB    . PHE B 1 198 ? 43.152 -10.586 -10.811 1.00 63.71  ? 195 PHE B CB    1 
ATOM   3512 C  CG    . PHE B 1 198 ? 43.114 -12.086 -11.033 1.00 64.03  ? 195 PHE B CG    1 
ATOM   3513 C  CD1   . PHE B 1 198 ? 42.423 -12.922 -10.157 1.00 62.74  ? 195 PHE B CD1   1 
ATOM   3514 C  CD2   . PHE B 1 198 ? 43.786 -12.665 -12.106 1.00 61.46  ? 195 PHE B CD2   1 
ATOM   3515 C  CE1   . PHE B 1 198 ? 42.409 -14.310 -10.351 1.00 62.29  ? 195 PHE B CE1   1 
ATOM   3516 C  CE2   . PHE B 1 198 ? 43.776 -14.052 -12.293 1.00 62.15  ? 195 PHE B CE2   1 
ATOM   3517 C  CZ    . PHE B 1 198 ? 43.087 -14.863 -11.414 1.00 61.36  ? 195 PHE B CZ    1 
ATOM   3518 N  N     . ALA B 1 199 ? 46.197 -9.508  -10.130 1.00 63.71  ? 196 ALA B N     1 
ATOM   3519 C  CA    . ALA B 1 199 ? 47.647 -9.646  -10.264 1.00 63.83  ? 196 ALA B CA    1 
ATOM   3520 C  C     . ALA B 1 199 ? 48.275 -9.724  -8.862  1.00 63.99  ? 196 ALA B C     1 
ATOM   3521 O  O     . ALA B 1 199 ? 49.189 -10.534 -8.655  1.00 64.66  ? 196 ALA B O     1 
ATOM   3522 C  CB    . ALA B 1 199 ? 48.220 -8.485  -11.062 1.00 63.75  ? 196 ALA B CB    1 
ATOM   3523 N  N     . GLU B 1 200 ? 47.761 -8.914  -7.889  1.00 67.30  ? 197 GLU B N     1 
ATOM   3524 C  CA    . GLU B 1 200 ? 48.256 -8.935  -6.501  1.00 67.02  ? 197 GLU B CA    1 
ATOM   3525 C  C     . GLU B 1 200 ? 47.944 -10.315 -5.877  1.00 66.53  ? 197 GLU B C     1 
ATOM   3526 O  O     . GLU B 1 200 ? 48.845 -10.945 -5.301  1.00 66.04  ? 197 GLU B O     1 
ATOM   3527 C  CB    . GLU B 1 200 ? 47.697 -7.772  -5.655  1.00 68.02  ? 197 GLU B CB    1 
ATOM   3528 N  N     . TRP B 1 201 ? 46.693 -10.801 -6.054  1.00 66.17  ? 198 TRP B N     1 
ATOM   3529 C  CA    . TRP B 1 201 ? 46.237 -12.101 -5.577  1.00 66.32  ? 198 TRP B CA    1 
ATOM   3530 C  C     . TRP B 1 201 ? 47.160 -13.251 -6.054  1.00 67.08  ? 198 TRP B C     1 
ATOM   3531 O  O     . TRP B 1 201 ? 47.538 -14.107 -5.249  1.00 66.76  ? 198 TRP B O     1 
ATOM   3532 C  CB    . TRP B 1 201 ? 44.797 -12.337 -6.032  1.00 65.34  ? 198 TRP B CB    1 
ATOM   3533 C  CG    . TRP B 1 201 ? 44.263 -13.691 -5.666  1.00 66.47  ? 198 TRP B CG    1 
ATOM   3534 C  CD1   . TRP B 1 201 ? 43.631 -14.036 -4.510  1.00 66.34  ? 198 TRP B CD1   1 
ATOM   3535 C  CD2   . TRP B 1 201 ? 44.329 -14.885 -6.462  1.00 65.78  ? 198 TRP B CD2   1 
ATOM   3536 N  NE1   . TRP B 1 201 ? 43.285 -15.366 -4.537  1.00 67.02  ? 198 TRP B NE1   1 
ATOM   3537 C  CE2   . TRP B 1 201 ? 43.707 -15.914 -5.723  1.00 65.89  ? 198 TRP B CE2   1 
ATOM   3538 C  CE3   . TRP B 1 201 ? 44.838 -15.181 -7.738  1.00 65.57  ? 198 TRP B CE3   1 
ATOM   3539 C  CZ2   . TRP B 1 201 ? 43.591 -17.221 -6.212  1.00 64.89  ? 198 TRP B CZ2   1 
ATOM   3540 C  CZ3   . TRP B 1 201 ? 44.727 -16.473 -8.215  1.00 64.78  ? 198 TRP B CZ3   1 
ATOM   3541 C  CH2   . TRP B 1 201 ? 44.093 -17.472 -7.465  1.00 64.35  ? 198 TRP B CH2   1 
ATOM   3542 N  N     . ALA B 1 202 ? 47.519 -13.266 -7.361  1.00 67.42  ? 199 ALA B N     1 
ATOM   3543 C  CA    . ALA B 1 202 ? 48.380 -14.297 -7.952  1.00 68.28  ? 199 ALA B CA    1 
ATOM   3544 C  C     . ALA B 1 202 ? 49.784 -14.247 -7.400  1.00 68.70  ? 199 ALA B C     1 
ATOM   3545 O  O     . ALA B 1 202 ? 50.318 -15.291 -7.047  1.00 68.58  ? 199 ALA B O     1 
ATOM   3546 C  CB    . ALA B 1 202 ? 48.395 -14.179 -9.471  1.00 68.28  ? 199 ALA B CB    1 
ATOM   3547 N  N     . LYS B 1 203 ? 50.380 -13.040 -7.312  1.00 70.98  ? 200 LYS B N     1 
ATOM   3548 C  CA    . LYS B 1 203 ? 51.738 -12.826 -6.811  1.00 72.05  ? 200 LYS B CA    1 
ATOM   3549 C  C     . LYS B 1 203 ? 51.896 -13.345 -5.379  1.00 72.00  ? 200 LYS B C     1 
ATOM   3550 O  O     . LYS B 1 203 ? 52.953 -13.895 -5.049  1.00 72.02  ? 200 LYS B O     1 
ATOM   3551 C  CB    . LYS B 1 203 ? 52.118 -11.345 -6.909  1.00 75.41  ? 200 LYS B CB    1 
ATOM   3552 C  CG    . LYS B 1 203 ? 53.619 -11.119 -7.002  1.00 78.49  ? 200 LYS B CG    1 
ATOM   3553 C  CD    . LYS B 1 203 ? 53.970 -9.651  -7.185  1.00 83.92  ? 200 LYS B CD    1 
ATOM   3554 C  CE    . LYS B 1 203 ? 55.387 -9.449  -7.689  1.00 85.74  ? 200 LYS B CE    1 
ATOM   3555 N  NZ    . LYS B 1 203 ? 55.594 -8.071  -8.244  1.00 87.90  ? 200 LYS B NZ    1 
ATOM   3556 N  N     . GLU B 1 204 ? 50.834 -13.182 -4.547  1.00 71.13  ? 201 GLU B N     1 
ATOM   3557 C  CA    . GLU B 1 204 ? 50.772 -13.627 -3.159  1.00 72.12  ? 201 GLU B CA    1 
ATOM   3558 C  C     . GLU B 1 204 ? 50.878 -15.154 -3.083  1.00 71.74  ? 201 GLU B C     1 
ATOM   3559 O  O     . GLU B 1 204 ? 51.492 -15.680 -2.155  1.00 72.14  ? 201 GLU B O     1 
ATOM   3560 C  CB    . GLU B 1 204 ? 49.429 -13.228 -2.529  1.00 73.82  ? 201 GLU B CB    1 
ATOM   3561 C  CG    . GLU B 1 204 ? 49.298 -11.806 -2.017  1.00 77.07  ? 201 GLU B CG    1 
ATOM   3562 C  CD    . GLU B 1 204 ? 47.864 -11.365 -1.730  1.00 82.80  ? 201 GLU B CD    1 
ATOM   3563 O  OE1   . GLU B 1 204 ? 47.016 -12.230 -1.398  1.00 85.01  ? 201 GLU B OE1   1 
ATOM   3564 O  OE2   . GLU B 1 204 ? 47.586 -10.145 -1.844  1.00 86.14  ? 201 GLU B OE2   1 
ATOM   3565 N  N     . ARG B 1 205 ? 50.246 -15.866 -4.036  1.00 69.98  ? 202 ARG B N     1 
ATOM   3566 C  CA    . ARG B 1 205 ? 50.215 -17.329 -4.071  1.00 69.24  ? 202 ARG B CA    1 
ATOM   3567 C  C     . ARG B 1 205 ? 51.315 -17.965 -4.918  1.00 68.88  ? 202 ARG B C     1 
ATOM   3568 O  O     . ARG B 1 205 ? 51.359 -19.192 -5.023  1.00 69.10  ? 202 ARG B O     1 
ATOM   3569 C  CB    . ARG B 1 205 ? 48.831 -17.799 -4.515  1.00 69.10  ? 202 ARG B CB    1 
ATOM   3570 C  CG    . ARG B 1 205 ? 47.818 -17.708 -3.401  1.00 69.66  ? 202 ARG B CG    1 
ATOM   3571 C  CD    . ARG B 1 205 ? 46.459 -17.306 -3.897  1.00 70.10  ? 202 ARG B CD    1 
ATOM   3572 N  NE    . ARG B 1 205 ? 45.571 -16.865 -2.811  1.00 71.87  ? 202 ARG B NE    1 
ATOM   3573 C  CZ    . ARG B 1 205 ? 45.554 -15.630 -2.308  1.00 70.63  ? 202 ARG B CZ    1 
ATOM   3574 N  NH1   . ARG B 1 205 ? 46.379 -14.701 -2.776  1.00 70.34  ? 202 ARG B NH1   1 
ATOM   3575 N  NH2   . ARG B 1 205 ? 44.705 -15.314 -1.338  1.00 70.18  ? 202 ARG B NH2   1 
ATOM   3576 N  N     . GLY B 1 206 ? 52.202 -17.143 -5.479  1.00 66.13  ? 203 GLY B N     1 
ATOM   3577 C  CA    . GLY B 1 206 ? 53.294 -17.597 -6.332  1.00 65.43  ? 203 GLY B CA    1 
ATOM   3578 C  C     . GLY B 1 206 ? 52.817 -18.145 -7.669  1.00 65.39  ? 203 GLY B C     1 
ATOM   3579 O  O     . GLY B 1 206 ? 53.493 -18.990 -8.264  1.00 64.90  ? 203 GLY B O     1 
ATOM   3580 N  N     . ILE B 1 207 ? 51.646 -17.666 -8.153  1.00 64.10  ? 204 ILE B N     1 
ATOM   3581 C  CA    . ILE B 1 207 ? 51.033 -18.076 -9.418  1.00 63.87  ? 204 ILE B CA    1 
ATOM   3582 C  C     . ILE B 1 207 ? 51.422 -17.102 -10.544 1.00 64.93  ? 204 ILE B C     1 
ATOM   3583 O  O     . ILE B 1 207 ? 51.226 -15.888 -10.406 1.00 64.66  ? 204 ILE B O     1 
ATOM   3584 C  CB    . ILE B 1 207 ? 49.485 -18.151 -9.287  1.00 65.71  ? 204 ILE B CB    1 
ATOM   3585 C  CG1   . ILE B 1 207 ? 49.022 -19.142 -8.193  1.00 63.86  ? 204 ILE B CG1   1 
ATOM   3586 C  CG2   . ILE B 1 207 ? 48.824 -18.440 -10.627 1.00 64.67  ? 204 ILE B CG2   1 
ATOM   3587 C  CD1   . ILE B 1 207 ? 47.537 -19.000 -7.799  1.00 59.72  ? 204 ILE B CD1   1 
ATOM   3588 N  N     . HIS B 1 208 ? 51.945 -17.623 -11.664 1.00 66.13  ? 205 HIS B N     1 
ATOM   3589 C  CA    . HIS B 1 208 ? 52.287 -16.772 -12.781 1.00 67.23  ? 205 HIS B CA    1 
ATOM   3590 C  C     . HIS B 1 208 ? 51.046 -16.621 -13.642 1.00 66.69  ? 205 HIS B C     1 
ATOM   3591 O  O     . HIS B 1 208 ? 50.421 -17.622 -13.990 1.00 66.69  ? 205 HIS B O     1 
ATOM   3592 C  CB    . HIS B 1 208 ? 53.450 -17.356 -13.598 1.00 69.35  ? 205 HIS B CB    1 
ATOM   3593 C  CG    . HIS B 1 208 ? 53.663 -16.670 -14.924 1.00 73.36  ? 205 HIS B CG    1 
ATOM   3594 N  ND1   . HIS B 1 208 ? 53.470 -17.340 -16.125 1.00 76.24  ? 205 HIS B ND1   1 
ATOM   3595 C  CD2   . HIS B 1 208 ? 54.013 -15.383 -15.193 1.00 74.79  ? 205 HIS B CD2   1 
ATOM   3596 C  CE1   . HIS B 1 208 ? 53.726 -16.451 -17.078 1.00 76.72  ? 205 HIS B CE1   1 
ATOM   3597 N  NE2   . HIS B 1 208 ? 54.049 -15.258 -16.565 1.00 75.69  ? 205 HIS B NE2   1 
ATOM   3598 N  N     . LEU B 1 209 ? 50.673 -15.377 -13.982 1.00 64.35  ? 206 LEU B N     1 
ATOM   3599 C  CA    . LEU B 1 209 ? 49.523 -15.146 -14.864 1.00 64.57  ? 206 LEU B CA    1 
ATOM   3600 C  C     . LEU B 1 209 ? 50.001 -15.163 -16.327 1.00 65.21  ? 206 LEU B C     1 
ATOM   3601 O  O     . LEU B 1 209 ? 51.132 -14.755 -16.623 1.00 65.33  ? 206 LEU B O     1 
ATOM   3602 C  CB    . LEU B 1 209 ? 48.766 -13.851 -14.546 1.00 62.93  ? 206 LEU B CB    1 
ATOM   3603 C  CG    . LEU B 1 209 ? 48.033 -13.763 -13.215 1.00 61.97  ? 206 LEU B CG    1 
ATOM   3604 C  CD1   . LEU B 1 209 ? 47.229 -12.499 -13.153 1.00 61.60  ? 206 LEU B CD1   1 
ATOM   3605 C  CD2   . LEU B 1 209 ? 47.136 -14.982 -12.972 1.00 60.09  ? 206 LEU B CD2   1 
ATOM   3606 N  N     . GLU B 1 210 ? 49.153 -15.663 -17.232 1.00 66.67  ? 207 GLU B N     1 
ATOM   3607 C  CA    . GLU B 1 210 ? 49.495 -15.775 -18.640 1.00 67.08  ? 207 GLU B CA    1 
ATOM   3608 C  C     . GLU B 1 210 ? 48.288 -15.441 -19.436 1.00 67.01  ? 207 GLU B C     1 
ATOM   3609 O  O     . GLU B 1 210 ? 47.203 -15.943 -19.168 1.00 66.37  ? 207 GLU B O     1 
ATOM   3610 C  CB    . GLU B 1 210 ? 49.990 -17.193 -18.933 1.00 69.72  ? 207 GLU B CB    1 
ATOM   3611 C  CG    . GLU B 1 210 ? 50.449 -17.429 -20.353 1.00 71.50  ? 207 GLU B CG    1 
ATOM   3612 C  CD    . GLU B 1 210 ? 50.809 -18.880 -20.571 1.00 72.81  ? 207 GLU B CD    1 
ATOM   3613 O  OE1   . GLU B 1 210 ? 51.964 -19.259 -20.261 1.00 73.94  ? 207 GLU B OE1   1 
ATOM   3614 O  OE2   . GLU B 1 210 ? 49.928 -19.641 -21.035 1.00 72.67  ? 207 GLU B OE2   1 
ATOM   3615 N  N     . PHE B 1 211 ? 48.466 -14.565 -20.409 1.00 68.47  ? 208 PHE B N     1 
ATOM   3616 C  CA    . PHE B 1 211 ? 47.368 -14.099 -21.242 1.00 68.99  ? 208 PHE B CA    1 
ATOM   3617 C  C     . PHE B 1 211 ? 47.529 -14.438 -22.686 1.00 69.21  ? 208 PHE B C     1 
ATOM   3618 O  O     . PHE B 1 211 ? 48.648 -14.496 -23.203 1.00 68.88  ? 208 PHE B O     1 
ATOM   3619 C  CB    . PHE B 1 211 ? 47.187 -12.578 -21.085 1.00 69.69  ? 208 PHE B CB    1 
ATOM   3620 C  CG    . PHE B 1 211 ? 46.910 -12.148 -19.666 1.00 69.93  ? 208 PHE B CG    1 
ATOM   3621 C  CD1   . PHE B 1 211 ? 45.624 -12.232 -19.134 1.00 69.05  ? 208 PHE B CD1   1 
ATOM   3622 C  CD2   . PHE B 1 211 ? 47.938 -11.677 -18.850 1.00 71.11  ? 208 PHE B CD2   1 
ATOM   3623 C  CE1   . PHE B 1 211 ? 45.377 -11.860 -17.811 1.00 68.70  ? 208 PHE B CE1   1 
ATOM   3624 C  CE2   . PHE B 1 211 ? 47.687 -11.311 -17.524 1.00 71.60  ? 208 PHE B CE2   1 
ATOM   3625 C  CZ    . PHE B 1 211 ? 46.411 -11.403 -17.018 1.00 69.79  ? 208 PHE B CZ    1 
ATOM   3626 N  N     . SER B 1 212 ? 46.402 -14.673 -23.342 1.00 73.87  ? 209 SER B N     1 
ATOM   3627 C  CA    . SER B 1 212 ? 46.378 -14.929 -24.766 1.00 74.70  ? 209 SER B CA    1 
ATOM   3628 C  C     . SER B 1 212 ? 46.294 -13.523 -25.413 1.00 75.42  ? 209 SER B C     1 
ATOM   3629 O  O     . SER B 1 212 ? 45.822 -12.578 -24.771 1.00 74.65  ? 209 SER B O     1 
ATOM   3630 C  CB    . SER B 1 212 ? 45.171 -15.790 -25.136 1.00 77.44  ? 209 SER B CB    1 
ATOM   3631 O  OG    . SER B 1 212 ? 43.934 -15.240 -24.715 1.00 78.30  ? 209 SER B OG    1 
ATOM   3632 N  N     . THR B 1 213 ? 46.773 -13.378 -26.657 1.00 80.10  ? 210 THR B N     1 
ATOM   3633 C  CA    . THR B 1 213 ? 46.748 -12.116 -27.406 1.00 81.41  ? 210 THR B CA    1 
ATOM   3634 C  C     . THR B 1 213 ? 45.280 -11.595 -27.542 1.00 82.14  ? 210 THR B C     1 
ATOM   3635 O  O     . THR B 1 213 ? 44.395 -12.421 -27.782 1.00 81.73  ? 210 THR B O     1 
ATOM   3636 C  CB    . THR B 1 213 ? 47.483 -12.353 -28.735 1.00 89.76  ? 210 THR B CB    1 
ATOM   3637 O  OG1   . THR B 1 213 ? 48.878 -12.393 -28.443 1.00 90.77  ? 210 THR B OG1   1 
ATOM   3638 C  CG2   . THR B 1 213 ? 47.195 -11.295 -29.800 1.00 90.75  ? 210 THR B CG2   1 
ATOM   3639 N  N     . PRO B 1 214 ? 44.975 -10.272 -27.366 1.00 84.89  ? 211 PRO B N     1 
ATOM   3640 C  CA    . PRO B 1 214 ? 43.573 -9.827  -27.517 1.00 86.13  ? 211 PRO B CA    1 
ATOM   3641 C  C     . PRO B 1 214 ? 43.014 -10.232 -28.884 1.00 87.64  ? 211 PRO B C     1 
ATOM   3642 O  O     . PRO B 1 214 ? 43.718 -10.145 -29.910 1.00 87.58  ? 211 PRO B O     1 
ATOM   3643 C  CB    . PRO B 1 214 ? 43.646 -8.304  -27.364 1.00 86.98  ? 211 PRO B CB    1 
ATOM   3644 C  CG    . PRO B 1 214 ? 44.923 -8.044  -26.683 1.00 86.91  ? 211 PRO B CG    1 
ATOM   3645 C  CD    . PRO B 1 214 ? 45.870 -9.136  -27.062 1.00 86.26  ? 211 PRO B CD    1 
ATOM   3646 N  N     . TYR B 1 215 ? 41.750 -10.720 -28.875 1.00 91.84  ? 212 TYR B N     1 
ATOM   3647 C  CA    . TYR B 1 215 ? 40.954 -11.190 -30.023 1.00 93.62  ? 212 TYR B CA    1 
ATOM   3648 C  C     . TYR B 1 215 ? 41.453 -12.557 -30.603 1.00 94.68  ? 212 TYR B C     1 
ATOM   3649 O  O     . TYR B 1 215 ? 40.749 -13.145 -31.429 1.00 95.04  ? 212 TYR B O     1 
ATOM   3650 C  CB    . TYR B 1 215 ? 40.807 -10.096 -31.126 1.00 93.75  ? 212 TYR B CB    1 
ATOM   3651 C  CG    . TYR B 1 215 ? 40.502 -8.709  -30.588 1.00 93.97  ? 212 TYR B CG    1 
ATOM   3652 C  CD1   . TYR B 1 215 ? 39.229 -8.383  -30.120 1.00 93.64  ? 212 TYR B CD1   1 
ATOM   3653 C  CD2   . TYR B 1 215 ? 41.487 -7.725  -30.542 1.00 94.68  ? 212 TYR B CD2   1 
ATOM   3654 C  CE1   . TYR B 1 215 ? 38.949 -7.115  -29.605 1.00 94.39  ? 212 TYR B CE1   1 
ATOM   3655 C  CE2   . TYR B 1 215 ? 41.220 -6.455  -30.028 1.00 94.81  ? 212 TYR B CE2   1 
ATOM   3656 C  CZ    . TYR B 1 215 ? 39.949 -6.153  -29.561 1.00 95.20  ? 212 TYR B CZ    1 
ATOM   3657 O  OH    . TYR B 1 215 ? 39.683 -4.899  -29.054 1.00 95.69  ? 212 TYR B OH    1 
ATOM   3658 N  N     . HIS B 1 216 ? 42.633 -13.067 -30.142 1.00 99.43  ? 213 HIS B N     1 
ATOM   3659 C  CA    . HIS B 1 216 ? 43.250 -14.349 -30.552 1.00 100.65 ? 213 HIS B CA    1 
ATOM   3660 C  C     . HIS B 1 216 ? 43.365 -15.329 -29.360 1.00 100.77 ? 213 HIS B C     1 
ATOM   3661 O  O     . HIS B 1 216 ? 44.469 -15.519 -28.817 1.00 100.66 ? 213 HIS B O     1 
ATOM   3662 C  CB    . HIS B 1 216 ? 44.620 -14.127 -31.225 1.00 103.25 ? 213 HIS B CB    1 
ATOM   3663 C  CG    . HIS B 1 216 ? 44.537 -13.268 -32.446 1.00 106.47 ? 213 HIS B CG    1 
ATOM   3664 N  ND1   . HIS B 1 216 ? 45.065 -11.983 -32.465 1.00 108.89 ? 213 HIS B ND1   1 
ATOM   3665 C  CD2   . HIS B 1 216 ? 43.951 -13.520 -33.643 1.00 108.60 ? 213 HIS B CD2   1 
ATOM   3666 C  CE1   . HIS B 1 216 ? 44.800 -11.506 -33.671 1.00 109.86 ? 213 HIS B CE1   1 
ATOM   3667 N  NE2   . HIS B 1 216 ? 44.128 -12.395 -34.416 1.00 109.98 ? 213 HIS B NE2   1 
ATOM   3668 N  N     . PRO B 1 217 ? 42.233 -15.956 -28.933 1.00 100.88 ? 214 PRO B N     1 
ATOM   3669 C  CA    . PRO B 1 217 ? 42.305 -16.875 -27.788 1.00 101.03 ? 214 PRO B CA    1 
ATOM   3670 C  C     . PRO B 1 217 ? 42.905 -18.229 -28.132 1.00 100.93 ? 214 PRO B C     1 
ATOM   3671 O  O     . PRO B 1 217 ? 42.386 -18.951 -28.988 1.00 101.27 ? 214 PRO B O     1 
ATOM   3672 C  CB    . PRO B 1 217 ? 40.854 -16.961 -27.298 1.00 102.70 ? 214 PRO B CB    1 
ATOM   3673 C  CG    . PRO B 1 217 ? 40.025 -16.656 -28.481 1.00 102.95 ? 214 PRO B CG    1 
ATOM   3674 C  CD    . PRO B 1 217 ? 40.851 -15.860 -29.459 1.00 102.55 ? 214 PRO B CD    1 
ATOM   3675 N  N     . GLN B 1 218 ? 44.021 -18.554 -27.474 1.00 99.28  ? 215 GLN B N     1 
ATOM   3676 C  CA    . GLN B 1 218 ? 44.725 -19.816 -27.658 1.00 98.92  ? 215 GLN B CA    1 
ATOM   3677 C  C     . GLN B 1 218 ? 44.922 -20.485 -26.315 1.00 97.91  ? 215 GLN B C     1 
ATOM   3678 O  O     . GLN B 1 218 ? 45.200 -19.808 -25.328 1.00 98.03  ? 215 GLN B O     1 
ATOM   3679 C  CB    . GLN B 1 218 ? 46.056 -19.648 -28.432 1.00 101.48 ? 215 GLN B CB    1 
ATOM   3680 C  CG    . GLN B 1 218 ? 46.996 -18.529 -27.945 1.00 103.04 ? 215 GLN B CG    1 
ATOM   3681 C  CD    . GLN B 1 218 ? 47.901 -18.921 -26.787 1.00 105.79 ? 215 GLN B CD    1 
ATOM   3682 O  OE1   . GLN B 1 218 ? 48.512 -20.006 -26.769 1.00 106.19 ? 215 GLN B OE1   1 
ATOM   3683 N  NE2   . GLN B 1 218 ? 48.019 -18.033 -25.792 1.00 106.08 ? 215 GLN B NE2   1 
ATOM   3684 N  N     . SER B 1 219 ? 44.745 -21.806 -26.272 1.00 92.64  ? 216 SER B N     1 
ATOM   3685 C  CA    . SER B 1 219 ? 44.920 -22.606 -25.067 1.00 90.81  ? 216 SER B CA    1 
ATOM   3686 C  C     . SER B 1 219 ? 45.730 -23.856 -25.456 1.00 89.44  ? 216 SER B C     1 
ATOM   3687 O  O     . SER B 1 219 ? 46.964 -23.803 -25.444 1.00 89.75  ? 216 SER B O     1 
ATOM   3688 C  CB    . SER B 1 219 ? 43.574 -22.926 -24.418 1.00 93.77  ? 216 SER B CB    1 
ATOM   3689 O  OG    . SER B 1 219 ? 42.675 -23.559 -25.310 1.00 93.02  ? 216 SER B OG    1 
ATOM   3690 N  N     . SER B 1 220 ? 45.039 -24.946 -25.837 1.00 83.54  ? 217 SER B N     1 
ATOM   3691 C  CA    . SER B 1 220 ? 45.578 -26.232 -26.301 1.00 81.80  ? 217 SER B CA    1 
ATOM   3692 C  C     . SER B 1 220 ? 44.401 -26.986 -26.928 1.00 80.33  ? 217 SER B C     1 
ATOM   3693 O  O     . SER B 1 220 ? 43.250 -26.636 -26.648 1.00 80.23  ? 217 SER B O     1 
ATOM   3694 C  CB    . SER B 1 220 ? 46.203 -27.041 -25.158 1.00 81.92  ? 217 SER B CB    1 
ATOM   3695 O  OG    . SER B 1 220 ? 45.281 -27.851 -24.444 1.00 82.16  ? 217 SER B OG    1 
ATOM   3696 N  N     . GLY B 1 221 ? 44.695 -27.993 -27.762 1.00 77.52  ? 218 GLY B N     1 
ATOM   3697 C  CA    . GLY B 1 221 ? 43.688 -28.825 -28.407 1.00 75.41  ? 218 GLY B CA    1 
ATOM   3698 C  C     . GLY B 1 221 ? 42.769 -29.455 -27.384 1.00 74.32  ? 218 GLY B C     1 
ATOM   3699 O  O     . GLY B 1 221 ? 41.548 -29.302 -27.473 1.00 74.37  ? 218 GLY B O     1 
ATOM   3700 N  N     . LYS B 1 222 ? 43.361 -30.129 -26.374 1.00 71.20  ? 219 LYS B N     1 
ATOM   3701 C  CA    . LYS B 1 222 ? 42.646 -30.783 -25.279 1.00 70.22  ? 219 LYS B CA    1 
ATOM   3702 C  C     . LYS B 1 222 ? 41.711 -29.793 -24.541 1.00 69.07  ? 219 LYS B C     1 
ATOM   3703 O  O     . LYS B 1 222 ? 40.532 -30.104 -24.326 1.00 68.22  ? 219 LYS B O     1 
ATOM   3704 C  CB    . LYS B 1 222 ? 43.651 -31.457 -24.334 1.00 71.79  ? 219 LYS B CB    1 
ATOM   3705 C  CG    . LYS B 1 222 ? 43.023 -32.255 -23.201 1.00 73.09  ? 219 LYS B CG    1 
ATOM   3706 C  CD    . LYS B 1 222 ? 44.030 -33.189 -22.552 1.00 74.11  ? 219 LYS B CD    1 
ATOM   3707 C  CE    . LYS B 1 222 ? 43.446 -33.953 -21.381 1.00 74.17  ? 219 LYS B CE    1 
ATOM   3708 N  NZ    . LYS B 1 222 ? 42.420 -34.992 -21.727 1.00 73.59  ? 219 LYS B NZ    1 
ATOM   3709 N  N     . VAL B 1 223 ? 42.233 -28.594 -24.201 1.00 69.29  ? 220 VAL B N     1 
ATOM   3710 C  CA    . VAL B 1 223 ? 41.483 -27.550 -23.489 1.00 68.71  ? 220 VAL B CA    1 
ATOM   3711 C  C     . VAL B 1 223 ? 40.369 -26.947 -24.375 1.00 68.81  ? 220 VAL B C     1 
ATOM   3712 O  O     . VAL B 1 223 ? 39.218 -26.872 -23.914 1.00 68.78  ? 220 VAL B O     1 
ATOM   3713 C  CB    . VAL B 1 223 ? 42.412 -26.477 -22.857 1.00 70.54  ? 220 VAL B CB    1 
ATOM   3714 C  CG1   . VAL B 1 223 ? 41.608 -25.343 -22.233 1.00 68.10  ? 220 VAL B CG1   1 
ATOM   3715 C  CG2   . VAL B 1 223 ? 43.332 -27.105 -21.820 1.00 69.41  ? 220 VAL B CG2   1 
ATOM   3716 N  N     . GLU B 1 224 ? 40.703 -26.530 -25.636 1.00 67.57  ? 221 GLU B N     1 
ATOM   3717 C  CA    . GLU B 1 224 ? 39.759 -25.959 -26.604 1.00 67.50  ? 221 GLU B CA    1 
ATOM   3718 C  C     . GLU B 1 224 ? 38.551 -26.904 -26.783 1.00 67.28  ? 221 GLU B C     1 
ATOM   3719 O  O     . GLU B 1 224 ? 37.399 -26.455 -26.742 1.00 67.41  ? 221 GLU B O     1 
ATOM   3720 C  CB    . GLU B 1 224 ? 40.463 -25.661 -27.936 1.00 68.69  ? 221 GLU B CB    1 
ATOM   3721 N  N     . ARG B 1 225 ? 38.834 -28.224 -26.918 1.00 68.79  ? 222 ARG B N     1 
ATOM   3722 C  CA    . ARG B 1 225 ? 37.829 -29.274 -27.038 1.00 69.12  ? 222 ARG B CA    1 
ATOM   3723 C  C     . ARG B 1 225 ? 37.023 -29.363 -25.746 1.00 69.02  ? 222 ARG B C     1 
ATOM   3724 O  O     . ARG B 1 225 ? 35.796 -29.465 -25.808 1.00 69.07  ? 222 ARG B O     1 
ATOM   3725 C  CB    . ARG B 1 225 ? 38.485 -30.627 -27.312 1.00 71.09  ? 222 ARG B CB    1 
ATOM   3726 C  CG    . ARG B 1 225 ? 38.891 -30.829 -28.757 1.00 72.45  ? 222 ARG B CG    1 
ATOM   3727 C  CD    . ARG B 1 225 ? 39.732 -32.082 -28.941 1.00 72.78  ? 222 ARG B CD    1 
ATOM   3728 N  NE    . ARG B 1 225 ? 40.966 -31.761 -29.649 1.00 76.01  ? 222 ARG B NE    1 
ATOM   3729 C  CZ    . ARG B 1 225 ? 42.177 -32.152 -29.270 1.00 76.43  ? 222 ARG B CZ    1 
ATOM   3730 N  NH1   . ARG B 1 225 ? 42.332 -32.903 -28.188 1.00 79.39  ? 222 ARG B NH1   1 
ATOM   3731 N  NH2   . ARG B 1 225 ? 43.249 -31.798 -29.975 1.00 77.62  ? 222 ARG B NH2   1 
ATOM   3732 N  N     . LYS B 1 226 ? 37.708 -29.332 -24.569 1.00 67.65  ? 223 LYS B N     1 
ATOM   3733 C  CA    . LYS B 1 226 ? 37.035 -29.403 -23.271 1.00 67.03  ? 223 LYS B CA    1 
ATOM   3734 C  C     . LYS B 1 226 ? 36.035 -28.262 -23.075 1.00 66.99  ? 223 LYS B C     1 
ATOM   3735 O  O     . LYS B 1 226 ? 34.893 -28.517 -22.696 1.00 65.03  ? 223 LYS B O     1 
ATOM   3736 C  CB    . LYS B 1 226 ? 38.039 -29.481 -22.120 1.00 66.77  ? 223 LYS B CB    1 
ATOM   3737 C  CG    . LYS B 1 226 ? 37.415 -29.832 -20.769 1.00 65.69  ? 223 LYS B CG    1 
ATOM   3738 C  CD    . LYS B 1 226 ? 36.560 -31.086 -20.792 1.00 65.68  ? 223 LYS B CD    1 
ATOM   3739 C  CE    . LYS B 1 226 ? 37.377 -32.346 -20.769 1.00 65.45  ? 223 LYS B CE    1 
ATOM   3740 N  NZ    . LYS B 1 226 ? 36.539 -33.484 -20.342 1.00 62.80  ? 223 LYS B NZ    1 
ATOM   3741 N  N     . ASN B 1 227 ? 36.443 -27.019 -23.387 1.00 70.26  ? 224 ASN B N     1 
ATOM   3742 C  CA    . ASN B 1 227 ? 35.563 -25.858 -23.271 1.00 71.58  ? 224 ASN B CA    1 
ATOM   3743 C  C     . ASN B 1 227 ? 34.353 -25.939 -24.212 1.00 71.76  ? 224 ASN B C     1 
ATOM   3744 O  O     . ASN B 1 227 ? 33.294 -25.384 -23.887 1.00 71.97  ? 224 ASN B O     1 
ATOM   3745 C  CB    . ASN B 1 227 ? 36.338 -24.563 -23.423 1.00 75.87  ? 224 ASN B CB    1 
ATOM   3746 C  CG    . ASN B 1 227 ? 37.017 -24.164 -22.132 1.00 77.83  ? 224 ASN B CG    1 
ATOM   3747 O  OD1   . ASN B 1 227 ? 36.420 -23.512 -21.269 1.00 78.52  ? 224 ASN B OD1   1 
ATOM   3748 N  ND2   . ASN B 1 227 ? 38.271 -24.552 -21.959 1.00 77.31  ? 224 ASN B ND2   1 
ATOM   3749 N  N     . SER B 1 228 ? 34.499 -26.672 -25.358 1.00 74.83  ? 225 SER B N     1 
ATOM   3750 C  CA    . SER B 1 228 ? 33.425 -26.896 -26.336 1.00 74.93  ? 225 SER B CA    1 
ATOM   3751 C  C     . SER B 1 228 ? 32.392 -27.810 -25.688 1.00 74.60  ? 225 SER B C     1 
ATOM   3752 O  O     . SER B 1 228 ? 31.208 -27.457 -25.674 1.00 74.88  ? 225 SER B O     1 
ATOM   3753 C  CB    . SER B 1 228 ? 33.968 -27.506 -27.632 1.00 79.49  ? 225 SER B CB    1 
ATOM   3754 O  OG    . SER B 1 228 ? 32.994 -28.226 -28.377 1.00 80.96  ? 225 SER B OG    1 
ATOM   3755 N  N     . ASP B 1 229 ? 32.848 -28.958 -25.119 1.00 74.05  ? 226 ASP B N     1 
ATOM   3756 C  CA    . ASP B 1 229 ? 31.987 -29.923 -24.434 1.00 74.48  ? 226 ASP B CA    1 
ATOM   3757 C  C     . ASP B 1 229 ? 31.260 -29.246 -23.289 1.00 74.34  ? 226 ASP B C     1 
ATOM   3758 O  O     . ASP B 1 229 ? 30.059 -29.471 -23.154 1.00 74.39  ? 226 ASP B O     1 
ATOM   3759 C  CB    . ASP B 1 229 ? 32.779 -31.128 -23.895 1.00 77.29  ? 226 ASP B CB    1 
ATOM   3760 C  CG    . ASP B 1 229 ? 33.600 -31.927 -24.901 1.00 78.78  ? 226 ASP B CG    1 
ATOM   3761 O  OD1   . ASP B 1 229 ? 33.468 -31.667 -26.134 1.00 82.53  ? 226 ASP B OD1   1 
ATOM   3762 O  OD2   . ASP B 1 229 ? 34.374 -32.818 -24.460 1.00 82.50  ? 226 ASP B OD2   1 
ATOM   3763 N  N     . ILE B 1 230 ? 31.978 -28.390 -22.482 1.00 72.39  ? 227 ILE B N     1 
ATOM   3764 C  CA    . ILE B 1 230 ? 31.417 -27.641 -21.341 1.00 72.27  ? 227 ILE B CA    1 
ATOM   3765 C  C     . ILE B 1 230 ? 30.258 -26.777 -21.830 1.00 73.19  ? 227 ILE B C     1 
ATOM   3766 O  O     . ILE B 1 230 ? 29.141 -26.938 -21.331 1.00 72.68  ? 227 ILE B O     1 
ATOM   3767 C  CB    . ILE B 1 230 ? 32.475 -26.810 -20.532 1.00 73.83  ? 227 ILE B CB    1 
ATOM   3768 C  CG1   . ILE B 1 230 ? 33.512 -27.708 -19.831 1.00 72.70  ? 227 ILE B CG1   1 
ATOM   3769 C  CG2   . ILE B 1 230 ? 31.786 -25.913 -19.500 1.00 72.50  ? 227 ILE B CG2   1 
ATOM   3770 C  CD1   . ILE B 1 230 ? 34.877 -27.081 -19.602 1.00 71.51  ? 227 ILE B CD1   1 
ATOM   3771 N  N     . LYS B 1 231 ? 30.531 -25.879 -22.812 1.00 75.77  ? 228 LYS B N     1 
ATOM   3772 C  CA    . LYS B 1 231 ? 29.545 -24.971 -23.403 1.00 77.36  ? 228 LYS B CA    1 
ATOM   3773 C  C     . LYS B 1 231 ? 28.337 -25.735 -23.993 1.00 78.50  ? 228 LYS B C     1 
ATOM   3774 O  O     . LYS B 1 231 ? 27.190 -25.344 -23.748 1.00 78.52  ? 228 LYS B O     1 
ATOM   3775 C  CB    . LYS B 1 231 ? 30.203 -24.024 -24.422 1.00 79.55  ? 228 LYS B CB    1 
ATOM   3776 N  N     . ARG B 1 232 ? 28.599 -26.852 -24.709 1.00 81.06  ? 229 ARG B N     1 
ATOM   3777 C  CA    . ARG B 1 232 ? 27.554 -27.686 -25.306 1.00 82.71  ? 229 ARG B CA    1 
ATOM   3778 C  C     . ARG B 1 232 ? 26.700 -28.410 -24.263 1.00 83.50  ? 229 ARG B C     1 
ATOM   3779 O  O     . ARG B 1 232 ? 25.472 -28.350 -24.355 1.00 83.67  ? 229 ARG B O     1 
ATOM   3780 C  CB    . ARG B 1 232 ? 28.128 -28.665 -26.350 1.00 88.58  ? 229 ARG B CB    1 
ATOM   3781 C  CG    . ARG B 1 232 ? 28.049 -28.111 -27.768 1.00 89.81  ? 229 ARG B CG    1 
ATOM   3782 C  CD    . ARG B 1 232 ? 29.047 -28.739 -28.704 1.00 90.71  ? 229 ARG B CD    1 
ATOM   3783 N  NE    . ARG B 1 232 ? 28.505 -29.940 -29.335 1.00 92.11  ? 229 ARG B NE    1 
ATOM   3784 C  CZ    . ARG B 1 232 ? 29.192 -31.066 -29.510 1.00 92.74  ? 229 ARG B CZ    1 
ATOM   3785 N  NH1   . ARG B 1 232 ? 28.623 -32.115 -30.093 1.00 94.07  ? 229 ARG B NH1   1 
ATOM   3786 N  NH2   . ARG B 1 232 ? 30.454 -31.153 -29.097 1.00 92.13  ? 229 ARG B NH2   1 
ATOM   3787 N  N     . LEU B 1 233 ? 27.338 -29.084 -23.279 1.00 81.70  ? 230 LEU B N     1 
ATOM   3788 C  CA    . LEU B 1 233 ? 26.667 -29.817 -22.200 1.00 82.60  ? 230 LEU B CA    1 
ATOM   3789 C  C     . LEU B 1 233 ? 25.764 -28.878 -21.385 1.00 83.55  ? 230 LEU B C     1 
ATOM   3790 O  O     . LEU B 1 233 ? 24.638 -29.251 -21.039 1.00 83.60  ? 230 LEU B O     1 
ATOM   3791 C  CB    . LEU B 1 233 ? 27.701 -30.533 -21.310 1.00 81.96  ? 230 LEU B CB    1 
ATOM   3792 C  CG    . LEU B 1 233 ? 27.196 -31.341 -20.107 1.00 82.36  ? 230 LEU B CG    1 
ATOM   3793 C  CD1   . LEU B 1 233 ? 26.210 -32.409 -20.519 1.00 82.10  ? 230 LEU B CD1   1 
ATOM   3794 C  CD2   . LEU B 1 233 ? 28.346 -31.984 -19.377 1.00 81.33  ? 230 LEU B CD2   1 
ATOM   3795 N  N     . LEU B 1 234 ? 26.253 -27.648 -21.119 1.00 85.85  ? 231 LEU B N     1 
ATOM   3796 C  CA    . LEU B 1 234 ? 25.500 -26.634 -20.401 1.00 87.57  ? 231 LEU B CA    1 
ATOM   3797 C  C     . LEU B 1 234 ? 24.265 -26.232 -21.206 1.00 88.98  ? 231 LEU B C     1 
ATOM   3798 O  O     . LEU B 1 234 ? 23.171 -26.203 -20.633 1.00 89.36  ? 231 LEU B O     1 
ATOM   3799 C  CB    . LEU B 1 234 ? 26.370 -25.411 -20.083 1.00 87.32  ? 231 LEU B CB    1 
ATOM   3800 C  CG    . LEU B 1 234 ? 27.193 -25.496 -18.801 1.00 87.18  ? 231 LEU B CG    1 
ATOM   3801 C  CD1   . LEU B 1 234 ? 28.149 -24.347 -18.707 1.00 86.81  ? 231 LEU B CD1   1 
ATOM   3802 C  CD2   . LEU B 1 234 ? 26.307 -25.497 -17.566 1.00 85.87  ? 231 LEU B CD2   1 
ATOM   3803 N  N     . THR B 1 235 ? 24.432 -25.965 -22.535 1.00 89.88  ? 232 THR B N     1 
ATOM   3804 C  CA    . THR B 1 235 ? 23.350 -25.576 -23.457 1.00 91.03  ? 232 THR B CA    1 
ATOM   3805 C  C     . THR B 1 235 ? 22.258 -26.660 -23.524 1.00 91.89  ? 232 THR B C     1 
ATOM   3806 O  O     . THR B 1 235 ? 21.071 -26.340 -23.509 1.00 91.72  ? 232 THR B O     1 
ATOM   3807 C  CB    . THR B 1 235 ? 23.926 -25.222 -24.842 1.00 100.45 ? 232 THR B CB    1 
ATOM   3808 O  OG1   . THR B 1 235 ? 24.908 -24.195 -24.698 1.00 100.43 ? 232 THR B OG1   1 
ATOM   3809 C  CG2   . THR B 1 235 ? 22.856 -24.761 -25.830 1.00 100.69 ? 232 THR B CG2   1 
ATOM   3810 N  N     . LYS B 1 236 ? 22.688 -27.930 -23.578 1.00 94.35  ? 233 LYS B N     1 
ATOM   3811 C  CA    . LYS B 1 236 ? 21.861 -29.128 -23.642 1.00 95.82  ? 233 LYS B CA    1 
ATOM   3812 C  C     . LYS B 1 236 ? 20.973 -29.247 -22.407 1.00 96.96  ? 233 LYS B C     1 
ATOM   3813 O  O     . LYS B 1 236 ? 19.799 -29.603 -22.537 1.00 97.45  ? 233 LYS B O     1 
ATOM   3814 C  CB    . LYS B 1 236 ? 22.767 -30.368 -23.805 1.00 97.12  ? 233 LYS B CB    1 
ATOM   3815 C  CG    . LYS B 1 236 ? 22.065 -31.721 -23.784 1.00 98.18  ? 233 LYS B CG    1 
ATOM   3816 C  CD    . LYS B 1 236 ? 21.844 -32.295 -25.170 1.00 100.36 ? 233 LYS B CD    1 
ATOM   3817 C  CE    . LYS B 1 236 ? 21.176 -33.646 -25.091 1.00 101.23 ? 233 LYS B CE    1 
ATOM   3818 N  NZ    . LYS B 1 236 ? 20.104 -33.806 -26.112 1.00 101.36 ? 233 LYS B NZ    1 
ATOM   3819 N  N     . LEU B 1 237 ? 21.518 -28.943 -21.210 1.00 101.19 ? 234 LEU B N     1 
ATOM   3820 C  CA    . LEU B 1 237 ? 20.748 -29.054 -19.966 1.00 101.90 ? 234 LEU B CA    1 
ATOM   3821 C  C     . LEU B 1 237 ? 19.982 -27.767 -19.611 1.00 102.07 ? 234 LEU B C     1 
ATOM   3822 O  O     . LEU B 1 237 ? 18.978 -27.858 -18.903 1.00 102.18 ? 234 LEU B O     1 
ATOM   3823 C  CB    . LEU B 1 237 ? 21.613 -29.573 -18.798 1.00 101.91 ? 234 LEU B CB    1 
ATOM   3824 C  CG    . LEU B 1 237 ? 22.186 -31.014 -18.970 1.00 102.59 ? 234 LEU B CG    1 
ATOM   3825 C  CD1   . LEU B 1 237 ? 23.039 -31.427 -17.773 1.00 102.49 ? 234 LEU B CD1   1 
ATOM   3826 C  CD2   . LEU B 1 237 ? 21.085 -32.054 -19.214 1.00 102.69 ? 234 LEU B CD2   1 
ATOM   3827 N  N     . LEU B 1 238 ? 20.416 -26.592 -20.136 1.00 105.18 ? 235 LEU B N     1 
ATOM   3828 C  CA    . LEU B 1 238 ? 19.732 -25.302 -19.933 1.00 105.52 ? 235 LEU B CA    1 
ATOM   3829 C  C     . LEU B 1 238 ? 18.305 -25.369 -20.527 1.00 105.59 ? 235 LEU B C     1 
ATOM   3830 O  O     . LEU B 1 238 ? 17.375 -24.895 -19.898 1.00 105.52 ? 235 LEU B O     1 
ATOM   3831 C  CB    . LEU B 1 238 ? 20.497 -24.128 -20.596 1.00 105.58 ? 235 LEU B CB    1 
ATOM   3832 C  CG    . LEU B 1 238 ? 21.550 -23.378 -19.767 1.00 106.51 ? 235 LEU B CG    1 
ATOM   3833 C  CD1   . LEU B 1 238 ? 22.409 -22.486 -20.663 1.00 106.50 ? 235 LEU B CD1   1 
ATOM   3834 C  CD2   . LEU B 1 238 ? 20.915 -22.549 -18.655 1.00 105.93 ? 235 LEU B CD2   1 
ATOM   3835 N  N     . VAL B 1 239 ? 18.141 -25.968 -21.729 1.00 106.76 ? 236 VAL B N     1 
ATOM   3836 C  CA    . VAL B 1 239 ? 16.855 -26.134 -22.424 1.00 106.51 ? 236 VAL B CA    1 
ATOM   3837 C  C     . VAL B 1 239 ? 15.880 -26.948 -21.536 1.00 106.30 ? 236 VAL B C     1 
ATOM   3838 O  O     . VAL B 1 239 ? 16.189 -28.080 -21.155 1.00 105.97 ? 236 VAL B O     1 
ATOM   3839 C  CB    . VAL B 1 239 ? 17.062 -26.760 -23.836 1.00 110.17 ? 236 VAL B CB    1 
ATOM   3840 C  CG1   . VAL B 1 239 ? 15.733 -27.098 -24.506 1.00 109.96 ? 236 VAL B CG1   1 
ATOM   3841 C  CG2   . VAL B 1 239 ? 17.891 -25.840 -24.727 1.00 109.97 ? 236 VAL B CG2   1 
ATOM   3842 N  N     . GLY B 1 240 ? 14.740 -26.338 -21.200 1.00 106.30 ? 237 GLY B N     1 
ATOM   3843 C  CA    . GLY B 1 240 ? 13.710 -26.945 -20.359 1.00 106.07 ? 237 GLY B CA    1 
ATOM   3844 C  C     . GLY B 1 240 ? 13.716 -26.462 -18.919 1.00 105.86 ? 237 GLY B C     1 
ATOM   3845 O  O     . GLY B 1 240 ? 12.655 -26.157 -18.361 1.00 105.88 ? 237 GLY B O     1 
ATOM   3846 N  N     . ARG B 1 241 ? 14.924 -26.391 -18.309 1.00 103.95 ? 238 ARG B N     1 
ATOM   3847 C  CA    . ARG B 1 241 ? 15.165 -25.942 -16.924 1.00 103.31 ? 238 ARG B CA    1 
ATOM   3848 C  C     . ARG B 1 241 ? 16.295 -24.874 -16.921 1.00 102.74 ? 238 ARG B C     1 
ATOM   3849 O  O     . ARG B 1 241 ? 17.349 -25.111 -16.316 1.00 102.85 ? 238 ARG B O     1 
ATOM   3850 C  CB    . ARG B 1 241 ? 15.521 -27.154 -16.025 1.00 102.90 ? 238 ARG B CB    1 
ATOM   3851 C  CG    . ARG B 1 241 ? 16.529 -28.131 -16.641 1.00 102.90 ? 238 ARG B CG    1 
ATOM   3852 C  CD    . ARG B 1 241 ? 16.607 -29.439 -15.894 1.00 103.24 ? 238 ARG B CD    1 
ATOM   3853 N  NE    . ARG B 1 241 ? 17.426 -30.412 -16.617 1.00 103.42 ? 238 ARG B NE    1 
ATOM   3854 C  CZ    . ARG B 1 241 ? 17.732 -31.621 -16.157 1.00 103.20 ? 238 ARG B CZ    1 
ATOM   3855 N  NH1   . ARG B 1 241 ? 17.294 -32.017 -14.966 1.00 103.07 ? 238 ARG B NH1   1 
ATOM   3856 N  NH2   . ARG B 1 241 ? 18.482 -32.442 -16.881 1.00 102.62 ? 238 ARG B NH2   1 
ATOM   3857 N  N     . PRO B 1 242 ? 16.121 -23.698 -17.595 1.00 99.51  ? 239 PRO B N     1 
ATOM   3858 C  CA    . PRO B 1 242 ? 17.230 -22.718 -17.649 1.00 98.90  ? 239 PRO B CA    1 
ATOM   3859 C  C     . PRO B 1 242 ? 17.557 -22.005 -16.348 1.00 98.15  ? 239 PRO B C     1 
ATOM   3860 O  O     . PRO B 1 242 ? 18.587 -21.339 -16.248 1.00 98.16  ? 239 PRO B O     1 
ATOM   3861 C  CB    . PRO B 1 242 ? 16.792 -21.736 -18.741 1.00 100.25 ? 239 PRO B CB    1 
ATOM   3862 C  CG    . PRO B 1 242 ? 15.328 -21.841 -18.787 1.00 100.42 ? 239 PRO B CG    1 
ATOM   3863 C  CD    . PRO B 1 242 ? 14.958 -23.233 -18.383 1.00 100.87 ? 239 PRO B CD    1 
ATOM   3864 N  N     . THR B 1 243 ? 16.681 -22.159 -15.365 1.00 96.34  ? 240 THR B N     1 
ATOM   3865 C  CA    . THR B 1 243 ? 16.791 -21.535 -14.061 1.00 95.37  ? 240 THR B CA    1 
ATOM   3866 C  C     . THR B 1 243 ? 17.180 -22.542 -12.961 1.00 94.26  ? 240 THR B C     1 
ATOM   3867 O  O     . THR B 1 243 ? 17.187 -22.174 -11.780 1.00 94.05  ? 240 THR B O     1 
ATOM   3868 C  CB    . THR B 1 243 ? 15.486 -20.772 -13.780 1.00 99.84  ? 240 THR B CB    1 
ATOM   3869 O  OG1   . THR B 1 243 ? 15.676 -19.948 -12.635 1.00 100.16 ? 240 THR B OG1   1 
ATOM   3870 C  CG2   . THR B 1 243 ? 14.279 -21.699 -13.591 1.00 100.18 ? 240 THR B CG2   1 
ATOM   3871 N  N     . LYS B 1 244 ? 17.507 -23.798 -13.341 1.00 90.90  ? 241 LYS B N     1 
ATOM   3872 C  CA    . LYS B 1 244 ? 17.867 -24.848 -12.385 1.00 89.36  ? 241 LYS B CA    1 
ATOM   3873 C  C     . LYS B 1 244 ? 19.307 -25.380 -12.542 1.00 88.16  ? 241 LYS B C     1 
ATOM   3874 O  O     . LYS B 1 244 ? 19.625 -26.442 -11.995 1.00 88.32  ? 241 LYS B O     1 
ATOM   3875 C  CB    . LYS B 1 244 ? 16.831 -25.991 -12.455 1.00 91.33  ? 241 LYS B CB    1 
ATOM   3876 N  N     . TRP B 1 245 ? 20.179 -24.636 -13.254 1.00 85.59  ? 242 TRP B N     1 
ATOM   3877 C  CA    . TRP B 1 245 ? 21.560 -25.055 -13.509 1.00 84.11  ? 242 TRP B CA    1 
ATOM   3878 C  C     . TRP B 1 245 ? 22.498 -25.045 -12.295 1.00 83.61  ? 242 TRP B C     1 
ATOM   3879 O  O     . TRP B 1 245 ? 23.493 -25.775 -12.326 1.00 83.28  ? 242 TRP B O     1 
ATOM   3880 C  CB    . TRP B 1 245 ? 22.196 -24.280 -14.662 1.00 82.13  ? 242 TRP B CB    1 
ATOM   3881 C  CG    . TRP B 1 245 ? 22.241 -22.790 -14.519 1.00 80.61  ? 242 TRP B CG    1 
ATOM   3882 C  CD1   . TRP B 1 245 ? 21.351 -21.895 -15.035 1.00 80.00  ? 242 TRP B CD1   1 
ATOM   3883 C  CD2   . TRP B 1 245 ? 23.301 -22.015 -13.941 1.00 78.81  ? 242 TRP B CD2   1 
ATOM   3884 N  NE1   . TRP B 1 245 ? 21.773 -20.609 -14.786 1.00 78.58  ? 242 TRP B NE1   1 
ATOM   3885 C  CE2   . TRP B 1 245 ? 22.966 -20.653 -14.112 1.00 78.16  ? 242 TRP B CE2   1 
ATOM   3886 C  CE3   . TRP B 1 245 ? 24.502 -22.338 -13.284 1.00 78.22  ? 242 TRP B CE3   1 
ATOM   3887 C  CZ2   . TRP B 1 245 ? 23.774 -19.615 -13.627 1.00 77.83  ? 242 TRP B CZ2   1 
ATOM   3888 C  CZ3   . TRP B 1 245 ? 25.301 -21.308 -12.804 1.00 78.26  ? 242 TRP B CZ3   1 
ATOM   3889 C  CH2   . TRP B 1 245 ? 24.938 -19.966 -12.978 1.00 77.74  ? 242 TRP B CH2   1 
ATOM   3890 N  N     . TYR B 1 246 ? 22.208 -24.251 -11.242 1.00 82.32  ? 243 TYR B N     1 
ATOM   3891 C  CA    . TYR B 1 246 ? 23.046 -24.190 -10.038 1.00 81.51  ? 243 TYR B CA    1 
ATOM   3892 C  C     . TYR B 1 246 ? 23.185 -25.591 -9.400  1.00 80.74  ? 243 TYR B C     1 
ATOM   3893 O  O     . TYR B 1 246 ? 24.293 -25.989 -9.009  1.00 80.49  ? 243 TYR B O     1 
ATOM   3894 C  CB    . TYR B 1 246 ? 22.502 -23.155 -9.013  1.00 82.37  ? 243 TYR B CB    1 
ATOM   3895 C  CG    . TYR B 1 246 ? 23.292 -23.109 -7.718  1.00 83.32  ? 243 TYR B CG    1 
ATOM   3896 C  CD1   . TYR B 1 246 ? 22.960 -23.933 -6.643  1.00 84.59  ? 243 TYR B CD1   1 
ATOM   3897 C  CD2   . TYR B 1 246 ? 24.388 -22.263 -7.577  1.00 84.33  ? 243 TYR B CD2   1 
ATOM   3898 C  CE1   . TYR B 1 246 ? 23.712 -23.930 -5.467  1.00 85.91  ? 243 TYR B CE1   1 
ATOM   3899 C  CE2   . TYR B 1 246 ? 25.140 -22.244 -6.404  1.00 85.48  ? 243 TYR B CE2   1 
ATOM   3900 C  CZ    . TYR B 1 246 ? 24.800 -23.080 -5.350  1.00 87.08  ? 243 TYR B CZ    1 
ATOM   3901 O  OH    . TYR B 1 246 ? 25.539 -23.052 -4.187  1.00 87.59  ? 243 TYR B OH    1 
ATOM   3902 N  N     . ASP B 1 247 ? 22.066 -26.324 -9.298  1.00 79.48  ? 244 ASP B N     1 
ATOM   3903 C  CA    . ASP B 1 247 ? 22.036 -27.658 -8.707  1.00 79.23  ? 244 ASP B CA    1 
ATOM   3904 C  C     . ASP B 1 247 ? 22.659 -28.712 -9.593  1.00 78.20  ? 244 ASP B C     1 
ATOM   3905 O  O     . ASP B 1 247 ? 23.102 -29.757 -9.096  1.00 77.93  ? 244 ASP B O     1 
ATOM   3906 C  CB    . ASP B 1 247 ? 20.599 -28.059 -8.344  1.00 82.09  ? 244 ASP B CB    1 
ATOM   3907 C  CG    . ASP B 1 247 ? 19.952 -27.149 -7.325  1.00 84.58  ? 244 ASP B CG    1 
ATOM   3908 O  OD1   . ASP B 1 247 ? 20.619 -26.820 -6.304  1.00 85.99  ? 244 ASP B OD1   1 
ATOM   3909 O  OD2   . ASP B 1 247 ? 18.782 -26.764 -7.537  1.00 88.33  ? 244 ASP B OD2   1 
ATOM   3910 N  N     . LEU B 1 248 ? 22.684 -28.448 -10.910 1.00 77.07  ? 245 LEU B N     1 
ATOM   3911 C  CA    . LEU B 1 248 ? 23.225 -29.385 -11.883 1.00 75.92  ? 245 LEU B CA    1 
ATOM   3912 C  C     . LEU B 1 248 ? 24.741 -29.295 -12.054 1.00 74.41  ? 245 LEU B C     1 
ATOM   3913 O  O     . LEU B 1 248 ? 25.331 -30.259 -12.546 1.00 74.19  ? 245 LEU B O     1 
ATOM   3914 C  CB    . LEU B 1 248 ? 22.487 -29.272 -13.221 1.00 75.96  ? 245 LEU B CB    1 
ATOM   3915 C  CG    . LEU B 1 248 ? 21.059 -29.833 -13.189 1.00 77.55  ? 245 LEU B CG    1 
ATOM   3916 C  CD1   . LEU B 1 248 ? 20.358 -29.594 -14.487 1.00 78.41  ? 245 LEU B CD1   1 
ATOM   3917 C  CD2   . LEU B 1 248 ? 21.043 -31.329 -12.872 1.00 77.43  ? 245 LEU B CD2   1 
ATOM   3918 N  N     . LEU B 1 249 ? 25.381 -28.187 -11.602 1.00 71.24  ? 246 LEU B N     1 
ATOM   3919 C  CA    . LEU B 1 249 ? 26.835 -28.023 -11.712 1.00 70.27  ? 246 LEU B CA    1 
ATOM   3920 C  C     . LEU B 1 249 ? 27.606 -29.257 -11.191 1.00 69.52  ? 246 LEU B C     1 
ATOM   3921 O  O     . LEU B 1 249 ? 28.445 -29.738 -11.958 1.00 69.54  ? 246 LEU B O     1 
ATOM   3922 C  CB    . LEU B 1 249 ? 27.357 -26.707 -11.114 1.00 70.22  ? 246 LEU B CB    1 
ATOM   3923 C  CG    . LEU B 1 249 ? 26.908 -25.435 -11.844 1.00 70.71  ? 246 LEU B CG    1 
ATOM   3924 C  CD1   . LEU B 1 249 ? 26.983 -24.253 -10.936 1.00 72.12  ? 246 LEU B CD1   1 
ATOM   3925 C  CD2   . LEU B 1 249 ? 27.719 -25.172 -13.104 1.00 70.67  ? 246 LEU B CD2   1 
ATOM   3926 N  N     . PRO B 1 250 ? 27.308 -29.862 -10.002 1.00 67.60  ? 247 PRO B N     1 
ATOM   3927 C  CA    . PRO B 1 250 ? 28.040 -31.090 -9.596  1.00 67.22  ? 247 PRO B CA    1 
ATOM   3928 C  C     . PRO B 1 250 ? 27.928 -32.255 -10.589 1.00 66.95  ? 247 PRO B C     1 
ATOM   3929 O  O     . PRO B 1 250 ? 28.952 -32.867 -10.916 1.00 66.37  ? 247 PRO B O     1 
ATOM   3930 C  CB    . PRO B 1 250 ? 27.401 -31.467 -8.255  1.00 68.24  ? 247 PRO B CB    1 
ATOM   3931 C  CG    . PRO B 1 250 ? 26.828 -30.210 -7.743  1.00 68.94  ? 247 PRO B CG    1 
ATOM   3932 C  CD    . PRO B 1 250 ? 26.355 -29.454 -8.951  1.00 69.01  ? 247 PRO B CD    1 
ATOM   3933 N  N     . VAL B 1 251 ? 26.703 -32.557 -11.102 1.00 67.06  ? 248 VAL B N     1 
ATOM   3934 C  CA    . VAL B 1 251 ? 26.546 -33.672 -12.051 1.00 67.10  ? 248 VAL B CA    1 
ATOM   3935 C  C     . VAL B 1 251 ? 27.231 -33.343 -13.398 1.00 66.44  ? 248 VAL B C     1 
ATOM   3936 O  O     . VAL B 1 251 ? 27.818 -34.241 -14.000 1.00 66.51  ? 248 VAL B O     1 
ATOM   3937 C  CB    . VAL B 1 251 ? 25.099 -34.214 -12.195 1.00 69.92  ? 248 VAL B CB    1 
ATOM   3938 C  CG1   . VAL B 1 251 ? 24.156 -33.222 -12.865 1.00 70.88  ? 248 VAL B CG1   1 
ATOM   3939 C  CG2   . VAL B 1 251 ? 25.088 -35.561 -12.905 1.00 70.45  ? 248 VAL B CG2   1 
ATOM   3940 N  N     . VAL B 1 252 ? 27.217 -32.068 -13.821 1.00 63.96  ? 249 VAL B N     1 
ATOM   3941 C  CA    . VAL B 1 252 ? 27.870 -31.614 -15.052 1.00 64.14  ? 249 VAL B CA    1 
ATOM   3942 C  C     . VAL B 1 252 ? 29.381 -31.885 -14.961 1.00 64.31  ? 249 VAL B C     1 
ATOM   3943 O  O     . VAL B 1 252 ? 29.946 -32.402 -15.913 1.00 64.34  ? 249 VAL B O     1 
ATOM   3944 C  CB    . VAL B 1 252 ? 27.525 -30.138 -15.368 1.00 66.30  ? 249 VAL B CB    1 
ATOM   3945 C  CG1   . VAL B 1 252 ? 28.383 -29.588 -16.498 1.00 64.97  ? 249 VAL B CG1   1 
ATOM   3946 C  CG2   . VAL B 1 252 ? 26.043 -29.987 -15.705 1.00 66.00  ? 249 VAL B CG2   1 
ATOM   3947 N  N     . GLN B 1 253 ? 30.017 -31.593 -13.802 1.00 64.95  ? 250 GLN B N     1 
ATOM   3948 C  CA    . GLN B 1 253 ? 31.447 -31.822 -13.557 1.00 64.65  ? 250 GLN B CA    1 
ATOM   3949 C  C     . GLN B 1 253 ? 31.816 -33.310 -13.524 1.00 64.01  ? 250 GLN B C     1 
ATOM   3950 O  O     . GLN B 1 253 ? 32.855 -33.690 -14.060 1.00 64.51  ? 250 GLN B O     1 
ATOM   3951 C  CB    . GLN B 1 253 ? 31.867 -31.179 -12.244 1.00 67.24  ? 250 GLN B CB    1 
ATOM   3952 C  CG    . GLN B 1 253 ? 32.326 -29.761 -12.394 1.00 67.91  ? 250 GLN B CG    1 
ATOM   3953 C  CD    . GLN B 1 253 ? 32.408 -29.105 -11.045 1.00 67.84  ? 250 GLN B CD    1 
ATOM   3954 O  OE1   . GLN B 1 253 ? 31.392 -28.673 -10.482 1.00 69.97  ? 250 GLN B OE1   1 
ATOM   3955 N  NE2   . GLN B 1 253 ? 33.610 -29.038 -10.480 1.00 66.32  ? 250 GLN B NE2   1 
ATOM   3956 N  N     . LEU B 1 254 ? 30.989 -34.150 -12.877 1.00 63.01  ? 251 LEU B N     1 
ATOM   3957 C  CA    . LEU B 1 254 ? 31.268 -35.587 -12.809 1.00 63.05  ? 251 LEU B CA    1 
ATOM   3958 C  C     . LEU B 1 254 ? 31.229 -36.158 -14.205 1.00 62.33  ? 251 LEU B C     1 
ATOM   3959 O  O     . LEU B 1 254 ? 32.117 -36.937 -14.558 1.00 62.26  ? 251 LEU B O     1 
ATOM   3960 C  CB    . LEU B 1 254 ? 30.304 -36.326 -11.885 1.00 62.89  ? 251 LEU B CB    1 
ATOM   3961 C  CG    . LEU B 1 254 ? 30.513 -36.078 -10.399 1.00 64.51  ? 251 LEU B CG    1 
ATOM   3962 C  CD1   . LEU B 1 254 ? 29.259 -36.383 -9.632  1.00 63.62  ? 251 LEU B CD1   1 
ATOM   3963 C  CD2   . LEU B 1 254 ? 31.693 -36.891 -9.852  1.00 64.83  ? 251 LEU B CD2   1 
ATOM   3964 N  N     . ALA B 1 255 ? 30.234 -35.708 -15.025 1.00 59.67  ? 252 ALA B N     1 
ATOM   3965 C  CA    . ALA B 1 255 ? 30.062 -36.105 -16.429 1.00 59.82  ? 252 ALA B CA    1 
ATOM   3966 C  C     . ALA B 1 255 ? 31.345 -35.772 -17.162 1.00 59.32  ? 252 ALA B C     1 
ATOM   3967 O  O     . ALA B 1 255 ? 32.041 -36.675 -17.594 1.00 58.76  ? 252 ALA B O     1 
ATOM   3968 C  CB    . ALA B 1 255 ? 28.891 -35.359 -17.053 1.00 59.50  ? 252 ALA B CB    1 
ATOM   3969 N  N     . LEU B 1 256 ? 31.694 -34.481 -17.215 1.00 59.15  ? 253 LEU B N     1 
ATOM   3970 C  CA    . LEU B 1 256 ? 32.879 -33.936 -17.856 1.00 59.97  ? 253 LEU B CA    1 
ATOM   3971 C  C     . LEU B 1 256 ? 34.160 -34.613 -17.471 1.00 60.60  ? 253 LEU B C     1 
ATOM   3972 O  O     . LEU B 1 256 ? 34.992 -34.834 -18.346 1.00 61.30  ? 253 LEU B O     1 
ATOM   3973 C  CB    . LEU B 1 256 ? 33.006 -32.449 -17.527 1.00 59.59  ? 253 LEU B CB    1 
ATOM   3974 C  CG    . LEU B 1 256 ? 32.034 -31.501 -18.199 1.00 60.54  ? 253 LEU B CG    1 
ATOM   3975 C  CD1   . LEU B 1 256 ? 32.027 -30.173 -17.480 1.00 59.40  ? 253 LEU B CD1   1 
ATOM   3976 C  CD2   . LEU B 1 256 ? 32.361 -31.320 -19.694 1.00 60.49  ? 253 LEU B CD2   1 
ATOM   3977 N  N     . ASN B 1 257 ? 34.342 -34.925 -16.166 1.00 62.89  ? 254 ASN B N     1 
ATOM   3978 C  CA    . ASN B 1 257 ? 35.576 -35.524 -15.631 1.00 63.17  ? 254 ASN B CA    1 
ATOM   3979 C  C     . ASN B 1 257 ? 35.662 -37.038 -15.753 1.00 63.27  ? 254 ASN B C     1 
ATOM   3980 O  O     . ASN B 1 257 ? 36.748 -37.592 -15.593 1.00 62.46  ? 254 ASN B O     1 
ATOM   3981 C  CB    . ASN B 1 257 ? 35.820 -35.075 -14.189 1.00 62.80  ? 254 ASN B CB    1 
ATOM   3982 C  CG    . ASN B 1 257 ? 36.159 -33.609 -14.111 1.00 62.48  ? 254 ASN B CG    1 
ATOM   3983 O  OD1   . ASN B 1 257 ? 36.990 -33.098 -14.877 1.00 60.97  ? 254 ASN B OD1   1 
ATOM   3984 N  ND2   . ASN B 1 257 ? 35.524 -32.902 -13.196 1.00 61.92  ? 254 ASN B ND2   1 
ATOM   3985 N  N     . ASN B 1 258 ? 34.543 -37.696 -16.038 1.00 65.23  ? 255 ASN B N     1 
ATOM   3986 C  CA    . ASN B 1 258 ? 34.509 -39.142 -16.225 1.00 67.69  ? 255 ASN B CA    1 
ATOM   3987 C  C     . ASN B 1 258 ? 34.271 -39.462 -17.709 1.00 69.51  ? 255 ASN B C     1 
ATOM   3988 O  O     . ASN B 1 258 ? 33.795 -40.536 -18.064 1.00 70.14  ? 255 ASN B O     1 
ATOM   3989 C  CB    . ASN B 1 258 ? 33.476 -39.773 -15.307 1.00 67.01  ? 255 ASN B CB    1 
ATOM   3990 C  CG    . ASN B 1 258 ? 33.938 -39.765 -13.880 1.00 67.14  ? 255 ASN B CG    1 
ATOM   3991 O  OD1   . ASN B 1 258 ? 34.644 -40.666 -13.461 1.00 67.92  ? 255 ASN B OD1   1 
ATOM   3992 N  ND2   . ASN B 1 258 ? 33.571 -38.747 -13.106 1.00 63.71  ? 255 ASN B ND2   1 
ATOM   3993 N  N     . THR B 1 259 ? 34.636 -38.501 -18.568 1.00 75.38  ? 256 THR B N     1 
ATOM   3994 C  CA    . THR B 1 259 ? 34.503 -38.552 -20.014 1.00 77.28  ? 256 THR B CA    1 
ATOM   3995 C  C     . THR B 1 259 ? 35.830 -39.001 -20.600 1.00 78.56  ? 256 THR B C     1 
ATOM   3996 O  O     . THR B 1 259 ? 36.848 -38.323 -20.433 1.00 78.17  ? 256 THR B O     1 
ATOM   3997 C  CB    . THR B 1 259 ? 33.950 -37.196 -20.529 1.00 83.47  ? 256 THR B CB    1 
ATOM   3998 O  OG1   . THR B 1 259 ? 32.558 -37.112 -20.198 1.00 84.29  ? 256 THR B OG1   1 
ATOM   3999 C  CG2   . THR B 1 259 ? 34.131 -36.994 -22.032 1.00 83.41  ? 256 THR B CG2   1 
ATOM   4000 N  N     . TYR B 1 260 ? 35.809 -40.156 -21.273 1.00 82.83  ? 257 TYR B N     1 
ATOM   4001 C  CA    . TYR B 1 260 ? 36.971 -40.767 -21.907 1.00 85.25  ? 257 TYR B CA    1 
ATOM   4002 C  C     . TYR B 1 260 ? 37.661 -39.828 -22.933 1.00 85.39  ? 257 TYR B C     1 
ATOM   4003 O  O     . TYR B 1 260 ? 36.982 -39.152 -23.711 1.00 85.54  ? 257 TYR B O     1 
ATOM   4004 C  CB    . TYR B 1 260 ? 36.565 -42.133 -22.512 1.00 88.38  ? 257 TYR B CB    1 
ATOM   4005 C  CG    . TYR B 1 260 ? 37.586 -42.762 -23.437 1.00 92.33  ? 257 TYR B CG    1 
ATOM   4006 C  CD1   . TYR B 1 260 ? 38.660 -43.489 -22.933 1.00 95.45  ? 257 TYR B CD1   1 
ATOM   4007 C  CD2   . TYR B 1 260 ? 37.463 -42.653 -24.824 1.00 94.72  ? 257 TYR B CD2   1 
ATOM   4008 C  CE1   . TYR B 1 260 ? 39.595 -44.086 -23.784 1.00 97.67  ? 257 TYR B CE1   1 
ATOM   4009 C  CE2   . TYR B 1 260 ? 38.396 -43.239 -25.683 1.00 95.96  ? 257 TYR B CE2   1 
ATOM   4010 C  CZ    . TYR B 1 260 ? 39.464 -43.953 -25.157 1.00 97.95  ? 257 TYR B CZ    1 
ATOM   4011 O  OH    . TYR B 1 260 ? 40.395 -44.532 -25.991 1.00 99.98  ? 257 TYR B OH    1 
ATOM   4012 N  N     . SER B 1 261 ? 39.013 -39.790 -22.901 1.00 86.96  ? 258 SER B N     1 
ATOM   4013 C  CA    . SER B 1 261 ? 39.852 -38.995 -23.801 1.00 87.50  ? 258 SER B CA    1 
ATOM   4014 C  C     . SER B 1 261 ? 40.428 -39.882 -24.938 1.00 88.54  ? 258 SER B C     1 
ATOM   4015 O  O     . SER B 1 261 ? 41.267 -40.770 -24.678 1.00 88.12  ? 258 SER B O     1 
ATOM   4016 C  CB    . SER B 1 261 ? 40.973 -38.298 -23.032 1.00 90.66  ? 258 SER B CB    1 
ATOM   4017 O  OG    . SER B 1 261 ? 42.018 -37.851 -23.883 1.00 88.87  ? 258 SER B OG    1 
ATOM   4018 N  N     . PRO B 1 262 ? 39.981 -39.644 -26.205 1.00 91.42  ? 259 PRO B N     1 
ATOM   4019 C  CA    . PRO B 1 262 ? 40.492 -40.453 -27.337 1.00 92.06  ? 259 PRO B CA    1 
ATOM   4020 C  C     . PRO B 1 262 ? 42.020 -40.419 -27.488 1.00 92.77  ? 259 PRO B C     1 
ATOM   4021 O  O     . PRO B 1 262 ? 42.643 -41.475 -27.683 1.00 93.02  ? 259 PRO B O     1 
ATOM   4022 C  CB    . PRO B 1 262 ? 39.797 -39.836 -28.554 1.00 93.38  ? 259 PRO B CB    1 
ATOM   4023 C  CG    . PRO B 1 262 ? 38.584 -39.136 -27.992 1.00 93.33  ? 259 PRO B CG    1 
ATOM   4024 C  CD    . PRO B 1 262 ? 38.995 -38.638 -26.660 1.00 93.06  ? 259 PRO B CD    1 
ATOM   4025 N  N     . VAL B 1 263 ? 42.615 -39.202 -27.352 1.00 92.34  ? 260 VAL B N     1 
ATOM   4026 C  CA    . VAL B 1 263 ? 44.046 -38.938 -27.481 1.00 92.56  ? 260 VAL B CA    1 
ATOM   4027 C  C     . VAL B 1 263 ? 44.896 -39.588 -26.371 1.00 92.55  ? 260 VAL B C     1 
ATOM   4028 O  O     . VAL B 1 263 ? 45.983 -40.088 -26.676 1.00 92.90  ? 260 VAL B O     1 
ATOM   4029 C  CB    . VAL B 1 263 ? 44.339 -37.409 -27.622 1.00 96.37  ? 260 VAL B CB    1 
ATOM   4030 C  CG1   . VAL B 1 263 ? 44.266 -36.670 -26.285 1.00 97.39  ? 260 VAL B CG1   1 
ATOM   4031 C  CG2   . VAL B 1 263 ? 45.681 -37.156 -28.295 1.00 96.17  ? 260 VAL B CG2   1 
ATOM   4032 N  N     . LEU B 1 264 ? 44.417 -39.575 -25.101 1.00 91.83  ? 261 LEU B N     1 
ATOM   4033 C  CA    . LEU B 1 264 ? 45.179 -40.086 -23.953 1.00 90.97  ? 261 LEU B CA    1 
ATOM   4034 C  C     . LEU B 1 264 ? 44.783 -41.481 -23.431 1.00 89.86  ? 261 LEU B C     1 
ATOM   4035 O  O     . LEU B 1 264 ? 45.555 -42.036 -22.636 1.00 89.91  ? 261 LEU B O     1 
ATOM   4036 C  CB    . LEU B 1 264 ? 45.145 -39.066 -22.786 1.00 91.08  ? 261 LEU B CB    1 
ATOM   4037 C  CG    . LEU B 1 264 ? 46.016 -37.807 -22.926 1.00 91.56  ? 261 LEU B CG    1 
ATOM   4038 C  CD1   . LEU B 1 264 ? 45.431 -36.671 -22.157 1.00 91.45  ? 261 LEU B CD1   1 
ATOM   4039 C  CD2   . LEU B 1 264 ? 47.423 -38.035 -22.404 1.00 92.15  ? 261 LEU B CD2   1 
ATOM   4040 N  N     . LYS B 1 265 ? 43.613 -42.044 -23.849 1.00 86.19  ? 262 LYS B N     1 
ATOM   4041 C  CA    . LYS B 1 265 ? 43.130 -43.371 -23.409 1.00 84.84  ? 262 LYS B CA    1 
ATOM   4042 C  C     . LYS B 1 265 ? 42.496 -43.341 -21.985 1.00 82.73  ? 262 LYS B C     1 
ATOM   4043 O  O     . LYS B 1 265 ? 41.848 -44.317 -21.575 1.00 82.92  ? 262 LYS B O     1 
ATOM   4044 C  CB    . LYS B 1 265 ? 44.250 -44.459 -23.519 1.00 89.77  ? 262 LYS B CB    1 
ATOM   4045 C  CG    . LYS B 1 265 ? 43.829 -45.924 -23.239 1.00 93.05  ? 262 LYS B CG    1 
ATOM   4046 C  CD    . LYS B 1 265 ? 44.741 -46.652 -22.200 1.00 97.53  ? 262 LYS B CD    1 
ATOM   4047 C  CE    . LYS B 1 265 ? 44.272 -48.056 -21.835 1.00 99.41  ? 262 LYS B CE    1 
ATOM   4048 N  NZ    . LYS B 1 265 ? 43.084 -48.050 -20.924 1.00 100.59 ? 262 LYS B NZ    1 
ATOM   4049 N  N     . TYR B 1 266 ? 42.668 -42.229 -21.242 1.00 77.22  ? 263 TYR B N     1 
ATOM   4050 C  CA    . TYR B 1 266 ? 42.145 -42.106 -19.881 1.00 74.35  ? 263 TYR B CA    1 
ATOM   4051 C  C     . TYR B 1 266 ? 41.305 -40.883 -19.702 1.00 72.62  ? 263 TYR B C     1 
ATOM   4052 O  O     . TYR B 1 266 ? 41.513 -39.913 -20.425 1.00 72.17  ? 263 TYR B O     1 
ATOM   4053 C  CB    . TYR B 1 266 ? 43.295 -42.058 -18.879 1.00 75.00  ? 263 TYR B CB    1 
ATOM   4054 C  CG    . TYR B 1 266 ? 44.180 -43.282 -18.891 1.00 75.15  ? 263 TYR B CG    1 
ATOM   4055 C  CD1   . TYR B 1 266 ? 43.727 -44.502 -18.389 1.00 75.94  ? 263 TYR B CD1   1 
ATOM   4056 C  CD2   . TYR B 1 266 ? 45.485 -43.218 -19.374 1.00 76.80  ? 263 TYR B CD2   1 
ATOM   4057 C  CE1   . TYR B 1 266 ? 44.542 -45.631 -18.389 1.00 76.76  ? 263 TYR B CE1   1 
ATOM   4058 C  CE2   . TYR B 1 266 ? 46.314 -44.339 -19.367 1.00 77.57  ? 263 TYR B CE2   1 
ATOM   4059 C  CZ    . TYR B 1 266 ? 45.837 -45.544 -18.873 1.00 77.89  ? 263 TYR B CZ    1 
ATOM   4060 O  OH    . TYR B 1 266 ? 46.648 -46.649 -18.840 1.00 78.39  ? 263 TYR B OH    1 
ATOM   4061 N  N     . THR B 1 267 ? 40.368 -40.919 -18.726 1.00 68.41  ? 264 THR B N     1 
ATOM   4062 C  CA    . THR B 1 267 ? 39.473 -39.807 -18.366 1.00 66.31  ? 264 THR B CA    1 
ATOM   4063 C  C     . THR B 1 267 ? 40.246 -38.782 -17.484 1.00 64.52  ? 264 THR B C     1 
ATOM   4064 O  O     . THR B 1 267 ? 41.229 -39.185 -16.842 1.00 64.86  ? 264 THR B O     1 
ATOM   4065 C  CB    . THR B 1 267 ? 38.264 -40.311 -17.511 1.00 68.15  ? 264 THR B CB    1 
ATOM   4066 O  OG1   . THR B 1 267 ? 38.712 -40.816 -16.247 1.00 68.09  ? 264 THR B OG1   1 
ATOM   4067 C  CG2   . THR B 1 267 ? 37.387 -41.317 -18.220 1.00 66.67  ? 264 THR B CG2   1 
ATOM   4068 N  N     . PRO B 1 268 ? 39.812 -37.496 -17.364 1.00 63.92  ? 265 PRO B N     1 
ATOM   4069 C  CA    . PRO B 1 268 ? 40.521 -36.566 -16.453 1.00 63.21  ? 265 PRO B CA    1 
ATOM   4070 C  C     . PRO B 1 268 ? 40.615 -37.066 -14.997 1.00 62.20  ? 265 PRO B C     1 
ATOM   4071 O  O     . PRO B 1 268 ? 41.635 -36.834 -14.360 1.00 61.32  ? 265 PRO B O     1 
ATOM   4072 C  CB    . PRO B 1 268 ? 39.714 -35.274 -16.564 1.00 64.93  ? 265 PRO B CB    1 
ATOM   4073 C  CG    . PRO B 1 268 ? 39.008 -35.366 -17.856 1.00 65.16  ? 265 PRO B CG    1 
ATOM   4074 C  CD    . PRO B 1 268 ? 38.683 -36.817 -18.029 1.00 65.77  ? 265 PRO B CD    1 
ATOM   4075 N  N     . HIS B 1 269 ? 39.593 -37.791 -14.490 1.00 60.50  ? 266 HIS B N     1 
ATOM   4076 C  CA    . HIS B 1 269 ? 39.601 -38.376 -13.146 1.00 61.17  ? 266 HIS B CA    1 
ATOM   4077 C  C     . HIS B 1 269 ? 40.759 -39.365 -13.006 1.00 61.63  ? 266 HIS B C     1 
ATOM   4078 O  O     . HIS B 1 269 ? 41.458 -39.364 -11.991 1.00 62.19  ? 266 HIS B O     1 
ATOM   4079 C  CB    . HIS B 1 269 ? 38.284 -39.104 -12.866 1.00 61.68  ? 266 HIS B CB    1 
ATOM   4080 C  CG    . HIS B 1 269 ? 38.245 -39.820 -11.547 1.00 63.65  ? 266 HIS B CG    1 
ATOM   4081 N  ND1   . HIS B 1 269 ? 37.545 -39.303 -10.462 1.00 64.02  ? 266 HIS B ND1   1 
ATOM   4082 C  CD2   . HIS B 1 269 ? 38.809 -40.996 -11.181 1.00 62.20  ? 266 HIS B CD2   1 
ATOM   4083 C  CE1   . HIS B 1 269 ? 37.710 -40.176 -9.481  1.00 62.84  ? 266 HIS B CE1   1 
ATOM   4084 N  NE2   . HIS B 1 269 ? 38.468 -41.207 -9.863  1.00 63.13  ? 266 HIS B NE2   1 
ATOM   4085 N  N     . GLN B 1 270 ? 40.954 -40.219 -14.009 1.00 61.68  ? 267 GLN B N     1 
ATOM   4086 C  CA    . GLN B 1 270 ? 42.016 -41.210 -13.964 1.00 61.25  ? 267 GLN B CA    1 
ATOM   4087 C  C     . GLN B 1 270 ? 43.371 -40.553 -13.948 1.00 60.54  ? 267 GLN B C     1 
ATOM   4088 O  O     . GLN B 1 270 ? 44.231 -40.972 -13.187 1.00 60.09  ? 267 GLN B O     1 
ATOM   4089 C  CB    . GLN B 1 270 ? 41.908 -42.164 -15.146 1.00 63.07  ? 267 GLN B CB    1 
ATOM   4090 C  CG    . GLN B 1 270 ? 40.757 -43.125 -14.985 1.00 64.23  ? 267 GLN B CG    1 
ATOM   4091 C  CD    . GLN B 1 270 ? 40.510 -43.975 -16.196 1.00 66.75  ? 267 GLN B CD    1 
ATOM   4092 O  OE1   . GLN B 1 270 ? 40.561 -43.524 -17.343 1.00 68.06  ? 267 GLN B OE1   1 
ATOM   4093 N  NE2   . GLN B 1 270 ? 40.222 -45.230 -15.953 1.00 67.15  ? 267 GLN B NE2   1 
ATOM   4094 N  N     . LEU B 1 271 ? 43.567 -39.521 -14.776 1.00 58.32  ? 268 LEU B N     1 
ATOM   4095 C  CA    . LEU B 1 271 ? 44.835 -38.809 -14.875 1.00 57.99  ? 268 LEU B CA    1 
ATOM   4096 C  C     . LEU B 1 271 ? 45.191 -37.997 -13.626 1.00 57.51  ? 268 LEU B C     1 
ATOM   4097 O  O     . LEU B 1 271 ? 46.375 -37.795 -13.323 1.00 57.23  ? 268 LEU B O     1 
ATOM   4098 C  CB    . LEU B 1 271 ? 44.788 -37.909 -16.100 1.00 58.02  ? 268 LEU B CB    1 
ATOM   4099 C  CG    . LEU B 1 271 ? 44.835 -38.599 -17.452 1.00 59.50  ? 268 LEU B CG    1 
ATOM   4100 C  CD1   . LEU B 1 271 ? 44.549 -37.612 -18.539 1.00 56.98  ? 268 LEU B CD1   1 
ATOM   4101 C  CD2   . LEU B 1 271 ? 46.209 -39.268 -17.689 1.00 57.71  ? 268 LEU B CD2   1 
ATOM   4102 N  N     . LEU B 1 272 ? 44.169 -37.541 -12.897 1.00 56.77  ? 269 LEU B N     1 
ATOM   4103 C  CA    . LEU B 1 272 ? 44.383 -36.753 -11.692 1.00 56.98  ? 269 LEU B CA    1 
ATOM   4104 C  C     . LEU B 1 272 ? 44.606 -37.628 -10.450 1.00 56.87  ? 269 LEU B C     1 
ATOM   4105 O  O     . LEU B 1 272 ? 45.469 -37.299 -9.646  1.00 57.41  ? 269 LEU B O     1 
ATOM   4106 C  CB    . LEU B 1 272 ? 43.212 -35.756 -11.486 1.00 55.81  ? 269 LEU B CB    1 
ATOM   4107 C  CG    . LEU B 1 272 ? 43.375 -34.663 -10.405 1.00 55.69  ? 269 LEU B CG    1 
ATOM   4108 C  CD1   . LEU B 1 272 ? 44.584 -33.765 -10.668 1.00 53.44  ? 269 LEU B CD1   1 
ATOM   4109 C  CD2   . LEU B 1 272 ? 42.132 -33.785 -10.332 1.00 55.20  ? 269 LEU B CD2   1 
ATOM   4110 N  N     . PHE B 1 273 ? 43.841 -38.732 -10.291 1.00 58.51  ? 270 PHE B N     1 
ATOM   4111 C  CA    . PHE B 1 273 ? 43.947 -39.571 -9.103  1.00 58.07  ? 270 PHE B CA    1 
ATOM   4112 C  C     . PHE B 1 273 ? 44.659 -40.907 -9.287  1.00 58.41  ? 270 PHE B C     1 
ATOM   4113 O  O     . PHE B 1 273 ? 45.026 -41.515 -8.281  1.00 58.47  ? 270 PHE B O     1 
ATOM   4114 C  CB    . PHE B 1 273 ? 42.558 -39.794 -8.480  1.00 59.53  ? 270 PHE B CB    1 
ATOM   4115 C  CG    . PHE B 1 273 ? 41.763 -38.524 -8.266  1.00 58.32  ? 270 PHE B CG    1 
ATOM   4116 C  CD1   . PHE B 1 273 ? 42.158 -37.585 -7.313  1.00 56.43  ? 270 PHE B CD1   1 
ATOM   4117 C  CD2   . PHE B 1 273 ? 40.626 -38.262 -9.016  1.00 53.31  ? 270 PHE B CD2   1 
ATOM   4118 C  CE1   . PHE B 1 273 ? 41.435 -36.397 -7.131  1.00 53.67  ? 270 PHE B CE1   1 
ATOM   4119 C  CE2   . PHE B 1 273 ? 39.899 -37.077 -8.828  1.00 54.17  ? 270 PHE B CE2   1 
ATOM   4120 C  CZ    . PHE B 1 273 ? 40.311 -36.152 -7.892  1.00 53.95  ? 270 PHE B CZ    1 
ATOM   4121 N  N     . GLY B 1 274 ? 44.859 -41.358 -10.525 1.00 60.70  ? 271 GLY B N     1 
ATOM   4122 C  CA    . GLY B 1 274 ? 45.523 -42.628 -10.826 1.00 60.90  ? 271 GLY B CA    1 
ATOM   4123 C  C     . GLY B 1 274 ? 44.715 -43.852 -10.432 1.00 61.06  ? 271 GLY B C     1 
ATOM   4124 O  O     . GLY B 1 274 ? 45.285 -44.884 -10.082 1.00 60.44  ? 271 GLY B O     1 
ATOM   4125 N  N     . ILE B 1 275 ? 43.376 -43.727 -10.465 1.00 63.72  ? 272 ILE B N     1 
ATOM   4126 C  CA    . ILE B 1 275 ? 42.381 -44.758 -10.122 1.00 64.81  ? 272 ILE B CA    1 
ATOM   4127 C  C     . ILE B 1 275 ? 41.133 -44.594 -11.016 1.00 65.88  ? 272 ILE B C     1 
ATOM   4128 O  O     . ILE B 1 275 ? 40.912 -43.525 -11.598 1.00 66.28  ? 272 ILE B O     1 
ATOM   4129 C  CB    . ILE B 1 275 ? 41.964 -44.733 -8.594  1.00 67.63  ? 272 ILE B CB    1 
ATOM   4130 C  CG1   . ILE B 1 275 ? 41.492 -43.327 -8.129  1.00 66.86  ? 272 ILE B CG1   1 
ATOM   4131 C  CG2   . ILE B 1 275 ? 43.062 -45.270 -7.681  1.00 66.08  ? 272 ILE B CG2   1 
ATOM   4132 C  CD1   . ILE B 1 275 ? 40.283 -43.303 -7.264  1.00 66.31  ? 272 ILE B CD1   1 
ATOM   4133 N  N     . ASP B 1 276 ? 40.313 -45.655 -11.100 1.00 67.08  ? 273 ASP B N     1 
ATOM   4134 C  CA    . ASP B 1 276 ? 39.051 -45.635 -11.832 1.00 69.12  ? 273 ASP B CA    1 
ATOM   4135 C  C     . ASP B 1 276 ? 38.070 -44.923 -10.886 1.00 69.58  ? 273 ASP B C     1 
ATOM   4136 O  O     . ASP B 1 276 ? 38.346 -44.788 -9.690  1.00 69.79  ? 273 ASP B O     1 
ATOM   4137 C  CB    . ASP B 1 276 ? 38.560 -47.067 -12.151 1.00 72.44  ? 273 ASP B CB    1 
ATOM   4138 C  CG    . ASP B 1 276 ? 39.231 -47.824 -13.306 1.00 75.27  ? 273 ASP B CG    1 
ATOM   4139 O  OD1   . ASP B 1 276 ? 40.106 -47.234 -13.994 1.00 76.52  ? 273 ASP B OD1   1 
ATOM   4140 O  OD2   . ASP B 1 276 ? 38.877 -49.006 -13.524 1.00 79.10  ? 273 ASP B OD2   1 
ATOM   4141 N  N     . SER B 1 277 ? 36.954 -44.451 -11.413 1.00 69.35  ? 274 SER B N     1 
ATOM   4142 C  CA    . SER B 1 277 ? 35.973 -43.720 -10.633 1.00 70.41  ? 274 SER B CA    1 
ATOM   4143 C  C     . SER B 1 277 ? 34.814 -44.592 -10.182 1.00 71.27  ? 274 SER B C     1 
ATOM   4144 O  O     . SER B 1 277 ? 34.610 -45.665 -10.732 1.00 71.49  ? 274 SER B O     1 
ATOM   4145 C  CB    . SER B 1 277 ? 35.469 -42.554 -11.465 1.00 73.88  ? 274 SER B CB    1 
ATOM   4146 O  OG    . SER B 1 277 ? 34.325 -41.943 -10.899 1.00 73.72  ? 274 SER B OG    1 
ATOM   4147 N  N     . ASN B 1 278 ? 34.051 -44.143 -9.199  1.00 70.92  ? 275 ASN B N     1 
ATOM   4148 C  CA    . ASN B 1 278 ? 32.892 -44.878 -8.712  1.00 72.44  ? 275 ASN B CA    1 
ATOM   4149 C  C     . ASN B 1 278 ? 31.662 -44.469 -9.513  1.00 74.03  ? 275 ASN B C     1 
ATOM   4150 O  O     . ASN B 1 278 ? 30.600 -45.068 -9.365  1.00 74.06  ? 275 ASN B O     1 
ATOM   4151 C  CB    . ASN B 1 278 ? 32.699 -44.670 -7.212  1.00 68.57  ? 275 ASN B CB    1 
ATOM   4152 C  CG    . ASN B 1 278 ? 33.934 -45.010 -6.430  1.00 67.12  ? 275 ASN B CG    1 
ATOM   4153 O  OD1   . ASN B 1 278 ? 34.543 -46.066 -6.610  1.00 64.17  ? 275 ASN B OD1   1 
ATOM   4154 N  ND2   . ASN B 1 278 ? 34.346 -44.112 -5.549  1.00 62.30  ? 275 ASN B ND2   1 
ATOM   4155 N  N     . THR B 1 279 ? 31.809 -43.440 -10.356 1.00 79.85  ? 276 THR B N     1 
ATOM   4156 C  CA    . THR B 1 279 ? 30.744 -42.941 -11.223 1.00 81.94  ? 276 THR B CA    1 
ATOM   4157 C  C     . THR B 1 279 ? 31.259 -42.949 -12.660 1.00 83.71  ? 276 THR B C     1 
ATOM   4158 O  O     . THR B 1 279 ? 31.651 -41.899 -13.168 1.00 84.11  ? 276 THR B O     1 
ATOM   4159 C  CB    . THR B 1 279 ? 30.181 -41.561 -10.793 1.00 77.95  ? 276 THR B CB    1 
ATOM   4160 O  OG1   . THR B 1 279 ? 31.203 -40.570 -10.844 1.00 78.13  ? 276 THR B OG1   1 
ATOM   4161 C  CG2   . THR B 1 279 ? 29.511 -41.584 -9.436  1.00 77.23  ? 276 THR B CG2   1 
ATOM   4162 N  N     . PRO B 1 280 ? 31.311 -44.121 -13.333 1.00 91.62  ? 277 PRO B N     1 
ATOM   4163 C  CA    . PRO B 1 280 ? 31.780 -44.132 -14.733 1.00 92.82  ? 277 PRO B CA    1 
ATOM   4164 C  C     . PRO B 1 280 ? 30.634 -43.686 -15.651 1.00 93.69  ? 277 PRO B C     1 
ATOM   4165 O  O     . PRO B 1 280 ? 29.508 -44.188 -15.534 1.00 94.10  ? 277 PRO B O     1 
ATOM   4166 C  CB    . PRO B 1 280 ? 32.200 -45.591 -14.962 1.00 94.80  ? 277 PRO B CB    1 
ATOM   4167 C  CG    . PRO B 1 280 ? 31.878 -46.336 -13.636 1.00 94.53  ? 277 PRO B CG    1 
ATOM   4168 C  CD    . PRO B 1 280 ? 30.910 -45.474 -12.897 1.00 93.67  ? 277 PRO B CD    1 
ATOM   4169 N  N     . PHE B 1 281 ? 30.893 -42.707 -16.527 1.00 98.67  ? 278 PHE B N     1 
ATOM   4170 C  CA    . PHE B 1 281 ? 29.832 -42.220 -17.404 1.00 108.81 ? 278 PHE B CA    1 
ATOM   4171 C  C     . PHE B 1 281 ? 29.931 -42.926 -18.739 1.00 112.82 ? 278 PHE B C     1 
ATOM   4172 O  O     . PHE B 1 281 ? 30.291 -42.338 -19.763 1.00 117.02 ? 278 PHE B O     1 
ATOM   4173 C  CB    . PHE B 1 281 ? 29.791 -40.676 -17.474 1.00 110.39 ? 278 PHE B CB    1 
ATOM   4174 C  CG    . PHE B 1 281 ? 29.147 -40.020 -16.261 1.00 114.21 ? 278 PHE B CG    1 
ATOM   4175 C  CD1   . PHE B 1 281 ? 29.691 -40.177 -14.986 1.00 113.34 ? 278 PHE B CD1   1 
ATOM   4176 C  CD2   . PHE B 1 281 ? 28.011 -39.231 -16.397 1.00 107.02 ? 278 PHE B CD2   1 
ATOM   4177 C  CE1   . PHE B 1 281 ? 29.099 -39.577 -13.869 1.00 105.06 ? 278 PHE B CE1   1 
ATOM   4178 C  CE2   . PHE B 1 281 ? 27.426 -38.621 -15.278 1.00 110.92 ? 278 PHE B CE2   1 
ATOM   4179 C  CZ    . PHE B 1 281 ? 27.973 -38.801 -14.023 1.00 108.00 ? 278 PHE B CZ    1 
ATOM   4180 N  N     . ALA B 1 282 ? 29.626 -44.243 -18.680 1.00 118.68 ? 279 ALA B N     1 
ATOM   4181 C  CA    . ALA B 1 282 ? 29.627 -45.210 -19.777 1.00 122.60 ? 279 ALA B CA    1 
ATOM   4182 C  C     . ALA B 1 282 ? 28.548 -44.860 -20.815 1.00 125.11 ? 279 ALA B C     1 
ATOM   4183 O  O     . ALA B 1 282 ? 28.781 -45.020 -22.021 1.00 121.94 ? 279 ALA B O     1 
ATOM   4184 C  CB    . ALA B 1 282 ? 29.411 -46.615 -19.226 1.00 123.18 ? 279 ALA B CB    1 
ATOM   4185 N  N     . ASN B 1 283 ? 27.378 -44.359 -20.337 1.00 129.23 ? 280 ASN B N     1 
ATOM   4186 C  CA    . ASN B 1 283 ? 26.244 -43.939 -21.166 1.00 137.15 ? 280 ASN B CA    1 
ATOM   4187 C  C     . ASN B 1 283 ? 26.585 -42.599 -21.872 1.00 146.44 ? 280 ASN B C     1 
ATOM   4188 O  O     . ASN B 1 283 ? 26.039 -41.542 -21.526 1.00 148.95 ? 280 ASN B O     1 
ATOM   4189 C  CB    . ASN B 1 283 ? 24.948 -43.843 -20.318 1.00 139.09 ? 280 ASN B CB    1 
ATOM   4190 C  CG    . ASN B 1 283 ? 23.948 -44.980 -20.482 1.00 139.26 ? 280 ASN B CG    1 
ATOM   4191 O  OD1   . ASN B 1 283 ? 24.085 -45.875 -21.331 1.00 140.13 ? 280 ASN B OD1   1 
ATOM   4192 N  ND2   . ASN B 1 283 ? 22.900 -44.962 -19.663 1.00 133.73 ? 280 ASN B ND2   1 
ATOM   4193 N  N     . GLN B 1 284 ? 27.519 -42.664 -22.856 1.00 148.96 ? 281 GLN B N     1 
ATOM   4194 C  CA    . GLN B 1 284 ? 27.991 -41.528 -23.650 1.00 147.10 ? 281 GLN B CA    1 
ATOM   4195 C  C     . GLN B 1 284 ? 26.823 -40.997 -24.482 1.00 155.52 ? 281 GLN B C     1 
ATOM   4196 O  O     . GLN B 1 284 ? 26.390 -41.643 -25.444 1.00 158.05 ? 281 GLN B O     1 
ATOM   4197 C  CB    . GLN B 1 284 ? 29.183 -41.936 -24.531 1.00 148.33 ? 281 GLN B CB    1 
ATOM   4198 N  N     . ASP B 1 285 ? 26.287 -39.833 -24.063 1.00 157.26 ? 282 ASP B N     1 
ATOM   4199 C  CA    . ASP B 1 285 ? 25.139 -39.177 -24.689 1.00 147.63 ? 282 ASP B CA    1 
ATOM   4200 C  C     . ASP B 1 285 ? 25.495 -38.336 -25.929 1.00 141.57 ? 282 ASP B C     1 
ATOM   4201 O  O     . ASP B 1 285 ? 26.672 -38.196 -26.279 1.00 140.16 ? 282 ASP B O     1 
ATOM   4202 C  CB    . ASP B 1 285 ? 24.353 -38.353 -23.652 1.00 149.56 ? 282 ASP B CB    1 
ATOM   4203 C  CG    . ASP B 1 285 ? 22.850 -38.485 -23.806 1.00 150.06 ? 282 ASP B CG    1 
ATOM   4204 O  OD1   . ASP B 1 285 ? 22.324 -39.599 -23.576 1.00 138.30 ? 282 ASP B OD1   1 
ATOM   4205 O  OD2   . ASP B 1 285 ? 22.199 -37.476 -24.159 1.00 159.81 ? 282 ASP B OD2   1 
ATOM   4206 N  N     . THR B 1 286 ? 24.446 -37.795 -26.590 1.00 141.66 ? 283 THR B N     1 
ATOM   4207 C  CA    . THR B 1 286 ? 24.473 -36.993 -27.818 1.00 137.36 ? 283 THR B CA    1 
ATOM   4208 C  C     . THR B 1 286 ? 25.313 -35.707 -27.749 1.00 134.78 ? 283 THR B C     1 
ATOM   4209 O  O     . THR B 1 286 ? 26.246 -35.556 -28.548 1.00 135.54 ? 283 THR B O     1 
ATOM   4210 C  CB    . THR B 1 286 ? 23.032 -36.657 -28.288 1.00 145.52 ? 283 THR B CB    1 
ATOM   4211 O  OG1   . THR B 1 286 ? 22.392 -35.835 -27.311 1.00 140.80 ? 283 THR B OG1   1 
ATOM   4212 C  CG2   . THR B 1 286 ? 22.182 -37.899 -28.570 1.00 143.81 ? 283 THR B CG2   1 
ATOM   4213 N  N     . LEU B 1 287 ? 24.953 -34.775 -26.822 1.00 133.04 ? 284 LEU B N     1 
ATOM   4214 C  CA    . LEU B 1 287 ? 25.542 -33.439 -26.607 1.00 124.13 ? 284 LEU B CA    1 
ATOM   4215 C  C     . LEU B 1 287 ? 24.947 -32.460 -27.630 1.00 128.26 ? 284 LEU B C     1 
ATOM   4216 O  O     . LEU B 1 287 ? 24.994 -31.246 -27.433 1.00 131.00 ? 284 LEU B O     1 
ATOM   4217 C  CB    . LEU B 1 287 ? 27.088 -33.423 -26.624 1.00 123.75 ? 284 LEU B CB    1 
ATOM   4218 C  CG    . LEU B 1 287 ? 27.792 -32.653 -25.506 1.00 120.34 ? 284 LEU B CG    1 
ATOM   4219 C  CD1   . LEU B 1 287 ? 27.808 -33.444 -24.210 1.00 116.60 ? 284 LEU B CD1   1 
ATOM   4220 C  CD2   . LEU B 1 287 ? 29.221 -32.349 -25.891 1.00 117.51 ? 284 LEU B CD2   1 
ATOM   4221 N  N     . ASP B 1 288 ? 24.366 -33.009 -28.712 1.00 128.94 ? 285 ASP B N     1 
ATOM   4222 C  CA    . ASP B 1 288 ? 23.693 -32.290 -29.793 1.00 128.35 ? 285 ASP B CA    1 
ATOM   4223 C  C     . ASP B 1 288 ? 22.207 -32.207 -29.440 1.00 121.88 ? 285 ASP B C     1 
ATOM   4224 O  O     . ASP B 1 288 ? 21.667 -33.119 -28.807 1.00 113.97 ? 285 ASP B O     1 
ATOM   4225 C  CB    . ASP B 1 288 ? 23.891 -33.010 -31.138 1.00 130.81 ? 285 ASP B CB    1 
ATOM   4226 C  CG    . ASP B 1 288 ? 25.332 -33.044 -31.608 1.00 129.08 ? 285 ASP B CG    1 
ATOM   4227 O  OD1   . ASP B 1 288 ? 25.800 -32.022 -32.164 1.00 123.67 ? 285 ASP B OD1   1 
ATOM   4228 O  OD2   . ASP B 1 288 ? 25.994 -34.094 -31.420 1.00 127.77 ? 285 ASP B OD2   1 
ATOM   4229 N  N     . LEU B 1 289 ? 21.554 -31.117 -29.844 1.00 121.14 ? 286 LEU B N     1 
ATOM   4230 C  CA    . LEU B 1 289 ? 20.143 -30.862 -29.543 1.00 127.52 ? 286 LEU B CA    1 
ATOM   4231 C  C     . LEU B 1 289 ? 19.153 -31.588 -30.466 1.00 136.34 ? 286 LEU B C     1 
ATOM   4232 O  O     . LEU B 1 289 ? 19.332 -31.587 -31.690 1.00 141.23 ? 286 LEU B O     1 
ATOM   4233 C  CB    . LEU B 1 289 ? 19.866 -29.345 -29.529 1.00 127.61 ? 286 LEU B CB    1 
ATOM   4234 C  CG    . LEU B 1 289 ? 20.929 -28.473 -28.848 1.00 128.26 ? 286 LEU B CG    1 
ATOM   4235 C  CD1   . LEU B 1 289 ? 21.629 -27.576 -29.854 1.00 126.90 ? 286 LEU B CD1   1 
ATOM   4236 C  CD2   . LEU B 1 289 ? 20.339 -27.673 -27.707 1.00 122.94 ? 286 LEU B CD2   1 
ATOM   4237 N  N     . THR B 1 290 ? 18.101 -32.199 -29.867 1.00 134.78 ? 287 THR B N     1 
ATOM   4238 C  CA    . THR B 1 290 ? 17.029 -32.907 -30.587 1.00 124.96 ? 287 THR B CA    1 
ATOM   4239 C  C     . THR B 1 290 ? 16.106 -31.854 -31.204 1.00 131.03 ? 287 THR B C     1 
ATOM   4240 O  O     . THR B 1 290 ? 16.032 -30.750 -30.671 1.00 124.33 ? 287 THR B O     1 
ATOM   4241 C  CB    . THR B 1 290 ? 16.242 -33.859 -29.655 1.00 128.39 ? 287 THR B CB    1 
ATOM   4242 O  OG1   . THR B 1 290 ? 15.420 -33.109 -28.759 1.00 124.28 ? 287 THR B OG1   1 
ATOM   4243 C  CG2   . THR B 1 290 ? 17.140 -34.827 -28.890 1.00 122.39 ? 287 THR B CG2   1 
ATOM   4244 N  N     . ARG B 1 291 ? 15.396 -32.184 -32.306 1.00 130.28 ? 288 ARG B N     1 
ATOM   4245 C  CA    . ARG B 1 291 ? 14.482 -31.251 -32.989 1.00 133.76 ? 288 ARG B CA    1 
ATOM   4246 C  C     . ARG B 1 291 ? 13.442 -30.626 -32.032 1.00 134.26 ? 288 ARG B C     1 
ATOM   4247 O  O     . ARG B 1 291 ? 13.035 -29.478 -32.230 1.00 127.82 ? 288 ARG B O     1 
ATOM   4248 C  CB    . ARG B 1 291 ? 13.828 -31.899 -34.225 1.00 133.87 ? 288 ARG B CB    1 
ATOM   4249 C  CG    . ARG B 1 291 ? 12.831 -33.034 -33.949 1.00 135.50 ? 288 ARG B CG    1 
ATOM   4250 C  CD    . ARG B 1 291 ? 11.397 -32.611 -34.238 1.00 129.07 ? 288 ARG B CD    1 
ATOM   4251 N  NE    . ARG B 1 291 ? 11.287 -31.933 -35.533 1.00 132.65 ? 288 ARG B NE    1 
ATOM   4252 C  CZ    . ARG B 1 291 ? 10.449 -30.935 -35.797 1.00 130.53 ? 288 ARG B CZ    1 
ATOM   4253 N  NH1   . ARG B 1 291 ? 9.614  -30.494 -34.862 1.00 123.69 ? 288 ARG B NH1   1 
ATOM   4254 N  NH2   . ARG B 1 291 ? 10.437 -30.371 -36.998 1.00 121.68 ? 288 ARG B NH2   1 
ATOM   4255 N  N     . GLU B 1 292 ? 13.058 -31.382 -30.980 1.00 132.48 ? 289 GLU B N     1 
ATOM   4256 C  CA    . GLU B 1 292 ? 12.127 -30.966 -29.939 1.00 136.28 ? 289 GLU B CA    1 
ATOM   4257 C  C     . GLU B 1 292 ? 12.817 -29.918 -29.049 1.00 135.41 ? 289 GLU B C     1 
ATOM   4258 O  O     . GLU B 1 292 ? 12.223 -28.869 -28.789 1.00 132.04 ? 289 GLU B O     1 
ATOM   4259 C  CB    . GLU B 1 292 ? 11.673 -32.182 -29.117 1.00 137.71 ? 289 GLU B CB    1 
ATOM   4260 C  CG    . GLU B 1 292 ? 10.165 -32.309 -29.009 1.00 141.29 ? 289 GLU B CG    1 
ATOM   4261 C  CD    . GLU B 1 292 ? 9.608  -32.007 -27.631 1.00 147.47 ? 289 GLU B CD    1 
ATOM   4262 O  OE1   . GLU B 1 292 ? 9.733  -32.877 -26.738 1.00 143.03 ? 289 GLU B OE1   1 
ATOM   4263 O  OE2   . GLU B 1 292 ? 9.046  -30.904 -27.445 1.00 148.93 ? 289 GLU B OE2   1 
ATOM   4264 N  N     . GLU B 1 293 ? 14.083 -30.194 -28.617 1.00 132.84 ? 290 GLU B N     1 
ATOM   4265 C  CA    . GLU B 1 293 ? 14.917 -29.305 -27.786 1.00 127.58 ? 290 GLU B CA    1 
ATOM   4266 C  C     . GLU B 1 293 ? 15.285 -28.034 -28.554 1.00 128.26 ? 290 GLU B C     1 
ATOM   4267 O  O     . GLU B 1 293 ? 15.365 -26.969 -27.947 1.00 129.17 ? 290 GLU B O     1 
ATOM   4268 C  CB    . GLU B 1 293 ? 16.209 -30.007 -27.340 1.00 128.26 ? 290 GLU B CB    1 
ATOM   4269 C  CG    . GLU B 1 293 ? 16.041 -31.018 -26.222 1.00 127.14 ? 290 GLU B CG    1 
ATOM   4270 C  CD    . GLU B 1 293 ? 17.246 -31.908 -25.979 1.00 138.81 ? 290 GLU B CD    1 
ATOM   4271 O  OE1   . GLU B 1 293 ? 18.006 -32.168 -26.940 1.00 144.37 ? 290 GLU B OE1   1 
ATOM   4272 O  OE2   . GLU B 1 293 ? 17.428 -32.354 -24.823 1.00 140.27 ? 290 GLU B OE2   1 
ATOM   4273 N  N     . GLU B 1 294 ? 15.515 -28.159 -29.885 1.00 128.24 ? 291 GLU B N     1 
ATOM   4274 C  CA    . GLU B 1 294 ? 15.869 -27.082 -30.813 1.00 134.28 ? 291 GLU B CA    1 
ATOM   4275 C  C     . GLU B 1 294 ? 14.755 -26.037 -30.876 1.00 138.62 ? 291 GLU B C     1 
ATOM   4276 O  O     . GLU B 1 294 ? 15.034 -24.845 -30.724 1.00 136.32 ? 291 GLU B O     1 
ATOM   4277 C  CB    . GLU B 1 294 ? 16.179 -27.639 -32.217 1.00 135.53 ? 291 GLU B CB    1 
ATOM   4278 C  CG    . GLU B 1 294 ? 17.550 -28.290 -32.323 1.00 137.06 ? 291 GLU B CG    1 
ATOM   4279 C  CD    . GLU B 1 294 ? 18.228 -28.295 -33.683 1.00 139.35 ? 291 GLU B CD    1 
ATOM   4280 O  OE1   . GLU B 1 294 ? 17.997 -27.354 -34.478 1.00 136.23 ? 291 GLU B OE1   1 
ATOM   4281 O  OE2   . GLU B 1 294 ? 19.011 -29.237 -33.946 1.00 135.35 ? 291 GLU B OE2   1 
ATOM   4282 N  N     . LEU B 1 295 ? 13.495 -26.491 -31.078 1.00 139.02 ? 292 LEU B N     1 
ATOM   4283 C  CA    . LEU B 1 295 ? 12.307 -25.635 -31.143 1.00 143.79 ? 292 LEU B CA    1 
ATOM   4284 C  C     . LEU B 1 295 ? 11.999 -25.040 -29.761 1.00 142.72 ? 292 LEU B C     1 
ATOM   4285 O  O     . LEU B 1 295 ? 11.578 -23.883 -29.676 1.00 147.21 ? 292 LEU B O     1 
ATOM   4286 C  CB    . LEU B 1 295 ? 11.101 -26.416 -31.685 1.00 143.78 ? 292 LEU B CB    1 
ATOM   4287 N  N     . SER B 1 296 ? 12.231 -25.832 -28.683 1.00 142.59 ? 293 SER B N     1 
ATOM   4288 C  CA    . SER B 1 296 ? 12.024 -25.423 -27.289 1.00 143.60 ? 293 SER B CA    1 
ATOM   4289 C  C     . SER B 1 296 ? 13.051 -24.360 -26.886 1.00 143.85 ? 293 SER B C     1 
ATOM   4290 O  O     . SER B 1 296 ? 12.727 -23.489 -26.075 1.00 146.37 ? 293 SER B O     1 
ATOM   4291 C  CB    . SER B 1 296 ? 12.106 -26.622 -26.348 1.00 147.19 ? 293 SER B CB    1 
ATOM   4292 O  OG    . SER B 1 296 ? 11.075 -27.564 -26.602 1.00 143.91 ? 293 SER B OG    1 
ATOM   4293 N  N     . LEU B 1 297 ? 14.281 -24.429 -27.466 1.00 143.61 ? 294 LEU B N     1 
ATOM   4294 C  CA    . LEU B 1 297 ? 15.384 -23.484 -27.235 1.00 145.87 ? 294 LEU B CA    1 
ATOM   4295 C  C     . LEU B 1 297 ? 15.075 -22.125 -27.881 1.00 149.41 ? 294 LEU B C     1 
ATOM   4296 O  O     . LEU B 1 297 ? 15.279 -21.092 -27.243 1.00 148.34 ? 294 LEU B O     1 
ATOM   4297 C  CB    . LEU B 1 297 ? 16.721 -24.029 -27.770 1.00 145.84 ? 294 LEU B CB    1 
ATOM   4298 N  N     . LEU B 1 298 ? 14.570 -22.133 -29.137 1.00 148.71 ? 295 LEU B N     1 
ATOM   4299 C  CA    . LEU B 1 298 ? 14.200 -20.930 -29.893 1.00 148.55 ? 295 LEU B CA    1 
ATOM   4300 C  C     . LEU B 1 298 ? 12.939 -20.262 -29.307 1.00 154.25 ? 295 LEU B C     1 
ATOM   4301 O  O     . LEU B 1 298 ? 12.724 -19.067 -29.531 1.00 152.65 ? 295 LEU B O     1 
ATOM   4302 C  CB    . LEU B 1 298 ? 14.022 -21.247 -31.393 1.00 148.50 ? 295 LEU B CB    1 
ATOM   4303 C  CG    . LEU B 1 298 ? 15.281 -21.699 -32.161 1.00 145.33 ? 295 LEU B CG    1 
ATOM   4304 C  CD1   . LEU B 1 298 ? 14.916 -22.564 -33.351 1.00 139.87 ? 295 LEU B CD1   1 
ATOM   4305 C  CD2   . LEU B 1 298 ? 16.125 -20.511 -32.616 1.00 141.23 ? 295 LEU B CD2   1 
ATOM   4306 N  N     . GLN B 1 299 ? 12.124 -21.037 -28.543 1.00 153.73 ? 296 GLN B N     1 
ATOM   4307 C  CA    . GLN B 1 299 ? 10.903 -20.581 -27.864 1.00 154.88 ? 296 GLN B CA    1 
ATOM   4308 C  C     . GLN B 1 299 ? 11.278 -19.685 -26.672 1.00 156.85 ? 296 GLN B C     1 
ATOM   4309 O  O     . GLN B 1 299 ? 10.598 -18.685 -26.420 1.00 157.72 ? 296 GLN B O     1 
ATOM   4310 C  CB    . GLN B 1 299 ? 10.057 -21.776 -27.394 1.00 156.21 ? 296 GLN B CB    1 
ATOM   4311 N  N     . GLU B 1 300 ? 12.375 -20.046 -25.955 1.00 155.54 ? 297 GLU B N     1 
ATOM   4312 C  CA    . GLU B 1 300 ? 12.933 -19.312 -24.808 1.00 148.30 ? 297 GLU B CA    1 
ATOM   4313 C  C     . GLU B 1 300 ? 13.480 -17.958 -25.283 1.00 147.97 ? 297 GLU B C     1 
ATOM   4314 O  O     . GLU B 1 300 ? 13.408 -16.975 -24.537 1.00 149.56 ? 297 GLU B O     1 
ATOM   4315 C  CB    . GLU B 1 300 ? 14.040 -20.131 -24.122 1.00 149.60 ? 297 GLU B CB    1 
ATOM   4316 C  CG    . GLU B 1 300 ? 13.513 -21.260 -23.250 1.00 144.43 ? 297 GLU B CG    1 
ATOM   4317 C  CD    . GLU B 1 300 ? 14.502 -22.358 -22.903 1.00 139.73 ? 297 GLU B CD    1 
ATOM   4318 O  OE1   . GLU B 1 300 ? 15.652 -22.037 -22.525 1.00 137.13 ? 297 GLU B OE1   1 
ATOM   4319 O  OE2   . GLU B 1 300 ? 14.118 -23.547 -22.999 1.00 133.09 ? 297 GLU B OE2   1 
ATOM   4320 N  N     . ILE B 1 301 ? 14.003 -17.916 -26.543 1.00 146.10 ? 298 ILE B N     1 
ATOM   4321 C  CA    . ILE B 1 301 ? 14.537 -16.730 -27.235 1.00 140.17 ? 298 ILE B CA    1 
ATOM   4322 C  C     . ILE B 1 301 ? 13.294 -15.889 -27.665 1.00 143.17 ? 298 ILE B C     1 
ATOM   4323 O  O     . ILE B 1 301 ? 12.925 -15.846 -28.847 1.00 137.46 ? 298 ILE B O     1 
ATOM   4324 C  CB    . ILE B 1 301 ? 15.477 -17.129 -28.442 1.00 143.18 ? 298 ILE B CB    1 
ATOM   4325 C  CG1   . ILE B 1 301 ? 16.537 -18.218 -28.061 1.00 134.76 ? 298 ILE B CG1   1 
ATOM   4326 C  CG2   . ILE B 1 301 ? 16.143 -15.907 -29.106 1.00 145.15 ? 298 ILE B CG2   1 
ATOM   4327 C  CD1   . ILE B 1 301 ? 17.757 -17.816 -27.148 1.00 126.91 ? 298 ILE B CD1   1 
ATOM   4328 N  N     . ARG B 1 302 ? 12.633 -15.267 -26.657 1.00 140.03 ? 299 ARG B N     1 
ATOM   4329 C  CA    . ARG B 1 302 ? 11.430 -14.432 -26.761 1.00 133.58 ? 299 ARG B CA    1 
ATOM   4330 C  C     . ARG B 1 302 ? 11.190 -13.741 -25.418 1.00 125.50 ? 299 ARG B C     1 
ATOM   4331 O  O     . ARG B 1 302 ? 11.191 -14.397 -24.374 1.00 118.74 ? 299 ARG B O     1 
ATOM   4332 C  CB    . ARG B 1 302 ? 10.196 -15.276 -27.140 1.00 133.57 ? 299 ARG B CB    1 
ATOM   4333 O  "O5'" . DA  C 2 1   ? 24.724 -50.601 11.948  1.00 107.27 ? 1   DA  C "O5'" 1 
ATOM   4334 C  "C5'" . DA  C 2 1   ? 24.272 -51.971 11.963  1.00 107.19 ? 1   DA  C "C5'" 1 
ATOM   4335 C  "C4'" . DA  C 2 1   ? 25.347 -52.920 11.432  1.00 106.70 ? 1   DA  C "C4'" 1 
ATOM   4336 O  "O4'" . DA  C 2 1   ? 25.108 -54.262 11.927  1.00 107.12 ? 1   DA  C "O4'" 1 
ATOM   4337 C  "C3'" . DA  C 2 1   ? 25.450 -53.036 9.891   1.00 105.74 ? 1   DA  C "C3'" 1 
ATOM   4338 O  "O3'" . DA  C 2 1   ? 26.845 -52.854 9.466   1.00 103.73 ? 1   DA  C "O3'" 1 
ATOM   4339 C  "C2'" . DA  C 2 1   ? 24.959 -54.478 9.613   1.00 106.58 ? 1   DA  C "C2'" 1 
ATOM   4340 C  "C1'" . DA  C 2 1   ? 25.394 -55.171 10.893  1.00 107.21 ? 1   DA  C "C1'" 1 
ATOM   4341 N  N9    . DA  C 2 1   ? 24.773 -56.474 11.183  1.00 107.80 ? 1   DA  C N9    1 
ATOM   4342 C  C8    . DA  C 2 1   ? 25.297 -57.708 10.871  1.00 108.10 ? 1   DA  C C8    1 
ATOM   4343 N  N7    . DA  C 2 1   ? 24.614 -58.726 11.356  1.00 108.09 ? 1   DA  C N7    1 
ATOM   4344 C  C5    . DA  C 2 1   ? 23.580 -58.129 12.067  1.00 108.09 ? 1   DA  C C5    1 
ATOM   4345 C  C6    . DA  C 2 1   ? 22.492 -58.667 12.820  1.00 108.04 ? 1   DA  C C6    1 
ATOM   4346 N  N6    . DA  C 2 1   ? 22.277 -59.987 12.973  1.00 107.87 ? 1   DA  C N6    1 
ATOM   4347 N  N1    . DA  C 2 1   ? 21.633 -57.786 13.412  1.00 107.97 ? 1   DA  C N1    1 
ATOM   4348 C  C2    . DA  C 2 1   ? 21.850 -56.463 13.258  1.00 108.02 ? 1   DA  C C2    1 
ATOM   4349 N  N3    . DA  C 2 1   ? 22.832 -55.841 12.574  1.00 107.99 ? 1   DA  C N3    1 
ATOM   4350 C  C4    . DA  C 2 1   ? 23.674 -56.736 11.997  1.00 107.97 ? 1   DA  C C4    1 
ATOM   4351 P  P     . DT  C 2 2   ? 27.485 -51.377 9.170   1.00 101.29 ? 2   DT  C P     1 
ATOM   4352 O  OP1   . DT  C 2 2   ? 26.440 -50.321 9.350   1.00 100.75 ? 2   DT  C OP1   1 
ATOM   4353 O  OP2   . DT  C 2 2   ? 28.235 -51.456 7.884   1.00 101.32 ? 2   DT  C OP2   1 
ATOM   4354 O  "O5'" . DT  C 2 2   ? 28.564 -51.233 10.360  1.00 97.29  ? 2   DT  C "O5'" 1 
ATOM   4355 C  "C5'" . DT  C 2 2   ? 28.131 -50.926 11.710  1.00 91.69  ? 2   DT  C "C5'" 1 
ATOM   4356 C  "C4'" . DT  C 2 2   ? 29.101 -51.459 12.742  1.00 85.78  ? 2   DT  C "C4'" 1 
ATOM   4357 O  "O4'" . DT  C 2 2   ? 29.202 -52.899 12.647  1.00 85.45  ? 2   DT  C "O4'" 1 
ATOM   4358 C  "C3'" . DT  C 2 2   ? 30.517 -50.917 12.647  1.00 81.18  ? 2   DT  C "C3'" 1 
ATOM   4359 O  "O3'" . DT  C 2 2   ? 30.981 -50.653 13.939  1.00 74.71  ? 2   DT  C "O3'" 1 
ATOM   4360 C  "C2'" . DT  C 2 2   ? 31.296 -52.056 12.000  1.00 83.40  ? 2   DT  C "C2'" 1 
ATOM   4361 C  "C1'" . DT  C 2 2   ? 30.556 -53.279 12.515  1.00 86.40  ? 2   DT  C "C1'" 1 
ATOM   4362 N  N1    . DT  C 2 2   ? 30.662 -54.488 11.594  1.00 91.04  ? 2   DT  C N1    1 
ATOM   4363 C  C2    . DT  C 2 2   ? 31.874 -55.160 11.487  1.00 93.69  ? 2   DT  C C2    1 
ATOM   4364 O  O2    . DT  C 2 2   ? 32.882 -54.825 12.075  1.00 94.54  ? 2   DT  C O2    1 
ATOM   4365 N  N3    . DT  C 2 2   ? 31.868 -56.245 10.641  1.00 95.02  ? 2   DT  C N3    1 
ATOM   4366 C  C4    . DT  C 2 2   ? 30.805 -56.725 9.892   1.00 95.10  ? 2   DT  C C4    1 
ATOM   4367 O  O4    . DT  C 2 2   ? 30.978 -57.715 9.173   1.00 95.12  ? 2   DT  C O4    1 
ATOM   4368 C  C5    . DT  C 2 2   ? 29.557 -55.971 10.031  1.00 94.60  ? 2   DT  C C5    1 
ATOM   4369 C  C7    . DT  C 2 2   ? 28.327 -56.378 9.267   1.00 94.95  ? 2   DT  C C7    1 
ATOM   4370 C  C6    . DT  C 2 2   ? 29.550 -54.901 10.864  1.00 93.11  ? 2   DT  C C6    1 
ATOM   4371 P  P     . DT  C 2 3   ? 32.094 -49.558 14.232  1.00 67.52  ? 3   DT  C P     1 
ATOM   4372 O  OP1   . DT  C 2 3   ? 31.747 -48.935 15.521  1.00 68.25  ? 3   DT  C OP1   1 
ATOM   4373 O  OP2   . DT  C 2 3   ? 32.296 -48.720 13.045  1.00 66.54  ? 3   DT  C OP2   1 
ATOM   4374 O  "O5'" . DT  C 2 3   ? 33.385 -50.443 14.405  1.00 64.17  ? 3   DT  C "O5'" 1 
ATOM   4375 C  "C5'" . DT  C 2 3   ? 33.528 -51.293 15.523  1.00 61.85  ? 3   DT  C "C5'" 1 
ATOM   4376 C  "C4'" . DT  C 2 3   ? 34.901 -51.933 15.503  1.00 60.23  ? 3   DT  C "C4'" 1 
ATOM   4377 O  "O4'" . DT  C 2 3   ? 35.066 -52.673 14.267  1.00 59.95  ? 3   DT  C "O4'" 1 
ATOM   4378 C  "C3'" . DT  C 2 3   ? 36.087 -50.951 15.573  1.00 58.57  ? 3   DT  C "C3'" 1 
ATOM   4379 O  "O3'" . DT  C 2 3   ? 37.155 -51.550 16.279  1.00 57.04  ? 3   DT  C "O3'" 1 
ATOM   4380 C  "C2'" . DT  C 2 3   ? 36.462 -50.766 14.112  1.00 58.41  ? 3   DT  C "C2'" 1 
ATOM   4381 C  "C1'" . DT  C 2 3   ? 36.180 -52.163 13.552  1.00 59.11  ? 3   DT  C "C1'" 1 
ATOM   4382 N  N1    . DT  C 2 3   ? 35.886 -52.163 12.080  1.00 58.56  ? 3   DT  C N1    1 
ATOM   4383 C  C2    . DT  C 2 3   ? 36.644 -52.963 11.251  1.00 59.14  ? 3   DT  C C2    1 
ATOM   4384 O  O2    . DT  C 2 3   ? 37.503 -53.730 11.657  1.00 59.06  ? 3   DT  C O2    1 
ATOM   4385 N  N3    . DT  C 2 3   ? 36.365 -52.825 9.907   1.00 60.42  ? 3   DT  C N3    1 
ATOM   4386 C  C4    . DT  C 2 3   ? 35.430 -51.964 9.324   1.00 60.66  ? 3   DT  C C4    1 
ATOM   4387 O  O4    . DT  C 2 3   ? 35.290 -51.961 8.098   1.00 61.93  ? 3   DT  C O4    1 
ATOM   4388 C  C5    . DT  C 2 3   ? 34.682 -51.138 10.253  1.00 58.72  ? 3   DT  C C5    1 
ATOM   4389 C  C7    . DT  C 2 3   ? 33.653 -50.173 9.745   1.00 58.12  ? 3   DT  C C7    1 
ATOM   4390 C  C6    . DT  C 2 3   ? 34.948 -51.267 11.566  1.00 58.34  ? 3   DT  C C6    1 
ATOM   4391 P  P     . DG  C 2 4   ? 37.722 -50.900 17.608  1.00 54.75  ? 4   DG  C P     1 
ATOM   4392 O  OP1   . DG  C 2 4   ? 38.793 -51.782 18.094  1.00 54.64  ? 4   DG  C OP1   1 
ATOM   4393 O  OP2   . DG  C 2 4   ? 36.578 -50.570 18.483  1.00 54.48  ? 4   DG  C OP2   1 
ATOM   4394 O  "O5'" . DG  C 2 4   ? 38.356 -49.535 17.104  1.00 55.31  ? 4   DG  C "O5'" 1 
ATOM   4395 C  "C5'" . DG  C 2 4   ? 39.577 -49.513 16.401  1.00 55.27  ? 4   DG  C "C5'" 1 
ATOM   4396 C  "C4'" . DG  C 2 4   ? 39.836 -48.123 15.838  1.00 55.93  ? 4   DG  C "C4'" 1 
ATOM   4397 O  "O4'" . DG  C 2 4   ? 39.815 -47.126 16.900  1.00 57.09  ? 4   DG  C "O4'" 1 
ATOM   4398 C  "C3'" . DG  C 2 4   ? 41.166 -47.952 15.131  1.00 55.64  ? 4   DG  C "C3'" 1 
ATOM   4399 O  "O3'" . DG  C 2 4   ? 40.918 -47.384 13.869  1.00 55.05  ? 4   DG  C "O3'" 1 
ATOM   4400 C  "C2'" . DG  C 2 4   ? 41.974 -47.029 16.075  1.00 55.86  ? 4   DG  C "C2'" 1 
ATOM   4401 C  "C1'" . DG  C 2 4   ? 40.873 -46.214 16.715  1.00 56.17  ? 4   DG  C "C1'" 1 
ATOM   4402 N  N9    . DG  C 2 4   ? 41.213 -45.601 18.017  1.00 55.48  ? 4   DG  C N9    1 
ATOM   4403 C  C8    . DG  C 2 4   ? 41.411 -46.252 19.215  1.00 54.78  ? 4   DG  C C8    1 
ATOM   4404 N  N7    . DG  C 2 4   ? 41.625 -45.449 20.227  1.00 53.78  ? 4   DG  C N7    1 
ATOM   4405 C  C5    . DG  C 2 4   ? 41.526 -44.180 19.684  1.00 53.85  ? 4   DG  C C5    1 
ATOM   4406 C  C6    . DG  C 2 4   ? 41.661 -42.900 20.308  1.00 53.97  ? 4   DG  C C6    1 
ATOM   4407 O  O6    . DG  C 2 4   ? 41.904 -42.649 21.495  1.00 53.81  ? 4   DG  C O6    1 
ATOM   4408 N  N1    . DG  C 2 4   ? 41.478 -41.846 19.394  1.00 54.13  ? 4   DG  C N1    1 
ATOM   4409 C  C2    . DG  C 2 4   ? 41.229 -42.010 18.039  1.00 53.73  ? 4   DG  C C2    1 
ATOM   4410 N  N2    . DG  C 2 4   ? 41.103 -40.886 17.316  1.00 52.98  ? 4   DG  C N2    1 
ATOM   4411 N  N3    . DG  C 2 4   ? 41.081 -43.205 17.446  1.00 53.97  ? 4   DG  C N3    1 
ATOM   4412 C  C4    . DG  C 2 4   ? 41.258 -44.245 18.323  1.00 54.50  ? 4   DG  C C4    1 
ATOM   4413 P  P     . DT  C 2 5   ? 42.055 -47.284 12.768  1.00 56.93  ? 5   DT  C P     1 
ATOM   4414 O  OP1   . DT  C 2 5   ? 41.404 -47.149 11.443  1.00 58.04  ? 5   DT  C OP1   1 
ATOM   4415 O  OP2   . DT  C 2 5   ? 43.052 -48.355 12.987  1.00 56.73  ? 5   DT  C OP2   1 
ATOM   4416 O  "O5'" . DT  C 2 5   ? 42.746 -45.894 13.126  1.00 56.63  ? 5   DT  C "O5'" 1 
ATOM   4417 C  "C5'" . DT  C 2 5   ? 42.032 -44.665 12.963  1.00 55.83  ? 5   DT  C "C5'" 1 
ATOM   4418 C  "C4'" . DT  C 2 5   ? 42.927 -43.492 13.315  1.00 55.40  ? 5   DT  C "C4'" 1 
ATOM   4419 O  "O4'" . DT  C 2 5   ? 43.054 -43.404 14.734  1.00 54.36  ? 5   DT  C "O4'" 1 
ATOM   4420 C  "C3'" . DT  C 2 5   ? 44.362 -43.586 12.782  1.00 54.66  ? 5   DT  C "C3'" 1 
ATOM   4421 O  "O3'" . DT  C 2 5   ? 44.484 -42.734 11.641  1.00 54.35  ? 5   DT  C "O3'" 1 
ATOM   4422 C  "C2'" . DT  C 2 5   ? 45.253 -43.157 13.972  1.00 53.65  ? 5   DT  C "C2'" 1 
ATOM   4423 C  "C1'" . DT  C 2 5   ? 44.243 -42.749 15.036  1.00 53.58  ? 5   DT  C "C1'" 1 
ATOM   4424 N  N1    . DT  C 2 5   ? 44.586 -43.092 16.454  1.00 54.15  ? 5   DT  C N1    1 
ATOM   4425 C  C2    . DT  C 2 5   ? 44.608 -42.065 17.380  1.00 54.64  ? 5   DT  C C2    1 
ATOM   4426 O  O2    . DT  C 2 5   ? 44.519 -40.885 17.068  1.00 55.50  ? 5   DT  C O2    1 
ATOM   4427 N  N3    . DT  C 2 5   ? 44.792 -42.457 18.680  1.00 53.50  ? 5   DT  C N3    1 
ATOM   4428 C  C4    . DT  C 2 5   ? 44.914 -43.744 19.160  1.00 54.59  ? 5   DT  C C4    1 
ATOM   4429 O  O4    . DT  C 2 5   ? 45.069 -43.925 20.387  1.00 55.52  ? 5   DT  C O4    1 
ATOM   4430 C  C5    . DT  C 2 5   ? 44.831 -44.789 18.146  1.00 53.96  ? 5   DT  C C5    1 
ATOM   4431 C  C7    . DT  C 2 5   ? 44.952 -46.229 18.540  1.00 53.92  ? 5   DT  C C7    1 
ATOM   4432 C  C6    . DT  C 2 5   ? 44.637 -44.421 16.862  1.00 53.65  ? 5   DT  C C6    1 
ATOM   4433 P  P     . DC  C 2 6   ? 45.814 -42.683 10.771  1.00 54.47  ? 6   DC  C P     1 
ATOM   4434 O  OP1   . DC  C 2 6   ? 45.508 -42.021 9.484   1.00 54.37  ? 6   DC  C OP1   1 
ATOM   4435 O  OP2   . DC  C 2 6   ? 46.450 -44.013 10.796  1.00 55.32  ? 6   DC  C OP2   1 
ATOM   4436 O  "O5'" . DC  C 2 6   ? 46.724 -41.703 11.633  1.00 55.55  ? 6   DC  C "O5'" 1 
ATOM   4437 C  "C5'" . DC  C 2 6   ? 46.455 -40.299 11.686  1.00 53.40  ? 6   DC  C "C5'" 1 
ATOM   4438 C  "C4'" . DC  C 2 6   ? 47.438 -39.615 12.613  1.00 51.36  ? 6   DC  C "C4'" 1 
ATOM   4439 O  "O4'" . DC  C 2 6   ? 47.291 -40.112 13.960  1.00 50.11  ? 6   DC  C "O4'" 1 
ATOM   4440 C  "C3'" . DC  C 2 6   ? 48.904 -39.808 12.272  1.00 51.56  ? 6   DC  C "C3'" 1 
ATOM   4441 O  "O3'" . DC  C 2 6   ? 49.581 -38.583 12.566  1.00 53.66  ? 6   DC  C "O3'" 1 
ATOM   4442 C  "C2'" . DC  C 2 6   ? 49.321 -40.911 13.249  1.00 49.98  ? 6   DC  C "C2'" 1 
ATOM   4443 C  "C1'" . DC  C 2 6   ? 48.552 -40.451 14.454  1.00 50.03  ? 6   DC  C "C1'" 1 
ATOM   4444 N  N1    . DC  C 2 6   ? 48.421 -41.436 15.606  1.00 51.22  ? 6   DC  C N1    1 
ATOM   4445 C  C2    . DC  C 2 6   ? 48.320 -40.932 16.910  1.00 52.21  ? 6   DC  C C2    1 
ATOM   4446 O  O2    . DC  C 2 6   ? 48.327 -39.701 17.077  1.00 53.70  ? 6   DC  C O2    1 
ATOM   4447 N  N3    . DC  C 2 6   ? 48.210 -41.806 17.956  1.00 51.74  ? 6   DC  C N3    1 
ATOM   4448 C  C4    . DC  C 2 6   ? 48.174 -43.128 17.730  1.00 51.50  ? 6   DC  C C4    1 
ATOM   4449 N  N4    . DC  C 2 6   ? 48.075 -43.943 18.792  1.00 51.60  ? 6   DC  C N4    1 
ATOM   4450 C  C5    . DC  C 2 6   ? 48.291 -43.670 16.409  1.00 50.84  ? 6   DC  C C5    1 
ATOM   4451 C  C6    . DC  C 2 6   ? 48.401 -42.799 15.387  1.00 51.42  ? 6   DC  C C6    1 
ATOM   4452 P  P     . DA  C 2 7   ? 50.486 -37.861 11.483  1.00 53.97  ? 7   DA  C P     1 
ATOM   4453 O  OP1   . DA  C 2 7   ? 49.623 -37.380 10.375  1.00 53.37  ? 7   DA  C OP1   1 
ATOM   4454 O  OP2   . DA  C 2 7   ? 51.643 -38.751 11.215  1.00 53.05  ? 7   DA  C OP2   1 
ATOM   4455 O  "O5'" . DA  C 2 7   ? 51.002 -36.609 12.296  1.00 55.17  ? 7   DA  C "O5'" 1 
ATOM   4456 C  "C5'" . DA  C 2 7   ? 50.157 -35.500 12.532  1.00 54.73  ? 7   DA  C "C5'" 1 
ATOM   4457 C  "C4'" . DA  C 2 7   ? 50.605 -34.773 13.786  1.00 54.94  ? 7   DA  C "C4'" 1 
ATOM   4458 O  "O4'" . DA  C 2 7   ? 50.432 -35.626 14.949  1.00 54.80  ? 7   DA  C "O4'" 1 
ATOM   4459 C  "C3'" . DA  C 2 7   ? 52.056 -34.320 13.823  1.00 55.28  ? 7   DA  C "C3'" 1 
ATOM   4460 O  "O3'" . DA  C 2 7   ? 52.117 -33.109 14.583  1.00 56.17  ? 7   DA  C "O3'" 1 
ATOM   4461 C  "C2'" . DA  C 2 7   ? 52.749 -35.481 14.548  1.00 54.63  ? 7   DA  C "C2'" 1 
ATOM   4462 C  "C1'" . DA  C 2 7   ? 51.675 -35.894 15.560  1.00 54.17  ? 7   DA  C "C1'" 1 
ATOM   4463 N  N9    . DA  C 2 7   ? 51.698 -37.311 15.916  1.00 53.58  ? 7   DA  C N9    1 
ATOM   4464 C  C8    . DA  C 2 7   ? 51.721 -38.368 15.061  1.00 53.74  ? 7   DA  C C8    1 
ATOM   4465 N  N7    . DA  C 2 7   ? 51.746 -39.532 15.656  1.00 54.15  ? 7   DA  C N7    1 
ATOM   4466 C  C5    . DA  C 2 7   ? 51.670 -39.227 16.991  1.00 53.89  ? 7   DA  C C5    1 
ATOM   4467 C  C6    . DA  C 2 7   ? 51.622 -40.039 18.156  1.00 53.36  ? 7   DA  C C6    1 
ATOM   4468 N  N6    . DA  C 2 7   ? 51.637 -41.377 18.119  1.00 52.03  ? 7   DA  C N6    1 
ATOM   4469 N  N1    . DA  C 2 7   ? 51.550 -39.407 19.363  1.00 53.21  ? 7   DA  C N1    1 
ATOM   4470 C  C2    . DA  C 2 7   ? 51.541 -38.066 19.393  1.00 53.19  ? 7   DA  C C2    1 
ATOM   4471 N  N3    . DA  C 2 7   ? 51.576 -37.200 18.366  1.00 53.82  ? 7   DA  C N3    1 
ATOM   4472 C  C4    . DA  C 2 7   ? 51.638 -37.855 17.178  1.00 53.88  ? 7   DA  C C4    1 
ATOM   4473 P  P     . DT  C 2 8   ? 53.447 -32.239 14.672  1.00 55.61  ? 8   DT  C P     1 
ATOM   4474 O  OP1   . DT  C 2 8   ? 53.031 -30.841 14.947  1.00 55.64  ? 8   DT  C OP1   1 
ATOM   4475 O  OP2   . DT  C 2 8   ? 54.307 -32.559 13.515  1.00 54.21  ? 8   DT  C OP2   1 
ATOM   4476 O  "O5'" . DT  C 2 8   ? 54.163 -32.835 15.957  1.00 56.87  ? 8   DT  C "O5'" 1 
ATOM   4477 C  "C5'" . DT  C 2 8   ? 53.681 -32.561 17.265  1.00 57.11  ? 8   DT  C "C5'" 1 
ATOM   4478 C  "C4'" . DT  C 2 8   ? 54.446 -33.384 18.273  1.00 56.97  ? 8   DT  C "C4'" 1 
ATOM   4479 O  "O4'" . DT  C 2 8   ? 54.121 -34.761 18.088  1.00 56.52  ? 8   DT  C "O4'" 1 
ATOM   4480 C  "C3'" . DT  C 2 8   ? 55.955 -33.349 18.112  1.00 58.07  ? 8   DT  C "C3'" 1 
ATOM   4481 O  "O3'" . DT  C 2 8   ? 56.506 -32.327 18.941  1.00 61.05  ? 8   DT  C "O3'" 1 
ATOM   4482 C  "C2'" . DT  C 2 8   ? 56.415 -34.743 18.565  1.00 56.58  ? 8   DT  C "C2'" 1 
ATOM   4483 C  "C1'" . DT  C 2 8   ? 55.114 -35.516 18.725  1.00 55.13  ? 8   DT  C "C1'" 1 
ATOM   4484 N  N1    . DT  C 2 8   ? 55.128 -36.884 18.145  1.00 52.33  ? 8   DT  C N1    1 
ATOM   4485 C  C2    . DT  C 2 8   ? 55.056 -37.963 18.989  1.00 51.43  ? 8   DT  C C2    1 
ATOM   4486 O  O2    . DT  C 2 8   ? 55.038 -37.871 20.198  1.00 51.67  ? 8   DT  C O2    1 
ATOM   4487 N  N3    . DT  C 2 8   ? 55.036 -39.175 18.365  1.00 51.32  ? 8   DT  C N3    1 
ATOM   4488 C  C4    . DT  C 2 8   ? 55.099 -39.429 17.011  1.00 51.42  ? 8   DT  C C4    1 
ATOM   4489 O  O4    . DT  C 2 8   ? 55.043 -40.586 16.623  1.00 50.84  ? 8   DT  C O4    1 
ATOM   4490 C  C5    . DT  C 2 8   ? 55.180 -38.254 16.163  1.00 51.96  ? 8   DT  C C5    1 
ATOM   4491 C  C7    . DT  C 2 8   ? 55.240 -38.393 14.671  1.00 51.53  ? 8   DT  C C7    1 
ATOM   4492 C  C6    . DT  C 2 8   ? 55.198 -37.050 16.767  1.00 52.27  ? 8   DT  C C6    1 
ATOM   4493 P  P     . DG  C 2 9   ? 57.956 -31.682 18.618  1.00 61.61  ? 9   DG  C P     1 
ATOM   4494 O  OP1   . DG  C 2 9   ? 57.820 -30.209 18.732  1.00 63.10  ? 9   DG  C OP1   1 
ATOM   4495 O  OP2   . DG  C 2 9   ? 58.516 -32.269 17.350  1.00 58.46  ? 9   DG  C OP2   1 
ATOM   4496 O  "O5'" . DG  C 2 9   ? 58.848 -32.227 19.833  1.00 61.05  ? 9   DG  C "O5'" 1 
ATOM   4497 C  "C5'" . DG  C 2 9   ? 58.312 -32.596 21.108  1.00 59.07  ? 9   DG  C "C5'" 1 
ATOM   4498 C  "C4'" . DG  C 2 9   ? 59.262 -33.589 21.809  1.00 58.01  ? 9   DG  C "C4'" 1 
ATOM   4499 O  "O4'" . DG  C 2 9   ? 59.034 -34.906 21.270  1.00 58.52  ? 9   DG  C "O4'" 1 
ATOM   4500 C  "C3'" . DG  C 2 9   ? 60.775 -33.358 21.617  1.00 58.07  ? 9   DG  C "C3'" 1 
ATOM   4501 O  "O3'" . DG  C 2 9   ? 61.517 -33.963 22.712  1.00 59.48  ? 9   DG  C "O3'" 1 
ATOM   4502 C  "C2'" . DG  C 2 9   ? 61.043 -34.122 20.317  1.00 57.17  ? 9   DG  C "C2'" 1 
ATOM   4503 C  "C1'" . DG  C 2 9   ? 60.174 -35.349 20.552  1.00 57.57  ? 9   DG  C "C1'" 1 
ATOM   4504 N  N9    . DG  C 2 9   ? 59.719 -36.072 19.349  1.00 56.89  ? 9   DG  C N9    1 
ATOM   4505 C  C8    . DG  C 2 9   ? 59.642 -35.615 18.045  1.00 55.91  ? 9   DG  C C8    1 
ATOM   4506 N  N7    . DG  C 2 9   ? 59.195 -36.514 17.208  1.00 55.11  ? 9   DG  C N7    1 
ATOM   4507 C  C5    . DG  C 2 9   ? 58.977 -37.640 18.005  1.00 55.20  ? 9   DG  C C5    1 
ATOM   4508 C  C6    . DG  C 2 9   ? 58.489 -38.941 17.664  1.00 55.23  ? 9   DG  C C6    1 
ATOM   4509 O  O6    . DG  C 2 9   ? 58.143 -39.367 16.542  1.00 56.39  ? 9   DG  C O6    1 
ATOM   4510 N  N1    . DG  C 2 9   ? 58.421 -39.785 18.781  1.00 53.38  ? 9   DG  C N1    1 
ATOM   4511 C  C2    . DG  C 2 9   ? 58.737 -39.410 20.062  1.00 54.02  ? 9   DG  C C2    1 
ATOM   4512 N  N2    . DG  C 2 9   ? 58.631 -40.346 21.004  1.00 53.19  ? 9   DG  C N2    1 
ATOM   4513 N  N3    . DG  C 2 9   ? 59.172 -38.200 20.394  1.00 55.74  ? 9   DG  C N3    1 
ATOM   4514 C  C4    . DG  C 2 9   ? 59.283 -37.376 19.317  1.00 55.82  ? 9   DG  C C4    1 
ATOM   4515 P  P     . DG  C 2 10  ? 61.962 -33.131 24.023  1.00 60.16  ? 10  DG  C P     1 
ATOM   4516 O  OP1   . DG  C 2 10  ? 60.752 -32.600 24.693  1.00 60.77  ? 10  DG  C OP1   1 
ATOM   4517 O  OP2   . DG  C 2 10  ? 63.038 -32.203 23.636  1.00 60.74  ? 10  DG  C OP2   1 
ATOM   4518 O  "O5'" . DG  C 2 10  ? 62.568 -34.274 24.956  1.00 59.12  ? 10  DG  C "O5'" 1 
ATOM   4519 C  "C5'" . DG  C 2 10  ? 63.724 -34.951 24.583  1.00 60.25  ? 10  DG  C "C5'" 1 
ATOM   4520 C  "C4'" . DG  C 2 10  ? 63.624 -36.416 24.940  1.00 62.04  ? 10  DG  C "C4'" 1 
ATOM   4521 O  "O4'" . DG  C 2 10  ? 62.789 -37.090 23.963  1.00 62.91  ? 10  DG  C "O4'" 1 
ATOM   4522 C  "C3'" . DG  C 2 10  ? 64.945 -37.164 24.941  1.00 64.05  ? 10  DG  C "C3'" 1 
ATOM   4523 O  "O3'" . DG  C 2 10  ? 64.933 -38.147 25.961  1.00 67.78  ? 10  DG  C "O3'" 1 
ATOM   4524 C  "C2'" . DG  C 2 10  ? 64.981 -37.801 23.562  1.00 63.29  ? 10  DG  C "C2'" 1 
ATOM   4525 C  "C1'" . DG  C 2 10  ? 63.518 -38.134 23.336  1.00 62.55  ? 10  DG  C "C1'" 1 
ATOM   4526 N  N9    . DG  C 2 10  ? 63.166 -38.162 21.923  1.00 61.33  ? 10  DG  C N9    1 
ATOM   4527 C  C8    . DG  C 2 10  ? 63.321 -37.133 21.032  1.00 60.64  ? 10  DG  C C8    1 
ATOM   4528 N  N7    . DG  C 2 10  ? 62.946 -37.432 19.825  1.00 60.33  ? 10  DG  C N7    1 
ATOM   4529 C  C5    . DG  C 2 10  ? 62.505 -38.747 19.896  1.00 60.01  ? 10  DG  C C5    1 
ATOM   4530 C  C6    . DG  C 2 10  ? 61.957 -39.595 18.885  1.00 59.51  ? 10  DG  C C6    1 
ATOM   4531 O  O6    . DG  C 2 10  ? 61.775 -39.350 17.685  1.00 59.32  ? 10  DG  C O6    1 
ATOM   4532 N  N1    . DG  C 2 10  ? 61.633 -40.856 19.381  1.00 59.81  ? 10  DG  C N1    1 
ATOM   4533 C  C2    . DG  C 2 10  ? 61.783 -41.245 20.693  1.00 60.55  ? 10  DG  C C2    1 
ATOM   4534 N  N2    . DG  C 2 10  ? 61.399 -42.495 20.973  1.00 61.27  ? 10  DG  C N2    1 
ATOM   4535 N  N3    . DG  C 2 10  ? 62.258 -40.451 21.668  1.00 60.26  ? 10  DG  C N3    1 
ATOM   4536 C  C4    . DG  C 2 10  ? 62.618 -39.222 21.192  1.00 60.64  ? 10  DG  C C4    1 
ATOM   4537 P  P     . DA  C 2 11  ? 66.275 -38.939 26.373  1.00 70.63  ? 11  DA  C P     1 
ATOM   4538 O  OP1   . DA  C 2 11  ? 66.220 -39.141 27.845  1.00 71.45  ? 11  DA  C OP1   1 
ATOM   4539 O  OP2   . DA  C 2 11  ? 67.441 -38.260 25.746  1.00 70.65  ? 11  DA  C OP2   1 
ATOM   4540 O  "O5'" . DA  C 2 11  ? 66.097 -40.350 25.646  1.00 69.85  ? 11  DA  C "O5'" 1 
ATOM   4541 C  "C5'" . DA  C 2 11  ? 64.870 -41.019 25.722  1.00 69.75  ? 11  DA  C "C5'" 1 
ATOM   4542 C  "C4'" . DA  C 2 11  ? 64.956 -42.400 25.103  1.00 70.31  ? 11  DA  C "C4'" 1 
ATOM   4543 O  "O4'" . DA  C 2 11  ? 64.585 -42.356 23.705  1.00 69.77  ? 11  DA  C "O4'" 1 
ATOM   4544 C  "C3'" . DA  C 2 11  ? 66.308 -43.094 25.162  1.00 71.59  ? 11  DA  C "C3'" 1 
ATOM   4545 O  "O3'" . DA  C 2 11  ? 66.066 -44.512 25.372  1.00 73.78  ? 11  DA  C "O3'" 1 
ATOM   4546 C  "C2'" . DA  C 2 11  ? 66.915 -42.768 23.783  1.00 69.99  ? 11  DA  C "C2'" 1 
ATOM   4547 C  "C1'" . DA  C 2 11  ? 65.674 -42.755 22.893  1.00 68.92  ? 11  DA  C "C1'" 1 
ATOM   4548 N  N9    . DA  C 2 11  ? 65.745 -41.836 21.759  1.00 66.72  ? 11  DA  C N9    1 
ATOM   4549 C  C8    . DA  C 2 11  ? 66.199 -40.551 21.765  1.00 65.82  ? 11  DA  C C8    1 
ATOM   4550 N  N7    . DA  C 2 11  ? 66.099 -39.950 20.606  1.00 65.12  ? 11  DA  C N7    1 
ATOM   4551 C  C5    . DA  C 2 11  ? 65.513 -40.896 19.789  1.00 64.52  ? 11  DA  C C5    1 
ATOM   4552 C  C6    . DA  C 2 11  ? 65.100 -40.868 18.435  1.00 64.14  ? 11  DA  C C6    1 
ATOM   4553 N  N6    . DA  C 2 11  ? 65.252 -39.805 17.636  1.00 63.93  ? 11  DA  C N6    1 
ATOM   4554 N  N1    . DA  C 2 11  ? 64.542 -41.993 17.925  1.00 63.96  ? 11  DA  C N1    1 
ATOM   4555 C  C2    . DA  C 2 11  ? 64.374 -43.056 18.721  1.00 64.62  ? 11  DA  C C2    1 
ATOM   4556 N  N3    . DA  C 2 11  ? 64.700 -43.190 20.011  1.00 65.43  ? 11  DA  C N3    1 
ATOM   4557 C  C4    . DA  C 2 11  ? 65.269 -42.059 20.489  1.00 65.28  ? 11  DA  C C4    1 
ATOM   4558 P  P     . DA  C 2 12  ? 67.225 -45.614 25.299  1.00 75.55  ? 12  DA  C P     1 
ATOM   4559 O  OP1   . DA  C 2 12  ? 66.873 -46.691 26.252  1.00 76.11  ? 12  DA  C OP1   1 
ATOM   4560 O  OP2   . DA  C 2 12  ? 68.552 -44.945 25.374  1.00 75.89  ? 12  DA  C OP2   1 
ATOM   4561 O  "O5'" . DA  C 2 12  ? 67.052 -46.179 23.825  1.00 74.76  ? 12  DA  C "O5'" 1 
ATOM   4562 C  "C5'" . DA  C 2 12  ? 65.870 -46.881 23.484  1.00 72.90  ? 12  DA  C "C5'" 1 
ATOM   4563 C  "C4'" . DA  C 2 12  ? 65.980 -47.455 22.098  1.00 71.28  ? 12  DA  C "C4'" 1 
ATOM   4564 O  "O4'" . DA  C 2 12  ? 66.045 -46.388 21.123  1.00 70.48  ? 12  DA  C "O4'" 1 
ATOM   4565 C  "C3'" . DA  C 2 12  ? 67.182 -48.342 21.847  1.00 71.46  ? 12  DA  C "C3'" 1 
ATOM   4566 O  "O3'" . DA  C 2 12  ? 66.734 -49.461 21.117  1.00 73.99  ? 12  DA  C "O3'" 1 
ATOM   4567 C  "C2'" . DA  C 2 12  ? 68.140 -47.446 21.034  1.00 69.80  ? 12  DA  C "C2'" 1 
ATOM   4568 C  "C1'" . DA  C 2 12  ? 67.177 -46.546 20.286  1.00 68.72  ? 12  DA  C "C1'" 1 
ATOM   4569 N  N9    . DA  C 2 12  ? 67.683 -45.205 19.992  1.00 66.10  ? 12  DA  C N9    1 
ATOM   4570 C  C8    . DA  C 2 12  ? 68.197 -44.300 20.885  1.00 65.11  ? 12  DA  C C8    1 
ATOM   4571 N  N7    . DA  C 2 12  ? 68.452 -43.120 20.365  1.00 64.46  ? 12  DA  C N7    1 
ATOM   4572 C  C5    . DA  C 2 12  ? 68.066 -43.251 19.038  1.00 64.02  ? 12  DA  C C5    1 
ATOM   4573 C  C6    . DA  C 2 12  ? 68.085 -42.353 17.933  1.00 62.94  ? 12  DA  C C6    1 
ATOM   4574 N  N6    . DA  C 2 12  ? 68.515 -41.084 18.009  1.00 62.35  ? 12  DA  C N6    1 
ATOM   4575 N  N1    . DA  C 2 12  ? 67.609 -42.807 16.752  1.00 62.19  ? 12  DA  C N1    1 
ATOM   4576 C  C2    . DA  C 2 12  ? 67.146 -44.062 16.673  1.00 62.51  ? 12  DA  C C2    1 
ATOM   4577 N  N3    . DA  C 2 12  ? 67.071 -44.993 17.629  1.00 63.28  ? 12  DA  C N3    1 
ATOM   4578 C  C4    . DA  C 2 12  ? 67.558 -44.522 18.800  1.00 64.44  ? 12  DA  C C4    1 
ATOM   4579 P  P     . DT  C 2 13  ? 67.674 -50.714 20.803  1.00 75.83  ? 13  DT  C P     1 
ATOM   4580 O  OP1   . DT  C 2 13  ? 66.827 -51.935 20.920  1.00 76.21  ? 13  DT  C OP1   1 
ATOM   4581 O  OP2   . DT  C 2 13  ? 68.932 -50.588 21.594  1.00 76.40  ? 13  DT  C OP2   1 
ATOM   4582 O  "O5'" . DT  C 2 13  ? 68.053 -50.484 19.270  1.00 74.31  ? 13  DT  C "O5'" 1 
ATOM   4583 C  "C5'" . DT  C 2 13  ? 67.033 -50.311 18.321  1.00 73.07  ? 13  DT  C "C5'" 1 
ATOM   4584 C  "C4'" . DT  C 2 13  ? 67.586 -49.751 17.040  1.00 72.65  ? 13  DT  C "C4'" 1 
ATOM   4585 O  "O4'" . DT  C 2 13  ? 68.013 -48.395 17.239  1.00 72.25  ? 13  DT  C "O4'" 1 
ATOM   4586 C  "C3'" . DT  C 2 13  ? 68.786 -50.492 16.461  1.00 73.14  ? 13  DT  C "C3'" 1 
ATOM   4587 O  "O3'" . DT  C 2 13  ? 68.369 -51.126 15.267  1.00 75.25  ? 13  DT  C "O3'" 1 
ATOM   4588 C  "C2'" . DT  C 2 13  ? 69.833 -49.384 16.217  1.00 72.13  ? 13  DT  C "C2'" 1 
ATOM   4589 C  "C1'" . DT  C 2 13  ? 68.999 -48.120 16.291  1.00 71.14  ? 13  DT  C "C1'" 1 
ATOM   4590 N  N1    . DT  C 2 13  ? 69.740 -46.891 16.728  1.00 69.37  ? 13  DT  C N1    1 
ATOM   4591 C  C2    . DT  C 2 13  ? 69.824 -45.811 15.868  1.00 68.76  ? 13  DT  C C2    1 
ATOM   4592 O  O2    . DT  C 2 13  ? 69.359 -45.808 14.732  1.00 68.77  ? 13  DT  C O2    1 
ATOM   4593 N  N3    . DT  C 2 13  ? 70.475 -44.713 16.390  1.00 68.18  ? 13  DT  C N3    1 
ATOM   4594 C  C4    . DT  C 2 13  ? 71.030 -44.577 17.655  1.00 67.62  ? 13  DT  C C4    1 
ATOM   4595 O  O4    . DT  C 2 13  ? 71.561 -43.508 17.968  1.00 67.82  ? 13  DT  C O4    1 
ATOM   4596 C  C5    . DT  C 2 13  ? 70.914 -45.746 18.509  1.00 66.98  ? 13  DT  C C5    1 
ATOM   4597 C  C7    . DT  C 2 13  ? 71.465 -45.728 19.899  1.00 65.26  ? 13  DT  C C7    1 
ATOM   4598 C  C6    . DT  C 2 13  ? 70.280 -46.830 18.014  1.00 68.65  ? 13  DT  C C6    1 
ATOM   4599 P  P     . DT  C 2 14  ? 69.386 -51.892 14.286  1.00 77.38  ? 14  DT  C P     1 
ATOM   4600 O  OP1   . DT  C 2 14  ? 68.620 -52.978 13.618  1.00 77.93  ? 14  DT  C OP1   1 
ATOM   4601 O  OP2   . DT  C 2 14  ? 70.652 -52.197 15.019  1.00 77.49  ? 14  DT  C OP2   1 
ATOM   4602 O  "O5'" . DT  C 2 14  ? 69.713 -50.775 13.205  1.00 75.72  ? 14  DT  C "O5'" 1 
ATOM   4603 C  "C5'" . DT  C 2 14  ? 68.666 -50.168 12.506  1.00 73.41  ? 14  DT  C "C5'" 1 
ATOM   4604 C  "C4'" . DT  C 2 14  ? 69.207 -49.138 11.570  1.00 72.02  ? 14  DT  C "C4'" 1 
ATOM   4605 O  "O4'" . DT  C 2 14  ? 69.800 -48.068 12.326  1.00 71.51  ? 14  DT  C "O4'" 1 
ATOM   4606 C  "C3'" . DT  C 2 14  ? 70.270 -49.644 10.602  1.00 72.14  ? 14  DT  C "C3'" 1 
ATOM   4607 O  "O3'" . DT  C 2 14  ? 69.852 -49.315 9.299   1.00 73.72  ? 14  DT  C "O3'" 1 
ATOM   4608 C  "C2'" . DT  C 2 14  ? 71.558 -48.911 11.032  1.00 71.35  ? 14  DT  C "C2'" 1 
ATOM   4609 C  "C1'" . DT  C 2 14  ? 71.011 -47.675 11.721  1.00 70.59  ? 14  DT  C "C1'" 1 
ATOM   4610 N  N1    . DT  C 2 14  ? 71.886 -47.083 12.798  1.00 68.53  ? 14  DT  C N1    1 
ATOM   4611 C  C2    . DT  C 2 14  ? 72.186 -45.729 12.748  1.00 68.14  ? 14  DT  C C2    1 
ATOM   4612 O  O2    . DT  C 2 14  ? 71.891 -45.002 11.809  1.00 68.30  ? 14  DT  C O2    1 
ATOM   4613 N  N3    . DT  C 2 14  ? 72.897 -45.260 13.818  1.00 67.40  ? 14  DT  C N3    1 
ATOM   4614 C  C4    . DT  C 2 14  ? 73.305 -45.960 14.936  1.00 67.60  ? 14  DT  C C4    1 
ATOM   4615 O  O4    . DT  C 2 14  ? 73.917 -45.360 15.828  1.00 67.95  ? 14  DT  C O4    1 
ATOM   4616 C  C5    . DT  C 2 14  ? 72.928 -47.373 14.954  1.00 66.88  ? 14  DT  C C5    1 
ATOM   4617 C  C7    . DT  C 2 14  ? 73.302 -48.250 16.111  1.00 65.53  ? 14  DT  C C7    1 
ATOM   4618 C  C6    . DT  C 2 14  ? 72.231 -47.851 13.903  1.00 67.79  ? 14  DT  C C6    1 
ATOM   4619 P  P     . DT  C 2 15  ? 70.689 -49.719 8.001   1.00 75.63  ? 15  DT  C P     1 
ATOM   4620 O  OP1   . DT  C 2 15  ? 69.719 -49.982 6.904   1.00 76.08  ? 15  DT  C OP1   1 
ATOM   4621 O  OP2   . DT  C 2 15  ? 71.696 -50.747 8.376   1.00 76.04  ? 15  DT  C OP2   1 
ATOM   4622 O  "O5'" . DT  C 2 15  ? 71.453 -48.365 7.683   1.00 74.76  ? 15  DT  C "O5'" 1 
ATOM   4623 C  "C5'" . DT  C 2 15  ? 70.706 -47.165 7.599   1.00 74.16  ? 15  DT  C "C5'" 1 
ATOM   4624 C  "C4'" . DT  C 2 15  ? 71.610 -45.974 7.408   1.00 73.75  ? 15  DT  C "C4'" 1 
ATOM   4625 O  "O4'" . DT  C 2 15  ? 72.288 -45.651 8.643   1.00 73.60  ? 15  DT  C "O4'" 1 
ATOM   4626 C  "C3'" . DT  C 2 15  ? 72.697 -46.127 6.350   1.00 73.72  ? 15  DT  C "C3'" 1 
ATOM   4627 O  "O3'" . DT  C 2 15  ? 72.714 -44.941 5.611   1.00 74.96  ? 15  DT  C "O3'" 1 
ATOM   4628 C  "C2'" . DT  C 2 15  ? 73.983 -46.312 7.179   1.00 72.66  ? 15  DT  C "C2'" 1 
ATOM   4629 C  "C1'" . DT  C 2 15  ? 73.666 -45.450 8.383   1.00 72.09  ? 15  DT  C "C1'" 1 
ATOM   4630 N  N1    . DT  C 2 15  ? 74.433 -45.768 9.630   1.00 69.88  ? 15  DT  C N1    1 
ATOM   4631 C  C2    . DT  C 2 15  ? 74.937 -44.721 10.380  1.00 69.52  ? 15  DT  C C2    1 
ATOM   4632 O  O2    . DT  C 2 15  ? 74.881 -43.542 10.034  1.00 69.65  ? 15  DT  C O2    1 
ATOM   4633 N  N3    . DT  C 2 15  ? 75.555 -45.101 11.536  1.00 69.25  ? 15  DT  C N3    1 
ATOM   4634 C  C4    . DT  C 2 15  ? 75.699 -46.380 12.037  1.00 69.57  ? 15  DT  C C4    1 
ATOM   4635 O  O4    . DT  C 2 15  ? 76.268 -46.540 13.114  1.00 71.00  ? 15  DT  C O4    1 
ATOM   4636 C  C5    . DT  C 2 15  ? 75.117 -47.431 11.235  1.00 68.36  ? 15  DT  C C5    1 
ATOM   4637 C  C7    . DT  C 2 15  ? 75.217 -48.860 11.679  1.00 67.17  ? 15  DT  C C7    1 
ATOM   4638 C  C6    . DT  C 2 15  ? 74.501 -47.079 10.088  1.00 68.98  ? 15  DT  C C6    1 
ATOM   4639 P  P     . DC  C 2 16  ? 73.487 -44.814 4.231   1.00 76.06  ? 16  DC  C P     1 
ATOM   4640 O  OP1   . DC  C 2 16  ? 72.524 -44.274 3.241   1.00 76.57  ? 16  DC  C OP1   1 
ATOM   4641 O  OP2   . DC  C 2 16  ? 74.222 -46.084 3.957   1.00 76.14  ? 16  DC  C OP2   1 
ATOM   4642 O  "O5'" . DC  C 2 16  ? 74.550 -43.684 4.570   1.00 75.19  ? 16  DC  C "O5'" 1 
ATOM   4643 C  "C5'" . DC  C 2 16  ? 74.095 -42.459 5.124   1.00 74.85  ? 16  DC  C "C5'" 1 
ATOM   4644 C  "C4'" . DC  C 2 16  ? 75.241 -41.670 5.701   1.00 74.61  ? 16  DC  C "C4'" 1 
ATOM   4645 O  "O4'" . DC  C 2 16  ? 75.729 -42.299 6.907   1.00 73.85  ? 16  DC  C "O4'" 1 
ATOM   4646 C  "C3'" . DC  C 2 16  ? 76.441 -41.500 4.782   1.00 75.26  ? 16  DC  C "C3'" 1 
ATOM   4647 O  "O3'" . DC  C 2 16  ? 76.784 -40.131 4.777   1.00 77.94  ? 16  DC  C "O3'" 1 
ATOM   4648 C  "C2'" . DC  C 2 16  ? 77.526 -42.379 5.426   1.00 73.67  ? 16  DC  C "C2'" 1 
ATOM   4649 C  "C1'" . DC  C 2 16  ? 77.137 -42.297 6.894   1.00 72.33  ? 16  DC  C "C1'" 1 
ATOM   4650 N  N1    . DC  C 2 16  ? 77.624 -43.436 7.788   1.00 70.01  ? 16  DC  C N1    1 
ATOM   4651 C  C2    . DC  C 2 16  ? 78.287 -43.135 9.001   1.00 68.58  ? 16  DC  C C2    1 
ATOM   4652 O  O2    . DC  C 2 16  ? 78.537 -41.948 9.281   1.00 69.18  ? 16  DC  C O2    1 
ATOM   4653 N  N3    . DC  C 2 16  ? 78.649 -44.162 9.828   1.00 67.18  ? 16  DC  C N3    1 
ATOM   4654 C  C4    . DC  C 2 16  ? 78.358 -45.435 9.502   1.00 67.09  ? 16  DC  C C4    1 
ATOM   4655 N  N4    . DC  C 2 16  ? 78.724 -46.406 10.354  1.00 66.43  ? 16  DC  C N4    1 
ATOM   4656 C  C5    . DC  C 2 16  ? 77.657 -45.762 8.295   1.00 67.84  ? 16  DC  C C5    1 
ATOM   4657 C  C6    . DC  C 2 16  ? 77.300 -44.744 7.484   1.00 69.13  ? 16  DC  C C6    1 
ATOM   4658 P  P     . DG  C 2 17  ? 77.515 -39.455 3.524   1.00 79.89  ? 17  DG  C P     1 
ATOM   4659 O  OP1   . DG  C 2 17  ? 76.920 -38.094 3.335   1.00 79.27  ? 17  DG  C OP1   1 
ATOM   4660 O  OP2   . DG  C 2 17  ? 77.569 -40.435 2.393   1.00 79.04  ? 17  DG  C OP2   1 
ATOM   4661 O  "O5'" . DG  C 2 17  ? 78.998 -39.287 4.097   1.00 79.32  ? 17  DG  C "O5'" 1 
ATOM   4662 C  "C5'" . DG  C 2 17  ? 79.237 -38.352 5.148   1.00 77.02  ? 17  DG  C "C5'" 1 
ATOM   4663 C  "C4'" . DG  C 2 17  ? 80.616 -38.545 5.736   1.00 74.63  ? 17  DG  C "C4'" 1 
ATOM   4664 O  "O4'" . DG  C 2 17  ? 80.643 -39.746 6.531   1.00 72.79  ? 17  DG  C "O4'" 1 
ATOM   4665 C  "C3'" . DG  C 2 17  ? 81.759 -38.650 4.724   1.00 74.12  ? 17  DG  C "C3'" 1 
ATOM   4666 O  "O3'" . DG  C 2 17  ? 82.716 -37.674 5.064   1.00 75.44  ? 17  DG  C "O3'" 1 
ATOM   4667 C  "C2'" . DG  C 2 17  ? 82.286 -40.084 4.896   1.00 72.35  ? 17  DG  C "C2'" 1 
ATOM   4668 C  "C1'" . DG  C 2 17  ? 81.848 -40.413 6.321   1.00 70.85  ? 17  DG  C "C1'" 1 
ATOM   4669 N  N9    . DG  C 2 17  ? 81.625 -41.825 6.601   1.00 67.59  ? 17  DG  C N9    1 
ATOM   4670 C  C8    . DG  C 2 17  ? 80.926 -42.743 5.843   1.00 66.30  ? 17  DG  C C8    1 
ATOM   4671 N  N7    . DG  C 2 17  ? 80.867 -43.931 6.392   1.00 65.41  ? 17  DG  C N7    1 
ATOM   4672 C  C5    . DG  C 2 17  ? 81.535 -43.773 7.602   1.00 64.77  ? 17  DG  C C5    1 
ATOM   4673 C  C6    . DG  C 2 17  ? 81.803 -44.707 8.632   1.00 64.16  ? 17  DG  C C6    1 
ATOM   4674 O  O6    . DG  C 2 17  ? 81.481 -45.889 8.687   1.00 64.48  ? 17  DG  C O6    1 
ATOM   4675 N  N1    . DG  C 2 17  ? 82.519 -44.138 9.689   1.00 64.12  ? 17  DG  C N1    1 
ATOM   4676 C  C2    . DG  C 2 17  ? 82.950 -42.835 9.735   1.00 64.51  ? 17  DG  C C2    1 
ATOM   4677 N  N2    . DG  C 2 17  ? 83.646 -42.475 10.815  1.00 63.80  ? 17  DG  C N2    1 
ATOM   4678 N  N3    . DG  C 2 17  ? 82.694 -41.939 8.787   1.00 65.70  ? 17  DG  C N3    1 
ATOM   4679 C  C4    . DG  C 2 17  ? 81.990 -42.480 7.748   1.00 66.06  ? 17  DG  C C4    1 
ATOM   4680 P  P     . DC  C 2 18  ? 83.915 -37.256 4.092   1.00 75.94  ? 18  DC  C P     1 
ATOM   4681 O  OP1   . DC  C 2 18  ? 84.281 -35.854 4.441   1.00 75.45  ? 18  DC  C OP1   1 
ATOM   4682 O  OP2   . DC  C 2 18  ? 83.573 -37.610 2.695   1.00 76.16  ? 18  DC  C OP2   1 
ATOM   4683 O  "O5'" . DC  C 2 18  ? 85.062 -38.249 4.593   1.00 75.16  ? 18  DC  C "O5'" 1 
ATOM   4684 C  "C5'" . DC  C 2 18  ? 85.566 -38.088 5.915   1.00 73.55  ? 18  DC  C "C5'" 1 
ATOM   4685 C  "C4'" . DC  C 2 18  ? 86.246 -39.335 6.429   1.00 72.20  ? 18  DC  C "C4'" 1 
ATOM   4686 O  "O4'" . DC  C 2 18  ? 85.345 -40.441 6.453   1.00 71.49  ? 18  DC  C "O4'" 1 
ATOM   4687 C  "C3'" . DC  C 2 18  ? 87.465 -39.830 5.643   1.00 71.67  ? 18  DC  C "C3'" 1 
ATOM   4688 O  "O3'" . DC  C 2 18  ? 88.656 -39.346 6.282   1.00 71.61  ? 18  DC  C "O3'" 1 
ATOM   4689 C  "C2'" . DC  C 2 18  ? 87.353 -41.366 5.735   1.00 70.94  ? 18  DC  C "C2'" 1 
ATOM   4690 C  "C1'" . DC  C 2 18  ? 86.143 -41.566 6.641   1.00 70.52  ? 18  DC  C "C1'" 1 
ATOM   4691 N  N1    . DC  C 2 18  ? 85.364 -42.768 6.348   1.00 69.84  ? 18  DC  C N1    1 
ATOM   4692 C  C2    . DC  C 2 18  ? 85.325 -43.805 7.296   1.00 70.31  ? 18  DC  C C2    1 
ATOM   4693 O  O2    . DC  C 2 18  ? 85.937 -43.674 8.356   1.00 70.45  ? 18  DC  C O2    1 
ATOM   4694 N  N3    . DC  C 2 18  ? 84.614 -44.929 7.014   1.00 70.65  ? 18  DC  C N3    1 
ATOM   4695 C  C4    . DC  C 2 18  ? 83.966 -45.039 5.840   1.00 70.74  ? 18  DC  C C4    1 
ATOM   4696 N  N4    . DC  C 2 18  ? 83.264 -46.158 5.617   1.00 71.53  ? 18  DC  C N4    1 
ATOM   4697 C  C5    . DC  C 2 18  ? 84.002 -43.996 4.854   1.00 69.71  ? 18  DC  C C5    1 
ATOM   4698 C  C6    . DC  C 2 18  ? 84.705 -42.890 5.145   1.00 69.43  ? 18  DC  C C6    1 
ATOM   4699 P  P     . DA  C 2 19  ? 90.117 -39.613 5.681   1.00 70.29  ? 19  DA  C P     1 
ATOM   4700 O  OP1   . DA  C 2 19  ? 90.992 -38.542 6.208   1.00 69.04  ? 19  DA  C OP1   1 
ATOM   4701 O  OP2   . DA  C 2 19  ? 90.009 -39.822 4.209   1.00 71.49  ? 19  DA  C OP2   1 
ATOM   4702 O  "O5'" . DA  C 2 19  ? 90.517 -41.025 6.315   1.00 69.24  ? 19  DA  C "O5'" 1 
ATOM   4703 C  "C5'" . DA  C 2 19  ? 90.636 -41.178 7.695   1.00 70.56  ? 19  DA  C "C5'" 1 
ATOM   4704 C  "C4'" . DA  C 2 19  ? 90.850 -42.634 8.058   1.00 72.44  ? 19  DA  C "C4'" 1 
ATOM   4705 O  "O4'" . DA  C 2 19  ? 89.660 -43.385 7.728   1.00 73.13  ? 19  DA  C "O4'" 1 
ATOM   4706 C  "C3'" . DA  C 2 19  ? 92.027 -43.326 7.346   1.00 73.23  ? 19  DA  C "C3'" 1 
ATOM   4707 O  "O3'" . DA  C 2 19  ? 92.918 -43.928 8.296   1.00 73.85  ? 19  DA  C "O3'" 1 
ATOM   4708 C  "C2'" . DA  C 2 19  ? 91.372 -44.372 6.457   1.00 73.26  ? 19  DA  C "C2'" 1 
ATOM   4709 C  "C1'" . DA  C 2 19  ? 90.031 -44.608 7.144   1.00 73.82  ? 19  DA  C "C1'" 1 
ATOM   4710 N  N9    . DA  C 2 19  ? 88.981 -45.017 6.213   1.00 75.24  ? 19  DA  C N9    1 
ATOM   4711 C  C8    . DA  C 2 19  ? 88.624 -44.401 5.031   1.00 75.66  ? 19  DA  C C8    1 
ATOM   4712 N  N7    . DA  C 2 19  ? 87.677 -45.016 4.370   1.00 75.96  ? 19  DA  C N7    1 
ATOM   4713 C  C5    . DA  C 2 19  ? 87.406 -46.128 5.154   1.00 76.85  ? 19  DA  C C5    1 
ATOM   4714 C  C6    . DA  C 2 19  ? 86.493 -47.201 5.002   1.00 78.27  ? 19  DA  C C6    1 
ATOM   4715 N  N6    . DA  C 2 19  ? 85.654 -47.313 3.950   1.00 79.44  ? 19  DA  C N6    1 
ATOM   4716 N  N1    . DA  C 2 19  ? 86.465 -48.150 5.982   1.00 77.53  ? 19  DA  C N1    1 
ATOM   4717 C  C2    . DA  C 2 19  ? 87.304 -48.032 7.035   1.00 77.17  ? 19  DA  C C2    1 
ATOM   4718 N  N3    . DA  C 2 19  ? 88.219 -47.082 7.276   1.00 76.95  ? 19  DA  C N3    1 
ATOM   4719 C  C4    . DA  C 2 19  ? 88.217 -46.150 6.287   1.00 76.35  ? 19  DA  C C4    1 
ATOM   4720 O  "O5'" . DT  D 3 1   ? 90.083 -54.845 7.646   1.00 113.54 ? 1   DT  D "O5'" 1 
ATOM   4721 C  "C5'" . DT  D 3 1   ? 89.000 -55.629 8.175   1.00 113.43 ? 1   DT  D "C5'" 1 
ATOM   4722 C  "C4'" . DT  D 3 1   ? 88.419 -54.989 9.442   1.00 112.75 ? 1   DT  D "C4'" 1 
ATOM   4723 O  "O4'" . DT  D 3 1   ? 88.005 -53.618 9.171   1.00 112.51 ? 1   DT  D "O4'" 1 
ATOM   4724 C  "C3'" . DT  D 3 1   ? 87.198 -55.690 10.045  1.00 111.61 ? 1   DT  D "C3'" 1 
ATOM   4725 O  "O3'" . DT  D 3 1   ? 87.325 -55.714 11.514  1.00 110.08 ? 1   DT  D "O3'" 1 
ATOM   4726 C  "C2'" . DT  D 3 1   ? 86.016 -54.863 9.515   1.00 111.60 ? 1   DT  D "C2'" 1 
ATOM   4727 C  "C1'" . DT  D 3 1   ? 86.612 -53.459 9.406   1.00 111.59 ? 1   DT  D "C1'" 1 
ATOM   4728 N  N1    . DT  D 3 1   ? 86.014 -52.613 8.283   1.00 110.65 ? 1   DT  D N1    1 
ATOM   4729 C  C2    . DT  D 3 1   ? 86.644 -51.430 7.893   1.00 110.02 ? 1   DT  D C2    1 
ATOM   4730 O  O2    . DT  D 3 1   ? 87.677 -51.002 8.401   1.00 109.96 ? 1   DT  D O2    1 
ATOM   4731 N  N3    . DT  D 3 1   ? 86.017 -50.761 6.869   1.00 109.24 ? 1   DT  D N3    1 
ATOM   4732 C  C4    . DT  D 3 1   ? 84.846 -51.110 6.215   1.00 108.95 ? 1   DT  D C4    1 
ATOM   4733 O  O4    . DT  D 3 1   ? 84.411 -50.375 5.328   1.00 108.34 ? 1   DT  D O4    1 
ATOM   4734 C  C5    . DT  D 3 1   ? 84.230 -52.350 6.664   1.00 109.63 ? 1   DT  D C5    1 
ATOM   4735 C  C7    . DT  D 3 1   ? 82.959 -52.842 6.030   1.00 109.80 ? 1   DT  D C7    1 
ATOM   4736 C  C6    . DT  D 3 1   ? 84.834 -53.032 7.663   1.00 110.08 ? 1   DT  D C6    1 
ATOM   4737 P  P     . DG  D 3 2   ? 86.101 -55.403 12.544  1.00 108.19 ? 2   DG  D P     1 
ATOM   4738 O  OP1   . DG  D 3 2   ? 86.427 -56.058 13.847  1.00 108.66 ? 2   DG  D OP1   1 
ATOM   4739 O  OP2   . DG  D 3 2   ? 84.790 -55.696 11.886  1.00 108.33 ? 2   DG  D OP2   1 
ATOM   4740 O  "O5'" . DG  D 3 2   ? 86.227 -53.817 12.732  1.00 102.47 ? 2   DG  D "O5'" 1 
ATOM   4741 C  "C5'" . DG  D 3 2   ? 87.361 -53.277 13.401  1.00 96.13  ? 2   DG  D "C5'" 1 
ATOM   4742 C  "C4'" . DG  D 3 2   ? 87.154 -51.816 13.709  1.00 89.93  ? 2   DG  D "C4'" 1 
ATOM   4743 O  "O4'" . DG  D 3 2   ? 86.826 -51.100 12.494  1.00 87.73  ? 2   DG  D "O4'" 1 
ATOM   4744 C  "C3'" . DG  D 3 2   ? 86.044 -51.505 14.705  1.00 86.44  ? 2   DG  D "C3'" 1 
ATOM   4745 O  "O3'" . DG  D 3 2   ? 86.526 -50.548 15.633  1.00 84.19  ? 2   DG  D "O3'" 1 
ATOM   4746 C  "C2'" . DG  D 3 2   ? 84.933 -50.923 13.823  1.00 85.53  ? 2   DG  D "C2'" 1 
ATOM   4747 C  "C1'" . DG  D 3 2   ? 85.744 -50.244 12.737  1.00 84.87  ? 2   DG  D "C1'" 1 
ATOM   4748 N  N9    . DG  D 3 2   ? 85.018 -50.030 11.482  1.00 81.81  ? 2   DG  D N9    1 
ATOM   4749 C  C8    . DG  D 3 2   ? 84.211 -50.929 10.812  1.00 80.50  ? 2   DG  D C8    1 
ATOM   4750 N  N7    . DG  D 3 2   ? 83.698 -50.443 9.708   1.00 79.82  ? 2   DG  D N7    1 
ATOM   4751 C  C5    . DG  D 3 2   ? 84.211 -49.150 9.628   1.00 79.34  ? 2   DG  D C5    1 
ATOM   4752 C  C6    . DG  D 3 2   ? 84.010 -48.130 8.647   1.00 78.54  ? 2   DG  D C6    1 
ATOM   4753 O  O6    . DG  D 3 2   ? 83.320 -48.173 7.618   1.00 78.23  ? 2   DG  D O6    1 
ATOM   4754 N  N1    . DG  D 3 2   ? 84.727 -46.967 8.946   1.00 78.59  ? 2   DG  D N1    1 
ATOM   4755 C  C2    . DG  D 3 2   ? 85.527 -46.797 10.056  1.00 78.72  ? 2   DG  D C2    1 
ATOM   4756 N  N2    . DG  D 3 2   ? 86.112 -45.598 10.192  1.00 78.15  ? 2   DG  D N2    1 
ATOM   4757 N  N3    . DG  D 3 2   ? 85.725 -47.741 10.981  1.00 79.37  ? 2   DG  D N3    1 
ATOM   4758 C  C4    . DG  D 3 2   ? 85.039 -48.887 10.704  1.00 80.11  ? 2   DG  D C4    1 
ATOM   4759 P  P     . DC  D 3 3   ? 85.879 -50.382 17.081  1.00 81.58  ? 3   DC  D P     1 
ATOM   4760 O  OP1   . DC  D 3 3   ? 86.873 -50.835 18.074  1.00 81.12  ? 3   DC  D OP1   1 
ATOM   4761 O  OP2   . DC  D 3 3   ? 84.524 -50.979 17.076  1.00 82.59  ? 3   DC  D OP2   1 
ATOM   4762 O  "O5'" . DC  D 3 3   ? 85.696 -48.804 17.177  1.00 78.77  ? 3   DC  D "O5'" 1 
ATOM   4763 C  "C5'" . DC  D 3 3   ? 86.813 -47.964 17.052  1.00 76.70  ? 3   DC  D "C5'" 1 
ATOM   4764 C  "C4'" . DC  D 3 3   ? 86.430 -46.615 16.494  1.00 74.35  ? 3   DC  D "C4'" 1 
ATOM   4765 O  "O4'" . DC  D 3 3   ? 85.907 -46.766 15.171  1.00 73.51  ? 3   DC  D "O4'" 1 
ATOM   4766 C  "C3'" . DC  D 3 3   ? 85.382 -45.868 17.286  1.00 73.25  ? 3   DC  D "C3'" 1 
ATOM   4767 O  "O3'" . DC  D 3 3   ? 85.975 -44.765 17.914  1.00 72.58  ? 3   DC  D "O3'" 1 
ATOM   4768 C  "C2'" . DC  D 3 3   ? 84.337 -45.431 16.251  1.00 73.26  ? 3   DC  D "C2'" 1 
ATOM   4769 C  "C1'" . DC  D 3 3   ? 85.000 -45.735 14.922  1.00 73.07  ? 3   DC  D "C1'" 1 
ATOM   4770 N  N1    . DC  D 3 3   ? 84.041 -46.208 13.871  1.00 73.29  ? 3   DC  D N1    1 
ATOM   4771 C  C2    . DC  D 3 3   ? 83.783 -45.401 12.744  1.00 74.35  ? 3   DC  D C2    1 
ATOM   4772 O  O2    . DC  D 3 3   ? 84.345 -44.302 12.632  1.00 74.01  ? 3   DC  D O2    1 
ATOM   4773 N  N3    . DC  D 3 3   ? 82.917 -45.863 11.795  1.00 74.73  ? 3   DC  D N3    1 
ATOM   4774 C  C4    . DC  D 3 3   ? 82.360 -47.077 11.919  1.00 74.15  ? 3   DC  D C4    1 
ATOM   4775 N  N4    . DC  D 3 3   ? 81.550 -47.491 10.940  1.00 74.55  ? 3   DC  D N4    1 
ATOM   4776 C  C5    . DC  D 3 3   ? 82.620 -47.919 13.049  1.00 72.74  ? 3   DC  D C5    1 
ATOM   4777 C  C6    . DC  D 3 3   ? 83.450 -47.450 13.989  1.00 72.66  ? 3   DC  D C6    1 
ATOM   4778 P  P     . DG  D 3 4   ? 85.253 -44.073 19.154  1.00 71.64  ? 4   DG  D P     1 
ATOM   4779 O  OP1   . DG  D 3 4   ? 86.300 -43.519 20.037  1.00 72.90  ? 4   DG  D OP1   1 
ATOM   4780 O  OP2   . DG  D 3 4   ? 84.260 -45.033 19.698  1.00 72.88  ? 4   DG  D OP2   1 
ATOM   4781 O  "O5'" . DG  D 3 4   ? 84.463 -42.884 18.486  1.00 69.50  ? 4   DG  D "O5'" 1 
ATOM   4782 C  "C5'" . DG  D 3 4   ? 85.138 -41.696 18.152  1.00 68.93  ? 4   DG  D "C5'" 1 
ATOM   4783 C  "C4'" . DG  D 3 4   ? 84.213 -40.765 17.407  1.00 67.70  ? 4   DG  D "C4'" 1 
ATOM   4784 O  "O4'" . DG  D 3 4   ? 83.619 -41.471 16.295  1.00 66.61  ? 4   DG  D "O4'" 1 
ATOM   4785 C  "C3'" . DG  D 3 4   ? 83.063 -40.193 18.237  1.00 67.14  ? 4   DG  D "C3'" 1 
ATOM   4786 O  "O3'" . DG  D 3 4   ? 83.025 -38.800 18.032  1.00 68.98  ? 4   DG  D "O3'" 1 
ATOM   4787 C  "C2'" . DG  D 3 4   ? 81.821 -40.927 17.713  1.00 65.89  ? 4   DG  D "C2'" 1 
ATOM   4788 C  "C1'" . DG  D 3 4   ? 82.225 -41.287 16.290  1.00 64.95  ? 4   DG  D "C1'" 1 
ATOM   4789 N  N9    . DG  D 3 4   ? 81.613 -42.511 15.760  1.00 61.41  ? 4   DG  D N9    1 
ATOM   4790 C  C8    . DG  D 3 4   ? 81.448 -43.723 16.399  1.00 59.65  ? 4   DG  D C8    1 
ATOM   4791 N  N7    . DG  D 3 4   ? 80.922 -44.652 15.634  1.00 59.05  ? 4   DG  D N7    1 
ATOM   4792 C  C5    . DG  D 3 4   ? 80.729 -44.010 14.405  1.00 59.11  ? 4   DG  D C5    1 
ATOM   4793 C  C6    . DG  D 3 4   ? 80.178 -44.494 13.177  1.00 58.45  ? 4   DG  D C6    1 
ATOM   4794 O  O6    . DG  D 3 4   ? 79.719 -45.620 12.927  1.00 59.10  ? 4   DG  D O6    1 
ATOM   4795 N  N1    . DG  D 3 4   ? 80.151 -43.502 12.189  1.00 57.44  ? 4   DG  D N1    1 
ATOM   4796 C  C2    . DG  D 3 4   ? 80.599 -42.203 12.358  1.00 56.95  ? 4   DG  D C2    1 
ATOM   4797 N  N2    . DG  D 3 4   ? 80.486 -41.384 11.297  1.00 55.34  ? 4   DG  D N2    1 
ATOM   4798 N  N3    . DG  D 3 4   ? 81.138 -41.746 13.488  1.00 58.28  ? 4   DG  D N3    1 
ATOM   4799 C  C4    . DG  D 3 4   ? 81.163 -42.697 14.468  1.00 59.63  ? 4   DG  D C4    1 
ATOM   4800 P  P     . DA  D 3 5   ? 81.856 -37.870 18.605  1.00 71.83  ? 5   DA  D P     1 
ATOM   4801 O  OP1   . DA  D 3 5   ? 82.415 -36.512 18.887  1.00 71.46  ? 5   DA  D OP1   1 
ATOM   4802 O  OP2   . DA  D 3 5   ? 81.122 -38.614 19.663  1.00 72.64  ? 5   DA  D OP2   1 
ATOM   4803 O  "O5'" . DA  D 3 5   ? 80.916 -37.762 17.346  1.00 72.76  ? 5   DA  D "O5'" 1 
ATOM   4804 C  "C5'" . DA  D 3 5   ? 81.407 -37.225 16.147  1.00 73.41  ? 5   DA  D "C5'" 1 
ATOM   4805 C  "C4'" . DA  D 3 5   ? 80.310 -37.207 15.118  1.00 74.04  ? 5   DA  D "C4'" 1 
ATOM   4806 O  "O4'" . DA  D 3 5   ? 79.944 -38.571 14.786  1.00 73.29  ? 5   DA  D "O4'" 1 
ATOM   4807 C  "C3'" . DA  D 3 5   ? 79.025 -36.513 15.568  1.00 75.75  ? 5   DA  D "C3'" 1 
ATOM   4808 O  "O3'" . DA  D 3 5   ? 78.580 -35.695 14.506  1.00 79.98  ? 5   DA  D "O3'" 1 
ATOM   4809 C  "C2'" . DA  D 3 5   ? 78.060 -37.682 15.856  1.00 73.09  ? 5   DA  D "C2'" 1 
ATOM   4810 C  "C1'" . DA  D 3 5   ? 78.546 -38.712 14.849  1.00 71.12  ? 5   DA  D "C1'" 1 
ATOM   4811 N  N9    . DA  D 3 5   ? 78.247 -40.096 15.177  1.00 66.88  ? 5   DA  D N9    1 
ATOM   4812 C  C8    . DA  D 3 5   ? 78.424 -40.736 16.379  1.00 66.01  ? 5   DA  D C8    1 
ATOM   4813 N  N7    . DA  D 3 5   ? 78.095 -42.018 16.358  1.00 65.20  ? 5   DA  D N7    1 
ATOM   4814 C  C5    . DA  D 3 5   ? 77.697 -42.227 15.037  1.00 64.24  ? 5   DA  D C5    1 
ATOM   4815 C  C6    . DA  D 3 5   ? 77.224 -43.373 14.341  1.00 62.28  ? 5   DA  D C6    1 
ATOM   4816 N  N6    . DA  D 3 5   ? 77.071 -44.575 14.902  1.00 61.05  ? 5   DA  D N6    1 
ATOM   4817 N  N1    . DA  D 3 5   ? 76.940 -43.233 13.034  1.00 62.57  ? 5   DA  D N1    1 
ATOM   4818 C  C2    . DA  D 3 5   ? 77.088 -42.025 12.450  1.00 63.44  ? 5   DA  D C2    1 
ATOM   4819 N  N3    . DA  D 3 5   ? 77.501 -40.878 12.993  1.00 64.00  ? 5   DA  D N3    1 
ATOM   4820 C  C4    . DA  D 3 5   ? 77.805 -41.051 14.299  1.00 64.85  ? 5   DA  D C4    1 
ATOM   4821 P  P     . DA  D 3 6   ? 77.437 -34.579 14.711  1.00 82.46  ? 6   DA  D P     1 
ATOM   4822 O  OP1   . DA  D 3 6   ? 78.103 -33.251 14.595  1.00 83.44  ? 6   DA  D OP1   1 
ATOM   4823 O  OP2   . DA  D 3 6   ? 76.609 -34.925 15.921  1.00 82.04  ? 6   DA  D OP2   1 
ATOM   4824 O  "O5'" . DA  D 3 6   ? 76.515 -34.798 13.421  1.00 79.20  ? 6   DA  D "O5'" 1 
ATOM   4825 C  "C5'" . DA  D 3 6   ? 77.066 -35.344 12.228  1.00 74.75  ? 6   DA  D "C5'" 1 
ATOM   4826 C  "C4'" . DA  D 3 6   ? 76.036 -36.179 11.502  1.00 70.28  ? 6   DA  D "C4'" 1 
ATOM   4827 O  "O4'" . DA  D 3 6   ? 75.941 -37.501 12.094  1.00 68.62  ? 6   DA  D "O4'" 1 
ATOM   4828 C  "C3'" . DA  D 3 6   ? 74.621 -35.600 11.468  1.00 67.88  ? 6   DA  D "C3'" 1 
ATOM   4829 O  "O3'" . DA  D 3 6   ? 74.211 -35.596 10.111  1.00 67.24  ? 6   DA  D "O3'" 1 
ATOM   4830 C  "C2'" . DA  D 3 6   ? 73.801 -36.568 12.348  1.00 66.80  ? 6   DA  D "C2'" 1 
ATOM   4831 C  "C1'" . DA  D 3 6   ? 74.579 -37.872 12.209  1.00 66.03  ? 6   DA  D "C1'" 1 
ATOM   4832 N  N9    . DA  D 3 6   ? 74.463 -38.784 13.350  1.00 62.61  ? 6   DA  D N9    1 
ATOM   4833 C  C8    . DA  D 3 6   ? 74.744 -38.507 14.664  1.00 61.46  ? 6   DA  D C8    1 
ATOM   4834 N  N7    . DA  D 3 6   ? 74.669 -39.549 15.465  1.00 60.53  ? 6   DA  D N7    1 
ATOM   4835 C  C5    . DA  D 3 6   ? 74.328 -40.595 14.615  1.00 60.48  ? 6   DA  D C5    1 
ATOM   4836 C  C6    . DA  D 3 6   ? 74.073 -41.986 14.839  1.00 59.59  ? 6   DA  D C6    1 
ATOM   4837 N  N6    . DA  D 3 6   ? 74.132 -42.580 16.056  1.00 57.90  ? 6   DA  D N6    1 
ATOM   4838 N  N1    . DA  D 3 6   ? 73.748 -42.742 13.755  1.00 59.27  ? 6   DA  D N1    1 
ATOM   4839 C  C2    . DA  D 3 6   ? 73.674 -42.165 12.550  1.00 59.63  ? 6   DA  D C2    1 
ATOM   4840 N  N3    . DA  D 3 6   ? 73.904 -40.890 12.212  1.00 60.62  ? 6   DA  D N3    1 
ATOM   4841 C  C4    . DA  D 3 6   ? 74.220 -40.145 13.302  1.00 61.24  ? 6   DA  D C4    1 
ATOM   4842 P  P     . DA  D 3 7   ? 72.832 -34.972 9.604   1.00 65.20  ? 7   DA  D P     1 
ATOM   4843 O  OP1   . DA  D 3 7   ? 73.059 -34.373 8.265   1.00 66.24  ? 7   DA  D OP1   1 
ATOM   4844 O  OP2   . DA  D 3 7   ? 72.246 -34.149 10.688  1.00 64.92  ? 7   DA  D OP2   1 
ATOM   4845 O  "O5'" . DA  D 3 7   ? 71.981 -36.287 9.418   1.00 62.89  ? 7   DA  D "O5'" 1 
ATOM   4846 C  "C5'" . DA  D 3 7   ? 72.529 -37.375 8.704   1.00 61.55  ? 7   DA  D "C5'" 1 
ATOM   4847 C  "C4'" . DA  D 3 7   ? 71.562 -38.536 8.670   1.00 61.71  ? 7   DA  D "C4'" 1 
ATOM   4848 O  "O4'" . DA  D 3 7   ? 71.672 -39.290 9.894   1.00 62.20  ? 7   DA  D "O4'" 1 
ATOM   4849 C  "C3'" . DA  D 3 7   ? 70.086 -38.164 8.516   1.00 62.08  ? 7   DA  D "C3'" 1 
ATOM   4850 O  "O3'" . DA  D 3 7   ? 69.544 -38.901 7.415   1.00 63.00  ? 7   DA  D "O3'" 1 
ATOM   4851 C  "C2'" . DA  D 3 7   ? 69.455 -38.535 9.875   1.00 61.32  ? 7   DA  D "C2'" 1 
ATOM   4852 C  "C1'" . DA  D 3 7   ? 70.394 -39.607 10.393  1.00 60.62  ? 7   DA  D "C1'" 1 
ATOM   4853 N  N9    . DA  D 3 7   ? 70.512 -39.661 11.840  1.00 58.41  ? 7   DA  D N9    1 
ATOM   4854 C  C8    . DA  D 3 7   ? 70.869 -38.638 12.676  1.00 57.81  ? 7   DA  D C8    1 
ATOM   4855 N  N7    . DA  D 3 7   ? 70.991 -39.002 13.939  1.00 57.74  ? 7   DA  D N7    1 
ATOM   4856 C  C5    . DA  D 3 7   ? 70.785 -40.378 13.913  1.00 57.20  ? 7   DA  D C5    1 
ATOM   4857 C  C6    . DA  D 3 7   ? 70.758 -41.374 14.936  1.00 57.02  ? 7   DA  D C6    1 
ATOM   4858 N  N6    . DA  D 3 7   ? 71.025 -41.122 16.234  1.00 56.12  ? 7   DA  D N6    1 
ATOM   4859 N  N1    . DA  D 3 7   ? 70.475 -42.654 14.564  1.00 56.85  ? 7   DA  D N1    1 
ATOM   4860 C  C2    . DA  D 3 7   ? 70.222 -42.915 13.275  1.00 57.21  ? 7   DA  D C2    1 
ATOM   4861 N  N3    . DA  D 3 7   ? 70.203 -42.067 12.233  1.00 57.90  ? 7   DA  D N3    1 
ATOM   4862 C  C4    . DA  D 3 7   ? 70.492 -40.800 12.625  1.00 57.71  ? 7   DA  D C4    1 
ATOM   4863 P  P     . DT  D 3 8   ? 68.001 -38.812 6.983   1.00 62.28  ? 8   DT  D P     1 
ATOM   4864 O  OP1   . DT  D 3 8   ? 67.932 -39.093 5.526   1.00 61.71  ? 8   DT  D OP1   1 
ATOM   4865 O  OP2   . DT  D 3 8   ? 67.388 -37.569 7.530   1.00 61.35  ? 8   DT  D OP2   1 
ATOM   4866 O  "O5'" . DT  D 3 8   ? 67.395 -40.047 7.786   1.00 61.39  ? 8   DT  D "O5'" 1 
ATOM   4867 C  "C5'" . DT  D 3 8   ? 67.863 -41.349 7.531   1.00 60.93  ? 8   DT  D "C5'" 1 
ATOM   4868 C  "C4'" . DT  D 3 8   ? 67.296 -42.319 8.541   1.00 61.42  ? 8   DT  D "C4'" 1 
ATOM   4869 O  "O4'" . DT  D 3 8   ? 67.690 -41.951 9.889   1.00 61.32  ? 8   DT  D "O4'" 1 
ATOM   4870 C  "C3'" . DT  D 3 8   ? 65.776 -42.434 8.555   1.00 61.76  ? 8   DT  D "C3'" 1 
ATOM   4871 O  "O3'" . DT  D 3 8   ? 65.470 -43.759 8.214   1.00 64.02  ? 8   DT  D "O3'" 1 
ATOM   4872 C  "C2'" . DT  D 3 8   ? 65.379 -42.087 10.014  1.00 60.31  ? 8   DT  D "C2'" 1 
ATOM   4873 C  "C1'" . DT  D 3 8   ? 66.675 -42.337 10.769  1.00 59.49  ? 8   DT  D "C1'" 1 
ATOM   4874 N  N1    . DT  D 3 8   ? 66.850 -41.575 12.057  1.00 57.99  ? 8   DT  D N1    1 
ATOM   4875 C  C2    . DT  D 3 8   ? 66.991 -42.282 13.239  1.00 58.12  ? 8   DT  D C2    1 
ATOM   4876 O  O2    . DT  D 3 8   ? 66.914 -43.498 13.316  1.00 59.37  ? 8   DT  D O2    1 
ATOM   4877 N  N3    . DT  D 3 8   ? 67.243 -41.515 14.346  1.00 57.42  ? 8   DT  D N3    1 
ATOM   4878 C  C4    . DT  D 3 8   ? 67.386 -40.140 14.415  1.00 57.62  ? 8   DT  D C4    1 
ATOM   4879 O  O4    . DT  D 3 8   ? 67.615 -39.604 15.510  1.00 58.41  ? 8   DT  D O4    1 
ATOM   4880 C  C5    . DT  D 3 8   ? 67.253 -39.447 13.153  1.00 56.81  ? 8   DT  D C5    1 
ATOM   4881 C  C7    . DT  D 3 8   ? 67.380 -37.958 13.110  1.00 55.30  ? 8   DT  D C7    1 
ATOM   4882 C  C6    . DT  D 3 8   ? 67.007 -40.188 12.036  1.00 57.49  ? 8   DT  D C6    1 
ATOM   4883 P  P     . DT  D 3 9   ? 63.992 -44.242 7.871   1.00 64.85  ? 9   DT  D P     1 
ATOM   4884 O  OP1   . DT  D 3 9   ? 64.092 -45.212 6.751   1.00 64.06  ? 9   DT  D OP1   1 
ATOM   4885 O  OP2   . DT  D 3 9   ? 63.109 -43.054 7.765   1.00 65.68  ? 9   DT  D OP2   1 
ATOM   4886 O  "O5'" . DT  D 3 9   ? 63.595 -45.014 9.196   1.00 64.16  ? 9   DT  D "O5'" 1 
ATOM   4887 C  "C5'" . DT  D 3 9   ? 64.447 -45.999 9.718   1.00 63.34  ? 9   DT  D "C5'" 1 
ATOM   4888 C  "C4'" . DT  D 3 9   ? 64.052 -46.334 11.134  1.00 63.13  ? 9   DT  D "C4'" 1 
ATOM   4889 O  "O4'" . DT  D 3 9   ? 64.409 -45.254 12.007  1.00 62.43  ? 9   DT  D "O4'" 1 
ATOM   4890 C  "C3'" . DT  D 3 9   ? 62.563 -46.606 11.371  1.00 63.45  ? 9   DT  D "C3'" 1 
ATOM   4891 O  "O3'" . DT  D 3 9   ? 62.450 -47.916 11.936  1.00 66.11  ? 9   DT  D "O3'" 1 
ATOM   4892 C  "C2'" . DT  D 3 9   ? 62.134 -45.488 12.341  1.00 61.57  ? 9   DT  D "C2'" 1 
ATOM   4893 C  "C1'" . DT  D 3 9   ? 63.447 -45.145 13.013  1.00 61.03  ? 9   DT  D "C1'" 1 
ATOM   4894 N  N1    . DT  D 3 9   ? 63.542 -43.757 13.594  1.00 59.78  ? 9   DT  D N1    1 
ATOM   4895 C  C2    . DT  D 3 9   ? 63.952 -43.607 14.907  1.00 59.50  ? 9   DT  D C2    1 
ATOM   4896 O  O2    . DT  D 3 9   ? 64.158 -44.551 15.660  1.00 60.00  ? 9   DT  D O2    1 
ATOM   4897 N  N3    . DT  D 3 9   ? 64.061 -42.302 15.331  1.00 58.73  ? 9   DT  D N3    1 
ATOM   4898 C  C4    . DT  D 3 9   ? 63.828 -41.146 14.595  1.00 58.72  ? 9   DT  D C4    1 
ATOM   4899 O  O4    . DT  D 3 9   ? 63.988 -40.040 15.133  1.00 58.71  ? 9   DT  D O4    1 
ATOM   4900 C  C5    . DT  D 3 9   ? 63.408 -41.369 13.216  1.00 58.47  ? 9   DT  D C5    1 
ATOM   4901 C  C7    . DT  D 3 9   ? 63.094 -40.208 12.314  1.00 57.93  ? 9   DT  D C7    1 
ATOM   4902 C  C6    . DT  D 3 9   ? 63.311 -42.645 12.784  1.00 59.09  ? 9   DT  D C6    1 
ATOM   4903 P  P     . DC  D 3 10  ? 61.045 -48.585 12.365  1.00 68.00  ? 10  DC  D P     1 
ATOM   4904 O  OP1   . DC  D 3 10  ? 61.177 -50.046 12.171  1.00 68.69  ? 10  DC  D OP1   1 
ATOM   4905 O  OP2   . DC  D 3 10  ? 59.915 -47.839 11.728  1.00 68.19  ? 10  DC  D OP2   1 
ATOM   4906 O  "O5'" . DC  D 3 10  ? 61.022 -48.292 13.925  1.00 66.60  ? 10  DC  D "O5'" 1 
ATOM   4907 C  "C5'" . DC  D 3 10  ? 62.125 -48.673 14.713  1.00 65.00  ? 10  DC  D "C5'" 1 
ATOM   4908 C  "C4'" . DC  D 3 10  ? 61.876 -48.345 16.159  1.00 63.88  ? 10  DC  D "C4'" 1 
ATOM   4909 O  "O4'" . DC  D 3 10  ? 62.043 -46.924 16.376  1.00 63.01  ? 10  DC  D "O4'" 1 
ATOM   4910 C  "C3'" . DC  D 3 10  ? 60.498 -48.706 16.680  1.00 64.01  ? 10  DC  D "C3'" 1 
ATOM   4911 O  "O3'" . DC  D 3 10  ? 60.655 -49.355 17.933  1.00 66.16  ? 10  DC  D "O3'" 1 
ATOM   4912 C  "C2'" . DC  D 3 10  ? 59.791 -47.343 16.804  1.00 62.63  ? 10  DC  D "C2'" 1 
ATOM   4913 C  "C1'" . DC  D 3 10  ? 60.957 -46.411 17.109  1.00 61.07  ? 10  DC  D "C1'" 1 
ATOM   4914 N  N1    . DC  D 3 10  ? 60.782 -44.952 16.693  1.00 58.83  ? 10  DC  D N1    1 
ATOM   4915 C  C2    . DC  D 3 10  ? 61.042 -43.929 17.634  1.00 58.80  ? 10  DC  D C2    1 
ATOM   4916 O  O2    . DC  D 3 10  ? 61.296 -44.238 18.814  1.00 59.73  ? 10  DC  D O2    1 
ATOM   4917 N  N3    . DC  D 3 10  ? 60.994 -42.624 17.225  1.00 57.27  ? 10  DC  D N3    1 
ATOM   4918 C  C4    . DC  D 3 10  ? 60.748 -42.330 15.940  1.00 57.02  ? 10  DC  D C4    1 
ATOM   4919 N  N4    . DC  D 3 10  ? 60.701 -41.029 15.590  1.00 57.07  ? 10  DC  D N4    1 
ATOM   4920 C  C5    . DC  D 3 10  ? 60.503 -43.355 14.961  1.00 56.48  ? 10  DC  D C5    1 
ATOM   4921 C  C6    . DC  D 3 10  ? 60.552 -44.632 15.372  1.00 57.17  ? 10  DC  D C6    1 
ATOM   4922 P  P     . DC  D 3 11  ? 59.481 -50.239 18.558  1.00 67.16  ? 11  DC  D P     1 
ATOM   4923 O  OP1   . DC  D 3 11  ? 60.106 -51.241 19.462  1.00 68.04  ? 11  DC  D OP1   1 
ATOM   4924 O  OP2   . DC  D 3 11  ? 58.583 -50.677 17.449  1.00 66.74  ? 11  DC  D OP2   1 
ATOM   4925 O  "O5'" . DC  D 3 11  ? 58.678 -49.167 19.439  1.00 64.98  ? 11  DC  D "O5'" 1 
ATOM   4926 C  "C5'" . DC  D 3 11  ? 59.297 -48.481 20.513  1.00 62.63  ? 11  DC  D "C5'" 1 
ATOM   4927 C  "C4'" . DC  D 3 11  ? 58.351 -47.432 21.094  1.00 61.61  ? 11  DC  D "C4'" 1 
ATOM   4928 O  "O4'" . DC  D 3 11  ? 58.532 -46.168 20.401  1.00 60.88  ? 11  DC  D "O4'" 1 
ATOM   4929 C  "C3'" . DC  D 3 11  ? 56.841 -47.747 21.005  1.00 61.55  ? 11  DC  D "C3'" 1 
ATOM   4930 O  "O3'" . DC  D 3 11  ? 56.192 -47.348 22.231  1.00 63.18  ? 11  DC  D "O3'" 1 
ATOM   4931 C  "C2'" . DC  D 3 11  ? 56.389 -46.877 19.834  1.00 60.22  ? 11  DC  D "C2'" 1 
ATOM   4932 C  "C1'" . DC  D 3 11  ? 57.276 -45.665 20.052  1.00 60.31  ? 11  DC  D "C1'" 1 
ATOM   4933 N  N1    . DC  D 3 11  ? 57.402 -44.704 18.880  1.00 60.00  ? 11  DC  D N1    1 
ATOM   4934 C  C2    . DC  D 3 11  ? 57.603 -43.348 19.141  1.00 59.40  ? 11  DC  D C2    1 
ATOM   4935 O  O2    . DC  D 3 11  ? 57.742 -42.983 20.303  1.00 59.90  ? 11  DC  D O2    1 
ATOM   4936 N  N3    . DC  D 3 11  ? 57.638 -42.470 18.105  1.00 58.34  ? 11  DC  D N3    1 
ATOM   4937 C  C4    . DC  D 3 11  ? 57.509 -42.903 16.853  1.00 57.93  ? 11  DC  D C4    1 
ATOM   4938 N  N4    . DC  D 3 11  ? 57.572 -41.996 15.873  1.00 57.85  ? 11  DC  D N4    1 
ATOM   4939 C  C5    . DC  D 3 11  ? 57.285 -44.277 16.552  1.00 58.13  ? 11  DC  D C5    1 
ATOM   4940 C  C6    . DC  D 3 11  ? 57.220 -45.134 17.587  1.00 59.31  ? 11  DC  D C6    1 
ATOM   4941 P  P     . DA  D 3 12  ? 55.579 -48.444 23.234  1.00 63.33  ? 12  DA  D P     1 
ATOM   4942 O  OP1   . DA  D 3 12  ? 56.581 -49.521 23.419  1.00 62.99  ? 12  DA  D OP1   1 
ATOM   4943 O  OP2   . DA  D 3 12  ? 54.213 -48.760 22.754  1.00 63.63  ? 12  DA  D OP2   1 
ATOM   4944 O  "O5'" . DA  D 3 12  ? 55.413 -47.658 24.610  1.00 62.29  ? 12  DA  D "O5'" 1 
ATOM   4945 C  "C5'" . DA  D 3 12  ? 56.495 -47.051 25.239  1.00 61.33  ? 12  DA  D "C5'" 1 
ATOM   4946 C  "C4'" . DA  D 3 12  ? 56.128 -45.631 25.649  1.00 61.72  ? 12  DA  D "C4'" 1 
ATOM   4947 O  "O4'" . DA  D 3 12  ? 56.041 -44.763 24.490  1.00 61.42  ? 12  DA  D "O4'" 1 
ATOM   4948 C  "C3'" . DA  D 3 12  ? 54.829 -45.430 26.419  1.00 62.44  ? 12  DA  D "C3'" 1 
ATOM   4949 O  "O3'" . DA  D 3 12  ? 55.086 -44.439 27.394  1.00 65.28  ? 12  DA  D "O3'" 1 
ATOM   4950 C  "C2'" . DA  D 3 12  ? 53.855 -44.921 25.339  1.00 61.40  ? 12  DA  D "C2'" 1 
ATOM   4951 C  "C1'" . DA  D 3 12  ? 54.789 -44.103 24.452  1.00 60.96  ? 12  DA  D "C1'" 1 
ATOM   4952 N  N9    . DA  D 3 12  ? 54.421 -44.031 23.044  1.00 60.20  ? 12  DA  D N9    1 
ATOM   4953 C  C8    . DA  D 3 12  ? 54.094 -45.080 22.235  1.00 59.92  ? 12  DA  D C8    1 
ATOM   4954 N  N7    . DA  D 3 12  ? 53.988 -44.763 20.966  1.00 59.63  ? 12  DA  D N7    1 
ATOM   4955 C  C5    . DA  D 3 12  ? 54.379 -43.441 20.917  1.00 58.59  ? 12  DA  D C5    1 
ATOM   4956 C  C6    . DA  D 3 12  ? 54.505 -42.523 19.853  1.00 57.16  ? 12  DA  D C6    1 
ATOM   4957 N  N6    . DA  D 3 12  ? 54.262 -42.837 18.577  1.00 55.89  ? 12  DA  D N6    1 
ATOM   4958 N  N1    . DA  D 3 12  ? 54.927 -41.266 20.154  1.00 57.31  ? 12  DA  D N1    1 
ATOM   4959 C  C2    . DA  D 3 12  ? 55.187 -40.947 21.431  1.00 57.28  ? 12  DA  D C2    1 
ATOM   4960 N  N3    . DA  D 3 12  ? 55.110 -41.724 22.511  1.00 58.27  ? 12  DA  D N3    1 
ATOM   4961 C  C4    . DA  D 3 12  ? 54.679 -42.973 22.186  1.00 59.30  ? 12  DA  D C4    1 
ATOM   4962 P  P     . DT  D 3 13  ? 54.060 -44.107 28.589  1.00 67.28  ? 13  DT  D P     1 
ATOM   4963 O  OP1   . DT  D 3 13  ? 54.918 -43.822 29.769  1.00 68.23  ? 13  DT  D OP1   1 
ATOM   4964 O  OP2   . DT  D 3 13  ? 52.990 -45.153 28.647  1.00 67.33  ? 13  DT  D OP2   1 
ATOM   4965 O  "O5'" . DT  D 3 13  ? 53.374 -42.745 28.109  1.00 64.64  ? 13  DT  D "O5'" 1 
ATOM   4966 C  "C5'" . DT  D 3 13  ? 54.196 -41.638 27.731  1.00 62.29  ? 13  DT  D "C5'" 1 
ATOM   4967 C  "C4'" . DT  D 3 13  ? 53.377 -40.508 27.161  1.00 59.65  ? 13  DT  D "C4'" 1 
ATOM   4968 O  "O4'" . DT  D 3 13  ? 53.280 -40.670 25.749  1.00 58.96  ? 13  DT  D "O4'" 1 
ATOM   4969 C  "C3'" . DT  D 3 13  ? 51.943 -40.369 27.701  1.00 59.15  ? 13  DT  D "C3'" 1 
ATOM   4970 O  "O3'" . DT  D 3 13  ? 51.801 -39.068 28.245  1.00 60.60  ? 13  DT  D "O3'" 1 
ATOM   4971 C  "C2'" . DT  D 3 13  ? 51.063 -40.578 26.468  1.00 58.82  ? 13  DT  D "C2'" 1 
ATOM   4972 C  "C1'" . DT  D 3 13  ? 52.018 -40.243 25.326  1.00 59.03  ? 13  DT  D "C1'" 1 
ATOM   4973 N  N1    . DT  D 3 13  ? 51.713 -40.924 24.028  1.00 58.98  ? 13  DT  D N1    1 
ATOM   4974 C  C2    . DT  D 3 13  ? 51.831 -40.214 22.833  1.00 59.79  ? 13  DT  D C2    1 
ATOM   4975 O  O2    . DT  D 3 13  ? 52.141 -39.032 22.767  1.00 60.22  ? 13  DT  D O2    1 
ATOM   4976 N  N3    . DT  D 3 13  ? 51.544 -40.941 21.700  1.00 59.70  ? 13  DT  D N3    1 
ATOM   4977 C  C4    . DT  D 3 13  ? 51.233 -42.289 21.612  1.00 59.41  ? 13  DT  D C4    1 
ATOM   4978 O  O4    . DT  D 3 13  ? 51.040 -42.787 20.493  1.00 59.47  ? 13  DT  D O4    1 
ATOM   4979 C  C5    . DT  D 3 13  ? 51.153 -42.991 22.899  1.00 58.90  ? 13  DT  D C5    1 
ATOM   4980 C  C7    . DT  D 3 13  ? 50.799 -44.447 22.964  1.00 57.36  ? 13  DT  D C7    1 
ATOM   4981 C  C6    . DT  D 3 13  ? 51.409 -42.281 24.026  1.00 59.43  ? 13  DT  D C6    1 
ATOM   4982 P  P     . DG  D 3 14  ? 50.576 -38.629 29.192  1.00 62.12  ? 14  DG  D P     1 
ATOM   4983 O  OP1   . DG  D 3 14  ? 51.091 -37.655 30.172  1.00 63.77  ? 14  DG  D OP1   1 
ATOM   4984 O  OP2   . DG  D 3 14  ? 49.853 -39.846 29.659  1.00 61.79  ? 14  DG  D OP2   1 
ATOM   4985 O  "O5'" . DG  D 3 14  ? 49.629 -37.824 28.187  1.00 60.86  ? 14  DG  D "O5'" 1 
ATOM   4986 C  "C5'" . DG  D 3 14  ? 50.198 -36.950 27.220  1.00 59.20  ? 14  DG  D "C5'" 1 
ATOM   4987 C  "C4'" . DG  D 3 14  ? 49.197 -36.619 26.133  1.00 58.47  ? 14  DG  D "C4'" 1 
ATOM   4988 O  "O4'" . DG  D 3 14  ? 49.175 -37.673 25.143  1.00 57.95  ? 14  DG  D "O4'" 1 
ATOM   4989 C  "C3'" . DG  D 3 14  ? 47.753 -36.460 26.604  1.00 59.31  ? 14  DG  D "C3'" 1 
ATOM   4990 O  "O3'" . DG  D 3 14  ? 47.197 -35.286 26.026  1.00 61.64  ? 14  DG  D "O3'" 1 
ATOM   4991 C  "C2'" . DG  D 3 14  ? 47.059 -37.738 26.098  1.00 57.81  ? 14  DG  D "C2'" 1 
ATOM   4992 C  "C1'" . DG  D 3 14  ? 47.829 -37.972 24.819  1.00 56.68  ? 14  DG  D "C1'" 1 
ATOM   4993 N  N9    . DG  D 3 14  ? 47.775 -39.331 24.281  1.00 54.26  ? 14  DG  D N9    1 
ATOM   4994 C  C8    . DG  D 3 14  ? 47.764 -40.526 24.978  1.00 51.89  ? 14  DG  D C8    1 
ATOM   4995 N  N7    . DG  D 3 14  ? 47.819 -41.577 24.204  1.00 51.05  ? 14  DG  D N7    1 
ATOM   4996 C  C5    . DG  D 3 14  ? 47.923 -41.053 22.915  1.00 51.94  ? 14  DG  D C5    1 
ATOM   4997 C  C6    . DG  D 3 14  ? 48.019 -41.707 21.641  1.00 52.40  ? 14  DG  D C6    1 
ATOM   4998 O  O6    . DG  D 3 14  ? 48.082 -42.914 21.397  1.00 53.06  ? 14  DG  D O6    1 
ATOM   4999 N  N1    . DG  D 3 14  ? 48.079 -40.795 20.583  1.00 52.13  ? 14  DG  D N1    1 
ATOM   5000 C  C2    . DG  D 3 14  ? 48.068 -39.422 20.727  1.00 52.07  ? 14  DG  D C2    1 
ATOM   5001 N  N2    . DG  D 3 14  ? 48.137 -38.712 19.599  1.00 51.89  ? 14  DG  D N2    1 
ATOM   5002 N  N3    . DG  D 3 14  ? 47.993 -38.794 21.902  1.00 52.36  ? 14  DG  D N3    1 
ATOM   5003 C  C4    . DG  D 3 14  ? 47.913 -39.672 22.950  1.00 53.21  ? 14  DG  D C4    1 
ATOM   5004 P  P     . DA  D 3 15  ? 45.922 -34.575 26.698  1.00 64.80  ? 15  DA  D P     1 
ATOM   5005 O  OP1   . DA  D 3 15  ? 46.386 -33.306 27.319  1.00 66.15  ? 15  DA  D OP1   1 
ATOM   5006 O  OP2   . DA  D 3 15  ? 45.171 -35.568 27.531  1.00 65.37  ? 15  DA  D OP2   1 
ATOM   5007 O  "O5'" . DA  D 3 15  ? 44.995 -34.253 25.439  1.00 62.49  ? 15  DA  D "O5'" 1 
ATOM   5008 C  "C5'" . DA  D 3 15  ? 45.454 -33.496 24.365  1.00 61.41  ? 15  DA  D "C5'" 1 
ATOM   5009 C  "C4'" . DA  D 3 15  ? 44.560 -33.742 23.164  1.00 60.53  ? 15  DA  D "C4'" 1 
ATOM   5010 O  "O4'" . DA  D 3 15  ? 44.862 -35.067 22.629  1.00 59.38  ? 15  DA  D "O4'" 1 
ATOM   5011 C  "C3'" . DA  D 3 15  ? 43.055 -33.726 23.483  1.00 59.92  ? 15  DA  D "C3'" 1 
ATOM   5012 O  "O3'" . DA  D 3 15  ? 42.324 -33.039 22.476  1.00 61.03  ? 15  DA  D "O3'" 1 
ATOM   5013 C  "C2'" . DA  D 3 15  ? 42.684 -35.203 23.539  1.00 59.74  ? 15  DA  D "C2'" 1 
ATOM   5014 C  "C1'" . DA  D 3 15  ? 43.672 -35.823 22.553  1.00 58.42  ? 15  DA  D "C1'" 1 
ATOM   5015 N  N9    . DA  D 3 15  ? 43.964 -37.231 22.813  1.00 55.75  ? 15  DA  D N9    1 
ATOM   5016 C  C8    . DA  D 3 15  ? 43.889 -37.905 24.013  1.00 54.88  ? 15  DA  D C8    1 
ATOM   5017 N  N7    . DA  D 3 15  ? 44.149 -39.202 23.911  1.00 54.78  ? 15  DA  D N7    1 
ATOM   5018 C  C5    . DA  D 3 15  ? 44.392 -39.379 22.543  1.00 54.49  ? 15  DA  D C5    1 
ATOM   5019 C  C6    . DA  D 3 15  ? 44.702 -40.512 21.751  1.00 53.96  ? 15  DA  D C6    1 
ATOM   5020 N  N6    . DA  D 3 15  ? 44.857 -41.745 22.242  1.00 54.10  ? 15  DA  D N6    1 
ATOM   5021 N  N1    . DA  D 3 15  ? 44.899 -40.318 20.428  1.00 53.54  ? 15  DA  D N1    1 
ATOM   5022 C  C2    . DA  D 3 15  ? 44.740 -39.102 19.914  1.00 53.45  ? 15  DA  D C2    1 
ATOM   5023 N  N3    . DA  D 3 15  ? 44.418 -37.981 20.535  1.00 54.37  ? 15  DA  D N3    1 
ATOM   5024 C  C4    . DA  D 3 15  ? 44.276 -38.178 21.863  1.00 54.80  ? 15  DA  D C4    1 
ATOM   5025 P  P     . DC  D 3 16  ? 40.843 -32.440 22.789  1.00 61.90  ? 16  DC  D P     1 
ATOM   5026 O  OP1   . DC  D 3 16  ? 40.912 -30.955 22.722  1.00 62.92  ? 16  DC  D OP1   1 
ATOM   5027 O  OP2   . DC  D 3 16  ? 40.318 -33.111 24.013  1.00 59.99  ? 16  DC  D OP2   1 
ATOM   5028 O  "O5'" . DC  D 3 16  ? 39.978 -32.943 21.536  1.00 61.51  ? 16  DC  D "O5'" 1 
ATOM   5029 C  "C5'" . DC  D 3 16  ? 40.300 -32.556 20.196  1.00 59.63  ? 16  DC  D "C5'" 1 
ATOM   5030 C  "C4'" . DC  D 3 16  ? 39.847 -33.626 19.205  1.00 59.21  ? 16  DC  D "C4'" 1 
ATOM   5031 O  "O4'" . DC  D 3 16  ? 40.701 -34.767 19.347  1.00 57.33  ? 16  DC  D "O4'" 1 
ATOM   5032 C  "C3'" . DC  D 3 16  ? 38.428 -34.170 19.393  1.00 60.17  ? 16  DC  D "C3'" 1 
ATOM   5033 O  "O3'" . DC  D 3 16  ? 37.510 -33.452 18.582  1.00 63.86  ? 16  DC  D "O3'" 1 
ATOM   5034 C  "C2'" . DC  D 3 16  ? 38.530 -35.617 18.904  1.00 57.74  ? 16  DC  D "C2'" 1 
ATOM   5035 C  "C1'" . DC  D 3 16  ? 40.017 -35.936 18.969  1.00 55.60  ? 16  DC  D "C1'" 1 
ATOM   5036 N  N1    . DC  D 3 16  ? 40.344 -37.005 19.938  1.00 53.72  ? 16  DC  D N1    1 
ATOM   5037 C  C2    . DC  D 3 16  ? 41.012 -38.173 19.501  1.00 53.40  ? 16  DC  D C2    1 
ATOM   5038 O  O2    . DC  D 3 16  ? 41.301 -38.311 18.305  1.00 53.87  ? 16  DC  D O2    1 
ATOM   5039 N  N3    . DC  D 3 16  ? 41.288 -39.145 20.411  1.00 52.98  ? 16  DC  D N3    1 
ATOM   5040 C  C4    . DC  D 3 16  ? 40.950 -38.985 21.704  1.00 51.31  ? 16  DC  D C4    1 
ATOM   5041 N  N4    . DC  D 3 16  ? 41.259 -39.969 22.549  1.00 49.77  ? 16  DC  D N4    1 
ATOM   5042 C  C5    . DC  D 3 16  ? 40.304 -37.798 22.177  1.00 51.52  ? 16  DC  D C5    1 
ATOM   5043 C  C6    . DC  D 3 16  ? 40.027 -36.840 21.277  1.00 52.57  ? 16  DC  D C6    1 
ATOM   5044 P  P     . DA  D 3 17  ? 36.473 -32.426 19.213  1.00 67.96  ? 17  DA  D P     1 
ATOM   5045 O  OP1   . DA  D 3 17  ? 35.410 -32.183 18.227  1.00 68.20  ? 17  DA  D OP1   1 
ATOM   5046 O  OP2   . DA  D 3 17  ? 37.237 -31.296 19.718  1.00 69.77  ? 17  DA  D OP2   1 
ATOM   5047 O  "O5'" . DA  D 3 17  ? 35.865 -33.207 20.457  1.00 72.07  ? 17  DA  D "O5'" 1 
ATOM   5048 C  "C5'" . DA  D 3 17  ? 36.312 -32.907 21.749  1.00 76.33  ? 17  DA  D "C5'" 1 
ATOM   5049 C  "C4'" . DA  D 3 17  ? 35.283 -32.085 22.483  1.00 80.80  ? 17  DA  D "C4'" 1 
ATOM   5050 O  "O4'" . DA  D 3 17  ? 34.369 -32.966 23.165  1.00 83.04  ? 17  DA  D "O4'" 1 
ATOM   5051 C  "C3'" . DA  D 3 17  ? 35.846 -31.167 23.559  1.00 83.16  ? 17  DA  D "C3'" 1 
ATOM   5052 O  "O3'" . DA  D 3 17  ? 34.990 -30.031 23.740  1.00 84.18  ? 17  DA  D "O3'" 1 
ATOM   5053 C  "C2'" . DA  D 3 17  ? 35.864 -32.061 24.796  1.00 84.02  ? 17  DA  D "C2'" 1 
ATOM   5054 C  "C1'" . DA  D 3 17  ? 34.657 -32.983 24.556  1.00 84.72  ? 17  DA  D "C1'" 1 
ATOM   5055 N  N9    . DA  D 3 17  ? 34.877 -34.373 24.980  1.00 86.60  ? 17  DA  D N9    1 
ATOM   5056 C  C8    . DA  D 3 17  ? 36.077 -35.067 25.006  1.00 87.04  ? 17  DA  D C8    1 
ATOM   5057 N  N7    . DA  D 3 17  ? 35.984 -36.292 25.487  1.00 87.45  ? 17  DA  D N7    1 
ATOM   5058 C  C5    . DA  D 3 17  ? 34.627 -36.417 25.799  1.00 88.49  ? 17  DA  D C5    1 
ATOM   5059 C  C6    . DA  D 3 17  ? 33.860 -37.486 26.348  1.00 90.00  ? 17  DA  D C6    1 
ATOM   5060 N  N6    . DA  D 3 17  ? 34.396 -38.680 26.674  1.00 90.89  ? 17  DA  D N6    1 
ATOM   5061 N  N1    . DA  D 3 17  ? 32.512 -37.272 26.548  1.00 89.15  ? 17  DA  D N1    1 
ATOM   5062 C  C2    . DA  D 3 17  ? 31.981 -36.070 26.213  1.00 87.97  ? 17  DA  D C2    1 
ATOM   5063 N  N3    . DA  D 3 17  ? 32.596 -34.996 25.684  1.00 87.28  ? 17  DA  D N3    1 
ATOM   5064 C  C4    . DA  D 3 17  ? 33.930 -35.235 25.501  1.00 87.40  ? 17  DA  D C4    1 
HETATM 5065 ZN ZN    . ZN  E 4 .   ? 23.459 -55.147 46.352  1.00 61.23  2 401 ZN  A ZN    1 
HETATM 5066 C  C1    . GOL F 5 .   ? 17.143 -29.109 9.381   1.00 93.55  ? 402 GOL A C1    1 
HETATM 5067 O  O1    . GOL F 5 .   ? 18.261 -28.288 9.069   1.00 93.61  ? 402 GOL A O1    1 
HETATM 5068 C  C2    . GOL F 5 .   ? 17.365 -30.538 8.942   1.00 93.72  ? 402 GOL A C2    1 
HETATM 5069 O  O2    . GOL F 5 .   ? 18.600 -31.017 9.477   1.00 92.46  ? 402 GOL A O2    1 
HETATM 5070 C  C3    . GOL F 5 .   ? 17.355 -30.680 7.436   1.00 95.50  ? 402 GOL A C3    1 
HETATM 5071 O  O3    . GOL F 5 .   ? 16.884 -31.961 7.025   1.00 95.38  ? 402 GOL A O3    1 
HETATM 5072 C  C1    . GOL G 5 .   ? 34.405 -13.342 12.336  1.00 94.69  ? 403 GOL A C1    1 
HETATM 5073 O  O1    . GOL G 5 .   ? 35.535 -12.500 12.256  1.00 95.31  ? 403 GOL A O1    1 
HETATM 5074 C  C2    . GOL G 5 .   ? 33.440 -12.845 13.385  1.00 96.84  ? 403 GOL A C2    1 
HETATM 5075 O  O2    . GOL G 5 .   ? 33.150 -11.463 13.170  1.00 97.59  ? 403 GOL A O2    1 
HETATM 5076 C  C3    . GOL G 5 .   ? 33.945 -13.074 14.792  1.00 99.37  ? 403 GOL A C3    1 
HETATM 5077 O  O3    . GOL G 5 .   ? 35.284 -12.624 14.956  1.00 99.45  ? 403 GOL A O3    1 
HETATM 5078 N  N1    . X2P H 6 .   ? 29.285 -36.761 19.927  1.00 67.47  ? 404 X2P A N1    1 
HETATM 5079 C  C4    . X2P H 6 .   ? 32.141 -36.732 22.501  1.00 60.49  ? 404 X2P A C4    1 
HETATM 5080 C  C5    . X2P H 6 .   ? 30.028 -36.771 21.107  1.00 68.37  ? 404 X2P A C5    1 
HETATM 5081 C  C6    . X2P H 6 .   ? 29.960 -36.680 18.708  1.00 67.05  ? 404 X2P A C6    1 
HETATM 5082 C  C7    . X2P H 6 .   ? 31.404 -36.656 18.771  1.00 66.91  ? 404 X2P A C7    1 
HETATM 5083 C  C8    . X2P H 6 .   ? 27.810 -36.930 20.129  1.00 64.85  ? 404 X2P A C8    1 
HETATM 5084 C  C10   . X2P H 6 .   ? 26.627 -37.211 22.391  1.00 72.26  ? 404 X2P A C10   1 
HETATM 5085 C  C13   . X2P H 6 .   ? 27.267 -38.256 19.572  1.00 61.09  ? 404 X2P A C13   1 
HETATM 5086 C  C15   . X2P H 6 .   ? 26.314 -36.393 18.259  1.00 58.82  ? 404 X2P A C15   1 
HETATM 5087 C  C17   . X2P H 6 .   ? 25.510 -35.835 19.385  1.00 60.43  ? 404 X2P A C17   1 
HETATM 5088 C  C20   . X2P H 6 .   ? 36.627 -38.451 22.718  1.00 42.57  ? 404 X2P A C20   1 
HETATM 5089 C  C21   . X2P H 6 .   ? 37.345 -39.625 22.877  1.00 42.38  ? 404 X2P A C21   1 
HETATM 5090 C  C22   . X2P H 6 .   ? 37.831 -40.261 21.761  1.00 48.84  ? 404 X2P A C22   1 
HETATM 5091 C  C24   . X2P H 6 .   ? 36.919 -38.566 20.342  1.00 45.00  ? 404 X2P A C24   1 
HETATM 5092 F  F     . X2P H 6 .   ? 38.517 -41.423 21.902  1.00 53.19  ? 404 X2P A F     1 
HETATM 5093 C  C23   . X2P H 6 .   ? 37.625 -39.747 20.498  1.00 49.92  ? 404 X2P A C23   1 
HETATM 5094 CL CL    . X2P H 6 .   ? 38.212 -40.601 19.112  1.00 58.35  ? 404 X2P A CL    1 
HETATM 5095 C  C19   . X2P H 6 .   ? 36.404 -37.904 21.457  1.00 45.76  ? 404 X2P A C19   1 
HETATM 5096 C  C18   . X2P H 6 .   ? 35.665 -36.593 21.308  1.00 48.98  ? 404 X2P A C18   1 
HETATM 5097 N  N     . X2P H 6 .   ? 34.214 -36.741 21.178  1.00 57.74  ? 404 X2P A N     1 
HETATM 5098 C  C1    . X2P H 6 .   ? 33.640 -36.674 19.958  1.00 63.69  ? 404 X2P A C1    1 
HETATM 5099 O  O4    . X2P H 6 .   ? 34.293 -36.581 18.925  1.00 65.22  ? 404 X2P A O4    1 
HETATM 5100 C  C2    . X2P H 6 .   ? 32.183 -36.703 19.964  1.00 65.50  ? 404 X2P A C2    1 
HETATM 5101 O  O     . X2P H 6 .   ? 31.986 -36.572 17.566  1.00 67.20  ? 404 X2P A O     1 
HETATM 5102 O  O1    . X2P H 6 .   ? 29.381 -36.620 17.631  1.00 66.45  ? 404 X2P A O1    1 
HETATM 5103 C  C16   . X2P H 6 .   ? 27.004 -35.796 19.444  1.00 60.59  ? 404 X2P A C16   1 
HETATM 5104 C  C14   . X2P H 6 .   ? 26.584 -37.905 18.240  1.00 59.15  ? 404 X2P A C14   1 
HETATM 5105 N  N2    . X2P H 6 .   ? 27.841 -36.939 21.608  1.00 69.78  ? 404 X2P A N2    1 
HETATM 5106 C  C11   . X2P H 6 .   ? 26.115 -36.008 23.243  1.00 74.29  ? 404 X2P A C11   1 
HETATM 5107 O  O3    . X2P H 6 .   ? 26.519 -34.769 22.641  1.00 75.06  ? 404 X2P A O3    1 
HETATM 5108 C  C12   . X2P H 6 .   ? 24.611 -36.053 23.388  1.00 74.21  ? 404 X2P A C12   1 
HETATM 5109 C  C9    . X2P H 6 .   ? 29.060 -36.751 22.191  1.00 69.32  ? 404 X2P A C9    1 
HETATM 5110 O  O2    . X2P H 6 .   ? 29.237 -36.631 23.398  1.00 70.00  ? 404 X2P A O2    1 
HETATM 5111 C  C3    . X2P H 6 .   ? 31.409 -36.753 21.188  1.00 64.74  ? 404 X2P A C3    1 
HETATM 5112 C  C     . X2P H 6 .   ? 33.520 -37.338 22.325  1.00 58.99  ? 404 X2P A C     1 
HETATM 5113 MG MG    . MG  I 7 .   ? 30.318 -36.327 15.991  1.00 54.22  2 405 MG  A MG    1 
HETATM 5114 MG MG    . MG  J 7 .   ? 34.034 -36.298 16.982  1.00 51.99  2 406 MG  A MG    1 
HETATM 5115 S  S     . SO4 K 8 .   ? 26.808 -37.068 39.018  1.00 163.76 ? 407 SO4 A S     1 
HETATM 5116 O  O1    . SO4 K 8 .   ? 27.281 -35.684 39.019  1.00 164.21 ? 407 SO4 A O1    1 
HETATM 5117 O  O2    . SO4 K 8 .   ? 26.085 -37.331 37.761  1.00 163.53 ? 407 SO4 A O2    1 
HETATM 5118 O  O3    . SO4 K 8 .   ? 25.925 -37.230 40.168  1.00 162.64 ? 407 SO4 A O3    1 
HETATM 5119 O  O4    . SO4 K 8 .   ? 27.941 -37.996 39.134  1.00 163.43 ? 407 SO4 A O4    1 
HETATM 5120 S  S     . SO4 L 8 .   ? 17.225 -50.444 32.063  1.00 96.42  ? 408 SO4 A S     1 
HETATM 5121 O  O1    . SO4 L 8 .   ? 17.933 -51.374 31.185  1.00 94.26  ? 408 SO4 A O1    1 
HETATM 5122 O  O2    . SO4 L 8 .   ? 17.309 -49.082 31.538  1.00 97.58  ? 408 SO4 A O2    1 
HETATM 5123 O  O3    . SO4 L 8 .   ? 17.828 -50.488 33.402  1.00 99.42  ? 408 SO4 A O3    1 
HETATM 5124 O  O4    . SO4 L 8 .   ? 15.808 -50.794 32.157  1.00 97.74  ? 408 SO4 A O4    1 
HETATM 5125 C  C1    . GOL M 5 .   ? 44.258 -45.094 -14.072 1.00 77.35  ? 409 GOL A C1    1 
HETATM 5126 O  O1    . GOL M 5 .   ? 43.719 -46.382 -13.770 1.00 74.79  ? 409 GOL A O1    1 
HETATM 5127 C  C2    . GOL M 5 .   ? 45.620 -45.216 -14.721 1.00 81.47  ? 409 GOL A C2    1 
HETATM 5128 O  O2    . GOL M 5 .   ? 46.608 -45.586 -13.750 1.00 85.41  ? 409 GOL A O2    1 
HETATM 5129 C  C3    . GOL M 5 .   ? 46.048 -43.949 -15.424 1.00 80.71  ? 409 GOL A C3    1 
HETATM 5130 O  O3    . GOL M 5 .   ? 47.379 -44.077 -15.924 1.00 80.12  ? 409 GOL A O3    1 
HETATM 5131 S  S     . SO4 N 8 .   ? 40.850 -34.781 -26.021 1.00 111.21 ? 401 SO4 B S     1 
HETATM 5132 O  O1    . SO4 N 8 .   ? 42.266 -34.460 -25.886 1.00 109.23 ? 401 SO4 B O1    1 
HETATM 5133 O  O2    . SO4 N 8 .   ? 40.476 -34.865 -27.421 1.00 111.07 ? 401 SO4 B O2    1 
HETATM 5134 O  O3    . SO4 N 8 .   ? 40.613 -36.066 -25.385 1.00 112.75 ? 401 SO4 B O3    1 
HETATM 5135 O  O4    . SO4 N 8 .   ? 40.023 -33.759 -25.353 1.00 113.19 ? 401 SO4 B O4    1 
HETATM 5136 MG MG    . MG  O 7 .   ? 36.764 -16.291 -24.072 1.00 112.51 2 402 MG  B MG    1 
HETATM 5137 C  C1    . GOL P 5 .   ? 52.676 -44.811 14.393  1.00 85.32  ? 101 GOL C C1    1 
HETATM 5138 O  O1    . GOL P 5 .   ? 51.337 -45.185 14.087  1.00 90.27  ? 101 GOL C O1    1 
HETATM 5139 C  C2    . GOL P 5 .   ? 52.897 -43.326 14.211  1.00 79.71  ? 101 GOL C C2    1 
HETATM 5140 O  O2    . GOL P 5 .   ? 51.970 -42.584 15.018  1.00 77.50  ? 101 GOL C O2    1 
HETATM 5141 C  C3    . GOL P 5 .   ? 54.317 -42.985 14.605  1.00 76.21  ? 101 GOL C C3    1 
HETATM 5142 O  O3    . GOL P 5 .   ? 54.698 -41.688 14.156  1.00 73.01  ? 101 GOL C O3    1 
HETATM 5143 O  O     . HOH Q 9 .   ? 40.717 -56.682 37.504  1.00 50.53  ? 501 HOH A O     1 
HETATM 5144 O  O     . HOH Q 9 .   ? 37.908 -58.252 22.161  1.00 62.85  ? 502 HOH A O     1 
HETATM 5145 O  O     . HOH Q 9 .   ? 51.902 -48.748 16.056  1.00 86.20  ? 503 HOH A O     1 
HETATM 5146 O  O     . HOH Q 9 .   ? 31.654 -39.543 12.736  1.00 62.62  ? 504 HOH A O     1 
HETATM 5147 O  O     . HOH Q 9 .   ? 23.975 -63.121 37.044  1.00 67.85  ? 505 HOH A O     1 
HETATM 5148 O  O     . HOH Q 9 .   ? 19.108 -32.856 11.312  1.00 76.43  ? 506 HOH A O     1 
HETATM 5149 O  O     . HOH Q 9 .   ? 51.833 -31.950 -0.271  1.00 62.50  ? 507 HOH A O     1 
HETATM 5150 O  O     . HOH Q 9 .   ? 57.437 -33.024 -14.966 1.00 62.08  ? 508 HOH A O     1 
HETATM 5151 O  O     . HOH Q 9 .   ? 34.081 -51.417 19.160  1.00 59.23  ? 509 HOH A O     1 
HETATM 5152 O  O     . HOH Q 9 .   ? 46.816 -32.755 16.944  1.00 47.79  ? 510 HOH A O     1 
HETATM 5153 O  O     . HOH Q 9 .   ? 53.527 -27.258 0.869   1.00 50.15  ? 511 HOH A O     1 
HETATM 5154 O  O     . HOH Q 9 .   ? 44.577 -46.684 8.275   1.00 53.73  ? 512 HOH A O     1 
HETATM 5155 O  O     . HOH Q 9 .   ? 31.383 -55.384 55.465  1.00 57.59  ? 513 HOH A O     1 
HETATM 5156 O  O     . HOH Q 9 .   ? 34.320 -34.391 -11.150 1.00 60.04  ? 514 HOH A O     1 
HETATM 5157 O  O     . HOH Q 9 .   ? 27.145 -54.967 53.726  1.00 58.17  ? 515 HOH A O     1 
HETATM 5158 O  O     . HOH Q 9 .   ? 29.943 -43.459 17.841  1.00 59.67  ? 516 HOH A O     1 
HETATM 5159 O  O     . HOH Q 9 .   ? 56.045 -31.117 0.002   1.00 55.25  ? 517 HOH A O     1 
HETATM 5160 O  O     . HOH Q 9 .   ? 26.051 -39.909 40.494  1.00 54.38  ? 518 HOH A O     1 
HETATM 5161 O  O     . HOH Q 9 .   ? 28.595 -48.793 21.317  1.00 57.37  ? 519 HOH A O     1 
HETATM 5162 O  O     . HOH Q 9 .   ? 22.388 -53.933 28.607  1.00 62.78  ? 520 HOH A O     1 
HETATM 5163 O  O     . HOH Q 9 .   ? 28.712 -35.916 14.656  1.00 53.25  ? 521 HOH A O     1 
HETATM 5164 O  O     . HOH Q 9 .   ? 32.377 -39.986 16.462  1.00 66.15  ? 522 HOH A O     1 
HETATM 5165 O  O     . HOH Q 9 .   ? 47.912 -29.299 13.730  1.00 54.73  ? 523 HOH A O     1 
HETATM 5166 O  O     . HOH Q 9 .   ? 35.116 -37.926 -10.457 1.00 55.48  ? 524 HOH A O     1 
HETATM 5167 O  O     . HOH Q 9 .   ? 39.367 -43.738 0.957   1.00 53.11  ? 525 HOH A O     1 
HETATM 5168 O  O     . HOH Q 9 .   ? 50.544 -29.140 -3.103  1.00 65.54  ? 526 HOH A O     1 
HETATM 5169 O  O     . HOH Q 9 .   ? 19.233 -44.331 41.613  1.00 63.50  ? 527 HOH A O     1 
HETATM 5170 O  O     . HOH Q 9 .   ? 20.489 -44.689 34.891  1.00 63.95  ? 528 HOH A O     1 
HETATM 5171 O  O     . HOH Q 9 .   ? 48.144 -48.514 5.740   1.00 69.41  ? 529 HOH A O     1 
HETATM 5172 O  O     . HOH Q 9 .   ? 14.622 -38.753 10.027  1.00 70.63  ? 530 HOH A O     1 
HETATM 5173 O  O     . HOH Q 9 .   ? 60.085 -40.770 10.152  1.00 55.15  ? 531 HOH A O     1 
HETATM 5174 O  O     . HOH Q 9 .   ? 54.331 -40.015 -7.656  1.00 58.36  ? 532 HOH A O     1 
HETATM 5175 O  O     . HOH Q 9 .   ? 38.701 -61.641 53.166  1.00 57.74  ? 533 HOH A O     1 
HETATM 5176 O  O     . HOH Q 9 .   ? 50.114 -27.402 14.397  1.00 56.89  ? 534 HOH A O     1 
HETATM 5177 O  O     . HOH Q 9 .   ? 40.092 -57.877 20.627  1.00 66.54  ? 535 HOH A O     1 
HETATM 5178 O  O     . HOH Q 9 .   ? 44.445 -33.215 5.990   1.00 59.55  ? 536 HOH A O     1 
HETATM 5179 O  O     . HOH Q 9 .   ? 43.041 -55.657 26.279  1.00 60.55  ? 537 HOH A O     1 
HETATM 5180 O  O     . HOH Q 9 .   ? 34.633 -53.561 28.261  1.00 66.40  ? 538 HOH A O     1 
HETATM 5181 O  O     . HOH Q 9 .   ? 34.413 -41.614 -7.662  1.00 45.92  ? 539 HOH A O     1 
HETATM 5182 O  O     . HOH Q 9 .   ? 29.725 -40.947 36.555  1.00 77.37  ? 540 HOH A O     1 
HETATM 5183 O  O     . HOH Q 9 .   ? 20.158 -55.638 56.382  1.00 66.32  ? 541 HOH A O     1 
HETATM 5184 O  O     . HOH Q 9 .   ? 26.527 -46.632 38.647  1.00 53.01  ? 542 HOH A O     1 
HETATM 5185 O  O     . HOH Q 9 .   ? 47.664 -34.098 7.730   1.00 55.14  ? 543 HOH A O     1 
HETATM 5186 O  O     . HOH Q 9 .   ? 18.087 -52.610 28.650  1.00 81.60  ? 544 HOH A O     1 
HETATM 5187 O  O     . HOH Q 9 .   ? 21.559 -45.326 27.422  1.00 70.25  ? 545 HOH A O     1 
HETATM 5188 O  O     . HOH Q 9 .   ? 32.172 -42.627 16.034  1.00 66.75  ? 546 HOH A O     1 
HETATM 5189 O  O     . HOH Q 9 .   ? 24.074 -33.867 14.314  1.00 64.49  ? 547 HOH A O     1 
HETATM 5190 O  O     . HOH Q 9 .   ? 37.105 -45.177 -4.927  1.00 75.22  ? 548 HOH A O     1 
HETATM 5191 O  O     . HOH Q 9 .   ? 30.058 -34.181 16.355  1.00 72.61  ? 549 HOH A O     1 
HETATM 5192 O  O     . HOH Q 9 .   ? 14.647 -36.501 7.874   1.00 71.29  ? 550 HOH A O     1 
HETATM 5193 O  O     . HOH Q 9 .   ? 35.112 -48.002 12.206  1.00 59.16  ? 551 HOH A O     1 
HETATM 5194 O  O     . HOH Q 9 .   ? 49.670 -41.541 9.257   1.00 61.02  ? 552 HOH A O     1 
HETATM 5195 O  O     . HOH Q 9 .   ? 26.338 -34.499 -6.095  1.00 65.33  ? 553 HOH A O     1 
HETATM 5196 O  O     . HOH Q 9 .   ? 46.077 -48.257 0.772   1.00 68.22  ? 554 HOH A O     1 
HETATM 5197 O  O     . HOH Q 9 .   ? 33.343 -30.358 19.120  1.00 69.45  ? 555 HOH A O     1 
HETATM 5198 O  O     . HOH Q 9 .   ? 38.012 -44.400 11.849  1.00 57.69  ? 556 HOH A O     1 
HETATM 5199 O  O     . HOH Q 9 .   ? 20.703 -43.219 23.996  1.00 73.73  ? 557 HOH A O     1 
HETATM 5200 O  O     . HOH Q 9 .   ? 21.276 -61.812 62.000  1.00 60.89  ? 558 HOH A O     1 
HETATM 5201 O  O     . HOH Q 9 .   ? 30.784 -64.253 35.651  1.00 65.85  ? 559 HOH A O     1 
HETATM 5202 O  O     . HOH Q 9 .   ? 19.879 -41.959 34.264  1.00 61.45  ? 560 HOH A O     1 
HETATM 5203 O  O     . HOH Q 9 .   ? 27.209 -42.215 7.309   1.00 59.54  ? 561 HOH A O     1 
HETATM 5204 O  O     . HOH Q 9 .   ? 17.726 -57.355 43.654  1.00 58.90  ? 562 HOH A O     1 
HETATM 5205 O  O     . HOH Q 9 .   ? 49.892 -37.827 5.628   1.00 64.74  ? 563 HOH A O     1 
HETATM 5206 O  O     . HOH Q 9 .   ? 37.486 -49.047 7.715   1.00 60.79  ? 564 HOH A O     1 
HETATM 5207 O  O     . HOH Q 9 .   ? 30.270 -47.659 38.372  1.00 62.07  ? 565 HOH A O     1 
HETATM 5208 O  O     . HOH Q 9 .   ? 49.656 -35.962 7.571   1.00 53.79  ? 566 HOH A O     1 
HETATM 5209 O  O     . HOH Q 9 .   ? 43.679 -51.865 22.947  1.00 55.54  ? 567 HOH A O     1 
HETATM 5210 O  O     . HOH Q 9 .   ? 26.666 -48.545 23.166  1.00 57.24  ? 568 HOH A O     1 
HETATM 5211 O  O     . HOH Q 9 .   ? 21.944 -50.466 16.953  1.00 70.07  ? 569 HOH A O     1 
HETATM 5212 O  O     . HOH Q 9 .   ? 46.105 -46.672 -6.644  1.00 57.47  ? 570 HOH A O     1 
HETATM 5213 O  O     . HOH Q 9 .   ? 32.113 -50.638 41.988  1.00 51.16  ? 571 HOH A O     1 
HETATM 5214 O  O     . HOH Q 9 .   ? 41.174 -51.650 24.370  1.00 54.20  ? 572 HOH A O     1 
HETATM 5215 O  O     . HOH Q 9 .   ? 27.592 -41.631 18.167  1.00 36.27  ? 573 HOH A O     1 
HETATM 5216 O  O     . HOH Q 9 .   ? 44.766 -53.430 25.203  1.00 69.10  ? 574 HOH A O     1 
HETATM 5217 O  O     . HOH Q 9 .   ? 20.754 -42.776 28.180  1.00 64.55  ? 575 HOH A O     1 
HETATM 5218 O  O     . HOH Q 9 .   ? 41.477 -52.002 27.323  1.00 64.76  ? 576 HOH A O     1 
HETATM 5219 O  O     . HOH Q 9 .   ? 23.335 -40.667 19.690  1.00 67.33  ? 577 HOH A O     1 
HETATM 5220 O  O     . HOH Q 9 .   ? 20.014 -57.772 59.855  1.00 63.82  ? 578 HOH A O     1 
HETATM 5221 O  O     . HOH Q 9 .   ? 39.246 -54.893 7.875   1.00 56.21  ? 579 HOH A O     1 
HETATM 5222 O  O     . HOH Q 9 .   ? 24.530 -23.770 7.311   1.00 49.13  ? 580 HOH A O     1 
HETATM 5223 O  O     . HOH Q 9 .   ? 59.781 -22.505 -1.297  1.00 66.13  ? 581 HOH A O     1 
HETATM 5224 O  O     . HOH Q 9 .   ? 33.776 -68.889 55.203  1.00 67.31  ? 582 HOH A O     1 
HETATM 5225 O  O     . HOH Q 9 .   ? 23.245 -33.831 17.060  1.00 61.21  ? 583 HOH A O     1 
HETATM 5226 O  O     . HOH Q 9 .   ? 35.281 -69.945 57.188  1.00 68.81  ? 584 HOH A O     1 
HETATM 5227 O  O     . HOH Q 9 .   ? 44.252 -27.500 21.466  1.00 59.85  ? 585 HOH A O     1 
HETATM 5228 O  O     . HOH Q 9 .   ? 29.328 -26.451 -7.000  1.00 75.12  ? 586 HOH A O     1 
HETATM 5229 O  O     . HOH Q 9 .   ? 30.896 -32.851 19.162  1.00 70.58  ? 587 HOH A O     1 
HETATM 5230 O  O     . HOH Q 9 .   ? 17.635 -50.257 27.339  1.00 65.63  ? 588 HOH A O     1 
HETATM 5231 O  O     . HOH Q 9 .   ? 28.456 -31.963 17.276  1.00 73.13  ? 589 HOH A O     1 
HETATM 5232 O  O     . HOH Q 9 .   ? 54.819 -40.261 -5.028  1.00 64.68  ? 590 HOH A O     1 
HETATM 5233 O  O     . HOH Q 9 .   ? 55.584 -37.874 -4.113  1.00 60.70  ? 591 HOH A O     1 
HETATM 5234 O  O     . HOH Q 9 .   ? 51.625 -26.040 2.382   1.00 45.95  ? 592 HOH A O     1 
HETATM 5235 O  O     . HOH Q 9 .   ? 26.813 -34.015 14.752  1.00 60.44  ? 593 HOH A O     1 
HETATM 5236 O  O     . HOH Q 9 .   ? 50.461 -23.743 2.693   1.00 51.39  ? 594 HOH A O     1 
HETATM 5237 O  O     . HOH Q 9 .   ? 21.018 -45.328 11.751  1.00 61.34  ? 595 HOH A O     1 
HETATM 5238 O  O     . HOH R 9 .   ? 46.715 -29.423 -1.213  1.00 55.94  ? 501 HOH B O     1 
HETATM 5239 O  O     . HOH R 9 .   ? 44.385 -28.865 0.099   1.00 52.43  ? 502 HOH B O     1 
HETATM 5240 O  O     . HOH R 9 .   ? 46.661 -29.239 -22.645 1.00 71.94  ? 503 HOH B O     1 
HETATM 5241 O  O     . HOH R 9 .   ? 36.439 -17.795 -0.958  1.00 63.97  ? 504 HOH B O     1 
HETATM 5242 O  O     . HOH R 9 .   ? 36.984 -14.086 -20.437 1.00 64.25  ? 505 HOH B O     1 
HETATM 5243 O  O     . HOH R 9 .   ? 39.722 -16.694 -20.318 1.00 62.16  ? 506 HOH B O     1 
HETATM 5244 O  O     . HOH R 9 .   ? 24.331 -28.627 -27.420 1.00 70.46  ? 507 HOH B O     1 
HETATM 5245 O  O     . HOH R 9 .   ? 36.811 -32.349 -17.629 1.00 59.66  ? 508 HOH B O     1 
HETATM 5246 O  O     . HOH R 9 .   ? 48.258 -28.694 -15.998 1.00 67.62  ? 509 HOH B O     1 
HETATM 5247 O  O     . HOH R 9 .   ? 37.026 -42.194 -14.605 1.00 70.53  ? 510 HOH B O     1 
HETATM 5248 O  O     . HOH R 9 .   ? 33.319 -39.778 -9.186  1.00 58.00  ? 511 HOH B O     1 
HETATM 5249 O  O     . HOH R 9 .   ? 45.740 -30.723 -30.711 1.00 79.05  ? 512 HOH B O     1 
HETATM 5250 O  O     . HOH R 9 .   ? 32.100 -26.521 -7.640  1.00 78.21  ? 513 HOH B O     1 
HETATM 5251 O  O     . HOH R 9 .   ? 44.726 -19.708 -1.678  1.00 66.39  ? 514 HOH B O     1 
HETATM 5252 O  O     . HOH R 9 .   ? 46.392 -9.141  -13.914 1.00 65.05  ? 515 HOH B O     1 
HETATM 5253 O  O     . HOH R 9 .   ? 43.161 -20.482 0.541   1.00 63.34  ? 516 HOH B O     1 
HETATM 5254 O  O     . HOH R 9 .   ? 48.266 -33.794 -21.554 1.00 64.27  ? 517 HOH B O     1 
HETATM 5255 O  O     . HOH R 9 .   ? 26.463 -26.097 -6.744  1.00 70.12  ? 518 HOH B O     1 
HETATM 5256 O  O     . HOH R 9 .   ? 54.173 -34.176 -22.046 1.00 63.13  ? 519 HOH B O     1 
HETATM 5257 O  O     . HOH R 9 .   ? 47.459 -28.841 -29.069 1.00 70.10  ? 520 HOH B O     1 
HETATM 5258 O  O     . HOH R 9 .   ? 29.894 -13.980 -6.697  1.00 60.12  ? 521 HOH B O     1 
HETATM 5259 O  O     . HOH R 9 .   ? 41.475 -48.447 -9.982  1.00 59.50  ? 522 HOH B O     1 
HETATM 5260 O  O     . HOH R 9 .   ? 28.308 -14.731 -4.346  1.00 74.36  ? 523 HOH B O     1 
HETATM 5261 O  O     . HOH R 9 .   ? 41.377 -20.226 -21.220 1.00 69.28  ? 524 HOH B O     1 
HETATM 5262 O  O     . HOH R 9 .   ? 30.539 -34.903 -21.762 1.00 64.38  ? 525 HOH B O     1 
HETATM 5263 O  O     . HOH R 9 .   ? 25.921 -21.566 -22.702 1.00 75.20  ? 526 HOH B O     1 
HETATM 5264 O  O     . HOH R 9 .   ? 36.233 -44.933 -14.902 1.00 63.02  ? 527 HOH B O     1 
HETATM 5265 O  O     . HOH R 9 .   ? 29.105 -38.907 -20.329 1.00 74.02  ? 528 HOH B O     1 
HETATM 5266 O  O     . HOH R 9 .   ? 36.124 -44.277 -19.949 1.00 71.30  ? 529 HOH B O     1 
HETATM 5267 O  O     . HOH S 9 .   ? 24.835 -48.706 7.934   1.00 90.95  ? 201 HOH C O     1 
HETATM 5268 O  O     . HOH S 9 .   ? 38.983 -46.512 10.478  1.00 61.08  ? 202 HOH C O     1 
HETATM 5269 O  O     . HOH S 9 .   ? 53.715 -40.267 12.053  1.00 58.89  ? 203 HOH C O     1 
HETATM 5270 O  O     . HOH S 9 .   ? 56.285 -30.080 20.963  1.00 64.67  ? 204 HOH C O     1 
HETATM 5271 O  O     . HOH S 9 .   ? 54.342 -29.021 16.471  1.00 49.34  ? 205 HOH C O     1 
HETATM 5272 O  O     . HOH S 9 .   ? 70.476 -43.649 9.913   1.00 69.82  ? 206 HOH C O     1 
HETATM 5273 O  O     . HOH S 9 .   ? 42.179 -47.810 8.896   1.00 53.20  ? 207 HOH C O     1 
HETATM 5274 O  O     . HOH S 9 .   ? 94.934 -45.103 9.811   1.00 80.00  ? 208 HOH C O     1 
HETATM 5275 O  O     . HOH S 9 .   ? 50.942 -34.543 18.970  1.00 55.94  ? 209 HOH C O     1 
HETATM 5276 O  O     . HOH S 9 .   ? 59.002 -39.608 23.716  1.00 61.71  ? 210 HOH C O     1 
HETATM 5277 O  O     . HOH S 9 .   ? 58.506 -35.251 14.715  1.00 56.77  ? 211 HOH C O     1 
HETATM 5278 O  O     . HOH S 9 .   ? 57.265 -42.145 12.896  1.00 52.38  ? 212 HOH C O     1 
HETATM 5279 O  O     . HOH S 9 .   ? 58.523 -38.033 13.999  1.00 60.97  ? 213 HOH C O     1 
HETATM 5280 O  O     . HOH S 9 .   ? 74.157 -40.870 9.039   1.00 64.92  ? 214 HOH C O     1 
HETATM 5281 O  O     . HOH S 9 .   ? 47.535 -41.438 7.411   1.00 66.79  ? 215 HOH C O     1 
HETATM 5282 O  O     . HOH S 9 .   ? 50.083 -46.994 16.121  1.00 35.36  ? 216 HOH C O     1 
HETATM 5283 O  O     . HOH S 9 .   ? 31.590 -53.831 8.250   1.00 71.77  ? 217 HOH C O     1 
HETATM 5284 O  O     . HOH S 9 .   ? 68.201 -45.847 9.775   1.00 57.39  ? 218 HOH C O     1 
HETATM 5285 O  O     . HOH S 9 .   ? 39.748 -47.006 7.961   1.00 58.10  ? 219 HOH C O     1 
HETATM 5286 O  O     . HOH S 9 .   ? 22.317 -47.446 12.729  1.00 57.73  ? 220 HOH C O     1 
HETATM 5287 O  O     . HOH S 9 .   ? 37.023 -48.515 10.325  1.00 49.92  ? 221 HOH C O     1 
HETATM 5288 O  O     . HOH T 9 .   ? 33.922 -34.116 17.093  1.00 46.38  ? 101 HOH D O     1 
HETATM 5289 O  O     . HOH T 9 .   ? 51.334 -36.451 22.914  1.00 57.84  ? 102 HOH D O     1 
HETATM 5290 O  O     . HOH T 9 .   ? 51.857 -47.599 23.511  1.00 64.61  ? 103 HOH D O     1 
HETATM 5291 O  O     . HOH T 9 .   ? 67.138 -46.237 12.858  1.00 67.98  ? 104 HOH D O     1 
HETATM 5292 O  O     . HOH T 9 .   ? 59.710 -40.366 13.057  1.00 50.36  ? 105 HOH D O     1 
HETATM 5293 O  O     . HOH T 9 .   ? 38.728 -35.586 24.089  1.00 67.52  ? 106 HOH D O     1 
HETATM 5294 O  O     . HOH T 9 .   ? 50.535 -44.338 27.074  1.00 59.02  ? 107 HOH D O     1 
HETATM 5295 O  O     . HOH T 9 .   ? 53.158 -45.624 17.993  1.00 66.20  ? 108 HOH D O     1 
HETATM 5296 O  O     . HOH T 9 .   ? 69.411 -33.374 9.734   1.00 74.03  ? 109 HOH D O     1 
HETATM 5297 O  O     . HOH T 9 .   ? 71.487 -41.917 8.050   1.00 59.22  ? 110 HOH D O     1 
HETATM 5298 O  O     . HOH T 9 .   ? 43.922 -30.387 20.364  1.00 60.71  ? 111 HOH D O     1 
HETATM 5299 O  O     . HOH T 9 .   ? 63.324 -39.378 6.977   1.00 57.24  ? 112 HOH D O     1 
HETATM 5300 O  O     . HOH T 9 .   ? 31.598 -40.542 24.740  1.00 74.02  ? 113 HOH D O     1 
HETATM 5301 O  O     . HOH T 9 .   ? 64.377 -37.567 4.877   1.00 64.06  ? 114 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   PRO 2   -1  ?   ?   ?   A . n 
A 1 3   GLY 3   0   ?   ?   ?   A . n 
A 1 4   CYS 4   1   ?   ?   ?   A . n 
A 1 5   ASN 5   2   ?   ?   ?   A . n 
A 1 6   THR 6   3   ?   ?   ?   A . n 
A 1 7   LYS 7   4   ?   ?   ?   A . n 
A 1 8   LYS 8   5   ?   ?   ?   A . n 
A 1 9   PRO 9   6   ?   ?   ?   A . n 
A 1 10  ASN 10  7   ?   ?   ?   A . n 
A 1 11  LEU 11  8   8   LEU LEU A . n 
A 1 12  ASP 12  9   9   ASP ASP A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  GLU 14  11  11  GLU GLU A . n 
A 1 15  LEU 15  12  12  LEU LEU A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  GLN 17  14  14  GLN GLN A . n 
A 1 18  LEU 18  15  15  LEU LEU A . n 
A 1 19  LEU 19  16  16  LEU LEU A . n 
A 1 20  GLN 20  17  17  GLN GLN A . n 
A 1 21  GLY 21  18  18  GLY GLY A . n 
A 1 22  HIS 22  19  19  HIS HIS A . n 
A 1 23  TYR 23  20  20  TYR TYR A . n 
A 1 24  ILE 24  21  21  ILE ILE A . n 
A 1 25  LYS 25  22  22  LYS LYS A . n 
A 1 26  GLY 26  23  23  GLY GLY A . n 
A 1 27  TYR 27  24  24  TYR TYR A . n 
A 1 28  PRO 28  25  25  PRO PRO A . n 
A 1 29  LYS 29  26  26  LYS LYS A . n 
A 1 30  GLN 30  27  27  GLN GLN A . n 
A 1 31  TYR 31  28  28  TYR TYR A . n 
A 1 32  THR 32  29  29  THR THR A . n 
A 1 33  TYR 33  30  30  TYR TYR A . n 
A 1 34  PHE 34  31  31  PHE PHE A . n 
A 1 35  LEU 35  32  32  LEU LEU A . n 
A 1 36  GLU 36  33  33  GLU GLU A . n 
A 1 37  ASP 37  34  34  ASP ASP A . n 
A 1 38  GLY 38  35  35  GLY GLY A . n 
A 1 39  LYS 39  36  36  LYS LYS A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  LYS 41  38  38  LYS LYS A . n 
A 1 42  VAL 42  39  39  VAL VAL A . n 
A 1 43  SER 43  40  40  SER SER A . n 
A 1 44  ARG 44  41  41  ARG ARG A . n 
A 1 45  PRO 45  42  42  PRO PRO A . n 
A 1 46  GLU 46  43  43  GLU GLU A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  VAL 48  45  45  VAL VAL A . n 
A 1 49  LYS 49  46  46  LYS LYS A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  PRO 52  49  49  PRO PRO A . n 
A 1 53  PRO 53  50  50  PRO PRO A . n 
A 1 54  GLN 54  51  51  GLN GLN A . n 
A 1 55  SER 55  52  52  SER SER A . n 
A 1 56  ASP 56  53  53  ASP ASP A . n 
A 1 57  ARG 57  54  54  ARG ARG A . n 
A 1 58  GLN 58  55  55  GLN GLN A . n 
A 1 59  LYS 59  56  56  LYS LYS A . n 
A 1 60  ILE 60  57  57  ILE ILE A . n 
A 1 61  VAL 61  58  58  VAL VAL A . n 
A 1 62  LEU 62  59  59  LEU LEU A . n 
A 1 63  GLN 63  60  60  GLN GLN A . n 
A 1 64  ALA 64  61  61  ALA ALA A . n 
A 1 65  HIS 65  62  62  HIS HIS A . n 
A 1 66  ASN 66  63  63  ASN ASN A . n 
A 1 67  LEU 67  64  64  LEU LEU A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  HIS 69  66  66  HIS HIS A . n 
A 1 70  THR 70  67  67  THR THR A . n 
A 1 71  GLY 71  68  68  GLY GLY A . n 
A 1 72  ARG 72  69  69  ARG ARG A . n 
A 1 73  GLU 73  70  70  GLU GLU A . n 
A 1 74  ALA 74  71  71  ALA ALA A . n 
A 1 75  THR 75  72  72  THR THR A . n 
A 1 76  LEU 76  73  73  LEU LEU A . n 
A 1 77  LEU 77  74  74  LEU LEU A . n 
A 1 78  LYS 78  75  75  LYS LYS A . n 
A 1 79  ILE 79  76  76  ILE ILE A . n 
A 1 80  ALA 80  77  77  ALA ALA A . n 
A 1 81  ASN 81  78  78  ASN ASN A . n 
A 1 82  LEU 82  79  79  LEU LEU A . n 
A 1 83  TYR 83  80  80  TYR TYR A . n 
A 1 84  TRP 84  81  81  TRP TRP A . n 
A 1 85  TRP 85  82  82  TRP TRP A . n 
A 1 86  PRO 86  83  83  PRO PRO A . n 
A 1 87  ASN 87  84  84  ASN ASN A . n 
A 1 88  MET 88  85  85  MET MET A . n 
A 1 89  ARG 89  86  86  ARG ARG A . n 
A 1 90  LYS 90  87  87  LYS LYS A . n 
A 1 91  ASP 91  88  88  ASP ASP A . n 
A 1 92  VAL 92  89  89  VAL VAL A . n 
A 1 93  VAL 93  90  90  VAL VAL A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  GLN 95  92  92  GLN GLN A . n 
A 1 96  LEU 96  93  93  LEU LEU A . n 
A 1 97  GLY 97  94  94  GLY GLY A . n 
A 1 98  ARG 98  95  95  ARG ARG A . n 
A 1 99  CYS 99  96  96  CYS CYS A . n 
A 1 100 GLN 100 97  97  GLN GLN A . n 
A 1 101 GLN 101 98  98  GLN GLN A . n 
A 1 102 CYS 102 99  99  CYS CYS A . n 
A 1 103 LEU 103 100 100 LEU LEU A . n 
A 1 104 ILE 104 101 101 ILE ILE A . n 
A 1 105 THR 105 102 102 THR THR A . n 
A 1 106 ASN 106 103 103 ASN ASN A . n 
A 1 107 ALA 107 104 104 ALA ALA A . n 
A 1 108 SER 108 105 105 SER SER A . n 
A 1 109 ASN 109 106 106 ASN ASN A . n 
A 1 110 LYS 110 107 107 LYS LYS A . n 
A 1 111 ALA 111 108 108 ALA ALA A . n 
A 1 112 SER 112 109 109 SER SER A . n 
A 1 113 GLY 113 110 110 GLY GLY A . n 
A 1 114 PRO 114 111 111 PRO PRO A . n 
A 1 115 ILE 115 112 112 ILE ILE A . n 
A 1 116 LEU 116 113 113 LEU LEU A . n 
A 1 117 ARG 117 114 114 ARG ARG A . n 
A 1 118 PRO 118 115 115 PRO PRO A . n 
A 1 119 ASP 119 116 116 ASP ASP A . n 
A 1 120 ARG 120 117 117 ARG ARG A . n 
A 1 121 PRO 121 118 118 PRO PRO A . n 
A 1 122 GLN 122 119 119 GLN GLN A . n 
A 1 123 LYS 123 120 120 LYS LYS A . n 
A 1 124 PRO 124 121 121 PRO PRO A . n 
A 1 125 PHE 125 122 122 PHE PHE A . n 
A 1 126 ASP 126 123 123 ASP ASP A . n 
A 1 127 LYS 127 124 124 LYS LYS A . n 
A 1 128 PHE 128 125 125 PHE PHE A . n 
A 1 129 PHE 129 126 126 PHE PHE A . n 
A 1 130 ILE 130 127 127 ILE ILE A . n 
A 1 131 ASP 131 128 128 ASP ASP A . n 
A 1 132 TYR 132 129 129 TYR TYR A . n 
A 1 133 ILE 133 130 130 ILE ILE A . n 
A 1 134 GLY 134 131 131 GLY GLY A . n 
A 1 135 PRO 135 132 132 PRO PRO A . n 
A 1 136 LEU 136 133 133 LEU LEU A . n 
A 1 137 PRO 137 134 134 PRO PRO A . n 
A 1 138 PRO 138 135 135 PRO PRO A . n 
A 1 139 SER 139 136 136 SER SER A . n 
A 1 140 GLN 140 137 137 GLN GLN A . n 
A 1 141 GLY 141 138 138 GLY GLY A . n 
A 1 142 TYR 142 139 139 TYR TYR A . n 
A 1 143 LEU 143 140 140 LEU LEU A . n 
A 1 144 TYR 144 141 141 TYR TYR A . n 
A 1 145 VAL 145 142 142 VAL VAL A . n 
A 1 146 LEU 146 143 143 LEU LEU A . n 
A 1 147 VAL 147 144 144 VAL VAL A . n 
A 1 148 VAL 148 145 145 VAL VAL A . n 
A 1 149 VAL 149 146 146 VAL VAL A . n 
A 1 150 ASP 150 147 147 ASP ASP A . n 
A 1 151 GLY 151 148 148 GLY GLY A . n 
A 1 152 MET 152 149 149 MET MET A . n 
A 1 153 THR 153 150 150 THR THR A . n 
A 1 154 GLY 154 151 151 GLY GLY A . n 
A 1 155 PHE 155 152 152 PHE PHE A . n 
A 1 156 THR 156 153 153 THR THR A . n 
A 1 157 TRP 157 154 154 TRP TRP A . n 
A 1 158 LEU 158 155 155 LEU LEU A . n 
A 1 159 TYR 159 156 156 TYR TYR A . n 
A 1 160 PRO 160 157 157 PRO PRO A . n 
A 1 161 THR 161 158 158 THR THR A . n 
A 1 162 LYS 162 159 159 LYS LYS A . n 
A 1 163 ALA 163 160 160 ALA ALA A . n 
A 1 164 PRO 164 161 161 PRO PRO A . n 
A 1 165 SER 165 162 162 SER SER A . n 
A 1 166 THR 166 163 163 THR THR A . n 
A 1 167 SER 167 164 164 SER SER A . n 
A 1 168 ALA 168 165 165 ALA ALA A . n 
A 1 169 THR 169 166 166 THR THR A . n 
A 1 170 VAL 170 167 167 VAL VAL A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 SER 172 169 169 SER SER A . n 
A 1 173 LEU 173 170 170 LEU LEU A . n 
A 1 174 ASN 174 171 171 ASN ASN A . n 
A 1 175 VAL 175 172 172 VAL VAL A . n 
A 1 176 LEU 176 173 173 LEU LEU A . n 
A 1 177 THR 177 174 174 THR THR A . n 
A 1 178 SER 178 175 175 SER SER A . n 
A 1 179 ILE 179 176 176 ILE ILE A . n 
A 1 180 ALA 180 177 177 ALA ALA A . n 
A 1 181 ILE 181 178 178 ILE ILE A . n 
A 1 182 PRO 182 179 179 PRO PRO A . n 
A 1 183 LYS 183 180 180 LYS LYS A . n 
A 1 184 VAL 184 181 181 VAL VAL A . n 
A 1 185 ILE 185 182 182 ILE ILE A . n 
A 1 186 HIS 186 183 183 HIS HIS A . n 
A 1 187 SER 187 184 184 SER SER A . n 
A 1 188 ASP 188 185 185 ASP ASP A . n 
A 1 189 GLN 189 186 186 GLN GLN A . n 
A 1 190 GLY 190 187 187 GLY GLY A . n 
A 1 191 ALA 191 188 188 ALA ALA A . n 
A 1 192 ALA 192 189 189 ALA ALA A . n 
A 1 193 PHE 193 190 190 PHE PHE A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 SER 195 192 192 SER SER A . n 
A 1 196 SER 196 193 193 SER SER A . n 
A 1 197 THR 197 194 194 THR THR A . n 
A 1 198 PHE 198 195 195 PHE PHE A . n 
A 1 199 ALA 199 196 196 ALA ALA A . n 
A 1 200 GLU 200 197 197 GLU GLU A . n 
A 1 201 TRP 201 198 198 TRP TRP A . n 
A 1 202 ALA 202 199 199 ALA ALA A . n 
A 1 203 LYS 203 200 200 LYS LYS A . n 
A 1 204 GLU 204 201 201 GLU GLU A . n 
A 1 205 ARG 205 202 202 ARG ARG A . n 
A 1 206 GLY 206 203 203 GLY GLY A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 HIS 208 205 205 HIS HIS A . n 
A 1 209 LEU 209 206 206 LEU LEU A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 PHE 211 208 208 PHE PHE A . n 
A 1 212 SER 212 209 209 SER SER A . n 
A 1 213 THR 213 210 210 THR THR A . n 
A 1 214 PRO 214 211 211 PRO PRO A . n 
A 1 215 TYR 215 212 212 TYR TYR A . n 
A 1 216 HIS 216 213 213 HIS HIS A . n 
A 1 217 PRO 217 214 214 PRO PRO A . n 
A 1 218 GLN 218 215 215 GLN GLN A . n 
A 1 219 SER 219 216 216 SER SER A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 GLY 221 218 218 GLY GLY A . n 
A 1 222 LYS 222 219 219 LYS LYS A . n 
A 1 223 VAL 223 220 220 VAL VAL A . n 
A 1 224 GLU 224 221 221 GLU GLU A . n 
A 1 225 ARG 225 222 222 ARG ARG A . n 
A 1 226 LYS 226 223 223 LYS LYS A . n 
A 1 227 ASN 227 224 224 ASN ASN A . n 
A 1 228 SER 228 225 225 SER SER A . n 
A 1 229 ASP 229 226 226 ASP ASP A . n 
A 1 230 ILE 230 227 227 ILE ILE A . n 
A 1 231 LYS 231 228 228 LYS LYS A . n 
A 1 232 ARG 232 229 229 ARG ARG A . n 
A 1 233 LEU 233 230 230 LEU LEU A . n 
A 1 234 LEU 234 231 231 LEU LEU A . n 
A 1 235 THR 235 232 232 THR THR A . n 
A 1 236 LYS 236 233 233 LYS LYS A . n 
A 1 237 LEU 237 234 234 LEU LEU A . n 
A 1 238 LEU 238 235 235 LEU LEU A . n 
A 1 239 VAL 239 236 236 VAL VAL A . n 
A 1 240 GLY 240 237 237 GLY GLY A . n 
A 1 241 ARG 241 238 238 ARG ARG A . n 
A 1 242 PRO 242 239 239 PRO PRO A . n 
A 1 243 THR 243 240 240 THR THR A . n 
A 1 244 LYS 244 241 241 LYS LYS A . n 
A 1 245 TRP 245 242 242 TRP TRP A . n 
A 1 246 TYR 246 243 243 TYR TYR A . n 
A 1 247 ASP 247 244 244 ASP ASP A . n 
A 1 248 LEU 248 245 245 LEU LEU A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PRO 250 247 247 PRO PRO A . n 
A 1 251 VAL 251 248 248 VAL VAL A . n 
A 1 252 VAL 252 249 249 VAL VAL A . n 
A 1 253 GLN 253 250 250 GLN GLN A . n 
A 1 254 LEU 254 251 251 LEU LEU A . n 
A 1 255 ALA 255 252 252 ALA ALA A . n 
A 1 256 LEU 256 253 253 LEU LEU A . n 
A 1 257 ASN 257 254 254 ASN ASN A . n 
A 1 258 ASN 258 255 255 ASN ASN A . n 
A 1 259 THR 259 256 256 THR THR A . n 
A 1 260 TYR 260 257 257 TYR TYR A . n 
A 1 261 SER 261 258 258 SER SER A . n 
A 1 262 PRO 262 259 259 PRO PRO A . n 
A 1 263 VAL 263 260 260 VAL VAL A . n 
A 1 264 LEU 264 261 261 LEU LEU A . n 
A 1 265 LYS 265 262 262 LYS LYS A . n 
A 1 266 TYR 266 263 263 TYR TYR A . n 
A 1 267 THR 267 264 264 THR THR A . n 
A 1 268 PRO 268 265 265 PRO PRO A . n 
A 1 269 HIS 269 266 266 HIS HIS A . n 
A 1 270 GLN 270 267 267 GLN GLN A . n 
A 1 271 LEU 271 268 268 LEU LEU A . n 
A 1 272 LEU 272 269 269 LEU LEU A . n 
A 1 273 PHE 273 270 270 PHE PHE A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 ASP 276 273 273 ASP ASP A . n 
A 1 277 SER 277 274 274 SER SER A . n 
A 1 278 ASN 278 275 275 ASN ASN A . n 
A 1 279 THR 279 276 276 THR THR A . n 
A 1 280 PRO 280 277 277 PRO PRO A . n 
A 1 281 PHE 281 278 278 PHE PHE A . n 
A 1 282 ALA 282 279 279 ALA ALA A . n 
A 1 283 ASN 283 280 280 ASN ASN A . n 
A 1 284 GLN 284 281 281 GLN GLN A . n 
A 1 285 ASP 285 282 282 ASP ASP A . n 
A 1 286 THR 286 283 283 THR THR A . n 
A 1 287 LEU 287 284 284 LEU LEU A . n 
A 1 288 ASP 288 285 285 ASP ASP A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 THR 290 287 287 THR THR A . n 
A 1 291 ARG 291 288 288 ARG ARG A . n 
A 1 292 GLU 292 289 289 GLU GLU A . n 
A 1 293 GLU 293 290 290 GLU GLU A . n 
A 1 294 GLU 294 291 291 GLU GLU A . n 
A 1 295 LEU 295 292 292 LEU LEU A . n 
A 1 296 SER 296 293 293 SER SER A . n 
A 1 297 LEU 297 294 294 LEU LEU A . n 
A 1 298 LEU 298 295 295 LEU LEU A . n 
A 1 299 GLN 299 296 296 GLN GLN A . n 
A 1 300 GLU 300 297 297 GLU GLU A . n 
A 1 301 ILE 301 298 298 ILE ILE A . n 
A 1 302 ARG 302 299 299 ARG ARG A . n 
A 1 303 THR 303 300 300 THR THR A . n 
A 1 304 SER 304 301 301 SER SER A . n 
A 1 305 LEU 305 302 302 LEU LEU A . n 
A 1 306 TYR 306 303 303 TYR TYR A . n 
A 1 307 HIS 307 304 304 HIS HIS A . n 
A 1 308 PRO 308 305 305 PRO PRO A . n 
A 1 309 SER 309 306 306 SER SER A . n 
A 1 310 THR 310 307 307 THR THR A . n 
A 1 311 PRO 311 308 308 PRO PRO A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 ALA 313 310 310 ALA ALA A . n 
A 1 314 SER 314 311 311 SER SER A . n 
A 1 315 SER 315 312 312 SER SER A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 SER 317 314 314 SER SER A . n 
A 1 318 TRP 318 315 315 TRP TRP A . n 
A 1 319 SER 319 316 316 SER SER A . n 
A 1 320 PRO 320 317 317 PRO PRO A . n 
A 1 321 VAL 321 318 318 VAL VAL A . n 
A 1 322 VAL 322 319 319 VAL VAL A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 GLN 324 321 321 GLN GLN A . n 
A 1 325 LEU 325 322 322 LEU LEU A . n 
A 1 326 VAL 326 323 323 VAL VAL A . n 
A 1 327 GLN 327 324 324 GLN GLN A . n 
A 1 328 GLU 328 325 325 GLU GLU A . n 
A 1 329 ARG 329 326 326 ARG ARG A . n 
A 1 330 VAL 330 327 327 VAL VAL A . n 
A 1 331 ALA 331 328 328 ALA ALA A . n 
A 1 332 ARG 332 329 329 ARG ARG A . n 
A 1 333 PRO 333 330 330 PRO PRO A . n 
A 1 334 ALA 334 331 331 ALA ALA A . n 
A 1 335 SER 335 332 332 SER SER A . n 
A 1 336 LEU 336 333 333 LEU LEU A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 PRO 338 335 335 PRO PRO A . n 
A 1 339 ARG 339 336 336 ARG ARG A . n 
A 1 340 TRP 340 337 337 TRP TRP A . n 
A 1 341 HIS 341 338 338 HIS HIS A . n 
A 1 342 LYS 342 339 339 LYS LYS A . n 
A 1 343 PRO 343 340 340 PRO PRO A . n 
A 1 344 SER 344 341 341 SER SER A . n 
A 1 345 THR 345 342 342 THR THR A . n 
A 1 346 VAL 346 343 343 VAL VAL A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 LYS 348 345 345 LYS LYS A . n 
A 1 349 VAL 349 346 346 VAL VAL A . n 
A 1 350 LEU 350 347 347 LEU LEU A . n 
A 1 351 ASN 351 348 348 ASN ASN A . n 
A 1 352 PRO 352 349 349 PRO PRO A . n 
A 1 353 ARG 353 350 350 ARG ARG A . n 
A 1 354 THR 354 351 351 THR THR A . n 
A 1 355 VAL 355 352 352 VAL VAL A . n 
A 1 356 VAL 356 353 353 VAL VAL A . n 
A 1 357 ILE 357 354 354 ILE ILE A . n 
A 1 358 LEU 358 355 355 LEU LEU A . n 
A 1 359 ASP 359 356 356 ASP ASP A . n 
A 1 360 HIS 360 357 357 HIS HIS A . n 
A 1 361 LEU 361 358 358 LEU LEU A . n 
A 1 362 GLY 362 359 359 GLY GLY A . n 
A 1 363 ASN 363 360 360 ASN ASN A . n 
A 1 364 ASN 364 361 361 ASN ASN A . n 
A 1 365 ARG 365 362 362 ARG ARG A . n 
A 1 366 THR 366 363 363 THR THR A . n 
A 1 367 VAL 367 364 364 VAL VAL A . n 
A 1 368 SER 368 365 365 SER SER A . n 
A 1 369 ILE 369 366 366 ILE ILE A . n 
A 1 370 ASP 370 367 367 ASP ASP A . n 
A 1 371 ASN 371 368 368 ASN ASN A . n 
A 1 372 LEU 372 369 369 LEU LEU A . n 
A 1 373 LYS 373 370 370 LYS LYS A . n 
A 1 374 PRO 374 371 371 PRO PRO A . n 
A 1 375 THR 375 372 372 THR THR A . n 
A 1 376 SER 376 373 373 SER SER A . n 
A 1 377 HIS 377 374 374 HIS HIS A . n 
A 1 378 GLN 378 375 375 GLN GLN A . n 
A 1 379 ASN 379 376 ?   ?   ?   A . n 
A 1 380 GLY 380 377 ?   ?   ?   A . n 
A 1 381 THR 381 378 ?   ?   ?   A . n 
A 1 382 THR 382 379 ?   ?   ?   A . n 
A 1 383 ASN 383 380 ?   ?   ?   A . n 
A 1 384 ASP 384 381 ?   ?   ?   A . n 
A 1 385 THR 385 382 ?   ?   ?   A . n 
A 1 386 ALA 386 383 ?   ?   ?   A . n 
A 1 387 THR 387 384 ?   ?   ?   A . n 
A 1 388 MET 388 385 ?   ?   ?   A . n 
A 1 389 ASP 389 386 ?   ?   ?   A . n 
A 1 390 HIS 390 387 ?   ?   ?   A . n 
A 1 391 LEU 391 388 ?   ?   ?   A . n 
A 1 392 GLU 392 389 ?   ?   ?   A . n 
A 1 393 LYS 393 390 ?   ?   ?   A . n 
A 1 394 ASN 394 391 ?   ?   ?   A . n 
A 1 395 GLU 395 392 ?   ?   ?   A . n 
B 1 1   GLY 1   -2  ?   ?   ?   B . n 
B 1 2   PRO 2   -1  ?   ?   ?   B . n 
B 1 3   GLY 3   0   ?   ?   ?   B . n 
B 1 4   CYS 4   1   ?   ?   ?   B . n 
B 1 5   ASN 5   2   ?   ?   ?   B . n 
B 1 6   THR 6   3   ?   ?   ?   B . n 
B 1 7   LYS 7   4   ?   ?   ?   B . n 
B 1 8   LYS 8   5   ?   ?   ?   B . n 
B 1 9   PRO 9   6   ?   ?   ?   B . n 
B 1 10  ASN 10  7   ?   ?   ?   B . n 
B 1 11  LEU 11  8   ?   ?   ?   B . n 
B 1 12  ASP 12  9   ?   ?   ?   B . n 
B 1 13  ALA 13  10  ?   ?   ?   B . n 
B 1 14  GLU 14  11  ?   ?   ?   B . n 
B 1 15  LEU 15  12  ?   ?   ?   B . n 
B 1 16  ASP 16  13  ?   ?   ?   B . n 
B 1 17  GLN 17  14  ?   ?   ?   B . n 
B 1 18  LEU 18  15  ?   ?   ?   B . n 
B 1 19  LEU 19  16  ?   ?   ?   B . n 
B 1 20  GLN 20  17  ?   ?   ?   B . n 
B 1 21  GLY 21  18  ?   ?   ?   B . n 
B 1 22  HIS 22  19  ?   ?   ?   B . n 
B 1 23  TYR 23  20  ?   ?   ?   B . n 
B 1 24  ILE 24  21  ?   ?   ?   B . n 
B 1 25  LYS 25  22  ?   ?   ?   B . n 
B 1 26  GLY 26  23  ?   ?   ?   B . n 
B 1 27  TYR 27  24  ?   ?   ?   B . n 
B 1 28  PRO 28  25  ?   ?   ?   B . n 
B 1 29  LYS 29  26  ?   ?   ?   B . n 
B 1 30  GLN 30  27  ?   ?   ?   B . n 
B 1 31  TYR 31  28  ?   ?   ?   B . n 
B 1 32  THR 32  29  ?   ?   ?   B . n 
B 1 33  TYR 33  30  ?   ?   ?   B . n 
B 1 34  PHE 34  31  ?   ?   ?   B . n 
B 1 35  LEU 35  32  ?   ?   ?   B . n 
B 1 36  GLU 36  33  ?   ?   ?   B . n 
B 1 37  ASP 37  34  ?   ?   ?   B . n 
B 1 38  GLY 38  35  ?   ?   ?   B . n 
B 1 39  LYS 39  36  ?   ?   ?   B . n 
B 1 40  VAL 40  37  ?   ?   ?   B . n 
B 1 41  LYS 41  38  ?   ?   ?   B . n 
B 1 42  VAL 42  39  ?   ?   ?   B . n 
B 1 43  SER 43  40  ?   ?   ?   B . n 
B 1 44  ARG 44  41  ?   ?   ?   B . n 
B 1 45  PRO 45  42  ?   ?   ?   B . n 
B 1 46  GLU 46  43  ?   ?   ?   B . n 
B 1 47  GLY 47  44  ?   ?   ?   B . n 
B 1 48  VAL 48  45  ?   ?   ?   B . n 
B 1 49  LYS 49  46  ?   ?   ?   B . n 
B 1 50  ILE 50  47  ?   ?   ?   B . n 
B 1 51  ILE 51  48  ?   ?   ?   B . n 
B 1 52  PRO 52  49  ?   ?   ?   B . n 
B 1 53  PRO 53  50  ?   ?   ?   B . n 
B 1 54  GLN 54  51  ?   ?   ?   B . n 
B 1 55  SER 55  52  ?   ?   ?   B . n 
B 1 56  ASP 56  53  ?   ?   ?   B . n 
B 1 57  ARG 57  54  ?   ?   ?   B . n 
B 1 58  GLN 58  55  ?   ?   ?   B . n 
B 1 59  LYS 59  56  ?   ?   ?   B . n 
B 1 60  ILE 60  57  ?   ?   ?   B . n 
B 1 61  VAL 61  58  ?   ?   ?   B . n 
B 1 62  LEU 62  59  ?   ?   ?   B . n 
B 1 63  GLN 63  60  ?   ?   ?   B . n 
B 1 64  ALA 64  61  ?   ?   ?   B . n 
B 1 65  HIS 65  62  ?   ?   ?   B . n 
B 1 66  ASN 66  63  ?   ?   ?   B . n 
B 1 67  LEU 67  64  ?   ?   ?   B . n 
B 1 68  ALA 68  65  ?   ?   ?   B . n 
B 1 69  HIS 69  66  ?   ?   ?   B . n 
B 1 70  THR 70  67  ?   ?   ?   B . n 
B 1 71  GLY 71  68  ?   ?   ?   B . n 
B 1 72  ARG 72  69  ?   ?   ?   B . n 
B 1 73  GLU 73  70  ?   ?   ?   B . n 
B 1 74  ALA 74  71  ?   ?   ?   B . n 
B 1 75  THR 75  72  ?   ?   ?   B . n 
B 1 76  LEU 76  73  ?   ?   ?   B . n 
B 1 77  LEU 77  74  ?   ?   ?   B . n 
B 1 78  LYS 78  75  ?   ?   ?   B . n 
B 1 79  ILE 79  76  ?   ?   ?   B . n 
B 1 80  ALA 80  77  ?   ?   ?   B . n 
B 1 81  ASN 81  78  ?   ?   ?   B . n 
B 1 82  LEU 82  79  ?   ?   ?   B . n 
B 1 83  TYR 83  80  ?   ?   ?   B . n 
B 1 84  TRP 84  81  ?   ?   ?   B . n 
B 1 85  TRP 85  82  ?   ?   ?   B . n 
B 1 86  PRO 86  83  ?   ?   ?   B . n 
B 1 87  ASN 87  84  ?   ?   ?   B . n 
B 1 88  MET 88  85  ?   ?   ?   B . n 
B 1 89  ARG 89  86  ?   ?   ?   B . n 
B 1 90  LYS 90  87  ?   ?   ?   B . n 
B 1 91  ASP 91  88  ?   ?   ?   B . n 
B 1 92  VAL 92  89  ?   ?   ?   B . n 
B 1 93  VAL 93  90  ?   ?   ?   B . n 
B 1 94  LYS 94  91  ?   ?   ?   B . n 
B 1 95  GLN 95  92  ?   ?   ?   B . n 
B 1 96  LEU 96  93  ?   ?   ?   B . n 
B 1 97  GLY 97  94  ?   ?   ?   B . n 
B 1 98  ARG 98  95  ?   ?   ?   B . n 
B 1 99  CYS 99  96  ?   ?   ?   B . n 
B 1 100 GLN 100 97  ?   ?   ?   B . n 
B 1 101 GLN 101 98  ?   ?   ?   B . n 
B 1 102 CYS 102 99  ?   ?   ?   B . n 
B 1 103 LEU 103 100 ?   ?   ?   B . n 
B 1 104 ILE 104 101 ?   ?   ?   B . n 
B 1 105 THR 105 102 ?   ?   ?   B . n 
B 1 106 ASN 106 103 ?   ?   ?   B . n 
B 1 107 ALA 107 104 ?   ?   ?   B . n 
B 1 108 SER 108 105 ?   ?   ?   B . n 
B 1 109 ASN 109 106 ?   ?   ?   B . n 
B 1 110 LYS 110 107 ?   ?   ?   B . n 
B 1 111 ALA 111 108 ?   ?   ?   B . n 
B 1 112 SER 112 109 ?   ?   ?   B . n 
B 1 113 GLY 113 110 ?   ?   ?   B . n 
B 1 114 PRO 114 111 ?   ?   ?   B . n 
B 1 115 ILE 115 112 ?   ?   ?   B . n 
B 1 116 LEU 116 113 ?   ?   ?   B . n 
B 1 117 ARG 117 114 ?   ?   ?   B . n 
B 1 118 PRO 118 115 ?   ?   ?   B . n 
B 1 119 ASP 119 116 116 ASP ASP B . n 
B 1 120 ARG 120 117 117 ARG ARG B . n 
B 1 121 PRO 121 118 118 PRO PRO B . n 
B 1 122 GLN 122 119 119 GLN GLN B . n 
B 1 123 LYS 123 120 120 LYS LYS B . n 
B 1 124 PRO 124 121 121 PRO PRO B . n 
B 1 125 PHE 125 122 122 PHE PHE B . n 
B 1 126 ASP 126 123 123 ASP ASP B . n 
B 1 127 LYS 127 124 124 LYS LYS B . n 
B 1 128 PHE 128 125 125 PHE PHE B . n 
B 1 129 PHE 129 126 126 PHE PHE B . n 
B 1 130 ILE 130 127 127 ILE ILE B . n 
B 1 131 ASP 131 128 128 ASP ASP B . n 
B 1 132 TYR 132 129 129 TYR TYR B . n 
B 1 133 ILE 133 130 130 ILE ILE B . n 
B 1 134 GLY 134 131 131 GLY GLY B . n 
B 1 135 PRO 135 132 132 PRO PRO B . n 
B 1 136 LEU 136 133 133 LEU LEU B . n 
B 1 137 PRO 137 134 134 PRO PRO B . n 
B 1 138 PRO 138 135 135 PRO PRO B . n 
B 1 139 SER 139 136 136 SER SER B . n 
B 1 140 GLN 140 137 137 GLN GLN B . n 
B 1 141 GLY 141 138 138 GLY GLY B . n 
B 1 142 TYR 142 139 139 TYR TYR B . n 
B 1 143 LEU 143 140 140 LEU LEU B . n 
B 1 144 TYR 144 141 141 TYR TYR B . n 
B 1 145 VAL 145 142 142 VAL VAL B . n 
B 1 146 LEU 146 143 143 LEU LEU B . n 
B 1 147 VAL 147 144 144 VAL VAL B . n 
B 1 148 VAL 148 145 145 VAL VAL B . n 
B 1 149 VAL 149 146 146 VAL VAL B . n 
B 1 150 ASP 150 147 147 ASP ASP B . n 
B 1 151 GLY 151 148 148 GLY GLY B . n 
B 1 152 MET 152 149 149 MET MET B . n 
B 1 153 THR 153 150 150 THR THR B . n 
B 1 154 GLY 154 151 151 GLY GLY B . n 
B 1 155 PHE 155 152 152 PHE PHE B . n 
B 1 156 THR 156 153 153 THR THR B . n 
B 1 157 TRP 157 154 154 TRP TRP B . n 
B 1 158 LEU 158 155 155 LEU LEU B . n 
B 1 159 TYR 159 156 156 TYR TYR B . n 
B 1 160 PRO 160 157 157 PRO PRO B . n 
B 1 161 THR 161 158 158 THR THR B . n 
B 1 162 LYS 162 159 159 LYS LYS B . n 
B 1 163 ALA 163 160 160 ALA ALA B . n 
B 1 164 PRO 164 161 161 PRO PRO B . n 
B 1 165 SER 165 162 162 SER SER B . n 
B 1 166 THR 166 163 163 THR THR B . n 
B 1 167 SER 167 164 164 SER SER B . n 
B 1 168 ALA 168 165 165 ALA ALA B . n 
B 1 169 THR 169 166 166 THR THR B . n 
B 1 170 VAL 170 167 167 VAL VAL B . n 
B 1 171 LYS 171 168 168 LYS LYS B . n 
B 1 172 SER 172 169 169 SER SER B . n 
B 1 173 LEU 173 170 170 LEU LEU B . n 
B 1 174 ASN 174 171 171 ASN ASN B . n 
B 1 175 VAL 175 172 172 VAL VAL B . n 
B 1 176 LEU 176 173 173 LEU LEU B . n 
B 1 177 THR 177 174 174 THR THR B . n 
B 1 178 SER 178 175 175 SER SER B . n 
B 1 179 ILE 179 176 176 ILE ILE B . n 
B 1 180 ALA 180 177 177 ALA ALA B . n 
B 1 181 ILE 181 178 178 ILE ILE B . n 
B 1 182 PRO 182 179 179 PRO PRO B . n 
B 1 183 LYS 183 180 180 LYS LYS B . n 
B 1 184 VAL 184 181 181 VAL VAL B . n 
B 1 185 ILE 185 182 182 ILE ILE B . n 
B 1 186 HIS 186 183 183 HIS HIS B . n 
B 1 187 SER 187 184 184 SER SER B . n 
B 1 188 ASP 188 185 185 ASP ASP B . n 
B 1 189 GLN 189 186 186 GLN GLN B . n 
B 1 190 GLY 190 187 187 GLY GLY B . n 
B 1 191 ALA 191 188 188 ALA ALA B . n 
B 1 192 ALA 192 189 189 ALA ALA B . n 
B 1 193 PHE 193 190 190 PHE PHE B . n 
B 1 194 THR 194 191 191 THR THR B . n 
B 1 195 SER 195 192 192 SER SER B . n 
B 1 196 SER 196 193 193 SER SER B . n 
B 1 197 THR 197 194 194 THR THR B . n 
B 1 198 PHE 198 195 195 PHE PHE B . n 
B 1 199 ALA 199 196 196 ALA ALA B . n 
B 1 200 GLU 200 197 197 GLU GLU B . n 
B 1 201 TRP 201 198 198 TRP TRP B . n 
B 1 202 ALA 202 199 199 ALA ALA B . n 
B 1 203 LYS 203 200 200 LYS LYS B . n 
B 1 204 GLU 204 201 201 GLU GLU B . n 
B 1 205 ARG 205 202 202 ARG ARG B . n 
B 1 206 GLY 206 203 203 GLY GLY B . n 
B 1 207 ILE 207 204 204 ILE ILE B . n 
B 1 208 HIS 208 205 205 HIS HIS B . n 
B 1 209 LEU 209 206 206 LEU LEU B . n 
B 1 210 GLU 210 207 207 GLU GLU B . n 
B 1 211 PHE 211 208 208 PHE PHE B . n 
B 1 212 SER 212 209 209 SER SER B . n 
B 1 213 THR 213 210 210 THR THR B . n 
B 1 214 PRO 214 211 211 PRO PRO B . n 
B 1 215 TYR 215 212 212 TYR TYR B . n 
B 1 216 HIS 216 213 213 HIS HIS B . n 
B 1 217 PRO 217 214 214 PRO PRO B . n 
B 1 218 GLN 218 215 215 GLN GLN B . n 
B 1 219 SER 219 216 216 SER SER B . n 
B 1 220 SER 220 217 217 SER SER B . n 
B 1 221 GLY 221 218 218 GLY GLY B . n 
B 1 222 LYS 222 219 219 LYS LYS B . n 
B 1 223 VAL 223 220 220 VAL VAL B . n 
B 1 224 GLU 224 221 221 GLU GLU B . n 
B 1 225 ARG 225 222 222 ARG ARG B . n 
B 1 226 LYS 226 223 223 LYS LYS B . n 
B 1 227 ASN 227 224 224 ASN ASN B . n 
B 1 228 SER 228 225 225 SER SER B . n 
B 1 229 ASP 229 226 226 ASP ASP B . n 
B 1 230 ILE 230 227 227 ILE ILE B . n 
B 1 231 LYS 231 228 228 LYS LYS B . n 
B 1 232 ARG 232 229 229 ARG ARG B . n 
B 1 233 LEU 233 230 230 LEU LEU B . n 
B 1 234 LEU 234 231 231 LEU LEU B . n 
B 1 235 THR 235 232 232 THR THR B . n 
B 1 236 LYS 236 233 233 LYS LYS B . n 
B 1 237 LEU 237 234 234 LEU LEU B . n 
B 1 238 LEU 238 235 235 LEU LEU B . n 
B 1 239 VAL 239 236 236 VAL VAL B . n 
B 1 240 GLY 240 237 237 GLY GLY B . n 
B 1 241 ARG 241 238 238 ARG ARG B . n 
B 1 242 PRO 242 239 239 PRO PRO B . n 
B 1 243 THR 243 240 240 THR THR B . n 
B 1 244 LYS 244 241 241 LYS LYS B . n 
B 1 245 TRP 245 242 242 TRP TRP B . n 
B 1 246 TYR 246 243 243 TYR TYR B . n 
B 1 247 ASP 247 244 244 ASP ASP B . n 
B 1 248 LEU 248 245 245 LEU LEU B . n 
B 1 249 LEU 249 246 246 LEU LEU B . n 
B 1 250 PRO 250 247 247 PRO PRO B . n 
B 1 251 VAL 251 248 248 VAL VAL B . n 
B 1 252 VAL 252 249 249 VAL VAL B . n 
B 1 253 GLN 253 250 250 GLN GLN B . n 
B 1 254 LEU 254 251 251 LEU LEU B . n 
B 1 255 ALA 255 252 252 ALA ALA B . n 
B 1 256 LEU 256 253 253 LEU LEU B . n 
B 1 257 ASN 257 254 254 ASN ASN B . n 
B 1 258 ASN 258 255 255 ASN ASN B . n 
B 1 259 THR 259 256 256 THR THR B . n 
B 1 260 TYR 260 257 257 TYR TYR B . n 
B 1 261 SER 261 258 258 SER SER B . n 
B 1 262 PRO 262 259 259 PRO PRO B . n 
B 1 263 VAL 263 260 260 VAL VAL B . n 
B 1 264 LEU 264 261 261 LEU LEU B . n 
B 1 265 LYS 265 262 262 LYS LYS B . n 
B 1 266 TYR 266 263 263 TYR TYR B . n 
B 1 267 THR 267 264 264 THR THR B . n 
B 1 268 PRO 268 265 265 PRO PRO B . n 
B 1 269 HIS 269 266 266 HIS HIS B . n 
B 1 270 GLN 270 267 267 GLN GLN B . n 
B 1 271 LEU 271 268 268 LEU LEU B . n 
B 1 272 LEU 272 269 269 LEU LEU B . n 
B 1 273 PHE 273 270 270 PHE PHE B . n 
B 1 274 GLY 274 271 271 GLY GLY B . n 
B 1 275 ILE 275 272 272 ILE ILE B . n 
B 1 276 ASP 276 273 273 ASP ASP B . n 
B 1 277 SER 277 274 274 SER SER B . n 
B 1 278 ASN 278 275 275 ASN ASN B . n 
B 1 279 THR 279 276 276 THR THR B . n 
B 1 280 PRO 280 277 277 PRO PRO B . n 
B 1 281 PHE 281 278 278 PHE PHE B . n 
B 1 282 ALA 282 279 279 ALA ALA B . n 
B 1 283 ASN 283 280 280 ASN ASN B . n 
B 1 284 GLN 284 281 281 GLN GLN B . n 
B 1 285 ASP 285 282 282 ASP ASP B . n 
B 1 286 THR 286 283 283 THR THR B . n 
B 1 287 LEU 287 284 284 LEU LEU B . n 
B 1 288 ASP 288 285 285 ASP ASP B . n 
B 1 289 LEU 289 286 286 LEU LEU B . n 
B 1 290 THR 290 287 287 THR THR B . n 
B 1 291 ARG 291 288 288 ARG ARG B . n 
B 1 292 GLU 292 289 289 GLU GLU B . n 
B 1 293 GLU 293 290 290 GLU GLU B . n 
B 1 294 GLU 294 291 291 GLU GLU B . n 
B 1 295 LEU 295 292 292 LEU LEU B . n 
B 1 296 SER 296 293 293 SER SER B . n 
B 1 297 LEU 297 294 294 LEU LEU B . n 
B 1 298 LEU 298 295 295 LEU LEU B . n 
B 1 299 GLN 299 296 296 GLN GLN B . n 
B 1 300 GLU 300 297 297 GLU GLU B . n 
B 1 301 ILE 301 298 298 ILE ILE B . n 
B 1 302 ARG 302 299 299 ARG ARG B . n 
B 1 303 THR 303 300 ?   ?   ?   B . n 
B 1 304 SER 304 301 ?   ?   ?   B . n 
B 1 305 LEU 305 302 ?   ?   ?   B . n 
B 1 306 TYR 306 303 ?   ?   ?   B . n 
B 1 307 HIS 307 304 ?   ?   ?   B . n 
B 1 308 PRO 308 305 ?   ?   ?   B . n 
B 1 309 SER 309 306 ?   ?   ?   B . n 
B 1 310 THR 310 307 ?   ?   ?   B . n 
B 1 311 PRO 311 308 ?   ?   ?   B . n 
B 1 312 PRO 312 309 ?   ?   ?   B . n 
B 1 313 ALA 313 310 ?   ?   ?   B . n 
B 1 314 SER 314 311 ?   ?   ?   B . n 
B 1 315 SER 315 312 ?   ?   ?   B . n 
B 1 316 ARG 316 313 ?   ?   ?   B . n 
B 1 317 SER 317 314 ?   ?   ?   B . n 
B 1 318 TRP 318 315 ?   ?   ?   B . n 
B 1 319 SER 319 316 ?   ?   ?   B . n 
B 1 320 PRO 320 317 ?   ?   ?   B . n 
B 1 321 VAL 321 318 ?   ?   ?   B . n 
B 1 322 VAL 322 319 ?   ?   ?   B . n 
B 1 323 GLY 323 320 ?   ?   ?   B . n 
B 1 324 GLN 324 321 ?   ?   ?   B . n 
B 1 325 LEU 325 322 ?   ?   ?   B . n 
B 1 326 VAL 326 323 ?   ?   ?   B . n 
B 1 327 GLN 327 324 ?   ?   ?   B . n 
B 1 328 GLU 328 325 ?   ?   ?   B . n 
B 1 329 ARG 329 326 ?   ?   ?   B . n 
B 1 330 VAL 330 327 ?   ?   ?   B . n 
B 1 331 ALA 331 328 ?   ?   ?   B . n 
B 1 332 ARG 332 329 ?   ?   ?   B . n 
B 1 333 PRO 333 330 ?   ?   ?   B . n 
B 1 334 ALA 334 331 ?   ?   ?   B . n 
B 1 335 SER 335 332 ?   ?   ?   B . n 
B 1 336 LEU 336 333 ?   ?   ?   B . n 
B 1 337 ARG 337 334 ?   ?   ?   B . n 
B 1 338 PRO 338 335 ?   ?   ?   B . n 
B 1 339 ARG 339 336 ?   ?   ?   B . n 
B 1 340 TRP 340 337 ?   ?   ?   B . n 
B 1 341 HIS 341 338 ?   ?   ?   B . n 
B 1 342 LYS 342 339 ?   ?   ?   B . n 
B 1 343 PRO 343 340 ?   ?   ?   B . n 
B 1 344 SER 344 341 ?   ?   ?   B . n 
B 1 345 THR 345 342 ?   ?   ?   B . n 
B 1 346 VAL 346 343 ?   ?   ?   B . n 
B 1 347 LEU 347 344 ?   ?   ?   B . n 
B 1 348 LYS 348 345 ?   ?   ?   B . n 
B 1 349 VAL 349 346 ?   ?   ?   B . n 
B 1 350 LEU 350 347 ?   ?   ?   B . n 
B 1 351 ASN 351 348 ?   ?   ?   B . n 
B 1 352 PRO 352 349 ?   ?   ?   B . n 
B 1 353 ARG 353 350 ?   ?   ?   B . n 
B 1 354 THR 354 351 ?   ?   ?   B . n 
B 1 355 VAL 355 352 ?   ?   ?   B . n 
B 1 356 VAL 356 353 ?   ?   ?   B . n 
B 1 357 ILE 357 354 ?   ?   ?   B . n 
B 1 358 LEU 358 355 ?   ?   ?   B . n 
B 1 359 ASP 359 356 ?   ?   ?   B . n 
B 1 360 HIS 360 357 ?   ?   ?   B . n 
B 1 361 LEU 361 358 ?   ?   ?   B . n 
B 1 362 GLY 362 359 ?   ?   ?   B . n 
B 1 363 ASN 363 360 ?   ?   ?   B . n 
B 1 364 ASN 364 361 ?   ?   ?   B . n 
B 1 365 ARG 365 362 ?   ?   ?   B . n 
B 1 366 THR 366 363 ?   ?   ?   B . n 
B 1 367 VAL 367 364 ?   ?   ?   B . n 
B 1 368 SER 368 365 ?   ?   ?   B . n 
B 1 369 ILE 369 366 ?   ?   ?   B . n 
B 1 370 ASP 370 367 ?   ?   ?   B . n 
B 1 371 ASN 371 368 ?   ?   ?   B . n 
B 1 372 LEU 372 369 ?   ?   ?   B . n 
B 1 373 LYS 373 370 ?   ?   ?   B . n 
B 1 374 PRO 374 371 ?   ?   ?   B . n 
B 1 375 THR 375 372 ?   ?   ?   B . n 
B 1 376 SER 376 373 ?   ?   ?   B . n 
B 1 377 HIS 377 374 ?   ?   ?   B . n 
B 1 378 GLN 378 375 ?   ?   ?   B . n 
B 1 379 ASN 379 376 ?   ?   ?   B . n 
B 1 380 GLY 380 377 ?   ?   ?   B . n 
B 1 381 THR 381 378 ?   ?   ?   B . n 
B 1 382 THR 382 379 ?   ?   ?   B . n 
B 1 383 ASN 383 380 ?   ?   ?   B . n 
B 1 384 ASP 384 381 ?   ?   ?   B . n 
B 1 385 THR 385 382 ?   ?   ?   B . n 
B 1 386 ALA 386 383 ?   ?   ?   B . n 
B 1 387 THR 387 384 ?   ?   ?   B . n 
B 1 388 MET 388 385 ?   ?   ?   B . n 
B 1 389 ASP 389 386 ?   ?   ?   B . n 
B 1 390 HIS 390 387 ?   ?   ?   B . n 
B 1 391 LEU 391 388 ?   ?   ?   B . n 
B 1 392 GLU 392 389 ?   ?   ?   B . n 
B 1 393 LYS 393 390 ?   ?   ?   B . n 
B 1 394 ASN 394 391 ?   ?   ?   B . n 
B 1 395 GLU 395 392 ?   ?   ?   B . n 
C 2 1   DA  1   1   1   DA  A   C . n 
C 2 2   DT  2   2   2   DT  T   C . n 
C 2 3   DT  3   3   3   DT  T   C . n 
C 2 4   DG  4   4   4   DG  G   C . n 
C 2 5   DT  5   5   5   DT  T   C . n 
C 2 6   DC  6   6   6   DC  C   C . n 
C 2 7   DA  7   7   7   DA  A   C . n 
C 2 8   DT  8   8   8   DT  T   C . n 
C 2 9   DG  9   9   9   DG  G   C . n 
C 2 10  DG  10  10  10  DG  G   C . n 
C 2 11  DA  11  11  11  DA  A   C . n 
C 2 12  DA  12  12  12  DA  A   C . n 
C 2 13  DT  13  13  13  DT  T   C . n 
C 2 14  DT  14  14  14  DT  T   C . n 
C 2 15  DT  15  15  15  DT  T   C . n 
C 2 16  DC  16  16  16  DC  C   C . n 
C 2 17  DG  17  17  17  DG  G   C . n 
C 2 18  DC  18  18  18  DC  C   C . n 
C 2 19  DA  19  19  19  DA  A   C . n 
D 3 1   DT  1   1   1   DT  T   D . n 
D 3 2   DG  2   2   2   DG  G   D . n 
D 3 3   DC  3   3   3   DC  C   D . n 
D 3 4   DG  4   4   4   DG  G   D . n 
D 3 5   DA  5   5   5   DA  A   D . n 
D 3 6   DA  6   6   6   DA  A   D . n 
D 3 7   DA  7   7   7   DA  A   D . n 
D 3 8   DT  8   8   8   DT  T   D . n 
D 3 9   DT  9   9   9   DT  T   D . n 
D 3 10  DC  10  10  10  DC  C   D . n 
D 3 11  DC  11  11  11  DC  C   D . n 
D 3 12  DA  12  12  12  DA  A   D . n 
D 3 13  DT  13  13  13  DT  T   D . n 
D 3 14  DG  14  14  14  DG  G   D . n 
D 3 15  DA  15  15  15  DA  A   D . n 
D 3 16  DC  16  16  16  DC  C   D . n 
D 3 17  DA  17  17  17  DA  A   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 ZN  1  401 393 ZN  ZN  A . 
F 5 GOL 1  402 801 GOL GOL A . 
G 5 GOL 1  403 802 GOL GOL A . 
H 6 X2P 1  404 1   X2P LIG A . 
I 7 MG  1  405 1   MG  MG  A . 
J 7 MG  1  406 1   MG  MG  A . 
K 8 SO4 1  407 2   SO4 SO4 A . 
L 8 SO4 1  408 3   SO4 SO4 A . 
M 5 GOL 1  409 2   GOL GOL A . 
N 8 SO4 1  401 1   SO4 SO4 B . 
O 7 MG  1  402 1   MG  MG  B . 
P 5 GOL 1  101 1   GOL GOL C . 
Q 9 HOH 1  501 126 HOH HOH A . 
Q 9 HOH 2  502 71  HOH HOH A . 
Q 9 HOH 3  503 139 HOH HOH A . 
Q 9 HOH 4  504 85  HOH HOH A . 
Q 9 HOH 5  505 122 HOH HOH A . 
Q 9 HOH 6  506 138 HOH HOH A . 
Q 9 HOH 7  507 78  HOH HOH A . 
Q 9 HOH 8  508 99  HOH HOH A . 
Q 9 HOH 9  509 77  HOH HOH A . 
Q 9 HOH 10 510 132 HOH HOH A . 
Q 9 HOH 11 511 59  HOH HOH A . 
Q 9 HOH 12 512 42  HOH HOH A . 
Q 9 HOH 13 513 26  HOH HOH A . 
Q 9 HOH 14 514 45  HOH HOH A . 
Q 9 HOH 15 515 53  HOH HOH A . 
Q 9 HOH 16 516 146 HOH HOH A . 
Q 9 HOH 17 517 140 HOH HOH A . 
Q 9 HOH 18 518 60  HOH HOH A . 
Q 9 HOH 19 519 86  HOH HOH A . 
Q 9 HOH 20 520 95  HOH HOH A . 
Q 9 HOH 21 521 37  HOH HOH A . 
Q 9 HOH 22 522 134 HOH HOH A . 
Q 9 HOH 23 523 130 HOH HOH A . 
Q 9 HOH 24 524 52  HOH HOH A . 
Q 9 HOH 25 525 51  HOH HOH A . 
Q 9 HOH 26 526 72  HOH HOH A . 
Q 9 HOH 27 527 114 HOH HOH A . 
Q 9 HOH 28 528 93  HOH HOH A . 
Q 9 HOH 29 529 149 HOH HOH A . 
Q 9 HOH 30 530 14  HOH HOH A . 
Q 9 HOH 31 531 63  HOH HOH A . 
Q 9 HOH 32 532 54  HOH HOH A . 
Q 9 HOH 33 533 49  HOH HOH A . 
Q 9 HOH 34 534 70  HOH HOH A . 
Q 9 HOH 35 535 32  HOH HOH A . 
Q 9 HOH 36 536 92  HOH HOH A . 
Q 9 HOH 37 537 129 HOH HOH A . 
Q 9 HOH 38 538 144 HOH HOH A . 
Q 9 HOH 39 539 96  HOH HOH A . 
Q 9 HOH 40 540 27  HOH HOH A . 
Q 9 HOH 41 541 148 HOH HOH A . 
Q 9 HOH 42 542 61  HOH HOH A . 
Q 9 HOH 43 543 123 HOH HOH A . 
Q 9 HOH 44 544 133 HOH HOH A . 
Q 9 HOH 45 545 113 HOH HOH A . 
Q 9 HOH 46 546 135 HOH HOH A . 
Q 9 HOH 47 547 102 HOH HOH A . 
Q 9 HOH 48 548 29  HOH HOH A . 
Q 9 HOH 49 549 117 HOH HOH A . 
Q 9 HOH 50 550 88  HOH HOH A . 
Q 9 HOH 51 551 68  HOH HOH A . 
Q 9 HOH 52 552 69  HOH HOH A . 
Q 9 HOH 53 553 155 HOH HOH A . 
Q 9 HOH 54 554 157 HOH HOH A . 
Q 9 HOH 55 555 161 HOH HOH A . 
Q 9 HOH 56 556 65  HOH HOH A . 
Q 9 HOH 57 557 160 HOH HOH A . 
Q 9 HOH 58 558 11  HOH HOH A . 
Q 9 HOH 59 559 44  HOH HOH A . 
Q 9 HOH 60 560 94  HOH HOH A . 
Q 9 HOH 61 561 159 HOH HOH A . 
Q 9 HOH 62 562 35  HOH HOH A . 
Q 9 HOH 63 563 119 HOH HOH A . 
Q 9 HOH 64 564 143 HOH HOH A . 
Q 9 HOH 65 565 100 HOH HOH A . 
Q 9 HOH 66 566 101 HOH HOH A . 
Q 9 HOH 67 567 46  HOH HOH A . 
Q 9 HOH 68 568 109 HOH HOH A . 
Q 9 HOH 69 569 18  HOH HOH A . 
Q 9 HOH 70 570 83  HOH HOH A . 
Q 9 HOH 71 571 103 HOH HOH A . 
Q 9 HOH 72 572 47  HOH HOH A . 
Q 9 HOH 73 573 5   HOH HOH A . 
Q 9 HOH 74 574 121 HOH HOH A . 
Q 9 HOH 75 575 30  HOH HOH A . 
Q 9 HOH 76 576 154 HOH HOH A . 
Q 9 HOH 77 577 10  HOH HOH A . 
Q 9 HOH 78 578 147 HOH HOH A . 
Q 9 HOH 79 579 2   HOH HOH A . 
Q 9 HOH 80 580 3   HOH HOH A . 
Q 9 HOH 81 581 12  HOH HOH A . 
Q 9 HOH 82 582 73  HOH HOH A . 
Q 9 HOH 83 583 28  HOH HOH A . 
Q 9 HOH 84 584 74  HOH HOH A . 
Q 9 HOH 85 585 127 HOH HOH A . 
Q 9 HOH 86 586 112 HOH HOH A . 
Q 9 HOH 87 587 38  HOH HOH A . 
Q 9 HOH 88 588 13  HOH HOH A . 
Q 9 HOH 89 589 40  HOH HOH A . 
Q 9 HOH 90 590 55  HOH HOH A . 
Q 9 HOH 91 591 56  HOH HOH A . 
Q 9 HOH 92 592 20  HOH HOH A . 
Q 9 HOH 93 593 162 HOH HOH A . 
Q 9 HOH 94 594 24  HOH HOH A . 
Q 9 HOH 95 595 9   HOH HOH A . 
R 9 HOH 1  501 115 HOH HOH B . 
R 9 HOH 2  502 84  HOH HOH B . 
R 9 HOH 3  503 107 HOH HOH B . 
R 9 HOH 4  504 118 HOH HOH B . 
R 9 HOH 5  505 97  HOH HOH B . 
R 9 HOH 6  506 158 HOH HOH B . 
R 9 HOH 7  507 163 HOH HOH B . 
R 9 HOH 8  508 58  HOH HOH B . 
R 9 HOH 9  509 136 HOH HOH B . 
R 9 HOH 10 510 106 HOH HOH B . 
R 9 HOH 11 511 128 HOH HOH B . 
R 9 HOH 12 512 21  HOH HOH B . 
R 9 HOH 13 513 111 HOH HOH B . 
R 9 HOH 14 514 76  HOH HOH B . 
R 9 HOH 15 515 79  HOH HOH B . 
R 9 HOH 16 516 7   HOH HOH B . 
R 9 HOH 17 517 142 HOH HOH B . 
R 9 HOH 18 518 110 HOH HOH B . 
R 9 HOH 19 519 105 HOH HOH B . 
R 9 HOH 20 520 151 HOH HOH B . 
R 9 HOH 21 521 17  HOH HOH B . 
R 9 HOH 22 522 33  HOH HOH B . 
R 9 HOH 23 523 36  HOH HOH B . 
R 9 HOH 24 524 34  HOH HOH B . 
R 9 HOH 25 525 152 HOH HOH B . 
R 9 HOH 26 526 156 HOH HOH B . 
R 9 HOH 27 527 16  HOH HOH B . 
R 9 HOH 28 528 22  HOH HOH B . 
R 9 HOH 29 529 25  HOH HOH B . 
S 9 HOH 1  201 137 HOH HOH C . 
S 9 HOH 2  202 66  HOH HOH C . 
S 9 HOH 3  203 75  HOH HOH C . 
S 9 HOH 4  204 116 HOH HOH C . 
S 9 HOH 5  205 57  HOH HOH C . 
S 9 HOH 6  206 124 HOH HOH C . 
S 9 HOH 7  207 41  HOH HOH C . 
S 9 HOH 8  208 98  HOH HOH C . 
S 9 HOH 9  209 104 HOH HOH C . 
S 9 HOH 10 210 87  HOH HOH C . 
S 9 HOH 11 211 81  HOH HOH C . 
S 9 HOH 12 212 64  HOH HOH C . 
S 9 HOH 13 213 120 HOH HOH C . 
S 9 HOH 14 214 91  HOH HOH C . 
S 9 HOH 15 215 141 HOH HOH C . 
S 9 HOH 16 216 1   HOH HOH C . 
S 9 HOH 17 217 153 HOH HOH C . 
S 9 HOH 18 218 89  HOH HOH C . 
S 9 HOH 19 219 43  HOH HOH C . 
S 9 HOH 20 220 125 HOH HOH C . 
S 9 HOH 21 221 67  HOH HOH C . 
T 9 HOH 1  101 39  HOH HOH D . 
T 9 HOH 2  102 131 HOH HOH D . 
T 9 HOH 3  103 150 HOH HOH D . 
T 9 HOH 4  104 82  HOH HOH D . 
T 9 HOH 5  105 62  HOH HOH D . 
T 9 HOH 6  106 80  HOH HOH D . 
T 9 HOH 7  107 108 HOH HOH D . 
T 9 HOH 8  108 145 HOH HOH D . 
T 9 HOH 9  109 31  HOH HOH D . 
T 9 HOH 10 110 90  HOH HOH D . 
T 9 HOH 11 111 23  HOH HOH D . 
T 9 HOH 12 112 48  HOH HOH D . 
T 9 HOH 13 113 19  HOH HOH D . 
T 9 HOH 14 114 50  HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 28350 ? 
1 MORE         -287  ? 
1 'SSA (A^2)'  56360 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_555 -y,-x,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 62.0450000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 401 ? 1_555 ND1 ? A HIS 69  ? A HIS 66  ? 1_555 105.0 ? 
2  NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 99  ? A CYS 96  ? 1_555 107.5 ? 
3  ND1 ? A HIS 69  ? A HIS 66  ? 1_555 ZN ? E ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 99  ? A CYS 96  ? 1_555 100.7 ? 
4  NE2 ? A HIS 65  ? A HIS 62  ? 1_555 ZN ? E ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 106.8 ? 
5  ND1 ? A HIS 69  ? A HIS 66  ? 1_555 ZN ? E ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 119.3 ? 
6  SG  ? A CYS 99  ? A CYS 96  ? 1_555 ZN ? E ZN . ? A ZN 401 ? 1_555 SG  ? A CYS 102 ? A CYS 99  ? 1_555 116.6 ? 
7  OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 OD2 ? A ASP 188 ? A ASP 185 ? 1_555 85.9  ? 
8  OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O   ? H X2P .   ? A X2P 404 ? 1_555 96.6  ? 
9  OD2 ? A ASP 188 ? A ASP 185 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O   ? H X2P .   ? A X2P 404 ? 1_555 93.9  ? 
10 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O1  ? H X2P .   ? A X2P 404 ? 1_555 170.4 ? 
11 OD2 ? A ASP 188 ? A ASP 185 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O1  ? H X2P .   ? A X2P 404 ? 1_555 88.9  ? 
12 O   ? H X2P .   ? A X2P 404 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O1  ? H X2P .   ? A X2P 404 ? 1_555 75.7  ? 
13 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O   ? Q HOH .   ? A HOH 521 ? 1_555 86.9  ? 
14 OD2 ? A ASP 188 ? A ASP 185 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O   ? Q HOH .   ? A HOH 521 ? 1_555 91.5  ? 
15 O   ? H X2P .   ? A X2P 404 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O   ? Q HOH .   ? A HOH 521 ? 1_555 173.8 ? 
16 O1  ? H X2P .   ? A X2P 404 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O   ? Q HOH .   ? A HOH 521 ? 1_555 101.4 ? 
17 OD1 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O   ? Q HOH .   ? A HOH 549 ? 1_555 99.3  ? 
18 OD2 ? A ASP 188 ? A ASP 185 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O   ? Q HOH .   ? A HOH 549 ? 1_555 169.7 ? 
19 O   ? H X2P .   ? A X2P 404 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O   ? Q HOH .   ? A HOH 549 ? 1_555 94.4  ? 
20 O1  ? H X2P .   ? A X2P 404 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O   ? Q HOH .   ? A HOH 549 ? 1_555 87.1  ? 
21 O   ? Q HOH .   ? A HOH 521 ? 1_555 MG ? I MG . ? A MG 405 ? 1_555 O   ? Q HOH .   ? A HOH 549 ? 1_555 80.0  ? 
22 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 91.6  ? 
23 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 88.5  ? 
24 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 65.8  ? 
25 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 O4  ? H X2P .   ? A X2P 404 ? 1_555 175.3 ? 
26 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 O4  ? H X2P .   ? A X2P 404 ? 1_555 92.1  ? 
27 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 O4  ? H X2P .   ? A X2P 404 ? 1_555 95.7  ? 
28 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 O   ? H X2P .   ? A X2P 404 ? 1_555 96.6  ? 
29 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 O   ? H X2P .   ? A X2P 404 ? 1_555 161.0 ? 
30 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 O   ? H X2P .   ? A X2P 404 ? 1_555 97.2  ? 
31 O4  ? H X2P .   ? A X2P 404 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 O   ? H X2P .   ? A X2P 404 ? 1_555 80.8  ? 
32 OD2 ? A ASP 131 ? A ASP 128 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 O   ? T HOH .   ? D HOH 101 ? 1_555 80.5  ? 
33 OE1 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 O   ? T HOH .   ? D HOH 101 ? 1_555 104.6 ? 
34 OE2 ? A GLU 224 ? A GLU 221 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 O   ? T HOH .   ? D HOH 101 ? 1_555 165.3 ? 
35 O4  ? H X2P .   ? A X2P 404 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 O   ? T HOH .   ? D HOH 101 ? 1_555 95.7  ? 
36 O   ? H X2P .   ? A X2P 404 ? 1_555 MG ? J MG . ? A MG 406 ? 1_555 O   ? T HOH .   ? D HOH 101 ? 1_555 93.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-10-07 
2 'Structure model' 1 1 2015-11-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? .      1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? BUSTER-TNT  ? ? ? 2.11.5 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15   3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .      4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .      5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DC 6  ? ? "C1'" C DC 6  ? ? N1 C DC 6  ? ? 110.33 108.30 2.03 0.30 N 
2 1 "O4'" D DC 11 ? ? "C1'" D DC 11 ? ? N1 D DC 11 ? ? 110.21 108.30 1.91 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 34  ? ? 46.65   25.59  
2  1 THR A 174 ? ? -66.48  4.80   
3  1 GLN A 186 ? ? -99.06  33.90  
4  1 LYS A 262 ? ? 71.53   31.21  
5  1 ARG A 329 ? ? -119.70 76.49  
6  1 THR B 174 ? ? -68.64  4.56   
7  1 GLN B 186 ? ? -90.15  35.37  
8  1 TYR B 212 ? ? 71.74   -8.87  
9  1 HIS B 213 ? ? -117.32 75.40  
10 1 SER B 216 ? ? -134.87 -90.76 
11 1 LYS B 262 ? ? 78.26   -11.57 
12 1 LEU B 284 ? ? 81.21   -18.69 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 8   ? CG  ? A LEU 11  CG  
2  1 Y 1 A LEU 8   ? CD1 ? A LEU 11  CD1 
3  1 Y 1 A LEU 8   ? CD2 ? A LEU 11  CD2 
4  1 Y 1 A LYS 22  ? CG  ? A LYS 25  CG  
5  1 Y 1 A LYS 22  ? CD  ? A LYS 25  CD  
6  1 Y 1 A LYS 22  ? CE  ? A LYS 25  CE  
7  1 Y 1 A LYS 22  ? NZ  ? A LYS 25  NZ  
8  1 Y 1 A GLU 43  ? CG  ? A GLU 46  CG  
9  1 Y 1 A GLU 43  ? CD  ? A GLU 46  CD  
10 1 Y 1 A GLU 43  ? OE1 ? A GLU 46  OE1 
11 1 Y 1 A GLU 43  ? OE2 ? A GLU 46  OE2 
12 1 Y 1 A LYS 87  ? CG  ? A LYS 90  CG  
13 1 Y 1 A LYS 87  ? CD  ? A LYS 90  CD  
14 1 Y 1 A LYS 87  ? CE  ? A LYS 90  CE  
15 1 Y 1 A LYS 87  ? NZ  ? A LYS 90  NZ  
16 1 Y 1 A LYS 91  ? CG  ? A LYS 94  CG  
17 1 Y 1 A LYS 91  ? CD  ? A LYS 94  CD  
18 1 Y 1 A LYS 91  ? CE  ? A LYS 94  CE  
19 1 Y 1 A LYS 91  ? NZ  ? A LYS 94  NZ  
20 1 Y 1 A ARG 329 ? CG  ? A ARG 332 CG  
21 1 Y 1 A ARG 329 ? CD  ? A ARG 332 CD  
22 1 Y 1 A ARG 329 ? NE  ? A ARG 332 NE  
23 1 Y 1 A ARG 329 ? CZ  ? A ARG 332 CZ  
24 1 Y 1 A ARG 329 ? NH1 ? A ARG 332 NH1 
25 1 Y 1 A ARG 329 ? NH2 ? A ARG 332 NH2 
26 1 Y 1 A LYS 345 ? CG  ? A LYS 348 CG  
27 1 Y 1 A LYS 345 ? CD  ? A LYS 348 CD  
28 1 Y 1 A LYS 345 ? CE  ? A LYS 348 CE  
29 1 Y 1 A LYS 345 ? NZ  ? A LYS 348 NZ  
30 1 Y 1 B ARG 117 ? CG  ? B ARG 120 CG  
31 1 Y 1 B ARG 117 ? CD  ? B ARG 120 CD  
32 1 Y 1 B ARG 117 ? NE  ? B ARG 120 NE  
33 1 Y 1 B ARG 117 ? CZ  ? B ARG 120 CZ  
34 1 Y 1 B ARG 117 ? NH1 ? B ARG 120 NH1 
35 1 Y 1 B ARG 117 ? NH2 ? B ARG 120 NH2 
36 1 Y 1 B LYS 168 ? CG  ? B LYS 171 CG  
37 1 Y 1 B LYS 168 ? CD  ? B LYS 171 CD  
38 1 Y 1 B LYS 168 ? CE  ? B LYS 171 CE  
39 1 Y 1 B LYS 168 ? NZ  ? B LYS 171 NZ  
40 1 Y 1 B GLU 197 ? CG  ? B GLU 200 CG  
41 1 Y 1 B GLU 197 ? CD  ? B GLU 200 CD  
42 1 Y 1 B GLU 197 ? OE1 ? B GLU 200 OE1 
43 1 Y 1 B GLU 197 ? OE2 ? B GLU 200 OE2 
44 1 Y 1 B GLU 221 ? CG  ? B GLU 224 CG  
45 1 Y 1 B GLU 221 ? CD  ? B GLU 224 CD  
46 1 Y 1 B GLU 221 ? OE1 ? B GLU 224 OE1 
47 1 Y 1 B GLU 221 ? OE2 ? B GLU 224 OE2 
48 1 Y 1 B LYS 228 ? CG  ? B LYS 231 CG  
49 1 Y 1 B LYS 228 ? CD  ? B LYS 231 CD  
50 1 Y 1 B LYS 228 ? CE  ? B LYS 231 CE  
51 1 Y 1 B LYS 228 ? NZ  ? B LYS 231 NZ  
52 1 Y 1 B LYS 241 ? CG  ? B LYS 244 CG  
53 1 Y 1 B LYS 241 ? CD  ? B LYS 244 CD  
54 1 Y 1 B LYS 241 ? CE  ? B LYS 244 CE  
55 1 Y 1 B LYS 241 ? NZ  ? B LYS 244 NZ  
56 1 Y 1 B GLN 281 ? CG  ? B GLN 284 CG  
57 1 Y 1 B GLN 281 ? CD  ? B GLN 284 CD  
58 1 Y 1 B GLN 281 ? OE1 ? B GLN 284 OE1 
59 1 Y 1 B GLN 281 ? NE2 ? B GLN 284 NE2 
60 1 Y 1 B LEU 292 ? CG  ? B LEU 295 CG  
61 1 Y 1 B LEU 292 ? CD1 ? B LEU 295 CD1 
62 1 Y 1 B LEU 292 ? CD2 ? B LEU 295 CD2 
63 1 Y 1 B LEU 294 ? CG  ? B LEU 297 CG  
64 1 Y 1 B LEU 294 ? CD1 ? B LEU 297 CD1 
65 1 Y 1 B LEU 294 ? CD2 ? B LEU 297 CD2 
66 1 Y 1 B GLN 296 ? CG  ? B GLN 299 CG  
67 1 Y 1 B GLN 296 ? CD  ? B GLN 299 CD  
68 1 Y 1 B GLN 296 ? OE1 ? B GLN 299 OE1 
69 1 Y 1 B GLN 296 ? NE2 ? B GLN 299 NE2 
70 1 Y 1 B ARG 299 ? CG  ? B ARG 302 CG  
71 1 Y 1 B ARG 299 ? CD  ? B ARG 302 CD  
72 1 Y 1 B ARG 299 ? NE  ? B ARG 302 NE  
73 1 Y 1 B ARG 299 ? CZ  ? B ARG 302 CZ  
74 1 Y 1 B ARG 299 ? NH1 ? B ARG 302 NH1 
75 1 Y 1 B ARG 299 ? NH2 ? B ARG 302 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY -2  ? A GLY 1   
2   1 Y 1 A PRO -1  ? A PRO 2   
3   1 Y 1 A GLY 0   ? A GLY 3   
4   1 Y 1 A CYS 1   ? A CYS 4   
5   1 Y 1 A ASN 2   ? A ASN 5   
6   1 Y 1 A THR 3   ? A THR 6   
7   1 Y 1 A LYS 4   ? A LYS 7   
8   1 Y 1 A LYS 5   ? A LYS 8   
9   1 Y 1 A PRO 6   ? A PRO 9   
10  1 Y 1 A ASN 7   ? A ASN 10  
11  1 Y 1 A ASN 376 ? A ASN 379 
12  1 Y 1 A GLY 377 ? A GLY 380 
13  1 Y 1 A THR 378 ? A THR 381 
14  1 Y 1 A THR 379 ? A THR 382 
15  1 Y 1 A ASN 380 ? A ASN 383 
16  1 Y 1 A ASP 381 ? A ASP 384 
17  1 Y 1 A THR 382 ? A THR 385 
18  1 Y 1 A ALA 383 ? A ALA 386 
19  1 Y 1 A THR 384 ? A THR 387 
20  1 Y 1 A MET 385 ? A MET 388 
21  1 Y 1 A ASP 386 ? A ASP 389 
22  1 Y 1 A HIS 387 ? A HIS 390 
23  1 Y 1 A LEU 388 ? A LEU 391 
24  1 Y 1 A GLU 389 ? A GLU 392 
25  1 Y 1 A LYS 390 ? A LYS 393 
26  1 Y 1 A ASN 391 ? A ASN 394 
27  1 Y 1 A GLU 392 ? A GLU 395 
28  1 Y 1 B GLY -2  ? B GLY 1   
29  1 Y 1 B PRO -1  ? B PRO 2   
30  1 Y 1 B GLY 0   ? B GLY 3   
31  1 Y 1 B CYS 1   ? B CYS 4   
32  1 Y 1 B ASN 2   ? B ASN 5   
33  1 Y 1 B THR 3   ? B THR 6   
34  1 Y 1 B LYS 4   ? B LYS 7   
35  1 Y 1 B LYS 5   ? B LYS 8   
36  1 Y 1 B PRO 6   ? B PRO 9   
37  1 Y 1 B ASN 7   ? B ASN 10  
38  1 Y 1 B LEU 8   ? B LEU 11  
39  1 Y 1 B ASP 9   ? B ASP 12  
40  1 Y 1 B ALA 10  ? B ALA 13  
41  1 Y 1 B GLU 11  ? B GLU 14  
42  1 Y 1 B LEU 12  ? B LEU 15  
43  1 Y 1 B ASP 13  ? B ASP 16  
44  1 Y 1 B GLN 14  ? B GLN 17  
45  1 Y 1 B LEU 15  ? B LEU 18  
46  1 Y 1 B LEU 16  ? B LEU 19  
47  1 Y 1 B GLN 17  ? B GLN 20  
48  1 Y 1 B GLY 18  ? B GLY 21  
49  1 Y 1 B HIS 19  ? B HIS 22  
50  1 Y 1 B TYR 20  ? B TYR 23  
51  1 Y 1 B ILE 21  ? B ILE 24  
52  1 Y 1 B LYS 22  ? B LYS 25  
53  1 Y 1 B GLY 23  ? B GLY 26  
54  1 Y 1 B TYR 24  ? B TYR 27  
55  1 Y 1 B PRO 25  ? B PRO 28  
56  1 Y 1 B LYS 26  ? B LYS 29  
57  1 Y 1 B GLN 27  ? B GLN 30  
58  1 Y 1 B TYR 28  ? B TYR 31  
59  1 Y 1 B THR 29  ? B THR 32  
60  1 Y 1 B TYR 30  ? B TYR 33  
61  1 Y 1 B PHE 31  ? B PHE 34  
62  1 Y 1 B LEU 32  ? B LEU 35  
63  1 Y 1 B GLU 33  ? B GLU 36  
64  1 Y 1 B ASP 34  ? B ASP 37  
65  1 Y 1 B GLY 35  ? B GLY 38  
66  1 Y 1 B LYS 36  ? B LYS 39  
67  1 Y 1 B VAL 37  ? B VAL 40  
68  1 Y 1 B LYS 38  ? B LYS 41  
69  1 Y 1 B VAL 39  ? B VAL 42  
70  1 Y 1 B SER 40  ? B SER 43  
71  1 Y 1 B ARG 41  ? B ARG 44  
72  1 Y 1 B PRO 42  ? B PRO 45  
73  1 Y 1 B GLU 43  ? B GLU 46  
74  1 Y 1 B GLY 44  ? B GLY 47  
75  1 Y 1 B VAL 45  ? B VAL 48  
76  1 Y 1 B LYS 46  ? B LYS 49  
77  1 Y 1 B ILE 47  ? B ILE 50  
78  1 Y 1 B ILE 48  ? B ILE 51  
79  1 Y 1 B PRO 49  ? B PRO 52  
80  1 Y 1 B PRO 50  ? B PRO 53  
81  1 Y 1 B GLN 51  ? B GLN 54  
82  1 Y 1 B SER 52  ? B SER 55  
83  1 Y 1 B ASP 53  ? B ASP 56  
84  1 Y 1 B ARG 54  ? B ARG 57  
85  1 Y 1 B GLN 55  ? B GLN 58  
86  1 Y 1 B LYS 56  ? B LYS 59  
87  1 Y 1 B ILE 57  ? B ILE 60  
88  1 Y 1 B VAL 58  ? B VAL 61  
89  1 Y 1 B LEU 59  ? B LEU 62  
90  1 Y 1 B GLN 60  ? B GLN 63  
91  1 Y 1 B ALA 61  ? B ALA 64  
92  1 Y 1 B HIS 62  ? B HIS 65  
93  1 Y 1 B ASN 63  ? B ASN 66  
94  1 Y 1 B LEU 64  ? B LEU 67  
95  1 Y 1 B ALA 65  ? B ALA 68  
96  1 Y 1 B HIS 66  ? B HIS 69  
97  1 Y 1 B THR 67  ? B THR 70  
98  1 Y 1 B GLY 68  ? B GLY 71  
99  1 Y 1 B ARG 69  ? B ARG 72  
100 1 Y 1 B GLU 70  ? B GLU 73  
101 1 Y 1 B ALA 71  ? B ALA 74  
102 1 Y 1 B THR 72  ? B THR 75  
103 1 Y 1 B LEU 73  ? B LEU 76  
104 1 Y 1 B LEU 74  ? B LEU 77  
105 1 Y 1 B LYS 75  ? B LYS 78  
106 1 Y 1 B ILE 76  ? B ILE 79  
107 1 Y 1 B ALA 77  ? B ALA 80  
108 1 Y 1 B ASN 78  ? B ASN 81  
109 1 Y 1 B LEU 79  ? B LEU 82  
110 1 Y 1 B TYR 80  ? B TYR 83  
111 1 Y 1 B TRP 81  ? B TRP 84  
112 1 Y 1 B TRP 82  ? B TRP 85  
113 1 Y 1 B PRO 83  ? B PRO 86  
114 1 Y 1 B ASN 84  ? B ASN 87  
115 1 Y 1 B MET 85  ? B MET 88  
116 1 Y 1 B ARG 86  ? B ARG 89  
117 1 Y 1 B LYS 87  ? B LYS 90  
118 1 Y 1 B ASP 88  ? B ASP 91  
119 1 Y 1 B VAL 89  ? B VAL 92  
120 1 Y 1 B VAL 90  ? B VAL 93  
121 1 Y 1 B LYS 91  ? B LYS 94  
122 1 Y 1 B GLN 92  ? B GLN 95  
123 1 Y 1 B LEU 93  ? B LEU 96  
124 1 Y 1 B GLY 94  ? B GLY 97  
125 1 Y 1 B ARG 95  ? B ARG 98  
126 1 Y 1 B CYS 96  ? B CYS 99  
127 1 Y 1 B GLN 97  ? B GLN 100 
128 1 Y 1 B GLN 98  ? B GLN 101 
129 1 Y 1 B CYS 99  ? B CYS 102 
130 1 Y 1 B LEU 100 ? B LEU 103 
131 1 Y 1 B ILE 101 ? B ILE 104 
132 1 Y 1 B THR 102 ? B THR 105 
133 1 Y 1 B ASN 103 ? B ASN 106 
134 1 Y 1 B ALA 104 ? B ALA 107 
135 1 Y 1 B SER 105 ? B SER 108 
136 1 Y 1 B ASN 106 ? B ASN 109 
137 1 Y 1 B LYS 107 ? B LYS 110 
138 1 Y 1 B ALA 108 ? B ALA 111 
139 1 Y 1 B SER 109 ? B SER 112 
140 1 Y 1 B GLY 110 ? B GLY 113 
141 1 Y 1 B PRO 111 ? B PRO 114 
142 1 Y 1 B ILE 112 ? B ILE 115 
143 1 Y 1 B LEU 113 ? B LEU 116 
144 1 Y 1 B ARG 114 ? B ARG 117 
145 1 Y 1 B PRO 115 ? B PRO 118 
146 1 Y 1 B THR 300 ? B THR 303 
147 1 Y 1 B SER 301 ? B SER 304 
148 1 Y 1 B LEU 302 ? B LEU 305 
149 1 Y 1 B TYR 303 ? B TYR 306 
150 1 Y 1 B HIS 304 ? B HIS 307 
151 1 Y 1 B PRO 305 ? B PRO 308 
152 1 Y 1 B SER 306 ? B SER 309 
153 1 Y 1 B THR 307 ? B THR 310 
154 1 Y 1 B PRO 308 ? B PRO 311 
155 1 Y 1 B PRO 309 ? B PRO 312 
156 1 Y 1 B ALA 310 ? B ALA 313 
157 1 Y 1 B SER 311 ? B SER 314 
158 1 Y 1 B SER 312 ? B SER 315 
159 1 Y 1 B ARG 313 ? B ARG 316 
160 1 Y 1 B SER 314 ? B SER 317 
161 1 Y 1 B TRP 315 ? B TRP 318 
162 1 Y 1 B SER 316 ? B SER 319 
163 1 Y 1 B PRO 317 ? B PRO 320 
164 1 Y 1 B VAL 318 ? B VAL 321 
165 1 Y 1 B VAL 319 ? B VAL 322 
166 1 Y 1 B GLY 320 ? B GLY 323 
167 1 Y 1 B GLN 321 ? B GLN 324 
168 1 Y 1 B LEU 322 ? B LEU 325 
169 1 Y 1 B VAL 323 ? B VAL 326 
170 1 Y 1 B GLN 324 ? B GLN 327 
171 1 Y 1 B GLU 325 ? B GLU 328 
172 1 Y 1 B ARG 326 ? B ARG 329 
173 1 Y 1 B VAL 327 ? B VAL 330 
174 1 Y 1 B ALA 328 ? B ALA 331 
175 1 Y 1 B ARG 329 ? B ARG 332 
176 1 Y 1 B PRO 330 ? B PRO 333 
177 1 Y 1 B ALA 331 ? B ALA 334 
178 1 Y 1 B SER 332 ? B SER 335 
179 1 Y 1 B LEU 333 ? B LEU 336 
180 1 Y 1 B ARG 334 ? B ARG 337 
181 1 Y 1 B PRO 335 ? B PRO 338 
182 1 Y 1 B ARG 336 ? B ARG 339 
183 1 Y 1 B TRP 337 ? B TRP 340 
184 1 Y 1 B HIS 338 ? B HIS 341 
185 1 Y 1 B LYS 339 ? B LYS 342 
186 1 Y 1 B PRO 340 ? B PRO 343 
187 1 Y 1 B SER 341 ? B SER 344 
188 1 Y 1 B THR 342 ? B THR 345 
189 1 Y 1 B VAL 343 ? B VAL 346 
190 1 Y 1 B LEU 344 ? B LEU 347 
191 1 Y 1 B LYS 345 ? B LYS 348 
192 1 Y 1 B VAL 346 ? B VAL 349 
193 1 Y 1 B LEU 347 ? B LEU 350 
194 1 Y 1 B ASN 348 ? B ASN 351 
195 1 Y 1 B PRO 349 ? B PRO 352 
196 1 Y 1 B ARG 350 ? B ARG 353 
197 1 Y 1 B THR 351 ? B THR 354 
198 1 Y 1 B VAL 352 ? B VAL 355 
199 1 Y 1 B VAL 353 ? B VAL 356 
200 1 Y 1 B ILE 354 ? B ILE 357 
201 1 Y 1 B LEU 355 ? B LEU 358 
202 1 Y 1 B ASP 356 ? B ASP 359 
203 1 Y 1 B HIS 357 ? B HIS 360 
204 1 Y 1 B LEU 358 ? B LEU 361 
205 1 Y 1 B GLY 359 ? B GLY 362 
206 1 Y 1 B ASN 360 ? B ASN 363 
207 1 Y 1 B ASN 361 ? B ASN 364 
208 1 Y 1 B ARG 362 ? B ARG 365 
209 1 Y 1 B THR 363 ? B THR 366 
210 1 Y 1 B VAL 364 ? B VAL 367 
211 1 Y 1 B SER 365 ? B SER 368 
212 1 Y 1 B ILE 366 ? B ILE 369 
213 1 Y 1 B ASP 367 ? B ASP 370 
214 1 Y 1 B ASN 368 ? B ASN 371 
215 1 Y 1 B LEU 369 ? B LEU 372 
216 1 Y 1 B LYS 370 ? B LYS 373 
217 1 Y 1 B PRO 371 ? B PRO 374 
218 1 Y 1 B THR 372 ? B THR 375 
219 1 Y 1 B SER 373 ? B SER 376 
220 1 Y 1 B HIS 374 ? B HIS 377 
221 1 Y 1 B GLN 375 ? B GLN 378 
222 1 Y 1 B ASN 376 ? B ASN 379 
223 1 Y 1 B GLY 377 ? B GLY 380 
224 1 Y 1 B THR 378 ? B THR 381 
225 1 Y 1 B THR 379 ? B THR 382 
226 1 Y 1 B ASN 380 ? B ASN 383 
227 1 Y 1 B ASP 381 ? B ASP 384 
228 1 Y 1 B THR 382 ? B THR 385 
229 1 Y 1 B ALA 383 ? B ALA 386 
230 1 Y 1 B THR 384 ? B THR 387 
231 1 Y 1 B MET 385 ? B MET 388 
232 1 Y 1 B ASP 386 ? B ASP 389 
233 1 Y 1 B HIS 387 ? B HIS 390 
234 1 Y 1 B LEU 388 ? B LEU 391 
235 1 Y 1 B GLU 389 ? B GLU 392 
236 1 Y 1 B LYS 390 ? B LYS 393 
237 1 Y 1 B ASN 391 ? B ASN 394 
238 1 Y 1 B GLU 392 ? B GLU 395 
# 
_ndb_struct_conf_na.entry_id   4ZTF 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 4  1_555 D DC 16 1_555 -0.193 -0.004 -0.679 -29.491 -15.199 1.474  1  C_DG4:DC16_D  C 4  ? D 16 ? 19 1 
1 C DT 5  1_555 D DA 15 1_555 0.045  -0.169 -0.039 -16.688 -4.371  3.129  2  C_DT5:DA15_D  C 5  ? D 15 ? 20 1 
1 C DC 6  1_555 D DG 14 1_555 0.065  -0.172 -0.118 0.235   2.176   -0.418 3  C_DC6:DG14_D  C 6  ? D 14 ? 19 1 
1 C DA 7  1_555 D DT 13 1_555 -0.078 -0.181 -0.007 0.435   -15.674 -1.585 4  C_DA7:DT13_D  C 7  ? D 13 ? 20 1 
1 C DT 8  1_555 D DA 12 1_555 0.053  -0.155 0.102  -6.594  -16.137 5.946  5  C_DT8:DA12_D  C 8  ? D 12 ? 20 1 
1 C DG 9  1_555 D DC 11 1_555 -0.256 -0.171 0.160  9.994   4.572   -2.337 6  C_DG9:DC11_D  C 9  ? D 11 ? 19 1 
1 C DG 10 1_555 D DC 10 1_555 -0.461 -0.183 0.133  14.367  -9.257  0.169  7  C_DG10:DC10_D C 10 ? D 10 ? 19 1 
1 C DA 11 1_555 D DT 9  1_555 0.036  -0.294 -0.089 4.079   -19.905 2.194  8  C_DA11:DT9_D  C 11 ? D 9  ? 20 1 
1 C DA 12 1_555 D DT 8  1_555 0.236  -0.142 0.239  -0.644  -13.875 4.511  9  C_DA12:DT8_D  C 12 ? D 8  ? 20 1 
1 C DT 13 1_555 D DA 7  1_555 0.139  -0.179 0.250  -3.343  -15.721 3.112  10 C_DT13:DA7_D  C 13 ? D 7  ? 20 1 
1 C DT 14 1_555 D DA 6  1_555 -0.196 -0.262 -0.036 -4.649  -18.153 2.277  11 C_DT14:DA6_D  C 14 ? D 6  ? 20 1 
1 C DT 15 1_555 D DA 5  1_555 -0.241 -0.207 -0.175 -5.423  -15.585 -0.358 12 C_DT15:DA5_D  C 15 ? D 5  ? 20 1 
1 C DC 16 1_555 D DG 4  1_555 0.151  -0.132 -0.057 -9.386  -12.457 -0.044 13 C_DC16:DG4_D  C 16 ? D 4  ? 19 1 
1 C DG 17 1_555 D DC 3  1_555 -0.277 -0.300 0.152  -1.054  -10.383 -1.026 14 C_DG17:DC3_D  C 17 ? D 3  ? 19 1 
1 C DC 18 1_555 D DG 2  1_555 0.229  -0.189 -0.030 6.353   -3.573  0.583  15 C_DC18:DG2_D  C 18 ? D 2  ? 19 1 
1 C DA 19 1_555 D DT 1  1_555 0.800  -0.084 -0.402 -1.466  -13.484 20.279 16 C_DA19:DT1_D  C 19 ? D 1  ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DG 4  1_555 D DC 16 1_555 C DT 5  1_555 D DA 15 1_555 0.421  0.104  3.016 -4.680 4.317  35.180 -0.402 -1.306 2.930 7.071  
7.666   35.734 1  CC_DG4DT5:DA15DC16_DD  C 4  ? D 16 ? C 5  ? D 15 ? 
1 C DT 5  1_555 D DA 15 1_555 C DC 6  1_555 D DG 14 1_555 0.331  0.763  3.013 0.124  8.025  28.851 -0.106 -0.617 3.109 15.727 
-0.243  29.924 2  CC_DT5DC6:DG14DA15_DD  C 5  ? D 15 ? C 6  ? D 14 ? 
1 C DC 6  1_555 D DG 14 1_555 C DA 7  1_555 D DT 13 1_555 -1.531 0.999  3.377 -4.854 6.129  36.400 0.679  1.698  3.658 9.674  
7.662   37.202 3  CC_DC6DA7:DT13DG14_DD  C 6  ? D 14 ? C 7  ? D 13 ? 
1 C DA 7  1_555 D DT 13 1_555 C DT 8  1_555 D DA 12 1_555 0.534  -0.337 3.431 0.846  3.138  32.812 -1.151 -0.790 3.397 5.538  
-1.493  32.969 4  CC_DA7DT8:DA12DT13_DD  C 7  ? D 13 ? C 8  ? D 12 ? 
1 C DT 8  1_555 D DA 12 1_555 C DG 9  1_555 D DC 11 1_555 0.630  1.915  2.990 2.327  5.390  35.777 2.351  -0.698 3.268 8.701  
-3.757  36.240 5  CC_DT8DG9:DC11DA12_DD  C 8  ? D 12 ? C 9  ? D 11 ? 
1 C DG 9  1_555 D DC 11 1_555 C DG 10 1_555 D DC 10 1_555 -0.811 0.479  3.230 -0.325 5.594  31.661 -0.138 1.407  3.272 10.153 
0.590   32.140 6  CC_DG9DG10:DC10DC11_DD C 9  ? D 11 ? C 10 ? D 10 ? 
1 C DG 10 1_555 D DC 10 1_555 C DA 11 1_555 D DT 9  1_555 -0.025 -0.184 3.495 3.160  3.465  41.009 -0.659 0.399  3.458 4.926  
-4.493  41.265 7  CC_DG10DA11:DT9DC10_DD C 10 ? D 10 ? C 11 ? D 9  ? 
1 C DA 11 1_555 D DT 9  1_555 C DA 12 1_555 D DT 8  1_555 -0.046 0.020  3.227 -4.706 -1.822 39.875 0.234  -0.461 3.208 -2.659 
6.866   40.180 8  CC_DA11DA12:DT8DT9_DD  C 11 ? D 9  ? C 12 ? D 8  ? 
1 C DA 12 1_555 D DT 8  1_555 C DT 13 1_555 D DA 7  1_555 -0.137 -0.510 3.312 0.333  -4.465 32.477 -0.117 0.302  3.349 -7.936 
-0.592  32.776 9  CC_DA12DT13:DA7DT8_DD  C 12 ? D 8  ? C 13 ? D 7  ? 
1 C DT 13 1_555 D DA 7  1_555 C DT 14 1_555 D DA 6  1_555 -0.097 -0.269 3.183 3.048  -2.211 37.006 -0.135 0.548  3.176 -3.473 
-4.787  37.191 10 CC_DT13DT14:DA6DA7_DD  C 13 ? D 7  ? C 14 ? D 6  ? 
1 C DT 14 1_555 D DA 6  1_555 C DT 15 1_555 D DA 5  1_555 0.014  0.103  3.265 0.827  -4.427 38.595 0.693  0.079  3.233 -6.670 
-1.247  38.847 11 CC_DT14DT15:DA5DA6_DD  C 14 ? D 6  ? C 15 ? D 5  ? 
1 C DT 15 1_555 D DA 5  1_555 C DC 16 1_555 D DG 4  1_555 -0.194 -0.006 3.377 -1.723 0.322  37.505 -0.053 0.069  3.382 0.501  
2.679   37.545 12 CC_DT15DC16:DG4DA5_DD  C 15 ? D 5  ? C 16 ? D 4  ? 
1 C DC 16 1_555 D DG 4  1_555 C DG 17 1_555 D DC 3  1_555 0.053  0.659  3.165 -4.035 10.059 33.455 -0.410 -0.690 3.197 16.930 
6.792   35.119 13 CC_DC16DG17:DC3DG4_DD  C 16 ? D 4  ? C 17 ? D 3  ? 
1 C DG 17 1_555 D DC 3  1_555 C DC 18 1_555 D DG 2  1_555 0.906  -0.192 3.057 1.748  1.987  32.770 -0.659 -1.320 3.084 3.515  
-3.092  32.873 14 CC_DG17DC18:DG2DC3_DD  C 17 ? D 3  ? C 18 ? D 2  ? 
1 C DC 18 1_555 D DG 2  1_555 C DA 19 1_555 D DT 1  1_555 0.795  0.035  3.566 7.066  13.398 30.395 -2.364 -0.086 3.383 23.787 
-12.545 33.880 15 CC_DC18DA19:DT1DG2_DD  C 18 ? D 2  ? C 19 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION' ZN  
5 GLYCEROL GOL 
6 
;(1R,2R,5S)-8'-(3-chloro-4-fluorobenzyl)-6'-hydroxy-2'-[(2S)-2-hydroxypropyl]-9',10'-dihydro-2'H-spiro[bicyclo[3.1.0]hexane-2,3'-imidazo[5,1-a][2,6]naphthyridine]-1',5',7'(8'H)-trione
;
X2P 
7 'MAGNESIUM ION' MG  
8 'SULFATE ION' SO4 
9 water HOH 
#